4JBHA

2.2a resolution structure of cobalt and zinc bound thermostable alcohol dehydrogenase from pyrobaculum aerophilum
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
333
structure length
333
Chain Sequence
HEMRAAAFSTPGLENLKLVEAETPRPGPGEVLIRVKYAGVNPLDYNVVAGAVKASPMPHIPGSEFAGVVEEAGPGVTGVSRGDPVVVYNRLYCGHCRQCLTGWTQMCEVTGGGIIGIVTQGGYAEYAVVPAKNAVATRADLKEAATLPIGALTAWNMAYRASISPGEKVAVVGATGNVGIYAVQFAKLLGGEVYAISRRKAKVESILKSAGADAVLTPDEAKSAAPFDVVLDPTGSASWDLSFGVLGRGGRYVTAGALTGAEVRLDLRRLYGMQILVIGATGGRRADFNTVVRLLEAGRIKAFLHNVYPLADVRKALEELRSPERVGKVLIAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Alcohol dehydrogenase (Zinc)
publication title Physicochemical Characterization of a Thermostable Alcohol Dehydrogenase from Pyrobaculum aerophilum.
pubmed doi rcsb
source organism Pyrobaculum aerophilum
total genus 100
structure length 333
sequence length 333
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2013-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4jbhA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4jbhA01
2VN8A 3AY3A 3FSRA 3ENKA 1LEHA 1FXSA 2B69A 3H9UA 1VKNA 4FFNA 3ZHYA 4AJLA 4CMIA 4DPMA 4WCDA 5JBIA 1H6DA 1PJSA 2VCYA 4CLRA 1XHLA 4I9HA 3WGOA 3MJ4A 1ENOA 2G1UA 3IAHA 4I5DA 3PEFA 1OMOA 2BFOA 3IP1A 4FIZA 1U7HA 2C5EA 5ILGA 4GL4A 4BV9A 1I8TA 2OP1A 2WE8A 3QW2A 3TRIA 5IDXA 2Y1FA 4PLVA 1PWXA 2VWGA 4IJUA 1GZ3A 1NR1A 2NADA 4JJFA 4Y9DA 1FMCA 5ER6A 7MDHA 3H65A 3JD3A 3ZW8A 3AWDA 4BO2A 5CHEA 3K9QO 1KY4A 3ZWVA 3V2GA 1ZSVA 2VRBA 1KVTA 4FC7A 3ZHZA 2HMVA 1Y8QB 1Y5MA 3D1LA 2NVUB 4HADA 1QRRA 4XCVA 1Q0QA 2HQ1A 4S3MA 4ND3A 1XR3A 1TA4A 3LDHA 1XKQA 4GWKA 4OQZA 1DLIA 1QYVA 1E1KA 5COBA 1Y8QA 4JJIA 2NVUA 1T2AA 3BMOB 1GCOA 4AJ1A 4CMCA 3C8MA 4TRMA 4J2HA 3K8ZA 3DZHA 5JY6A 4J1TA 2EWMA 4IDCA 4H16A 5A3JA 4O6VA 4XRRA 1T25A 2BGLA 2J3KA 3SC4A 1BDMA 1I2BA 3SJ7A 3Q11A 3BMOA 1WZEA 2GRAA 3FWZA 3GUYA 4FD3A 2VTDA 3ORFA 1HLPA 1I36A 2BFPA 3RBVA 2BHLA 4Q3AA 1DHTA 2J8ZA 2IZ1A 4UEOA 3OP4A 3OETA 3CZRA 5EMHA 3I3OA 4UEKA 2F1KA 4ND1A 3MTJA 5KVVA 3EUWA 5TF4A 4E33A 3T7EA 4BGIA 3I83A 3DBVO 3FN4A 3F5SA 3QSGA 3GGGA 3M2PA 5LDHA 3G3EA 2ZQZA 4BKPA 3PHJA 3DHYA 4II2A 3MJCA 4M49A 1R15A 4NR0A 4JP2A 4XRGA 1D8AA 4OOEA 5KJCA 1P0FA 3BXXA 4IJWA 1XQ1A 3C85A 1Y8RB 5DBGA 1JKIA 5JW6A 1K6JA 3DEYX 1PS9A 2OMEA 4Z0HO 1KVRA 5JO9A 1MFZA 1PS8A 1NFFA 2JCYA 3GNQA 2IZZA 1HXHA 2P68A 1MXFA 4PLHA 3EW7A 4KDFA 1DRUA 1ZW1A 2Y68A 3PGJA 3JQAD 4B8WA 4KUHA 5JAIA 3CPSA 1VPDA 2IRWA 1N1EA 4Q3NA 3INRA 4OIMA 4FCCA 4N18A 3T4XA 5U9CA 1NPTO 2H9IA 2EJWA 2Y93A 5ITVA 2OOSA 2OUIA 4CUJA 2IEBA 4K28A 5TLSA 4BO9A 4JGBA 2HK7A 2C0CA 4FJ0A 4PLGA 1U1IA 4QEDA 2PZKA 1WMAA 4NBUA 1QKIA 4WGGA 2I76A 4GVXA 3ZU2A 4ZJUA 4J9UE 3RD5A 5U1PA 4KWIA 1OC2A 1ZEMA 1HDYA 2VYNA 4YEDA 4RPGA 4B79A 4D42A 3VDQA 1DRWA 1Z73A 2BFAA 3VZSA 4JXKA 2HO5A 7ADHA 1KC3A 1HE4A 3AOGA 4DLAA 2J3IA 3RJ5A 4FFOA 2P4QA 4Z9YA 4NBTA 3WIDA 1DFGA 1VL0A 1CJCA 1C0PA 4NI5A 4YT5A 5GZ6A 2PNFA 2D0IA 3OJOA 1HDXA 5TS3A 4RV9A 4WEQA 4HNGA 1GYRA 1UXGA 1Y9EA 3ZCXA 2PH3A 1BMDA 1O95A 1E6WA 4L0QA 1EZ4A 2EHDA 1YOVB 1C0KA 3VC7A 4R1UA 3RWBA 2AG8A 4MINA 3U4DA 1XDWA 2PD3A 2HMWA 2DTEA 2F00A 1E3EA 1A7AA 3OJFA 4GWGA 4IQGA 1PL6A 2I99A 1WPQA 2VYVD 1ONPA 1YOVA 1M6WA 4TRNA 1JAXA 1PU2A 2WWRA 3WMWA 5JDIA 3ZN2A 1IZ0A 1LDMA 1G0NA 1VL8A 3UH1A 4CMEA 2R2GA 2DBQA 2XPCA 1MUUA 1OFGA 3UW3A 1T2DA 1BXGB 3BYZA 3I4FA 4BMVA 3ASVA 2V6FA 2EKLA 4XX0A 4B4UA 1BDBA 2D59A 4BNLA 3R0IA 3FI9A 4LVUA 3X2EA 5K6AA 2FZEA 3SLKA 2DFDA 4J3FA 4HFNA 1BXGA 1UR5A 1YWGO 1A7KA 2FR8A 1PJLA 2W4QA 4TROA 1NPDA 4OSPA 1QV6A 3L4BC 3AI3A 3RJ9A 1CWUA 1GU7A 3MJEA 4FS3A 2C82A 4TWRA 4E30A 3MJSA 1H6CA 2X58A 4RF5A 3RBZA 4GSKA 1ISJA 3CTMA 3LC2O 4R9RA 1RYDA 2XOXA 3OICA 3DBRB 3GVXA 2CF5A 3DONA 3IOYA 3P19A 4U0JA 4CQMD 3L9WA 4GVLA 3NGXA 3ZU5A 1H0KA 3VPXA 3R6DA 2X9VA 3KLPX 1I3LA 4Y67A 5FI3A 1SOWA 2QQ5A 2HK8A 2VWQA 1PZGA 3GOHA 5A3VA 3S2EA 3UFXA 2C7GA 4CUZA 4D79A 3DBRA 3H7AA 3GR6A 3PHGA 3WGGA 1YB5A 2Y0EA 3FD8A 3U09A 4YXFA 1I32A 3V1TC 4E2YA 1KEPA 3O38A 1NVTA 3OA0A 1XELA 4PZEA 1A4UA 3DHEA 4BNXA 3Q3CA 1PZHA 5IXSA 2R00A 1R0LA 3QVTA 4NQZA 4D43A 3GRKA 4CL8A 3DFUA 5IDQA 4J1QA 4XWYA 1X1TA 4XR9A 4R3NA 4J7UA 1V3TA 1YXMA 5TJHA 4A2CA 2Y0CA 1E6UA 1CF2O 3GY0A 3HUDA 4TRJA 4D3FA 3ZWOA 1AGNA 1V3UA 3W4IA 4BS9A 4MVJG 1IL0A 1WDLA 2H63A 5L95A 4Z0TA 4J43A 3FNEA 3U4HA 3GZ4A 4II3A 1UP4A 3EHEA 3JD4A 4RPLA 4N5NA 4EJ6A 2X0JA 3DZGA 4B7CA 2G5CA 2J3HA 4XIYA 1YQXA 2AEJA 2NV6A 1SB9A 2HRBA 2B36A 3B20A 1RKXA 1HDRA 1GUZA 1KETA 1N5DA 3CH6A 3INTA 4Y6SA 5HBRA 3UHAA 1YO6A 1PJ2A 4HKTA 3E6AA 4IS3A 1EVIA 1Y6JA 3VKVA 1ENPA 1KOLA 4L75A 3DMTA 4WNCA 2JAHA 5HRUA 3AM4A 1IYZA 3PJEA 1H5QA 4YDRA 4OL9A 2CF6A 3RUDA 3WB9A 3PWZA 3ANLA 2AQ8A 2GSDA 1FF9A 2JHGA 5F1KA 1R66A 4B3IA 4L74A 5A5FA 4EDFA 2VZ8A 3L4SO 5I7EA 1GV0A 1QP8A 3PHLA 1DIRA 4QT0A 4BKQA 5CFZA 4B7UA 5DP2A 1SAYA 3MWEB 1ONNA 1NVGA 1DEHA 1PSDA 3OQ1A 3OECA 4M54A 4EBFA 3JYNA 1QXSA 1BVUA 3O8QB 3G17A 4U5QA 3TSCA 4A27A 1T2FA 3JSAA 5IF3A 3PDUA 2IE0A 4I5EA 1DO8A 1B3BA 4G2NA 5JSFA 3WQRA 2ZQYA 1NTOA 3G49A 2DTDA 2PKRA 3O8QA 4BO8A 3I52A 3ZNQA 1ZO8A 1X7HA 3I4CA 4CMEC 5A06A 2Y05A 3WWYA 1NVMB 1CIVA 1XIVA 3RFXA 4IDDA 1V0JA 3QRWA 3V8BA 3TZCA 4DVJA 1ADGA 2EW2A 4KUEA 5K6AC 4XEHA 1DIAA 2AA3A 3NV9A 1G1AA 3AFMA 4JCOA 4MP3A 2PK3A 3AI2A 3VH4A 4UREA 1VKOA 1LDGA 1J4AA 4BB5A 4A5OA 1CEQA 3GMDA 4J1SA 1O9BA 4K1LA 1TVEA 4CM3A 2HJRA 1HETA 3ZZNA 5JYDA 1OI7A 4CM4B 1ISGA 3LVFO 2ZTMA 2RHCA 3ENNA 5TQVA 2WD8A 1Q7BA 4L4SA 2B5WA 5DBIA 1M75A 4WJZA 3CE6A 3TFOA 2PD4A 3ROPA 4K6CA 3V1YA 1R6DA 3WFIA 4CM4A 1F8FA 3D4OA 2YFHA 3MOGA 3AUSA 1H2BA 3Q1LA 1UDAA 3HFSA 1A71A 1DXYA 2I5PO 5K0ZA 3DMYA 4IJVA 3P5SA 3O9ZA 1PL8A 2DTXA 5L4SA 1N8KA 2VT3A 4PRKA 2WMDA 2FHSA 2NNLD 2B37A 2GLXA 3ZWBA 5JC8A 1YGYA 4RGBA 5H83A 2ZTLA 2WM3A 1L7EA 1U3WA 2FPPA 4N7RA 2PGLA 1M2WA 4RL6A 2EG9A 4JNKA 3HQ4O 2NQ8A 3IUSA 3LF2A 2WYWA 4RO0A 5HS6A 1V35A 2OP0A 2NACA 3A4VA 2NM0A 3C7AA 3ZNPA 1DC3A 1JKFA 1YJ8A 3A14A 3AW9A 2PZJA 1PJ4A 4M89A 4BMNA 2DFVA 3O26A 1P33A 2NQTA 3ANNA 1EUCA 4XJSA 1KVQA 4GX0A 2DLDA 3R3SA 1GEEA 4MOWA 5CEFA 4Q3BA 1PR3A 2BMAA 1H94A 4P22A 4AL4A 1HYEA 2V6GA 3OIFA 2A9FA 5BR7A 3GFBA 3PQDA 4IIVA 4XQEA 3ZHBA 4TKMA 1ZSNA 4DRYA 3TDKA 2JL1A 1U28A 4J1NA 5L45A 1DBVO 2HLPA 4OQYA 5LCXA 4E5KA 1MGOA 3QVWA 4WEOA 2V65A 2GN4A 2YV1A 3W4KA 2I6TA 2QHXA 1HE5A 4IGFA 2QZZA 5TNXA 2GGSA 4FPXA 4ZQHA 4DMMA 4OHUA 4Y98A 4PVDA 1CYDA 2DT5A 2EGGA 4HFMA 2PKQO 2EW8A 3WGYA 5HM8A 4IDFA 2O3QA 3GDOA 5EIOA 4TMFA 2G0TA 3LZ6A 4C7KA 2Q50A 2FY8A 2YDXA 3DMTC 3HE3A 2AE2A 2V6MA 3D4PA 4WASA 4EYEA 1LSJA 4RPJA 4UVDA 2ZB7A 1RYEA 1HTBA 4UULA 3N58A 3U3XA 1LLUA 1YBMA 1FDUA 2QRLA 4IZHA 4X54A 2GN9A 3ZV6A 3DXFA 1ORRA 5JYEA 3ABIA 3EMKA 4XD2A 3ZV5A 3MOIA 4EZBA 4MVJA 2CY0A 5EINA 3OEYA 3GRPA 5F1OA 1EE2A 4OXYA 4Q9NA 4KQXA 4KUGA 3T7CA 1HRDA 2ZTUA 3GNTA 3U4IA 5JDCC 2PGDA 3ZW9A 4XDYA 4BB6A 2X5JO 1QYXA 1U3UA 1VM6A 4K6FA 3QVOA 1K0UA 4XGKA 3FNHA 1ZMTA 3SEFA 2UUOA 4W7HA 4BNTA 4AJEA 4CMGA 1ADBA 1EQUA 1T26A 2Q1SA 3LT2A 3SXPA 4F46A 1U5AA 4KWHA 3ZWMA 5JAZA 5GY7A 1XQ6A 4WNIA 1RM3A 3DBHB 3RQSA 5DN9A 2QZ9A 1KEUA 1X15A 1PGPA 2YQ4A 5FF9A 1X0VA 3JYLA 5CG1A 2JKVA 5H82A 6LDHA 4BO3A 4OSOA 3WX0A 1DJNA 5JPIA 1YBAA 3DBHA 3OFSA 3CEAA 5AOVA 2QYTA 3SBOA 5DNAA 4B7XA 4WLVA 1Z74A 4ALLA 4YT8A 3A06A 1VJ1A 3VVBA 2ZKLA 4HXYA 1GD1O 3MZ0A 2IYOA 3IKVA 1PQUA 1YDWA 4RVFA 4UVIA 4UVGA 3RC2A 3ZWAA 3CINA 5L7TA 5CDGA 3GT0A 2H6EA 2IZ0A 2X9GA 4IMPA 3CMCO 3TOZA 4RVUA 1FJHA 3M2TA 3CKYA 3WGHA 4B4OA 2V6BA 5TGDA 3AU9A 2WD7B 5CP8A 4Z6KA 1MC4A 4UEJA 3AOEC 4E32A 3VDRA 3HDJA 4NHEA 3JD0A 2PWZA 4RVHA 4QTZA 2GUGA 1BXZA 4L4XA 3ZV3A 3QHAA 1YDEA 3WOHA 2RHRA 1MV8A 3ITDA 1RWBA 2AQHA 3ZV4A 2WD7A 5G2OA 4MVJH 2YZ7A 4CR6A 2RCYA 5T57A 1UXIA 5I7VA 2VUSA 2FMUA 4R41A 4XJTA 3RASA 3FR7A 3H3FA 4PN3A 1TEHA 4BO1A 2VYND 3Q6IA 1H9BA 1P74A 4RF4A 3HB4X 3O03A 3R1IA 1X7DA 4I8XA 1HDZA 1I33A 5BQFA 2Z5LA 4K9DA 1EVYA 1IB6A 1KEVA 2QIOA 4R4JA 3JTMA 3SLGA 1HYHA 4ZGWA 1UXHA 5KJ6A 1RM4A 4H15A 3WGIA 1DC5A 4NNJA 4EEXA 1UP7A 4O5OA 4TRRA 5COQA 4RORA 4M8SA 3I9OA 1P9LA 4E6PA 3JQDA 4OAQA 1DRVA 2CSUA 4IDEA 4KP7A 3GAZA 4TQGA 4XQ9A 3ZH2A 1EQ2A 4I08A 2Z1MA 4B4WA 4E31A 3ADPA 5JAMA 3FCOA 3KZVA 5BNTA 4RF3A 3BMCB 1IY8A 3GEDA 2H1SA 3VPHA 2BI7A 4GX2A 1PZEA 3K5PA 2GERA 5JCJA 3D0OA 2CNBA 1KEWA 4C7JA 1DFIA 1LRLA 1XA0A 3DAPA 4ZA2A 2QG4A 1HF3A 5A03A 2P9CA 5MGBA 1SZJG 3PQFA 4U6QA 1MG5A 3BMCA 1ZKMA 2DBRA 3KSDO 5G0WA 4ALKA 4BGUA 4FFMA 2X0RA 1KC1A 3ETGA 2EF1A 5MDHA 4B3JA 3DOCA 3RVDA 1O89A 1HE3A 4KDEA 4DC1A 1U8FO 1KYQA 3L77A 4W9NA 1JQBA 3EY4A 3FRJA 4U6SA 3GHYA 3JQCA 4YJHB 1BW9B 5T64A 2VHXA 4QECA 1E3WB 4NG5A 1DB3A 5A1TA 1E3IA 5KKCA 3OEWA 3TNLA 3OH8A 4U8GA 1C0LA 4ALNA 1P1KA 1E7MA 4C4OA 3PHHA 4PIVA 2JFHA 4A7PA 2P9EA 1DIGA 2AE1A 1LQTA 2HAEA 3KSUA 1EDZA 4P4LA 1BW9A 5T6BA 2AEMA 3M1AA 1E3WA 4PLFA 3TZ6A 5CDTA 1NR7A 2HKIA 2TMGA 3Q9UA 4GBJA 5FI5A 1ZXBA 1YE3A 2PGJA 1Y9AA 5TIIA 4ZQBA 5CDSA 4D46A 2IXAA 1Q1NA 4HV4A 1ZSYA 4E5MA 3U62A 4Z0PA 1PGJA 1GQQA 3AFNA 2JJYA 2VNAA 3EDMA 5KKAA 3WNVA 3PZBA 4ZD6A 4LSMA 2C7VA 4YYZA 4BL5A 5A9RA 1NM5A 3E1KA 4NU5A 3WBBA 4YWJA 5AXAA 3Q0EA 2FRDA 1TB4A 1ZK1A 3JQ6A 2OL4A 3MWDB 4WLEA 5F5LA 3ZU4A 3Q2KA 2YQ5A 4W82A 1JU9A 1P1FA 5DOZA 1BHSA 5EQDA 1C1XB 1D1SA 5T67A 3BA1A 4BOYA 1VE9A 3TZQA 2WDZA 1F0YA 2Y66A 2X4GA 5FWNA 2VT2A 2Q1WA 4FDAA 4BNGA 4FOOA 1ZK3A 4R51A 1C1XA 5J23A 5KJEA 3SX2A 5B4VA 1GTMA 4N5LA 1LRJA 1XU7A 3DL2A 4NFYA 2EP5A 3L07A 3IUPA 4CPDA 3QA9A 4O0LA 2Y0DA 4WPGA 1Y8RA 3OHSX 5DOVA 4I5FA 5FEUA 2P9GA 3WQQA 4TZTA 2CVQA 4MKZA 3N74A 2NTJA 1E7RA 3GZNB 1QYWA 4HFRA 1JW9B 1L7DA 3PVZA 4DPLA 1H93A 1GQ2A 1I5RA 4BKOA 1PJBA 3OIGA 3WTBA 1VL6A 3QE3A 1T1SA 3GZNA 5I9LA 2UYYA 1W4ZA 3DQPA 4XZ3A 4QFCA 4DTIA 5C37A 3OJ0A 4YVFA 4NPCA 3TQHA 4AJOA 3JQBC 2OFPA 2A94A 2UDPA 3WIEA 1LDEA 2RH4A 3QV1A 3TL2A 2X86A 3DB2A 3LC7O 4FN4A 3DC2A 3I9NA 2V7PA 5L4LA 4PLYA 1JVSA 3WSWA 3V5NA 4DC0A 1G0OA 3HJAA 3ICPA 1E77A 1XG5A 3W6UA 4R5HA 1A9ZA 1Z7BA 1PJQA 1X1EA 4ZICA 1T2EA 4GAEA 3F4BA 4PG4A 1D3AA 3GDFA 4MP8A 2X5KO 3BIOA 3D64A 4INAA 2HCTA 4L4RA 1AHIA 3RUEA 4HNHA 1NPYA 3E8XA 3KB6A 4YCAA 4JX8A 4P4NA 3CIFA 4AJPA 3RC7A 2Y1GA 2ZCVA 2B83A 2GN8A 3E82A 3GNSA 4TVOA 1R37A 1B15A 4I9NA 3KYDB 3QWAA 4J2OA 1T4BA 3ROKA 4JLWA 4CM6A 5TX7A 2RIRA 1YL7A 1VJ0A 4PG7A 4J7CA 1ADCA 4XDZA 5G0SA 3WICA 3TL3A 3WG9A 5CAEA 2RH8A 3KYDA 2XF8A 1D4FA 4G65A 5KJFA 3NT5A 4NZ9A 3VH2A 5C3MA 1E1MA 2HJSA 2Q4EA 3F9IA 3RUIA 4YA6A 1K6XA 3PJGA 1FDTA 2NTVA 3QQPA 3STHA 3PYXA 3B1JA 1GY8A 1ULUA 2ZIZA 1E7SA 2VQ3A 1C14A 3E9MA 4R9SA 4IBOA 1BTOA 3C7DB 4OJNA 2P4HX 3IMFA 4YR9A 5F5NA 2EERA 1B0AA 1WP4A 4BO0A 2I67A 3ZHXA 2VZ0A 3AK4A 3I6QA 4UVHA 3WS7A 1MFPA 1H6BA 1ZH8A 1E3JA 4R3WA 2VHVA 3X2FA 1R4NB 3C1OA 5I7FA 5L7WA 3NTRA 1SMKA 2O23A 3COSA 4E13A 4BO4A 2FWMX 3D5QA 3GEGA 4LMPA 4IGEA 4R68A 4CLHA 2O2YA 3S1LA 4YAJA 1ML3A 4U0KA 2Y67A 2Y1DA 5BSFA 3G0OA 1HYGA 5BT9A 1R4NA 2O7QA 4LMRA 2TMDA 4XR4A 4DA9A 3C1TA 2JHFA 4UUOA 4EJ0A 1TXGA 3HZZA 3VTFA 3KVOA 4BNFA 2O3JA 3AM5A 4GLLA 5L53A 4ESOA 1T1RA 1FDWA 3D7LA 5A02A 1IUKA 4H7PA 4ID9A 1P1JA 3U9LA 2Z1NA 1IE3A 1ZEJA 1KVSA 3GVCA 4RVGA 2ILTA 3VH3A 1ZJZA 3N7UA 2OBYA 4CODB 1NASA 2OGUA 4R1TA 2ZK7A 4NBVA 5A9SB 4XYBA 4MKXA 1JWAB 2NU8A 1SO8A 2G76A 3K2EA 3PLRA 2IYPA 1HKUA 1LLDA 4CLDA 5IG2A 4CR7A 5ENDA 2NVBA 3QJ5A 3HFGA 1ONOA 1RM0A 4AJKA 4EGFA 1YH3A 5A9SA 5GZ3A 1Q0HA 2VZ9A 3DHNA 4PFJA 4R16A 1L1FA 1SB8A 2HK9A 9LDBA 3KRTA 3GG9A 3PPIA 1SEPA 1Z6ZA 4F6LA 1MA0A 2CVZA 2UVDA 2HSDA 1DSSG 1WLYA 1FK8A 4DYDA 2DKNA 2FR0A 3QVSA 3RU9A 2G17A 1A72A 1LXCA 4IINA 3GLQA 1ISFA 2EGHA 4LW8A 3RSHA 5JO0A 1UUFA 1E3SA 1PZFA 1VLLA 2Y1CA 1YBVA 2GASA 1E5QA 1I30A 1N9GB 4BNJA 3VH1A 4QQRA 1B2LA 4KTTE 1ZJYA 5HS4A 1B26A 1WMBA 3JQ8B 5KNLA 3NT2A 4QUKA 3PFWO 5L7YA 2X8LA 5F3RA 4RPHA 3WJ7A 1N9GA 2VRCA 1WWKA 3IS3A 2X6TA 3VOSA 4W4TA 1LTHR 3LLVA 3U0BA 3JQ8A 3H5NA 2YUTA 3ONDA 4URFA 1U3VA 2X5OA 4WOJA 1ISIA 4J16A 2AHRA 2XXBA 3ETDA 1U7TA 3QY9A 4Z3KA 3H5AA 3WYCA 1LSUA 4E2ZA 3RUHA 4NFHA 3ZWNA 2IODA 3KXDA 3RC9A 3VZQA 3K96A 4L76A 1JAYA 4HBGA 4PRLA 2C5AA 3PWKA 3FF4A 5IDYA 1QYDA 3TZHA 3E18A 5EERA 2XXJA 3PQEA 4MVJD 5JMWA 3F46A 1H6AA 4MKRA 2DU8A 1HT0A 3UVEA 3GFGA 3I23A 4PG8A 4EUFA 5JDIC 1KVUA 3C3XA 1UAGA 1P1RA 1IHYA 4YAGA 3RBXA 4CV2A 1LDYA 1Q7GA 2DPGA 1E0DA 2ZYGA 3H8VA 4PG6A 5FFFA 3TWOA 4DQVA 3B1KA 1U8XX 3PFFA 3GN2A 1GPDG 4F6CA 5KVSA 1PGQA 1ZK0A 1YKFA 4IXWA 1DC4A 3RUFA 4D3SA 2GR9A 1LNQA 1V9LA 4MIYA 4J0EA 1I3MA 2POQX 3WR5A 3FNFA 3SC6A 1HSZA 3BTUA 2C54A 3I9JA 1CDOA 4WECA 4ZRNA 1W6UA 2EEZA 1BVRA 3EGOA 5IZCA 3AJRA 4PLPA 4R1SA 5HWSA 4ALMA 4BO5A 3BTOA 4UUNA 3OIDA 3WGQA 1BRMA 2RBEA 1UDCA 3H9EO 4R5MA 2B4RO 3ZI0A 3S2FA 1V3VA 2G82A 1HZZA 2Z95A 5JMPA 4E5YA 4EITA 2EP7A 3BMQB 4EUHA 3IJRA 2B0JA 2FOIA 4B4VA 1PJCA 1P45A 3I1JA 1NYTA 3L9XA 3DZJA 1K89A 4ILKA 1YB4A 3WNQA 3OSUA 3SJUA 5I8ZA 3S2IA 4OM8A 5LC1A 3LC1O 3KM0A 4DREA 1SBYA 3BMQA 1DPGA 3W6ZA 4AJ2A 1EDOA 2DM6A 1Y1PA 4BNIA 1MC5A 3TOXA 1FDVA 4XGIA 5AQ1A 2VWPA 1Y81A 1J0XO 4OKNA 2FR1A 2YHIB 1K6IA 1LUAA 1O0SA 4NU6A 1A9YA 2JD1A 2O3SA 1NAIA 3CZMA 2JCVA 2BELA 4RZIA 2R00C 1M67A 5DCYA 1I0ZA 5IZ4A 2IEDA 5A05A 4G81A 4GQAA 2YHIA 4EI2A 1EK6A 1ZZEA 2DAPA 3PI7A 3ZNOA 1PQWA 2B4QA 1QLJA 3C1AA 3OM9A 3K31A 2CDBA 1PTJA 4CM7A 2VNSA 5CDUA 2ZTVA 3PWSA 1DOHA 4WLOA 5EQFA 4WCFB 1UJMA 4Q3CA 3ONEA 2GCGA 2O3TA 3P2OA 4NMHA 4Q3DA 2VTEA 1NQAO 4CM1A 1GR0A 2I66A 2PY6A 4G5HA 3PP8A 5F21A 1SOVA 3EC7A 1AE1A 1BGVA 2VWHA 4WCFA 1EMDA 4RVSA 1GZ4A 1LC0A 1WNTA 4YT2A 4OKIA 4R1NA 5DULA 4ZQGA 5THQA 1KIFA 3BHMA 1GYPA 2Q46A 3FHLA 2AW5A 1P1HA 1ARZA 4FQ8A 4RZHA 1PJTA 2GD1O 2JD0A 3VTZA 2D2IA 5AXBA 1R0KA 3V2UA 1X13A 1HZJA 1P1IA 4YJFB 4E2WA 1NNUA 3GVIA 4ND5A 5B4UA 1LA2A 3DFZA 4W7IA 1WDMA 3NX4A 5ICMA 3QWFA 3L6OO 3DAFA 4XKJA 3ZU3A 3NDIA 4DYVA 1K2WA 4IDGA 1DIBA 4YJFA 3U5TA 2BF7A 3JQ9A 3PTZA 2P5UA 2X23A 4EW6A 2A35A 3NJ8A 4IQ0A 4A03A 4BNZA 3VZRA 3RCBA 4DPKA 4XYMA 3L6EA 2WEKA 4OOFA 3UGKA 2E48A 1N92A 1GADO 1VSUA 4DLBA 5A5EA 1PS0A 1AUPA 3E9QA 4OO3A 5EN4A 4W6ZA 2QX7A 2YFQA 4IDBA 4BNVA 4Q39A 3FTNA 4DL9A 1ID1A 3DWFA 2EIHA 4IM7A 5A04A 2H5LA 4FJ2A 1HDGO 4ND2A 3F6YA 1V8BA 4M55A 4NK5A 2BRUA 1LQUA 4ONEA 3LT4A 1NP3A 4XA8A 4E21A 4PGFA 4GMGA 1E6EA 2JAPA 4AFNA 5IFLA 4YRAA 3LU1A 2GDZA 2IDZA 4XIJA 4BO7A 4N54A 3WXBA 2DVMA 3GF4A 2VHYA 1LI4A 4IZIA 3W8EA 4JBGA 4CMBA 3PIDA 4XQCA 3KOUA 5ITWA 1EFKA 1UZLA 2Q1UA 1GZ6A 4OGWA 2Y99A 1NAHA 1OC4A 2D5CA 2UUPA 4XGNA 4FFLA 4D7AA 4CR8A 1ZK4A 3KYCB 2GF2A 4HX5A 1I10A 3U49A 4EUEA 4AG3A 4IQ8A 4AJ4A 4MIOA 2QYSA 3GUCA 4GMFA 2NUAA 1QMGA 4CQLB 2EV9A 5B4TA 5C5IA 4CV3A 1E7WA 1P44A 4MPDA 3OF2A 2C29D 2PLAA 3INGA 3KYCA 4CMAA 4RF2A 2O2SA 4YQYA 1VJTA 5ER9A 5F1PA 2O7SA 3H5RA 4CUKA 1EEHA 3I5MA 5ILOA 3IL2A 4CQLA 5JAQA 3KO8A 4KMSA 1EFLA 1MXHA 3HN2A 3OBBA 1Q7CA 3K73O 2GPTA 4IDAA 5L9AA 2P2SA 3QVXA 1C3VA 1JLLA 2FZWA 4GPD1 4NJMB 2Y1EA 3KEOA 4Z9FA 5LDGA 4DQUA 1IOLA 1F12A 3AM3A 4BNKA 2BH9A 3GGPA 3U4CA 4GKVA 2AEFA 2IXBA 2EJVA 4NJMA 1W0CA 2O4CA 1EK5A 4Y8VA 1CRWG 1W8DA 2WSBA 4YRBA 1E92A 1P77A 1O8CA 2X7HA 3JQ7B 3ST7A 4JIGA 2ZCUA 5ADHA 5IJZA 5KIAA 2NU6A 2J5KA 4LN1A 1LDNA 1JWBB 3HG7A 2WE7A 3NJ4A 4EEZA 4D0RA 4BQRA 3MCVA 1O94A 4GKBA 1MX3A 5DZSA 3PHIA 3JQ7A 4WOKA 4J7XA 1DAOA 3B70A 3NGLA 1PIWA 4D41A 4O1MA 2Q2QA 4MO2A 2GZ2A 3PYLA 3LK7A 3H3JA 4PCVA 1LDBA 1PR9A 4QFDA 3ZWYA 3PLNA 3I6IA 1UZNA 2E82A 3WLEA 1E3LA 2BD0A 3E03A 1YL6A 3IQDB 4WCFC 4FW8A 4RQUA 2PD6A 3WGTA 2C59A 5HTOA 1N1GA 1B14A 1YQDA 2AG5A 3ICCA 3NDRA 3WQSB 3D3WB 1R16A 4HUJA 1J49A 4P38A 2GNAA 2GZ1A 1IPFA 4NJOA 6ADHA 4IJKA 3ZWPA 1R12A 3MJVA 3GGOA 1PX0A 1HE2A 2P91A 3LYLA 2RAFA 4HP8A 4YACA 3ZWCA 1CQJA 1EVJA 3D3WA 1HEUA 4MVJE 2YJZA 3QWHA 2W90A 3TN7A 4NH4A 3VPSA 4N5MA 4JK3A 4FR5A 3DAGA 5TRTA 5I8WA 3JQ9C 1DIHA 3QWIA 2Q2WA 1JTVA 1ADFA 1MLDA 1QLHA 4BNWA 3GQVA 1XU9A 3VZPA 4YJHA 3OJEA 1K5HA 2OXIA 2HU2A 4TVBA 5K1SA 3L4BA 2VOJA 4JQCA 5TSDA 4CM8B 2VHZA 1H9AA 2BKAA 1LSSA 2D1YA 1U4OA 2ZJ1A 2P5YA 1C1DB 1D1TA 3A1NA 4F3YA 3F1KA 3HDYA 3K92A 1NFRA 5I7SA 4AJHA 2O50A 1PQPA 4J90A 3EZLA 3KYBA 3ON5A 4CMJA 3JCZA 3P2YA 1P31A 3W4JA 3OQ6A 3I9MA 4MP6A 4E2XA 3AUUA 4L73A 1UAYA 4CM8A 4CL3A 3WYBA 2CDCA 1C1DA 4I5GA 4BUCA 2A4KA 3TPCA 1GYQA 5CPFA 1M6HA 2O3RA 4W99A 1Z7EA 2ZB8A 3H9QA 2DC1A 3Q2IA 1ISHA 2W2LA 1QV7A 5L51A 1B8PA 5C7LO 1IULA 2QRJA 5THKA 3BZUA 4XYLA 1ZFNA 4L9RA 3UN1A 5G4KB 3WSVA 4GX1A 4M86A 5FYDA 4IXTA 2WTBA 4A0SA 1JKJA 3NRCA 1HSOA 1WW8A 4RPKA 3CXRA 1NWCA 5TC4A 4BNHA 2DPHA 3FNGA 1YONA 5G4KA 5EPOA 4CV1A 1MP0A 1F17A 4ZVVA 4WLNA 1P0CA 4NDNE 1B7GO 4QXMA 3DZBA 3ETEA 3GMSA 4ZHSA 1U5CA 4OYRA 1JVBA 3VVCA 4ALIA 4CM9A 2Q4BA 1HLDA 1I01A 5JE8A 3DOOA 2WYUA 1BXKA 4IUYA 2O3UA 2QRKA 3T4EA 1XSEA 4LRSB 1EE9A 4BQPA 3AI1A 3E5RA 3EVTA 5A9TA 5IAAA 3LQFA 4NIMA 5DBFA 3JD2A 2Q2VA 3NAQA 3JYOA 3RC1A 3NUGA 4DMLA 3VKUA 1WDKA 4E0BA 2J5QA 4PG5A 1T2CA 2NWQA 3FPLA 4RLSA 1D7OA 2PZMA 4PLZA 3WJAA 2VRCD 5BSEA 1HWYA 3JQEA 2OBNA 3UCEA 1E5LA 2I3AA 2HUNA 1B16A 3DR3A 3KBOA 1TI7A 1U9JA 1YQGA 2ET6A 3MJTA 3PDJA 3RU7A 4A10A 4D44A 2NU9A 1BSVA 3K2BA 4NK4A 4WK6A 3GG2A 4NBWA 5G0TA 4LCEA 1AXGA 3RI3A 1A4IA 1EBUA 5DF1A 3EYWA 5DP1A 4RQTA 4J9VA 5DCWA 1KY5A 5BSHA 2BFMA 3UXYA 3KTDA 1LRKA 5L40A 2YY7A 1M76A 3NT4A 4DUPA 2OO5A 1NXQA 3MTGA 4YAEA 4ALJA 2JFFA 4ZQEA 3V2HA 4QSMA 4IMRA 2C20A 3TF5A 2GZ3A 5G0UA 1NHGA 3EVNA 3RUCA 1T24A 4KOAA 1T4DA 1TLTA 1DC6A 2VUUA 3NEPX 4IS2A 1YJQA 5B12A 3KHUA 5EJ2A 3DBLB 1PEDA 3RFVA 2CZCA 5JNLA 1LJ8A 1SC6A 3KEQA 4W9NC 1EUZA 4I9UA 1IZ9A 4JBHA 1CQIA 3HDQA 1PGNA 3M6IA 5JC1A 1TT7A 1I3KA 1U2GA 3DBLA 2Y1OA 8LDHA 2FPGA 1RJWA 1AN9A 4OXNA 2DBZA 1WVGA 4P8RA 1ENZA 4B8ZA 5BSGA 4PZDA 3HDHA 1IPEA 1F14A 5EESA 1NBOA 1NQOA 3G1TA 1YS4A 4FGWA 1QR6A 1GQYA 3BMNB 3IIEA 1U3TA 2FSSA 2PV7A 3GH3A 3KV3O 4WE3A 2D5AA 4FC6A 2Q99A 2CDAA 4RCVA 3UUWA 1LX6A 1DDOA 3K6JA 4FBGA 3WWZA 3BMNA 3UICA 1VSVA 4F45A 1GFSA 2JCXA 5DDIP 3DTTA 4XB2A 4E5PA 3GK3A 3S55A 1UH5A 4O59O 4U7WA 4MVJM 5I9MA 3QWBA 3AY6A 3AUTA 4ROSA 2DBVO 1ZIDA 3PRJA 1MB4A 2C2YA 5JCXA 2GYYA 3VPGA 3LT1A 1P3DA 3RKRA 4EJMA 3PIIA 4RDIA 3PGXA 4UUPA 2DUUA 3GPIA 3UCFA 4Y6PA 3IP3A 2PH5A 3GA0A 4K26A 4YJDA 4IY1A 4YQZA 4BO6A 4E12A 1NWHA 3RKUA 3HADA 4TKLA 2AQIA 4KTVE 5L3ZA 3JQAB 3TJRA 2LDXA 4PLTA 1O6ZA 3DZKA 1GCUA 3PJDA 2D3TA 3RFTA 3LF1A 1N7GA 4OH1A 1H2HA 3E5MA 4FJ1A 2HMUA 3QLJA 2E37A 3JV7A 1PGOA 1NX6A 3FWNA 1LBEA 4AJJA 4NBRA 4J91A 3JQAA 3NTOA 4BKRA 1I3NA 1N7HA 4RDHA 5G4LA 5AYVA 1W73A 3E48A 5B37A 4AJNA 5C7IO 3CMMA 4YT4A 3PK0A 2Q45A 4UAGA 4B3HA 1SNYA 2AMFA 5EL0A 4BGVA 3PXXA 3V1UA 3JQGB 3FBGA 4LGVA 3E9NA 2EKPA 4J6FA 5ES3A 1ZCJA 3AY7A 1XCBA 3D5TA 4LRTB 2PZLA 2AQKA 3DO5A 3AUAA 4J0FA 3UCXA 4P4GA 2VUTA 1LU9A 3H2ZA 2YV2A 4WKGA 3VAZA 3JQGA 3NTQA 4ND4A 5JLAA 5KJ1A 1BG6A 2PKQP 5I9NA 3JYQA 2O48X 1MG0A 2WJPA 1Y7TA 2OZPA 2WYVA 4D45A 3HN7A 1UZMA 4FFRA 1ULSA 2JFGA 3L6DA 3GC6A 2VOEA 3GAFA 5KVCA 2CFCA 3GVPA 4XQGA 4XYGA 3QIVA 5CG2A 3ZWXA 3G79A 5TJ9A 1XLTA 3IC5A 1GL3A 4LCJA 2Q3EA 3TZKA 1RPNA 1AHHA 1I24A 2NTNA 2ZYAA 3R3JA 2BI8A 4BNMA 2VYVA 3UOGA 4MJLA 2QW8A 4AJIA 3CUKA 5JDCA 2CUKA 2W98A 3JD1A 1KERA 4XB1A 4DBVO 1DJQA 1Z45A 1C0IA 3F3SA 5JFOA 3BTSA 4GI2A 3B6ZA 3VHRA 5DT9A 2OHXA 1FDSA 2A92A 2GN6A 2NLOA 4QO8A 1ZUD1 1S6YA 2ZATA 1ZXLA 1XEAA 2ZB4A 3GPDG 4GSLA 3CSDA 3I9KA 4BV8A 4AVYA 2LDBA 4MDHA 3WMXA 4DWVA 2B5VA 3RIHA 3RUAA 1LC3A 3C7CB 4JP3A 4Z9XA 4MIEA 2ZYDA 3GHHA 4CQMB 1F8GA 1G6KA 1NQ5A 3ZNNA 3BHJA 1F06A 3H9JA 3OA2A 3BAZA 3ITKA 1DHRA 3F47A 4CJXA 5ENVA 4YAKA 4CM5A 4A26A 1LLCA 1S7CA 2YW9A 3S2GA 4BKUA 1WXDA 4FGSA 4LK3A 3F1LA 4CQMA 1NFQA 1UDBA 4YPOA 2YDYA 1PJ3A 2HDHA 4NFSA 5JS6A 3TFQA 3OMLA 4E3ZA 4BMSA 4J4TA 5BNIA 1LLQA 4CV0A 2YV3A 3OJLA 5T5QA 1J5PA 1R0SA 4H3VA 5GZ1A 1BWSA 1GDHA 1E7QA 4IPTA 3AOEA 4RJTA 2YHUA 4DLLA 4E4YA 2FPIA 4PLWA 1GUYA 2I3GA 1M66A 2GO1A 1GAEO 4ZN6A 1U4SA 1OBFO 4DGSA 3F4LA 1GEGA 4YJGB 4MVJI 4GX5A 3B1FA 2X9NA 1CERA 1X7GA 9LDTA 1QSGA 2HMTA 5TT1A 5KTKA 3WGZA 3KETA 1ISMA 3RAJA 1NQTA 2J3JA 3H9GA 1HL3A 1ZBQA 4YRDA 2J6IA 4BNYA 1QORA 1ZNQO 3UKOA 4YJGA 1AXEA 3ANMA 3A28A 3WLFA 2W2KB 3NKLA 3ASUA 3PZRA 4M1QA 2UAGA 4CLEA 4JBIA 1NHWA 5G0VA 1HDCA 2BGKA 5KCZA 3ZWWA 3OQBA 3H2SA 2DQ4A 5T8KA 3W8FA 2R6JA 3P7MA 2FN7A 2W2KA 4BNUA 2X0IA 4CMHA 1WAMA 2EXXA 3IDSA 3JQFA 4FB5A 3DZIA 5KOIA 5IN5A 4DXHA 3PYMA 4DIBA 4LISA 3HHPA 2HRZA 4ITUA 3DOJA 5JCJD 1KBZA 5B1YA 2X0NA 2CVOA 3EAGA 4LVCA 4YBZA 1GUFA 4FFPA 3WFJA 4BNNA 3HB5X 2EKQA 1V6AA 4HFJA 3K30A 1RM5A 4MVJP 1JN0A 2CMDA 2D8AA 4O63O 4WLUA 3GVHA 4QO7A 4PZCA 2PA3A 2VHWA 3EK2A 1B3RA 1KS9A 1DAPA 1OOEA 1QG6A 1OZAA 4YTEA 4M87A 5AVOA 1GV1A 4UUMA 2Q49A 3SVTA 4ZQFA 5K9ZA 3O4RA 5C7OO 3ROQA 4I1IA 2AXQA 1EVZA 3LSYA 1I2ZA 5BNFA 3GN1A 3D3EA 1EUDA 1K3TA 3MEQA 1B8VA 3JYPA 2DUWA 1A5ZA 1DLJA 4DBZA 4JN6B 4LSWA 5KVQA 2NVWA 3Q9NA 1UXKA 3ADOA 4ZU3A 1YL5A 1HDOA 5L4NA 3FTPA 3ONFA 4J49A 1LSOA 2C07A 2PR2A 4JROA 1E1NA 5HA5A 1O5IA 4CMKA 4UVEA 1GPJA 1UP6A 2I9PA 3H4VA 4OMUA 3ZGYA 1YVEI 4YB8A 2W8ZA 1Q0LA 3H6KA 4XYEA 2E49A 5GMOA 2J5RA 4MVJF 5CEJA 3LT0A 3VPFA 2XAAA 2BGMA 1JDJA 1VC2A 3BTVA 3BHIA 4PLCA 2O4UX 4TZKA 4J4BA 1JA9A 2X22A 3M1LA 1QYCA 4GGOA 4S1VA 2PTGA 3G1UA 1TT5B 3ZDFA 1ZMOA 1XWFA 3FPCA 1U2DA 2PFGA 1ENYA 2BLLA 2W2LD 3WBFA 5IZCC 1XGKA 2JD2A 3IKTA 3NDJA 1YB1A 4HY3A 5JY1A 1SPXA 2ZB3A 1PWZA 1TT5A 4QX6A 4J4HA 3EZYA 4L8VA 4WUVA 5COAA 5CEEA 3HNPA 1DFHA 2UV8A 1UXJA 1R4MB 4KQWA 4BHTA 3L0DA 4CLXA 3KSZO 1Z82A 4AICA 3HSKA 1ZK2A 4Z3DA 4YAIA 3RROA 4HWKA 1Y5RA 3WTCA 4GGPA 4CLOB 3F5QA 5JXWA 2NU7A 1CETA 1E1LA 4D3DA 2ZJ0A 1YRLA 4ZRMA 3PJFA 4RLHA 1WZIA 1R4MA 1OAAA 1PL7A 5H81A 4R01A 4E5NA 4CLOA 4CM9D 1ZVMA 3A9WA 1X0XA 2FSVA 4WLFA 5IDWA 3HWRA 1J6UA 3DTYA 2Q1TA 3I9LA 4DIFA 4IIUA 4OXKA 1VRWA 3FBTA 4FOSA 2X1HA 3D4NA 4R69A 1Z75A 3W1VA 1B8UA 3C24A 4KZPA 5A4DA 4JJGA 3UF0A 5IXYA 5AXDA 1N2SA 1X14A 2I65A 3JQBA 3UAGA 4TSKA 1SEVA 2HMSA 4DQXA 3FR8A 3WDSA 3KUXA 5U4QA 5IN4A 1Q2XA 4PVCA 2D4AA 4Q3EA 8ADHA 5KWEA 3ULKA 2C2XA 4DIOA 3ROMA 2B35A 3KLMX 3NYWA 3GEMA 2CD9A 1A27A 3WYEA 4BGEA 4RVDA 1IHXA 4Y6RA 2SCUA 2B4TO 5TT0A 4R54A 4A73A 2NSDA 1E7YA 3IJPA 5CDYA 3AU8A 3QP9A 5CPBA 4BVAA 5ICSA 5AXCA 3W8DA 4BIIA 1VI2A 5T8KC 3DDNA 1I2CA 4CMIB 3DZFA 5DCUA 3S8MA 1SCUA 2E6UX 1XYGA 2OORA 2E4AA 1EBFA 4CLRB 3GDGA 4GH5A 2YYYA 3JQFC 3LLSA 4FSHA 4D0SA 2FP4A 4GLOA
chains in the Genus database with same CATH superfamily
3AY3A 1PTKA 1RRKA 3KR0A 3ENKA 4L9AA 3UK0A 4FFNA 5ETJA 1WTAA 2YIMA 5JBIA 2G6BA 4XAQA 4CLRA 3FKQA 3O0DA 4YP5A 1L4FA 5LKAA 4PSKA 3MPOA 3B60A 4NMMA 1W1WA 3I6YA 3IP1A 3LSTA 4G01B 3SQOA 5IKMA 1U7HA 4X6LA 5ILGA 4GL4A 3R8XA 1Y4ZA 4PZAA 4NQRA 3QXSA 1F6DA 3P9XA 5TQ2A 5IDXA 4KL8S 1LNSA 1MNAA 3FVQA 1NR1A 1BNCA 1RP1A 5ER6A 5KDLA 3ZCQA 3R7AA 3TGWA 2R8YA 5IEBA 3H65A 5TMEA 3ZDXB 4BO2A 5IUNC 4MW0A 3UPDA 4OQXA 3K9QO 1KY4A 2PCJA 3I58A 3C6MA 3MJFA 2BKVA 1EVQA 2QVCA 4QPNA 3DNPA 1KVTA 3ZHZA 2HMVA 3U7HB 3D1LA 1PX2A 3X1WA 4D99A 4G1VA 2XVXA 2O0HA 5JIBA 2HYDA 3GJ7A 4N1AA 4Q03A 1QRRA 2D3WA 2I1QA 3KWJA 3MGBA 1EP1B 4H6WA 1KZ7B 4DA0A 1M34B 1XR3A 1JJIA 1NG9A 1REQB 1XKQA 4NEQA 2C77A 3WQBA 3CVYA 3HCBA 4OQZA 2X2EA 4JI8B 3V4FA 4MRPA 1F9EA 1KI7A 5E1MA 2WKSA 1GCOA 2LE0A 3KNZA 4FEEA 1NLUA 1I13A 2C1ZA 3OZGA 1M34A 1IY2A 1DS6A 4OFWA 4IDCA 2XWSA 4FX2A 1REQA 4GPEA 2JKYA 4H16A 3QIAA 3VV3A 3SMQA 1SC3A 2ODTX 3FBWA 5EI5A 4WBNB 2J3KA 1RQGA 1VPEA 4KXVA 4RVCA 3D0RA 1CW2B 3CX7A 2GRAA 4H7KA 1FYWA 4RY0A 4QJ3A 4WCVA 1UOOA 3U7IA 4B73A 1BOOA 1I36A 3ZQKA 4LJ9A 4Q3AA 3LGSA 5EMHA 1N2JA 4NDZA 4WBNA 3MTJA 2GAAA 1M2GA 3OFVA 1RC0A 1L7BA 4N82A 4F3TA 1P2TA 3T6KA 1EFUA 2ZQ5A 1BE8A 4RH1A 2RK4A 2C58A 2W48A 3DMNA 3U17A 3FN4A 1J42A 1MJFA 3F5SA 3LIIA 4OYYA 1E6CA 3VR6A 4A0FA 2ZQZA 1N34B 4BKPA 1QZUA 2VLIA 3PHJA 5CJJA 1WVIA 3MJCA 4KGXA 1D8AA 1NE2A 4MUMA 2DWOA 4OOEA 4TYQA 5LM3A 2PGNA 2R1TB 3MWLA 2C9CA 3EOAI 3S8YA 3S1SA 1N8TA 1Y8RB 2ZPUA 3GUVA 2CLEB 2C99A 1PS9A 2J46A 1QYIA 1V8FA 3BIFA 4ZU1X 2FNAA 3HCDA 4DSTA 1KVRA 2CNLA 4MUKA 3G5MA 3GNQA 4F4IA 3I42A 2ZJ7A 4DCUA 1HXHA 3DAYA 2P68A 1MXFA 2R1TA 1F51E 3DTVB 3IRUA 3M9XA 4L3WA 4DDTA 2ZUVA 1L5ZA 1QAMA 3JQAD 4F5EA 1U80A 2GPAA 2VYQA 1R9NA 3P0JA 3CPSA 3MW8A 4KUHA 5JAIA 1VE5A 4RELA 5CM9C 1VLVA 2KW5A 5FTWA 3T4XA 5JRZA 1XV5A 4AY5A 5KPJA 4GMKA 2Y93A 3DTVA 2BJVA 2OUIA 3ESCA 3N0WA 2Q3FA 4KODA 4J0KA 3CF2A 2JLRA 2X8AA 2IEBA 1K06A 4O5AA 3KAQA 4OQEA 1W94A 3IA2A 4DWOA 1SG0A 1GQRA 1U2RA 2D1FA 3ZIAD 4BO9A 2AEEA 3QV2A 3NORA 4C6RA 1TYZA 2EJTA 1WMAA 4KN6A 4RVOA 4GVXA 4BJ5A 1B23P 2AHOA 2Q3JA 2QTVB 4HQOA 3JARB 5U1PA 1O94C 4N3GA 3FNQA 1I6KA 4FGLA 3ACDA 4N3AA 4RPGA 3BH0A 3V34A 4D42A 3FB4A 1SUEA 2RAPA 1CF4A 1IWOA 2BFAA 4J75A 2K7FA 5KAPA 4Y30A 1XF1A 7ADHA 1GGHA 1KC3A 4M76B 1HE4A 3AOGA 1RPJA 4QREA 1AG9A 3C74A 3DE7X 4CDRA 4QU9A 5F23A 3OQVA 5KZMB 1HR0B 2P4QA 1A8SA 2QTVA 5FDFA 1IN7A 4YY3B 4NBTA 4LBWA 3JARA 3BILA 2LTAA 2PNFA 5EGSA 1R2QA 3K8YA 1F4LA 3SYMA 3UKDA 1TKBA 1LK7A 1Z0AA 4YUAA 4W5QA 1NUUA 4JSRA 4QE3A 4WEQA 2Y0PA 1UXGA 4C76A 3M0EA 1BMDA 1Z5UA 1NVBA 3TL6A 1E6WA 2RBKA 3MHPA 1HQDA 5EIHA 4MX8A 2FPXA 5EIWA 3AKDA 4ZGBA 1SOAA 3TD6A 2PD3A 4MUIA 3GJ0A 4F84A 3E70C 4XB6B 2F00A 3G0IA 2Q9CA 1MZVA 2FQXA 2GWRA 4GWGA 2CMGA 4Y9RA 2AJLI 4EJSC 3EXIB 4PYRA 1EWRA 1JHVA 1M6WA 1PU2A 2ROQA 2WWRA 3LCUA 3WYNA 1QHHB 4PANA 5C18A 5ICCA 5BWCA 1E63A 3RT9A 3HCEA 3EDRA 1G0NA 3F9CA 2O0JA 1VL8A 3UH1A 3O8RA 1CKEA 2KE5A 4HPJB 4M1YA 1DKUA 1QV9A 2IHYA 1OFGA 1L8XA 4MUYA 1T2DA 1BXGB 3MTQA 3BYZA 3EXIA 3I4FA 1IUOA 4QM7A 1QOZA 3NIGB 2AC2A 2FX5A 3RDPA 1QHHA 1QNFA 1BDBA 1UMBB 4F9GA 4BNLA 1PG5A 4QHSA 4K6MA 3AV3A 2RHOA 1JHDA 3OFJA 2E5WA 4LVUA 4RY9A 5B2FA 4FINA 4QGFA 3CCFA 2FZEA 3EPJA 4OX9B 4HFNA 2G80A 1BXGA 1UR5A 3F7TA 1XJQA 4MQ5A 1PJLA 4GYWA 4URVR 3L4BC 2ZROA 1UMBA 5CXSA 3IP9A 4UDNA 3N76A 1CWUA 3K7EA 1ORWA 3MJEA 4FZVA 2ACKA 4YJ3F 5AKZA 1H8ED 3G0BA 1XCMA 3MJSA 1H6CA 3H6GA 3LC0A 2JAWA 5GIPE 3B6EA 5JU6A 2O1EA 1UWCA 4GSKA 4LC9A 5ALJA 1X1QA 2ZVPX 3UAZA 1DWQA 3ELUA 4ZOQI 2CNWA 5KC9A 3LC2O 3GUUA 3GRYA 2QM0A 3H1PA 4DLUA 1O6CA 2V7GA 1GSAA 3RIYA 2FEKA 2XOXA 3ESQA 2J9RA 5H5JA 2R48A 1C9EA 3NH9A 3X43A 3L9WA 4UCFA 2NSYA 2GXAA 1H0KA 3IBTA 3HSYA 1RFLA 1E9AA 4XVQA 2X9VA 3VPXA 2O5CA 2AN5A 3UK7A 3P26A 5BWBA 2HSJA 5A3VA 2QQ5A 2HK8A 4PZLA 1FPMA 1ZHHA 4PTZA 1PUXA 4DCCA 3WGGA 2HSGA 1YB5A 2Y0EA 3WNZA 3U09A 2H51A 2I2DA 4DLPA 1I2AA 5F5NA 2UXDB 3A31A 1W8IA 4EZEA 1K0FA 3I9V6 1GG8A 1IM2A 2O5RA 4KR3A 2I22A 1OYVA 1U0TA 2WINI 3KDPA 3BEOA 3PNMA 3Q9LA 4RMIA 5IJXA 3UOWA 4BBJA 4DG9A 4RD0A 4Y3UA 3L3BA 4E08A 1U04A 2R00A 1R0LA 4NQZA 3B6JA 2ZDGA 4C89A 4D43A 4DSNA 2C3PA 1G17A 2HFJA 2IVZA 3OM0A 3KIPA 4Q6BA 4XR9A 4IZ6A 4G09A 4O4HB 4BC0A 2JGLA 1YXMA 2J9YB 2K87A 3EQ6A 4OBWA 5KAMA 3RHSA 5CFQA 5KPDA 2HHHB 1JDSA 3C4JA 3X44A 4R9UC 1U1DA 5ALIA 4B2YA 1PR1A 4TRJA 3CNNA 4LXGA 3ZXYA 4D3FA 4NYJR 3O83A 4Q3KA 4YCNA 4O4HA 2GSWA 4LDRA 2PAAA 4F92B 1W7AA 5DNYB 3CH4B 4J43A 4O8ZA 1R0YA 2EZ4A 3KAJA 1XCPA 1Z22A 4O4HF 2HHLA 1UQUA 2OD9A 3AJEA 1ISSA 2W2QA 1ZUIA 2IZ5A 1KOGA 4FFWA 4M36A 4N5NA 5EVJA 4EJ6A 5LU8A 1N9ZA 1QGOA 2VUIB 4YECA 4W8OA 2J3HA 1MJGM 5ESRA 2FEWB 5HIIA 2AEJA 3DL4A 3NU1A 2VQ6A 2H5IA 1A97A 1N5DA 3INTA 3S2YA 4M1MA 4XQ0A 3UXHA 3VX3A 3GCXA 2XDWA 2XCIA 1L4NA 3FDFA 3E6AA 3FTCA 3E7XA 4HLUC 4TL6A 3TW0A 2GHTA 4IHAA 1SXPA 1C4WA 2EF0A 5A6SB 3KV1A 4L75A 3DMTA 3VR0A 4WNCA 2JAHA 4QUHA 3K9BA 3TSAA 1U0GA 2CF6A 3KHKA 4OL9A 5AICA 1BHQ1 5IDVA 1SD1A 3PWZA 4RV4A 4PWZA 4MWSA 4AVYA 1XJWA 1AC5A 5E1DA 3WGVA 2A14A 2V9PA 3VDMA 5A6SA 4L74A 4EDFA 5ALMA 1ZU5A 4NECA 4ZFNA 3L4SO 2GVDC 2IH5A 1DCMA 2VPXA 4NOLA 4YONB 4DB4A 4OIFA 3VKWA 4BKQA 1U1FA 2BFCB 1WCXA 2Q5IA 3L7BA 4W1RA 9GPBA 3FVWA 3TLXA 5K99A 2VCEA 3DM9B 3OT1B 4P93A 1ONNA 1BX3A 1NVGA 2FUEA 4EG1A 2XGMA 1SUFA 3OECA 3VMMA 3TI9A 1RZRA 1OWLA 1BVUA 2O2HA 4HNVA 3K0FB 5AD1A 4D3XA 4TN1A 3JSAA 3FZGA 1T9BA 1IBSA 1NW5A 1DAHA 2BFCA 3PDUA 4W8GA 4XUEA 4B3TB 2NNWB 3OT1A 1B3BA 4G2NA 3NIBA 1VSTA 4GM4A 3PV0A 3ILVA 1THTA 3CZ9A 3G49A 2DTDA 2PKRA 1P81A 2C96A 3T9AA 3I52A 3JRXA 3K0FA 2GKSA 4JKOA 1ZO8A 1ZJWA 2M1ZA 3NVMB 3ZX4A 1ZI9A 2WHRA 4WN3A 3OZVA 4YX9A 1QIMA 4PYMA 2R8EA 2Y9MB 2XKAA 3FPBA 1DUVG 4BJ6A 3WWYA 4F06A 1NNEA 3NETA 4ZYXA 4ZCPA 3O21A 2Z6UA 4NAHA 4IQFA 2FN9A 3V1MA 5HXAA 1CDEA 3PQ8A 1EGMB 4X85A 1J00A 1FB5A 1LKZA 1EXMA 4GM0A 2EW2A 3N2LA 4FGJA 4MRRA 4XEHA 4Z54A 1ZX1A 3NV9A 3C8UA 5HRAA 3AFMA 1JFSA 3ND6A 3MFYA 3ZYZA 4X1OA 2FZGA 1LDGA 5BW5A 2YWEA 2FEOA 1YRQA 2JRCA 2PCLA 2XB9A 4LBVA 4EHKA 2JI6A 2OY0A 3G82C 3HXQA 3THSA 3Q8MA 1SBNE 4J1SA 1O9BA 2FQYA 1SXJC 4OSEA 4K1LA 5J58A 5EHNA 3DE5X 1AO0A 1NSFA 1TVEA 3N75A 4KFUA 2HJRA 1HETA 4QOEA 2R4UA 5ALZA 3ZHVA 1CS0B 1OBVA 2Q5OA 3QITA 4CM4B 3PUJA 3ENNA 3Q72A 1R9JA 3HYTA 2AN1A 2PM8A 2VP6A 3CB4A 4MR7B 2NIPA 4PONA 3B7PA 2QS9A 2JA2A 3KOXA 4L27A 1I3OA 1SCDA 2D1SA 3P4YA 3B3JA 3VYTB 1D6SA 4XTRA 1M1YB 2R9VA 4NXMB 4I7EA 2HDNB 1T8RA 1CS0A 4CM4A 3HB0A 1F8FA 4MW6A 1Y3AA 5AVWA 1TTTA 1CY4A 4MR7A 4JZYA 4XWAA 3DLTA 3D9QX 1H2BA 4HX9A 4QFBA 2I5PO 1TKCA 2ZITA 3I04M 1B4DA 1WETA 2FPPB 4YCSA 3P5SA 2CZGA 2CNDA 1T10A 3O9ZA 1PL8A 3KQHA 2DTXA 5L4SA 3DYVA 1UJ6A 2GBIA 2VT3A 3DF9A 4PRKA 1PKEA 2G07A 2WMDA 2FHSA 2X0FA 2B37A 2ZXUA 3U4AA 1YGYA 1O3YA 1U9YA 3W3AA 1ZMRA 4TXLA 4JI1B 4ZI2A 5CT9A 4CTMA 5AW3A 1TTQB 5EXXA 2OSVA 2FPPA 3AHDA 3GMTA 2PGLA 5ALDA 5JSHA 1T13A 4JNKA 3VR5D 1ZAKA 1W4AA 2JGDB 4P2GA 3PC4A 4YYEA 2YZGA 3HQ4O 2NQ8A 4MYTA 1GZ5A 4Q7JB 1V35A 3M1YA 2OP0A 2NACA 4HPWA 1I51A 4LDQA 5AKEA 4UMDA 3C7AA 1IBKB 1JKFA 1QX3A 3A14A 4WX2B 2XRZA 4AWBA 2PZJA 4M89A 3TAUA 2GUWA 4BJ3A 4OV6B 4EFKA 2NQTA 2JGDA 2A2ZA 2JZOA 4MI3A 4GX0A 5DWDA 2QTHA 1QCDA 2OECA 4H4CA 4HTFA 5TMDA 2CXSA 4AL4A 5E1BA 4H3KB 3LWDA 4BVEA 4CZ2A 3KQPA 4K2AA 4RLFA 1ORVA 1NIPA 4M9UA 3PHBE 2QXYA 2MHCA 1P0QA 1VE6A 4J1NA 3RVQA 2HLPA 4OQYA 2JGJA 4OLBA 2NUPB 5YASA 5TR9A 4WEOA 1NBHA 1OAOA 2GN4A 2YV1A 3W4KA 5HSGA 2QHXA 1U90A 4HYEA 3TIIA 4WRRA 1JR3D 1X9HA 4IGFA 3HXPA 3TGLA 2O9JA 4R1LA 3NO4A 3IUYA 4YI5A 5AO9A 5IW8A 4DMMA 5K45A 2FI1A 3IUJA 1J2YA 4OHUA 1CYDA 1EAYA 1QFMA 1T5BA 1Z62A 4PVDA 2BDEA 2EW8A 4LKRA 4Q1DA 2IIVA 1P5ZB 3SBEA 2O3QA 5EIOA 1T1GA 4TMFA 3OAAA 5BW8A 1CUHA 4YP0A 1IDOA 4CYMA 4KW7A 2FY8A 1OGJA 2TSYB 3CS3A 4KLCA 3DMTC 4RJJA 2HY7A 2AE2A 1NXPA 1RWKA 5D00A 4EY6A 3PPYA 5KTPA 2I4OA 1KDOA 3TZ6A 2W37A 2B9EA 5FFNA 3RU2A 1NN0A 2ZU0C 1SZPA 5LJIA 4A8PA 3HEMA 4PC1A 5I9BA 4BECA 8AT1A 3RLIA 1ZD4A 4TKZA 1MIHA 5FCDA 2D7DA 5A0FA 4OMCA 1EK2A 2Q1XA 4AKIA 3GJ5A 4GXNA 3EMKA 3SQDA 3OJXA 1RYHA 2EBHX 4CT0A 3ET5A 4MVJA 1MW9X 3OEYA 2P3LA 3GRPA 5F1OA 1EE2A 1Z0UA 3T7CA 2REOA 3OLYA 2JAXA 4J94A 5IKOA 1J25A 3UOAB 5JDCC 1RDFA 3I09A 3MJRA 4FVTA 4PAOA 3ZW9A 3WKCA 5EPUA 4BB6A 2ORWA 2OEPA 1QYXA 4C20A 2DULA 4HLCA 2ZSJA 4O2AF 4H1WA 4RX1A 1YZKA 4K6FA 5G1PA 1H4QA 3UKJA 3ROTA 4KITB 1ZMTA 3SEFA 2UUOA 4W7HA 1JR6A 5IMBA 1NDHA 2YWDA 5JARA 3TECE 1ADBA 2LV8A 1T26A 3LT2A 3SXPA 4F46A 5A2GA 5BN4B 4HDQB 2OA0A 3SU8A 1Z4NA 2AZMA 4QG3A 3D0QA 4YMSA 3L46A 3JW8A 5JAZA 5HP4A 1FRQA 2A0XA 4P9NA 4O8CA 4WNIA 2UVPB 1DX4A 4I50B 3CF0A 3EVGA 2GTPA 1X15A 4KXYA 4XD7D 2CBGA 3ZG6A 2HM7A 2W71A 4O2BB 5FF9A 4PQFA 4J0DA 3IQGX 4QTUB 5IP5A 1JMYA 3P2MA 5BN4A 1P5RA 4ZT6A 1G6Q1 1E2KA 6LDHA 3VYRB 3V7NA 1DKPA 1YBAA 3DV0B 4A8TA 2UVPA 4E88A 3CRNA 4I50A 2A1UB 1O5TA 1EP9A 3AR5A 2I54A 4ALLA 3IHLA 2E87A 1IXRC 4O2BA 4AS1A 1VJ1A 1SVKA 2ATCA 3FZEA 1NJFA 4HXYA 4I50F 5ICGA 4WW0A 4RVFA 4UVIA 4BFYA 4EYSA 4NCJA 4NZZA 5LD2B 3RC2A 3DV0A 4Y2HA 2XVYA 3CINA 1K88A 4MR8B 2A1UA 3UB2A 3VSAA 5CDGA 2GAOA 3UGJA 4DCSA 3R0XA 5BO5A 5CR9A 2H6EA 1LPPA 1ZVKA 2WTNA 3CMCO 4IMPA 3CKYA 3K3PA 3AU9A 4O33A 2WD7B 3GOQA 4XARA 2NO0A 4J3JA 4OF4A 1AB5A 2A1TS 5AHXA 4NHEA 4AG6A 3JD0A 4MR8A 2PWZA 4JSYA 1SKMA 1AURA 1DWOA 2FB9A 5BMOA 3O8OB 3SQNA 1XZPA 2CHEA 1OY1A 4JJKA 4YRQA 3NRBA 3HVKA 4DSZA 1BZYA 1N6PA 1J2UA 3MTDA 2AQHA 5C51B 1P0PA 2WD7A 5FB3A 3EA4A 5JASA 4C2UA 3LWZA 1AHNA 2IWHA 4E15A 4ZO9A 1B00A 2CL5A 1ZPDA 1R0WA 5K8LA 5LVAA 3RREA 3O8OA 2QJWA 5DSXA 2VUSA 1FOEB 2OXRA 2O8CB 3FR7A 2CLOB 2D2VA 1S3SA 2IE8A 4PN3A 2C2OA 1YV9A 3ESDA 1TEHA 2VYND 1NLYA 4YEDA 3Q6IA 4H7EA 1P74A 4RF4A 3O3CA 1BDIA 3FFTA 1X7DA 3OIUA 4QUAA 5JZVA 3EXEB 2Z5GA 4K9DA 3PEWA 4RPCA 1EVYA 5DK6A 2O8CA 4JC0A 5TF0A 2WU0A 4X1KB 1HYHA 5KJ6A 5E7MA 2IP2A 5HS6A 5BSTA 3EFOB 4H15A 3TFWA 4F04A 1U0EA 3ND5A 4WN9B 2WOOA 1GPH1 1OFUX 3ID6C 4D97A 5KWSA 3DUWA 1ZH0A 2OFWA 4DT1B 1BE0A 4E11A 5BV7A 3EXEA 4M8SA 4LYHA 4E6PA 3D8HA 1PDOA 3UFBA 2QB5A 4GT1A 4JASB 4K9RA 4X1KA 4WUTA 3ZH2A 1H3EA 4RUKA 4ZZ3A 3EFOA 2FN8A 3W06A 3ADPA 4LJSA 4WN9A 3WL7A 3WLHA 3A6DA 1RRMA 3FKSA 1QFZA 3KZVA 4ILEA 4Q18A 2PXHA 3ZLBA 4CGYA 4QKQA 3RFUA 4BQOA 1C5KA 4DT1A 2BI7A 3OTGA 1PZEA 4KIJA 4XVHA 3I53A 4ER0A 2HT1A 1SHLA 2A78A 5JCJA 1OZHA 1W44A 4F1JA 1FX0A 1OAOC 2MSNA 3WBKA 1D7AA 5A3QA 4ZA2A 2GH1A 5HIMA 1U8AA 4MV6A 4O2RA 1KQ3A 5A03A 1F6WA 1MG5A 4I1YA 1R6UA 4YAFA 3QPDA 2NXCA 3I0MA 3EIHA 4BGUA 2X0RA 1XVTA 1M2VA 4YV1A 4B3JA 1F8XA 3RVDA 3UTDA 5CXUA 2YWHA 1HE3A 4KDEA 1ZD3A 1SUCA 1U8FO 3BMXA 3QNUA 4Q4AA 1KYQA 2WPDD 3IO5A 1D4AA 5DGHA 3DD5A 4K9QA 1AT1A 4Y2TA 5A71A 3FRJA 1NV9A 4U6SA 2BEJA 4WXPA 3T9FA 5CFMA 1CZHA 1LBHA 5EEGA 3W3ZB 3LPLA 3G9TA 4QECA 3BCSA 2F90A 5KKCA 3OEWA 1RU3A 4QNMA 3TNLA 4U8GA 4PEVA 1C0LA 3MS7A 1E7MA 1RMYA 4IH1A 4ZQCB 1LQTA 2HAEA 1N6RA 1I80A 4CIYA 1YR9A 2DUMA 4EHDA 1P4RA 2AEMA 1JXAA 3SDBA 5FI5A 2H8KA 1ZXBA 3D8NA 2J48A 3SD7A 4MW9A 3A9VA 4J0QA 1J1UA 3T3OA 3AH8A 2FMTA 1CF9A 4OI2A 4E5MA 1Q19A 3F6EX 1GQQA 3PC8C 1NJSA 4P98A 3PPXA 3TTVA 1PLJA 2GEFA 3GRZA 3KZOA 3MRTA 1Q0TA 2B99A 2ZJ8A 4WESB 4PAGA 1TK2A 2ZIUB 3DTNA 3IURA 3JQ6A 3STUA 4GM1A 3PL5A 3R9IA 1H2AS 4REMA 5BURA 1G8FA 4UTPA 2CLIB 4HDNB 4BCCA 3EEOA 3R9XB 2H7XA 1RKVA 4M7RA 4PGMA 1C1XB 5T67A 3PA8A 4WESA 5EP3A 5C4MA 2AK3A 1VE9A 2P2YA 4AF6A 4PYLA 1R8XA 3DWEX 1CY0A 1JTFA 1T6YA 2GHQA 3QPCA 2VT2A 5CU7A 1G60A 1G8YA 2Q1WA 4HDNA 1CNEA 3R9XA 1ZK3A 2V55B 4ZZ0A 3ZJ4A 1DX6A 1C1XA 2ID9A 5JJLA 1FDRA 5KJEA 3E4CA 5J23A 4Z9BA 3WMGA 3L7KA 5E2BA 1Y6RA 3BDVA 4M8KA 3C16C 1XU7A 3NWOA 3OQIB 3QENA 4GICA 4M8LA 4U63A 3L07A 3ISJA 4LWZA 2Z2KA 3LY8A 1Y34E 4O1IA 4DBLE 4WK4B 3ZVMA 4ZTZB 1OIWA 3RJMA 1JZSA 1RBQA 2WJVA 3IR5A 3E3LA 5FEUA 2FPMA 2YYAA 2XT0A 4TZTA 2CVQA 1TIPA 2NO7A 2ZSFA 1E7RA 1R10A 1YKSA 2YVKA 2H0AA 3DMFA 3GZNB 3FPSA 3LLUA 3OQIA 1GUDA 3NIDB 4RSMA 3ZIDA 4WMLA 3K0SA 1ID8A 1T0IA 2BPOA 2H4YA 4C0XA 3QE0A 1UIMA 3PVZA 3N5KA 2QT9A 4B09A 4DPLA 1H93A 2QVYX 1GTL1 5HJ7A 5LFAA 1Z6AA 4BKOA 5H4GA 3WTBA 1VL6A 4RMJA 3VMFA 3U19A 3PKJA 3U3OA 4ERXA 6YASA 3L4JA 1W93A 2VNKA 3GZNA 1RABA 5AVXA 5I9LA 4X5OA 4TV9F 3BUSA 1T5LA 4XZ3A 5F3DA 4QFCA 3MTEA 3P2JA 4FI3F 4DTIA 1RYBA 4CETA 2BGTA 4YVFA 4NPCA 3TQHA 1KH3A 2VR1A 3JQBC 3TUZC 4UM9B 3CRVA 4OQQA 1CP2A 2K2WA 3WIEA 2I78A 3I1IA 3QV1A 4DM4A 1AV7A 5IX8A 2PQ2A 4R8MA 2V7WA 1ECFA 3LC7O 1L5WA 1X9GA 3DC2A 1LPAB 1ZY2A 3I9NA 1KFBB 2O6HA 5KU1A 5L4LA 1OH8A 4DC0A 1G0OA 1PVVA 3D81A 4AC9A 4MRAA 5A0VA 5EP2A 3IYLW 4C4PA 4R5HA 3OZIA 4BWGA 5DO9A 3QF7A 1A9ZA 3DDHA 2PU5A 4JFRA 1Z17A 2RG7A 4UTVA 3VNRA 5EYPA 1NUTA 3U44A 4KPYA 1SVLA 1Z3CA 2HRCA 4FGZA 4XWKA 3FNRA 4OHVA 4QRHA 4V0LA 4V39A 1QG2A 2XKJE 1JLRA 1CRZA 1U0JA 2IC5A 1NMZA 3NBQA 4L4RA 4GXTA 1GNVA 1NPYA 3DOEA 4LXTA 4CXMA 2X13A 4JX8A 4P4NA 3V1LA 5GIOE 1KZHA 2B83A 2GN8A 2OORC 1V47A 3IELA 1R37A 5CAEB 4CTKA 1XTSA 1LK5A 5E9WA 3WIBA 4JLWA 3A6LA 2AB0A 1YL7A 1P9NA 2WJIA 3F98A 1ADCA 3L7LA 1I4OA 3SR3A 5CVEA 1EVLA 2BV3A 2ZRBA 2Z9BA 2ZXFA 5G0SA 1II9A 1ZKDA 2JS7A 3WICA 1NY5A 3I30X 3ZI7A 2UUCB 2IS6A 2YFYA 3AHIA 3BXFA 3L93A 3TL3A 5CAEA 3H5TA 3JWEA 1NYLA 4IH4A 2H1LA 3KFVA 1GPLA 1JLSA 3FAKA 3NT5A 4NYJQ 1P5FA 5HHTA 4DCMA 2HJSA 1FNSA 4PCUA 1NRXA 2BCEA 2WJ6A 2F9MA 3F9IA 2EFJA 2AJDA 3RUIA 2OXTA 5C4GB 1PK8A 1E0AA 4GR5A 3SYLA 1M1XB 4RK4A 5EP1A 1GY8A 3GLKA 2VQ3A 4ENVA 3C14C 4HPXB 1OHHD 4J29A 3AR4A 4OJNA 1TUIA 3MUNA 4N6NA 2PWBA 4C0BA 1NY6A 1DV1A 2AD5A 4YR9A 3AUJB 5DYYA 1G21E 1WP4A 2I67A 3QLUA 2OG1A 2P3OA 5I9IA 1GCIA 3ZK9A 2SKDA 2VDMB 1Y6ZA 2W2VA 1Z0FA 7YASA 1FTWA 3PQ6A 3T4UA 4IRUB 2CVFA 1GTVA 2KYRA 4YR7A 3X2FA 3C1OA 4RXMA 5I7FA 2JHAA 1X8XA 3PQCA 2WNIA 1S8AA 3AKYA 1S2MA 2O23A 3NTRA 4UTZA 2Z8YA 3CSUA 1POXA 1NSYA 4LVOA 2FWMX 421PA 4RTQA 3HYNA 2VHUA 4IGEA 2Q7OE 2O2YA 2YIJA 4YAJA 4U0KA 5DYIA 1TM1E 4YRLA 4PAQA 2XUAA 1J1ZA 1HYGA 2VATA 2O7QA 4QYMA 5JBQA 1YMUA 4X3PA 3AB3A 2WB4A 3N6RA 4EG8A 1XCGB 5BYAA 4GF5A 2YHAA 3OT4A 3KVOA 3QBEA 3UV7A 2BW0A 1N57A 1QVWA 2P7HA 4BTVA 3GARA 5EMLA 3WB1A 1WUIS 2I6SA 1VKRA 2M6SA 3D7LA 3QX7A 4GP7A 4CTNA 4E5SA 3GLSA 3ZDDA 3FOZA 4ID9A 1P1JA 2HC9A 1WVMA 2OLEA 4H1TA 4RBNA 2Z83A 2QTMA 5K8JB 2H2WA 1IIRA 3IXQA 3LE8A 4RVGA 5CMLA 3AF4A 4H18A 1ZJZA 3IBFA 2G0AA 3HKEB 4MW1A 2P2GA 1CD5A 3HA2A 1TDJA 4CODB 3B3AA 1WXEA 2ONCA 2VDUE 4NBVA 3I2FA 4QOJA 2O54A 1EHCA 3EY9A 1N5IA 4RJLA 4D9EA 5HVNA 5AK3A 1QHNA 1YHZA 2ZRFA 3I0NA 1SG9A 5ERXA 1AKQA 1QQ7A 1HKUA 1AY0A 2ENUA 4FE7A 1RKUA 5EQJB 1L9XA 4S1OA 3WVNA 1KNXA 3HKEA 1QQTA 3QJ5A 3PT9A 5C1OA 3VOAA 3BA6A 4RESA 1YCDA 3LUCA 3BJMA 2JFXA 4M46A 4N5HX 4R16A 1SB8A 1L1FA 1RAIA 3H86A 2GD6A 3CLHA 1U7OA 2I2BA 3L7AA 4MRVA 1WQ4A 2OQRA 2YIVX 1Z6ZA 2WIGA 2ONYA 1WLYA 5DHPA 3AONB 1G19A 3BZWA 4HN9A 4DMKA 1Y7HA 4O0MA 2G17A 3J7TA 1L5NA 1LXCA 3WHIA 5IKPA 1ISFA 5JZMA 4Q93A 3JVIA 1UUFA 1E3SA 2WIAA 1BX0A 5IKXA 1VLLA 1IY9A 1WPGA 1ZCZA 2PT9A 4YJKA 4H7FA 1YBVA 3YASA 5EHZA 1B0ZA 1E5QA 1I30A 1N9GB 3EWIA 4BNJA 2AMYA 3VH1A 2ZVQX 4KNVA 2Z8XA 4KTTE 3NTVA 5LN1A 3RSOA 1RPTA 1B26A 5F2EA 2HO4A 3X1MA 3PNBA 1FS4A 2A9PA 2FSGA 2YHBA 3ZTYA 5L7YA 3BF7A 4LKOA 2IF2A 5I8PA 4NLLA 3WJ7A 1N9GA 1Z07A 3CB2A 1WWKA 2VJLA 1IQRA 3HA7A 3ZKAA 1MT3A 4MGKR 2AXPA 3VOSA 4IV8A 3NAGA 4K88A 5D8DA 5E7IA 3T7RA 2XTNA 3CWCA 4HNSA 1U94A 1VA5A 4BJ1A 1X3LA 4Q1EA 1WB9A 3IUBA 2X5OA 1L5HB 4PQEA 4ZJPA 4LSGA 4UCQA 4KOEC 3TTWA 3VZCA 1DQPA 4BTEA 1U7TA 1SIOA 3H5AA 1LSUA 4B40A 3RUHA 1FFWA 3KAKA 1U5BB 3ADKA 5SZIA 2FSIA 1D0IA 3W5SA 4LFBB 2WYIA 3KYJB 1U2SA 4INPA 4HBGA 3FMFA 3IODA 4PRLA 1L5HA 5IDYA 1E9FA 1QYDA 3LQ2A 3TZHA 3U3MA 4BUJA 1MHTA 1GVNB 2PL9A 3ML1A 2OPBA 3FPAA 4R0VA 4UNIA 4QGSA 1BOFA 1U5BA 2DU8A 2GJKA 1E1RD 1WKCA 4EUFA 3NGMA 1SOMA 1SBTA 1UAGA 1VHJA 1Y4DE 4F7WA 4C2AA 2ZVJA 3S68A 4Z7QB 5BRAA 4F2WA 4P33A 1YACA 3BK2A 3H8VA 4B5KA 1X6VA 4OB7A 2W6ID 4BLVA 5FFFA 1MPTA 3HBAA 3B1KA 5HZKA 3HVRA 3E1GA 1BMQA 4NZOA 1QGAA 4K03A 1AB6A 1H2FA 3HACA 3GN2A 1FS5A 4A6DA 1GPDG 4F6CA 1M7GA 1ZK0A 2QEQA 4C4YA 4LUCA 1DC4A 2GR9A 2BHNA 2QQGA 1T9ZA 1Q3TA 1S9DA 5JXGA 2N3ZA 3PXAA 3WR5A 4UHCA 4LQDA 3BTUA 2C54A 3I9JA 1CVIA 3ABRB 4P6VF 3MBIA 4WECA 3OEEA 3UC5A 2EEZA 5BN1A 2JHPA 1BVRA 1PAUA 1ODTC 4QBHA 1XRNA 2XJ9A 3RRYA 4HGPA 2DSTA 3QLUC 3OIDA 3PD0A 1W87A 1BRMA 2RBEA 4Y2SA 1FYFA 1ZZGA 4ER6A 3DDCA 3K71B 3U1TA 1CCWA 1HZZA 2Z95A 4L72A 4JVMA 3RK1A 5CCXA 3KD2A 1PNVA 3MYYA 2VSXA 2MSDB 4I5IA 3ZHRA 2DFTA 4A15A 1QGUB 5LMUB 1N5MA 3L9XA 4XUCA 5BOVA 4BRZA 4Y1EA 4ILKA 4MRMB 1Z33A 4H4DA 1Y5IA 1XZMA 3OSUA 4N9QA 1WBJB 3W34A 4B84A 3VFDA 3IQXA 2OSBA 3PGLA 3AIKA 4KZKA 3TLMA 1QHIA 4HAXA 4QL3A 2H4JA 2OCGA 1O7JA 3RTEA 4X7MA 1S0UA 3O4GA 1QGUA 1DOZA 4ZCLA 2NV2B 3HY3A 3ZBTA 4MRMA 5CYPA 3U6BA 1MC5A 3TOXA 3ZDEA 1LS6A 1HLFA 3C1UA 4B6SA 5BQXA 3SHOA 4YMTA 3RAEC 4CU2A 2QAGB 3G5TA 3HU1A 1RADA 4TMVA 3K09C 1VHLA 4P32A 5C35A 1M83A 4EPTA 2WFLB 2CUNA 3HGMA 3FGNA 1IBRA 3VNQA 4EFMA 1A9YA 3S2SA 2XCQA 1NAIA 3CZMA 1GG9A 1H05A 2JCVA 3ETJA 4HO1X 4RZIA 2F55A 1M67A 1I0ZA 4TGLA 4RWZA 1RHMA 5A05A 2QAGA 1DE0A 3G5LA 5F52A 3QE4A 4GQAA 1QIIA 2C61A 4S04A 4WFIA 4AUMA 1GDTA 2WFLA 4DLTA 3M33A 4DY4A 4CVNA 2EFEB 3RW9A 2CDBA 2O8DB 1PTJA 2P90A 1J21A 2AJTA 3ORYA 5CLLA 2YZNA 2ZBPA 2ZTVA 1T2NA 1KSGA 3PWSA 4IYJA 4DDWA 5EQFA 3NUQA 2YWGA 2O19A 3UT0A 4Q3CA 2GCGA 1XK7A 2CWDA 4JD5A 5H8WA 3TZBA 1TJYA 1TFRA 4LNUB 4CQNA 4QYTA 3QMMA 3FLAA 4K9PA 4PYNA 4Q3DA 2O8DA 1RLTA 5LZ4A 5DTJA 3OZFA 2QN8A 1XNHA 4PICA 2V1UA 3QVMA 2ZT6A 4G5HA 2FEXA 5F21A 1Z37A 1AE1A 1S2DA 5F2NA 3OWHA 2B34A 2ZU6A 2OBBA 4RVSA 1GZ4A 1WNTA 4IWXA 4YT2A 4R1NA 4KE9A 5AVRA 4LNUA 5DK4A 4PZZA 3L8DA 2QUIA 1VHTA 4DS3A 1E5VA 3LRTA 1VG0B 1E9RA 3PSAA 4U39A 1TU0A 3LBAA 1P1HA 1ARZA 4FQ8A 4RZHA 2WAMA 3TUJC 3LQQA 1IXSB 2GD1O 4CG2A 1YGPA 5JNRA 3D54D 2ACWA 5IJ9B 4W9MC 1P1IA 3ENWA 4TKVB 1NNUA 3UBMA 1MOZA 1M9NA 1LWNA 3E3MA 3QOXA 5GGXA 3CEMA 3OX3A 4EABA 4ND5A 1XDBA 3F7MA 4ICIA 1IJBA 5LA6F 1HOTA 2C2KA 1AGRA 3QWFA 2ORVA 2B1QA 2MSCB 2RGWA 2WTEA 3JASB 4YNBA 3ZU3A 4JI4B 3GGDA 1A9RA 3N28A 4IDGA 3RTDA 5IJ9A 4TKVA 1HUQA 3U5TA 1PT7A 1DBPA 3PFNA 3JQ9A 3QEKA 3AVWA 3ZBPA 3URKA 3NJ8A 1QIJA 2JFQA 2GN2A 3H1BA 5JEEA 4OHKA 3AVPA 4PHFA 1Z5VA 1H0RA 3JASA 4HYYA 4K5QA 1D9XA 5B58C 3S2ZA 2YCLA 1OZ0A 2ZUCA 3GJTA 2PUTA 2QRMA 1GADO 2EW1A 1OYWA 1RKBA 4DLBA 5A5EA 3LHKA 4INJA 4OHPA 2DCUA 2BUCA 2ZEJA 2QX7A 3UT5B 4DLKA 5FNZA 1VXRA 4ETWA 1N8SA 4YASA 4ND7A 3DDSA 3M5WA 4KYTA 3TG8A 13PKA 4M0CA 3RR2A 1XZFA 4QDJA 1HTWA 4NK5A 5HOQA 2BRUA 2WG0A 1K1EA 1TKRA 1H2XA 2RGUA 4ONEA 4R81A 1JEYB 3P20A 4P7JA 4XA8A 1VL1A 2B1RA 1IZZA 4PGFA 3UT5A 1NBEA 3I6MA 4AFNA 1Z88A 1BVHA 4V0OA 3LU1A 2GDZA 2WBLC 5DI9A 5HCUA 4YRAA 4JB3A 3GJZA 3KJQA 3MT7A 3LW8A 1L5RA 3B2EA 5SYAA 4MA4A 5K3EA 1JEYA 3GYGA 1M2JA 1NJ8A 2C84A 5CJPA 3RIGA 3WXBA 4A6PA 2G08A 2QD4A 5FA6A 5EXTA 4IJ6A 3W8EA 5A4KA 4V0NA 4S1NA 4XQCA 1MABB 3DJYA 2C2WA 1EFKA 1DT3A 4G97A 1GRQA 1XCJA 2MMGA 2P0AA 3BWBA 2J5XA 2WTUA 4U7PB 2D5CA 4XGNA 3UXMA 3T9DA 1KI1A 3TCXB 3E58A 3KYCB 4JGIA 1NUQA 3D4IA 4AG3A 1B73A 4C07A 5L6MB 2OFXA 3SWWA 4IQ8A 2IJGX 3IVAA 4ZV7A 2NMVA 1MABA 2QYSA 4C04A 4GMFA 3B1ZA 1E9SA 1OFTA 4KO1S 5C5IA 2PRZA 5IH3A 2C29D 3KYCA 4CMAA 5LB2A 1T5OA 2O2SA 5F1PA 1SPBS 1EQAA 1WB5A 1BJKA 3EVFA 1ILWA 4CE6A 5JAOA 2R47A 1LD3A 1OW3B 2ASVA 2ZAYA 4BFCA 4KMSA 3T52A 1G7TA 3HN2A 2IK8A 4Y6OA 4QOHA 2GPTA 3DDUA 4UBOA 2P2SA 4OJTA 2OWDA 2FZWA 3L7NA 4AP6A 3UMMA 5JJBA 3T0FA 3WP1B 1IOLA 3ZJYA 3AM3A 1PG2A 2MYUA 3O7MA 4BNKA 3FMGA 5KTRA 3S7ZA 1FQKA 5KYWB 3AFGA 3RF6A 1NW8A 3BE4A 4KMRA 1YI1A 2ZYRA 3C98A 4LC1A 4ZAGA