4JBHA

2.2a resolution structure of cobalt and zinc bound thermostable alcohol dehydrogenase from pyrobaculum aerophilum
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
333
structure length
333
Chain Sequence
HEMRAAAFSTPGLENLKLVEAETPRPGPGEVLIRVKYAGVNPLDYNVVAGAVKASPMPHIPGSEFAGVVEEAGPGVTGVSRGDPVVVYNRLYCGHCRQCLTGWTQMCEVTGGGIIGIVTQGGYAEYAVVPAKNAVATRADLKEAATLPIGALTAWNMAYRASISPGEKVAVVGATGNVGIYAVQFAKLLGGEVYAISRRKAKVESILKSAGADAVLTPDEAKSAAPFDVVLDPTGSASWDLSFGVLGRGGRYVTAGALTGAEVRLDLRRLYGMQILVIGATGGRRADFNTVVRLLEAGRIKAFLHNVYPLADVRKALEELRSPERVGKVLIAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alcohol dehydrogenase (Zinc)
publication title Physicochemical Characterization of a Thermostable Alcohol Dehydrogenase from Pyrobaculum aerophilum.
pubmed doi rcsb
source organism Pyrobaculum aerophilum
molecule tags Oxidoreductase
total genus 100
structure length 333
sequence length 333
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2013-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4jbhA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4jbhA01
1PGOA 4K1LA 1YDWA 3HZZA 4AL4A 3G3EA 3L6OO 1P77A 4NDNE 4CLRB 3E48A 3ZWBA 5CEJA 1N7GA 1LEHA 1OFGA 2C0CA 4L73A 4EITA 1U3UA 4PGFA 4J16A 3RUFA 2YJZA 2XF8A 5KJEA 2C29D 4EEZA 3INRA 3NEPX 3OBBA 5ER6A 4RPLA 3ASUA 1DB3A 4N5MA 2GYYA 2O4UX 2QG4A 2UV8A 4YJFA 2HCTA 4FW8A 3WMWA 1QKIA 2NU9A 3CXRA 3GVPA 4Y9DA 3KYDA 4DYVA 3P5SA 3DBRB 1ZKMA 5TLSA 4FGSA 4I1IA 2O3JA 4J4TA 4DUPA 4CLHA 4I9HA 1A7AA 4YEDA 2HJRA 5AXCA 3ZWYA 4XJSA 1MC4A 2BF7A 1HETA 2X4GA 2C82A 3TZCA 4ZICA 2P9CA 3BA1A 4BO2A 5A5EA 1GPDG 1DEHA 4W6ZA 4MVJH 4JLWA 1EDOA 2NACA 1TT7A 1ZW1A 4ALMA 4I9UA 1NAIA 1O8CA 1GUYA 1LBEA 1N92A 3PYLA 3U09A 4CLEA 1UXJA 2CVQA 1RM3A 5I9NA 3LT1A 2NU7A 3KRTA 1CQIA 4J0EA 3T7CA 1ZK4A 1Z75A 5F1PA 1NHGA 1MFZA 3IP1A 1I24A 1SOWA 2BI8A 5I9MA 4J6FA 3JYNA 1LLCA 3WG9A 3VHRA 4ZU3A 1I30A 1NQOA 3HB4X 4R1TA 5L7YA 3K8ZA 1ENYA 2NU8A 4N5NA 4D3SA 4LGVA 4D3DA 5GMOA 4CM7A 2GD1O 4WPGA 9LDBA 4J3FA 1GD1O 2W2LA 1PR3A 3GF4A 3ZHZA 4Y8VA 1K2WA 3GGGA 3HHPA 1ZSNA 3CIFA 4CM9D 4IINA 2QZZA 2Y68A 3V2UA 2DUWA 4HWKA 1Y81A 2PK3A 3LC2O 2YV2A 2QHXA 5KTKA 2QRKA 3LT2A 3DHNA 3PLNA 4YWJA 1V6AA 4BB5A 1PZEA 4XZ3A 3MWDB 3K31A 3NYWA 4CMKA 1VPDA 3OF2A 3V8BA 3O38A 1I32A 1Y8RB 5AVOA 1T4BA 3NT4A 3C8MA 4AFNA 2VHZA 4WCFC 3JQ8B 4YAIA 3AUUA 3GRKA 4CMIA 1GCUA 3EVTA 1P3DA 3FD8A 2OXIA 1PL7A 3DDNA 4FFPA 4BNHA 3TFOA 3H9QA 3RBVA 3ROKA 1MG0A 3VC7A 2AEJA 6LDHA 4E33A 4PLYA 1EEHA 1KIFA 3GFBA 4CMGA 1UDAA 1L1FA 3A4VA 1YKFA 2YYYA 3P7MA 4JK3A 5DNAA 3GR6A 4IGFA 3PGJA 1KY5A 2EW2A 4ZVVA 2FPIA 3L9WA 3F3SA 4UVEA 3JD3A 1U3VA 2PY6A 3M1AA 4IMRA 1DC5A 1W8DA 4I5GA 3GNQA 4LISA 1EFLA 5JMWA 1AXEA 2OFPA 2NVWA 3TZ6A 4IDCA 3Q1LA 4FB5A 2QYTA 4R4JA 4E5NA 4OSOA 4GX5A 4NH4A 3HE3A 3DAFA 3ZWCA 1YGYA 2VZ0A 4U6SA 1NQ5A 1HE3A 5JO9A 2NTNA 2DUUA 1H6CA 2X5OA 3ASVA 4DPKA 5JE8A 4MIOA 3U49A 3ZN2A 3DXFA 3TFQA 1SBYA 4WUVA 1P9LA 3K92A 4NFYA 1UP7A 3JQGB 1F8FA 2W2LD 3DOOA 1O95A 3DZIA 1YH3A 1FDVA 3CH6A 4I08A 3QWIA 1QLHA 4YAGA 1GY8A 5JS6A 2DTXA 2GR9A 3DMTC 2P5UA 3LK7A 4Z9FA 4NBRA 1QYCA 1MXFA 4AJ1A 5FEUA 2O3TA 2EEZA 1N9GB 1UZNA 1E6WA 3B6ZA 1V3VA 4NU5A 1A4IA 1CDOA 4R5HA 3HFSA 3G49A 3UKOA 5L7WA 1KY4A 4FFRA 4HX5A 1OOEA 3MJCA 4OXKA 2H63A 3FF4A 3RWBA 1Q0HA 2D1YA 5TT1A 4KOAA 5I8ZA 1DJNA 3OH8A 1HKUA 4TVBA 4B3IA 2AG8A 2GDZA 1YL5A 2OO5A 1DFHA 1DAOA 1UJMA 1DC3A 5I7SA 1BXZA 4NJMA 2X86A 1SMKA 1YQDA 2GLXA 4ITUA 4Z0HO 5IN4A 3EY4A 4PLTA 3JYPA 3JQBC 4MO2A 3WYBA 3MOGA 2XXJA 3VPHA 1LSOA 2BD0A 3BHIA 1TB4A 2LDBA 8ADHA 5HTOA 4DYDA 2YDXA 4CLOA 4FJ2A 4DQXA 2EHDA 1PIWA 3GZ4A 4W82A 4AJJA 3DBLB 1LTHR 4WEOA 5TRTA 3UCXA 3KEQA 1GFSA 1KVRA 5DBGA 1HSZA 1E3LA 4RVDA 3H9JA 3KYCA 1IULA 3O26A 4GSKA 5U1PA 2VUTA 3DZGA 3WNQA 7ADHA 1YBMA 3GHHA 1ENZA 3L6DA 4PN3A 3WFIA 4RO0A 1KBZA 4Z3KA 4O59O 5AXAA 1GCOA 2IXAA 3DWFA 2WTBA 5IZCC 1BDBA 4JQCA 4JJFA 5L4NA 1E7SA 5I8WA 2ZCVA 2YV1A 1F14A 1VJTA 4R5MA 4RF2A 5EIOA 3S2FA 3AOGA 1NNUA 3ADOA 4ALIA 5FWNA 4QEDA 3AI2A 1CWUA 3ZU5A 5A9SA 3QIVA 3JV7A 1JAXA 5TSDA 3RC9A 2C5AA 2A35A 1UAYA 4XQ9A 4AVYA 1I3MA 1LDMA 1G1AA 2VN8A 1K89A 4J43A 5EINA 5A03A 1SO8A 3GQVA 2IRWA 3W8EA 5CDGA 2PZLA 5C7OO 4OMUA 2X0IA 4D7AA 4R9RA 3VZPA 3NJ8A 4INAA 4XQCA 4O6VA 3FTPA 5KNLA 3PFFA 4II3A 4N54A 3ZI0A 4BL5A 3EHEA 5EQFA 1PS8A 5BSHA 4XJTA 1ULUA 1X15A 2AHRA 4WECA 3TDKA 1NHWA 4NFHA 3H2ZA 1Y5RA 3GLQA 3Q6IA 3U4HA 4D45A 1LDNA 1LDGA 3C1TA 4BNUA 1TT5B 5ICSA 4WLFA 1NPYA 1GV0A 4W7HA 2PFGA 4YRBA 1NAHA 3MJVA 4UREA 1X7HA 4BNTA 2GASA 3WOHA 3KV3O 4A7PA 2GSDA 2CDBA 3AU8A 1EUCA 1EVYA 3NTQA 2VTEA 5IDYA 4P38A 8LDHA 5DP1A 2RAFA 2X8LA 3BMCB 3IP3A 4WOKA 4CMJA 1HE2A 2RBEA 3UHAA 2WD7A 1KEVA 4CMBA 3D3WB 4BO8A 1M75A 5JAIA 1E1NA 3HADA 4L4RA 1NTOA 4MKXA 2VT2A 4GBJA 5HS6A 1VSVA 1I2BA 4KDFA 4YT4A 1KS9A 1OMOA 4XYBA 1MP0A 4XIYA 3MCVA 2BFAA 2HK9A 4JJIA 4ZQHA 1WDLA 4KUGA 1XSEA 3WSVA 5L45A 1B8VA 1ADBA 4FCCA 4BGIA 4CUKA 1I2CA 1Z82A 2PH3A 3PHIA 3DZFA 3ZWOA 1B2LA 4I5FA 3H5RA 1J0XO 3E9NA 3LF2A 3PTZA 1Y8QB 4YRDA 4CMHA 1DC6A 5L53A 1YE3A 1WZIA 3VPGA 3WWZA 4PLPA 4GKVA 4RL6A 4J1TA 4WCFB 1EBFA 3ZWMA 1Q0LA 1JWAB 3RSHA 1ADCA 4CM8A 4OJNA 3H9EO 3MJ4A 2GN8A 3O03A 4YJFB 3ZWXA 1P74A 2I5PO 2OP0A 1I2ZA 4UVIA 1GU7A 4E2ZA 1PWXA 2BGKA 3F46A 4QO8A 1NVTA 4E2WA 5BNIA 3VOSA 1S7CA 4FFMA 4XGKA 1FJHA 3HDYA 3FBTA 5B12A 1RPNA 7MDHA 1U7HA 2ILTA 3MOIA 4GX1A 5I9LA 2G1UA 5F21A 5TJ9A 4BNJA 1Y9AA 4QSMA 5TS3A 5K9ZA 2O48X 3OJEA 3GPIA 3PPIA 4RF5A 3F5SA 3IC5A 3FN4A 4YT8A 3G1TA 4N5LA 1TXGA 4CQMB 5EQDA 3RD5A 2V6MA 1T1SA 4ZA2A 4YVFA 4EBFA 4M8SA 4ZD6A 4D0SA 5KVSA 3CMCO 5JCJA 1W73A 2PV7A 4D79A 2I9PA 1SEVA 4YYZA 3CZRA 1X7DA 1PJQA 4BO5A 4NBUA 1BVRA 1K6XA 1U2DA 4ZRMA 4YJHB 3K2BA 5JW6A 3RU7A 3WJ7A 1U8FO 1HDRA 2B4TO 3I9NA 3PEFA 1EQ2A 2JKVA 2VUUA 4M1QA 4NR0A 1A7KA 2RHRA 3FBGA 2B0JA 3I4CA 2FN7A 5CP8A 1DRWA 1FF9A 1GQQA 3VPSA 4HV4A 3O4RA 4CQLA 4BO3A 2ZTLA 4FJ1A 2CDCA 3AJRA 3FNHA 2WYVA 1R4NB 1PGNA 4RDHA 2O50A 1L7DA 3NDIA 3O8QA 3AY7A 4FPXA 4PZDA 3JYQA 3JQ9C 1BDMA 4H15A 4DRYA 3D4OA 3A06A 4WLOA 5A3VA 4CM4B 1ONPA 1YJ8A 5JDIA 1C0KA 4F3YA 3IDSA 2J3KA 1NQTA 2C2YA 3ZNOA 4BNLA 1LDYA 1M66A 2IZ0A 1A72A 1G0NA 4H7PA 4LRTB 1SC6A 3W4KA 2DBVO 1Y9EA 4GMFA 1XGKA 3UW3A 1EE9A 3UOGA 3PQDA 1VSUA 3OICA 5BSEA 2O7SA 4E5MA 1KETA 3GVIA 1PGJA 3BYZA 3KSUA 2UUOA 3H8VA 2VOEA 4DREA 2VCYA 5IDWA 5TJHA 3RUHA 3ZH2A 1ZK0A 1E3WB 1UDCA 3SX2A 3SC6A 2GRAA 3U62A 2BMAA 3B1JA 4TVOA 2CNBA 3LLSA 2DPHA 4PG6A 1H6AA 4CR8A 5JCJD 1DJQA 2D5CA 4DMLA 1EK5A 2EWMA 4BMNA 1P44A 4YPOA 1HDXA 3N74A 2B35A 2CY0A 3RIHA 3WYEA 2YW9A 1P1HA 3HB5X 3PWSA 4IGEA 1ENPA 1H93A 5K1SA 2BELA 3PHJA 4NBVA 2HMWA 3AY6A 3GRPA 4L9RA 2X9NA 4Y6SA 4ALJA 4YT5A 5JMPA 2ZYDA 1UP4A 3E03A 4U0JA 3UCEA 3MJSA 4WLNA 4PLWA 3BMOB 2C7GA 1XELA 2A94A 3ZHXA 1ZK2A 5DP2A 2X9GA 3PQEA 2D8AA 5A9TA 4DIFA 4J2OA 2I3AA 4CR6A 5JSFA 4XR4A 3V1YA 2DC1A 1FDWA 2DPGA 3RFVA 3CINA 3U3XA 2P9EA 4NQZA 1HZJA 1P33A 3ZWAA 1J4AA 2JAHA 2NM0A 4WE3A 4F6LA 3AOEC 4U0KA 4L4SA 1W4ZA 4I9NA 5ILOA 1UXIA 3RVDA 1E6EA 3VVCA 2O2YA 4BNFA 2AEFA 4ND3A 2Y1OA 2VNSA 1RYDA 4B4VA 2Y0EA 3E8XA 2FPPA 1T2DA 1U8XX 2I76A 4QO7A 5KOIA 1C1XB 3GGOA 1MGOA 4A73A 1E7QA 4IM7A 2X0JA 4OGWA 3C3XA 1WPQA 3RROA 4BNGA 1NX6A 3JQ7A 1NR1A 1HLDA 3JYOA 3GPDG 1A71A 2WEKA 4Q3BA 3HFGA 5L3ZA 5TF4A 3BTOA 2UDPA 1A9ZA 3ZWWA 1OAAA 2AQHA 2FWMX 4FQ8A 3DAGA 2XPCA 1LX6A 3AUTA 5ES3A 4A27A 1BMDA 3QVSA 1B16A 4YAKA 3H5AA 3GC6A 2Q1TA 4GQAA 4BNIA 1YDEA 2EXXA 1T2CA 5ENVA 1I8TA 3H4VA 5IDQA 4R1SA 4Q39A 3RUDA 3ZV6A 2Q50A 3U5TA 4RVGA 1DHTA 4TRNA 3RBXA 5L40A 2V6FA 2FMUA 3S1LA 3ZW8A 1EUZA 1LA2A 1D4FA 1M76A 4UVHA 1QLJA 3FPCA 4DXHA 3W6UA 4B8ZA 4AG3A 3GDOA 5DOZA 2QQ5A 2D3TA 1C0LA 2EGHA 1QSGA 5KJ6A 1U4SA 1LJ8A 1XYGA 2CD9A 3DL2A 1LQTA 3GN2A 3QV1A 3VKVA 1E3JA 2CF5A 4PG5A 1ARZA 2YQ4A 2OOSA 5EL0A 3KTDA 1RWBA 1VKNA 1BW9B 4GX0A 2EG9A 5DCUA 4EUFA 1Y5MA 4E2XA 5JFOA 4LN1A 1F8GA 4ALNA 1P1JA 2GUGA 3HQ4O 4OOFA 4NBWA 1V9LA 3PI7A 5L4SA 3FHLA 2PKRA 1HDZA 3NUGA 1Z7EA 5JNLA 1VJ0A 3GZNA 4GWKA 1LRJA 3K6JA 4TRRA 2EKLA 4BKQA 1YB5A 3NJ4A 3AM4A 4LVUA 3WFJA 2EIHA 4IDGA 1EVIA 3PJGA 1EUDA 3NTRA 3SVTA 1YXMA 3WMXA 2WE8A 2Q46A 1DIBA 3LC7O 3QLJA 3S2IA 1Z74A 3PJDA 3VPXA 1AUPA 3P19A 2ZB7A 2DFDA 3S55A 1U4OA 4J2HA 3RBZA 4J7UA 4IZHA 4BMVA 2W2KB 3L4BC 3TL2A 4BO0A 4I5DA 4W4TA 1FDSA 3DBHB 4YAEA 3TN7A 1DO8A 1WMAA 5G0WA 4D41A 1VM6A 2VWGA 4JX8A 3RFTA 4HADA 4RQUA 3TZKA 5K6AA 1YB4A 2DLDA 5ADHA 1JKFA 4KUEA 3ZWPA 1GQYA 5JC8A 1OC4A 4U7WA 1AHIA 1ZUD1 4CMEA 3IJPA 1YOVA 4D42A 5I7VA 4MP8A 1DDOA 3ZNQA 4RVUA 2CMDA 4YA6A 4IJKA 2FHSA 2JFHA 3QVXA 1XU9A 1H5QA 2PKQP 5DBIA 1BXGB 1ML3A 3LYLA 2GN6A 3TNLA 3PXXA 2H9IA 1Q7GA 4R3WA 2IE0A 3RC2A 3ADPA 1ISGA 3JQFC 4MPDA 3ZWNA 2CFCA 5EN4A 3GA0A 4LCJA 4R3NA 3LSYA 3GN1A 3AM3A 4J9UE 1JVSA 4DMMA 3VH1A 1MB4A 4W9NA 2HRZA 5H82A 4PVCA 2Q4EA 1PGPA 2EERA 3UAGA 1DRVA 3FTNA 3VDQA 1A9YA 3A9WA 4K28A 2DQ4A 3DR3A 4OKIA 5JLAA 4RZIA 1XCBA 4PLVA 4R41A 1U28A 5IXSA 4Q3NA 3OJ0A 4KTVE 2J3JA 3DAPA 4R9SA 2TMDA 4UUPA 5ER9A 1YWGO 5THQA 4EUHA 2OP1A 2HMUA 5DCWA 4R68A 4WEQA 4XIJA 4JROA 1GEEA 5B4UA 4UEOA 4J1SA 5JAZA 2RIRA 4FC7A 4R54A 2BHLA 2YHIA 5CEFA 3Q2KA 1HZZA 4ZQGA 4KQXA 1G6KA 5G0TA 1UP6A 3ST7A 4MP3A 1KERA 4HBGA 1K3TA 3BHJA 2PZJA 3BHMA 3IKTA 1YBVA 4UEKA 3JQEA 3E82A 3B20A 1ZMOA 1W0CA 5DDIP 2CSUA 3E5RA 2SCUA 4XX0A 4RQTA 1HE5A 1E7MA 5ITWA 1TLTA 1U3WA 4RPKA 4AJOA 1BTOA 1YQXA 4IQGA 5T6BA 3K9QO 4CL8A 3D64A 3GUYA 2QZ9A 3HDHA 3WLFA 3JQBA 2V7PA 3JD4A 2JD2A 4L8VA 1DIRA 3V2GA 1LRLA 1IZ0A 3ROPA 4CV0A 1QP8A 3F5QA 4MVJP 4F6CA 1B0AA 4IIVA 3R0IA 6ADHA 3GOHA 4E5YA 2QW8A 2J3HA 4J1QA 2VWPA 4Y98A 4YJGB 1EZ4A 5CAEA 2YV3A 2Y93A 2HK8A 2EP7A 1PJTA 2VHXA 2Z1MA 3FR8A 3FWNA 3NT5A 4Q3EA 4DGSA 4GVXA 4XA8A 2ZKLA 2DAPA 1X0XA 4XD2A 3C1OA 3K5PA 1B15A 4NNJA 4Y6PA 1LUAA 4Z6KA 3I9LA 3BMQA 3H2SA 4R01A 3UFXA 4XQGA 1Y1PA 4K6FA 4CR7A 5JBIA 1R4MA 4H16A 3DC2A 1A27A 4BS9A 3EZLA 3D5QA 4AJHA 5HRUA 2VRBA 2X6TA 4YCAA 1T26A 1ONNA 3PZRA 4TSKA 4GWGA 3H7AA 5U9CA 4DIBA 3LU1A 4HXYA 5ILGA 3QWAA 1PSDA 2GO1A 4R69A 2NTVA 3GAFA 1V3UA 3GEDA 4E5PA 4TKMA 1H9AA 4CLXA 4J7CA 2BGMA 3WTBA 2H1SA 4AJEA 4DQVA 4O5OA 3TRIA 1JAYA 3TOZA 4Z3DA 3RC1A 1ZNQO 4UAGA 1B8PA 1J49A 3OQBA 2R6JA 1B26A 4YACA 4LW8A 1PEDA 4PG8A 4EJMA 3M2PA 5JYDA 4IXTA 4BNZA 4E3ZA 3AW9A 3AWDA 3UN1A 2DBZA 1UH5A 3D5TA 2ZB3A 3ZHYA 1NQAO 2OGUA 5DBFA 3ITKA 3WNVA 3BZUA 3G0OA 4FBGA 5EPOA 4EUEA 1U1IA 3BMNA 2CDAA 2BLLA 4DTIA 4BO9A 1EBUA 2WD8A 2Y1DA 2Y67A 4W99A 1L7EA 2NVUA 3MJTA 1P0CA 1X14A 1GADO 3S8MA 4E32A 3NDJA 5A04A 3QVWA 3S2GA 3PJEA 5MGBA 4NBTA 4OH1A 3NT2A 4ZGWA 5I7EA 1SOVA 3TZHA 1YQGA 2ZTVA 4ND2A 1KC3A 3WS7A 4TZTA 1NVGA 2IXBA 3AI1A 3JQAB 1KOLA 2H5LA 3WIDA 5K0ZA 3SLKA 4BKRA 2WE7A 4CMAA 1HE4A 3K73O 3F47A 3LF1A 4PG4A 3V5NA 3WQRA 1D1TA 4B79A 1LNQA 1A4UA 3DTTA 1ZK1A 2BRUA 1ONOA 5FF9A 2Q1SA 4RVSA 3IQDB 2ZJ1A 3WGZA 4LSWA 5JDCA 3NTOA 3UICA 1ZIDA 2FSVA 3F6YA 4FGWA 4XYGA 3TZQA 3CMMA 4M55A 1E3EA 3D4NA 4BO1A 1EK6A 1ZMTA 2RHCA 1U5CA 5A9RA 1XLTA 3B70A 2Z95A 1JQBA 4PLCA 3MEQA 5JCXA 1DFGA 2Y1EA 2PKQO 1NASA 4CODB 4OXNA 3GDFA 1C1DA 2JHGA 4OO3A 1P1RA 4NI5A 5B1YA 2X9VA 2E4AA 4GSLA 4BIIA 2VWHA 4DVJA 2Q3EA 1LDEA 4WNIA 3Q11A 4KMSA 2AA3A 5FI5A 3OA2A 1PJBA 4IBOA 5EESA 3H3JA 3DZHA 3WJAA 2GPTA 1JKJA 2NUAA 1JKIA 2WM3A 5DT9A 1KVUA 4H3VA 4RVHA 4AJLA 1C3VA 3GEGA 4WK6A 2IODA 3VZRA 1NP3A 4CLRA 4FFNA 2OZPA 5KIAA 3AFMA 2DTDA 2NWQA 3ZWVA 1FXSA 5MDHA 3W8FA 4L75A 3QJ5A 5G4KB 2NU6A 3CPSA 4N18A 3KXDA 1EVJA 5DN9A 3B1FA 4PCVA 4Z9YA 3ICCA 1U5AA 1VE9A 3CKYA 4HFMA 4P4GA 3TJRA 4PZCA 3IL2A 3DBRA 3QQPA 4K9DA 4C4OA 5COBA 2X5KO 5LCXA 2QRJA 2PD6A 2JJYA 2GGSA 2AW5A 1HF3A 2Q45A 4JBGA 1V8BA 1BWSA 4PLHA 1PZFA 3PIIA 1VL6A 4WKGA 4DLBA 4MVJI 2V6GA 4J1NA 4FC6A 3I1JA 2PGJA 5KJ1A 4BO7A 2J3IA 3W8DA 5TIIA 3DBVO 2HMVA 1LC3A 4YAJA 3CSDA 3L0DA 5DOVA 2CF6A 2PA3A 1Q0QA 1I3KA 5BNFA 3T4EA 2D2IA 2NVBA 1U7TA 4P22A 3PJFA 1JVBA 1DAPA 4WCDA 4IPTA 1NXQA 1EVZA 3WGGA 4JP3A 4TZKA 3PYXA 3OHSX 1ZVMA 2HUNA 2BFMA 1PJ2A 2G5CA 4KWHA 4X54A 1PU2A 4GLLA 2GF2A 3OJFA 4U6QA 5CDSA 3KO8A 1I36A 3QP9A 1D3AA 3LT0A 1D8AA 3VTFA 4PLGA 3KYDB 1E5LA 1VI2A 3BAZA 4R51A 4U5QA 4TMFA 2O3QA 2PZKA 1T1RA 5DF1A 1E1LA 4C7KA 1SCUA 4XCVA 2X58A 3DQPA 4IS3A 4RDIA 5A06A 3HWRA 3M2TA 3DFZA 1HDGO 1HDCA 4FFOA 1LSSA 2DFVA 2PWZA 5CG1A 2P4HX 4BVAA 1ZEMA 1I3NA 1R0LA 3ONDA 4C7JA 5F5NA 3GHYA 2JFFA 3TWOA 4XQEA 3TQHA 4L4XA 1VL0A 3WXBA 4GX2A 4NHEA 3N58A 1UZLA 2GN9A 1PJSA 2OORA 1RJWA 4N7RA 1E1KA 4HY3A 5H81A 4DC0A 4NK4A 4ALKA 2EKPA 3I9JA 1R12A 4CM5A 5AQ1A 1KVSA 4BNKA 3JQ8A 4ESOA 2HO5A 4KDEA 2I3GA 4CV3A 1LDBA 4RCVA 4I8XA 3FNEA 1NYTA 2AQ8A 1GV1A 4IQ8A 4LK3A 5DZSA 1XA0A 1YL7A 1UUFA 3PVZA 3ZW9A 2NADA 3WICA 3ENNA 4XGIA 2A9FA 4MVJE 4J91A 2R00A 3CUKA 5ICMA 4D44A 2WSBA 1U2GA 4UUNA 2VHVA 5JY6A 1Q7CA 4RPJA 2QIOA 3FSRA 2QRLA 1PGQA 3L07A 5H83A 1DLIA 1O94A 1YO6A 1IL0A 4ZQBA 4BNXA 5CDUA 3K30A 4M54A 1PQUA 4WNCA 5AYVA 4B7XA 5KKCA 4S1VA 1AN9A 1DSSG 4GMGA 4NG5A 1AE1A 3H65A 5IJZA 2CVOA 2X0RA 2A4KA 3H3FA 3AM5A 2AMFA 4ND4A 2P68A 4CMIB 1ADFA 3UCFA 1FK8A 4BGUA 2HSDA 4RV9A 2HDHA 2O3SA 1QV6A 4Q3DA 1QYVA 3NGXA 3ZV4A 2YDYA 5G0VA 4DLLA 1X1EA 2FY8A 4GKBA 4TROA 1VKOA 1X7GA 5IXYA 2H6EA 4HKTA 3RAJA 4CV1A 3ZNPA 2Q1UA 3RU9A 5F1OA 3JQGA 1LU9A 2EKQA 4K26A 2EF1A 4TWRA 4IDAA 3ZV5A 3DOJA 1FMCA 3MWEB 3MTGA 4J49A 4KZPA 2RH4A 5AOVA 4CPDA 5CDTA 3B1KA 4BV9A 4QXMA 1PQWA 5T8KA 4BNVA 2F00A 3HN7A 5IAAA 4BNWA 1C0PA 3OIFA 1KEWA 2I99A 4ND1A 1N9GA 1QRRA 4BGEA 1ZK3A 1O0SA 3GY0A 4PLFA 1TA4A 4PIVA 1QYDA 3OQ1A 4WJZA 4CL3A 2PLAA 3GVHA 1EQUA 2BFOA 1SZJG 2ZQZA 1P31A 1ZBQA 3COSA 3DEYX 3L77A 3W4JA 3OEYA 2Q1WA 3HJAA 4EZBA 1J6UA 3I83A 5BR7A 3HN2A 3U0BA 1KEUA 3L9XA 1MC5A 3JSAA 3VKUA 4UUOA 5CHEA 5C5IA 3F1KA 1PJ4A 4PLZA 2EJVA 1N5DA 4CJXA 1GYQA 3WGIA 2Y1GA 1R15A 1UR5A 5HS4A 1SNYA 1DRUA 2F1KA 4CUZA 3ROMA 5JC1A 4OAQA 1J5PA 3H6KA 1MLDA 3JQCA 1ID1A 2LDXA 4AJPA 2BH9A 4YJDA 3V2HA 3DBLA 1IB6A 4NPCA 2FZWA 2GERA 3KM0A 2HKIA 1JDJA 3LDHA 3GEMA 3VZSA 5T67A 2HQ1A 1DC4A 1CF2O 2G0TA 1H0KA 1YBAA 1G0OA 1LXCA 3H5NA 3GMSA 1P1FA 1E6UA 5CG2A 1DPGA 3PLRA 3ZGYA 2I66A 5JDIC 4NJMB 3I5MA 3GVXA 3I52A 1GQ2A 3LC1O 2IZZA 4J0FA 4Q3CA 2C7VA 1XU7A 3KEOA 5TX7A 5KVQA 2W4QA 3W1VA 3QWHA 3Q2IA 1B3RA 3GNSA 3OSUA 3DFUA 1ZEJA 2WMDA 4XB2A 4CLOB 2EV9A 1LI4A 3PWZA 3UF0A 1ZZEA 3I3OA 4J90A 5L7TA 1VLLA 3ZU3A 4B8WA 3WYCA 2NTJA 1QORA 1ADGA 2IYOA 4ZJUA 2XXBA 2OBNA 3KYCB 1WDMA 4EYEA 3AY3A 4ZHSA 3C7CB 1PQPA 3FI9A 1E7WA 5T5QA 4DL9A 5C37A 4A5OA 5HM8A 2EW8A 3PHGA 2O2SA 4DBVO 2VYVA 1O89A 1Q7BA 2AEMA 1EFKA 4DQUA 3QWFA 1TT5A 4NMHA 4IIUA 2GNAA 3RUIA 1BSVA 1YL6A 4IQ0A 5TGDA 1Y7TA 1GZ4A 3X2FA 5A9SB 5AXBA 3ANNA 4FIZA 3IOYA 3IIEA 2AG5A 5BSGA 1GYPA 3JD0A 1FDUA 2VOJA 3EGOA 2NLOA 3L4SO 1XWFA 1EMDA 3BMCA 2X22A 4FFLA 5T57A 4LMRA 2BGLA 2DBQA 4BO6A 2JCXA 2HAEA 3NX4A 4PVDA 1WW8A 4XDYA 3AUAA 4PG7A 1LLDA 1V35A 1ZSVA 5FFFA 5HBRA 4B7CA 4ID9A 5GZ1A 2CUKA 3IAHA 4ZRNA 4JBIA 2JHFA 3QY9A 3RJ9A 1WDKA 2I65A 2A92A 4FSHA 1M67A 4XR9A 3EMKA 1CEQA 4E2YA 2YUTA 3SBOA 3KOUA 3CZMA 4NJOA 4RF3A 3H9UA 4Z0TA 1ISMA 4BGVA 4U8GA 5JAMA 3RQSA 3UXYA 2B36A 1R0KA 3IKVA 1PL6A 2VHYA 3ZZNA 4O1MA 3BXXA 1Y8QA 2OL4A 3OJLA 2FSSA 4QT0A 1DHRA 4YQYA 5JAQA 4IZIA 3ROQA 2Z5LA 1PL8A 1XG5A 2J5RA 4KUHA 3HUDA 2WD7B 3WGTA 3E9QA 4GH5A 4IMPA 4WCFA 5FI3A 1VC2A 4BKOA 2G17A 4P4LA 1YJQA 4UVDA 1QR6A 4Q9NA 1JN0A 2ZK7A 1ZXLA 1YS4A 3SEFA 3GG9A 5IFLA 3RCBA 4DPLA 5CFZA 1F06A 2AXQA 1ZJZA 3OEWA 2PD3A 3LVFO 4GL4A 4ZQEA 3WGOA 1X13A 2X23A 2VYVD 4FOOA 4QX6A 3VZQA 3WGQA 4GAEA 3KZVA 4M87A 1HDOA 3AK4A 4JN6B 2Q2WA 4IDDA 1HL3A 1N1GA 4R1NA 2DBRA 1YONA 3VH4A 3PFWO 1KEPA 4NU6A 2XAAA 3JYLA 4IXWA 4F46A 4BKPA 4A03A 3ITDA 5G4LA 5G2OA 5A05A 5F1KA 2NSDA 4RLHA 1UDBA 3GGPA 2Q4BA 5LDGA 3ICPA 1XKQA 1X0VA 1UZMA 1R66A 3INGA 3UH1A 1T2EA 3A28A 4XDZA 4IJVA 4CQMA 4CM8B 2RCYA 3C7AA 3K96A 1ENOA 3EUWA 1WZEA 2E6UX 4OIMA 3WB9A 4LSMA 3IUPA 1LQUA 4RZHA 2Y99A 4CM3A 3ABIA 4EDFA 2O4CA 1NFQA 4TRJA 2ZIZA 3FPLA 4BV8A 3FR7A 3C1AA 3OJOA 4YJHA 2VYNA 4M86A 2O3RA 3ZNNA 3STHA 3ETDA 1I01A 1Q2XA 3A14A 3INTA 2JAPA 2D5AA 2B37A 4GGOA 1NWCA 1IPFA 3DMYA 4LCEA 1HDYA 4UUMA 1NWHA 4GPD1 1K5HA 3DMTA 1ZFNA 5KVVA 4RORA 4E21A 1V3TA 3Q0EA 2YZ7A 1AGNA 2GZ1A 3GNTA 4D43A 4OQYA 5IF3A 4QECA 4FN4A 1GPJA 2D4AA 3UGKA 4CV2A 3TPCA 2Q99A 3E18A 2C07A 5JO0A 1R4NA 1ZJYA 1C0IA 2IDZA 3KSZO 5JPIA 2FP4A 2ZB8A 1JW9B 1N2SA 1CETA 2VQ3A 1ULSA 1P1KA 4B4UA 3M1LA 3OQ6A 4D46A 2GZ3A 4CM4A 4AJ2A 4UEJA 2P91A 3GT0A 4XRRA 5K6AC 4JIGA 2V6BA 4WASA 1DOHA 3DZBA 3KB6A 4BNNA 1R37A 4BOYA 4CMEC 1WLYA 5EMHA 4Z0PA 4B4OA 1SPXA 5ENDA 2FR0A 4MVJF 2PH5A 4KQWA 4Y67A 3F4LA 3EC7A 3WSWA 5TC4A 1H2BA 1Z73A 1IYZA 1HYHA 1HEUA 5L9AA 1JTVA 1AHHA 1DXYA 2ZYAA 4CQLB 2PTGA 1MG5A 1GAEO 1B3BA 4KWIA 3JD2A 2E49A 4TKLA 1IE3A 3DO5A 3P2OA 4YR9A 4MJLA 4YB8A 4DLAA 3E5MA 1H9BA 3O8QB 4ONEA 4CMCA 4CUJA 2FPGA 4Y6RA 4QUKA 2D59A 4CQMD 4W9NC 4JJGA 4BHTA 1E3WA 3VVBA 3PYMA 3F1LA 3KSDO 5IZCA 3L6EA 2JD1A 2HMTA 4JP2A 4O63O 4TQGA 2UYYA 5FYDA 2FOIA 1HSOA 3RUAA 2R2GA 4WGGA 1I3LA 3JQDA 3LQFA 3OA0A 3OMLA 1LSUA 4HNGA 3KETA 3DHEA 2VYND 1JWBB 1SEPA 1ZSYA 2VRCA 4B3JA 4RPGA 1GZ3A 4JXKA 2FR8A 1XEAA 1U3TA 3G17A 4J7XA 4E5KA 2G76A 1XDWA 4YRAA 4HUJA 2Y0CA 2DTEA 3K2EA 4CM1A 3QE3A 1R6DA 1EDZA 5B37A 1ISHA 3QHAA 3RI3A 2PD4A 2GN4A 2C5EA 1PWZA 2ET6A 5COQA 3BMOA 1O9BA 2JCVA 1DIGA 1N7HA 4IJWA 3UVEA 1RM5A 2HJSA 3OIDA 3TL3A 4RLSA 5CDYA 2WYUA 4EGFA 4BB6A 3FWZA 3EVNA 2GZ2A 3KLMX 1MX3A 1LLQA 3RKUA 4LRSB 1BVUA 3CTMA 2EJWA 3NKLA 1QXSA 2CZCA 3DTYA 5G0UA 2O3UA 2VUSA 5A1TA 1B7GO 5JYEA 4BNMA 2FZEA 1CRWG 1R0SA 5B4TA 3TF5A 1ISJA 2XOXA 4L74A 4URFA 4OHUA 1K0UA 3OP4A 1A5ZA 1KVQA 1XR3A 4L76A 2DVMA 3IS3A 4O0LA 3C24A 3PWKA 4JCOA 5F5LA 3OETA 3RJ5A 1XQ1A 3GMDA 1OBFO 2C20A 1XIVA 1C1XA 4HP8A 4K6CA 4NK5A 1SAYA 4PZEA 2ZQYA 3R1IA 5C7IO 1ORRA 2DKNA 2ZATA 1T4DA 1CJCA 2OUIA 4P8RA 1DIAA 1BGVA 2X7HA 1X1TA 1XHLA 1NFFA 3OFSA 4FDAA 4NZ9A 3HG7A 4BNYA 4IDEA 4ZN6A 4II2A 5BQFA 1CYDA 3EW7A 5KJFA 4E0BA 3ANMA 2E48A 2ZTUA 2O7QA 3I6IA 4AJNA 3QSGA 1T24A 3DONA 1SB8A 4L0QA 1Y6JA 1B8UA 4E4YA 2VHWA 3QVTA 4FS3A 1IHXA 4JNKA 1MA0A 3KBOA 1I0ZA 2VRCD 3PZBA 3S2EA 1DFIA 1LC0A 2VZ9A 3DZJA 3KYBA 5CEEA 1QV7A 4EW6A 4WLEA 3WQSB 4W7IA 5A3JA 3PK0A 4EJ6A 3RUCA 3JQ7B 1H6BA 2P4QA 1E3SA 4KTTE 4MVJM 2FR1A 4QQRA 3ULKA 1LLUA 5LDHA 3EZYA 2AQIA 4XYMA 1KVTA 5T64A 3ZV3A 4BO4A 2OHXA 4A10A 1BW9A 3FCOA 1GTMA 1PJCA 3VH2A 1UAGA 1JU9A 1F12A 3U4DA 3WQQA 5C3MA 2B5VA 3WWYA 5KWEA 3QVOA 5GZ6A 3WBBA 2W90A 3V1UA 1HLPA 1Z45A 1NVMB 2WWRA 1UXHA 1RM0A 1E77A 4M89A 4TRMA 3OIGA 3JTMA 2OBYA 3P2YA 2PNFA 1M6HA 5EJ2A 5U4QA 3W6ZA 4AJ4A 3DB2A 3QWBA 3AFNA 1VJ1A 1CIVA 1XQ6A 2Q2QA 4ZQFA 3TOXA 1MUUA 5TQVA 1YRLA 2VZ8A 3I6QA 2C2XA 1PZGA 3VTZA 3M6IA 1VRWA 1WVGA 2I67A 1QYXA 3R3SA 5L4LA 1BXKA 3NRCA 3ONEA 4DC1A 9LDTA 3WGYA 4D3FA 2HMSA 5IN5A 5COAA 3RASA 1E5QA 4CLDA 4DPMA 2W2KA 4WLUA 5ITVA 4HFJA 3CE6A 3DBHA 4J9VA 5IZ4A 1CERA 5KJCA 4IDBA 4G81A 1YB1A 1KYQA 3ETEA 5JDCC 4EEXA 4YT2A 3F4BA 4ND5A 2B5WA 3HDJA 3W4IA 3ENKA 4AJIA 4XYLA 4ROSA 1ZCJA 3PDJA 3TSCA 4B7UA 4DWVA 1HT0A 3WGHA 3PP8A 1KC1A 3GZNB 4RGBA 3EK2A 4FJ0A 1F0YA 1PJLA 3QW2A 4YBZA 5F3RA 4E13A 1AXGA 4MIYA 4R1UA 5C7LO 3EYWA 3UUWA 1BXGA 2ZTMA 1GR0A 3ON5A 3FNFA 3AI3A 2E37A 1VL8A 5L95A 2BFPA 1DLJA 5EERA 1B14A 3PQFA 2ZCUA 2IZ1A 1P45A 1WP4A 2UAGA 3T7EA 2J6IA 4A0SA 3ETGA 3JQ9A 3U9LA 3C85A 2DM6A 3VPFA 2YQ5A 2ZJ0A 2JFGA 2C59A 1MFPA 2GCGA 1WNTA 4DIOA 4Z9XA 1HWYA 4MIEA 3SJUA 2O23A 4PRLA 4BMSA 1MXHA 2X5JO 3ZHBA 4LMPA 2EGGA 1HXHA 4QFCA 4MKRA 1HYGA 3LLVA 3NAQA 3FRJA 1Y8RA 1YOVB 3MTJA 3SC4A 3WR5A 3GH3A 3BIOA 5KVCA 2PGLA 3OM9A 2UVDA 1JLLA 3JCZA 3KUXA 4B3HA 3LZ6A 5THKA 3ZCXA 5B4VA 2B4QA 2Z1NA 5IDXA 2IYPA 3AUSA 3ANLA 3NGLA 3N7UA 3Q9NA 4A26A 4FR5A 3RC7A 1PZHA 3EAGA 1N1EA 4NIMA 5GZ3A 2WJPA 3HNPA 4YTEA 3GFGA 3R6DA 4HFRA 2ZB4A 3SLGA 4LVCA 4UULA 3GUCA 4MVJG 1GDHA 4MINA 1E7RA 4AICA 3ZU4A 1T25A 2UUPA 2PZMA 1BG6A 2Q2VA 2AQKA 1I5RA 3GG2A 3D0OA 2D0IA 1ISIA 1W6UA 3T4XA 4OQZA 3PDUA 1NR7A 4QTZA 1UXGA 2IEDA 4B4WA 2B83A 2P5YA 4GVLA 3DOCA 1I10A 2HLPA 2VT3A 1BRMA 2YHIB 4XGNA 5A02A 4E30A 3PGXA 3KVOA 4YXFA 2B69A 1E92A 5KKAA 2B4RO 3C7DB 4YJGA 3WBFA 1U9JA 5CPFA 4FOSA 2RH8A 4IUYA 1RM4A 1S6YA 3PRJA 2DT5A 4J4BA 3D7LA 2NV6A 2VNAA 4F45A 2NQTA 4XB1A 1PX0A 4G2NA 2QX7A 4BQRA 3AOEA 3KHUA 3WDSA 3H9GA 1NFRA 1N8KA 3CEAA 4XYEA 4KP7A 1GUZA 4DBZA 1WAMA 1WMBA 4IJUA 1IUKA 2HU2A 1P0FA 2Y0DA 1ZO8A 4FD3A 3BTUA 4GGPA 5DULA 1NBOA 3FNGA 4MKZA 2HK7A 5HWSA 1YVEI 4XKJA 4D0RA 5G0SA 1Z6ZA 2PGDA 2YHUA 3R3JA 4PFJA 2Y1FA 1QG6A 4YDRA 5I7FA 5JY1A 1CQJA 2J8ZA 2TMGA 3DZKA 3U4CA 2PR2A 3V1TC 4GLOA 1ZXBA 4OOEA 1FDTA 2C54A 3VAZA 5BT9A 4OL9A 2VTDA 2BKAA 3I23A 3I9OA 4S3MA 2R00C 2WYWA 1M6WA 3VDRA 5L51A 4A2CA 1T2AA 4XWYA 4IY1A 3ZDFA 5KCZA 3BMQB 4OKNA 1D7OA 3IUSA 5LC1A 2X0NA 4OM8A 1M2WA 5JXWA 2WDZA 1QYWA 1R4MB 3GVCA 3NV9A 5J23A 3D3EA 1H94A 3LT4A 1NM5A 2FRDA 4G5HA 4PRKA 3E6AA 1TI7A 3QA9A 2NQ8A 1R16A 1E7YA 2NNLD 1SB9A 1RYEA 2YY7A 4BUCA 2IEBA 1Q1NA 1TVEA 3VH3A 1E0DA 1OI7A 3Q3CA 4MVJA 3WIEA 3AU9A 3JQAA 4HFNA 3G79A 4ILKA 1O6ZA 1HYEA 1H2HA 1GEGA 1WXDA 4WOJA 5TT0A 3WX0A 4DA9A 1E3IA 1C14A 5TNXA 3HDQA 3X2EA 1RKXA 4RVFA 3GDGA 2I6TA 2HRBA 5DCYA 3GK3A 3MJEA 3ORFA 4G65A 1PS0A 1GYRA 3JQ6A 3E9MA 3IJRA 2Y05A 4R16A 2VWQA 3RKRA 2X1HA 3BTVA 5IG2A 5T8KC 3I9MA 3BMNB 1T2FA 2J5QA 2V65A 3SXPA 3OECA 4ALLA 1GUFA 2NVUB 3IMFA 4JBHA 2W8ZA 5BNTA 1K6JA 4CM6A 2Y1CA 1F17A 1MV8A 5A4DA 4BKUA 4HNHA 3JD1A 3QRWA 4JGBA 5GY7A 2G82A 3PHHA 2DU8A 2EP5A 2JD0A 3EDMA 3KLPX 4AJKA 4I5EA 4BQPA 1IPEA 2POQX 1O5IA 1I33A 3MZ0A 4P4NA 1LSJA 1ISFA 4YQZA 4IDFA 2J5KA 1OC2A 1BHSA 1IZ9A 3I9KA 3O9ZA 3RFXA 1HTBA 1PS9A 3HSKA 2Q49A 3WLEA 3L4BA 3GAZA 3SJ7A 3A1NA 4XEHA 2BI7A 1IHYA 2AE2A 1PJ3A 3ONFA 4UVGA 4Q3AA 4WLVA 2E82A 2YFHA 3DHYA 5BSFA 4QFDA 1WWKA 4EJ0A 4RJTA 1D1SA 1HRDA 1GZ6A 1Z7BA 2JCYA 2P9GA 3F9IA 1IOLA 4MOWA 1EE2A 1PR9A 4J4HA 5AXDA 2P2SA 3G1UA 3NDRA 3WTCA 3D4PA 2CVZA 1QMGA 3D3WA 3E1KA 4MDHA 3D1LA 4RF4A 4GI2A 4OYRA 1NPTO 2Y66A 5HA5A 1OZAA 4OXYA 1ZH8A 5G4KA 1H6DA 3I4FA 1LRKA 1UXKA 1PTJA 4IS2A 4XRGA 3PIDA 1NPDA 4EI2A 2OMEA 1C1DB 4M49A 4MP6A 2AE1A 3JQFA 3RUEA 2ZYGA 5CPBA 4E12A 4OSPA 2QYSA 4MVJD 4E31A 3JQAD 1GL3A 1V0JA 4E6PA 5A5FA 1JA9A 1E1MA 1TEHA 3PHLA 3Q9UA 3ZU2A 4CM9A 3BTSA 4NFSA 1DIHA 1P1IA 4RPHA 1IY8A 1DBVO 2YFQA 3U4IA 2JL1A 2W98A 1K6IA
chains in the Genus database with same CATH superfamily
1PGOA 2EZ9A 5KYXA 1QGAA 2INGX 2BH2A 2PXHA 4I6EA 2RBGA 4UE6A 4JP1A 4ZVNA 2G3YA 4LJ5A 2WR8A 4ZCTA 4JJ4A 5B58C 1N7GA 1O6FA 4G24A 1U3UA 4PGFA 1LI7A 3CZPA 4OP2A 4EITA 1ZAYA 5FTKA 1WHSA 1YR9A 1QOQB 3RUFA 4ZCMA 1U0FA 4G4JA 4BCDA 2XF8A 2C29D 4R2WA 2NU6B 1AQIA 3INRA 5JAUA 1KTIA 3NBYC 1MVNA 2P79A 3OBBA 1WZ2A 4HVLA 4RPLA 4OIFA 1MDFA 5CLHA 3ERCA 2QG4A 1P39A 4EZIA 2HCTA 4FW8A 5DIZA 1X7WB 3EF0A 2XLCA 3PICA 1C9YA 2WF7A 3S3TA 3KYDA 3NLLA 4DSTA 4DYVA 3P5SA 2RHWA 4V02A 1MABA 2POCA 2WJVA 4NYJR 1EGVB 1YE8A 4I1IA 2O3JA 1BFUA 3ABOB 3DE0X 2DT8A 3ZE7A 4CLHA 4DUPA 1CLUA 4FX2A 1A7AA 2GTIA 2HJRA 2PO5A 3AR8A 4QQFA 4LRUA 2X4GA 4IF4A 4WN3A 4HS4A 4XJSA 2XCUA 3F7NA 1X1RA 2A9QA 1A50B 1PBNA 5D84A 5AKJA 4ZOLF 1P5HA 3GQBB 4W5NA 1LPBB 4JV5B 1PK7A 1ZW1A 4I9UA 3WLSA 2QJOA 5EZQA 5AW0A 1GP2A 1EVEA 2IOHA 3LUPA 3Q85A 4IKOA 3CF2A 2NO7A 5G02A 4DLXA 3OCJA 4RFVA 1UXJA 2CVQA 3KG2A 4HMQA 3KRTA 2CWDA 1MJNA 4J0EA 3T7CA 3G68A 1ZONA 1G3RA 3EA0A 5F1PA 3PT9A 1MFZA 2ZKIA 2FX3A 2WB4A 1I24A 1U1FA 1FLVA 1QO0A 4J6FA 3JYNA 4TTRA 4Q16A 5I9MA 3WG9A 3RQIA 3N70A 1VB5A 3WADA 1GGMA 1LKZA 2VI5A 2Q9BA 3HYSA 4XJVA 2ZDGA 3CGWA 4D3SA 5DLQC 4QRHA 2P0AA 2GD1O 3NTVA 2AMYA 3TLBA 3K8QA 2R5FA 4J3FA 3TECE 3I2KA 3ZHZA 4JC8A 5DYWA 2Q7DA 2AR9A 1K2WA 4RAQA 3CX3A 3RS3A 5KX5B 1ZSNA 1SXGA 1H05A 2XODA 3B3QA 1U9IA 2QZZA 2Z4TA 3CIFA 4I4TA 4NCHA 3TLKA 4DW8A 5H4GA 2GTPA 2C84A 3L8DA 3BCHA 3LC2O 4Q01A 3AVTA 3DVQX 1OU4A 3M9WA 4HH1A 5KREA 3DHNA 1NJ1A 1USUA 3G5TA 4A15A 4RACA 3TMAA 4XZ3A 4CMKA 5HKBA 4LGCA 2A86A 1Y8RB 2NMVA 1FY2A 5JSHA 1K06A 3KVYA 3NT4A 1CRZA 4BLUA 3C8MA 1DV1A 4UEQA 4B3FX 2VHZA 3ZD8A 3T0IA 4AXXA 2PL1A 4QPPA 1VIYA 4QUDA 4N47A 4DV5B 4FXPA 3EVTA 1T4MA 3FD8A 2OXIA 4Y2HA 3UMJA 2ZVQX 3O3CA 2O8BA 3U4QA 4YRKA 4BNHA 4WXPA 5EP2A 5K8UA 3SK0A 1JBQA 4V0LA 2DQZA 2AEJA 4URZR 5IC4A 1XCLA 3GFBA 4CMGA 3OIWA 4QUAA 1HT2E 1SVUA 4JU9A 4J03A 4BZWA 4COOA 3Q8LA 5BV0A 3K70D 4B75A 2Z3WA 3D6TB 3PGJA 4MV1A 4EQZA 3IGFA 5A6VA 4HAYA 2D2XA 4ZVVA 4I3FA 1U3VA 1ZL2A 3ECCA 3ZJ5A 5AUOB 2BY4A 3TS1A 4IICA 1EFLA 1ZH2A 1AXEA 3TZ6A 4F11A 3SZLA 2IZ6A 1TQ2A 3Q1LA 3A25A 4IDCA 4ZDWA 4DLSA 4ZOCA 2I7DA 2WFMA 4R4JA 4YGYA 1SCIA 1XX6A 1CZLA 4NAVA 2TECE 2DZDA 3C4VA 5K6TA 1UFOA 2COKA 1NXPA 4U9UA 5LQSA 2FWAA 3VU3A 2R1TA 1IG3A 4FHEA 4NH4A 1CULC 4ZRDA 3DAFA 2VZ0A 4AMVA 4C4YA 1DRKA 1A7JA 2FVXA 1QGED 4XWAA 4G8BA 1OB5A 1Y3CE 5TMEA 3WRXC 2AR7A 4Q9AA 2NTNA 5JO9A 3ASVA 5KNDH 3AHJA 2ODBA 5H02A 1UMDA 4D97A 1FJGB 1SBCA 4DPKA 1U3DA 1USKA 2OB1A 2R6GA 1CQPA 4WNAA 4RJLA 3ZN2A 1GQSA 1SBYA 2Q9AA 1K75A 1GGFA 2QE7D 3LRPA 1P9LA 2JA2A 3OCVA 3OZDA 4PC3A 4L5JA 3LTEA 1UP7A 4V0ME 5IABA 4URHA 3DOOA 4YNBA 4RTMA 1FFGA 4UTOA 3HKDB 3L8MA 3CH6A 3CUYA 4P84A 1UWKA 4I08A 3FKQA 4YAGA 1EFCA 1KHTA 1STOA 3EMBA 1EIZA 2E5WA 3FZYA 2DTXA 2GR9A 4R84A 4TN5A 1XNGA 1GZSA 4Z9FA 5JS6A 2QMUA 3CS3A 4MDYA 1QYCA 3HBJA 4YP1A 1MXFA 1N6IA 2OG1A 5A3SA 4MQEA 3VPAA 1GPH1 4XWKA 1N9GB 4R8RA 3H13A 2H4XA 1PLJA 1RJ9B 5I7HA 1E2HA 1BO6A 1RS0A 1W2WB 1W19A 5HIMA 5JS8A 3QEOA 3T7DA 1SM4A 2GHRA 5ALLA 4PXAA 3OJXA 1DJNA 4RGQA 1NI4A 1W5AA 4JUCA 4M2LA 4B3IA 2F8TA 2AG8A 2I2CA 4G9EA 2HSGA 2GDZA 5EPUA 1RBQA 2WRZA 4GGMX 2X0FA 1EZ1A 4B6PA 2JIQA 1DFHA 1V6SA 2XMRA 2JGJA 4JI8B 4HLUC 5LA6B 5DLDA 5I3ZA 1BXZA 1SG9A 5FH9A 4IIFA 4UMFA 4NEGA 5BUSA 4KBYA 2R7MA 3EMDA 1HUQA 3N7AA 3TNJA 5EG5A 4XVQA 4X9XA 1U2PA 4RD2A 1HEYA 2BD0A 1TB4A 5DYIA 3ZZ0A 2LDBA 2QAIA 1R8XA 4TTVA 4Q9JA 5IHXA 4B82A 4DQXA 2O07A 3HUTA 2ZUCA 1AKWA 4G36A 2DECA 3NP9A 4MW0A 1LK5A 1KJQA 3DBLB 4AJJA 3UCXA 2QJWA 4ZGBA 4LXTA 1GFSA 1KVRA 3RFXA 3RADC 4CU5A 3WB1A 4RVDA 1KIMA 5CVJA 5CX1B 4CIDA 3KYCA 4L2IB 1E5DA 4YN3A 3WGJA 4GSKA 5EXTA 1B6RA 2EWWA 2AOUB 3AP1A 4S0ZA 7ADHA 1YTUA 2NVOA 1YBMA 2FW6A 1UPUA 3DOFA 5E4JA 5ALYA 1ENZA 3L6DA 4PN3A 5JECA 1XJQA 3ZVNA 1G38A 1A97A 3IQZA 5EMJA 5T7BA 3ZZMA 1L4FA 3WZMA 3KXKA 1L4LA 1UBJS 2ZR9A 2ZETA 3DWFA 1C8BA 1OI2A 5IZCC 5LP1A 3QW4B 3AXTA 4JJFA 3ZXUB 4R2LA 1TEZA 3U1TA 4PQYA 4NXNB 3N6VA 3NAMA 5MN5A 1MD9A 1E63A 2FWIA 1KYTA 5BRAA 1YDHA 2OCYC 2YWCA 1FEZA 1SCJA 4QEDA 2BYTA 3WKEA 1Q95A 3EJ6A 2R1VA 5A9SA 2GM5A 4D4HA 5IBQA 2Q6TA 1O95D 1ZD9A 3LPCA 2PUEA 2XGGA 1PG0A 5FPTA 3VHLB 4DA4A 1TUBB 4XQ9A 4PZ9A 1I3MA 3CUSA 1LDMA 5DXFA 4ENUA 2PCLA 3KJFA 1G1AA 1SUIA 2PJDA 3G2KA 3LOQA 3IV6A 3B7PA 3LXUX 5EINA 3GQVA 2DULA 2J9RA 4KLNA 3VU9A 1CE8A 1IMOA 3SEQA 2IRWA 5CDGA 2PZLA 4UHEA 2OO7A 1LCIA 2X0IA 4D4JA 4D7AA 3JALA 3GP8A 2EWVA 1CJKC 4GBMA 1V8FA 3I1FA 3QYPA 4TL8A 1I51A 4C1BA 4C06A 3BEDA 3NJ8A 1EIWA 5IT0A 1KZ6A 4L15A 2W6JD 3MUOA 1ZVQA 4YP6A 2PUBA 1A8SA 1H1LA 5B7NA 4OA8A 5BSHA 5CB4A 4CCYB 4KPEC 2NSLA 2GZMA 1ULUA 1XDZA 2AHRA 2C4NA 2GJSA 3NBKA 1PFWA 3I92A 4V0MA 3K16A 1NHWA 4NFHA 4L9SA 3CA8A 3GJ5A 2CLDX 3K8YA 3GBSA 2HXSA 1XPOA 1XNQB 3ICEA 1JPVA 3E84A 4URUR 2ZJFA 2PFGA 3P2KA 2VJPA 2V4MA 2NXNA 4HWGA 3MJVA 1ZMBA 1X7HA 2E85A 4XTRA 3TLXA 2IDKA 3WOHA 3OU7A 3N8HA 2GSDA 4RELA 5CM9C 3RIMA 3S70A 8LDHA 5DP1A 1P7WA 5AUNB 2H1LA 4UDXX 4I7EA 3QVLA 1HGXA 4MRMB 1BE8A 5GVSA 1XXHB 4WOKA 4CMJA 1HE2A 1OI4A 4I3GA 2QTZA 3NYRA 1M75A 2B6NA 1E1NA 4L4RA 1MHTA 5H80A 1DQZA 1SOUA 3LL4A 4HL6A 4L8YA 3T9DA 3PUXA 1UFKA 5DSTA 1Z2NX 2CBGA 1OVGA 1I2BA 2GVNA 4FZVA 2TMYA 1Y0BA 2J33A 2XW6A 4NYMQ 3P9ZA 2YJ6A 3RDPA 3AF5A 1F2TB 2IIQA 3ACDA 3HCDA 4N82A 1DAHA 3OZWA 4KUGA 4UEWA 1KGDA 2FA9A 2VLBA 3BWCA 4UMVA 4F6RA 2YZNA 1IM8A 1ADBA 3P8ZA 3R24A 5DHQA 2OLJA 5ALKA 3Q3EA 1Z37A 1JR4A 5E6SB 4ASUD 1SC3A 1ZM3A 3E22A 3CEPB 3LY8A 1T8RA 5KNBD 2Y8EA 3FZQA 3PHIA 3OZEA 3ZWOA 4N65A 5JJ5A 4IHKA 2XE6A 3C7TA 1RWNA 2FQ1A 1HPLA 1DCFA 2HWYA 2C3YA 3E9NA 2JFOA 3GEIA 5J9FA 3TH5A 1XQXA 3KUCA 1FLNA 2Z09A 1RR6A 4YRDA 1Y1KE 2PZGA 1DZ3A 1DXQA 4E5VA 2I0FA 4PNHA 3VPGA 5A04A 3O8RA 4GKVA 1ZOPA 3FAKA 1WDTA 3W5UA 4RL6A 2KB0A 5G1OA 3MBIA 2PMKA 2RKBA 1EBFA 3D8HA 3HGTA 5TEVA 3ZWMA 4RTJA 3IOEA 3GGJA 1LB1B 4CM8A 5B30A 5EHZA 4EARA 2QTWB 3H9EO 5JYCA 1V45E 2EP8A 5FQNA 3O03A 721PA 3HBMA 1P60A 2D0OB 2FHPA 1Y4ZA 1P74A 1YUMA 4G1UC 3ZWXA 5L3QA 2UZAA 3ZIUA 2CVPA 2QYOA 4IJ6A 1SBNE 1XT6A 8ABPA 1NVTA 1JQ3A 4MCHA 4D4MA 3P52A 4QFBA 4TMZA 1S7CA 1M2EA 5EI5A 2HQRA 2ZVPX 3PNQA 4DDKA 5KDOA 4NCBA 4PR3A 1NUHA 4O4JB 5CFOA 5H7XA 2ODQA 2KMLA 3BEOA 2QN8A 3IMKA 1DV2A 1TZBA 1J0AA 3H86A 3L7BA 1VGRA 3LBFA 3QLUC 3TLGA 4G0UA 5BPHA 3FTFA 1A4XA 4D8YA 2ILTA 3WDLA 2IS6A 4HEQA 4B2PA 2P9TA 2RAUA 5DPMA 1QFXA 3B5JA 3PUVA 5T6MA 3UWMA 4AMZA 3IEXA 4XUCA 1J00A 4ZAFA 5BN5A 4XPZA 2EFYA 3RTAA 2XMCA 1Y9AA 1PEAA 2Z0MA 2XNSA 2O48X 4G4SO 1YJXA 3OZBA 4G9GA 4B6EA 4XD7D 1JIUA 5BWOA 3F5SA 2AD1A 1Z6QA 3I32A 5I7RA 5K2MA 2HF2A 1SBHA 4N5LA 5A1JA 3I8XA 1TXGA 4OM7A 4IV0A 3HWX1 1J42A 1B6TA 1L5SA 4ZKDA 4ZA2A 2IE8A 1W6RA 1JQKA 1KY3A 2DR0A 2GS9A 3H5WA 4ZD6A 4D0SA 3LUKA 3AKCA 4DA7A 5LMNB 1IY0A 2IF2A 3BB1A 2Z3ZA 1G5PA 1KJWA 1WUYA 1IN6A 1IOVA 1PJQA 1LLFA 1QFJA 2RH9B 3AVOA 3KB8A 2R8YA 4BO5A 4XWWA 4RTRA 1BVRA 3I2IA 1QGDA 4ZRMA 4BVKA 2BDTA 1XRSB 3K2BA 4IFIA 5IRCD 1SD5A 1HDRA 3ZY3A 3GPLA 3EBOA 4IRXA 2FW9A 1IIBA 1XAGA 4D9JA 3L6UA 4C5BA 1AK2A 3PXUA 3PEFA 2DQSA 2RGAA 2VAWA 5A62A 1ID8A 4M1QA 2OGZA 1PKXA 1W88A 3FBGA 1PVOA 2FN7A 4R31A 4JI4B 3OZRA 2Y0PA 5CA0F 3WWDA 4FDTA 3NEJA 1T5LA 3O4RA 3V4PB 2CNWA 2LRHA 1VGQA 1NYRA 1C9KA 2QQ0A 3I6MA 2HSWA 5ESWA 4FJ1A 3AJRA 1W0KA 3EZXA 2WYVA 1UC5B 1P73A 1PGNA 1R4NB 2JAWA 4GZLA 1Z68A 3BXFA 3NDIA 3BDAA 2Z9DA 3UJ6A 3N86A 3W34A 2QK4A 1PZNA 2MYTA 1OTXA 3I5AA 2DQYA 3JYQA 4EUNA 1UK7A 4RX1A 1GL7A 4DRYA 4FWIB 5MN4A 2W2MA 3U4QB 2O8CA 4CM4B 1YJ8A 4JKIA 2GRJA 1C0KA 3Q3JB 5BSVA 4F3YA 2PRIA 5EEHA 2DB3A 3OC6A 4FONA 1JQ5A 1NQTA 3PFHA 2HEGA 2QD2A 1EG2A 1QDUA 1D1QA 3CR8A 3LVRE 4IGIA 2ZXUA 1EXVA 1M2FA 2H7YA 4OVKA 4TM7A 4GPIB 1M66A 2HBRA 1Y48E 3ADCA 3BH6A 3EXHB 2DQKA 4TXMA 1A72A 1YI8A 1A98A 1BJRE 2YV4A 5IKOA 3ESQA 1QF9A 1MNQA 4GZ6A 2Q9UA 4F3KA 1X1QA 5DGXA 4QGBA 5F4BA 3R0VA 1OGIA 2E1PA 2OKGA 4Y2TA 4KMOA 2PZEA 4K9PA 3DW1X 3WISA 3ZBTA 5AVJA 5BSEA 1EGMB 2O7SA 4JI3B 4X93A 1DO0A 3B3AA 3S40A 3VR2D 2VP2A 4ENTA 1CUUA 1ZVJA 2G5GX 2WT4A 2WQ6A 3H8VA 4QQKA 4FILA 5AVZA 1F51E 2VCYA 1MZVA 2FPGB 2ZGVA 5CHYA 2BSQA 4X44A 4X71A 3RUHA 1M33A 4H1VA 1E3WB 1EH5A 1X1CA 4IIJB 3DM5A 2BT4A 1UMCA 4RJJA 3U62A 4YMGA 1IHPA 3KIPA 4FFBB 4KQJA 4PG6A 1H6AA 3QPVA 4CR8A 3N39C 3NHJA 3N8KA 1XXLA 2VJAA 3B85A 3FNBA 4DNXA 3L0CA 5FBLB 1XV5A 2CY0A 2QJRA 3WYEA 4IGEA 3HB5X 4IYRA 3CLTD 9GPBA 3UJHA 5K1SA 4ZI7F 1XZMA 3W7VA 3G82C 3T52A 4EABA 4F2DA 1M2VA 2HMWA 4HOYA 4JT9A 4L9RA 4N9QA 3WQBA 4ALJA 5JMPA 2BGWA 1GAQA 2OZLA 4WADA 3MTEA 5C80A 4JLKA 1RCFA 1G5RA 4NBNA 3DE6X 3UCEA 4UOEA 5A4AA 5ICCA 3BSFA 4WLNA 1QP7A 3K35A 5G1PA 5AJZA 5J5AA 2D2VA 4BC0A 4MQEB 4ZK2A 1ZGAA 1W85A 1XELA 2J07A 2YN0A 2OGWA 3BAFA 3ZHXA 2IP1A 3N05A 1PP4A 1NN1A 5IXJA 2Q0HA 4DIFA 4F5EA 1FU4A 4CR6A 2FEAA 3NVDA 4XR4A 3V1YA 1M5TA 5JSFA 3I5XA 1FDWA 1X6VA 5EZYF 4NQZA 1QHHB 3H18A 1HZJA 5LQNA 1CB7A 3ZWAA 4N76A 1CCWA 1J4AA 5C31A 1PAUA 1F2UB 3U7QB 4CKBA 2Q8PA 3M4YA 3PGLA 4AUNA 5JXJA 3ZQUA 1NYQA 1XMIA 4U0KA 3UUGA 1TTQB 4MTCA 4W9RA 1PYOA 2H17A 3RVDA 4IMJB 3VVCA 1DU4A 1RYNA 3A9UA 4OHZA 4LF8B 1PR0A 3G8DA 1OA0A 4V2UA 5B1HA 2GBPA 4XE5A 3QTBA 4OFZA 1POWA 2UZIR 2Y0EA 5HZKA 1U0JA 3QKWA 1U8XX 1QGZA 5ALNA 4QO7A 1XMXA 2X2FA 1C1XB 2F3UA 1MGOA 1XVTA 2GCPA 2CDNA 2OUKA 1W7AA 5JALA 1E9AA 1XQYA 4GXTA 4UZSA 2OM2A 3ZKWB 4EECA 4LGMA 2PX8A 3CVJA 3GPDG 2BGTA 2H0RA 3HXKA 1UDXA 3RYIB 4K9RA 5L3ZA 3DA8A 3I64A 1IBLB 5I7VA 5AJHA 3W9UA 2AQHA 5YASA 4CCAA 4CGYA 4IOLA 3MRXA 3BJZA 3TLZA 3RABA 3AUTA 4ADSG 4MRVA 5CUQA 4BVBA 1BMDA 3VPCA 5JSUA 1I0IA 3NNDA 1B16A 1JXOA 4TOIA 5LUBA 3FRHA 2C9OA 3GRAA 2QSUA 1VHTA 3OLQA 3OUZA 2J7KA 5TR9A 4RD6A 4PV7A 1U9ZA 4U3JB 4JC0A 3UOWA 3DXZA 3HP1A 1T2CA 5KC9A 1BN7A 3JVIA 3LBNA 1OQAA 1CJBA 3RTBA 2Q50A 3RUDA 1NM5C 5TQ2B 4DADA 2X76A 2ZSFA 4DG8A 1RAFA 3ZDDA 3IPLA 1P2BA 5AVTA 1DHTA 1E4YA 3JAKB 3SVLA 5FP0A 4K9LA 1RT9A 2CJPA 1JALA 3Q9LA 1EUZA 4O4LF 1D6MA 1U7ZA 3D6MA 3GRYA 1QLJA 5JSQA 1LS1A 2Z43A 2RC5A 4RD3A 5DM4A 2B1IA 3CG0A 4XXHA 2FXVA 2D3TA 1U04A 2J6CA 1QSGA 2OV1A 2JLCA 3W3ZB 1LJ8A 1QR2A 3HY3A 1OFTA 4F60A 1N3LA 1VECA 1G20E 3FMOB 4FBLA 4IH1A 3SM3A 2PZFA 3BG5A 4TT3A 3VKVA 3H2YA 4WFJA 1VZ3A 2I7TA 1BC5A 4RGYA 3BKXA 4AYTA 1RXVA 2FWPA 1TUEA 5DCUA 1BW9B 1R6BX 2EG9A 3AX6A 1IXYA 1CUWA 1AKRA 3HZOA 3N2GA 3TQFA 4FTWA 1DJMA 3CO5A 3A58B 3HQ4O 3JQRA 3MLBA 3THOA 3WWCA 4TMKA 4X63A 4BQFA 5KMGA 3PI7A 4G1MB 1U8UA 1RXWA 3X1JA 1EXWA 4H31A 2B82A 3OOJA 1WM1A 1S8AA 3L18A 1YZQA 1OFUX 2AR0A 4IW3B 4LJ4A 4BU0A 5JD4A 3R7SA 1RLIA 5FOTA 2FGJA 5LB2A 3SM9A 5H16A 5JH7F 3NJ4A 5AUQA 1IOZA 1VBFA 2JFQA 5F9MA 3MT0A 1C1HA 1BJTA 4OKSA 4LXUA 1N8SA 3L7OA 4UPDA 1SHKA 1EUDA 1N32B 2J9FA 4ML3A 3THYB 1YA4A 1Y3IA 2Q46A 1CHNA 1QFMA 1DIBA 4ZVLA 4EJFA 2VHJA 1WY5A 3PJDA 4YO7A 2P78A 1AUPA 2PS0A 4L28A 5H3HA 5KYUB 5CVVA 3ZHTA 5HJ2A 1RZ3A 1CUVA 1EFVB 1QRSA 1GT6A 1E5VA 4NXMB 3RBZA 4BMVA 1YMQA 3FPGA 3U3ZA 1DARA 2W2KB 5IJWA 1D2RA 1VG0B 3KYJB 4WWHA 5LBUA 5G0WA 1K92A 4D41A 2FKNA 2C42A 4JX8A 2DJ5A 1U0EA 4RY8A 1IBCA 2EJTA 2WJWA 4QU9A 1BKDR 4AO8A 5CXQA 1OLXA 3HBFA 4TS1A 4I1PA 2I91A 3NV7A 4C03A 4KUEA 5JC8A 4CMEA 1JG1A 2JEOA 2OQRA 1U7XA 4JIMA 1O3YA 1FNNA 1YOVA 3RHFA 1N8NA 4Q4JB 3A1FA 2CMDA 3PCRB 4NG4A 3TUZC 4FINA 2WTAA 2JFHA 4QTTB 2VSOA 1EX9A 2FZCA 3VBCA 4JGGA 3KS9A 3UQZA 1BXGB 4D9EA 2Q5HA 1T2UA 2I7XA 5KSWB 4C2UA 4RIIA 2P9BA 2VFAA 2XCOA 1A4RA 1IPHA 1Q7GA 2IE0A 3KU4A 3RC2A 1I4OA 3RSZA 3FFBA 2AYXA 1ZGCA 4NZYA 4EFKA 4OHMA 4Z54A 4Y6OA 4J9UE 1VCHA 5FADA 5FBWB 4P82A 1NNI1 2Q28A 1CHDA 1CS4C 3EFEA 1TU0A 2XE7A 4G4IA 3HSYA 1BKSB 5TMDA 3WQHA 2W8BA 1VKHA 4K9OA 3EG9A 1PGPA 2PCJA 4FYHA 4H6VA 3L0BA 3M3HA 3GV0A 1E2JA 5SZJA 1CUHA 3QKSA 5TEWA 4DDMA 1A9YA 3A9WA 4K28A 1QHEA 4MNTA 5HZHA 3B1VA 4MWGA 1XCBA 4RZIA 1DAEA 4PLVA 2DG2A 2O1XA 3EEBA 4Q3NA 3OJ0A 5ELMA 5IXSA 2RGWA 5FA6A 5JEEA 2LIVA 1P4HA 4UTXA 2TMDA 2O20A 1ZA1A 4J16C 4JD5A 4PBRA 2OP1A 1E99A 2HMUA 4LC1A 1VLMA 4CF5A 3KJEA 3PDHA 3EA5A 4WEQA 5EIXA 3U60B 1J23A 2NYAA 4PC6A 2GHQA 4PYJA 1GNQA 5B4UA 3IDFA 4UEOA 1NNEA 1JJAA 4BEVA 5FR2A 2GNPA 2RIRA 3DULA 4R54A 1PG5A 5JAZA 2A8YA 3HKEB 3E1SA 3Q2KA 1G20A 3K0FA 1SOAA 4ZQGA 2I8LA 2H2IA 1XC7A 1XTTA 4MKHA 3ST7A 4HBGA 1L0BA 2RGCA 1DEXA 1ULZA 3BHJA 4ICIA 5EKXA 4CQNA 4OLFA 5IYZF 1ZC3A 2B98A 3H0EA 1I9GA 4KBGA 1PL0A 3REFA 4UEKA 4A2QA 5HJ7A 1T5SA 1PWEA 4NYIQ 3JQEA 1W0CA 2HA4A 1G60A 1OIWA 2QRHA 1LFDB 3CX8A 3O3NB 4HQOA 1ZRHA 1E2FA 4HLCA 1PNTA 4C7OA 1HE5A 1JHYA 4F04A 4HRVA 1E7MA 3MCWA 5ITWA 4ROTA 1TLTA 1VE3A 4GRDA 4Q47A 5CJJA 2ENUA 4AJOA 4NCAA 3DE4X 4G41A 4PYIA 1BKYA 4N3NA 1OJ7A 1E2IA 4EKGA 3UXMA 2OR3A 4RESA 3ROPA 4M1WA 1D9ZA 4JELA 1OH7A 3RSLA 4IIVA 1HTTA 2WU8A 1UBNA 2JAOA 4FYIA 4KU4A 3ROGA 3PITA 4RTLA 4FHDA 1V5WA 2A78A 1Z8NA 4YMSA 3O8CA 3NASA 2Z1MA 3FWNA 4PANA 2D2EA 2V5UA 4RK6A 2V7UA 4Q3EA 2I87A 4GR5A 2OYCA 4DSAA 2FSGA 1NQVA 4E5UA 2PSFA 3MWJA 3BWBA 1G7SA 2XDWA 1X0XA 3NONA 2F62A 3C1OA 3H1AA 4MV8A 4OXRA 4XD2A 4ID3A 4IRMA 4NNJA 1LUAA 1P2FA 3I9LA 4Y6PA 5AVVA 1NVVQ 3LHFA 2MYPA 2PXXA 3BMQA 1RBYA 3N2LA 4H0CA 4QBFA 2QX9A 3H0CA 4R01A 1TYEB 2P2YA 1IDOA 2XF2A 3NXSA 3U3DA 4Q21A 1ODIA 1VHQA 1Y1PA 3FWKA 4WFQA 1M72A 4ZCQA 5EXEA 1EAMA 1SG6A 2Q2OA 3TLYA 5BW5A 2ODPA 3EFOA 1R4MA 2XB2A 3F8TA 2ATCA 4BS9A 3EZLA 3OE7D 2AKYA 1G3QA 3ND6A 1GKKA 2QZPA 1IOWA 1MU0A 1NW9B 3LIIA 5C7YA 5LL6P 1JNXX 5JI3E 3HUUA 4BMZA 3TRDA 1ND6A 4HXYA 1J8MF 5DNEA 1KY2A 3DEIA 2GO1A 4R69A 2NTVA 3ZQJA 1DAIA 1I1QB 5B7GA 1V3UA 2VPYA 3GEDA 5CVTA 1JG6A 1WB5A 4CLXA 1CQJB 3SE0A 1JFFB 3REQA 4AJEA 3TRIA 3MRVA 1XZFA 5AKGA 1E2LA 1RCTE 4OUDA 2Z5VA 1B8PA 4UAGA 4B44A 1H4SA 4RK7A 4Z2YA 4DSZA 2BC9A 3LDUA 2ONYA 4OQLA 2ONZA 4YACA 4KFSA 4CIWA 4KVZA 4PG8A 1ZQ1A 2BBWA 3UB3A 2REBA 3IP8A 3UG7A 3AW9A 3AWDA 5JS2A 1U65A 4NLLA 3MFQA 3VYSB 4O25A 1Z0UA 3WNVA 3GUUA 3G0OA 1W35A 3IJ5A 4G5YA 1U1IA 3BMNA 4NESA 5EPOA 3R7WB 1K7FB 2G8LA 4M6WA 2Y67A 4BO9A 2VP6A 2NZYA 1ZJJA 2V6JA 2FF7A 3IKMB 1J06A 1F7UA 3S8MA 5IJXA 1WSAA 3IPCA 1Z6TA 5IBRA 3TW0A 1XZKA 5IPFA 3QVWA 4Q12A 4CI9A 2SICE 4ZGWA 3TZHA 2Q4RA 2ZTVA 4GI7A 4DE5A 1KFKB 4TZTA 1QIEA 5DTQA 3JQAB 3KPYA 2PPVA 5K0ZA 1HL7A 1G7RA 1PT5A 2A3NA 3BE4A 5EIHA 2VJLA 1P8AA 4CMAA 2JGFA 5FAXA 3K73O 2YYSA 5HEKA 1XTSA 3Q72A 2A5FA 2GK4A 1RYFA 5IVKA 1A4UA 1TADA 3DTTA 1ZK1A 3Q15C 1T8UA 2NTYC 2BRUA 3FF1A 1ONOA 4WN9A 5FF9A 4RVSA 2TS1A 3BGWA 5FEMA 3OUUA 2ZJ1A 2OCLA 2V5AA 4UBJA 3SSNA 3ELWA 4JLJA 3WK8A 1YKGA 3RAFC 5ALWA 3BWEA 1NJ6A 5DYYA 3UICA 4UFOA 1TO6A 2FEOA 4JEUA 2Q21A 2SKEA 3CMMA 3EPHA 4M55A 4BO1A 3L0SA 1S9DA 4HQLA 4WBSA 1QTIA 4MZXA 5A9RA 2WC1A 5EMKA 4QYIB 5JWOA 4MYDA 4MW2A 2PKXA 3B70A 4FR0A 4HN9A 4UAUA 1D2GA 5LKAA 1FFEA 1FYWA 1JQBA 1FPMA 4LJAA 1ECBA 3MEQA 2HBZA 4IVPA 3TTXA 3ESAA 4B46A 4MVYA 4HAZA 2FAXA 1SN7A 2PLRA 3SKXA 4BJ3A 1CUBA 5IANA 1SQ6A 1XZEA 1T3TA 5K0FA 1TJ4A 3B6EA 9ATCA 1L1RA 1AQ6A 4IH4A 3SX4A 4BRSA 1ZWKA 2QP4A 4LYFA 3AFGA 4IDOA 1G4HA 4MUEA 1RIFA 4DVJA 2VWHA 5FNVA 4NONA 3UQYS 2Y4OA 3EPLA 5C81A 3FZGA 1N6RA 3RIEA 3O4HA 4BE4A 1G41A 2IYRA 3AHIA 4FSDA 4US1R 1TW3A 2AJLI 1FU7A 3H3JA 3DZHA 2FUEA 2QXUA 2Z2ZA 2C2KA 1NSYA 1Q15A 2HHAA 2REQB 3WJAA 2GJKA 4MYCA 3OZVA 4F72A 3GDHA 2GPTA 4IDQA 5IH7A 3BE6A 2NUAA 2FPKA 2O1SA 1U2RA 4EO9A 1JKIA 5HW0A 2QTLA 1QGUB 1RRFA 1KVUA 1XJ5A 4F06A 1E2QA 3GZTB 3GEGA 3LT5A 4LEIA 5I01A 3BGIA 1NULA 1PX2A 2IODA 4WK6A 1U0GA 1MPTA 1V6CA 3TZEA 5DXJA 4QA9A 1TM3E 3KEMA 2BN4A 1LJUA 1BWPA 2QX4A 1J25A 1NLZA 1FXSA 4QJ3A 5P8WA 3W8FA 1JJBA 2QI9F 1DX4A 1DPFA 3GFFA 3AP3A 1V8PA 2YW2A 5B6IA 3TEFA 1IEQA 5AW7A 6PFKA 2QQFA 1O2DA 3OO0A 3B1FA 2JLUA 5F3WB 4PCVA 4Z9YA 1UBUS 1U5AA 1GKUB 1VE9A 2P9JA 2IKSA 1H4VB 4P4GA 1JR2A 3FCYA 1ZIPA 3CV3A 2PEZA 4PZCA 3F98A 3QQPA 4E7OA 4F96A 2QRVB 2PL9A 2PD6A 1AOXA 2F43A 3ER8A 2Q45A 1YRHA 3PIIA 1Q1BA 1VE6A 3BC1A 4ZDKA 2CLLB 1WTCA 1OYYA 3I1JA 1WB6A 5K3DA 2J3IA 3UJPA 5KJ1A 5TIIA 4D25A 3FLMA 1YC5A 3HXLA 2HLNA 5KTYA 3VSBA 4EPVA 3N2GB 3ICQB 2RMKA 2J6BA 3A4TA 3CNNA 3QNMA 4P22A 1K4YA 5FFMA 5BNFA 4ZMSA 1JVBA 4A8PA 2WBLC 3H11A 1EVZA 2X1VA 1FYEA 3HDGA 4OPMA 5C4IA 4TZKA 4ZAGA 1EPUA 2OYRA 3KEFA 4O02B 3Q7EA 2G5CA 5K0LA 5DLPA 1PU2A 4GLLA 1KZHA 3X44A 5LZ4A 1JMKC 4QNMA 1Y6RA 1G2IA 4YFYA 1I36A 4ABTA 2J85A 1RKVA 2R8OA 2VT7A 5AW4A 2J0SA 4IILA 1D3AA 5C8DA 1UPTA 2NU9B 2EYUA 3DCIA 4Z8YA 3VTFA 1VI2A 2J9FB 2EATA 5BOSA 2J0VA 1OH8A 1R4ZA 4KNVA 4MRPA 5JI2E 1R6VA 1R0YA 4XCVA 4ZEOA 3WK7A 1XQ9A 2R6R1 5G3ZA 2CKMA 4CI0B 1HKHA 5A06A 4FHCA 3R5TA 4XIIA 2WW8A 3DFZA 1P2GA 4TV8A 4BFCA 5LR6A 1HDGO 1HDCA 2Q3LA 4BV3A 1EJ0A 5EWJA 3FPSA 4DUYB 3WK9A 1W2GA 4C3VA 2V7BA 3ONDA 3BBLA 4C7JA 2GK6A 4Q66C 5F5NA 3WAKA 4RJKA 2ZT5A 2HV8A 4XQEA 4M7WA 4DT1A 2C92A 2PN1A 4TYPA 1YZKA 1VL0A 4HJRA 1ABEA 2WHRA 4P6VF 3KSBC 4MB2A 1N5KA 3MWDA 2OORA 1T6NA 1K6MA 1IRXA 4HY3A 5EPEA 4DC0A 1H2ZA 3KSAC 2EKPA 3I9JA 4CM5A 4MV7A 4QC2A 1UBLS 5AQ1A 5SY6A 4YCLA 4GDFA 4GI3A 2V8BA 2I4TA 2Y6UA 3LY7A 3L2OB 1OU0A 4I1VA 1LDBA 4GR4A 1X7ZB 3FNEA 1NYTA 3QOFA 1VYUA 2AQ8A 1EFPA 1GV1A 1P7VA 2JKZA 2QN6A 2XCQA 4IQ8A 1DAMA 4LK3A 4TSFD 1S2GA 2ZP1A 4ZCLA 4N9WA 4WH0A 4NBLA 3KKQA 1YQUA 2E6KA 3PVZA 2BGRA 3F6EX 4ZT7A 6GPBA 1G8AA 5EJAA 1KPGA 2WVJA 3W2GA 1XJWA 1N6LA 5K09A 4J91A 1DAKA 2HT1A 5ICMA 2A30A 3O83A 1SRRA 2C03A 4KK4A 3VTKA 1Y7IA 3ZZ1A 2W8BB 4R0NA 4ZFNA 3EG9B 5HE8A 2XX3A 4C6HA 5JY6A 2OB2A 1KDZA 3LUBA 1HYQA 4BYMA 3IAM6 5EIWA 5H83A 3D6UA 5F33A 4UBLA 4OHKA 3QYFA 4KV9A 2W2PA 5CDUA 4M54A 4P3OA 2GXAA 1FFXB 4S1VA 4HTFB 3PB3A 2JB9A 1ZCAA 3V48A 4D57A 4GMGA 5JTUA 3AIOA 1AE1A 4NOJA 1A9OA 3IE0A 4OAOA 2CVOA 2GF0A 1E9BA 3H3FA 4J1TC 5EE0A 1M1NB 3AM5A 1MB2A 1FP6A 4AZ0A 5AWFC 4CMIB 4ACBA 1ADFA 4BGUA 2I4NA 4RV9A 1NVWQ 4D3ZA 1YCGA 2AMVA 1V71A 3COWA 2VAXA 1QHSA 3O73A 1AQNA 2IX3A 3K1YA 3MJFA 4EI2A 5FOQA 3PUJA 3W79A 4DLLA 4HAWA 2IH5A 1X7GA 3WMRA 5K8IA 1NN0A 1IWBB 3P9IA 4MV0A 1GZ7A 2VF2A 3D6FA 4IAOA 1JSLA 4CV1A 1IY1A 1E1CA 4DY4A 1W76A 3RS9A 2KYRA 2Q1UA 4TYYA 1ZN9A 3JQGA 1OBVA 2FPUA 3CCFA 2XAUA 5A3QA 4K26A 3COJA 2EF1A 1J0DA 2FPIB 4G8CA 4MWSA 4UUQA 3DZ8A 3MWEB 4Y1FA 3HP4A 1DAGA 5LU8A 2WVAA 1E89A 5CDTA 2A0KA 3B1KA 4BV9A 4J94A 1C80A 1CUEA 2ZSIA 4KHZA 5IAAA 2PMDA 2XZPA 3QLVA 1MVLA 4M37A 5K01A 4NCJA 3MA0A 4OY3A 2VNJA 2G9NA 4EKDA 1O0SA 3T54A 5KAPA 1S4MA 4NKRA 1F1JA 2H07A 2VAPA 2WZCA 3ZLJA 1R8SA 4CL3A 4WJZA 2ZIGA 1NG1A 2PLAA 2MR6A 3I0ZA 1WXXA 3R44A 4NY1A 2BFOA 2QD4A 1SZJG 2WWWA 1P31A 3RVPA 2P8SA 3L77A 5AVRA 1N34B 3W4JA 3CF4G 4EVIA 2C97A 4QVIA 2WM9B 4QXAA 4ETIA 1UJ4A 3HN2A 3U0BA 5AK0A 1KEUA 1RYHA 1MC5A 1T2NA 3VKUA 2PUVA 2O0HA 1MO5A 3OIVA 5C5IA 2B8JA 1N57A 3GZJA 4DUGD 4CJXA 1F0NA 3FSJX 3IOMA 1KAGA 3P45A 1AB5A 1JR3D 4DQKA 3AUKA 1R15A 3QVMA 4DNPA 1TJ3A 3CW2A 1Q2UA 1WMFA 4M9RA 3ASYA 2R7LA 5FOVA 4NAHA 4UARA 4QYMA 3U37A 4UNNA 3H6KA 3TLJA 3KWLA 2LW7A 2QZ4A 3TQRA 5C1PA 1T6XA 3EDQA 3JQCA 1ID1A 1XRRA 2JI4A 3G23A 2ECOA 2QTCA 3IEUA 4M1SA 5JASA 1JAZA 5JNTA 2EZTA 3U7IA 2GERA 3TW4A 1Z88A 3NNSA 1G55A 1JDJA 3F97A 3PXDA 3EZ2A 3GEMA 4AI6A 3FNIA 3BL5A 2QJTA 3FCSB 2G0TA 3FVWA 1FP2A 1IONA 2X0KA 3H05A 4GECA 1KKLA 5KOHB 4IX9A 1YSCA 3VOAA 1LXCA 4KAXA 1P1FA 2Z4RA 3VZCA 4BTEA 4E21A 5CG2A 3EIFA 2VH2A 2H4FA 4NMLA 1NZJA 3KEGA 2WABA 4DM4A 1XYYA 2MOKA 3LV8A 3ZK9A 4ZT4A 4G07A 4UOZA 3REQB 3IRUA 3NKVA 1GQ2A 3PC6A 4LHWA 3LC1O 1KQFA 2IZZA 4J0FA 4HGYA 2VSQA 4LJ6A 4CN9A 3KEOA 2VRNA 4N3GA 4QJ5A 5KVQA 3O95A 1B3RA 3GNSA 2GCIA 2HWUA 4OI2A 3AR2A 4CLOB 2EV9A 1GUAA 4E2FA 1ZJWA 5IAGA 4RCZA 2XRYA 3PWZA 3RVOA 2ZIEA 3UG6A 5CBPB 1DTWB 2W6IA 5CLFA 5L7TA 3ZU3A 3CKLA 2JAQA 3VU8A 3WYCA 2R2AA 2CEKA 2IY7A 3EVZA 1MB9A 4IIEA 2KX7A 3DKVA 3T99A 2AF4C 2I3ZA 2I1WA 1JDNA