4JBHA

2.2a resolution structure of cobalt and zinc bound thermostable alcohol dehydrogenase from pyrobaculum aerophilum
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
333
structure length
333
Chain Sequence
HEMRAAAFSTPGLENLKLVEAETPRPGPGEVLIRVKYAGVNPLDYNVVAGAVKASPMPHIPGSEFAGVVEEAGPGVTGVSRGDPVVVYNRLYCGHCRQCLTGWTQMCEVTGGGIIGIVTQGGYAEYAVVPAKNAVATRADLKEAATLPIGALTAWNMAYRASISPGEKVAVVGATGNVGIYAVQFAKLLGGEVYAISRRKAKVESILKSAGADAVLTPDEAKSAAPFDVVLDPTGSASWDLSFGVLGRGGRYVTAGALTGAEVRLDLRRLYGMQILVIGATGGRRADFNTVVRLLEAGRIKAFLHNVYPLADVRKALEELRSPERVGKVLIAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alcohol dehydrogenase (Zinc)
publication title Physicochemical Characterization of a Thermostable Alcohol Dehydrogenase from Pyrobaculum aerophilum.
pubmed doi rcsb
source organism Pyrobaculum aerophilum
molecule tags Oxidoreductase
total genus 100
structure length 333
sequence length 333
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2013-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4jbhA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4jbhA01
2WYVA 3GEGA 2C59A 1BSVA 3E48A 3FSRA 3IL2A 1DBVO 3NGLA 4CQMB 1LNQA 3ZV6A 4FD3A 1ADCA 1ZK1A 2I5PO 1UXJA 1YWGO 3HQ4O 5IN4A 1HE3A 2VUTA 2C29D 1E92A 2Y67A 1T2DA 2BGMA 2H9IA 1BHSA 4R1UA 5JDCA 3RI3A 1E3JA 2ET6A 3PTZA 1U5AA 4HFJA 4JXKA 3WSWA 3AM3A 3WLEA 1F14A 2ZB3A 1PEDA 4E5NA 1XYGA 5IZCA 4PLCA 2FR8A 4XRGA 3GVHA 3NDIA 5L53A 4I5GA 4R1NA 1DIRA 2SCUA 5AXAA 4Z9FA 4OJNA 3B70A 3CSDA 3VOSA 3FRJA 4B8WA 3GDOA 4D3FA 1YBMA 2B69A 1ISJA 2FMUA 4H15A 3QWHA 3SJ7A 1LDEA 2ILTA 4Z9XA 3TL3A 2FR1A 4A7PA 4E21A 1YBVA 4BO8A 2GF2A 4ALJA 4YQYA 3OFSA 4HBGA 2VOEA 3DAFA 2Q2WA 4G81A 1ULUA 2I66A 1LLQA 1SZJG 4WOJA 4GX2A 3KSDO 1RJWA 1EFKA 1VI2A 1WPQA 1DFGA 3VPGA 3T7EA 3TDKA 1QP8A 4TRJA 1TB4A 2VWQA 4YVFA 2DKNA 3R1IA 4Z9YA 1N1GA 1XIVA 4MIOA 1PWZA 1RM3A 4TQGA 1QKIA 5AVOA 3P7MA 4WNIA 2JFFA 8ADHA 3RUFA 3I4CA 4Y6RA 4FB5A 4CV1A 1VKNA 1ZCJA 3I9LA 1FJHA 4YBZA 1HL3A 1YJ8A 2G76A 1Z73A 4OH1A 4R01A 1T1SA 5H83A 3BAZA 1B3BA 4ZQHA 3N7UA 1EVYA 1UR5A 3A14A 4BO6A 4PLFA 2HSDA 4NPCA 5IAAA 4LMRA 1HYGA 3WIEA 5A1TA 3L07A 4NNJA 4CMAA 5AXBA 1I2BA 4JK3A 1YXMA 2X58A 3OIDA 3CKYA 4D0RA 5A04A 4MP3A 5I7FA 2AQ8A 1UP4A 1JKFA 4TZKA 4XJSA 3A9WA 4YRDA 3JYLA 2Y66A 3VAZA 2PY6A 4CM8B 3JQDA 1HEUA 1PSDA 1A72A 3GG9A 1HYHA 3MTGA 1O95A 4BNJA 1EUCA 2W2LD 1U3WA 2FPPA 2FZEA 3GFGA 2PZKA 1YVEI 2PGJA 3ICCA 4G2NA 2C54A 3EGOA 3PI7A 3GLQA 1DC3A 4L8VA 4PVCA 4DUPA 3KM0A 1U1IA 2IEBA 1I5RA 4X54A 4K9DA 2J5KA 3CPSA 4XDZA 2PK3A 1GYRA 4RF5A 5A9TA 1T2CA 2GGSA 3QVWA 1HLDA 3SBOA 1B2LA 1UXIA 3GAZA 5CEJA 2WE7A 2NQ8A 1BGVA 2ZIZA 1EFLA 1U5CA 2C20A 2P5UA 4FQ8A 4S3MA 4RZHA 4EI2A 3TWOA 1XQ6A 4BNXA 1IYZA 3QJ5A 1KY5A 3RBZA 2ZTUA 1M67A 5AQ1A 3RAJA 1QYXA 4CMEC 5B4VA 1P77A 3ONFA 3TFQA 3ZU5A 4BO4A 3FCOA 1XKQA 5CDYA 4HX5A 2NM0A 1JKIA 4YB8A 3GEDA 4CJXA 3IJPA 3RU9A 4J49A 4CV0A 3QWFA 4BO3A 3BMQB 5JC1A 1ZIDA 4RPJA 3TQHA 1HE2A 2RHRA 4URFA 5HA5A 4XGNA 2C82A 1NQAO 4A73A 4M8SA 4W9NC 4YXFA 2WD7A 2BLLA 3JQAA 4XD2A 3T7CA 4NIMA 1GFSA 1R4MA 1GADO 3L77A 2R2GA 2ZATA 1X14A 3QW2A 1HWYA 4IS2A 5G2OA 1WDMA 2VT3A 3P2OA 4ZICA 2IRWA 1HDGO 1D7OA 2V7PA 1DJNA 1GL3A 2HLPA 3ICPA 1VM6A 4HNGA 1FDTA 2J3JA 4FDAA 3LU1A 5T5QA 4DYVA 3W6ZA 2HMUA 1U8XX 4WGGA 2JHGA 4BOYA 2OHXA 4I5FA 2E49A 5CPFA 3UOGA 3VZQA 1I2CA 1LQUA 3GGGA 4KOAA 4CM6A 5A5EA 2P4QA 4CLOA 3E9QA 3D3WA 3CINA 1T24A 4NH4A 2QIOA 2B36A 3IIEA 5C5IA 6ADHA 3M6IA 1BMDA 1Y7TA 4R3WA 2P4HX 3CXRA 2YV1A 2VZ9A 4J7XA 4EW6A 4HKTA 2E6UX 1B16A 4KZPA 1PL7A 4PVDA 2RBEA 1DHTA 1E1MA 3I9OA 3PJFA 1SNYA 1E6EA 3C7AA 4GX1A 3HSKA 1PZEA 1MUUA 3UCXA 1JQBA 4QFDA 3TRIA 3NTQA 1K6JA 3Q11A 1LTHR 2FOIA 3P2YA 4XYMA 3W8FA 1PZHA 1DRWA 1GV1A 4J91A 3K30A 1IHYA 4MDHA 1ADFA 4WLEA 5TNXA 3VPHA 3PK0A 2JHFA 2P5YA 3KSUA 2YHIB 3NKLA 3RJ9A 3NT4A 4I08A 4RQUA 2GRAA 2Q1TA 1GYQA 3GNQA 2PGLA 5EN4A 1GZ3A 1N1EA 1Y1PA 4J1TA 4O1MA 1C0IA 1GCUA 1GD1O 1BXGA 2FPGA 4E5PA 1OAAA 1DHRA 2EJVA 5B37A 4TKLA 4BNVA 3VPSA 5G4KB 4DMMA 2O4UX 4Q3EA 3G79A 1OC2A 3VKUA 4WCDA 5AXCA 1S6YA 1ADGA 2OZPA 4U0JA 4B3JA 5DZSA 4DPLA 3HWRA 3HADA 4Y6PA 4R3NA 4FOSA 4R68A 2D5AA 2UDPA 4RGBA 2YJZA 5DOZA 4B3IA 4E33A 3GR6A 3Q1LA 4AL4A 4IJWA 4ROSA 3BIOA 1U8FO 2Q49A 1U7HA 5T64A 3DHNA 4JX8A 2W2KB 5F5LA 5DP2A 1UAYA 2Y93A 3GMSA 3DB2A 4A2CA 1TI7A 3G0OA 3TNLA 4E6PA 2NTJA 3DBHA 3D5QA 2EWMA 3RUDA 3QHAA 2YHUA 3RKUA 4BS9A 3PYLA 2B35A 5A4DA 2A92A 4IM7A 4Z0PA 3UXYA 1AE1A 3IUSA 4YT8A 5HRUA 4PZDA 4TSKA 1ZEJA 2Z5LA 4BNFA 1TT5B 2AXQA 3JD4A 1HDRA 2AEJA 3DFZA 4JN6B 4CQMD 3FTPA 5CG2A 3A28A 4OAQA 2O3QA 4XZ3A 3KVOA 4BO9A 2GDZA 1G0NA 1MX3A 2QW8A 4INAA 1NWHA 2X23A 2YQ5A 1VKOA 4AJJA 4GX0A 4CLRA 1AN9A 4UVHA 1N9GA 3FPCA 4EITA 2VRCD 1P9LA 1E6WA 4O59O 4WCFA 4RL6A 4CMIA 4CLXA 3LYLA 5IXYA 1C1DB 1Q7GA 3WX0A 1PQWA 3GG2A 3I9NA 1DO8A 1YH3A 3HB4X 3DZHA 4PLWA 2YV3A 3A4VA 2DBVO 2H63A 3DOCA 1P0FA 2O7QA 1WVGA 1E3EA 3U3XA 2Y1EA 3R3JA 1EVZA 1NFFA 1E7WA 3JQFA 1DC4A 1NAIA 3K73O 4J4TA 3W4JA 1JAXA 1YO6A 5FFFA 5KVVA 4S1VA 1UP7A 4CODB 1ENYA 1CETA 3PJGA 3S2FA 1JVBA 3VPXA 5H82A 2DBZA 3DMYA 5A9SA 2X0NA 3UN1A 3FNHA 3GDGA 1J4AA 3FI9A 3GMDA 1ZW1A 4P4GA 4YACA 3SEFA 5JYDA 4EUHA 4WOKA 2EKLA 1P1IA 3I83A 2H1SA 1FMCA 5GZ1A 1K6IA 1H9AA 3AY7A 4LRTB 2EJWA 3TOXA 1U3VA 2JAHA 5B12A 1CF2O 4YJGA 1U3TA 2PD6A 4IMRA 4MVJM 4C7JA 4IZHA 4JCOA 5A5FA 3AUSA 3B1FA 3WTCA 3M1LA 4DLLA 1HDOA 3KOUA 3GRPA 1PIWA 3MWEB 1VJ1A 3E9NA 1IPFA 5KKCA 3RUIA 1UZLA 3C1OA 1O9BA 1KVSA 4IJVA 2X0IA 3GHHA 3WGGA 1SMKA 2P9GA 2YW9A 3HZZA 2DBRA 2VN8A 1TVEA 3AFNA 1PS8A 1GUYA 3NYWA 4P4NA 4ALNA 1C3VA 1FDUA 1QYCA 3U0BA 2X0JA 4FSHA 1Z6ZA 1N8KA 4R9RA 1E7MA 1QYDA 3WICA 3UICA 1E7RA 1XLTA 2P9CA 2JD2A 3ZDFA 3DOOA 4XA8A 3NEPX 5ADHA 3KXDA 4J0EA 4OKNA 4NJMA 1LXCA 2WTBA 3NTOA 2DVMA 2FR0A 4NBTA 5L4SA 1RKXA 3G17A 1GZ6A 2PH5A 3ROPA 1PJSA 5GZ6A 2D59A 4W7IA 3KBOA 5JW6A 4FJ1A 3ADPA 3FNGA 3ZN2A 1UH5A 5B4TA 1ENOA 2BFAA 3WBBA 1W73A 4OXKA 1Q7CA 1SB8A 4QSMA 2UYYA 2GNAA 3OIFA 1LLUA 3Q2IA 4YAEA 4RPHA 5T8KA 4BKOA 2NLOA 2POQX 5MDHA 4W7HA 4DWVA 4J1QA 4XQ9A 2FN7A 5BT9A 2D4AA 2QZ9A 4UUOA 3EHEA 3MJSA 2PLAA 1Z82A 2WMDA 2LDBA 3O9ZA 4E3ZA 4N7RA 1WDKA 4P8RA 2Q4BA 3RUAA 1K6XA 2GN9A 1SAYA 3ASVA 3GOHA 4AJHA 1Y81A 3JQ7A 5JFOA 5KJCA 2I9PA 4Y98A 4IIVA 1Y8RB 3NAQA 2IE0A 3O8QB 4GWGA 2QRLA 4KUGA 1UJMA 3RUCA 1Q0QA 2CVZA 4WASA 1T4BA 5L7YA 2UVDA 2XAAA 3NX4A 3B1JA 2DLDA 2BF7A 4KQXA 3TSCA 1GCOA 3PQFA 4EZBA 4KQWA 4OSPA 4LSWA 4NK4A 5HM8A 2VHZA 2B4QA 1K2WA 5BSGA 2Q1SA 3I6IA 1PTJA 1DLIA 1B0AA 4I8XA 3U4IA 1MLDA 1FF9A 4J1SA 1IL0A 3COSA 2Y1DA 2GCGA 4E32A 5JMWA 1CEQA 5DCYA 1DFIA 1JW9B 2HMSA 4PLYA 1LDGA 3PHHA 4CM1A 4Q3AA 3RC9A 1VL0A 1HKUA 1EBFA 4DA9A 2G5CA 3JD1A 3U4HA 4YJDA 1NVMB 3QE3A 2J5QA 1LDNA 3PLNA 3IQDB 5L3ZA 4CM9D 1CYDA 1M6WA 2W4QA 5JBIA 4NBUA 4J9VA 1XA0A 3GZ4A 4OOFA 3V1YA 3UAGA 1OFGA 4XR4A 4GBJA 4Y6SA 1X0XA 2EKPA 4OIMA 1F17A 3RSHA 4AVYA 3IDSA 4Z3KA 3F1KA 1HE5A 1IZ9A 4L9RA 4RVGA 1JA9A 2BELA 1ZK2A 3GFBA 4ZVVA 4IZIA 3AOEA 2WWRA 3JTMA 4GGOA 2D5CA 1T1RA 1ISIA 2ZK7A 2OL4A 4AJLA 1E1NA 4IJUA 4OHUA 2PD4A 4BKQA 5JCJA 4DQUA 3H5RA 3UKOA 5KJFA 2I67A 4XQGA 1UAGA 2IXBA 2DM6A 1VJTA 4H16A 1ONOA 1ZH8A 1Z45A 2HRBA 3ZHBA 3CMMA 1XQ1A 1C1XB 4LCJA 5IF3A 4IPTA 4MVJI 4B4UA 2RH8A 1UZMA 4GMGA 4XX0A 4XQCA 5TT1A 3BTUA 4ZQEA 2Y1OA 1R0KA 1WP4A 4TROA 3SVTA 1HDCA 1WXDA 1ZFNA 2GZ2A 1KY4A 5I8ZA 2Y1GA 2VWGA 2PFGA 4FGSA 3ITDA 5EIOA 4CM4B 4EJ6A 3OQ6A 4BHTA 2DFVA 2O3JA 1P31A 3PJDA 3AM5A 3DTYA 5CP8A 4KWIA 1KOLA 5COBA 4BNHA 3LQFA 4BIIA 4AJOA 4D7AA 1ZUD1 4NQZA 1I33A 1LC3A 4PG8A 3DBLA 1I10A 1E3WB 2OBYA 1LUAA 3LDHA 2CVQA 4MJLA 1I01A 4HNHA 5TJ9A 5DBGA 4B8ZA 1EE2A 4DC1A 1XELA 3D3EA 1HETA 3E18A 4K6CA 3STHA 1LU9A 2DT5A 1N7GA 3AUTA 3JQGA 1PQUA 2J3HA 2DPGA 1XR3A 4EJMA 4RO0A 4E12A 5DN9A 3H3FA 1C0LA 3SX2A 1YL5A 2Y05A 1ZXBA 3LC7O 4FPXA 4ZQBA 4DPMA 4CL3A 4BNLA 3ABIA 4KUHA 5C37A 4UEJA 3LSYA 3FN4A 1O0SA 3H9EO 3IJRA 1EZ4A 3BA1A 4GLOA 2CF5A 1ISMA 2OP1A 4RF4A 1DIBA 2E82A 3VDRA 2X6TA 4BMVA 1ZEMA 4E2XA 3VZRA 2ZTMA 4J2HA 1OC4A 4UREA 1KEUA 4YJFA 1SO8A 2GO1A 5KNLA 4IDEA 5EQDA 2RAFA 3DAPA 2ZTVA 3DFUA 1DAPA 4E5KA 3C1AA 3U5TA 1B3RA 4M89A 5CEEA 3PZRA 2NVUB 1AHHA 3FD8A 3I9JA 4WLFA 4DC0A 4JNKA 1F8GA 1NHWA 4AJPA 4BUCA 4NI5A 4XB2A 5JO0A 4IS3A 2CD9A 4O5OA 3VVCA 3E6AA 5L7TA 2IXAA 3RCBA 3GNSA 3GUYA 5L4NA 2BKAA 4XB1A 3JD3A 4LCEA 3SC6A 1T26A 2C7GA 4IQGA 5DOVA 5TX7A 2D1YA 4MVJE 3NJ8A 1YS4A 1QYVA 2VYVD 3BMCA 3ENKA 1I3KA 4ND1A 4UAGA 3K2BA 4EBFA 4YAJA 1ISGA 1K89A 4K26A 3D4OA 1DOHA 3OQBA 3ZWXA 3PHJA 1D1SA 4CMGA 4XR9A 4PLZA 5A05A 4DXHA 3RUHA 4A27A 3PFFA 1BRMA 1LLDA 4UEKA 2IODA 4PLVA 3ZV4A 1R0LA 4MINA 4TVBA 1ZKMA 4GWKA 5ER6A 5I9LA 1HF3A 3MOIA 5JS6A 4QO8A 2IYOA 3RU7A 3MZ0A 5IXSA 4DIFA 3JQBC 3WGYA 1Y5RA 3DZFA 5KCZA 4MKRA 2HK9A 3FPLA 1SEPA 4FBGA 3UHAA 2RIRA 4U6SA 5L51A 4ONEA 4UUMA 4CR6A 1R4NB 1PR3A 4MVJP 4W4TA 1AGNA 9LDBA 4CL8A 4R5MA 1PJLA 3BMNB 1A5ZA 2D8AA 1Y8QA 5C3MA 3Q0EA 4D0SA 3H4VA 1DC5A 2NU9A 1SOWA 1PZGA 3E8XA 4B7CA 4F6LA 3ZU3A 5FEUA 3PFWO 3I6QA 2VNAA 3EMKA 1LRKA 2Q99A 3D5TA 1D8AA 4BNKA 5JNLA 4LVCA 4PGFA 1TA4A 2X5OA 2NUAA 4PLTA 1ZNQO 4CR7A 3QA9A 1QLJA 2YYYA 3LF1A 2WSBA 4YCAA 2Y1FA 4M87A 3PRJA 4WEQA 5K6AA 2X1HA 1XHLA 3TOZA 2Q45A 4R9SA 4BNZA 3DONA 4II2A 3HDHA 4IDBA 2IEDA 2QYSA 3DXFA 2X8LA 1QV7A 1J0XO 1K5HA 4GSLA 4GKBA 2BD0A 2JL1A 2ZCVA 4PRLA 4RF2A 9LDTA 5EMHA 3C24A 3HN7A 3UW3A 2C2XA 2OP0A 4PFJA 3GY0A 3TFOA 1DPGA 3ENNA 3JYQA 3HDJA 4FFNA 4E2ZA 2CSUA 4E0BA 1A27A 2AG8A 2EXXA 3D4NA 1ENPA 2QRJA 4IINA 4JP3A 1E3IA 5JC8A 1PZFA 1EDZA 3GN1A 4AJEA 1W6UA 4FFPA 8LDHA 3PXXA 3R3SA 2Q1WA 3DEYX 1NYTA 5FYDA 4CLHA 4GPD1 3WGIA 1ZZEA 1H6BA 2X86A 3PGJA 3O26A 3GPIA 3CZRA 4UVDA 2Q1UA 4H3VA 1NQOA 2E37A 4PG6A 1TXGA 5T6BA 3WTBA 4PZCA 3WGOA 1PS9A 4A5OA 5I7EA 1I8TA 2X7HA 5KVQA 4BGIA 1U3UA 1IULA 2ZB8A 2PZJA 3RD5A 1NFQA 2NACA 3OHSX 4WEOA 2DUWA 2FSSA 4E4YA 3IAHA 4MVJA 1HDZA 3WIDA 1KVQA 2WD7B 3H9JA 3T4EA 3QWBA 2EP7A 3JQAB 4DIBA 1R4MB 1IB6A 3R0IA 4P22A 3E9MA 2PA3A 3ETGA 4HWKA 5F1KA 3ZW8A 2WD8A 3C7CB 2ZYGA 4XRRA 1R37A 1NPYA 5L40A 1DAOA 3ZHXA 3PJEA 1QMGA 2AHRA 1I30A 4QT0A 3ZWAA 3RASA 3JQ9C 4MIYA 2AG5A 2C07A 4KTTE 3AUAA 3PYXA 4U0KA 4CMBA 2RCYA 3RIHA 2R6JA 5DNAA 2BI8A 2AEFA 4IGEA 3NT2A 4I5EA 2JFHA 3WGTA 3D3WB 3CTMA 4Q9NA 4WECA 1PQPA 5A03A 5KWEA 4NR0A 4WLVA 3V2UA 4L4XA 4BO7A 3TZKA 1G1AA 1DEHA 4ND3A 1YRLA 4BKPA 2WYUA 4QQRA 5AXDA 5IJZA 3RQSA 1B26A 1T4DA 3DHEA 3E5MA 3IMFA 5EERA 5KIAA 4GLLA 3KYBA 4A0SA 4W6ZA 2A35A 3WR5A 4NU6A 1CJCA 3OJFA 1BVRA 3F5SA 1O94A 2OUIA 1VC2A 4YAGA 3JQ8B 3RUEA 3H6KA 2BH9A 3UUWA 4Q3DA 3DL2A 1E0DA 1Y9EA 1YE3A 3S8MA 4F3YA 5T57A 2BFPA 1R16A 5TJHA 1HXHA 3IKVA 3LK7A 4R41A 3CE6A 5TT0A 1YJQA 3L4BA 2Y0DA 4WLNA 3VVBA 3BTOA 3WSVA 5ENVA 3DZJA 1BW9A 4KWHA 3WLFA 4JQCA 3GVPA 3ETDA 3ZWOA 1NAHA 3E03A 1YB1A 4KUEA 4DREA 4B3HA 3ZWMA 1BXGB 4XJTA 4U7WA 4ZA2A 1UZNA 2Q50A 4OMUA 2J8ZA 4BGUA 2HRZA 2B37A 3V1UA 1EDOA 1TLTA 1WAMA 1E7YA 1UDBA 1ONNA 5KVCA 2VYND 3WQSB 3U4CA 5CDTA 2OMEA 1KS9A 3EYWA 3F4BA 2BGLA 3HDQA 3QVSA 1MB4A 2VZ8A 3DMTC 2R00C 2ZQZA 4UEOA 1WW8A 4BVAA 1KVRA 2A4KA 4TRNA 3IP1A 1H6AA 1A7KA 4GX5A 1I24A 2YHIA 4GKVA 4DPKA 1RM5A 3RKRA 3AWDA 1B8VA 3H2SA 4GVLA 1C0PA 3GC6A 1ML3A 4LK3A 2AQHA 1W8DA 1PJTA 4CMKA 3VH2A 4R69A 4OOEA 3ANMA 5G4KA 3OJLA 5JDIC 3DBHB 3JCZA 1PGJA 4GL4A 2HU2A 3C7DB 5IN5A 5THKA 3ZH2A 2DQ4A 2FSVA 3GT0A 4FCCA 4R16A 3ZHZA 2EW2A 1NHGA 4IJKA 4B79A 1RYEA 2Q2VA 3OA2A 3BHIA 4NFHA 3MWDB 5JDCC 3U4DA 3FWNA 3HNPA 4YJHB 2Q4EA 1C14A 2W98A 1WWKA 1QXSA 3E1KA 3WMWA 3QVOA 1F12A 1LDMA 4OQZA 5IZCC 1NVTA 2W2KA 1V3TA 3JYPA 4RLSA 1T2EA 1NVGA 3GGPA 1DB3A 3QY9A 3EZYA 1YONA 5JAZA 3MOGA 1E7QA 4RORA 4Z0HO 5JE8A 3SJUA 3GK3A 3M2PA 1UDAA 4WCFB 4CMIB 4TRMA 1HLPA 1ZMOA 5JLAA 3O03A 1GU7A 2GLXA 3PDJA 2B5WA 4BQPA 4ZRMA 1LI4A 1I32A 1U4SA 3AOGA 3I9KA 3L4SO 1YOVA 1KERA 3VHRA 4I5DA 1TT5A 1T25A 3FNEA 2XXBA 4EUEA 3OJOA 1O89A 2YFHA 3INRA 1I0ZA 1KEVA 4IDGA 1KVTA 2EIHA 1B14A 4AJKA 4E31A 4XYEA 5DP1A 4FFMA 1PJCA 1BWSA 3ZGYA 3GVCA 2G17A 2GD1O 1GZ4A 5ILGA 2O50A 3WYEA 2CDAA 1PGOA 4XYGA 4BNUA 4I9HA 4NK5A 4EDFA 5LDHA 5G4LA 4FJ2A 3DZGA 4NMHA 3H9UA 3ZWYA 1I36A 3L6DA 4OL9A 2GSDA 5G0UA 1OMOA 1C1DA 2A9FA 2QX7A 4MO2A 2HK8A 1ZBQA 1JWAB 3ZI0A 1UXGA 3G1TA 2WYWA 4C7KA 4RPGA 1GUFA 2QRKA 3BHJA 4TVOA 1H94A 2PKQP 3H8VA 3H65A 1E1LA 1D4FA 4LSMA 3RC2A 1L7DA 5IZ4A 3DZBA 3DHYA 1H6CA 5LC1A 2YFQA 3QP9A 4HXYA 2B0JA 4IUYA 3PHIA 2G82A 4FFOA 2NU8A 5EQFA 4RDHA 3TJRA 4RJTA 1Q1NA 3OSUA 3O4RA 4B7XA 2VTDA 1M66A 2XPCA 2XXJA 3G1UA 3L6OO 4BV9A 1ZSVA 5CHEA 2RH4A 4XYBA 2OXIA 7ADHA 3HN2A 3EVNA 3E82A 4TRRA 1HRDA 1RPNA 2IZZA 3KYDB 4AJ4A 2O3UA 4IGFA 3KLPX 3EAGA 1TEHA 3OEWA 4RPKA 3W8DA 4NBVA 3GGOA 3HG7A 3QLJA 1V3VA 2O23A 4PZEA 2DTEA 2IYPA 4FIZA 2BFMA 2X22A 3F5QA 5IDWA 5BQFA 3D0OA 4RF3A 1GDHA 3DBRB 1HSOA 2NWQA 4DTIA 1IHXA 2EF1A 4CV3A 1K3TA 2C5EA 5JPIA 2DPHA 1Z75A 2ZKLA 3INTA 1BXZA 4QXMA 2FPIA 1U4OA 1NM5A 4M86A 1AHIA 3WWYA 2DTDA 4CM3A 5JAMA 4KTVE 4BV8A 1BTOA 5EINA 1SEVA 1E77A 4R54A 4II3A 1PJ2A 4N5MA 2GPTA 3TF5A 1H2HA 1YQDA 4Y67A 1X1EA 4YWJA 1NWCA 3JD2A 3ONDA 2JD1A 3NV9A 1CDOA 4OGWA 4R51A 1MGOA 4OXYA 3VPFA 4XCVA 4MVJG 3ZWVA 4RVSA 4FJ0A 3PP8A 1SC6A 4YR9A 4CLDA 4LMPA 1F8FA 1JWBB 2HMWA 5C7OO 3UH1A 2C5AA 2AA3A 1YL6A 3JQ7B 2O48X 1MV8A 4D3DA 1P1JA 1MFPA 4BO5A 4ZHSA 1VL6A 1UP6A 3WS7A 1HDXA 2O3SA 1X7GA 3JQAD 1DFHA 5KVSA 3QWAA 1EVIA 4GQAA 4N54A 3NGXA 3PQDA 2W2LA 5DF1A 4P4LA 2YZ7A 2WDZA 1SB9A 2NSDA 3GVXA 4J2OA 1E5LA 3JSAA 3ROMA 1H9BA 4YRBA 3HJAA 3DQPA 3F4LA 3F6YA 5KJEA 4HFRA 1H0KA 4IQ8A 4A03A 4OM8A 1OBFO 5U1PA 3PGXA 3AK4A 3W6UA 5JAQA 4B7UA 1E3SA 3K92A 4D3SA 3I3OA 1P1HA 3ASUA 2H6EA 4LVUA 4TKMA 5B4UA 3VH3A 2VHWA 3O8QA 2HAEA 2HK7A 1EK5A 3U9LA 3F46A 5KOIA 2BI7A 1LSOA 3N74A 4QFCA 2BFOA 4YDRA 2NVWA 3AM4A 4N5LA 3C85A 3OM9A 3S1LA 5HTOA 2GN4A 3M1AA 1A7AA 4YEDA 3W4KA 2HUNA 5JY1A 1V6AA 3IC5A 1UDCA 1FXSA 1SBYA 1IE3A 3QVXA 3VH4A 1RM0A 4XGKA 3AU8A 3AI3A 1WNTA 2O4CA 1H93A 1IOLA 4CMEA 1V8BA 3KYCB 1ISHA 1PJBA 3SC4A 3GH3A 4ND5A 3RFXA 4A10A 1NTOA 1IY8A 1PGQA 2I3AA 4IIUA 2J5RA 4CMCA 1A71A 1F0YA 1X7DA 4I1IA 1S7CA 1PGPA 2PWZA 5J23A 1QR6A 4L73A 4TZTA 1QRRA 1X1TA 1NPTO 2QYTA 1FDSA 3CZMA 1HZZA 3OEYA 3I9MA 2Q2QA 1LA2A 3PWSA 2FRDA 1YQGA 2CZCA 4IMPA 4R1SA 3D1LA 3GEMA 4RV9A 3FHLA 3ORFA 4UULA 4JROA 4W9NA 4TWRA 5TLSA 1P0CA 4D42A 1VSUA 3GAFA 5BSFA 4QUKA 2X9GA 3ZW9A 3Q6IA 3WFJA 1DIAA 2YV2A 3MCVA 5A06A 4ALKA 4NG5A 3IP3A 1JLLA 2JKVA 3AY6A 4UUNA 4WJZA 4MP8A 3MJTA 2UUPA 2ZB7A 1Q2XA 1TT7A 2HKIA 1GQQA 3ZV5A 3CH6A 1I3LA 1G0OA 4HFNA 5AOVA 5EPOA 2Z1NA 4ALIA 4YRAA 4DGSA 3BMOB 4FFRA 1EQ2A 2UAGA 1VL8A 5IFLA 1MP0A 4FS3A 4JJIA 1Y6JA 1X15A 1WZEA 4IQ0A 2G1UA 3A06A 1LLCA 1DLJA 3JQGB 1XG5A 2GR9A 1PR9A 2Z1MA 3S2GA 4NJOA 3QIVA 2OOSA 1GEEA 5L4LA 4OKIA 2OORA 1KBZA 3ZWBA 3P5SA 4U8GA 5H81A 3EUWA 4ILKA 4J43A 4J9UE 4CM4A 4ZJUA 4PG5A 3ZWNA 1MXFA 4CQLA 1EUZA 3V2HA 4WCFC 1U2GA 2QQ5A 1U9JA 2XF8A 4FN4A 3GZNB 3ZU2A 1W4ZA 4L76A 5HBRA 4JJGA 3KUXA 1KVUA 3V1TC 1EUDA 2E48A 1ORRA 5JY6A 3ETEA 3PEFA 2NU6A 2GASA 2Y0CA 5ENDA 1RYDA 4DMLA 4BB6A 1IUKA 1XSEA 4N5NA 3JQFC 3OBBA 2CDCA 4Q3NA 2DC1A 2EKQA 2LDXA 5CPBA 1V35A 3PHLA 2B4RO 1P44A 3DMTA 3AU9A 2DFDA 4BGEA 2R00A 1MG0A 1CIVA 4Z6KA 1NNUA 1NR1A 5FI5A 2ZQYA 3WNQA 1Y9AA 4PIVA 1ZSYA 4PG4A 4GAEA 4GSKA 4J7CA 1H6DA 4J6FA 5B1YA 1R15A 1Y5MA 3RVDA 3ULKA 1LDBA 4HUJA 4RZIA 1Q7BA 5KJ6A 5I9NA 2X5JO 3KV3O 2O3RA 3CIFA 4EUFA 3BMCB 3NTRA 1Z7BA 1Q0HA 2O3TA 2PD3A 3D64A 4G65A 5COQA 3WWZA 1QLHA 3DZKA 3X2FA 2NVUA 4CM7A 4CQMA 2HQ1A 3ZV3A 1YB5A 3F9IA 4E5YA 2DTXA 2NU7A 4QECA 1P1KA 1Z74A 1YQXA 4WPGA 4HP8A 4CMHA 5K0ZA 5A3VA 3ADOA 4WE3A 3GRKA 3NDJA 2EEZA 1HZJA 1LSJA 5DDIP 5L9AA 5IDYA 4CLEA 1YB4A 3LF2A 1K0UA 2VRCA 3IUPA 1FDWA 2IZ0A 3INGA 1VLLA 1NFRA 1NP3A 3IOYA 1OI7A 5GZ3A 3JYOA 3L0DA 1T2FA 2HDHA 5DCUA 2C2YA 5DT9A 3OP4A 3DR3A 1Y8QB 1ADBA 2WJPA 3K2EA 2X9VA 4YPOA 1KETA 4UVGA 3VDQA 1ZK3A 2P68A 5G0TA 5HS4A 3FF4A 3U62A 4R5HA 3OECA 1ONPA 1GYPA 1LX6A 3GA0A 3EZLA 3RFTA 4J0FA 1AXGA 1P74A 1KEWA 3SXPA 4UUPA 4RDIA 3WYCA 3WGZA 1KEPA 4YA6A 4AJIA 5EESA 3PVZA 1ID1A 4AJ1A 2O2YA 4L4SA 2CMDA 3RWBA 5T8KC 4KMSA 4R1TA 2PR2A 3HB5X 4IDAA 7MDHA 4GH5A 2ZYAA 1R4NA 3WB9A 1GEGA 3GVIA 1XU9A 3HFGA 3ZNOA 3BMNA 2NV6A 4WLOA 1M75A 3MTJA 1GY8A 3JQEA 4JBIA 2EGHA 4EEXA 4DLAA 1ZVMA 3EC7A 3LZ6A 1R0SA 4OO3A 1A9ZA 3BXXA 3PDUA 1BDBA 4AJNA 1HYEA 2AQIA 2NADA 4J4BA 4Q3BA 5FF9A 1XU7A 4XKJA 1GR0A 3V8BA 3OMLA 3WDSA 1X7HA 3LC1O 4B4OA 3X2EA 5ITVA 2O7SA 2X4GA 4CM8A 3VTZA 2B83A 3CMCO 4I9NA 3RFVA 3ZCXA 3CUKA 1DIHA 1LQTA 3S55A 4E30A 5TGDA 4AICA 2JFGA 1BDMA 1I2ZA 1DIGA 1E6UA 5ES3A 4XEHA 3VZSA 4K28A 2ZB4A 1E1KA 3QWIA 4B4VA 2F00A 3B6ZA 3WQRA 4BL5A 2GZ3A 1RM4A 2Y99A 5JSFA 4RVFA 1E7SA 2GZ1A 3Q9UA 3OF2A 3OICA 1SCUA 2D2IA 5C7IO 1EQUA 4YAIA 4D41A 1JN0A 4NFSA 3GQVA 1YL7A 2AW5A 3M2TA 3RBVA 4PG7A 3F47A 4EYEA 2E4AA 3AOEC 1B8PA 2J3KA 1BG6A 1IZ0A 1NBOA 3G3EA 1PS0A 4IXWA 4OQYA 4EGFA 3LVFO 2OBNA 3FBTA 4W99A 3B20A 3ZNPA 3ZHYA 4BO1A 5KTKA 4AFNA 5TQVA 1W0CA 3DZIA 1DJQA 4M1QA 3KETA 3BMQA 2GN8A 1EMDA 3DTTA 4GGPA 4CLOB 4DIOA 5CDUA 5JCJD 2ZYDA 4Q3CA 4Z0TA 4LGVA 2EHDA 1P1FA 4BGVA 1GPDG 4G5HA 2VQ3A 1VE9A 4Y9DA 1A4UA 3EDMA 1NQ5A 3LT2A 5I7VA 4U5QA 1EBUA 4KDFA 1GTMA 4RVDA 1EE9A 5DCWA 4M55A 1R66A 3DDNA 4L4RA 1R6DA 1DDOA 3C8MA 4GMFA 4O6VA 4K1LA 2C7VA 2BMAA 5HS6A 1BW9B 2WE8A 4CUZA 2XOXA 5JO9A 1GAEO 4J1NA 4Q39A 2J3IA 3I52A 1E3LA 4NFYA 3ST7A 3F1LA 4CUJA 2W90A 1KYQA 3BYZA 4XWYA 1HTBA 2FZWA 2VRBA 3MJCA 4UVEA 3ANNA 5L7WA 3D7LA 4CM9A 1YBAA 5CEFA 3P19A 4J7UA 1NASA 1X0VA 3FWZA 3U09A 4BNNA 4GI2A 1NR7A 2YQ4A 3MJVA 4E13A 1HE4A 3EK2A 3PWZA 4OXNA 1WLYA 1DXYA 4L74A 3ZZNA 2Y1CA 1WZIA 1LSUA 2VTEA 4EEZA 3JQ8A 1QORA 4NBWA 4DQXA 3WXBA 3ON5A 1J49A 1G6KA 4JIGA 2IDZA 1LRLA 2FY8A 4DYDA 2OFPA 4I9UA 1KIFA 1NQTA 3PIIA 1JKJA 2A94A 3AJRA 4ZQGA 5THQA 4BNTA 2I65A 5JMPA 1ZJYA 1N7HA 3V5NA 3L9WA 1HDYA 2CDBA 5C7LO 2Z95A 5CAEA 4O0LA 1O8CA 3AFMA 3H7AA 4IDCA 4ITUA 4BMSA 4FFLA 4BNGA 5DULA 3ONEA 2EP5A 1J6UA 1SOVA 3BZUA 1ARZA 1GPJA 3VC7A 1A4IA 3PWKA 3AI1A 3RJ5A 1CERA 4BKUA 3TZ6A 5L45A 4RVUA 4PRKA 3N58A 4HADA 4AJ2A 3I1JA 5MGBA 4DBVO 1H5QA 2YUTA 3KTDA 5U9CA 1NXQA 2AEMA 2QHXA 4O63O 3D4PA 1BVUA 4U6QA 4NDNE 2X5KO 4ZRNA 3UCEA 5CFZA 2B5VA 3C1TA 3F3SA 4BB5A 5JAIA 1I3NA 4LW8A 2F1KA 2WM3A 1QG6A 3K8ZA 1BXKA 3MEQA 5F1OA 1J5PA 3LT1A 5TS3A 3ROQA 3PYMA 3LT0A 1U2DA 5JYEA 4CLRB 1NX6A 1OZAA 3MJ4A 4ND2A 1YDWA 5IG2A 1N9GB 3WQQA 2VUUA 1HT0A 1UUFA 2NTNA 4ESOA 3I4FA 3PQEA 1PX0A 3RC7A 3OIGA 1JTVA 4D46A 1YOVB 1ZSNA 4AG3A 2YDYA 2NQTA 4WLUA 4YJHA 2NNLD 1VRWA 2VT2A 3WNVA 3ZWCA 4NZ9A 2WEKA 3S2EA 1B8UA 1PWXA 4FC7A 1XEAA 2V6BA 4Y8VA 2PZLA 1UXKA 3Q2KA 1YDEA 2Y0EA 1EVJA 2I6TA 2GN6A 2QG4A 4BNIA 3AUUA 2PV7A 3MJEA 1PU2A 2CFCA 3TZHA 3HHPA 1KC1A 3S2IA 4DQVA 4QO7A 4KP7A 3SLGA 1FDVA 1LSSA 4DVJA 2FP4A 4PLPA 5A9SB 1M76A 3G49A 3OJEA 5F1PA 4DBZA 5ILOA 3O38A 5K1SA 1D3AA 3H3JA 1PJ4A 2J6IA 1YKFA 4FGWA 3KSZO 3JD0A 3KEQA 4YJGB 4QEDA 3DO5A 3A1NA 3UF0A 3LLSA 4D79A 4HFMA 3QV1A 3K31A 1A9YA 1UXHA 4XYLA 3L9XA 4CMJA 1N2SA 5TIIA 3UGKA 2Q46A 1N5DA 1U28A 1I3MA 4BKRA 2AE2A 1CQJA 1DSSG 4BO2A 1PL8A 1ZJZA 3JV7A 4F46A 1ZK0A 3LT4A 2JAPA 5GY7A 2I76A 2FWMX 3HDYA 5K6AC 4IDFA 3BHMA 1GQ2A 1WMAA 2HJSA 1PGNA 3CEAA 3KB6A 4L0QA 2QZZA 4IDDA 2VYVA 3ROKA 5BSEA 3ITKA 1T2AA 3TZCA 4ALLA 4DLBA 4DRYA 2TMDA 4MKZA 2AMFA 2PZMA 4MVJF 2D3TA 1V0JA 1E5QA 3PHGA 3WG9A 1AXEA 3OJ0A 3AI2A 4NHEA 5U4QA 1Z7EA 3QVTA 3HFSA 3K96A 4NJMB 4OYRA 4MIEA 3FR7A 3NJ4A 4ZN6A 4BNYA 5F21A 5TC4A 1XWFA 2Y68A 1ZK4A 5LDGA 2VZ0A 1F06A 3GPDG 4PLHA 5I8WA 2JCXA 5DBIA 2OO5A 2DBQA 5G0WA 3KYDA 1SPXA 4EJ0A 2PGDA 1RWBA 5GMOA 2I3GA 3JQBA 4LISA 4CR8A 2B4TO 3QSGA 3PLRA 3HUDA 1GQYA 1R12A 2EV9A 3TPCA 5AYVA 3BTSA 4IBOA 4J16A 3DBRA 3WJ7A 2VHXA 3FBGA 1LBEA 3NDRA 5TRTA 5A9RA 5HWSA 4RVHA 1L7EA 5BNFA 5IDXA 4FC6A 3I23A 4QTZA 1VJ0A 5T67A 3LC2O 2VOJA 2VWHA 2UUOA 3ANLA 2ZTLA 3TL2A 4WK6A 2EGGA 4ND4A 5FWNA 4PCVA 4RLHA 4ALMA 5G0SA 3PIDA 5F3RA 3DOJA 1M6HA 1LJ8A 2PKQO 4MVJD 3K6JA 2PNFA 2I99A 4YT5A 4F6CA 5ICMA 4K6FA 5TSDA 3KEOA 3EW7A 3H5AA 3NT5A 4R4JA 2PTGA 1C0KA 4JJFA 2BRUA 4WUVA 2CY0A 3SLKA 3WMXA 4YQZA 1ISFA 4BNMA 2JD0A 1CQIA 2ZJ0A 3AY3A 3HE3A 4LRSB 5FI3A 4YT2A 3GF4A 3ZNNA 3KRTA 4RQTA 2Q3EA 1CWUA 4H7PA 2HO5A 5EJ2A 4RPLA 2IZ1A 5DBFA 1CRWG 2GERA 5IDQA 1PL6A 1U7TA 1ENZA 2HJRA 2YDXA 1HSZA 1B7GO 2VHYA 4WKGA 5K9ZA 2AQKA 1ZXLA 2VNSA 1B15A 1LC0A 2DUUA 1Y8RA 1DC6A 3GNTA 3VKVA 4XQEA 1IPEA 3GHYA 3PPIA 4ID9A 1GV0A 4MOWA 5G0VA 4DL9A 1XCBA 3H5NA 5L95A 2V6GA 4E2YA 3C3XA 2V65A 1XGKA 1QYWA 1ZMTA 4HV4A 4MVJH 3VTFA 2H5LA 3L4BC 2VUSA 1VPDA 1O5IA 2VHVA 1NPDA 4NU5A 4BQRA 4BMNA 2V6FA 2PH3A 1N92A 4WNCA 2EG9A 4ZQFA 4FOOA 2HCTA 3Q9NA 4JLWA 1MXHA 2DU8A 4CV2A 1V9LA 1EEHA 1P1RA 3H9QA 4MPDA 4YTEA 2JJYA 4C4OA 4ZU3A 1VSVA 1ULSA 1X13A 3GUCA 4F45A 1O6ZA 5BSHA 1AUPA 2P91A 2W8ZA 5BNTA 3WBFA 1P33A 3AW9A 3OH8A 3Q3CA 4NBRA 3FR8A 2NTVA 2ZCUA 1L1FA 4E5MA 3JYNA 4RCVA 1H2BA 5TF4A 4CUKA 2DAPA 3ZWPA 4J90A 4YAKA 3KHUA 1P3DA 2O2SA 1MA0A 4PLGA 2UV8A 3KO8A 5ER9A 3NUGA 4M54A 4D45A 3WJAA 1WMBA 3OA0A 5A02A 1V3UA 2JCYA 3LLVA 4XGIA 3NRCA 1LDYA 4FR5A 3KYCA 4Z3DA 4JBGA 2VCYA 3OQ1A 3H2ZA 5I9MA 3RBXA 3JQ9A 5I7SA 2BHLA 5ICSA 1DRVA 4CM5A 3JQCA 3EY4A 4L75A 3VZPA 1Q0LA 1KC3A 5EL0A 3K9QO 4QX6A 5JXWA 1DRUA 3IKTA 5KJ1A 1LEHA 3QQPA 4FW8A 3EVTA 4GVXA 4ZGWA 1MC4A 4IY1A 3RROA 3H9GA 5CDGA 1QV6A 4LN1A 4YT4A 3E5RA 4XDYA 4YYZA 3WGQA 3BTVA 2EW8A 1ZO8A 2CNBA 2JCVA 2PKRA 3DC2A 3FNFA 4CPDA 3U49A 3DBLB 4JP2A 2V6MA 4TMFA 1OOEA 1YGYA 1C1XA 2BGKA 4UVIA 3UFXA 1LRJA 2YY7A 3V2GA 3WYBA 4B4WA 4BNWA 2CVOA 3GDFA 5BNIA 3ZNQA 4XIYA 4ZD6A 3OETA 3VH1A 5ITWA 2CF6A 3DAGA 3KLMX 3ZWWA 2FHSA 2X9NA 1JVSA 5COAA 3WGHA 1JU9A 2GYYA 3DWFA 4J4HA 1EK6A 4CQLB 3W1VA 2D0IA 2HMVA 3BMOA 4D44A 4JGBA 2VWPA 1D1TA 1MG5A 4N18A 2G0TA 2TMGA 6LDHA 1WDLA 2P2SA 3DBVO 1E3WA 1GUZA 2VYNA 4KDEA 3W8EA 3R6DA 4YJFB 3ZU4A 4PN3A 2P9EA 1MC5A 4J3FA 3TN7A 3WFIA 3WOHA 5JCXA 3W4IA 1P45A 1JAYA 3FTNA 3T4XA 3UVEA 5KKAA 1XDWA 4OSOA 1FK8A 2OGUA 3IS3A 3L6EA 1JDJA 4M49A 5F5NA 3QRWA 4A26A 4P38A 2EERA 3B1KA 3JQ6A 3I5MA 1M2WA 5BR7A 4JBHA 2ZJ1A 3GN2A 3GZNA 4IXTA 4W82A 3UCFA 3KZVA 1MFZA 2HMTA 2RHCA 3K5PA 1PJQA 4XIJA 2GUGA 3PZBA 2NVBA 4E2WA 5CG1A 4D43A 5A3JA 4MP6A 2AE1A 5CDSA 3RC1A 1QSGA 2C0CA 4BO0A 2CUKA 2X0RA 4MKXA 5LCXA 1PJ3A 3TZQA 4HY3A 5JDIA
chains in the Genus database with same CATH superfamily
1Y5IA 2PJZA 4NOJA 3LT5A 3GEGA 3IAFA 1BSVA 3V9AA 1K06A 3R7LA 1DBVO 2C5HA 4KIGA 1RE1A 4FYKA 5EKDA 2RFLA 3OPMA 1WXWA 4YCDA 1QIHA 1FP7A 1K63A 2YVUA 3EB9A 3QVVA 5EZYF 3ZV6A 2JK1A 3I5YA 2ZS9A 1KH1A 2K87A 3UTDA 3IP5A 1DARA 5J2UB 3HQ4O 1O97C 1HE3A 1II8B 1XZEA 2FEMA 1I7LA 1E92A 2OKGA 2BGMA 2Y67A 3CG0A 3IMKA 3ZYCA 2PS3A 3RI3A 3K9LA 4QEZA 3TDMA 1E3JA 1SJ9A 3DFIA 4A1OA 3ECAA 4ASUD 2IYAA 2JJ2D 2OECA 3VJMA 2ZB3A 1VMDA 1N34B 4BWYA 1D2CA 2BGJA 1E63A 4IL5A 1KAGA 5IZCA 3DSRA 3GVHA 3HBAA 4CKZA 1DTWA 3TOCA 5L53A 1Q0PA 4I5GA 4LJ5A 2GVDC 2XRZA 1YZVA 5AXAA 2OFWA 4UDXX 3N2KB 4E7OA 1B0UA 3TGPA 5GINE 4P0PB 3CSDA 3ENQA 1ZIXA 3QBEA 4QYXA 2GPBA 2B69A 3FB1A 4YMTA 1ISJA 5JSHA 4H15A 1XZFA 3PXBA 5A71A 2HHHB 3A6LA 3B1YA 2ACKA 3SE0A 4A7PA 4E21A 2OAGA 1G3MA 4BO8A 4ALJA 1XRJA 4YQYA 3OFSA 2Q5CA 4US1R 2VOEA 5EIEA 3L6CA 3C5VA 1UJ6A 4HWRA 4Y0NA 1ULUA 3TSAA 3I61A 4PANA 2I66A 2NZJA 2YWJA 2YXPX 3KZ1E 1CV2A 3FGNA 4GNKA 1RKBA 3V1LA 1X87A 1XTBA 2RC6A 1RQ2A 1EFKA 3BS4A 4MS1A 3W0LB 3V3KA 5HKAA 4AX4A 3VPGA 3TDKA 5JSKA 1QP8A 4N7BA 4LY3A 5B5SA 1KEKA 2GK7A 2V59A 3KALA 3T3DA 4Z9YA 4BYGA 4FMDF 1TVKA 1M8GA 1XE3A 1C3JA 2I1QA 4KAJA 4M1EA 1RM3A 5IC6A 4BMDA 4QOHA 4CG1A 2JFFA 3HRKA 3CIOA 1SG9A 4BFZA 3G6KA 4Y6RA 1YT5A 4KXYA 4FB5A 2IP4A 2ZBVA 1N7JA 4YBZA 1QIEA 5ABPA 4JBLA 4MMZB 5H83A 2ZPUA 3BAZA 1DRJA 1GKYA 1UR5A 4R05A 4XUEA 5TY0A 1SKUA 1QP0A 5IAAA 2E85A 3QELB 5C46F 2AFIA 5A1TA 3P26A 3U4QB 4XWGA 3QJYA 4JK3A 1E9SA 1LNSA 2X58A 3FOAA 1C3OB 4J0QA 4IOMA 1M0WA 4DDWA 1L3IA 1UP4A 2BR3A 4DG8A 2GZRA 1RXVA 3A9WA 2H8GA 1Z28A 1ZMBA 5EWMA 4YDHB 1Y3AA 2Y66A 3S70A 4CM8B 3A58B 3N0TA 4PYQA 1HEUA 4QJ4A 1M33A 1OFUX 5EXEA 4L6AA 2OCBA 3CWZA 3MTGA 3ZLUA 4R8LA 4IDOA 1M1NA 2YZGA 3IBGA 2FPPA 4X0EA 2J1LA 2PZKA 4YP6A 1WOYA 1SUWA 3EIXA 2IEZA 5CB4A 4RK5A 1DC3A 4DUPA 1LCIA 1DC7A 1GSOA 4DZTA 2RMKA 2X4IA 4I50B 4N1AA 4XB6B 2D1TA 1QP4A 2BFCB 2AJ8A 1GGMA 1F5NA 1N5RA 2PK3A 3NOQA 5B3KA 3QKWA 3MK31 1V9SA 2YTZA 3NXKA 2HWWA 4Y2TA 5B53A 4EPWA 2XMCA 2OD2A 5C7YA 5MHTA 3AILA 3JSXA 1V7QA 3R77A 4FFBB 5EMLA 1BGVA 4OBXA 1EFLA 2P5UA 1FLAA 1GZ5A 1NUQA 2G83A 2OCGA 1SIUA 5LUAA 4MITA 1S3FA 3QEMB 3QJ5A 4MQ4A 3MTBA 2F8TA 1QTQA 1RIIA 3TH5A 3AVQA 4XASA 3RBZA 3FUUA 2AYZA 3CVUA 3Q2OA 1JR3E 1KDTA 4U63A 1HG0A 1M2JA 1Y1LA 1P77A 2DULA 2JHPA 2VF2A 2VJMB 1IZ7A 3ONFA 3QEBZ 1U9CA 1DG9A 3DEZA 4M53A 1NW8A 1X1RA 3ZU5A 2P4SA 2IPMA 4OA8A 1NXSA 2W6QA 4DAOA 1AX9A 4FR2A 4ZQCB 1MNAA 1XKQA 2O0HA 3NORA 4WXMA 5CDYA 1U6JA 1JKIA 4FNOA 5EJ4A 2VAPA 2CWDA 4CW7A 2G08A 2BKXA 5JXIA 4NARA 2CYAA 4BRSA 1HMYA 2DJIA 1LNZA 2JGDA 3G2JA 4NAVA 4U2EA 3BFKA 1MH9A 1OJ7A 3IRUA 5SYAA 4BO3A 3T9EA 5AVXA 2FRDC 2OCLA 1X9IA 2RHRA 4UW9A 5I7WA 4RIHA 4AP5A 4HDMB 4IW3B 1NQAO 4UU7A 2H7CA 4M8SA 3GDHA 4BP1A 3HKCB 4Q7JB 4Q01A 2QL7A 2YWRA 3W9YA 1WE2A 4IJMA 3ZDDA 1T6YA 1TCBA 1X14A 2V97A 2ZRFA 3FKQA 2V4MA 3D8NA 3H17A 5M7EA 3KZXA 4BJ3A 3WDMA 3BD6A 4LX0A 4PYIA 4R2MA 1NT2A 721PA 3DCJA 1HDGO 2DGDA 4AMGA 2QAGA 4KHZA 1JHOA 3K09A 2HN9A 2HLPA 3M4ZA 3OUTA 2ZWAA 1VM6A 2V7EA 3B6IA 4UDYX 1Z5VA 4FDAA 2Z5FA 1BKYA 5BWCA 5T5QA 2NUPA 2HH9A 4GPAA 3C16C 2OHXA 2E49A 3CX8A 1H23A 2H2AA 3COPA 4RESA 3H2GA 5CPFA 4CM6A 1XZDA 4JDUA 4KOAA 2YYZA 3DUFA 3NETA 1MB2A 1MDFA 2C57A 3SF8A 5JBQA 1MNQA 1T24A 4NH4A 2GTPA 2JGIA 2AMLA 2OV4A 1JMVA 4KRYA 1QHYA 4RD6A 4WK0B 5JQGB 6ADHA 3M3PA 4QUGA 4FMCB 1F4PA 3WV5A 2FN3A 5DWVA 4HKTA 3QH4A 3HJTA 2E6UX 4EO9A 2I3ZA 3NONA 2CHFA 2NXJA 4UTVA 4LXIA 4GM0A 4H18A 1DHTA 1Y7HA 1V1MB 3I9OA 1WTCA 4HTFB 5E9WA 3C7AA 5IARA 4MRMB 1RVV1 1TJNA 3RV3A 2P65A 5DM0A 1FNDA 1KXJA 1MUUA 1U04A 2Y1WA 3AHGA 2JGNA 4LY6A 3ZHCA 4DSUA 1K6JA 2CWWA 3OOYA 4FQ5A 1LTHR 2FOIA 1YJBA 2ZSKA 5L8VA 1CS0B 5FTKA 3WKEA 3A1TA 4E2FA 1XV5A 1M6NA 1RHJA 1O0CA 1G8AA 4IF4A 1S1CA 2JHFA 2P5YA 3KSUA 2J9RA 2CLEB 2C2ZA 2OD7A 3CUUA 3Q3JB 3RJ9A 3TRDA 2VF4X 1W94A 1V5WA 1NR5A 4OQXA 2WFMA 4RW0A 5LZ7A 1NN5A 1T6XA 2GRAA 1N1EA 4YUXA 3CLSC 1E9FA 4O1MA 1C0IA 1GPAA 1JP7A 1USVA 2YIJA 3B9PA 4Z8XA 5DWQA 3PPWA 4L7VA 3T34A 1OAAA 4QPDA 2EJVA 3SJBA 2J0SA 1SBCA 4TKLA 2V0NA 3E53A 1RRVA 2O2DA 1T1EA 2WI8A 4HRAA 4J0GA 3OZEA 3ASYA 4PGMA 1WSDA 4TKUA 4UM8B 5AXCA 1XA3A 2AFHA 3CLSD 1S6YA 1PYDA 4H2DA 3T06B 1YNOA 4NTZA 4V0KA 2BM1A 4RD3A 5K3OA 4LOLA 4B3JA 4DPLA 3FZNA 2J4CA 4XOIA 2XMZA 3A0UA 4PC1A 4R3NA 3WL4A 4RGBA 3EXHB 3T61A 4E33A 3KWLA 1QNFA 2NN3C 2OM6A 4RY0A 3KVRA 1D7AA 1U8FO 3CN9A 1ULAA 2FPXA 3O82A 1RLJA 2Q49A 2PYIA 5T64A 1SGWA 2HHJA 3MAJA 1VXOA 3DHNA 4JX8A 2D7JA 2I4TA 4RIEA 4YC7A 5EXSA 2PT6A 3MPUA 3ZOZA 5ERXA 5K01A 3IT2A 5DXFA 1L7XA 5DP2A 5EYPB 2D7DA 3OU6A 1J5XA 5JWRA 2Y93A 4IVPA 4IYJA 1W25A 3P45A 1L7NA 2IP2A 4JSRA 4LV8B 3G0OA 4MGZR 2M6LA 2WIDA 3FSEA 2AJCA 1D2EA 4FEAA 3QHAA 2CLHB 1FQKA 1NF2A 2D5IA 1GAXA 1V2GA 3L5KA 1U11A 4QVKA 1VBKA 2A3RA 3IUSA 3KKLA 1X94A 3C0KA 2M2IA 2WVAA 3EVGA 1K7YA 1A5AB 1C8KA 2AMJA 3OSZA 4QREA 4BNFA 1TT5B 4C7VA 4OV6B 3A8TA 4EUSA 4ZO8A 1HDRA 2QUIA 1N2CA 5D8DA 4IVNA 4EAQA 3FLAA 3FTPA 3TGWA 3NH9A 1U0HC 4UM9D 4RTOA 4M8LA 4LDAA 2O3QA 2ZSJA 3OQHA 3WQHA 3IE2A 3DD1A 2NZYA 4B3FX 1MX3A 2MCFA 1FP4A 3EZ9A 4INAA 1NKSA 4QYIA 1A8SA 2YW2A 4AJJA 4JGGA 2O1WA 1N0IA 4LJKA 4EITA 1NXVA 4LC0A 2H2WA 1FA9A 4XUDA 4LRWA 3Q6NA 4RL6A 1D4ZA 1MT0A 4NENB 4B3CA 1U5BA 1EX9A 5L6MB 1E2FA 3AWIA 4IX1A 4CIDA 4Z4IA 3HDGA 1C1DB 3A1SA 1Q7GA 3WX0A 5ITSA 3VMFA 3QNUA 4R31A 1NW3A 1DO8A 2XE7A 3HVIA 1J07A 2XYHA 3DZHA 3JVIA 3P32A 5DLDA 4AKTA 2YV3A 4F5YA 1PX2A 2Z30A 1UBHS 3M5DA 1P0FA 3PTLA 4PFKA 2GYVA 3T1QA 1QG2A 2F9FA 4CU5A 3JX9A 1WVGA 3MFYA 2F43A 4UEQA 2BR5A 5CNKA 4K2AA 1F8YA 1RU3A 5ALHA 5AUNB 1NFFA 1V6CA 4MYSA 1BOOA 1DC4A 2DJ5A 2MU1A 3GEBA 4MJXA 5DLQC 3V1NA 3W4JA 1JAXA 1OH5A 3WO1A 1YO6A 5FFFA 2PHZA 4F3KA 3P0IA 4TZ6A 1UP7A 4B8YA 5HIIA 4F1KA 3NKVA 3PV0A 3K1JA 4CKBA 1EGMB 1JU3A 3PJGA 2P4EA 3U37A 3ZJTA 5H82A 2ZZMA 1JU4A 4TV9F 1OV4A 3G68A 3RNOA 2OBBA 1UJ5A 3ITNA 4YACA 1MD9A 3GMDA 1ZW1A 1XF1A 2ZYUX 5LLSA 2HIHA 5JV5A 2DR0A 1G21E 3OBIA 3ZPXA 1MHTA 2YWCA 3QF7A 3WK4A 1FMCA 3IAAA 3W6OA 1K6IA 2WSMA 4LRTB 3NALA 4WACA 1KA9H 4KK3A 5EFZA 3SC3A 3TOXA 4AO8A 2JAHA 2GHRA 3MG9A 4UU1A 2PD6A 4TL8A 4C7JA 4MVJM 3ELUA 4PV7A 3C2QA 4QYSA 4JCOA 3MNFA 5A5FA 1QU3A 5AI0A 4GPEA 4A8JB 5L3SA 3KZCA 3KOUA 2C84A 1G2OA 4Y2HA 5AO9A 3PGLA 4K3UA 1VJ1A 3RUIA 1UZLA 1BFKA 4KGDA 5JCOC 4L9SA 1BGXT 1KVSA 1MA3A 2HB6A 4LECA 4WV3A 3RREA 1KYTA 3SYRA 4F97A 3O93A 4IJVA 3U6KA 3GLIA 4AS2A 3GHHA 3WGGA 4GR5A 2Q6KA 2YW9A 1TA0A 3LJKA 4JQOA 4ND8B 3A3OA 5E4TA 1U2PA 3KWFA 1IBSA 2QE7D 5EGSA 1PS8A 4BQFA 5AKXA 1FDUA 4G5YA 1VE3A 5FOWA 4KQ6A 4PX5A 1VPTA 4JENA 3Q5DA 2X0JA 4IFBA 1E1CB 3GJYA 2JIDA 1US8A 2W6IA 4K88A 4N01A 1E7MA 4OL0A 1A2BA 1E2LA 1FYDA 2G63A 1C7FA 4AQDA 1FNMA 4LXTA 3UJ3X 1ANKA 5GIPE 4ER6A 1CC1S 4IGAA 3UMYA 4FUTA 3VSBA 5KSYA 3PCTA 4AW9A 3RB8A 2IF2A 1MMFB 3OVMA 4OKNA 1JXOA 4BX0A 5KYYA 3RAFC 2W2XA 3NTLA 4EK9A 5BXYA 2AOTB 3ZGLA 1LXCA 1NT4A 3JAKB 4L27A 2DVMA 1QH8A 5DNWA 5C80A 2FR0A 3HVKA 3DLHA 1G3UA 3G17A 3IDOA 4OKSA 3SHTA 1I9CA 1UCFA 4LNAA 5GZ6A 2D59A 6CHYA 4Q9IA 5JW6A 3NTXA 3K72B 2G0NA 4M6WB 4I3FA 3H86A 1YRYE 3ROFA 2ZBFA 3ADPA 1D9XA 3DEAA 3PC7A 5B4TA 4X20B 1ENOA 4F4FA 1BE8A 2WIGA 1NV8A 1EHIA 1ZD1A 3ZH9B 1W73A 1K92A 4QSMA 5H59A 2UYYA 4X1IB 2GNAA 3PR2B 3PNVA 3BF8A 4HF7A 2AFRA 3RWMB 2I6UA 5HF6A 2FN7A 2E55A 2D4AA 1GTRA 2Z6QA 2QZ9A 2G0AA 3EHEA 3CNQS 3G5UA 1KSJA 1O5OA 2PLAA 1Z82A 4IIGA 4AN1A 4UTRA 3CF6R 1WDKA 3EQ2A 4N7RA 3VAYA 4C03A 4AY6A 2C2KA 5KHAA 2XNDD 5J63A 3RGWS 3AR5A 3TVDA 5L3QB 1L4FA 1I5EA 3K5WA 1B73A 1OF1A 1HGXA 2I9PA 2R6CA 4L4UA 4LTNA 4JBNA 4PE5B 4IIVA 4V38A 3NAQA 5ALPA 4XVCA 4JJ7A 4ZAWA 3RVNA 4KGXA 4CCYB 1UJMA 3PBKA 4IMJB 3DE2X 1Q0QA 4ANFA 4PNHA 3TR0A 3L7YA 2FTKE 1Z2PX 1YR9A 5E6SA 3H0EA 1GQSA 3QYAA 2QUKA 2C61A 5AKEA 3HGTA 4KQXA 4C29A 1GCOA 2P77A 3RTCA 4WY2A 3Q3HA 3I6MA 4X9XA 3SLRA 3REOA 5H3CA 3GJ5A 4QODA 5HGJA 2B4QA 1J1ZA 1L3BA 2IEGA 1L5RA 3DE5X 4HQ0A 5LVAA 2BZSA 1PTJA 1IHDA 3DEFA 4F5ZA 4Q19A 4Y9SA 4IP0A 1MLDA 2JH3A 4M37A 3PXAA 1CEQA 5IC5A 1A50B 1E5DA 3H4TA 2HMSA 3LWZA 2G4LA 1DCTA 1PI3A 4X97A 4N5IX 5KVAA 2XB4A 4XLZA 4Q3AA 5CDFE 2HXGA 3RC9A 3S7ZA 2P2DA 4MCHA 1RJFA 2G3YA 1NVMB 1ZJ5A 1ZUIA 4CM9D 3PLNA 1JPUA 4XTCS 2H1WA 1GGHA 3THYB 3ESQA 3TE6A 3ZTYA 1IQRA 1NA5A 4QDXA 1QHIA 4OOFA 2GDJA 4V0SA 2EC5A 2XSZD 3BL5A 4DLNA 3QOWA 3U3OA 1U3FA 4M9SA 1NJGA 4M0FA 4NY1A 4OIMA 1F17A 4ZT3A 2RGWA 3H42B 4OTZA 4OJYA 1OH8A 1B76A 1M2HA 2KB0A 3F1KA 1QGUA 4RVGA 3G2OA 4RA6B 2BELA 1ZK2A 3OCZA 1AY0A 4LYAA 2BGWA 4GGOA 3CZ9A 4PWYA 2J6HA 5E95A 1T1RA 4LSZA 3UAWA 3KJIA 2OL4A 4X62B 2RHDA 2JKZA 4IJUA 4P3OA 1EZZA 3DOIA 2FW1A 4BKQA 2XB8A 4KN9S 1DWOA 3BWVA 5KDDA 3FNQA 5JPCA 4XCXA 1GTJ1 4F8EA 4WN9B 1PJZA 3V1MA 1TUBB 3H5RA 2QRNA 1LBIA 5AKIA 3DH0A 1LGYA 4ENVA 2I67A 1P62B 2EFGA 2A6PA 5LYJB 3TIVA 3T1HB 2DWOA 4ZJZA 3OCYA 3JZMA 2AG1A 2EDCA 4NNPA 1NXXA 2C7OA 3RYCB 4QOFA 1Z4LA 1Z45A 2HRBA 3R9WA 3IHLA 4LCJA 4NFLA 1YFJA 5LNK6 4IPTA 4AZVA 5AOAA 2RH8A 2HR1A 1AQLA 1UZMA 4XX0A 1U94A 5HF5A 3TCKA 3BTUA 2VAXA 2CEAA 3C39A 3UNXA 3ZKWA 4D56A 3MT0A 3HXQA 3LUCA 1XMPA 1HDCA 1X7WA 2VJOA 1ONBA 3HBMA 3NHMA 4BASA 3L0BA 3IIJA 4H3HB 1ZFNA 5TARA 3AHFA 1J0EA 2I3DA 4C7OB 2WSSA 2B3DA 4JGIA 1M5UA 2FEWB 2V54A 2XUFA 3DEHA 4B0OA 3K9BA 2VNHA 1JR3D 3NBKA 3UAVA 4EJ6A 3TINA 2DFVA 2O3JA 5DM2A 1P31A 3PJDA 1NVVR 1DKUA 1NBHA 2SNIE 1SXHA 3BOSA 3JZIA 3TB6A 1ZC3A 3ADCA 1SVMA 1L1QA 3L7JA 3PL5A 4D7AA 4NQZA 1I33A 1LC3A 4OHOA 3DBLA 1C4KA 2WF6A 3LDHA 1U8EA 1JNXX 1KO7A 1R6AA 4WWHA 4ARBA 4B8ZA 1EE2A 1AT1A 2QE6A 2QVBA 3OFKA 2BEUA 3RRZA 5MF6A 3G5MA 1Y42X 4Q1AA 4RU1A 4IOJA 1MZVA 3P9CA 2GRJA 4IKPA 4U6NA 1VJRA 3C3BA 5CX4A 3SSNA 1E0JA 1N7GA 1F2UA 3KSMA 2JJ1D 3I53A 3MWFA 2A86A 2L2QA 3CRZA 3OURA 1A8UA 1WG8A 4J0DA 2ZXFA 3LQQA 4RO0A 2JJ8A 4EJMA 5DN9A 3WYFA 4I4NA 2OCDA 5FL7D 1ZY2A 4ZXFA 2V9ZA 2CXUA 2G70A 3AESB 3LC7O 4FPXA 2VJDA 3DDUA 2B1IA 1GPMA 4UNQA 3I5AA 3KKKA 1ZOOA 4TUYB 4ZANA 5C35A 3K0FB 5B7NA 3I6ZA 3IOBA 2QBYA 3NP9A 1Z2OX 3LYHA 4MCAA 3LSYA 5DRYA 3UYKA 4F86A 1KJYA 3BK7A 4NLLA 4RSMA 1SU7A 1HORA 3O74A 4CKEA 2Q3LA 4BU1A 3H2KA 4ER3A 3QTLA 1WB6A 3VDRA 3X1JA 4LHXA 4J2HA 1KI1A 3AEYA 2P8JA 3M6LA 4ZPJA 4INJA 4CG2A 3QSYA 4M9RA 1AH2A 1Y1RA 3O94A 3U3JA 1ZD9A 5EIHA 5KYUA 2RAFA 3N39C 1OYVA 2W0SA 3FAZA 1USKA 4FHGA 2H0QA 5AW0A 2FRVA 5EUMA 4E5KA 3K8YA 5AKKA 1GQRA 4LOHA 3R9KA 4MWZA 3UFBA 4RVCA 4FCTA 4KI0A 1DEKA 1KGDA 3KC2A 2JAWA 5IBQA 4KRGA 1JEEA 1RI1A 2WZCA 5CGQB 1YS9A 3THXB 3RRMA 1JXMA 2F9MA 2IVFA 2RKWA 3F2VA 2F59A 4J03A 2DR2A 4IS3A 1BX3A 2PRZA 1CR0A 5JI2E 4EX7A 3E3MA 3TW8B 3PQ4A 4AUNA 1T26A 3DV0A 2VKQA 5DOVA 5TX7A 1LPPA 3G2PA 3PFCA 2MR5A 5KOHB 2PRIA 3K70B 2QZSA 4U2CA 5DO9A 1EDBA 1VYTA 2XNJA 1JSLA 3NJ8A 2VYVD 5EHGA 3UK0A 1IK4A 4EKIA 4EBFA 2CCKA 4WUTA 1ZS9A 1ISGA 1BA3A 1K89A 1VKRA 4TL6A 4K26A 4C6TB 4UHKA 5DV9A 2B8JA 1T13A 4KWEA 1C7JA 1GGEA 4O29A 5DIFA 5E7IA 4B7ZA 4H0NA 4CMGA 2FQQA 3LLUA 4PLZA 4OAOA 1JG4A 1U0FA 2GLTA 1RAAA 4DXHA 1II8A 5K3EA 3FTEA 1C7IA 1EM8B 4LWPA 1L5SA 1RCUA 1UT5A 5ALUA 4BLQA 1T1JA 4RK6A 3ESDA 4ZYXA 1CB0A 1R0LA 3L01A 5BSWA 4EGAA 5ER6A 3IP6A 1HF3A 1K7CA 3GNLA 2BHSA 3QUAA 4O2AB 4QO8A 3S1AB 2HV9A 3GLGE 4DIFA 3JQBC 5C5EA 4F9EA 5KCZA 1X1CA 1R9MA 4RZ2A 3IUEA 4RTMA 2W6JD 4G89A 3IR7A 3OQNA 1KPIA 1V8OA 1II9A 1YUMA 1BU8A 2CJXA 2CMFA 2QU8A 4YCJA 3UHAA 3V4FA 5EXXA 2RIRA 2FX3A 4R81A 4U6SA 4B0PA 5DMHA 4EJFA 1R4NB 1PR3A 4LK2A 1QQTA 4W4TA 4MW1A 4BFCA 1IM2A 1AGNA 2VVTA 5AJVB 4XSHA 1CQZA 2PRYA 9LDBA 4ESVA 1XRSB 3ESBA 1NY6A 2A5DA 1DX6A 1B8NA 4OQQA 4G8DA 5DU2A 4ZCQA 2HWYA 1IJEA 1V9CA 1R2QA 2H2GA 2JI6A 1DC5A 3CGWA 1ISRA 3LVBA 5CVUA 2JGFA 3E8XA 1Y4SA 4B7CA 2R4TA 4F6LA 2WJ6A 3K6RA 5FEUA 2NAFA 3I1IA 3IQGX 2CUZA 3ODPA 3PQ8A 3TECE 5FDFA 1LRKA 3CNOA 1ZLYA 3VM6A 3KK0A 2QJOA 2OHJA 4BNKA 2WJ4A 3ABOB 3G2HA 1ZCBA 3PUVA 1YCHA 4ATNA 4PLTA 4RELA 3NBZC 1MRZA 3KQHA 4AY2A 1QLJA 2JASA 3MUNA 4R8MA 4BFWA 1O6CA 2C9MA 2YYYA 4IHKA 1SRRA 4KFUA 4MYCA 3T1OA 1NBME 1SC4A 2D7CA 2D2EA 3O3OB 2XE8A 4M87A 1W30A 2Q45A 3MFQA 2H31A 3ROTA 1GRCA 4KQ1A 3RVKA 5JIBA 2YJ4A 4TQ9A 1MQ9A 1L7RA 3DXFA 3QXGA 1J0XO 3AVXA 3QELA 3D5EA 2ZDGA 3FLBA 4GKBA 3QYFA 2D00A 4PRLA 5FI0B 9LDTA 2C2GA 3C87A 3P2KA 3C24A 4ZO4A 3SK0A 5KU1A 4JXXA 4TSFD 1YD7A 4YP5A 4PFJA 1FLNA 5DI3B 3W3AD 4ZI7F 4I55B 4DZZA 5HBGA 3HDJA 3LAWA 3O84A 2CSUA 4Y9UA 2ZYIA 2Y9PB 3IPAA 5HR5A 3VO1A 4UM5A 1QHGA 1ENPA 1RE0A 5JC8A 1PZFA 2FDRA 3PNMA 5CX1A 1EDZA 1N75A 4AJEA 5B7GA 1P72A 1F38A 2YMPA 2OBMA 3R3SA 3G85A 1K75A 3R8XA 1H2WA 4XQ0A 1G5PA 1EJBA 1O9HA 1Q1EA 2X86A 4QOGA 4IEIA 1GZ7A 1JHXA 1NVVQ 1YIAA 2GXSA 1JLSA 4MS4B 3RF7A 3CZRA 1SCBA 2H57A 4I50A 1SUAA 3LY9A 1XTQA 4KHPB 1GN9A 1U7ZA 2BTQB 2RI0A 3MUFA 4PG6A 4Q5IA 2GWRA 3OWOA 2QF7A 3BWXA 4TT3D 3UBTA 1H4VB 4R84A 5I7EA 5A7GA 2X7HA 5THXA 1BMQA 4WSOA 3NC1C 5EKSA 3OWXA 1RI5A 4RK1A 1FSSA 3U44B 3IEVA 2PZJA 3OHSX 2IHBA 4OFBA 2YBEA 4YFYA 3QEMA 2XRFA 1KVQA 1N6IA 2D62A 5K6TA 4BLRA 3JQAB 3X3HA 4Z4GA 1U9IC 3LPMA 1R4MB 1IB6A 1VP3A 1YHYA 3R0IA 4H4CA 4P22A 5KTPA 1E0SA 2BFWA 2XVXA 3ETGA 3L8ZA 1SZCA 3LWNA 4Z4EA 3C7CB 2VJMA 5DGCA 1U4NA 1AKVA 3D6TB 2HRDA 1NKTA 1DAOA 2HMAA 3LDAA 2VI5A 4K87A 3AZPA 3UHFA 5T4HA 4RUKA 4HAIA 5KMGA 2IUTA 4ND6A 5FBHA 2GXQA 2WTUA 2FETA 2G6BA 4YRCA 1JGTA 3BCRA 3QMMA 3R2JA 2COUA 5HFJA 2QD1A 2WOOA 5KO2A 4CMBA 2YXDA 2OCAA 2O19A 2R6JA 1SURA 1ZA1A 2BI8A 3MM4A 3JZDA 3B3GA 1XD2B 4E07A 4N82A 1L5MA 2HNKA 2ODQA 4MA0A 4Q9NA 1JJFA 1PQPA 4HDMA 5C9ZA 2BMVA 2NO9A 3PHCA 1Y4AE 1DDIA 1X7XB 2XEDA 3HKCA 3LP6A 3SVLA 5JJ5A 2H1LA 4MV7A 1YRLA 4BKPA 5ALLA 5AXDA 4R40A 4XOUA 1WD7A 1Z4NA 2VQEB 5M29A 2WWYA 1BEUB 1F1BA 1ICIA 3AIIA 4RV5A 2FOLA 4MHTA 4W6ZA 1G4UR 4LNUB 4YRSA 1NJ5A 3OHMA 4QNRA 4LI3X 1PFQA 1P73A 3KNZA 3NTUA 1VC2A 1SVKA 1F5SA 4B2IA 3RUEA 3HCDA 4K9RA 1BMFA 1NXTA 4NMLA 1IIRA 2ZBPA 3SE7A 2IP1A 3UUWA 4BZQA 1E0DA 4F3YA 1JFFA 2JEOA 1X2BA 2QTTA 2BFPA 3DYBA 3HGMA 3I1FA 5T57A 4EA6A 2R6HA 5JRDS 4R41A 4YO8A 2IUFA 3EFBA 5TT0A 4DQLA 1OD6A 5A2QA 1NYRA 4WLNA 5A4JA 2PVPA 3ELDA 1QG4A 1U2GC 4MA5A 1T5OA 2PPLA 1GT6A 5JQGA 1QLWA 3AFGA 3QENA 3BXHA 1YB1A 5GONB 3ZGXA 3FUTA 1FVFA 4B3HA 1RAHA 3ZWMA 2JFOA 4U7WA 4ZA2A 2D1RA 1JEAA 1UZNA 2WWTA 3ESAA 4RX1A 4OMUA 4Y2SA 2EF0A 4BGUA 4CODB 1P39A 1V1MA 4GBED 4KPFC 1ESMA 3KLOA 4HTFA 4I4IA 4CEJB 1KRXA 4AC9A 1ONNA 3ESXA 4MRMA 1H66A 5KVCA 4JLDA 3A1EA 4HGNA 4TVKA 3HHEA 4MQLA 4DIDA 3FUWA 4G5XA 3L18A 2JIQA 4HZGA 4OYLA 1P0QA 1MB4A 3HY3A 1QS0B 1CS0A 1Z2NX 4H3KB 3DMTC 4QOIA 4F5DA 5KYWB 2R00C 1QQ7A 4RE5A 1S3SA 1SIBE 3IP1A 4I2VA 5J59A 4YQFA 2IDKA 1JEQA 3OTIA 4GKVA 4LTDA 1EM6A 1QF9A 3DZ8A 3FDFA 3AP3A 3CUYA 3TMAA 5EHZA 2P6UA 3AXTA 4KIFA 4LK3A 2QWXA 2W2QA 4WINA 3ZJVA 2PVSA 2CMKA 1NTRA 1CFJA 3BGDA 4QWMA 1QFJA 3VI4B 3AERB 4CMKA 1ACJA 1YK0A 2VBCA 3R76A 3PT5A 1W19A 2DHEA 4BQIA 2PUAA 5JDIC 2QSYA 2QU7A 5CJJA 4CCWA 5GJWC 4KE7A 1J2YA 3QY0A 4XE5A 4OMFG 1DAIA 1TTPB 2J31A 1OXSC 3C7DB 2DQ4A 4NDZA 2SKEA 1GG2A 2FSVA 3BSSA 3TLGB 3ZHZA 1APBA 1XVLA 2EW2A 2VYCA 4NESA 4B79A 4FWTA 2ZM5A 5HJ7A 2Q2VA 1LV7A 3OA2A 2V7BA 2A58A 4FI3F 4Z1MA 1TIBA 3FWNA 3PC4A 2Q4EA 3A6EA 5KAPA 4O4IF 1A9XA 4RH1A 1PR1A 1QXSA 3E1KA 2FPMA 2HLNA 5ALIA 4ZT2A 1LDMA 1HMPA 4JT2A 1OE0A 4A0RA 3M1IA 4OQZA 2PMKA 2FR8C 3DHWC 4RLSA 3CLTD 4FCWA 1AV7A 1Z34A 5EYPA 1DB3A 4P33A 3QY9A 3G89A 1R6XA 3M6VA 2PSFA 1K8YB 1LPAB 1E7QA 1H0SA 2WM8A 4GQIA 4RORA 5JE8A 4QYMA 1XL0A 2WLTA 4A15A 4KDCA 1ECCA 4ZEVA 2J85A 4IIJF 4CGZA 3BGWA 3CPEA 4MWGA 3O03A 3RSOA 4DEVA 1O4WA 1FNSA 4ZRMA 2DXIA 4AZ0B 3L4SO 1XQWA 1YOVA 5F35A 3VHRA 1TT5A 3MGCA 3Q7TA 3WVNA 3G9ZA 3GJ4A 3PPXA 1G19A 4IQFA 3OJOA 4K6MA 4B43A 5KS2A 3INRA 3IP8A 1DOAA 2ZRKA 1TCUA 3D1VA 2EIHA 1SCAA 2W83A 3IQZA 4FI3C 4IH1A 4QQNA 2XI4A 4DRZA 4CIYA 3GLKA 2GXAA 2PEYA 5KHOC 4EG3A 4ENTA 4E31A 4XYEA 1PJCA 4GWLA 2R8EA 4Q1VA 2WUEA 1IEQA 3GVCA 3ZGYA 2G17A 4J29A 4F5WA 2J09A 1GZ4A 2A7XA 4ZZ3A 1V37A 1WP9A 3PEEA 1KDRA 4JR1A 5I45A 3VUEA 1PGOA 2BEWA 2QR2A 2YRXA 5LYYA 1XA4A 5LDHA 1YRQA 1E1QA 5G4LA 5F3WB 2YMLA 3DZGA 3ZWYA 1I36A 1PZNA 1AMOA 3MCZA 1DU4A 3NHKA 4OL9A 4L5JA 4NOMA 4BY9E 1C1DA 4MO2A 5K8JB 2C2MA 3GXOA 4B7AA 5CU7A 4GLBA 2I80A 4ZT4A 5LKAA 1JF8A 2XOKA 1B0ZA 1Y0BA 4FT4A 2OUKA 4RPGA 2OVFA 1WCYA 4UPEA 3ONVA 5GPBA 2QM3A 4OQPA 4PAMA 4F9GA 5A5GA 1PR4A 2WRZA 4N5HX 4TS9A 3H65A 5I7UA 1D4FA 4BRZA 3RC2A 1RAFA 3GLFB 2QPAA 2VSQA 2YFQA 2R6AA 3QP9A 2F1HA 1Q2UA 2B0JA 2F17A 3EOZA 2G82A 3F0TA 2NU8A 4LPSA 4MYUA 4U2DA 3C3KA 1S3GA 1T6NA 1FVHA 2XZDA 1E60A 3B82A 1KQGA 3RIMA 3O4RA 3OZGA 1G7CA 2XPCA 3G1UA 4L08A 3L6OO 4NU8X 5AW1A 1ZSVA 2AC4A 5CHEA 3NVDA 5F9MA 3RW9A 2FSUA 3NWOA 4CDRA 1PVOA 5JJIA 3GMTA 3EVNA 3E82A 4P83A 1HRDA 2FVXA 4LYHA 5HW0A 4AJ4A 1ABBA 2HF7A 2AXNA 3EAGA 3W8DA 3IPXA 3GGOA 1XKTA 3HG7A 4M9CA 4X3PA 1QK3A 1VL5A 3V8EA 3C4VA 2B7BA 2VXYA 3RYHB 5DGHA 2VP2A 3AF6A 1JLMA 5IDWA 3DBRB 4LBWA 2NWQA 3CY6A 4DTIA 1L5FA 1IWBB 1H1LB 3IO5A 4CV3A 2KS6A 4EL5A 4AMBA 1RWXA 1PUIA 1BXZA 3SYLA 3G8AA 2B20A 3OD1A 3DUWA 1NLZA 1NM5A 4M86A 1RWQA 1AHIA 4ND8A 2DTDA 3EQ7A 2GD6A 3ZZMA 2ZJ6A 1G9TA 4F7DA 1BTOA 4IUDS 3W05A 1SEVA 1E77A 2R87A 3R4VA 1E1CA 3GLHB 5CVVA 4GI5A 3TF5A 1H2HA 3UOAB 4CFYA 3GFQA 1X1EA 3OE5A 4YWJA 1KR2A 4F2GA 1W9MA 1DDGA 1CDOA 1LB1B 2CFIA 3NV9A 4R51A 4UBNA 1MGOA 2WB2A 3O75A 5KC9A 2XHZA 3MLBA 3T0FA 4DUGD 4I3GA 3TBKA 4JI6B 2O2HA 3Q3GE 1ZN2A 3H6HA 3NATA 4FJ0A 4RVSA 5KTYA 3ICEA 4YR9A 5EOVA 2QROA 2W58A 2AOTA 4LMPA 3ZD9A 4PW0A 5C7OO 5IP5A 2LCIA 3JAKA 3RH0A 2Q3JA 4BLOA 5FFMA 1QQBA 4S12A 1MV8A 2IY7A 2LCQA 3QXXA 1MFPA 3D8HA 3EE6A 2PZFA 3M4JA 1AQNA 4MSUA 1A88A 1U31A 1V8DA 2WJ3A 1VL6A 1WKCA 3B3AA 1UP6A 3E2MA 3BGVA 3QFSA 3AMVA 3NGMA 4KEAA 1HDXA 3AHIA 4OQ4A 1T4CB 1X7GA 2JCSA 3SYNA 5KVSA 1ZP6A 4JUFA 4BLSA 1MX5A 1JQDA 4N54A 1K1EA 1G5QA 4X1IA 5DF1A 3SSAA 1DKRA 4LMBA 1Q1GA 3U1VA 2QLNA 3KXKA 4UNSA 3NZEA 1E5LA 1G20B 2GNOA 5FULA 3UUFA 4EI9A 2QX4A 1MJGM 1NVUQ 1TAGA 2XUOA 3WB1A 3V4VB 3EWAA 2AFVA 2PT5A 1TMKA 3V4ZA 5U1PA 4Z53A 5HQJA 3W6UA 5JAQA 3K92A 2WWWA 1XKLA 4PYLA 3A1WA 2C3YA 4UHCA 1HR0B 3RU3A 3AIOA 3ASUA 3LCUA 4LVUA 4TKMA 1PO7A 3U1BA 3HKBB 1POWA 2HHCA 4CCYA 1MIOB 1PP4A 1J2JA 5D86A 3VR4H 3ZIUA 1Q74A 4MROA 3OEHD 4URHA 2CE2X 3HCWA 2P1RA 2ETXA 2J5XA 5ELXA 1DIOB 3MQ4A 3RNLA 2GT1A 2D2VA 4JYPA 4N5LA 3CWQA 4X8OA 1BE0A 1N3BA 5JZMA 5HTOA 3KJZA 3M1AA 2Z2JA 4MLCA 4ENPA 2Z5GA 4RNDB 1XNRB 1FNCA 1Q1BA 3MMSA 4Z2AA 5FLEX 1SBYA 1A8IA 1IE3A 3DB1A 1UWKA 1W0JD 2DPYA 5NULA 2CB0A 3F6PA 1Z4JA 2WVJA 1JQ3A 4B6OA 4Y2RA 1CJVC 1UPFA 1WS6A 4L78A 4JI7B 3EEBA 1SK9A 1H93A 1KYIA 1YI0A 2QPOA 2WZDA 3SC4A 3GH3A 4HLUA 4BLWA 1Z07A 2B21A 3KLNA 1NTOA 2RHOA 5TEWA 1XHEA 1JBKA 4DJFC 1QPBA 1S7CA 1UBMS 4C87A 4HWOA 1P8JA 1TLLA 3AEQB 3H1FA 4ITRC 1NBMD 1R9NA 2GO7A 1QR6A 2XA2A 3E15A 4FDMA 4F8JA 1QRTA 2HNAA 1OZFA 4DFDA 3VR6H 2QYTA 3T1VA 1FDSA 1HZZA 3OEYA 4FT2A 3I9MA 4BVLA 3PWSA 5C5DA 1UQTA 3CH4B 2CZCA 4IMPA 3BH0A 3D1LA 3FFBA 4RV9A 5EFOA 3BSFA 3ORFA 3EPRA 1CHNA 2ZI5A 2ATVA 2B9EA 2PKYX 3L0IB 3II6X 1EWQA 5TLSA 1XN4A 3KQQA 3Q6IA 4GMKA 3P2EA 2IUEA 2AN1A 4RA6A 3S4YA 5LDDC 3MCVA 3JPYA 3VR5H 2YS7A 2BE9A 2P4UA 2R7NA 1GFZA 3L8HA 3IP3A 3KXPA 3AF1A 3PL1A 1J0CA 2J3LA 4JQSA 2PUBA 3R9XB 5D1HA 3TFWA 1FFAA 1YMUA 4JOCA 4ZJYA 1O54A 4HX9A 4WN9A 2ZB7A 1U2DC 4HYQA 1TUBA 5HOQA 3C74A 3CH6A 2C9CA 1QE5A 3RJZA 1NYQA 3PNQA 3GMIA 4IIHA 4ALIA 4D0GA 4FYMA 2REQA 5LYJA 3EH1A 2OYCA 3A6ZA 4DGSA 1OVMA 1WUTA 4PR3A 3TD9A 3T1NA 4K6OA 1DCMA 4OAPA 2KPOA 2G06A 5KQPA 3R6LA 2YBDA 3NMUF 5I48A 2ZRCA 4ZXPA 3SC2B 1P4RA 2E7ZA 3HY4A 1KZHA 4NCJA 3UPUA 5HIJA 4AXXA 2ORED 4MW9A 1WZEA 3NOOA 2W71A 3RODA 1CY7A 3JQGB 1PR9A 3K20A 4EJSC 4H1TA 2LD4A