4JBHA

2.2a resolution structure of cobalt and zinc bound thermostable alcohol dehydrogenase from pyrobaculum aerophilum
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
333
structure length
333
Chain Sequence
b'HEMRAAAFSTPGLENLKLVEAETPRPGPGEVLIRVKYAGVNPLDYNVVAGAVKASPMPHIPGSEFAGVVEEAGPGVTGVSRGDPVVVYNRLYCGHCRQCLTGWTQMCEVTGGGIIGIVTQGGYAEYAVVPAKNAVATRADLKEAATLPIGALTAWNMAYRASISPGEKVAVVGATGNVGIYAVQFAKLLGGEVYAISRRKAKVESILKSAGADAVLTPDEAKSAAPFDVVLDPTGSASWDLSFGVLGRGGRYVTAGALTGAEVRLDLRRLYGMQILVIGATGGRRADFNTVVRLLEAGRIKAFLHNVYPLADVRKALEELRSPERVGKVLIAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alcohol dehydrogenase (Zinc)
publication title Physicochemical Characterization of a Thermostable Alcohol Dehydrogenase from Pyrobaculum aerophilum.
pubmed doi rcsb
source organism Pyrobaculum aerophilum
molecule tags Oxidoreductase
total genus 100
structure length 333
sequence length 333
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2013-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4jbhA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4jbhA01
4WLUA 4ND2A 4L4RA 3X2FA 3INRA 2V65A 1C1XB 5ADHA 5JO0A 1PGQA 3A28A 1KS9A 1Z7BA 2O23A 9LDBA 4TRJA 2RAFA 4DREA 2XXBA 4EI2A 2QYSA 1SPXA 1I2BA 4GI2A 3ZHZA 1K6IA 4ALLA 1DPGA 2EP5A 3HDHA 4KDEA 5IDYA 4E2YA 2W8ZA 2DFVA 3WLFA 5A9TA 5G0WA 2JD1A 3OP4A 3KBOA 2WTBA 4NBVA 3R3SA 1PJ3A 4HNHA 4HNGA 1E5QA 1K3TA 4OSOA 4RF2A 5CPBA 4NU5A 1I2CA 1H2HA 4O59O 1GYQA 4CM4B 4RCVA 4LVUA 5I7SA 1N7GA 1PJSA 5F1PA 4HFRA 4JJIA 1CERA 1YL5A 1YOVA 4K28A 4QTZA 3K30A 1ZK0A 1NAHA 2QZZA 1F14A 1DHTA 4Y6SA 3FF4A 3AY6A 2NVUA 2W2KA 2O2YA 4Z0TA 5B4UA 5JDIA 1BTOA 3ICCA 3QA9A 1RYDA 2NSDA 4E5KA 2Q49A 4IDAA 1XA0A 1EQ2A 3RC1A 1MV8A 3O4RA 3BTVA 1KVTA 1DXYA 1O0SA 3OF2A 4LRTB 1C3VA 3ON5A 3DZGA 4UAGA 5FI5A 3QJ5A 3D5TA 2YW9A 3BMQA 3L0DA 3RUHA 5TLSA 1KY5A 2TMDA 2Q1UA 1W73A 3NJ8A 3LT2A 2QZ9A 2BH9A 2DUUA 2WE8A 5AVOA 3WWZA 3L9WA 3FBTA 1YOVB 3GEDA 2PWZA 4FCCA 3UICA 1AHIA 3JTMA 3GVXA 4WLOA 2NVUB 2W2KB 2D3TA 1PGNA 4E12A 2I3AA 1PL6A 1A9YA 3WGZA 2EP7A 3D7LA 2HMWA 4J90A 2O7QA 4IXTA 4XB1A 1LNQA 3C3XA 2VRCA 3ABIA 4ZN6A 4M55A 1JU9A 5C7IO 3IDSA 3C1AA 3RFTA 1DFIA 3U62A 3QVWA 5FWNA 3BMQB 1ZEJA 2R00A 3RBXA 2A35A 1VJ1A 4KUEA 4BMNA 3ZU5A 4AJIA 1RPNA 3OQ6A 3AK4A 5CFZA 2YHIA 5F1OA 4IY1A 3IUSA 3I3OA 4YJFA 4H15A 4CV2A 1LX6A 1I3KA 3IQDB 4BNLA 3RUFA 3P7MA 1RM3A 3OJ0A 3ZU3A 2RIRA 4L4XA 4BO9A 3F1KA 1DHRA 3I23A 4RL6A 3H9QA 1H5QA 5C37A 3H2SA 1NBOA 4HP8A 5EJ2A 1NVTA 3DMYA 4NR0A 3GUCA 2ZATA 4N5MA 1SO8A 5TX7A 1E3LA 2G1UA 3PLNA 4UVGA 5EIOA 4WKGA 1BHSA 4XB2A 5T6BA 3ST7A 4RZIA 1H6CA 1TT7A 1Y9EA 2EJWA 2DBZA 5K6AA 2YHIB 4G5HA 4Z9XA 4YJFB 1VJ0A 3U0BA 3HDQA 3X2EA 3RUCA 3W6UA 5JAIA 4E2WA 4B3HA 3NV9A 1UR5A 1BSVA 1RYEA 1V8BA 1VL0A 3AY7A 3V2UA 4RDHA 2DUWA 5DCWA 1PIWA 1U2GA 3H9UA 3PGJA 1Y1PA 1JLLA 4P4NA 4TRMA 4YVFA 1NP3A 4B4UA 4YAKA 1NTOA 3W4KA 4HBGA 1F17A 5C5IA 1MFZA 3ITKA 1NQ5A 3ETDA 4E4YA 4FC7A 4AJJA 3RFVA 3R1IA 4W9NC 2NU7A 2VYNA 3WWYA 2Y93A 3W8FA 3QWHA 3F4BA 2RH8A 3HFGA 3MJTA 4O0LA 4HWKA 2C29D 3K92A 1LU9A 1QYDA 2Q3EA 2Y0CA 3RIHA 3GMSA 5FFFA 4ALJA 3HDJA 4MO2A 5GY7A 1H94A 3D4OA 4XYEA 1FMCA 3PYLA 5HS4A 2G82A 3U49A 1HWYA 1R6DA 3NTOA 2BLLA 3AOEC 7ADHA 2C2YA 1YDEA 1ZK2A 4BNHA 3PQEA 2HO5A 2P9EA 3IKTA 3Q2KA 2WM3A 3ZWVA 3G79A 4BIIA 2J6IA 1LSUA 1EBFA 4BNYA 2J3JA 1DRUA 4DBZA 4CMIA 4NH4A 3CUKA 1ZJYA 4XYGA 1LRJA 1CEQA 4B4VA 3VZRA 4RQUA 5L45A 4K6FA 3P5SA 3GRPA 4EW6A 5IDXA 3ORFA 1EDZA 3DB2A 1HLPA 3CH6A 1Y81A 3EZLA 5J23A 1LC0A 4UULA 1ZNQO 2WYVA 2Y66A 4G2NA 4J0FA 1HETA 2X23A 3INGA 1U7TA 3RJ5A 3HNPA 2O7SA 2Y68A 2HLPA 1X13A 4U0JA 4PRKA 1LUAA 2H63A 3QHAA 1ULSA 4WASA 1LLUA 3PGXA 2C7GA 3RJ9A 3GDGA 2BGKA 4PRLA 5G0SA 1X0XA 4CMIB 3KSZO 4MVJM 2WJPA 4FN4A 2O3JA 3DAPA 4INAA 2O48X 2GN6A 4OJNA 1K2WA 1SCUA 2RCYA 4A73A 4Q3AA 4DIFA 1N7HA 5IZCA 2VYVD 5G0VA 1HE2A 2C2XA 2UV8A 4RLSA 1EE2A 5GZ1A 3I9MA 4XEHA 1VL8A 3KYBA 1K89A 1LQUA 3KRTA 4IIUA 2I65A 2X7HA 4YRBA 3ANMA 5DBFA 4AJEA 1KETA 2OBNA 2GERA 1Y9AA 3ZN2A 4I5DA 1DLIA 4J49A 1GY8A 5G2OA 5CG1A 2YZ7A 4CR6A 1PWXA 1VJTA 4RVGA 1N5DA 5A9RA 3H7AA 3S2GA 3E03A 1JN0A 1I3LA 1NPYA 3F3SA 3B70A 3EVNA 3VPFA 3ZW8A 5A06A 4IDFA 3GGOA 3W8DA 3DONA 4DUPA 1HYEA 1NASA 1ZIDA 3EK2A 4J43A 4JROA 1SB8A 3QWBA 4NBWA 1V0JA 4BHTA 3NDRA 3VOSA 3SX2A 2ZIZA 2E48A 3GHHA 1G0NA 5G4LA 4CM9D 2GDZA 2GYYA 4LSMA 4E32A 1I33A 3PFFA 2CDBA 3D4NA 3GT0A 4FJ2A 4YT2A 4DLBA 1NQAO 5TSDA 2P9GA 4PG7A 3AJRA 1K6XA 1ZEMA 2C5EA 4RQTA 3IP1A 3SBOA 4WLVA 3WGOA 3WMXA 3JD4A 1SNYA 4KUGA 4XD2A 5AXBA 5EMHA 4BNWA 1P9LA 4URFA 3PFWO 1MP0A 4C4OA 2J3KA 2B4RO 4HFJA 4XDYA 4B7CA 1QYWA 2AMFA 5JDIC 4FS3A 3C24A 3OICA 4MIEA 3GC6A 3UW3A 2FWMX 1S7CA 1AUPA 1EQUA 2BGMA 4B7XA 4EUFA 3ZWXA 3RUDA 2AEJA 2EXXA 3FR7A 3FWNA 3GAZA 4PLGA 3PXXA 4WUVA 1B7GO 4D44A 3C7AA 4L9RA 3RU7A 3AI1A 5IF3A 1W0CA 4IUYA 3OQBA 4CMHA 1A72A 2YFQA 4E30A 3MEQA 1FDUA 4BKOA 2ZTMA 5CDTA 3E5MA 3AM4A 2GR9A 2PK3A 1N92A 1LC3A 3GUYA 3EC7A 5B4TA 4OHUA 4LGVA 3FHLA 3ETEA 3PZBA 1PL7A 5JO9A 1HDCA 2PKQP 3BHIA 2BI8A 4ALMA 3B6ZA 3EZYA 4G65A 2PGDA 2Q46A 2ZK7A 5COAA 1JKFA 1DAOA 4QT0A 3ZV3A 1GL3A 3WX0A 1SZJG 2EW8A 2WYUA 2GN4A 5DULA 3KB6A 4D42A 3PK0A 2P4HX 3DL2A 4I1IA 1EDOA 3T4EA 3C8MA 1YKFA 3GQVA 5C7OO 1O95A 1ZBQA 1B16A 1EUDA 1JDJA 2G17A 1HKUA 3ENNA 4FQ8A 1G6KA 3CTMA 2VHWA 3ZWCA 2CZCA 4PN3A 3OETA 4RDIA 3ZWAA 1ISFA 1R4NA 3R3JA 1BMDA 2FPIA 3FNHA 3VVCA 4CM6A 3RUEA 3TRIA 3MOGA 3TZKA 1LRLA 2AQ8A 4DGSA 1U3VA 4BNIA 3E6AA 4D41A 1ID1A 2OZPA 4NI5A 4OO3A 5JMWA 2YY7A 2HMVA 4WCDA 1EFKA 3VHRA 3VZQA 4JP3A 3WICA 1JVBA 5DN9A 5CDSA 2A92A 2W90A 1DIAA 2ZKLA 4IDDA 4ZQGA 1GYPA 1CWUA 2FR8A 2DBVO 1T1SA 1VE9A 4HUJA 1C1DA 5HRUA 1X7GA 2RH4A 5L7TA 1RM0A 3MJVA 4RVUA 1T24A 1VPDA 5K6AC 2GZ1A 4CUJA 3ZW9A 3DEYX 4W7IA 4GGOA 3VH4A 1R4NB 2YDXA 1V3UA 4U7WA 3WQQA 1J5PA 1XWFA 5JYEA 2PV7A 4I9NA 3WR5A 2CVOA 4WPGA 2ET6A 2CMDA 5K1SA 4BNTA 2WWRA 5JS6A 1UP4A 4Z3DA 1F12A 2PA3A 3HQ4O 1JWBB 4MIYA 3VKUA 5L9AA 4HXYA 4XX0A 1PGJA 1LDEA 1ARZA 1YVEI 5ICSA 1B8UA 1C1DB 1PU2A 4Q3EA 4K26A 4R3NA 4EJMA 3DFZA 1DJNA 4ZICA 1YQGA 4Q3NA 3WLEA 4RF5A 1AXGA 1H0KA 3EW7A 5JC8A 1LLDA 3NT5A 1XR3A 4JJGA 4FFMA 3SC6A 5ILOA 2R2GA 4CMBA 4ONEA 3TZHA 5DNAA 5BNIA 1T4BA 3PWZA 4NU6A 4HX5A 4DMMA 4CM7A 3NYWA 2GNAA 2GUGA 2X0JA 3DAGA 3E1KA 3KTDA 2PFGA 1HEUA 4Y6PA 2Y0DA 1EFLA 4XYBA 4QSMA 3V1UA 4QFDA 2C82A 1EBUA 4DVJA 1KC3A 4NFSA 5K9ZA 2Z1NA 4ZU3A 4NJOA 4DPLA 1ISHA 1WVGA 2EGHA 2IZ0A 3KYCA 3QE3A 4E2XA 2OHXA 3K2BA 2GRAA 4BO2A 1ZO8A 4P8RA 4YB8A 1E92A 3E48A 4QO8A 3QY9A 4BNXA 2O3RA 2Q2VA 4Z9YA 3I1JA 5A03A 3GFGA 3W4IA 5CAEA 3NT4A 2ZJ1A 3H5RA 3WDSA 3FTPA 1O6ZA 1WDKA 3C7DB 1WXDA 2I99A 2A94A 1DFHA 3H9JA 5LC1A 2GZ2A 3B1KA 4HFNA 1HE5A 4JIGA 2PZJA 2EW2A 5BR7A 4NBRA 4BO3A 5CEJA 1UZLA 1U2DA 1OC2A 3D1LA 1QV7A 2HAEA 1PGPA 4QEDA 3WTCA 2IXAA 4UUPA 3BMOA 3WFIA 3I9JA 1YH3A 2O3QA 5HWSA 1YONA 2FR0A 3KYCB 2NACA 4OQYA 3WGQA 1FDTA 3NDJA 4J91A 4J4TA 4ZD6A 4EUEA 4P4GA 1JQBA 5COBA 3TSCA 1GZ3A 3BTUA 4CMEA 1PTJA 1R66A 5GMOA 1KIFA 5BNFA 1D1SA 1LI4A 1EUCA 2DPGA 4XWYA 1JWAB 2W2LA 3DTYA 3WYEA 3ZNQA 1R12A 1GQ2A 3UFXA 2P5UA 1TVEA 4Y8VA 3AOEA 1N1GA 1HYHA 4I9UA 2O3SA 4IDBA 3V1YA 1ENZA 4Q9NA 1PEDA 4E33A 2ILTA 5CHEA 4L0QA 4NMHA 1I30A 5DCYA 3KLMX 3TPCA 6ADHA 4D79A 1HZZA 4GAEA 1Z7EA 4OGWA 3DXFA 1TEHA 3PQDA 4XYMA 3PLRA 3M2TA 3IAHA 3F9IA 5BNTA 4DA9A 3TN7A 1JA9A 1SOVA 1L7DA 4GLOA 1PJQA 2YDYA 2HJSA 3JQGA 4CLHA 4FFPA 4ND5A 5DCUA 2O50A 1VC2A 4CQMA 3WGHA 5IG2A 4BV9A 4U8GA 4HKTA 4UUOA 1BXKA 3C7CB 4N7RA 3WGGA 1YB5A 3DBRA 1NYTA 2FHSA 4MVJA 4BMSA 1XU9A 1KEUA 2I3GA 3DZHA 2J5KA 1CDOA 3L6EA 3VH1A 1A4UA 2GO1A 2J8ZA 1BDMA 1DIBA 4YEDA 4OAQA 3DZBA 4Z0PA 4R5HA 3D5QA 1QP8A 4FW8A 4LISA 3S8MA 3MJ4A 1ZXBA 4JLWA 4KZPA 3NGLA 2D0IA 4YAGA 3JQGB 1MXFA 2GLXA 2IODA 2D5CA 4L76A 4UVHA 4CQMB 4IMRA 1QYCA 1VLLA 2OBYA 4PVDA 3TDKA 3WIEA 1HTBA 4H3VA 3HUDA 4CMKA 2Y0EA 3DBRB 1PJBA 5ITVA 1V3TA 4PLCA 1NPDA 3VZSA 3ZHBA 4ESOA 4OQZA 3HDYA 4K1LA 1YS4A 1T2FA 1PS9A 2O4UX 3NUGA 4RJTA 3AU8A 4CLOA 4IQ8A 3RD5A 3GNQA 5I8ZA 4MDHA 4IJUA 4Z3KA 3V5NA 2VYVA 3GEMA 2Y05A 2IZ1A 4XGKA 5IDWA 2D4AA 4KMSA 1ZSVA 4JQCA 1BRMA 2LDBA 4IJVA 4BGIA 3CPSA 1JAXA 1YBVA 1LDNA 3JQFA 3LC2O 5U9CA 4CMGA 1GCUA 3I9LA 1XQ6A 5CDYA 1YO6A 2JHGA 1B14A 5L4LA 3G17A 4DIBA 5LDHA 1K0UA 2AQIA 4EUHA 1P1RA 3BA1A 3PHHA 3I9OA 1LBEA 2CD9A 5IXSA 1X0VA 3EVTA 1GUZA 4J1SA 4IZHA 4EZBA 4EITA 4A2CA 1E1NA 3RQSA 1QMGA 3WBBA 2X8LA 5I9NA 4E5MA 3LLVA 2C7VA 3E9MA 2V7PA 3W1VA 3OIDA 4CLOB 4U5QA 3ADPA 3COSA 4FGWA 4L75A 3QQPA 4CM3A 7MDHA 5AXCA 1HRDA 2NM0A 4JK3A 4GX1A 2E4AA 3N7UA 4OXNA 5TNXA 2ZTVA 1XDWA 1SEVA 1PZHA 1WLYA 3MOIA 3S2FA 3JYQA 4Y9DA 5DOVA 3Q6IA 4XQ9A 4XKJA 3PJDA 1MG0A 4Z0HO 1OI7A 4J9VA 5A4DA 3LSYA 3FSRA 3WTBA 1QG6A 3ITDA 1SAYA 5EERA 4MVJG 4KQXA 2NTVA 3F4LA 3OQ1A 4OH1A 4RVDA 4D3SA 3BHMA 3QVOA 3C1OA 2PTGA 5ILGA 2Q99A 4N54A 3WOHA 4BO0A 3I52A 3JQAD 3DBLA 1I0ZA 5H83A 1WZEA 5EINA 3ZZNA 1E3IA 1I2ZA 1X7DA 5TF4A 1JAYA 3DHYA 3OH8A 2X5KO 3OMLA 1GV1A 5JXWA 1DEHA 4AVYA 4BNZA 2OORA 3ICPA 5JAZA 3EDMA 5L3ZA 1LJ8A 3O26A 1JVSA 2RBEA 4WEQA 5CEFA 2VHYA 1PJ2A 3RI3A 3OECA 5T8KC 2VT2A 3OBBA 3ENKA 1TI7A 1XKQA 4KDFA 2NQTA 3C1TA 3WJ7A 2AE1A 1A27A 1A4IA 4ND4A 1YJQA 2DU8A 1XG5A 3PTZA 1IOLA 5JYDA 3ULKA 1Z82A 4KTVE 4I5EA 2OOSA 3NRCA 2HRZA 3QIVA 3DBLB 2E37A 4O6VA 4ZRNA 5IN5A 3UKOA 2CUKA 5ICMA 3V2GA 3WNQA 3GPDG 2PKRA 4N18A 1YB4A 3Q9NA 2QRKA 2EKLA 2ZJ0A 5C7LO 2NVBA 1VKNA 4ZQFA 2NVWA 1AE1A 5COQA 3JQ9A 4BOYA 4LN1A 1V3VA 3CSDA 4ZHSA 4ID9A 5A3VA 3DZKA 4N5NA 4E0BA 4W82A 4BO6A 2HCTA 3KSUA 1FJHA 1WP4A 4QQRA 5L4SA 4UVDA 1Q1NA 5TS3A 1E7RA 5EQFA 1D8AA 3AUUA 3SXPA 2DM6A 2HK9A 2ZQYA 2PZKA 3ROKA 4DYDA 1MX3A 3Q9UA 1B26A 1P31A 4NK4A 4YXFA 2WD8A 1ZW1A 4ROSA 4YT8A 3RFXA 5JNLA 4RORA 4CM5A 2AG5A 1P74A 2IXBA 2DTXA 4PLVA 5JCJD 4YACA 2I76A 3QVSA 3JCZA 3GGPA 1X14A 1GZ6A 4J7XA 2J5QA 4GVXA 1ZUD1 1ULUA 1KBZA 4BS9A 2UYYA 3T7EA 1ZK4A 3KSDO 2H1SA 4A5OA 2AQKA 1KERA 5MDHA 1H6DA 3VH2A 4EJ6A 3MJSA 5AOVA 9LDTA 5DZSA 3BZUA 4CMEC 1J4AA 3NEPX 4AFNA 3AFMA 1E1MA 1Q0QA 2VOJA 5KJFA 2W4QA 4GVLA 5KOIA 3E18A 4FOOA 4P4LA 3WIDA 3S2IA 3VZPA 3WGYA 5A02A 3PHLA 1YGYA 1LDMA 4R51A 2JJYA 1M76A 1BVUA 3K96A 1IYZA 2XXJA 2D8AA 4AJNA 4RV9A 4BKUA 4KTTE 4MKXA 2ZTLA 2EIHA 3TL2A 4F46A 5JCXA 4R1SA 4BNFA 3IUPA 3DHEA 3UOGA 1PZGA 4Q3BA 1PX0A 1DBVO 3WQSB 3ZV5A 3QWAA 4BL5A 1OFGA 4CM8B 4UVIA 2JD0A 2VOEA 3IOYA 2B37A 2P4QA 5F5NA 1QORA 4OOFA 3CZRA 3JQ8A 2ZQZA 3NKLA 5I7FA 5JY6A 3O9ZA 4BO4A 2IEBA 3WS7A 3KEQA 2V6GA 1A7AA 3K31A 2DQ4A 1SEPA 5DT9A 2X0IA 1A9ZA 3PZRA 4IDEA 1XU7A 4MOWA 1Y8QA 1N1EA 2Q2QA 4R5MA 2AG8A 1U1IA 3PJFA 3UHAA 4RGBA 1FK8A 1NR7A 3FR8A 3L77A 5TIIA 5KVVA 1WMBA 3D3EA 2YV1A 4BQPA 4W4TA 2X4GA 2FMUA 5DF1A 3ANLA 1P3DA 3GK3A 4YDRA 1XEAA 2ZCUA 4XGIA 2C07A 2P91A 3MWDB 4FD3A 3JQ8B 4TKMA 3GVIA 4XJTA 5L40A 4YR9A 4W99A 3G1UA 4AICA 2FRDA 3RC7A 3GVHA 1GD1O 2NADA 3ZWMA 2C20A 2E6UX 2UAGA 1P1IA 1I3MA 2VZ9A 3TJRA 2B5VA 3KM0A 2NLOA 4B3JA 1Y8QB 1ZSNA 3ZWBA 4CUKA 4ZJUA 1O94A 3WG9A 3MJCA 4D43A 2HU2A 4UUMA 4Y98A 3H5NA 1R0KA 3LDHA 3LLSA 3V2HA 2EG9A 2QG4A 5LDGA 1PQUA 4DLLA 1WAMA 2YV2A 4GMFA 1N2SA 2CVZA 3JQFC 4EBFA 1E7MA 3CXRA 3I6IA 4XIYA 1Q2XA 3HJAA 3UN1A 4BKPA 4YQZA 3PIDA 4J7UA 1DC5A 4M54A 2QX7A 1DC6A 1D7OA 3ZU2A 4TZTA 2PY6A 3SLKA 1WZIA 3OM9A 4XR9A 1Q7GA 5F21A 5AXDA 3H6KA 5JE8A 4BO8A 5A9SA 2X9NA 3E9NA 5I9LA 1KC1A 1TT5A 1SOWA 1Z75A 5I7EA 3FPCA 3L4BC 1UXJA 2BF7A 4II2A 5BSEA 1LTHR 5KKAA 3EUWA 3PDUA 1DRWA 2GZ3A 2I5PO 2BD0A 4TVOA 5H81A 4A10A 1H9BA 4NIMA 1L7EA 5TGDA 4PLYA 1YL7A 1GQYA 4Z6KA 8ADHA 3GGGA 4BO1A 5CPFA 3HZZA 2I66A 3DDNA 1GEGA 1R0LA 4PLTA 4WOJA 4WLNA 1C14A 3GZNA 4FFNA 4NPCA 3RASA 4FFRA 1ENYA 4ZA2A 5T57A 3DZJA 1G0OA 3U3XA 1M66A 5T64A 2WYWA 3A14A 2YFHA 1SBYA 3OJEA 4WLFA 1AXEA 5THKA 3WYCA 2HJRA 3SJ7A 2Q50A 3ROQA 3LU1A 4CV3A 3L6DA 3HN2A 5G0UA 3ZNNA 2NTJA 3EMKA 2D2IA 3PHJA 4N5LA 5G0TA 5A9SB 3JQBA 3AOGA 5FEUA 2EWMA 4J4BA 1TT5B 3P19A 2H5LA 4C7KA 4A03A 5KNLA 1G1AA 4LCEA 3WXBA 1Z6ZA 1ZMTA 4S1VA 3WNVA 4KUHA 4CLXA 4NZ9A 3UAGA 2CF6A 2PNFA 3WYBA 5KJCA 1CF2O 5T67A 3VAZA 5EESA 1LSJA 5L7YA 2XOXA 4ZQBA 3U09A 2OFPA 2PR2A 3E82A 3GZNB 3EGOA 2Q45A 3AW9A 3M6IA 1NAIA 4OKIA 4P22A 4QFCA 1DLJA 2DC1A 2YV3A 1HL3A 4D45A 3NTQA 4GPD1 5THQA 3WFJA 3L07A 1TA4A 1GZ4A 1LLQA 3DC2A 3K73O 4PLZA 4IBOA 5L53A 4A7PA 2Y1CA 2X5JO 3AUAA 3WSWA 4CL8A 4OMUA 1ZXLA 1K5HA 3KHUA 4NHEA 1Y5MA 2HDHA 1B8VA 2DTDA 4UEOA 4BVAA 2JAPA 3TFQA 4BNJA 3Q11A 5GZ6A 2CSUA 1PGOA 3JQ9C 3GVCA 3PJEA 4PGFA 1A5ZA 4IDCA 4R9SA 1CYDA 5B4VA 1XYGA 3OEWA 3PJGA 4GMGA 3ASUA 4JXKA 3HADA 4TWRA 4XYLA 4RO0A 2QHXA 4E13A 4MVJH 3RAJA 3RVDA 2VZ8A 4U6QA 3INTA 1C0KA 2V6FA 4EJ0A 2BRUA 3BAZA 3AM5A 1ML3A 4H7PA 4BNMA 5HM8A 3JD2A 5KTKA 1LLCA 3PP8A 3FN4A 5I7VA 4NFHA 5BSHA 4MVJI 5IZ4A 4R1UA 1I5RA 4E5YA 5F3RA 4K6CA 4FBGA 1UXHA 2CVQA 1D3AA 4TSKA 4JN6B 1PZFA 1KEPA 3D3WA 4CMJA 4BQRA 4CM1A 4LW8A 2VYND 5IFLA 2PD3A 1X7HA 2IRWA 3GH3A 4CR8A 2BMAA 3DFUA 1TB4A 4FSHA 3ONEA 1GAEO 1XIVA 4XGNA 2X58A 1CQIA 1U3TA 2JKVA 3JD3A 5L4NA 1EUZA 5T8KA 3KO8A 3FBGA 2VUSA 4ITUA 1X1TA 4WJZA 5U1PA 3WQRA 4F3YA 4YPOA 5L51A 4O1MA 2YJZA 1ONOA 4U6SA 5ER9A 1U5AA 3D3WB 4DBVO 1TXGA 4OXKA 4YRDA 3QP9A 4Q3CA 3BMCA 3NGXA 1DIRA 4CLRA 3VVBA 2C5AA 3NDIA 2P9CA 5JY1A 4F45A 4CLEA 3KV3O 3DOOA 1NQTA 2C59A 2AHRA 2FZEA 5KKCA 1E3SA 1H6AA 1MA0A 3N74A 4ZVVA 4CJXA 3M2PA 4LCJA 3TOXA 3WSVA 4GWKA 4MKZA 3KLPX 1HF3A 4JP2A 4M86A 2NWQA 3L6OO 3UCXA 3VPSA 3GDFA 4BMVA 1N8KA 1MC4A 5FF9A 5A04A 1E77A 2AE2A 1EMDA 4W7HA 3GLQA 3W8EA 3JQDA 4E31A 3U4DA 5B12A 2HKIA 3F5QA 4IQ0A 1KEVA 3AI3A 4A26A 1PS8A 1ISIA 3GAFA 4R16A 4GX0A 3BMCB 3EYWA 4CLRB 5F5LA 2C54A 3PRJA 2GGSA 4HFMA 4E6PA 1EEHA 1HDZA 4RF3A 4ZGWA 3W4JA 4PLPA 3ZHXA 2SCUA 1PQWA 1Q7CA 3HWRA 4YJDA 3JV7A 3D4PA 3LQFA 4GKBA 3STHA 4MP3A 3IS3A 3JD0A 4AJHA 1DJQA 3BYZA 2O4CA 3DOJA 4JBIA 3GDOA 1OC4A 1HXHA 1UP7A 4DL9A 4D0SA 3BIOA 1BXZA 2VUTA 4RPGA 2O2SA 3H8VA 4GX5A 4UREA 3WB9A 1UAYA 5HS6A 4WLEA 1EK5A 3WBFA 3DBVO 1KYQA 4XIJA 3ZU4A 4OSPA 1E3JA 4IMPA 2QIOA 4JBHA 2GSDA 4CV1A 4LSWA 3W6ZA 1PSDA 3N58A 5JMPA 5KJ1A 3JYLA 4JNKA 4FB5A 1DAPA 1P0FA 1OMOA 3IMFA 4BB6A 2X86A 4EEZA 1RKXA 4OYRA 4ILKA 4BB5A 1GCOA 1VRWA 4CLDA 5JLAA 1HZJA 2OMEA 2JL1A 5ES3A 4MINA 3PIIA 2X9GA 1IPEA 4TKLA 4CUZA 1WNTA 3O8QA 3WJAA 4ALIA 1QR6A 4BNGA 2Q1TA 4OOEA 5TJ9A 3IL2A 1WWKA 4DLAA 4ZQHA 3ROMA 1MGOA 4PFJA 3UXYA 4JGBA 4PIVA 3VPXA 1ZMOA 2DPHA 4DQVA 2CDAA 1LSOA 5HBRA 1GUFA 4Q3DA 4ZQEA 1L1FA 5GZ3A 1B8PA 1O89A 1S6YA 1ZFNA 3O38A 1GDHA 4E21A 3ZNPA 3I6QA 3ZWPA 2NU6A 4DWVA 3LC7O 4BUCA 4J2OA 4R1NA 1F0YA 3LF1A 3QRWA 5H82A 3NTRA 1NWHA 2JFGA 4GSKA 3QLJA 2BGLA 2G5CA 1PJCA 3FRJA 1E0DA 4HV4A 2O3UA 1BGVA 2WEKA 3GVPA 1OZAA 2B0JA 3UCEA 2IE0A 3RKUA 1BDBA 1MXHA 1FXSA 1NR1A 3UH1A 2Z5LA 1H93A 3O8QB 3A1NA 5ENDA 1RJWA 1IE3A 1LA2A 1IL0A 3JQBC 1YQDA 3VC7A 1LDBA 1DB3A 4PG6A 1NVGA 1H6BA 3FPLA 1LRKA 1D4FA 1J6UA 2BHLA 4B4OA 4NFYA 1H9AA 2Y67A 1I32A 2PZLA 2J5RA 4R68A 3SLGA 3I5MA 2OP0A 3VTZA 5MGBA 1ADBA 1CETA 1I3NA 4L73A 4AG3A 4QECA 4M8SA 1NFRA 2OL4A 2DFDA 1V9LA 1BXGA 2EGGA 4IS3A 2AA3A 5L7WA 1HSOA 2EEZA 4RF4A 4EYEA 4WGGA 2VUUA 1B0AA 4BNUA 4FC6A 2D1YA 1IULA 1KVQA 1PZEA 3OIGA 5ENVA 3SC4A 3HN7A 2YQ5A 3D0OA 3B20A 5KVQA 3ROPA 4CR7A 3BTOA 3MWEB 2Q1WA 1R37A 3OJOA 3VDRA 3SVTA 1ZH8A 3UGKA 1GR0A 5DOZA 1E6UA 2Y1OA 3LT1A 2D59A 3GEGA 3KUXA 3F46A 3U4CA 1CIVA 3EHEA 1AHHA 4HY3A 2BELA 4WE3A 4R69A 3TF5A 1QSGA 2DKNA 3TZQA 3L4BA 2NQ8A 1DSSG 4RZHA 1T2CA 3AFNA 3H5AA 1LDYA 1BXGB 4WCFA 1Y7TA 3I83A 4XJSA 4CQLA 3QV1A 4WEOA 4RPHA 2HSDA 2E82A 4II3A 1V35A 2ZB8A 5IXYA 1QYVA 1XELA 2CY0A 4CM9A 4DXHA 4XQCA 1XLTA 5DP2A 5JDCA 3CMMA 4J3FA 1P77A 1NXQA 4IJKA 1U5CA 4QXMA 3WGTA 1B15A 3HSKA 4BNVA 1YXMA 1DOHA 3FD8A 3JYPA 1YQXA 1HDGO 3E9QA 3LYLA 1U8XX 1MFPA 3CMCO 4L8VA 1YB1A 4TRNA 2GASA 3K8ZA 4IM7A 3RROA 2EF1A 4WK6A 6LDHA 3EY4A 3UUWA 2VQ3A 3JSAA 1VM6A 5JBIA 3FTNA 3G49A 4DTIA 4WCFB 5A5FA 3TZCA 1UJMA 4FFOA 3CINA 2PH5A 5JFOA 4CQLB 4DC1A 1DRVA 2R6JA 4PZEA 3VDQA 5TRTA 4BGUA 2AQHA 1ENOA 1QV6A 2DLDA 3H9EO 3JQ7A 1GPDG 2Y1EA 4AJ4A 4IS2A 2PGLA 4MJLA 2B5WA 2ZB3A 5TQVA 2F00A 2GD1O 2ZB7A 3U4HA 3WMWA 1P1JA 1R15A 1ZJZA 1T2DA 2I9PA 1N9GA 2YHUA 3TWOA 4FPXA 1O8CA 4X54A 4QO7A 4AL4A 3B1JA 1HLDA 1WDLA 2OO5A 1JW9B 3MCVA 4TZKA 5A1TA 3NAQA 4MPDA 1DFGA 1QXSA 2OXIA 5AQ1A 2X5OA 2O3TA 3S55A 4JBGA 2BFAA 2AW5A 4GL4A 3RC9A 3FWZA 4DRYA 4FR5A 1SMKA 1GV0A 1UUFA 4AJKA 1NPTO 2Q4BA 2LDXA 1GEEA 1E7WA 2NU9A 1VI2A 1E3EA 4YAJA 1NVMB 1XCBA 4CODB 3FNGA 1YWGO 1AN9A 3JQ7B 2VHVA 2P68A 4R41A 2EJVA 1KVRA 2FSSA 3HB5X 4Z9FA 4GKVA 1EE9A 4YTEA 1O5IA 3AU9A 5KJEA 1R0SA 1N9GB 1ZZEA 4CV0A 1EVIA 1Y8RA 3H2ZA 3TZ6A 3TFOA 5JW6A 3GOHA 1OOEA 1NWCA 1UXKA 1HDOA 4WNIA 4GX2A 4GGPA 4D3FA 3ZV6A 5CEEA 2GN8A 2NU8A 4YA6A 3K9QO 1GTMA 2YYYA 1DIHA 1NFQA 1GFSA 4PG4A 1MLDA 5B37A 1H2BA 4NG5A 3IC5A 1ZSYA 2EHDA 3RC2A 2I6TA 1IY8A 1UAGA 3VH3A 4WNCA 5A3JA 1DC4A 1U28A 2UUPA 4IGFA 2AEMA 2BFOA 1P0CA 4PLWA 3ZV4A 3PDJA 4LVCA 1GUYA 1QLJA 4EDFA 4RPKA 3JYNA 4DPKA 5IN4A 5HA5A 5CDGA 1VL6A 3KETA 1W4ZA 4JX8A 2DTEA 1LXCA 4YWJA 1Y8RB 2UDPA 2VWGA 2CNBA 4R54A 4CM8A 4NNJA 1PJTA 2VZ0A 2OP1A 3D64A 2H6EA 4YAEA 3T7CA 1M67A 5G4KA 3ZDFA 2W2LD 1ISJA 1IPFA 3OFSA 2CFCA 2Y1DA 3S1LA 4IPTA 2WDZA 3QVTA 3T4XA 3RBVA 2AEFA 2OUIA 4J4HA 3ZHYA 1EVZA 4KOAA 4R1TA 3FNFA 3IJPA 4Q39A 5I8WA 4ZRMA 3OHSX 1UDAA 2HMUA 3RUAA 3TQHA 4LMPA 1HYGA 3ZI0A 4FJ0A 3P2YA 3PPIA 4OIMA 2DVMA 1UH5A 3RUIA 4L4SA 1TLTA 2JCYA 3DHNA 2FR1A 1KEWA 3VKVA 3GY0A 4MVJE 5FYDA 4YT4A 1E1LA 3LF2A 1V6AA 4IGEA 4B4WA 3CEAA 3BHJA 3O03A 4CQMD 5JSFA 5KVCA 1P45A 4FGSA 1JTVA 3CE6A 1WMAA 2VHXA 4AJ1A 5G4KB 4BKQA 1D1TA 4YJGA 4AJPA 1DO8A 4YCAA 2A4KA 2VWPA 3QVXA 3PHGA 4NK5A 4DC0A 4MVJD 4IQGA 1LQTA 3FI9A 5KWEA 1IZ9A 4OXYA 2PGJA 2PH3A 2Z1MA 4M89A 4B8ZA 5HTOA 1Q7BA 4PCVA 2BKAA 2JHFA 2QYTA 2FOIA 2GPTA 1E5LA 1M2WA 3LT0A 2V6MA 2C0CA 1Y6JA 3BMNA 3Q3CA 2HK8A 2ZYAA 4PZCA 3PI7A 4JJFA 4ND1A 2QW8A 2CF5A 2ZB4A 4YAIA 1P44A 1X15A 3L4SO 4MIOA 4OM8A 3PQFA 4B3IA 1FF9A 3QWFA 2DBQA 2VWHA 2X6TA 1ONPA 3M1LA 2J3HA 4YJGB 4M87A 4YBZA 1RM4A 1VKOA 2HUNA 1ADGA 1I8TA 1PR9A 4BNKA 3OA0A 1T2AA 1O9BA 2NUAA 5JAQA 3DMTA 1EZ4A 2B69A 2FSVA 4PVCA 5FI3A 4BNNA 4CPDA 1NHGA 5ITWA 3QWIA 1HE3A 4O5OA 1DDOA 2PLAA 2HQ1A 2ZTUA 3ADOA 3BMNB 5EPOA 5B1YA 1WPQA 3ZCXA 2PZMA 1Z73A 2VWQA 3CZMA 1CQJA 3I9KA 3SJUA 2TMGA 2B4QA 4AJ2A 2GCGA 4UEKA 1A71A 1JKIA 3GF4A 4J1QA 2IEDA 1PWZA 1R16A 3HFSA 4J16A 8LDHA 1GU7A 1I36A 5IJZA 3AY3A 3GMDA 2IYPA 3V1TC 3GN1A 3GRKA 5KJ6A 2VNAA 1I24A 4DIOA 3G3EA 2VTEA 4YQYA 3ZWYA 2X0NA 2EKPA 3R0IA 2AXQA 1IB6A 2FZWA 1X1EA 1PR3A 4YJHA 4EGFA 4CMCA 5CG2A 1BW9A 4RVSA 1R4MA 4RPLA 5EN4A 4WCFC 5AXAA 4G81A 2WD7A 3VTFA 1DC3A 4GLLA 2XF8A 2EKQA 3DOCA 4XDZA 5JDCC 4I8XA 2BFPA 4R9RA 5I9MA 3RWBA 1B2LA 1NX6A 3NT2A 2P5YA 4XR4A 2FPPA 3ZWOA 3KVOA 4IXWA 4TRRA 1U9JA 3DO5A 2PKQO 1GPJA 1J0XO 1NFFA 1P1FA 1YE3A 2PD4A 3H65A 3MTJA 1KVSA 1UP6A 4J2HA 1ADFA 4Y6RA 4B79A 5KCZA 2QRLA 3JYOA 1QRRA 1VSVA 4YJHB 3GR6A 1GQQA 2FY8A 4XRRA 1BW9B 2Z95A 5AYVA 1KOLA 5T5QA 4I9HA 3OIFA 1R4MB 5CP8A 4MVJF 2WD7B 2DAPA 1QLHA 2JCXA 5TC4A 1AGNA 2VRCD 3GNSA 4P38A 2A9FA 3TOZA 1E7SA 2B4TO 3UF0A 1E6WA 1LDGA 2JFHA 3F5SA 3GG2A 3MTGA 3U5TA 3JQ6A 1PS0A 3E5RA 4R3WA 5LCXA 2WMDA 3ZH2A 3RSHA 2POQX 3Q0EA 5L95A 1U7HA 4GH5A 1UDCA 3IIEA 1M75A 1ENPA 1C0PA 1FDWA 2OGUA 2IYOA 4MKRA 4BKRA 1PJLA 1ZK3A 1CJCA 4RVHA 1UDBA 4TQGA 2X1HA 1W6UA 2Y1GA 3GNTA 4JCOA 4QUKA 5BSFA 1T1RA 2GF2A 4L74A 3I9NA 5CDUA 3DBHA 5TJHA 2BFMA 4WECA 5JAMA 2RHCA 2VN8A 3AUSA 1FDVA 4K9DA 3OA2A 3I4CA 2RHRA 5BQFA 3CKYA 4NJMA 4TVBA 3HB4X 2VTDA 3MZ0A 1M6HA 4LK3A 5DBIA 2R00C 4MVJP 1OAAA 2FN7A 5DBGA 4E5PA 3ONDA 4F6LA 3DR3A 1C0IA 4OKNA 2V6BA 2YUTA 3ZNOA 1JKJA 3V8BA 3IJRA 1P1HA 2VHZA 4LMRA 5EL0A 4QX6A 3S2EA 3PVZA 1ZVMA 4TMFA 4J1NA 2B35A 4NDNE 3DBHB 3KXDA 4PG5A 1BWSA 5TT1A 1IUKA 1PJ4A 3DZFA 1ONNA 1MC5A 1RM5A 3ZWNA 4WOKA 4E3ZA 3PHIA 4GSLA 1LSSA 2VCYA 4NJMB 1U3UA 3U4IA 4UUNA 1ZCJA 4J7CA 4XZ3A 1E7QA 2HMSA 3OSUA 2HMTA 1FDSA 1NHWA 3LC1O 2WSBA 1A7KA 3JQCA 3AI2A 3K6JA 3P2OA 1EK6A 1F8GA 4FIZA 4IIVA 1GADO 3AM3A 3LZ6A 4IJWA 2D5AA 1ADCA 2ZYDA 3AWDA 3I4FA 1XQ1A 4FDAA 5F1KA 4I5GA 3M1AA 4YYZA 3ONFA 5IAAA 3DZIA 4UEJA 3JQEA 4DQUA 3PWSA 3K2EA 5TT0A 1XSEA 5KVSA 3OEYA 4D3DA 2Q2WA 3KEOA 3AUTA 3DWFA 4XRGA 4A0SA 1MUUA 4FFLA 1WDMA 1J49A 3BXXA 4NBUA 5JC1A 2YQ4A 3KYDA 4J1TA 2QQ5A 1GYRA 3H3FA 2X9VA 3H9GA 2BI7A 1I01A 3GG9A 4J0EA 4H16A 4I08A 4KP7A 3RBZA 1UZMA 2EV9A 3CIFA 1PL8A 4O63O 1KVUA 3JQAA 3G0OA 3R6DA 3VPGA 4D46A 5KIAA 3KZVA 1KY4A 1SB9A 5K0ZA 2FP4A 1E7YA 4RPJA 2H9IA 3DQPA 4IZIA 4MP6A 3ZGYA 2GN9A 5JPIA 3NX4A 3LT4A 3IKVA 1HSZA 1HE4A 3A06A 1YL6A 3F1LA 4GQAA 4XQEA 1F8FA 3FNEA 5BSGA 3JD1A 3PYMA 2G76A 3K5PA 4CMAA 4D0RA 1IZ0A 4B8WA 4BV8A 3KYDB 2VNSA 1MB4A 1M6WA 2UVDA 4B7UA 2X0RA 3E8XA 1U4OA 1E3WA 1Q0HA 3HE3A 1YDWA 4YT5A 3JQAB 3TNLA 5DP1A 1W8DA 1NM5A 3RU9A 3MJEA 1Z74A 2CDCA 1U4SA 4AJOA 3OJFA 4J6FA 4BGEA 1UXIA 4M49A 3BTSA 1I10A 2IDZA 2PD6A 1E6EA 4OL9A 1QKIA 2DBRA 1T4DA 3H3JA 1QYXA 1HDXA 3OJLA 3DAFA 5EQDA 3UCFA 4FJ1A 3C85A 2IZZA 1IHXA 1T26A 3HG7A 4PLFA 1ZKMA 4DYVA 1VSUA 4PG8A 3F6YA 2Q1SA 2JD2A 2ZYGA 3FCOA 4C7JA 1T25A 4BO7A 2FPGA 2QRJA 1E3WB 1ZK1A 3DMTC 1DIGA 3GZ4A 1U8FO 1PQPA 5IZCC 4A27A 1ORRA 2X22A 1T2EA 3ETGA 3QSGA 4IDGA 3Q2IA 1OBFO 1WW8A 1XHLA 3DTTA 1MG5A 4UVEA 3GPIA 5JCJA 1BVRA 3GHYA 1HDYA 4ALKA 4ND3A 3RCBA 3Q1LA 4GBJA 4R4JA 2HRBA 4KWHA 3GN2A 1BG6A 3SEFA 4W9NA 4KQWA 1IHYA 1C0LA 3RKRA 1UXGA 1HT0A 4RVFA 2JAHA 2HK7A 4EEXA 4XA8A 4DQXA 2Q4EA 1XGKA 4J9UE 3B1FA 4XQGA 1K6JA 1UZNA 4DPMA 2UUOA 3HHPA 1P1KA 2B83A 4CL3A 1EVJA 1YBMA 1Z45A 1B3BA 1Q0LA 4I5FA 3GA0A 4DMLA 5C3MA 2JFFA 4R01A 3PWKA 1ISMA 5DDIP 4ALNA 4F6CA 3G1TA 5A5EA 4D7AA 3VPHA 3PYXA 3A4VA 1YBAA 1NQOA 4HADA 4E5NA 3BMOB 4S3MA 3NJ4A 1P33A 2W98A 3GFBA 1YJ8A 4M1QA 4BO5A 4YRAA 2DT5A 4U0KA 4NBTA 4RLHA 4KWIA 2Y1FA 1EVYA 3KOUA 1RWBA 4IINA 3QW2A 1U3WA 2F1KA 2E49A 3F47A 2VT3A 4MP8A 4XCVA 3H4VA 4NQZA 2Y99A 1SC6A 4Y67A 2WE7A 1Y5RA 1C1XA 4E2ZA 3L9XA 4GWGA 1LEHA 1B3RA 4FOSA 2P2SA 4PZDA 3A9WA 2J3IA 3IP3A 2XPCA 2JCVA 1CRWG 2ZCVA 1ISGA 2B36A 3PEFA 1YRLA 5BT9A 2EERA 3WGIA 2I67A 2NTNA 1NNUA 3LVFO 5A05A 5U4QA 3ZWWA 4AJLA 4W6ZA 1F06A 4TROA 2NV6A 1HDRA 5ER6A 2VRBA 4BGVA 3TL3A 2G0TA 3ASVA 3U9LA 3ANNA 3UVEA 4PLHA 4LRSB 5IDQA 3EAGA 2XAAA 4CM4A 1E1KA 2NNLD 3LK7A
chains in the Genus database with same CATH superfamily
3TXYA 1MDFA 3INRA 3I6ZA 4F60A 1FVFA 1C1XB 1ZM9A 2V65A 3PE4A 4WESB 1RWNA 1XLVA 4DEVA 3SU8A 2WJYA 3ES9A 4PW0A 3RVNA 2GYVA 4IRUB 2ZE6A 3JSXA 3TO5A 3WNDA 3WV4A 3HBAA 3T5PA 5J2UF 2E7ZA 3SF8A 3LT5A 4I1UA 2C5GA 4EI2A 2QYSA 1SPXA 3CNNA 5CLHA 1K6IA 3GFFA 3ZHZA 3BGVA 1UJ2A 1L8XA 4N65A 4X24A 1L4KA 2CHFA 5BPFA 2W8ZA 1MMFB 4KR6A 1M0WA 1BS9A 1U2RA 2BY4A 3GLVA 3JYHA 1Z63A 3B2EA 5EIBD 5ALWA 3QTTA 4MLCA 3OP4A 3KBOA 5IW8A 2WTBA 2R4TA 1UWVA 3R3SA 4NHOA 4TT3A 1E20A 1P9NA 2GCIA 2QRZA 2CLHB 3QVKA 4P3NA 5L3SA 3CPJB 1KFKB 2G83A 2HFJA 5CA0B 2HI0A 3DEFA 4MB6A 4AWXA 1S89A 4YHHB 1TGYA 3NWPA 3HO1A 5DW3A 4JODA 5GAJA 2WF7A 1B6TA 3OE1A 4LDNA 4PYKA 3IE2A 1KP2A 4RCVA 1MNAA 4UMFA 2P11A 3RODA 3UHOA 4GIBA 1CUVA 4JOCA 3IE1A 4AUKA 1DCTA 1N7GA 4DLWA 2PLRA 4HFRA 1GHTA 5EHZA 1CERA 1VI5A 1YL5A 1YOVA 4QTZA 2ZE5A 4ZOLF 1O0CA 5ALHA 3V55A 3QVGB 2AMJA 2DHDA 1ZK0A 2ZU6A 2QZZA 2RHMA 3OM1A 3BSYA 3IPCA 5FA8A 1DHTA 1KI3A 4H6WA 4D0SA 3AY6A 4M0DA 5KDDA 1RLOA 1BTOA 1RTTA 4O4LA 1QH8B 4RK4A 3LUJA 1C4WA 1D1QA 3ICCA 4DADA 5HX7A 3T1YB 4P84A 1LVHA 3KP1A 3OCUA 1JJBA 4ZI7A 1W88A 4E5KA 1G18A 1UBLS 2OXCA 2P4SA 2LCIA 3D5EA 2I87A 2W2QA 2H18A 2QMOA 2YNMC 4IDAA 2J9XB 2VF4X 1XA0A 2WFAA 2G36A 1DQYA 3OF2A 1FUIA 2ACEA 2OHGA 5I3ZA 2ZPUA 4FR2A 3OZGA 3DZGA 3D6TB 1CKEA 4Z4EA 2DR0A 2YW9A 5EWMB 4IMJB 3RUHA 5TLSA 1JSXA 3SJCA 2PSFA 3RK4A 4IVRA 3A9UA 1JAIA 3SMQA 5ALRA 5C8YF 1CUUA 2BH9A 2DUUA 4BJ6A 1QU3A 3L9WA 3FBTA 1JZQA 2CFTA 4ER7A 2D1QA 4LHVA 4ZU6X 4GRAA 1E9VA 3DW1X 3TI9A 3GVXA 1MPXA 1O57A 2V4ZA 2VHJA 2NVUB 4LE2A 4Q0MA 2D3TA 1KO5A 3E7WA 3ONVA 2I3AA 3AINA 3WGZA 4LZJA 3AUXA 2EP7A 1G8FA 1WY5A 3K6RA 4QARA 3OSZA 1OVGA 2XGOA 5FPPA 1VE6A 3MILA 2EX1A 4HX9A 1LNQA 4U8HA 2VRCA 2VJOA 4U00A 2MU1A 1HT3A 4HUQB 3HR7A 4OUKX 4EF4A 3QMPA 3R7NA 5CXUA 1QO9A 5KTNA 3RFTA 5GIOE 4KN6A 2IYXA 3G7UA 5AW3A 1OBCA 2A35A 1V8OA 4BMNA 2OKCA 4WFKA 3ZU5A 3W1WA 2BUAA 4M1OA 2DR2A 1OPXA 3EGXB 3AK4A 5CFZA 2YHIA 4BY9E 2EFGA 3A0UA 4WFIA 3I3OA 3CC8A 3TEMA 1LX6A 1I3KA 2BMDA 4EO7A 5BW8A 4QYSA 4BNLA 3RUFA 4EQ6A 1RM3A 1V39A 3JXEA 1WDWB 3QXGA 4NAVA 5C4GB 4MGKR 2RIRA 2QMEA 4L4XA 4BO9A 3F1KA 5JVDB 3FHTA 4BLWA 3K15A 4M0EA 3VHXB 1NM5C 1OIXA 2C88A 5CIWA 1RXUA 2KI5A 3CLSD 3BJRA 2DPXA 4LF7B 2DXIA 4HP8A 1MIOB 1JR3E 4NR0A 4A0FA 2ZATA 4WQMA 5TX7A 2GEDA 3WMRA 1L3CA 4R3UC 5KNDA 5EIOA 4EK9A 5CVCA 3WK9A 4H27A 4ARAA 2E2WA 3GNLA 3KXIA 4RCZA 2VQFB 1NVVR 4UFOA 3OPYB 1JHQA 6CHYA 3BAFA 5FTNA 1N5LA 2EJWA 3A2KA 1M6NA 4XSGA 3WNZA 2AYXA 1E9RA 4YJFB 3SE7A 5DMHA 3U0BA 3VR1A 2QK4A 3P32A 2OYCA 3RUCA 2HH9A 3T06B 1SBCA 3B5JA 2RK4A 3W6UA 4E2WA 3PXGA 4CQNA 2YS7A 1XP8A 1TJ4A 4LI3X 1V8BA 1RYEA 4HAOA 1VL0A 2ONYA 3LPCA 1VI6A 3RSGA 1OV6A 3TRJA 5KS2A 1TF7A 2IKSA 1PIWA 5C1PA 2VF2A 3NBYC 3PGJA 1UANA 2PSEA 1USWA 1NP3A 4DXAA 3D8BA 2VHQA 1A9XB 2ONZA 2R7NA 4HNSA 4CT5A 3FJOA 1MFZA 1IK6A 3NETA 1NQ5A 3EF3A 3ETDA 3SZGA 1FYEA 3AJ8A 3AZOA 3K20A 1WMDA 2KYRA 2ODEA 4KO1S 4PQRA 5CRIA 4R1QA 1XQYA 5BW6B 5DSTA 5FX2A 5H8WA 2VYNA 3W7BA 2ZM5A 1ZNXA 1FP7A 2XQKA 3KD3A 4M0MA 3VC3A 3F4BA 3W8FA 3KJGA 1AKRA 4HWKA 1V7PC 1UKAA 5H3HA 2CHGA 2Q62A 5BUSA 3MSXA 4OJTA 3GMSA 3HYSA 1CZRA 3G0HA 4PNZA 2FWJA 2GCOA 4HTFA 1FMCA 1B76A 1J1ZA 2FU5C 5LDDC 1EWQA 1ZA2A 3R3UA 4Q7LA 3WBKA 2BE7A 1AK9A 7ADHA 2C2YA 5HVNA 5LQDA 1RQNA 1ZK2A 4HLDA 4QQFA 5JNVA 1JLLB 4V0KA 1II0A 3IKTA 2G1PA 4HQRA 2NT3A 3F8SA 5E4JA 1SBNE 1V45E 4AF7A 1OWOA 3DOIA 4KWTA 4EOGA 5AM1A 4BEJA 4CMIA 4K6KA 2F4VB 1KWGA 1LRJA 2QW1A 3GROA 2AZ4A 3VZRA 5HHTA 1II8B 5A4JA 3O3NB 3AP2A 2WOJA 4FZ5A 4H0NA 4B82A 1CY0A 1G8GA 4JKOA 1YAHA 2EDCA 2F3TA 4MB2A 3DB2A 4Q05A 4EY4A 4NBLA 2E1PA 3D2CA 3EZLA 3HU5A 4UULA 3LL4A 3F73A 5JNTA 4AT1A 3AQIA 4ZOBA 1V96A 5C32A 3HBFA 2Z08A 4G2NA 1OKKD 1ZN9A 5FUXA 1CX9B 4S2UA 3A6DA 4UBJA 1N6IA 4MKHA 2X5NA 1VBFA 2LD4A 2EKDA 1Q44A 1D0SA 3RJ5A 4IEFB 4Q4AB 1XVTA 2JI7A 7MHTA 2PGNA 2HLPA 3WRXA 3GFRA 1LUAA 2H63A 4WADA 2H4FA 2QMQA 3PG5A 4WASA 2JEYA 2C7GA 3TOVA 1CUGA 1DX4A 4V1CB 2R86A 5EHGA 3W2GA 2PMEA 1X0XA 1UBJS 3VU0A 5AUNB 2Z2YA 2ANCA 4H7IA 2O48X 2GN6A 2W22A 2H2IA 1QQAA 1SCUA 3EF1A 4QWWA 1IY9A 1OXXK 2YVKA 4NMWA 1VCIA 2C2XA 4PX5A 5G0VA 1OIVA 1WL8A 3RHTA 3TM5A 1QE5A 2ZJ4A 4BMZA 4HEA1 3GBPA 3ZIAA 4BQEA 2ZYUX 3B78A 3KYBA 3KRTA 4IIUA 2FOLA 5FOUA 5K3EA 3OZEA 2HD4A 1GSHA 5B64A 4R7GA 2GERA 1Y9AA 2DULA 4FLMA 1DLIA 1RYBA 3GRVA 3I2KA 4JNCA 1W4AA 4KAJA 5FUBA 3CA8A 2HNBA 3GA7A 4P81A 2YZ7A 1EP9A 4CR6A 1EYZA 3FOAA 1N5DA 1RIFA 3EVAA 4GNRA 5HEKA 5C3UA 3H7AA 1FMLA 2QTBA 1I3LA 4YS6A 4B83A 4BVHA 2IYAA 4QPJC 5IASA 1NW3A 4IWXA 1V43A 2RAVA 4B7AA 3FGNA 1O8BA 1VIVA 3JQPA 4IIFA 4L5IA 2XYPA 4HMOA 3GGOA 4IDFA 4LJKA 3DONA 2I2CA 1HYEA 2GK3A 3EK2A 4P5EA 4TWIA 4MV5A 4ZT7A 3T3MB 4DUPA 2ZT7A 1V0JA 3OTHA 4JJ6A 3ZS8A 1DAKA 2NUTB 3NDRA 4KQFA 1P2DA 3ZE8A 1HNXB 1J2TA 4YAUA 4KREA 3GHHA 2B1JA 5G4LA 1QR2A 4UU7A 1WPGA 2B78A 3ZI7A 3O8DA 3HR4A 2O05A 4MS4A 1NKVA 2DEUA 1GRRA 4HTAA 3IMGA 2FZGA 1UMBA 3PFFA 4IXDA 3ZE0B 1SC4A 3D4NA 3GT0A 3L8YA 4MR9B 2ACWA 5DHAA 2AKEA 4M9SA 1YA8A 1MQ9A 3H0CA 4LXHA 4UHFA 4RQTA 3WGOA 3AJRA 1K6XA 2C5EA 5LP6F 3IP1A 3QM1A 2Q5CA 5BV7A 1AN0A 2ZVJA 1SNYA 2BW0A 2KE5A 4PHFA 1YZLA 5AXBA 2CJXA 4URFA 4AZVA 4TS1A 4U3JB 4EX7A 4G4SP 4C4OA 2J3KA 2B4RO 4XDYA 4B7CA 2AMFA 3LO5A 1TC2A 3D59A 3HXTA 1PG2A 4FS3A 3C5VA 3UFBA 3UW3A 2R97A 1AUPA 4DMRA 4P35A 4WKPA 4HJRA 4QU5A 3LXXA 4M38A 4PLGA 5TPWB 2ZUUA 4EVQA 4K7JA 2WIJA 1B7GO 1K9SA 1RQXA 1PDVA 3C7AA 4HH1A 1HUQA 2XB6A 2XX3A 3AI1A 4KGVA 5LZ7A 4IUYA 3OQBA 4G0YA 5ELMA 3CLUC 3KT6A 3M89A 2G5GX 4WBNA 1NQVA 4OMCA 3VZDA 4BKOA 3WGVA 4FQ7A 5K0NA 5CDTA 2GR9A 2PK3A 1VCOA 3Q40A 3I53A 1N92A 2UYOA 1QOPB 4PFSA 3SICE 4BU0A 4MJXA 2M98A 3C87A 3HDTA 2HBQA 1JEAA 1RHUA 2J3DA 4RJ2A 3ETEA 3PZBA 4Q1CA 4AS1A 3HPRA 1PFQA 3UA3A 1HDCA 2AUMA 2BI8A 3BDIA 3PRHA 4BZQA 2AJ8A 3VR5H 1AKYA 3G88A 5KX5B 4KGDA 1DTWA 2JC3A 3AV0B 4DR4B 2WWVD 2QTTA 3L0BA 3IDAA 2QR2A 4UQLA 1DAOA 4RYLA 4UNIA 1J8QA 1SCBA 3WX0A 2BCJQ 2QQGA 3GCGA 4M0CA 4YAWA 5A1JA 1MHTA 4KQJA 3K0AA 3T5MA 5E6RB 3DL2A 3G1WA 4G85A 5CYOA 5I7AA 1EDOA 1RBYA 3C8MA 1E6CA 1YKFA 2NTEA 2VK8A 3GQVA 3GIWA 1O95A 3GRRA 3KHTA 1Z6YA 1PHRA 1W0JD 3G8DA 3NYIA 5ALPA 5KYVA 2VK1A 3VNVA 3ABQB 3ENNA 3GT4A 2O6HA 3QE0A 1LB1B 2ZI6A 4DA7A 1G6KA 4ISBA 5SZJA 3WWEA 5IH7A 2C31A 3IT2A 3N8GA 3ZCVA 1IN8A 2JH8A 4A1FA 4D4IA 1REQA 3MAAC 1RXWA 5JUWA 3VNRA 3SQDA 3VPBA 1UBMS 5JEDA 3RVQA 3AQ4A 4RIFA 4XD7D 2EZTA 4HEHA 4BX0A 3DPIA 3T5CA 4EL0A 1SVKA 3ZTWA 5CB4A 3TVDA 2FN8A 1WV1A 1LRLA 3TZKA 2MR6A 4NYIR 2AQ8A 3P27A 5KMGA 1G8HA 3D3NA 3SIRA 4KSYA 3TM4A 3CH4B 1EJ2A 5EZQA 3RYCB 3KWMA 3LK6A 1VA4A 1YF3A 1WMSA 4WCDA 3VZQA 5D1HA 1JVBA 4QU9A 4ASUD 4AX4A 2FZ5A 4Y6QA 4IDDA 1QZXA 2ZWVA 1WIWA 1BEUB 4EDFA 3GDWA 3DHWC 3MTIA 3FUXA 2DBVO 5KBYA 1T1SA 1VE9A 2HLDD 2IYNA 2YZMA 5LD2C 4KR7A 1C1DA 2XCUA 3AUKA 2RH4A 3K1AB 3PVSA 3FLMA 2A14A 4X1KB 4RVUA 2JLCA 5DK4A 2I03A 1T24A 4JU8A 4NV1A 4P4SB 2GZ1A 3T4UA 1Y5IA 4U9IS 3UT6A 4BB9A 1P0PA 1Q1ZA 3MT9A 2BP7A 2BN4A 2FPIB 1GKUB 3Q87B 2ZAMA 5L8VA 5JSZB 5JYEA 3GGCA 3HYCA 2YJNA 4I9NA 3QKRA 2D5LA 1Y6GA 2CEAA 4WPGA 5EE0A 2DFNA 4U2KA 5LQJA 2H3EA 1VBNA 1Z2DA 1RDFA 2NO6A 3GP5A 2WWXA 4BNTA 5LL6P 3JY6A 1D2NA 1O97D 3PX3A 2DZDA 4KQMA 1F12A 3IBGA 4FX5A 5FQNA 1Y37A 4MGZR 2P5SA 3P94A 3QY0A 1O9GA 5FUVA 3TLYA 3RG2A 1GTG1 1N2BA 1JRLA 1WJGA 2FSPA 2HWWA 1Y1KE 2F90A 3A6FA 5D3QA 3VPAA 1T36B 3P45A 2MINB 3TYXA 2HIGA 2A9JA 4O2BF 4QELA 1EA7A 1PGJA 1WXFA 4XIGS 1L4UA 3ZZ0A 1ARZA 4QOJA 2QOEA 2EZ8A 1SJ9A 2AN5A 2RHWA 2DG2A 2GBIA 2QN3A 3ZQ4A 4BXOA 5M5BA 2RGYA 2SHKA 2NUPA 4RSGA 4RHXA 4QGFA 4F4HA 1HFKA 2WB2A 4N76A 4M2LA 3RAGA 4OA8A 5KCMA 1ODSA 4GZ6A 4K26A 3E7XA 4EJMA 3PDIB 4Q1BA 3RT9A 5C5EA 1E59A 2Y1LA 3M6XA 2WP0A 3TIXB 3KEFA 3V7YA 3CURA 3VR6A 2NOAA 5CGZA 1AXGA 1OQAA 4ZVSA 1YB6A 3A3YA 3BN3A 3A9RA 1XRSB 3F3YA 3M4NA 3QJYA 4GXNA 4P1ZA 4QOSA 5C53B 4IW3B 3FW1A 1UM9B 2HZBA 1NKTA 1ODFA 1YZKA 2J0UB 2GUWA 4JP1A 4BPRA 4HX5A 5EIEA 2VKTA 2XYGA 1RWVA 3KS9A 1RZRD 3G0GA 4GI7A 3UMFA 2VIIA 4XX0B 4IHJB 1G291 1IN6A 2X0JA 3OFJA 1RCFA 4O4HA 1KARA 1YA6A 3TTYA 4H3KB 4QSMA 1ZD4A 4AKHA 1RQ2A 1RBQA 2WJ4A 2XY4A 5REQB 1VPVA 4L78A 1I4LD 1P0MA 1QKJA 4IJQA 4MRVA 4HEQA 4DVJA 4NFSA 2ZGVA 2HXGA 1QG2A 5AM2A 4NJOA 1C7FA 2HXSA 4IGAA 1O2DA 1WVGA 1TPYA 4CU2A 2EGHA 2VBFA 2CE2X 2DKFA 3KYCA 4NMXB 2WNIA 3RGWS 3D1JA 1TM4E 2A1TS 1NG9A 3ANYB 2CJPA 2PS3A 3QY9A 4WXRA 3WRXC 5GONF 4BNXA 1CEEA 2YW2A 3DEKA 5DTEA 3AIIA 3GFGA 3NT4A 5E9QA 2ZE7A 3LX5A 1DWPA 1FQWA 3I4LA 1T0PA 3FTPA 4CT0A 5BVGA 2CKDA 4I4TA 2WUGA 3PXDA 4PYRA 1XN4A 2PBFA 2OBXA 2J5BA 2R66A 4POAA 1VCHA 5LC1A 3A6ZA 1RI3A 3B1KA 4RTJA 2HIAA 4HFNA 3OQVA 2PZJA 4F4JA 4JT9A 4TN1A 5BR7A 4G8JA 1LI7A 3OZCA 2WWFA 4RE6A 2P79A 1EIZA 2BFCA 1MEEA 2HAEA 2IPLA 2W2OA 4YRRA 1TJPB 3WP1B 2IXAA 2FG6C 3BXHA 2LRHA 3BMOA 3QOYA 5EXDA 3WTCA 2ZZMA 1YH3A 4YRGA 3NM4A 3TCKA 3USZA 1W96A 1YONA 2XCTB 4TXMA 1FDTA 1JZTA 1IAVA 1Y3AA 5SZIA 5JROA 5IWAB 3B6MA 1V1MA 1JQBA 5COBA 4D4LA 1YFKA 1DBRA 3CLTD 2D2EA 1DJLA 5EUMA 5IUJC 2PA0A 1PQYA 1R66A 1LPMA 2IP2A 1KIFA 5ULLA 3UK7A 1OIWA 1VL5A 1YVUA 1MENA 3LJKA 4HYYA 4J0HA 2ZVQX 4QKQA 1DBWA 1FLNA 1T0UA 2FHPA 3IIIA 3ZNQA 1OTYA 2BGJA 2H5EA 4KX5A 1IZYA 5CT9A 4HUTA 1XTZA 5K0JA 3UPUA 2XD4A 3CIOA 3H86A 3FVVA 2QTHA 5EG5A 4HYQA 3NS7A 3RRXA 2B3TA 3I73A 4EPXA 5JHHB 1JDUA 4EG3A 1OAOA 3ID6C 3SBEA 2J9YB 5DCYA 3O7WA 2PT7A 1A8HA 3DXFA 5K0CA 1ECGA 4XYMA 3TLMA 1VP3A 1AF7A 3ZVLA 4CVNA 3GLGE 3IBYA 3M2TA 3IAHA 3PLRA 1KZHA 1HFJA 3KT8A 5BNTA 3R9WA 4CE6A 4D9GA 2PWYA 4Y9RA 1JA9A 4H6VA 3QEKA 1CDEA 1R6UA 4AYTA 2C0QA 6REQA 2JGJA 3O94A 2HTEA 1GAQA 2WTEA 4K6GA 4FYYA 4CQMA 4F85A 1NXWA 1XDDA 5IG2A 3SZ3A 2VDJA 1N3IA 4LY3A 1VGQA 4ODIA 4IF4A 1I7QB 1Z83A 2JLBA 3ODGA 3B85A 3WGGA 1EIWA 4MWGA 4JUFA 3JATB 4YCBA 1SHUX 4UEWA 2HRQA 3QPDA 2QT1A 4AI6A 1IZ8A 4BC1A 1OYYA 2YYSA 1KEUA 2PL1A 4WL0A 4CIWA 3KQVA 3EEYA 3HVUA 4JZKA 3MMPA 1ZIXA 1CDOA 4UHBA 5DW0A 2AT1A 2XT6A 4JYCA 3UBMA 1EE1A 2I80A 4C6RA 4QBIA 1OWLA 1AUQA 2GK7A 2FB9A 2ASVA 4OAQA 4K9PA 1ZC3A 3WE7A 5HKKD 3D5QA 1XL0A 3MJ4A 4KZPA 5BSVA 5ERXA 4YAGA 2JA2A 1Z38A 4OQPA 1GT6A 3BXFA 1MAAA 2D5CA 3SN6A 4WK2B 4KJZA 4HVLA 3B6JA 3CGGA 2H17A 2GAFA 3PNVA 5JSHA 4B5LA 3L8FA 3TDKA 3RVPA 1TCAA 3LYUA 2Y0EA 3DG9A 1DKLA 3RVJA 4BWVA 4CMKA 3BGIA 1CUWA 1NPDA 1PX2A 1MQ8B 2PAFA 1DCMA 3ZHBA 4INOA 1YR6A 1QG4A 2QEQA 3HDYA 3O8BA 4FFSA 1EA5A 1NDUA 1YS4A 1U1DA 4OQZA 4ZVQA 1GZDA 3THWB 3CZ5A 2RC6A 4B84A 1ECLA 2HA0A 4JI6B 4RNDB 1O95C 4CLOA 4OXIA 1Z13A 4KQEA 4IQ8A 3X1YA 1BU8A 3RD5A 3UHPA 3AJ9A 4G26A 5I8ZA 1W5SA 3IDZA 1JKMA 1JHYA 2VYVA 5IYZA 3GEMA 1VYUA 4OEHA 2Y05A 3IALA 3EUAA 4EENA 3NNSA 1ZSVA 1VJDA 4JQCA 1AB6A 1UK9A 1G5FA 1S4QA 2LDBA 4GM0A 3AR9A 5EZYB 3LC2O 2ISCA 4F3KA 1AV6A 1L7OA 2PEYA 4JJZA 4NG4A 3I9LA 3SDBA 3E3NA 2R8OA 4Z4QA 1FRQA 3CZPA 4B31A 3MS7A 5L4LA 4DIBA 2UZAA 1XZEA 2NAPA 2ALJA 3DOUA 4KW7A 5B57C 2O52A 4EUHA 2H65A 3X1WA 5LB4A 3WSTA 3EC1A 2CD9A 1PG5A 1YDGA 1X0VA 1GUZA 2HHHB 4ZO8A 4J1SA 1D9XA 1P3Y1 4JLKA 5BURA 1M6YA 3RQSA 1QMGA 3TMKA 3SJZA 5HM6A 5JH7A 2PZFA 3CKMA 3D0QA 2VDPB 2X8LA 2HU8A 2VJMB 3OIDA 3GX1A 1KS2A 4U5QA 4FGWA 4L75A 1S8NA 4CM3A 7MDHA 1I4EB 1HRDA 1MRZA 3HGMA 2NM0A 4OLBA 3MJHA 4JK3A 4E7PA 4OP1A 4GX1A 4IZOA 4YMUA 1J5XA 2P5TB 4RGYA 4XPZA 4BQOA 1J23A 2O0LA 3I72A 1WPRA 2Y0PA 2IBTA 1XDWA 2I2WA 1H1LB 3AXTA 2ZRPA 1PZHA 1WLYA 2NXNA 2WAAA 3EEIA 3S2FA 3DM9B 1ESMA 1IEWA 4YJ3F 4N0QA 5DOVA 2PWPA 5IAOA 4LJ8A 3ZE9A 4FE4A 4YPFA 5J4YA 3Q88A 3K0KA 4FGLA 3BFXA 1C9MA 1R50A 4DV7B 1OI7A 1KGSA 4JLBA 3LSYA 2FXIA 1UBNA 1QG6A 4KNWA 3O0TA 4Z86A 3WTBA 6NULA 5KQGA 2HYIC 3PLAE 4Y2SA 3TQCA 4OH1A 1QONA 5FWXA 1S2OA 5DASA 4D3SA 5KTPA 4GE3A 1YMQA 1ZD3A 3CNBA 3RC3A 2Q99A 1IN4A 1NY6A 4N54A 5JTTA 4L2IB 1WDTA 1ZI6A 2ZJ3A 1I0ZA 2ODWA 4HAZA 5DGXA 4B6PA 3C2QA 1WZEA 2B94A 2J7PD 3CX6A 4PM4A 4DUGA 5CM9C 5NULA 1E3IA 3RSFA 4B6GA 2O2HA 3PUXA 2CUNA 2W58A 2NSJA 2UZIR 1AVTA 2HCFA 2VXYA 5AIAA 5EIHA 5AVYA 2ADFA 2X5KO 1KE2A 2GT1A 1WVIA 5H9WA 1CNFA 2XIQA 5JXWA 1W5AA 4P86A 4AVYA 4ZTZB 2F2TA 1XZFA 1W1WA 3H2IA 3EDMA 7GPBA 5HIIA 1TAQA 3ZJVA 3DLAA 1T8UA 2K87A 2QUAA 3TR0A 1E2JA 3KZ1E 3PFBA 5F7OA 1JVSA 2RBEA 3PQ5A 4EZEA 4QDXA 4YI5A 3RI3A 1PJ2A 1PT9A 4MNTA 5I01A 2AHOA 1W4BA 4J7AA 5T8KC 2VT2A 3O83A 1QGED 1L5VA 3D7RA 3USCS 3ZI4A 2EBUA 1Z5NA 1NC1A 4BDSA 4L4ZA 5HSGA 5HUHA 4ND4A 4LV5B 4HLNA 4YUWA 4Y2XA 3PTZA 4YN3A 1XCMA 2BLNA 3H99A 4YMWA 4I6EA 1IOLA 4TKVA 3ASZA 4WOCA 3ULKA 4YMLA 5HRCA 4UM8B 1GAJA 1OXSC 1JZSA 3NHSA 3QIVA 5IN5A 3UKOA 2XBMA 5ICMA 1RHJA 5DKFA 3B60A 1Q1BA 3MPUA 3H8JA 3WNQA 4HB0A 5IMBA 4EX6A 8OHMA 1SOMA 1Y1RA 3WLOA 4DA4A 1GTVA 3J80A 2YHSA 1DUVG 4LA4A 4K8OA 2NVBA 1VKNA 3KUCA 4LVNA 5A0FA 1K8QA 3CZCA 2BEUB 3JQ9A 3WGLA 1BD4A 2WAMA 3RTGA 5HE8A 4LN1A 4E14A 9ABPA 1NBAA 5A3VA 1MJGA 3DZKA 4O29A 4W82A 2RGEA 1G3RA 4BO6A 5HF6A 4AULA 3MCZA 2JRCA 3NATA 2WTNA 1ECCA 3QKTA 4JIMA 5CM8B 2PMDA 2J33A 5EKTA 4CL3A 2P6RA 2YH2A 5EXSA 3X1KA 1GGKA 2BMJA 3U7GA 2DM6A 2VSOA 2IYYA 3KKQA 5PGMA 1MVLA 3A04A 2PCLA 2VDMB 3AR5A 1MA3A 1ISSA 1MX3A 1XZGA 1K66A 4PQFA 1PZXA 4YXFA 2WD8A 3K6KA 1NW8A 2WU1A 3MJRA 4ROSA 1WTCA 4S0XA 3RFXA 4YT8A 4GPEA 2ADMA 2JVKA 4RORA 5JNLA 1VECA 2AG5A 4PINA 5HW0A 5B2ZA 2WSMA 3PU6A 4YACA 4FNMA 3JCZA 3VKFA 2BJWA 2VVTA 5DLPA 2YYZA 3VR5D 1ZUD1 3ZCQA 4NTZA 1LZKA 1CZNA 1JNXX 5IKMA 2Q3MA 1SG6A 3EOZA 3I2JA 5D5QA 1ZK4A 1E6KA 1DU4A 1G8YA 1BOFA 2JBWA 3KSDO 2H1SA 4ZRDA 1SOUA 1KERA 1NI4A 3QKWA 4IKEA 5E3IA 3VH2A 2O1SA 4EJ6A 1QH0A 1E4EB 1IXSB 1L5RA 1N1DA 3KQQA 1WZ2A 2OC9A 4L9AA 1M2EA 3SPXA 2AJDA 3AFMA 1Q0QA 3PR2B 5EUQB 4JI0B 3W3AH 1P2GA 2ARKA 2P67A 3SJBA 1OTXA 2IEYA 1NDQA 1FTWA 1KZGB 1NXSA 2A86A 1JAHA 2LWIA 1K5DA 3E18A 3LKVA 4GVLA 4P4LA 3TQTA 1U9CA 3WIDA 3VZPA 3X1XA 4C0HA 5CB0A 4KNYA 3ZGZA 1LDMA 1I6WA 1UJ4A 4RZUA 1IYZA 2OSBA 2QJTA 2VPXA 4FHGA 3QFTA 4ZCLA 1P8JA 1S0UA 4BKUA 4MKXA 2ZTLA 5JXHA 2R8PA 1WXIA 1YK0A 3OEED 1QCYA 3RS4A 5LIRA 1OAOC 4F46A 4KFCA 2Z8YA 2J46A 3REFA 5BMVA 2QUHA 1KYZA 4QTTB 3ADKA 4ZYTA 3B53X 4D6XA 1M7BA 1ZNWA 3NJRA 1Q91A 1TM7E 1DBVO 1KYTA 1U90A 4FOTA 4RNCA 2WICA 4CM8B 3FYCA 4UOZA 3H6HA 5FDFA 2XV1A 2YMPA 5F5NA 4CCWA 1FFWA 2P4QA 1KBOA 3HO8A 4IRMA 4PONA 4WVFA 3MWDA 1MC1A 1X7XB 1ZVVA 2ZQZA 2K7FA 2C5FA 3CR7A 3LX8A 4JA0A 5I7FA 3B1WA 1SRRA 3OFND 3IPXA 3O9ZA 3OP1A 4BO4A 3PE3A 1JEOA 1LTQA 2Q8NA 3F2IA 1N77A 1XU4A 1N57A 3K31A 4HAWA 2XOKD 2DQ4A 1SEPA 3E8SA 4YONB 3ROTA 3IMEA 1XU7A 3C3EA 4MOWA 1BIFA 1N1EA 2Q2QA 2ZROA 1SIUA 3PJFA 5AK0A 5KAMA 2IH5A 4D26A 4HAIA 1N2XA 4IXNA 5JZBA 2HQSA 2HDWA 5EZ6B 2CBGA 1TAUA 3G2QA 2BFEB 3GRAA 4I0WB 2UZ1A 3FR8A 2GYUA 1FU7A 1RCTE 3GL9A 2JI6A 1QFZA 2B8TA 5LZ5A 3QU2A 3KR0A 4TUYB 2H7CA 4W8HA 2MSKA 3AUFA 3IUJA 2R8ZA 3BGWA 3LDAA 4L7QA 4O5AA 3G0CA 4EB6B 3K9WA 2HJGA 4OGKA 2C58A 1P3DA 2XIJA 3PXAA 4ER6A 2JLZA 3F90A 2AX4A 1CQZA 4RQBA 3AVYA 2H1IA 2OV4A 1VXOA 3SSMA 1X3LA 2FEKA 2P91A 2G63A 2PIDA 1U4NA 3GVIA 3JQ8B 4FD3A 4XJTA 2WPDD 3B89A 2I2DA 3NHUA 2XCQA 4F1WA 1UBSB 3OZUA 3PITA 4W99A 3G1UA 3TQQA 3ZWMA 2V7TA 2MSWA 3WZLA 2XE7A 4JLPA 4ZZ1A 2JFNA 4B81A 2C20A 2Z8XA 3E0XA 3K70D 3COZA 4H7EA 5HPYB 4YECA 2B5VA 1FUEA 1N8NA 2H2FA 1Y8QB 3NEYA 4G1EB 3ZWBA 4B3JA 1O0BA 3I8SA 1O94A 5H1YA 1SCKA 4RKRA 1K7CA 1DKNA 1F2VA 1Z0JA 2L18A 3MJCA 2IUUA 2HU2A 3EOAI 4UUMA 4JI4B 1U9ZA 4S35A 1Z06A 4TT3D 4DLLA 2Y76A 1XRRA 2WM8A 1TZJA 2N9UA 3LUPA 3NHYA 2OV2A 4HL6A 4QE3A 4Y0AA 4E88A 2R84A 1AQIA 2JB9A 2KMLA 3CRZA 3X1JA 1E7MA 4JU9A 2FUKA 4XIYA 1SCJA 2C8JA 2JAQA 3HJAA 3UN1A 4BKPA 1N2EA 2QS9A 3AR2A 4X60A 1HDEA 1DGQA 1PFUA 2L2QA 2R65A 1SU6A 4M54A 3HZRA 3Q0IA 2J08A 3WWOA 4E7OA 1BD3A 2RHJA 2V1XA 3HCPA 4G8BA 3K0SA 3OQHA 4RTOA 4OB8A 2I7VA 4LRQA 1OHHA 4XR9A 1Q7GA 5F21A 4F84A 4TYQA 1ZVQA 3LP6A 3U7IA 1G21B 4BO8A 3E9NA 3NRJA 2PJZA 5A9SA 5LA6A 4UFPA 1PKXA 1SOWA 3L7BA 2QTAA 1UPBA 5G53C 4CF5A 3DLTA 3KV1A 4RWZA 2BF7A 1GTSA 2W2NA 4WKNA 3I64A 5BSEA 1KK0A 4WUVA 1AB5A 4I6GA 3PDUA 1DRWA 1ZAKA 4MS1B 1Z4MA 5H81A 2JI8A 3DYBA 2J1LA 4NIMA 2Z2ZA 4Y30A 1YL7A 3FOBA 3MHTA 3FKSA 3CLUD 5CH8A 5CX1A 1KKUA 3DDNA 5GM1A 5FBVB 4PLTA 3BGDA 1FP4B 5BOVA 3NVDA 4NPCA 5LKRA 1KIAA 1Y7IA 3DZJA 3MS4A 4I9FA 2WYWA 3A14A 2YFHA 1SBYA 3L02A 3LOPA 3DMDA 3O4IA 3OJEA 4KPGA 1Y8AA 5AJVB 1IPHA 3CJQA 5SYMA 3RYIB 4YDQA 3RIYA 1KAMA 1CR6A 1R3UA 1WUIS 4OXRA 1ABFA 5P8WA 3VFDA 4K6MA 2R1TB 3L6DA 1U7WA 4F0JA 3KPYA 2NTJA 1FIUA 3ZZMA 2D54A 4KQ2A 2ZE8A 3HUTA 5A6VA 1ZRMA 2D2IA 2XMPA 3QVLA 4N5LA 3JQBA 1EESA 5IHXA 3THXA 2EWMA 4J4BA 1RLIA 1W44A 3R23A 2TRSB 3TEJA 3B5EA 1SUWA 2CNLA 2H31A 1G1AA 4G84A 1KHHA 4KXWA 1TYCA 4KXVA 3WBJA 5D7NA 1T8RA 2EYUA 4DBLC 3T1QA 2RDMA 3BSWA 4NZ9A 1XRQA 1E0SA 2CF6A 1JQDA 1VIAA 4I7EA 5C31A 5JNSA 5KJCA 5T67A 3QX3A 3S1AA 1IAQA 4TLBA 4C0WA 4KV9A 1U0EA 2P4UA 4V24A 5KU7A 2CBXA 4KBGA 3GZNB 3A4IA 3PX2A 1Y4ZA 4JQOA 4IOLA 2IPNA 3H19A 1U1GA 1OJLA 1NAIA 2GZSA 2DT8A 1X1DA 3L1IA 5CA0F 2WZCA 5B58T 2DC1A 5F51A 4KBYA 1Y0BA 3ZY6A 3ZHRA 1X8JA 2VBIA 5THQA 3L07A 4WX2B 3BD6A 5E1DA 4L6CA 1XCGB 1BHJA 3A3OA 2O8NA 3E61A 3NNNA 3KFVA 1NV9A 3H8WA 4RH0A 4F21A 3SJAA 1CUSA 3PF8A 1W4RA 2ZI7A 4OMUA 4RH1A 4I1RA 5IJWA 1K8RA 1QHHA 2ZSDA 4BYGA 1Y5MA 3LG2A 2QUZA 3TQSA 4TYNA 4AKIA 3VOBA 3GEBA 2OCYC 1X7WB 3C5EA 1Z5OA 1TQ4A 4GO1A 3TFQA 5IT9A 1P4SA 4RM2A 5K6RA 3AZPA 3FPEA 3JQ9C 3PJEA 5K3BA 1M5RA 3DT8A 2VDVE 2W6PA 2BBSA 3PJGA 3ASUA 4IHAA 3HADA 4BWFB 3ZQKA 3C3KA 3TAHA 1C4XA 1U3DA 3RVDA 3ZDBA 3TLGB 3HU1A 3D1VA 2VEOA 4OYLA 4LYYA 1UJCA 3C3DA 3SS9X 3WHKA 5DBOA 4EJ0A 3UBTA 4RH3A 2FW6A 2HHCA 3RW9A 3RHFA 4L85A 1KQNA 1UMKA 1VFPA 4YQEA 4D8TA 3EGDB 3EBOA 3OO1A 5I7VA 4OAOA 5BSHA 2EWVA 1W36C 3RSQA 4MVJI 3D81A 1W6RA 1N5OX 3I2IA 4JKYA 4JC8A 4BASA 5IZ4A 1T3HA 2P90A 3A6LA 4DLUA 4RANA 4HOYA 4E4RA 2DWUA 3R3WA 3WLSA 4FE7A 2BFWA 2WKPA 2ZYHA 5AI4A 1OBHA 2IOYA 2NZUG 2XYQA 1IXZA 3BXOA 4WHMA 2EJTA 3G85A 4TSKA 3V3TA 4ZDKA 4B9EA 2X9QA 4UM5A 2BBOA 3P2KA 4IL5A 4EELA 3I04A 1VL2A 1Y9JA 2AJBA 3P9QA 4FKZA 4HEJA 4XI9A 3LFUA 2FX3A 3MHPA 5E6UB 2VYND 5IFLA 5J4LA 3KQUA 3BRQA 4HS4A 5B3LA 3OT1B 2OLKA 3CF4G 3U60B 3SZMA 4L28A 1EFPA 1ANKA 5DWVA 5F1YA 1UOQA 2XCSB 2YRFA 1YJXA 1CJUC 2QN1A 3KLBA 4C6TA 5A0VA 3ONEA 4G1FA 3DDWA 4KVAA 4BDTA 3UQZA 4AKTA 1TGVA 1QVVA 1W8IA 4LXQA 3K4HA 1QK3A 5LLTA 2G1KA 4UTXA 5DH9A 1EUZA 2EARA 4MQUA 3ASYA 2ZBPA 1NJGA 3DMPA 3CKLA 4PF1A 1U0GA 2VUSA 3JWPA 5U1PA 3TLAA 3WQRA 4YPOA 2P7IA 1XJCA 1N1MA 2PKEA 3FMGA 1ZZGA 4URXR 3KLNA 4JOSA 5JVDF 3OZBA 1ONOA 4U6SA 5BN3B 5ER9A 4WFJA 2J4DA 4DBVO 1GVNB 1M1YB 3QBEA 5HOEA 1SUSA 2CYAA 2Z2KA 3NGXA 1DIRA 3E5HA 5JHGB 3NDIA 2PR7A 3EE6A 3I0MA 3FHJA 1Q19A 2A0FA 2OBMA 2TS1A 5IM4A 1RXVA 1UKBA 2Q1YA 2C59A 3DOOA 4GOMD 3EMBA 2AHRA 5AW9A 1ZLYA 1PD1A 4TYYA 1R0YA 2QN8A 4LCJA 1JEEA 2OKGA 1MABA 2ZJ8A 1DIOB 1QANA 1QHIA 1Z07A 2QVBA 1HF3A 4PXYA 5DCLA 4JP2A 4KFSA 1ULTA 3ZE7A 2NWQA 1A8SA 5BNZA 1R5NA 4GEKA 3DLIA 3A1SA 3GDFA 3NPAA 1N8KA 4KGZA 1CQIB 3R7SA 1VSTA 1XZNA 1E77A 2OK8A 4JT8A 3MTAA 4JB0A 2Y1KA 1ZGZA 1VE1A 2ODAA 4PAQA 1NJ6A 3H9BA 3O8LA 4AN0A 4CTOA 4W7HA 1QYRA 4DUYB 1NOKA 3GLQA 3QU7A 3RT1A 3JQDA 2G70A 1A8PA 3CXUA 3F71A 3F7TA 2IBSA 4JL6A 4Z49A 3AI3A 3E7DA 3OJXA 1VMDA 3RO7A 5DYNA 1FU8A 1B1AA 5CVDA 1KYYA 4WZAA 2IT1A 3GAFA 4R16A 4TMXA 3C4VA 5IJ0A 4CLRB 3BMCB 5AKJA 1K4MA 4LJLA 1BMTA 3JR3A 1E96A 1AK2A 3EQ9A 1GGMA 1EB9A 3PRJA 4RAOA 4E6PA 1F6BA 3ZIAD 4XSVA 1L0BA 1KI6B 5IEBA 1VA5A 3QLEA 1R18A 1Z39A 4G41A 1Q2UA 4ZFNA 1TZBA 4OK3A 1PNTA 4WN9B 3BZBA 4YJDA 5JRZA 4BU1A 5BR1A 3JV7A 3LQFA 3NALA 1EXWA 5LP6B 5K99A 4AJHA 4V0OA 5AW4A 4HSGA 1DBQA 4DNXA 5BORA 3KUDA 2X0EA 4D6YA 1HXHA 1CUFA 1WS6A 1E5XA 2GZRA 2X5XA 2RFLA 3BIOA 1BXZA