3WLEA

Crystal structure of (r)-carbonyl reductase from candida parapsilosis in complex with nad
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
335
structure length
335
Chain Sequence
SIPSSQYGFVFNKQSGLKLRNDLPVHKPKAGQLLLKVDAVGLCHSDLHVIYEGLDCGDNYVMGHEIAGTVAAVGDDVINYKVGDRVACVGPNGCGGCKYCRGAIDNVCKNAFGDWFGLGYDGGYQQYLLVTRPRNLSRIPDNVSADVAAASTDAVLTPYHAIKMAQVSPTSNILLIGAGGLGGNAIQVAKAFGAKVTVLDKKKEARDQAKKLGADAVYETLPESISPGSFSACFDFVSVQATFDVCQKYVEPKGVIMPVGLGAPNLSFNLGDLALREIRILGSFWGTTNDLDDVLKLVSEGKVKPVVRSAKLKELPEYIEKLRNNAYEGRVVFNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords (R)-specific carbonyl reductase
publication title Unconserved substrate-binding sites direct the stereoselectivity of medium-chain alcohol dehydrogenase
pubmed doi rcsb
source organism Candida parapsilosis
total genus 99
structure length 335
sequence length 335
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2013-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wleA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3wleA01
2JFGA 1SNYA 4ITUA 2H63A 1YB4A 2YJZA 1DIHA 5AXBA 4BNIA 5DBFA 3RKUA 4GKBA 4I9UA 2VNSA 2DPGA 2AE2A 4JBIA 1MP0A 1UDAA 3L6EA 3KSUA 3RJ5A 3IJPA 2VWGA 1YQXA 4D0RA 5EESA 3S2GA 4E33A 5T64A 1ZXLA 3W6UA 3OJLA 1ZK1A 4RLHA 4BO6A 3A9WA 2ZIZA 1FK8A 1YGYA 1VC2A 3QVXA 4YVFA 2XAAA 2DTEA 4D41A 2Y1OA 3PHGA 1ADFA 4OJNA 5FEUA 1KERA 5JXWA 5JPIA 3U4IA 3D1LA 4PRKA 2C54A 3ZWPA 3DBLB 2EKQA 4FJ1A 3FNGA 2Y68A 3F5QA 4IIUA 3WGZA 1MG0A 3QE3A 1BW9A 1PS8A 1EQUA 4RVHA 1QYWA 3QQPA 1DEHA 4TRJA 4J4TA 4Z3KA 1X0XA 2EERA 3PWZA 4F46A 3EMKA 3GT0A 4KQWA 5JAIA 1EK5A 4GPD1 1KC1A 2WD7A 2PGLA 3I52A 2WE7A 3DBLA 4R01A 4CMIB 2B5VA 3HJAA 3KM0A 4KWIA 3E9QA 1W8DA 3AUAA 4IPTA 5JO9A 4D43A 4CQMD 4FIZA 3GMDA 1V3VA 2W90A 2AMFA 4PVDA 2EP7A 4XWYA 4XEHA 2O7QA 3PFFA 1XYGA 3KTDA 3H5RA 2QW8A 4BB6A 2Y05A 3PQEA 2UVDA 3G1UA 2OORA 5L4NA 1UDCA 4CV0A 2X8LA 5ES3A 1KY5A 4D3SA 1DHRA 3NRCA 1SB9A 1YL7A 4RF5A 3VPGA 2CDAA 1P1HA 5BSFA 1PJ2A 1UUFA 4GI2A 3HNPA 1J5PA 4O6VA 4A5OA 2O48X 4IZIA 3RKRA 2BLLA 4BNTA 3L4SO 2FN7A 1N2SA 3RBVA 2AXQA 3E5RA 4CMJA 1EVZA 4BO3A 2OP0A 4GX1A 3QVWA 3DWFA 4DXHA 2EHDA 4PLZA 2O3UA 3PI7A 2FRDA 3GVXA 2GZ3A 4CM9D 1SOWA 4JLWA 2JCYA 4ROSA 1DFHA 4RF3A 1H9AA 2VUUA 3RFXA 3ICCA 3C3XA 1FDVA 5H81A 4ESOA 5CPFA 1LBEA 3ZV6A 5ICSA 1PJCA 4L9RA 1B7GO 4ND1A 5KVVA 4GGOA 1DC5A 3I83A 3SJ7A 2OBNA 3GVIA 1T1SA 3I4CA 3NT2A 5I8ZA 3X2EA 4GX2A 1I24A 1XLTA 3WGGA 2VWPA 4E5MA 3GDGA 2O3TA 1K6IA 2HK8A 2O7SA 3FTNA 1MV8A 3IMFA 1YO6A 3AUTA 2GN9A 4BGUA 1C0LA 3RUIA 2OOSA 4R4JA 3RD5A 1K5HA 1HE4A 3GOHA 4FFOA 3CMMA 3JD0A 3JYPA 1XU9A 4MINA 2C59A 4PLHA 4E32A 2VRBA 1PZHA 3M2PA 4DLAA 3ZW9A 5KOIA 1GZ6A 1ZXBA 1I3NA 1SEPA 2Y1DA 2HRZA 4MJLA 1X13A 3WGIA 1PZFA 1ZMTA 3KYDB 3LK7A 4DBVO 4L75A 2NVUA 1X1EA 3AUSA 3RAJA 5BSGA 2DU8A 3VDQA 3PXXA 1N7GA 3BHIA 4PLPA 4MIYA 5H82A 1I2ZA 4J2HA 1OFGA 3ANMA 3UOGA 5DDIP 4DA9A 2HJSA 1C1XB 4BO2A 1I3MA 3OQBA 1PGJA 3WLFA 1R4NB 3VTZA 4W7HA 2PGJA 2B5WA 3FD8A 4JGBA 5JS6A 2WDZA 1NQ5A 3KYDA 3RI3A 3MEQA 2D1YA 1HETA 5IXYA 2I66A 3QJ5A 2VT3A 3KLMX 5L53A 2E48A 3FWZA 2NM0A 4XYEA 4J16A 4F3YA 3C7AA 3O8QA 4OAQA 4NG5A 3WIDA 4U6QA 2C7VA 4XYGA 3FNFA 3ZHXA 1ULUA 3ZN2A 4F6CA 3QP9A 2O2SA 4D79A 4J3FA 1DRWA 4DQVA 2GSDA 1YJQA 2D3TA 4XYLA 1JW9B 3MTJA 5JSFA 3OEWA 3TJRA 4KUHA 1HLPA 3WGTA 3CSDA 1N1GA 4RVDA 5JAZA 4CMHA 3DBHB 2GZ2A 1GV1A 4WEQA 2JD0A 4MIOA 4XIJA 4NFSA 4KMSA 2WM3A 1LUAA 1XELA 2C20A 2VWQA 3E9MA 3MZ0A 4OO3A 2HMUA 1NR7A 3ASUA 4HFRA 1VL6A 2VUSA 1ZKMA 3GY0A 3U4DA 3WJ7A 3NJ8A 1E3WA 3PZRA 4RV9A 3I9JA 3GNSA 2PZMA 3TPCA 3FN4A 4ZA2A 4Q39A 1B8VA 3BIOA 4MVJE 5GZ6A 3AM5A 2CFCA 3BAZA 4FC6A 1R0SA 2VOEA 3GN2A 3LVFO 3B1FA 1F8GA 4JCOA 1PR3A 4OXNA 4PRLA 3OJOA 3WR5A 4OIMA 2VHYA 2Z1NA 2YY7A 1UR5A 4PG5A 2FR0A 3S2EA 3UFXA 4B4VA 3VKVA 2SCUA 3VAZA 1H9BA 1UJMA 1D7OA 2DC1A 4I9NA 1ZCJA 2X6TA 4E13A 3ZI0A 3UICA 1HXHA 3CZRA 3F4LA 1I36A 2Q4BA 2VZ9A 4TRRA 1AGNA 1HKUA 3VZQA 4CM3A 1BDMA 1RM5A 5BSHA 4EW6A 1V35A 1ISFA 1PJQA 4A03A 4CLRB 4YPOA 1H6CA 4ZJUA 3Q2KA 4PN3A 4PVCA 3BHMA 5LDHA 4J7CA 3EZYA 3K8ZA 4U0JA 2VHXA 2O4CA 4EUFA 3RWBA 4Z3DA 4GLOA 1JWAB 1MXHA 4ALJA 3K96A 3WS7A 3T4EA 1AE1A 1ZUD1 3VH2A 4GX0A 4R1SA 4KTTE 4AJIA 3DZFA 1GV0A 1NP3A 1Q1NA 4CLOB 5IXSA 2VOJA 4ZQBA 2A92A 3F1KA 1U8XX 3OFSA 1EFKA 2D5CA 4J1NA 3PEFA 3A28A 3AOGA 4PGFA 4CLXA 3ZWOA 1TT5B 4NFYA 3W4IA 4YBZA 5CHEA 1ZK0A 4AJ2A 2F1KA 3ETDA 1JAXA 5MDHA 4BGEA 2E37A 3H9QA 3ZGYA 4M86A 3GGPA 4JBHA 1HTBA 4RZHA 4XYMA 2FY8A 2AE1A 3GAFA 1GCOA 4TVOA 4B8ZA 5BSEA 6LDHA 3WSWA 2WE8A 1QXSA 4DQXA 1O6ZA 1QRRA 3HN7A 3C24A 4WNCA 2AA3A 5KNLA 1V8BA 3RUHA 2QIOA 4TZKA 3ENNA 1DJQA 4QX6A 3TSCA 2QRKA 2OGUA 1XU7A 2ZB7A 3PJFA 4H3VA 1C3VA 1D1TA 1Z82A 4FFNA 1NNUA 4BKUA 4YXFA 4RVGA 2BI7A 3W8DA 5A3JA 3AOEC 1DAOA 1R4MA 2O3RA 4Q3EA 4KTVE 1UZMA 4RORA 4R1TA 2NQTA 2X58A 4E2YA 2IE0A 1FDTA 4E4YA 4IM7A 4Y6PA 1GZ4A 3V1TC 1HWYA 3PPIA 3ZZNA 4AJLA 2X9GA 3CINA 3QVSA 5DT9A 1ZMOA 1T4BA 4LMRA 2W2LD 3DXFA 2YYYA 4KDEA 4KOAA 3GUCA 4CM5A 4U5QA 1P1JA 5HS6A 3TZKA 4WLFA 1PSDA 2YFQA 2POQX 5ITVA 1P77A 3VH4A 1A72A 4GMFA 3RVDA 1X1TA 3FI9A 1GUZA 1Q2XA 1TA4A 2I99A 2FSSA 2C5AA 1A7KA 1DJNA 1OAAA 1OC4A 1U7TA 2CVZA 4IZHA 1UAYA 4AICA 1V9LA 3KSZO 1M75A 5AYVA 2Q46A 1HDZA 3OQ6A 3F9IA 3H6KA 4ND5A 1MUUA 4ALKA 3F3SA 4ILKA 3BMNB 3NKLA 4YT8A 4I8XA 1YOVA 4IMRA 3TZ6A 1WPQA 3B6ZA 2AG5A 3BTVA 3LT0A 2VRCD 1ZK3A 3GQVA 3PYMA 4L4RA 2JFFA 4N7RA 4CM8B 2WYVA 3WXBA 4BMVA 1DOHA 1Y1PA 3UF0A 3GHHA 4MPDA 1DDOA 1T2AA 2VWHA 4QTZA 3C1TA 1F12A 3OBBA 3KHUA 4D45A 4DQUA 1MGOA 3BMNA 4OQYA 3H3FA 4M89A 4YYZA 1LC3A 3L07A 3LQFA 3UN1A 4W6ZA 3KV3O 1RYDA 3C7CB 4IBOA 3AM3A 2HMWA 2DBZA 4E5NA 1GCUA 5A9TA 4I9HA 5TLSA 4N54A 4TROA 4D42A 5C7OO 1LLUA 1AXGA 1Z7BA 2VYNA 3RQSA 1P1FA 1LSUA 2HK9A 3PJEA 1GQ2A 3IP1A 1EEHA 4E30A 2P5UA 3CPSA 5TRTA 4IJUA 4BS9A 3RBXA 1PJTA 3E03A 3TRIA 4I5EA 3GGGA 4B3JA 1H5QA 3NEPX 1BHSA 3I9OA 4L73A 1LRLA 4A26A 1UP7A 4BO1A 4FCCA 3RU7A 2D4AA 3MJSA 5TT0A 5CDUA 1PGPA 2DAPA 3QW2A 1LA2A 4FFRA 2PKQP 1ZH8A 4DIFA 2GLXA 4XCVA 5KJ6A 3NT4A 3GLQA 4X54A 4XRRA 2GASA 2O3QA 1VM6A 1YL5A 2ZTVA 4Q3BA 3PIIA 3KSDO 2G0TA 4Q3CA 5L4LA 1RWBA 1TVEA 3VPXA 1DLIA 4AJ4A 3I5MA 2GD1O 1OMOA 4DTIA 5DULA 3BZUA 3DL2A 3HB5X 1E1LA 4RPJA 4I5GA 4CM1A 3QLJA 4BQPA 1UP4A 2CDCA 3IUSA 3RSHA 4BV8A 3LF2A 3QWIA 4GAEA 5JE8A 1S6YA 1Z45A 4BNXA 2BGKA 4WCFB 5G0SA 4WNIA 5IZCC 5TJHA 4JJFA 1LDYA 2DBVO 3DZHA 3IS3A 4R9SA 5FI3A 1LEHA 3WNQA 1HLDA 1U8FO 2B4QA 1JQBA 3NTOA 4OSPA 1L1FA 1ZVMA 1Y7TA 1UXKA 1E3EA 1WAMA 3ST7A 4FR5A 5IZCA 1I33A 3R6DA 4IDGA 4OM8A 1YE3A 2X4GA 1JTVA 3NT5A 4WECA 4WCFA 3UXYA 5JAMA 1DBVO 3L9WA 3Q9NA 2E4AA 3MJCA 3PJDA 4XR4A 3BTOA 1KY4A 2C2YA 3TN7A 2YHIA 1DSSG 3FCOA 1E6EA 5IFLA 2GF2A 3CXRA 1U7HA 4E2WA 3PHIA 1PQPA 3G79A 4K26A 1IPFA 4UVHA 5TX7A 1B8PA 2JKVA 3ON5A 4DIOA 2Q49A 3JQDA 1P1RA 2HRBA 4G5HA 3HDHA 3U49A 4CR7A 4UUMA 1WDMA 1PJ4A 4OKNA 3CKYA 1AUPA 1JKJA 4XQGA 1EK6A 2Y1GA 2EGGA 1GQYA 4NU5A 1WZEA 1BVRA 2YV3A 4L76A 3H9EO 3VVBA 3TWOA 1PGNA 4I5FA 1FDWA 3GFBA 5GZ3A 4YEDA 4MVJH 4AJHA 2B35A 5B12A 1ENYA 5KJ1A 1H6DA 5JBIA 2PV7A 3K30A 3M2TA 4NJMB 1ID1A 5T5QA 4YTEA 2C7GA 1UP6A 1GEGA 1FJHA 2GZ1A 5TQVA 4EYEA 4UVDA 3G0OA 3JYNA 1KC3A 2BFAA 2R00A 4BNYA 3N58A 3PIDA 5DBIA 2NTVA 1R6DA 1ZNQO 4IDCA 4YAEA 1Q7GA 3TDKA 3RU9A 3WOHA 2QYTA 1DLJA 1LQTA 5L4SA 2UDPA 3L4BC 2Y1EA 1PL8A 2YQ5A 4PG6A 1KEVA 1VL0A 5FI5A 4PG4A 4DYVA 5JCXA 4J43A 1R12A 4CODB 3SLKA 2PZKA 1GL3A 4PZDA 4P38A 2RHCA 1GZ3A 4YT5A 1EBFA 3D3EA 2HU2A 1N9GB 3DEYX 1N1EA 3BTUA 5G0WA 4YR9A 2GUGA 3TNLA 2V6FA 2O3SA 2BFMA 1T26A 3Q0EA 4QFCA 3A06A 4Y9DA 1NFRA 1WMAA 1E5QA 4HXYA 3JQ7B 1HYHA 1SBYA 4CM4B 1Z75A 1T24A 2D59A 1GD1O 4IINA 1IUKA 1GFSA 4ALLA 4GSKA 1HZJA 4LVUA 4DPKA 1ENZA 5GY7A 3DTTA 3PWSA 5H83A 5F1PA 1T2CA 1DO8A 3W1VA 2AW5A 1MXFA 4B7UA 3WGHA 1IHXA 4O5OA 2O2YA 1ENOA 1QMGA 3WFJA 3VTFA 4DMMA 1GQQA 1Y8RB 1QG6A 4XR9A 4BHTA 1E6UA 1X15A 4W99A 3IOYA 5A9SB 4QT0A 1O89A 4YJGB 3VH3A 1I3LA 4S3MA 4PFJA 4W4TA 4J6FA 2BELA 3EDMA 1KVTA 1PJSA 4XKJA 5A05A 4MVJA 3AFMA 4EEXA 4HADA 3F1LA 4IGFA 4BUCA 4B7XA 5IZ4A 2HCTA 4P4NA 4PCVA 4CMEC 3I6IA 4U7WA 3GA0A 5C37A 3V1UA 4BNMA 3DTYA 3JTMA 3LF1A 4YRBA 1P0CA 4YJGA 5A9SA 3AU8A 3ROMA 1U1IA 1E7RA 4CMEA 4CL3A 3R1IA 3LC1O 3WTBA 1I3KA 2HMVA 2NUAA 4UAGA 5CDGA 1EVYA 4LN1A 4NBRA 2OBYA 4RVFA 2B4TO 3OM9A 2CVOA 3PVZA 3AY7A 2XXBA 3DOJA 3FWNA 4YRAA 3H9GA 3AM4A 1GUYA 1ZO8A 2ET6A 4UEJA 1KBZA 4RL6A 2DFDA 2PKRA 1ISIA 4Z9XA 1A7AA 3WG9A 3DR3A 1SAYA 1DIRA 3H4VA 3ZNPA 1E6WA 1A5ZA 4R3WA 1M6HA 5BNTA 3JQ6A 5KCZA 2FOIA 3W8FA 1Y9AA 5JDCC 1HYGA 3WGYA 3ZU2A 4RF2A 3FTPA 2X23A 5JCJA 2RHRA 4PZEA 2J3JA 4RQUA 1M6WA 2O50A 3WIEA 2GERA 4ALMA 5JDCA 4M55A 3NDRA 5EQFA 4HFNA 3G1TA 1T25A 2HK7A 4LMPA 3ZDFA 2ZTUA 3P7MA 4D46A 3GF4A 1XIVA 1KETA 1XCBA 2EJWA 1ZEMA 3DOOA 4CMIA 4EDFA 2NVWA 2D5AA 3BMOB 5CDSA 5A1TA 5L7YA 4LCEA 1P44A 4RVSA 4CUJA 4NPCA 4PZCA 1JKIA 3EY4A 3I4FA 1LC0A 1U2DA 4JNKA 5AXAA 2P9EA 2TMDA 3UKOA 3NX4A 1R15A 3RC2A 3NUGA 1DAPA 3DZKA 3BMOA 1N7HA 1B14A 4RZIA 4NHEA 5F5LA 4GBJA 1XR3A 5EPOA 2W8ZA 1H93A 2RH8A 4GWGA 2EEZA 4YDRA 1HE2A 4HNHA 5CEJA 4LRTB 4JP2A 4MKRA 5FFFA 3JD3A 3U0BA 3H2SA 3L6DA 4NBUA 4UUNA 3ICPA 3AU9A 1QYDA 3ONFA 5C7LO 1FF9A 4G2NA 3GEGA 1NHWA 2Q3EA 3KYCB 3LLVA 3OQ1A 3GR6A 2CY0A 4B4WA 5ADHA 1B3RA 4E12A 4MO2A 4GKVA 4CQMB 5J23A 1M66A 2PNFA 3WGQA 3IKVA 3MOIA 1O94A 3I1JA 2EXXA 1XQ1A 4ALIA 3P19A 2J3IA 4AJPA 1MX3A 1NASA 2CD9A 4J7XA 1GYPA 1H2HA 3OHSX 4BOYA 3O4RA 4CQMA 1ISHA 1JVBA 1M2WA 4CUKA 3JQGB 3SC6A 1TB4A 3JQBA 1E92A 4E5PA 2BF7A 3Q9UA 3Q3CA 4RF4A 3DMYA 3EK2A 4CLEA 1EQ2A 2AEMA 3DO5A 4A7PA 1K89A 1P1KA 2ZYGA 3HQ4O 5DP1A 2NLOA 4OMUA 3H5AA 2I5PO 2C2XA 4FW8A 5IDXA 5IDWA 3ZWBA 4D0SA 5DP2A 4HBGA 4CV3A 4B79A 2FPPA 3K6JA 3MJVA 1KOLA 4R69A 1JU9A 2Q1SA 3NJ4A 3OSUA 1O5IA 4GGPA 1PGQA 4M54A 4U0KA 4PLCA 5F1OA 3VC7A 4OHUA 5JY6A 1C1XA 1VKOA 2PFGA 1HRDA 1I32A 4IDFA 4PLFA 1R4NA 3JQ8B 3NV9A 4QUKA 1EBUA 4LISA 1GEEA 3RC9A 3K2EA 1B3BA 1R66A 3I9NA 4IDAA 3JQFC 4OL9A 2EV9A 2PD3A 1LX6A 5T6BA 3TL3A 3ZHYA 4KDFA 1Z73A 4YWJA 1LDGA 3QIVA 3VHRA 5TIIA 4DRYA 5KVQA 4E2ZA 1M76A 1MG5A 2Y93A 3D5QA 4Z0HO 3JQFA 4C4OA 3O38A 4WPGA 2AQ8A 1GTMA 4OQZA 4B8WA 3JQ8A 4MDHA 5HWSA 1VSUA 1JN0A 3VZPA 3KZVA 1T2EA 1ISJA 4MKZA 4R9RA 2GGSA 4B4OA 5K6AC 2Q2QA 1U3UA 4UULA 4J7UA 3KRTA 1NYTA 2JD2A 2GCGA 4M49A 4EJ0A 1LJ8A 3SVTA 4TWRA 5IDQA 6ADHA 4EUEA 4EZBA 3WYCA 4R5HA 4XZ3A 5K6AA 5L3ZA 4IXWA 2IXBA 4BNUA 3F46A 1MFZA 4PLYA 4MVJF 3DBHA 1RJWA 1GDHA 1W6UA 1NXQA 3INGA 1VL8A 4EITA 1DHTA 2ZB8A 3B1KA 4FJ0A 2VHZA 4W9NA 3UHAA 4BO4A 2BRUA 3K9QO 4XB1A 1ADGA 1LDNA 1PJBA 3MJ4A 3KBOA 3M6IA 3B20A 3CH6A 3GEMA 5FYDA 1K2WA 1TLTA 4INAA 5I9LA 1O0SA 1PZGA 3OECA 4G65A 4IY1A 3OIGA 1E0DA 3GPIA 4EJ6A 2Q1TA 1I2BA 3NGXA 3GHYA 1E7MA 2ZB3A 2Y1FA 1BTOA 4H7PA 4IQ0A 4WLNA 4DUPA 1DFGA 1S7CA 4UVEA 3TOZA 1E77A 3QWAA 4YJHB 2YDYA 2IRWA 4BKRA 1T2DA 2DTDA 4UVGA 3I23A 3ROPA 1DPGA 1C0PA 4TKLA 5IN5A 1BSVA 4HWKA 3ZH2A 5L7WA 5DCYA 2GNAA 4A73A 1W4ZA 4WK6A 3PTZA 4R41A 5CEEA 5DNAA 2AQKA 3GRKA 1AXEA 2I3AA 2W98A 3NGLA 4CR8A 1QSGA 3OIFA 3PLNA 3U3XA 4CLRA 5HRUA 4YJHA 1J0XO 5L7TA 2A35A 4BKOA 2QQ5A 3R3SA 4ID9A 1IE3A 3NDIA 1ONNA 1P31A 4CLHA 1PEDA 4KZPA 3FPLA 2IODA 4AJKA 4XQEA 3U5TA 1AN9A 1NVTA 1PX0A 3ZV4A 3GZ4A 4CLOA 4KQXA 2I76A 4II2A 3ETGA 2FMUA 1WDLA 4XA8A 1YQDA 4WJZA 3KB6A 2X0RA 4UEKA 4RPLA 5KJFA 2BI8A 2RAFA 2X1HA 3DZIA 1TT5A 2VYVA 2GDZA 2YV1A 2WYUA 3TQHA 2ZTLA 5GZ1A 1VJ1A 5HM8A 4J4HA 4E3ZA 5A3VA 4MP6A 4WLUA 4XD2A 2FZEA 3KXDA 2PTGA 4J90A 2Y1CA 4XX0A 1NPTO 2VUTA 1SC6A 3RJ9A 1TEHA 3GC6A 4TVBA 4YAJA 4LW8A 2DLDA 3A14A 5U1PA 1A71A 1D8AA 3PRJA 4QECA 3RUFA 4YAKA 5IG2A 2I67A 1K6XA 3EZLA 2DUUA 4BNKA 1EVIA 1HDGO 2CUKA 5KVCA 4OH1A 1A4IA 3QWHA 3JV7A 1NHGA 3JQAD 4R54A 4DLLA 1UH5A 1VPDA 4O63O 1NPDA 2VYND 4D3DA 3S2IA 3WQSB 1L7EA 2CVQA 4UVIA 3I9KA 1VRWA 2XF8A 3JD1A 2YHUA 1G0NA 4K1LA 5CEFA 1O9BA 3WQRA 4IUYA 4LCJA 4PG8A 2NTNA 1VSVA 4PLGA 3EAGA 4ZQHA 2I6TA 4UEOA 3GG2A 3ONEA 2GN4A 3GDOA 1U4OA 4R51A 3ZWYA 1IZ0A 5KVSA 5KKAA 2NV6A 3UVEA 4JROA 2H9IA 3HDQA 3AY3A 5LC1A 1BMDA 1ZW1A 8LDHA 3Q6IA 4XJSA 2HMSA 2VTDA 2CZCA 2P5YA 2BFOA 2P2SA 4IS3A 4WOJA 2WJPA 5CDTA 1CIVA 5LCXA 2C5EA 5U9CA 4M87A 3BMCB 4NK4A 1T1RA 3NDJA 4ZU3A 1FMCA 4P4GA 4P8RA 4WEOA 4DYDA 2B36A 2NU9A 3DFUA 1HSOA 1Z7EA 3AUUA 4GVLA 4NNJA 1UXJA 4TQGA 1NQOA 1PS0A 1X7GA 3LT4A 3C7DB 1E7WA 4RPHA 1YL6A 3ANLA 4FC7A 4BNHA 5L45A 3GVPA 1U5CA 4PLTA 1TXGA 1Y8QB 4RPKA 3ZWMA 5KJEA 3JQEA 3O9ZA 3ZWVA 4MP3A 1KVUA 2FHSA 4CM8A 3FRJA 1K6JA 4I5DA 2NSDA 2QYSA 3OF2A 4YJFB 3PDJA 2JFHA 3IDSA 3PWKA 5ENVA 2WD8A 1E3IA 4E21A 3IQDB 3ZWXA 4AFNA 1J6UA 1YXMA 3LZ6A 2QRJA 5KIAA 4BGIA 3LDHA 2D0IA 4N18A 3QHAA 4OOFA 3HB4X 1EZ4A 1FDSA 4OOEA 1DFIA 2EGHA 3M1LA 3RROA 4CJXA 1DXYA 3ZNNA 2Y0EA 4YT2A 5JMPA 1OZAA 1GPJA 3RC7A 1E1KA 1HYEA 2J3HA 1YQGA 4RO0A 5IF3A 4CV1A 3MOGA 3JCZA 1Y5MA 4D3FA 2PKQO 4XB2A 3GK3A 3KETA 4IIVA 5ER9A 4Q9NA 1GAEO 3DOCA 4GX5A 3D3WB 2NTJA 1BRMA 2P9GA 4XYBA 3INRA 5FF9A 4A27A 5CDYA 5F5NA 5EQDA 3GFGA 1EFLA 4YCAA 1HL3A 4BNNA 3ZHBA 1CRWG 3JSAA 3LU1A 3LSYA 4RCVA 1NFFA 1HEUA 1ZJZA 4O1MA 3B1JA 1BXGB 1BXZA 1SB8A 3AW9A 3FPCA 4DBZA 4L0QA 3D4PA 4QO8A 2DVMA 2IZ0A 3JQCA 2NADA 2GPTA 4J4BA 3R3JA 1X7HA 1VKNA 3ULKA 1DRUA 1PJ3A 3WMXA 4BO8A 4ALNA 3I9MA 1IZ9A 1QYXA 3CE6A 3IUPA 1IULA 3L0DA 2FR8A 2A9FA 5TSDA 3RIHA 2Z95A 4IGEA 2ILTA 3RUDA 1RM3A 3E6AA 4WCFC 3VZSA 2WSBA 2DTXA 4Z0PA 1A27A 2QZZA 2EIHA 3C8MA 5HTOA 1WP4A 3GH3A 3D7LA 4XGKA 1YDWA 1E5LA 3ORFA 1LSSA 3TFQA 9LDTA 4B7CA 4URFA 5A5EA 5G0TA 4CUZA 3DAGA 1YDEA 2R6JA 1PS9A 4RVUA 3U62A 1NQTA 3JYQA 4J1TA 3UCFA 2OZPA 4KUGA 1E1NA 1LXCA 9LDBA 1MLDA 4EI2A 4HUJA 1A9YA 3JQ9C 4RJTA 1P33A 2VNAA 4LSMA 2B83A 1ONPA 2GYYA 3DHEA 5CFZA 5L9AA 4BO0A 2X7HA 3ASVA 1Y5RA 2OO5A 2UYYA 3PK0A 2FR1A 1PJLA 5DCUA 4JJGA 4YT4A 3FNEA 5BR7A 1E3JA 3QA9A 3SJUA 2XPCA 1F14A 3E9NA 1ADCA 2JAPA 3JQ9A 4CMKA 3IKTA 4H15A 4BQRA 1OC2A 2OP1A 3BHJA 1P9LA 1VJTA 1VE9A 1YBVA 5JNLA 2QZ9A 3FR8A 4PLWA 4ZRNA 3HUDA 4FN4A 4R68A 5G4KB 1DB3A 3P5SA 1X14A 2ZTMA 4WOKA 2ZCVA 3FNHA 4BNJA 2OMEA 1KEUA 1TT7A 1E7SA 2R00C 5T57A 1Y6JA 2BMAA 4XQCA 1V3TA 3D4OA 3O26A 2Q1UA 4KWHA 1DRVA 2GO1A 3MWEB 3OJEA 4FOOA 4R5MA 3DMTC 1RYEA 2HJRA 2P68A 3DHNA 5F21A 5EMHA 1AHIA 1NAHA 2E49A 3LLSA 4CQLB 4IDBA 1N8KA 2O3JA 2GN8A 3PYXA 1KVQA 4GH5A 2AEJA 1U2GA 2B4RO 3CTMA 4QFDA 4H16A 1JDJA 1MFPA 3DMTA 4Z9YA 3RC1A 3ZWNA 2F00A 2VZ0A 5AVOA 2VCYA 3V1YA 1HDRA 4DIBA 1GYQA 3ANNA 4MVJD 2AQIA 4NJMA 3HE3A 5A03A 4YQZA 3DZGA 4D44A 1W73A 3KUXA 2CDBA 4JBGA 3U9LA 4CQLA 3U4CA 2AQHA 4KUEA 4HV4A 2P91A 5I9NA 1CQIA 2NNLD 4DGSA 3WBBA 3GDFA 4E2XA 3PQFA 3GAZA 1GR0A 1SZJG 1V6AA 1RKXA 2DBRA 2PZLA 2DM6A 1HE5A 2FP4A 1O95A 3M1AA 1C1DB 5EJ2A 3RUCA 3WWZA 2H6EA 1ZSNA 2J8ZA 4FOSA 4JXKA 1XKQA 3WBFA 3F4BA 5HA5A 3OJ0A 3DONA 4MKXA 1GYRA 4NQZA 3VPHA 5B4VA 1XQ6A 1Y9EA 3BTSA 1XSEA 1YH3A 5I7EA 3VZRA 1NWHA 3IAHA 1U4SA 2YDXA 3RFTA 3QV1A 1HDOA 2YW9A 1N9GA 4EEZA 1WXDA 2HKIA 3VOSA 1G1AA 4R16A 2X0NA 4J1QA 4AJNA 3E18A 2V6GA 1XG5A 3BXXA 3OMLA 4GL4A 5G0UA 3NAQA 5KTKA 3NTQA 2G17A 4Z6KA 3D64A 2ZK7A 3LC7O 5T8KA 4WASA 3UGKA 4YAIA 1GPDG 1Q0HA 2UV8A 3JQ7A 4YRDA 1PGOA 1KYQA 2NWQA 3GZNB 4OKIA 2G76A 3WB9A 3R0IA 4UUPA 4CM4A 3PLRA 4DLBA 3AY6A 5THKA 2OUIA 4AJ1A 1EUCA 1U3WA 3GG9A 4TRMA 3K2BA 1B16A 2Y0DA 1D4FA 3PHJA 2E6UX 1R16A 4J9UE 5KJCA 2BGMA 2P9CA 3RCBA 3WSVA 1XGKA 4R3NA 1EUZA 1A9ZA 3FF4A 4TSKA 1Y8RA 4OXKA 5G2OA 5EIOA 2WEKA 1PL6A 4DVJA 3LYLA 1XWFA 3P2YA 1KS9A 5TF4A 4NIMA 2BHLA 1HSZA 4PG7A 5AQ1A 1IHYA 2C07A 4TRNA 3EVTA 1UZNA 1CJCA 3F5SA 2IYOA 4A10A 2BKAA 3EGOA 2X22A 1DC3A 3DC2A 1D3AA 3X2FA 4EGFA 1PZEA 4FPXA 3KVOA 1H94A 4C7JA 3L6OO 3WFIA 3BMQB 1SCUA 4BNGA 1EMDA 4MOWA 2B69A 2EW2A 1I0ZA 2GN6A 1WMBA 3LC2O 4I08A 2EF1A 4O0LA 2JL1A 3JYLA 5B37A 4J91A 1YBAA 5CG2A 3OA2A 1SPXA 3K73O 1BW9B 3PYLA 1EVJA 2B0JA 3Q1LA 5COQA 2GRAA 4TKMA 5IDYA 1H6BA 1QKIA 2ZJ0A 1LDMA 3BMQA 3SLGA 2WD7B 3W8EA 1SO8A 1RPNA 4CL8A 1G6KA 2OXIA 2Q99A 4CM6A 4GSLA 4Y6SA 1WDKA 1QYCA 5K1SA 1EE9A 3DBRB 3K92A 3KOUA 1HF3A 4NMHA 2JAHA 4FGSA 5L95A 1LRKA 5AXDA 1J4AA 4U6SA 1MA0A 1LQUA 3HN2A 1K0UA 1I2CA 4IQGA 4R1UA 4XQ9A 1ZIDA 3ENKA 3I9LA 3RASA 1P3DA 4F6LA 3I3OA 4BO7A 2AG8A 4FSHA 2Y99A 1YRLA 2XOXA 3DBRA 2HUNA 1Q7CA 3DZBA 5C3MA 3DAPA 2IYPA 1WZIA 2VT2A 1Z74A 3PHLA 3EHEA 4BV9A 1ZK2A 1LTHR 1PIWA 4DREA 1NR1A 2DBQA 2FPIA 1T2FA 3SBOA 2Y0CA 4B4UA 1Q7BA 3V2GA 1C0KA 3VPSA 3KEOA 2LDXA 1DIAA 2WTBA 3D4NA 1U3VA 3A1NA 3FSRA 2J6IA 5TJ9A 3RUEA 2AHRA 2ZYDA 2E82A 1KVRA 4BNLA 1WW8A 2NQ8A 2PWZA 3H2ZA 2X9NA 4GWKA 2O23A 4UREA 3AJRA 2CSUA 4HX5A 3F6YA 5I7FA 3WLEA 2Z1MA 1HT0A 2GR9A 3HDYA 1I30A 4ZRMA 3VKUA 1CETA 2BH9A 3OETA 3QSGA 2YV2A 4E31A 2G5CA 3H8VA 1ZSYA 4A2CA 1KEPA 4JQCA 4CMGA 3DBVO 1XA0A 1P74A 5DCWA 4BL5A 3AI1A 1TI7A 4GQAA 3UCEA 2VHWA 3U4HA 3RUAA 3PGJA 4E5KA 1R37A 4BKPA 5A9RA 4RDIA 3CMCO 2CNBA 1UXIA 3HFSA 2CF5A 5G0VA 3D0OA 3K31A 4N5LA 1I8TA 3TF5A 3KYCA 4K6FA 2IZ1A 4K28A 2NACA 3G3EA 4L74A 3MJEA 1EE2A 3JQBC 1ADBA 3AI3A 3HHPA 2EJVA 3COSA 4JX8A 3QVOA 1ARZA 1U5AA 4WCDA 4XGIA 5G4LA 4IQ8A 1QYVA 3ZU5A 3EVNA 2X0JA 2NVUB 3LT1A 4MVJG 3ZV3A 1U28A 1T4DA 3ZWAA 1P0FA 5CP8A 5F1KA 4O59O 1OI7A 3HSKA 1B2LA 3PFWO 4IJVA 1XHLA 3WJAA 3OEYA 1B26A 3JQGA 2PR2A 2FSVA 4QEDA 5IAAA 3QRWA 5TS3A 1V0JA 5JDIC 3VPFA 4BNZA 2X0IA 2HQ1A 5I7VA 1W0CA 4UUOA 1Z6ZA 5ITWA 3KEQA 1CQJA 4FFLA 5JW6A 1BVUA 3ZWWA 2HLPA 3GNTA 1QP8A 3S2FA 3WICA 4A0SA 4CR6A 2HAEA 3O8QB 4YA6A 5JDIA 2CF6A 4XDZA 2V7PA 3PP8A 4CM9A 4LSWA 3O03A 5HS4A 4FQ8A 4NBTA 4M8SA 1KEWA 2X9VA 1ISGA 1H0KA 4IXTA 3VDRA 3E82A 5K0ZA 3EYWA 5TT1A 2ZKLA 1DC4A 1M67A 3GUYA 1LLCA 2X5JO 3TZQA 2H5LA 2PA3A 2YUTA 3ZCXA 4AL4A 1NTOA 2HDHA 4DWVA 5A04A 3I6QA 2OL4A 2QHXA 4FD3A 1N5DA 1KIFA 1ZSVA 4NR0A 1NAIA 4NI5A 1NVGA 3GVHA 1AHHA 1IL0A 4AVYA 2QRLA 5ILGA 1YWGO 3P2OA 2EKLA 4G81A 4CMBA 1PWZA 2G1UA 2P4HX 4S1VA 2PK3A 1HDCA 2Q50A 3MCVA 1E3WB 4FBGA 4W9NC 4J2OA 1PR9A 3RBZA 5C5IA 2Z5LA 3HFGA 4QO7A 3WWYA 1UZLA 4CMCA 4W82A 7ADHA 1ISMA 4XGNA 4C7KA 4NH4A 4AJOA 2VHVA 3H65A 2TMGA 4BNVA 2QX7A 3NYWA 2B37A 2J5KA 4HFJA 4HY3A 4BB5A 2PLAA 3GN1A 4NBVA 5JC1A 1LDEA 4JP3A 2OHXA 3PQDA 5JAQA 1JWBB 1UXHA 4BGVA 4FJ2A 2EWMA 2CMDA 4YACA 3DQPA 3T4XA 3H9UA 1J49A 2VYVD 2R2GA 1CDOA 4LGVA 2HSDA 5T67A 5BNIA 3AWDA 2VN8A 3VH1A 4GMGA 4YB8A 5A06A 1YJ8A 1IOLA 2C82A 2J3KA 1HZZA 1ZFNA 2PH5A 1UDBA 1JA9A 1P45A 5THQA 5U4QA 3WNVA 5B4TA 5I8WA 4MIEA 4Q3NA 2RCYA 1F06A 3HWRA 2Q45A 2ZYAA 2Y66A 5BNFA 5JYDA 1X7DA 5A02A 3SEFA 5KWEA 3ADOA 2DQ4A 5I7SA 2XXJA 3G17A 1PQUA 2DUWA 1FDUA 3G49A 4LRSB 4QSMA 4NK5A 1LLQA 3ETEA 4W7IA 5BT9A 3GGOA 5L51A 3ABIA 3DDNA 5JC8A 3ZNQA 3E1KA 1IB6A 5COAA 5DN9A 3QVTA 1SOVA 3B70A 4WGGA 3AFNA 5F3RA 1CEQA 4WLEA 5EERA 3QWFA 1IPEA 1NPYA 4GLLA 1QV6A 1P1IA 1Y81A 2DFVA 2I3GA 2IXAA 3OH8A 1HDYA 4DPLA 4PIVA 3W6ZA 1HE3A 1YB1A 4QXMA 1QLJA 1CF2O 1QLHA 4MVJM 3QWBA 4B3IA 4OGWA 1E7YA 2V65A 1MB4A 5AXCA 3GMSA 4MVJI 3MJTA 3L9XA 5EL0A 1R4MB 3T7EA 3T7CA 4NJOA 4ND3A 3UAGA 2Q1WA 4NFHA 4BO9A 3C85A 1RM4A 2BFPA 3KLPX 7MDHA 4ZQFA 4ZHSA 3AI2A 3H9JA 2VZ8A 3QY9A 4K6CA 4P4LA 5I9MA 5JO0A 3ZNOA 2H1SA 1F17A 1JKFA 4II3A 2FWMX 1NFQA 3HDJA 5CPBA 1LU9A 2P4QA 3UH1A 3V8BA 1YKFA 4IDEA 3S1LA 3ZW8A 1LLDA 3ITKA 1RM0A 2AEFA 3F47A 3HG7A 4JJIA 5COBA 3AOEA 1R0KA 1B15A 2PD4A 2EW8A 2PZJA 2UUOA 3Q11A 3FBTA 4FDAA 1BWSA 4Z9FA 1X0VA 3STHA 2NVBA 3EUWA 2Q4EA 4HNGA 2JCVA 3W4KA 5DBGA 1ZK4A 5JY1A 3DB2A 1NWCA 4ZICA 2D8AA 5AOVA 4L4XA 1VI2A 3IJRA 1LSOA 1G0OA 4XDYA 4FFPA 4J0EA 1YOVB 3WGOA 2IEDA 4BIIA 4YAGA 3UUWA 4AJJA 1O8CA 5ENDA 2V6MA 2J5QA 2RIRA 3DZJA 3JYOA 5B1YA 2QG4A 3MTGA 3D5TA 3WYBA 5EINA 1JVSA 2YFHA 3RFVA 3EW7A 1ZEJA 4FB5A 1BXKA 2HO5A 1KVSA 1GUFA 3C1OA 4RQTA 4ZGWA 4Z0TA 3BMCA 5MGBA 1XEAA 1SMKA 1ZZEA 4YJDA 5EN4A 3JQAB 1WLYA 3A4VA 4HFMA 1I01A 1NVMB 4NZ9A 5TC4A 2W2KB 1Y8QA 1JLLA 2JJYA 3W4JA 4XRGA 4E6PA 1QORA 3H5NA 2WYWA 1QV7A 1BG6A 1LDBA 3OICA 4BO5A 4J0FA 2W2LA 4IS2A 3IL2A 3TZHA 3JQAA 4YJFA 2PH3A 1PQWA 3ADPA 3S55A 1NX6A 3N74A 4ZQGA 5TNXA 5DOZA 5IJZA 4N5NA 3TOXA 4OXYA 4AG3A 2C0CA 4L8VA 1ZBQA 8ADHA 3OJFA 4CM7A 2VTEA 2D2IA 4XJTA 1LI4A 2W2KA 4IDDA 4KP7A 1IY8A 1LRJA 3TZCA 2UUPA 5CG1A 2G82A 3LT2A 1ML3A 1PU2A 4BKQA 1BDBA 5A4DA 4WLVA 2Q2WA 2IDZA 3ZHZA 4J49A 4BMSA 5A5FA 3GNQA 5FWNA 1I10A 1CYDA 2DPHA 3PHHA 2C29D 2ZCUA 3PJGA 3V2UA 5KKCA 2BD0A 1OOEA 5ILOA 3JD4A 5K9ZA 3ZU3A 1NBOA 1GU7A 3ONDA 3ZV5A 4JIGA 3D3WA 1XDWA 1PTJA 2JHFA 1I5RA 3WMWA 4HP8A 4QQRA 3FR7A 2VRCA 3HADA 1E1MA 3K5PA 1V3UA 4LK3A 1EDOA 3GVCA 4HKTA 2Y67A 1U9JA 3IIEA 4BNFA 4EUHA 1BXGA 2RBEA 3WTCA 2DT5A 5JFOA 3FHLA 1DIGA 3FBGA 4Y67A 3ROKA 1PWXA 4Q3DA 2NU7A 4R1NA 1DC6A 3TFOA 2J5RA 3ZU4A 2FPGA 3GRPA 1YONA 3UCXA 4YQYA 4I1IA 2A94A 1YBMA 4TMFA 3WQQA 4RPGA 1H6AA 5LDGA 1F8FA 4J9VA 4D7AA 5JLAA 1F0YA 2JHGA 2X86A 4RGBA 1WVGA 4DC1A 2NU8A 1CERA 2YHIB 4DPMA 4NU6A 4JN6B 3CUKA 3H7AA 3CZMA 4WLOA 3NTRA 5C7IO 2EKPA 4E0BA 5DZSA 2I65A 4CLDA 4BNWA 2WWRA 1VLLA 2IEBA 1BGVA 1CWUA 1UXGA 2ZJ1A 3BA1A 1Q0LA 1NM5A 4E5YA 3V5NA 1IYZA 4PLVA 2A4KA 2PD6A 1HDXA 1LNQA 2VQ3A 2ZATA 2ZQYA 3KO8A 4LVCA 4ND4A 4TZTA 4WUVA 5DF1A 1B0AA 5JYEA 3IP3A 3E48A 2WMDA 1R0LA 4BMNA 4NBWA 5CAEA 4L4SA 2X5KO 1PL7A 4Y6RA 5ICMA 4JK3A 5DOVA 4FGWA 2EG9A 2ZB4A 1ORRA 4WKGA 4CV2A 3UW3A 2PGDA 2V6BA 1YS4A 4DL9A 1QR6A 4ZVVA 4GVXA 4IJKA 2NU6A 4P22A 3SX2A 1SEVA 5G4KA 3WX0A 2HMTA 1LSJA 4IMPA 5TGDA 1ENPA 3E5MA 2I9PA 3INTA 3MWDB 3KYBA 2EP5A 5HBRA 4B3HA 1DIBA 1K3TA 2OFPA 1U3TA 2JCXA 4DC0A 2UAGA 4XIYA 2JD1A 1WWKA 3TL2A 1UAGA 4MP8A 1ZJYA 3VVCA 1H2BA 2O4UX 1YVEI 3DHYA 3OP4A 2YQ4A 4IJWA 4CPDA 3U09A 1MC4A 3DAFA 4NDNE 3SXPA 3C1AA 4M1QA 3WDSA 4EBFA 3WYEA 1E3LA 1MC5A 2FZWA 1EDZA 1NQAO 1GY8A 2ZQZA 4FS3A 4Y8VA 2Q2VA 5JMWA 1L7DA 4EJMA 3GPDG 4CMAA 4OYRA 3L77A 3IC5A 4ND2A 4ZD6A 1YB5A 1JAYA 5T8KC 3S8MA 3ROQA 1VJ0A 3L4BA 2BGLA 4ZN6A 3DFZA 5IN4A 1C1DA 1Q0QA 1N92A 3N7UA 3E8XA 3GEDA 1E7QA 3OIDA 5BQFA 2PY6A 1A4UA 4FFMA 1ULSA 4ONEA 2LDBA 3H3JA 1EUDA 3V2HA 3BYZA 4RDHA 2RH4A 1C0IA 4BVAA 1E3SA 1FXSA 4J1SA 5JCJD 5B4UA 3CEAA 4Y98A 3JD2A 3CIFA 4AJEA 4U8GA 2W4QA 3AK4A 3EC7A 5ER6A 1GADO 3OA0A 3Q2IA 3ITDA 3PDUA 1D1SA 1WNTA 4WE3A 2DKNA 4N5MA 3PZBA 5GMOA 4DMLA 1B8UA 3ZWCA 3PGXA 4OSOA 2X5OA 2IZZA 1ONOA 2YZ7A 1OBFO 4Q3AA 4RLSA 4ZQEA 3SC4A 3GZNA 5L40A 3HZZA 4MVJP 4F45A 1C14A 4K9DA
chains in the Genus database with same CATH superfamily
1SCBA 4DDVA 1FQJA 1IPHA 1SNYA 4QGSA 3W06A 4CETA 3UJ6A 1WEHA 2OXFA 4GPAA 1OWMA 3DXZA 5AXBA 3DULA 4YX9A 4OX9B 1RJFA 4S1TA 5DBFA 1S2IA 1P4JA 4WWHA 2IHUA 1NXPA 1W49A 2AE2A 4JBIA 5D51S 2YKGA 1UDAA 1CRPA 2X0KA 1AH2A 1W44A 2RGEA 2VWGA 1YQXA 1EZ1A 2B30A 5EESA 3S2GA 4E33A 1P6XA 2AN5A 1YDHA 4RXMA 4LQLA 2JFQA 2YNMC 2WTUA 2OAEA 3OJLA 2FI1A 4X7PA 2VQDA 2J6HA 3O82A 1DAIA 3CPHA 4BO6A 2ZYSA 4BDSA 2YH2A 2QQGA 1PKXA 1YGYA 4JA0A 3T5TA 2XAAA 1UBGA 2DTEA 2ONKA 1GFWA 3ZJUA 2RI1A 4IHJA 3M7IA 5HF8A 2HW8A 4QU8A 3L8GA 3U3KA 3CRZA 3ETCA 1Z56C 3N86A 5AD1A 1OJ7A 2P2NA 3CZQA 4TS9A 4R8MA 4MVYA 4IYRA 4L5CA 3U4IA 5JADA 5HKKD 4R81A 2DWQA 2EKQA 3JZDA 3MMZA 2Q0SA 1X8KA 4NCXA 2ZVPX 3ENVA 2Y68A 1PR6A 1PT7A 2A9JA 1CUGA 4O4HF 1PS8A 4RVHA 1EQUA 2HCRA 3K72B 3RIMA 2FMXA 5CM9C 4J4TA 5JAIA 4UDYX 1EK5A 1MO3A 5DIFA 5AVKA 3OJWA 4GPD1 4OXXA 4QPDA 2FXIA 1KC1A 2CE7A 3GEBA 1TA0A 2VNIA 4QXQA 2PGLA 3I52A 3DBLA 4QA9A 5EXEA 4JDPA 2NQ2C 2GZMA 4RMHA 1G8MA 3AFHA 3GARA 4KWIA 2C31A 5CNKA 2IP4A 1KEZA 1W8DA 3PUHA 3ND6A 5DNUA 3VUFA 3A58B 1KSHA 3M9WA 1E64A 2NSYA 1SN7A 1T9CA 4FIZA 5EXXA 3DZ8A 4EHDA 2HF7A 2AMFA 2I1WA 1XPOA 1T6XA 2EG5A 3ROGA 1E6CA 1BCSB 2O7QA 2E21A 4Z8XA 1NI4A 1XVIA 1YR1A 2ODNA 1R7RA 2GAFA 4ZPJA 5EY5B 2QRZA 1LBIA 2RONA 4EGJA 1QFYA 2DCMA 2P4EA 3PQEA 4G1VA 4XIIA 2UVDA 5AUOB 3VMFA 4LQCA 1XRJA 2VPYA 4RHEA 3V4LA 5CA1B 1KY5A 3IHWA 2QMEA 3E0XA 3NRCA 1JJAA 3E9ZA 3VPGA 2CDAA 4L0DA 3U1TA 3WMRA 4B48A 1UUFA 4OI0A 1J5PA 1U6KA 4O6VA 1U5BB 3SMQA 4KKXB 1XZEA 1GQSA 1XCLA 3RBVA 2AXQA 4RKWA 1Z3IX 3K0CA 2J9RA 1S4MA 3CLKA 1SFRA 2O07A 5CYPA 3ZYCA 1XDDA 3QVWA 2PL1A 4PLZA 1DTWA 1E6KA 2GZ3A 4CM9D 2ZLBA 4CIBA 3WYDA 5DGHA 3Q7QA 4ROSA 1XT6A 2BW0A 1G3IA 5AJYA 1WG8A 1XCJA 3C3XA 1H8HA 2YC2C 1T1JA 2BY4A 2FOXA 3PFNA 3REQB 1LBEA 2ZBPA 5JG7A 1PJCA 4ND1A 1B7GO 4BX9A 4J0HA 5KVVA 2PQMA 4HAVA 1W2GA 1V39A 3AF0A 3GAAA 3R5SA 3UW1A 4HYEA 5AFSA 1M8FA 4CG3A 2QQ0A 1E2EA 4HH3C 2A5JA 1Q83A 1QRAA 2YV5A 1K6IA 4XVCA 1GG8A 1X8JA 3SQXA 4DNOA 4ZO7A 3LUHA 1MV8A 4EY3A 2QAGC 4ZV9A 1P61B 3KCQA 1YK0A 4ZOLA 4LRYA 1OH6A 4M0DA 2FJ0A 5LMNB 4LVOA 2OOSA 1L5OA 3MBKA 3QPUA 4JB2A 2B7CA 2WNHA 4P4SB 3GOHA 3N39C 4FFOA 5H9VA 3VYSB 1X80B 3SZGA 3KNZA 3SK0A 4B9EA 3CMMA 3JYPA 4PO1A 2W0MA 1YS9A 4CDGA 3LZCA 3T3GA 2VK2A 3LY5A 3ZW9A 3W5VA 1ZH0A 1ZXBA 1I3NA 1GAJA 1SEPA 2XADA 2HRZA 3BE6A 2K2QB 3QEOA 3LOPA 3M34A 1PZFA 3KYDB 4D4KA 4IIBA 3FIUA 1F0PA 2NVUA 4QARA 1MJHA 1U8ZA 3OLVA 4RL4A 4DA7A 4ETMA 1G41A 2GCEA 3BHIA 3LG2A 3SQNA 1I2ZA 1CQWA 5CX1B 3LCMA 1UFRA 1F4LA 2W8BB 5KYUB 2QN3A 4I81A 1IK4A 4JUAA 3TX2A 3LXUX 4C6TA 4DA9A 1G20B 1I3MA 1PGJA 3WLFA 1XFDA 4D57A 5M7EA 3C6YA 3R4VA 2ZXFA 1ODFA 2PGJA 4WUTA 5JS6A 1JHRA 5JEDA 4QU0A 4OJYA 1XZBA 4ZAVA 1G38A 3GJ6A 5NLLA 3GI1A 5L6LB 2D1YA 4QLBA 2I66A 1ZGZA 2FA9A 3EGWA 3FPGA 3PFGA 2GFQA 3KLMX 1MRSA 4XYEA 2NM0A 1OF1A 2O2EA 4F3YA 4P0QB 3ZVKA 3UMBA 4QVIA 1SU6A 2JIZA 1T8SA 1Z35A 3ZVNA 2IVZA 3KB8A 5L3SA 2C7VA 4HHEA 3DQZA 3RIYA 2IX3A 1DGQA 3FNFA 1ULUA 2QLFA 4XIGS 3ZN2A 3DG9A 3IUNA 1XJ0A 2XV1A 2Q9CA 4BNDA 3ISTA 4YROA 4AIIA 2VHJA 2Q6IA 2GSDA 5J5CA 4J3NA 3NATA 1JLSA 1RLOA 2V3VA 1NP6A 4EQ6A 3IEKA 1N32B 1MH9A 3OEWA 2FZLA 4R2MA 1M2OB 1PT9A 2PX8A 3WGTA 4N0MA 1WZUA 3E7PA 4CMHA 4WEQA 1DEKA 3IUJA 3R6GA 4TLMB 4A16A 1HNWB 1A97A 2JD0A 4MIOA 4Q9DA 3I2HA 4KMSA 1A1SA 1IBSA 3E9MA 2C20A 1JHYA 2ACWA 2VWQA 2WIJA 4PSAA 4UZSA 1OU4A 2P6NA 4RK5A 3TTTA 2RARA 1WOMA 1ZKMA 2WWWA 4X1YB 5AKGA 1D6MA 3KJQA 3U4DA 1H3EA 1E3WA 1E9FA 1BDIA 4H6VA 4RWEA 1IBMB 3M89A 5JANA 3BDVA 4ARUA 2NGRA 1OROA 2KHZA 2DECA 4NAHA 4ZA2A 4Q39A 4LQDA 4FB4A 2ECOA 5GZ6A 1EE1A 3QI7A 3O4FA 2Z5FA 2Q9BA 2ZBUA 1CB0A 4JC4A 4JBXA 5FIUA 3AF3A 1JLKA 4H4CA 3KDSE 3TD9A 2PKYX 2WSSA 3ANSA 4PRLA 1EHYA 3TNJA 1QGOA 3MGAA 1KTIA 3OQNA 4OL0A 1J9GA 2ZSFA 3HYLA 4UE2A 1N4AA 4EJ2A 1RPZA 2IYLD 2D54A 4NS4A 2FFBA 4PG5A 1WQ3A 2DULA 1TM3E 4GR9A 3UFXA 2JH3A 3MRSA 2SCUA 4JLOA 1H9BA 3VKVA 1JQLB 3CX8A 3G0IA 1D7OA 2GEBA 4TT8A 2DC1A 2B4AA 2GUWA 3EAQA 2DUNA 2V3CC 3B3JA 4YAUA 2X6TA 2A0KA 1LK0A 2YXNA 3OQJA 3ZI0A 1UOPA 3AKDA 1HXHA 2PRJA 3OIUA 4EK9A 2AR0A 2GEUA 2IIVA 4IHJF 3PNSA 5BR8B 3PL1A 4O29A 2WQ7A 1SRRA 3T7AA 3NVKI 4TRRA 5BVHA 4CM3A 1ZICA 2A1UB 4L4ZA 4XUDA 3EG5A 1RHRA 2ZUWA 5F78A 4EW6A 5CLJA 4CLRB 1H6CA 1IQ0A 1U0NA 4ZJUA 1EDDA 3IMEA 1OXVA 3NPAA 1AK9A 1SHLA 3RJZA 4BV2A 3CXUA 2ZI9A 3BHMA 4HSEA 4I4IA 4KQJA 2JJMA 4ZMBA 2NV2B 3TUIC 1M1NA 3L1JA 1OAKA 3FPKA 2JHPA 3DUFB 3EZYA 4TT3A 1TUBA 2GF9A 3CUWA 3WC4A 2JLUA 2IBSA 1GL6A 2XAUA 3M0EA 3AEUA 1JWAB 1MXHA 3BQMB 3OC0A 4GLOA 5CW1A 3VOTA 2P77A 3K96A 4EW1A 3BM5A 3ZE0B 5LA6B 4B09A 4PQYA 3LO8A 5B58T 2MYNA 4KTTE 3IBFA 1Y3BE 1GPUA 3ME5A 4CLOB 3HXLA 4OA8A 1FU8A 3P2KA 1PP4A 3UT6A 2QI9C 2ZGVA 4RK4A 1JEEA 3WLOA 2CKDA 1Y34E 3KKZA 3E3LA 3EUEA 3X3HA 3B3FA 4J1NA 2D5CA 3GJRA 3K2IA 4IQFA 5BSVA 4BBAA 3SG0A 4LDRA 3HCFA 4IDHA 1TT5B 3N6VA 4NFYA 3M4YA 4R98A 5HNKA 5CHEA 4ITVA 4RX1A 4H7FA 4OGGA 2F1KA 2CBXA 4OYHA 4YUZA 4CN8A 2E37A 2OXEA 4JJAA 3ZGYA 2WKSA 3WWDA 3AFOA 2PRKA 3GGPA 4TV9B 3C4QA 3DTVD 3NH9A 4GUDA 1G17A 4B8ZA 1G21A 6LDHA 2WE8A 2WFMA 1E0SA 1ZP6A 3DBOB 4DQXA 3HN7A 4C3UA 3C24A 3W0LB 2AA3A 2ETVA 4UZFA 4YPVA 2OXRA 4LXUA 5KNLA 1GAQA 4TZKA 2ZCJA 3T9CA 4DE5A 5ITZB 5IJ9A 2EBFX 3H2HA 3ZX5A 3AFIA 3PJFA 3VTAA 1Z82A 2IY9A 3MRVA 1U1EA 2BI7A 4S0ZA 1FU4A 3NGMA 1MAUA 1FTSA 1H1TA 4MV8A 1Q2UA 1L7OA 2O3RA 1WQ1R 1UZMA 3LHSA 3X1YA 4M76B 4QBHA 3KQOA 1MQAA 4MS1B 5GONB 1K4YA 4E2YA 2REBA 4DQKA 3OPNA 4J94A 4E4YA 1TEZA 3AF1A 4Y6PA 1GZ4A 3DYIA 3UIEA 4R2IA 3G2PA 3R5TA 3KQQA 4OQ4A 3RRYA 5LMCA 2ZSEA 5I4BA 1T4BA 1PKEA 1Y1RA 1YOBA 2W2LD 3DXFA 4LOHA 4REQA 2CB9A 2ZWOA 1ODIA 2JVKA 3LDFA 3FZGA 1BEUB 2OENG 2C8JA 2VQEB 2UZ1B 3B9QA 2XRZA 5M2QA 5BYKA 3EW9A 3G68A 2YL2A 3HB9A 3F2VA 4WZAE 5K1ZA 4O4JA 2RH5A 5LUBA 5KU7A 1SIWA 2JAQA 2ZIVB 3OCYA 3FI9A 4REMA 1MHPA 3E7DA 1FMFA 4UARA 1SU7A 5DYWA 6AT1A 1GN8A 1A7KA 1DCFA 2HYIC 1FFYA 2IYAA 1DJNA 2I6SA 1U7TA 1AQYA 1UAYA 4ZOLF 1YD7A 1JQAA 4AICA 4NMLA 5JYBA 1JHAA 3DD1A 1V9LA 2ATEA 2PG3A 2E4VA 2Q46A 3OFJA 3TTVA 4YLYA 3FZYA 4X84A 2NU9B 3OPVA 1JMVA 1N2BA 1RE0A 1C9MA 1V95A 4UMEA 1B23P 1MUUA 4K6KA 4FYVA 1D03A 4ILKA 3BMNB 3CZ4A 3GIDA 3N3AC 1QYIA 4K6MA 1B76A 5CXSA 4A8JC 1NI5A 5HGXA 3QE2A 2WUEA 4ICIA 4YP5A 1N2XA 3B6ZA 3RFCA 2AG5A 3BTVA 3V9AA 3GQVA 5B1SA 1REQB 1C7ZA 4CM8B 1MT3A 1DOHA 1Z15A 1Z5PA 1YT5A 4BCCA 4Q4JB 2HPVA 1T2AA 2QE6A 3VSBA 4U2KA 4QTZA 1P2FA 3E23A 2ZFUA 1I5OA 2JJQA 4MI9A 4OAPA 3R7SA 2XCRB 1DWOA 4M89A 1LC3A 2RHJA 3DVRX 4G4SO 1FFCA 3QENA 3F6EX 3Q2OA 16PKA 1T5OA 2N9UA 5E7QA 5A9TA 1L5HA 4TROA 1NMSA 3IOMA 4MAMA 4D42A 5C7OO 1TD1A 3VOAA 2HN9A 2G9NA 4EHJA 1QO0D 2FLVA 4Q3KA 5CDFA 3EIUA 3MRTA 4ZWNA 5IAJA 3ZHTA 4GYJA 1GQ2A 2PYIA 3FLEA 5AM2A 4IJUA 3SF0A 3VU3A 3GGJA 3RBXA 3QUBA 2I9KA 2ZRQA 1L4YA 3QQ5A 1II0A 1RLMA 2GCIA 3FPEA 3VO1A 3LFTA 3OPMA 3JWHA 3WLMA 5JZVA 4B3JA 2QBYA 3T3PB 3NEPX 4MYSA 4EQZA 2H1WA 1ZMRA 3I9OA 4BFYA 4QJBA 3GJTA 5LOVA 1LRLA 2HIHA 2Z43A 1UP7A 3RU7A 2QY6A 2IELA 4RK7A 4QU5A 3A25A 2ZM6B 1MB2A 1PGPA 3DDUA 5FBWB 3QW2A 5I7WA 3TQQA 4X65B 4CTNA 3DMHA 1J0BA 3A7EA 4IIXA 2C78A 3DV0B 4HXFB 5E7JA 5TPZA 2HA0A 4BFLA 4EDHA 2BL4A 4QAJA 4CEHA 1KPHA 3GLQA 4X54A 1YE5A 3KVNA 3ZGOA 2GASA 2W43A 2PUEA 3C6QA 1U0BB 1RAHA 2A5FA 1SQ0A 1OTHA 1KYVA 4Q3BA 1SXHA 3KSDO 2J46A 2SICE 3K5WA 2P35A 4YUYA 4AJ4A 3I5MA 4KK3A 1OMOA 1EP3B 1UADA 1JV2B 2OILA 1AJEA 4RPIA 2QRHA 4RY8A 5AVTA 1OHHD 4I5GA 1GILA 2C3PA 3DF7A 3QJYA 2P3QA 1TE2A 2CDCA 3JARA 2JHCA 3IUSA 4HDOB 2W6OA 4GAEA 5JE8A 2QN9A 4FYKA 4MMYB 1S6YA 1MX9A 1NLMA 1RXUA 4IGKA 1N6KA 1OREA 2PUJA 2QIPA 1JBEA 1ZC4A 1YAJA 2OSVA 3S27A 1DDGA 1PG2A 5C81A 1F51E 4ZO4A 2XT6A 1EX7A 1LEHA 3D31A 5FI3A 3KQLA 2H52A 5K0LA 1E1YA 4ZXFA 4M7RA 2ZRLA 1IIRA 5AVVA 1U3GA 3I32A 4CEIB 2VK1A 5J9FA 1UXKA 2C0PA 5KHLB 4MWBA 5IZCA 1CNMA 1SCNE 4LXIA 3UUFA 5DGTA 3NQ41 7REQB 1YJAA 1S0UA 2ID9A 4C6TB 4OM8A 3O5AA 3BWEA 3NT5A 1RAIA 4JBWA 4V0SA 5LZ8A 1HDIA 4B3FX 4B83A 3Q9NA 3MJCA 4MQFB 5EP1A 4PANA 1TUIA 1PAUA 4A3SA 1DSSG 4KGVA 2J9ZB 1JKJB 2PCJA 2GF2A 3CXRA 4YDSA 1KMMA 4ZEWA 5REQA 3KKKA 3QMMA 4DHEA 5JHHB 4P0PB 3LKBA 1NN1A 1PQPA 1IAQA 2BBOA 3G79A 3KYJB 2DH5A 1U7PA 4WXMA 1IPFA 1EP9A 3EZFA 4Q5IA 5K0CA 2XGJA 4IVRA 5T6MA 3ROFA 3L6RA 1U7DA 1P1RA 4D3YA 4G3XA 1OFIA 1IBRA 4ND7A 1PJ4A 2AJDA 5JT1A 1C8VB 3WMEA 2F1IA 1A77A 1IEXA 1XTBA 4FEGA 4DCUA 4DG5A 2JKZA 2WTAA 1EK6A 4HEJA 4XQGA 3DW1X 2XE7A 1LS6A 3V33A 1TL7C 2W2TA 2Y77A 3PL5A 1WZEA 2C7RA 2RFLA 3FFWA 3MG9A 4MCIA 4D6XA 2G09A 2GFIA 3KJEA 2Z58A 4RFLA 2WHXA 2QT1A 3T3IA 2M2IA 2V58A 3DAOA 3TWOA 3I9V1 1PGNA 4U2EA 1X70A 4I5FA 1FDWA 3GFBA 5D5HA 3SF8A 4YEDA 5IU6A 3CU5A 1F4PA 1MPXA 1TYZA 3EB9A 2B35A 3T3HA 4MDYA 4DQLA 2E4WA 2J3QA 3B5JA 3PDIA 4Y3UA 3SLRA 4LF8B 2PV7A 4NJMB 5FBZA 4DM7A 1JB1A 1F48A 1IEWA 1F9AA 1S7GA 1X92A 5ALWA 1E3QA 3KT6A 1MPTA 4XVHA 4Y1EA 4RK6A 4BNYA 3USES 2A86A 1CQIB 3KTAA 4OV6B 4R2LA 3RG2A 1BROA 2ZPTX 3PXDA 2ONCA 1ZH4A 1Q7GA 3R09A 3WE7A 3W5BA 2QYTA 3AH8A 3BGWA 1DQRA 3T9AA 4EL5A 5B57C 5L8VA 5L4SA 2QW1A 1OKKD 1JA0A 1KEVA 4HI0E 4QHYA 4FSXA 1CUCA 1ADYA 1GSOA 3LPMA 3A1TA 1R12A 3ADKA 1YGPA 4CODB 5LKAA 2PV0A 1E1QA 2PZKA 4WK4B 4M8IA 5DM4A 2MYTA 3FYDA 4YDQA 3QEKA 3WHLA 1NRIA 4F3TA 3I6ZA 3EDCA 4U02A 2IYXA 1GZ3A 2MCFA 4LOAA 4EO9A 3GJXC 3OCZA 3B9RA 4MYHA 3TIIA 1COWD 2KJQA 4KN6A 3BTUA 3VU9A 3VVLA 4D4LA 5CFMA 3ABQB 3OZDA 5F2OA 4DY6A 3VNUA 3Q0EA 1JFSA 3IBSA 3A06A 3SSOA 2HU8A 4Y9DA 1JZTA 1WTAA 4XGRA 3I0NA 1VRVA 4DF3A 3IQIX 1SBYA 4O4JF 3FLBA 5GGXA 5AJTA 3D0RA 4UHBA 5AJWA 5I3CA 5IVIA 3U9TA 4ALLA 5LU8A 1HZJA 3IFSA 4MULA 5A62A 1TLFA 1RC1A 4DPKA 1K8ZB 4KIUA 4M9ZA 4Z2YA 1QS0B 3JVDA 3PUWA 2VBGA 5I9BA 1CJBA 5F1PA 1T2CA 1E62A 1DO8A 1OFUA 1UPBA 5F76A 1K9VF 4O5OA 3JRNA 5LQKA 4AG6A 3FFAA 3BB3A 5H4HA 2DR0A 5F51A 1LJUA 3AKZA 2OQ2A 1P4RA 4JITA 4N4AA 1XNJA 2G63A 2YRXA 3H84A 4BLVA 3N2GB 2PUHA 2WIFA 2VAXA 4HAYA 3E27A 3AG5A 4CCYB 1A8IA 4W99A 1O89A 3F7NA 4KX5A 2H7YA 4W9MC 4PFJA 1N6IA 4HXEB 4J6FA 5EZQA 3L43A 1PJSA 4YRLA 3RHTA 1MD9A 1KO5A 4E09A 5L3VA 2IHYA 3AEXA 3NTUA 4NMXB 4G0NA 1TTPB 2AZTA 4TSRA 4U3JA 1YBFA 4PCVA 2FRVA 1UZAA 4UMVA 3WB2A 3WRWA 3ESZA 2LCQA 1UMCA 3UHFA 5BN1A 1D9ZA 3I6IA 1N0HA 3GA0A 2ACKA 3OE7D 3V1UA 3JTMA 1C7EA 4F0JA 1F5NA 3RAGA 3WK4A 1P0CA 3I0ZA 1N25A 3PC7A 4YJGA 1DC8A 5K3BA 1SCUB 2GO7A 1E7RA 2VPXA 2HJVA 3ZK7A 1PHPA 2ZWVA 3K32A 2BEWA 1G1MA 1CJMA 1YRHA 1PYOA 3UANA 1I3KA 2NN3C 2RMKA 4X7MA 1E0JA 2H2WA 2YS6A 1Z4LA 1QDEA 3CBGA 3CNQS 3OG9A 3PVZA 1UT8A 2CVOA 2FPWA 2A59A 2V0NA 3GQBA 4LF5B 2XXBA 2RGWA 3FWNA 3AM4A 3N8DA 3ZDEA 3L4EA 3UHOA 3FUUA 5AI4A 3CGWA 1MTOA 4NBLA 3UK2A 5LIRA 3G0CA 3IPLA 1FS4A 3DR3A 1VMIA 3C2QA 3TSYA 5LOVF 5I4CA 3JQPA 2OKGA 3RRMA 2ZIXB 3K9HA 3LY8A 2Z57A 1M6HA 1IZ7A 4TV8B 3T7IA 4EG5A 4EW2A 3I5UA 1M2GA 1NVWQ 2CDRA 3I1FA 3JQ6A 5KCZA 1LPOA 3DJYA 3C3WA 2XOKA 2N46A 4HPJB 3MMNA 1JQEA 2VUHB 4LKOA 1CBUA 4IKEA 4JVMA 2LTAA 4Q4AA 2W6IA 2X23A 3IEIA 1N78A 3P45A 3M6LA 3ELWA 3DH0A 2QY9A 4HUQB 3GCXA 1M6WA 2W5UA 4E3WA 4TWJA 2QX9A 3DFKA 1G55A 1QG2A 4ALMA 1U9ZA 5DNDA 1E2JA 4G5FA 2ATCA 2FW1A 4DMCA 5CLFA 2X15A 4RADA 2WMOB 4G63A 1YULA 1GXSA 2P8SA 2DERA 2YJ4A 5FAXA 2QTLA 2CCKA 2FPIB 3CJTA 1DEOA 5HIJA 4C7OA 4ZCPA 1XCBA 2OXTA 3DOOA 1GO2A 1KZ6A 1U2ZA 1JBQA 3DGFC 2VSNA 3V8QA 2GPWA 9GPBA 4RE6A 3JAWA 1NBIA 2EOAA 3ZIAD 1XMOB 4YHBA 2JZCA 4ENRA 1X9IA 1P44A 1CS4C 4RVSA 4RHTA 2FPMA 2HBYA 2G9VA 1MQ9A 1MNAA 1AD2A 4NPCA 1QZUA 1DZ3A 3I4FA 1OZ0A 4JNKA 2EJCA 1OCEA 4WXRA 2IP2A 1MX5A 1O3YA 2AXEA 3IKMB 1TJNA 5EAIA 5IDVA 3G9UA 3DZKA 4LE2A 3HA7A 4NHEA 5IM5A 4N12A 4D25A 1J1ZA 1S1MA 2DGDA 4QNNA 2GI4A 1FY2A 2V5UA 3EH2A 1YZGA 2DH6A 1P9NA 1T1IA 2WHYA 3CN9A 4GWGA 5HP4A 1HE2A 1Y63A 3U56A 4HNHA 3NHBA 3E1SA 4KV9A 4LRTB 5F52A 3TCXB 1A2OA 2XDQB 3EXFA 4MKRA 1FUIA 3U0BA 3HYSA 3JR7A 3R7FA 1PJAA 1XLTC 4Z9AA 1XZ8A 1UC9A 2QRNA 4RY0A 5IAGA 5C7LO 2V96A 1E6LA 3GEGA 4YCSA 1UM9B 1BE1A 3EQ8A 2Q3EA 3OQ1A 2FCRA 1O94C 4CNBA 2IKQA 1EPUA 3F90A 5ADHA 3RK4A 3A3OA 3HO6A 3V2IA 3W5HA 4ZHQF 3U16A 1L7VC 2XQIA 3UGTA 1TQHA 2CVHA 4JT2A 3NFRA 1M66A 1Q1EA 2PNFA 2P3LA 5JRJA 1R88A 4M1ZA 1CUFA 3MOIA 5H0IA 2OFFA 2EXXA 1HNXB 2J9FB 4ALIA 3ZDBA 2HDNB 4AY3A 5CT6A 1XOIA 1MX3A 4EA8A 4LTDA 3AZQA 1J1IA 5T3YA 3R0JA 5FB3A 4FZVA 5F9FA 2XY4A 1EWQA 3HGQA 2V5VA 3R5JA 1PNVA 1PZMA 2WQZA 3FYUA 1C30B 4J76A 1ISHA 4MI6A 3RGGA 4BU1A 3N28A 1M2WA 1QIMA 2VJAA 3D6FA 1UMKA 4TKUB 4CUKA 3SM9A 4HLUC 3JQGB 4BATA 1KPGA 1TB4A 1OB2A 1E4OA 1XQVA 2G0AA 1EUQA 1QHXA 4P54A 3KZ1E 2RGXA 5TPWA 1EQ2A 2BJVA 5KNBA 2MSCB 1RWWA 3ESBA 1K4KA 3DV9A 1ORIA 1TU0A 1U3CA 1K89A 3S1AA 5JR3A 3RWOA 1H2ZA 2CNLA 1V48A 1WUJS 4U7PB 2C2XA 2BBWA 2MHCA 2YJ5A 4I1SA 2PFKA 1E4EB 5IDWA 4KSYA 2EJTA 5J4VA 2VPQA 1EFDN 2FF5A 3G5MA 3OJCA 5I4IA 2CMKA 2FPPA 4CU5A 3TW8B 1V4NA 1DAGA 1KOLA 5G3YA 3H83A 2Y0PA 5CVDA 5GVSA 2B78A 4M54A 1SKYB 2XX3A 1ZX1A 3RRXA 3U4QA 1MIOA 1K88A 3AL0C 5JY6A 1MAWA 4GW3A 4P53A 2CWDA 1GEEA 3P9QA 2R1ZA 4IXMA 2Z2JA 4DDKA 5PGMA 5F73A 3JQFC 4ZEXA 2RSLA 3LOUA 5FBRB 4P81A 3PLAE 2QXYA 3UPDA 3AEQB 3HYRA 3MJRA 4LYHA 2A67A 1K8YB 4FOLA 5KTNA 1PUIA 1RLIA 2I8AA 1LDGA 1V43A 3F5FA 1V16A 1D1PA 1ZBDA 2FW6A 3LBHA 3QIVA 5TIIA 2JJ2A 4MEJA 4NCJA 4C4OA 4YR7A 3VI3B 4UOZA 1GTMA 1KO4A 1SXIA 4MDHA 1OXKB 1RRGA 5AVZA 3VV2A 2Z98A 3CLHA 4XPIA 1QIIA 3L92A 5BQOA 2WG0A 4QUGA 3RIGA 4KAJA 1N1MA 5EEHA 3DHVA 3RODA 4M1KA 2ZWIA 3H16A 1WP9A 1CS0B 5EZYF 1LJ8A 3EF0A 3SVTA 2FFAA 5IDQA 3OCXA 2XQFA 1YTLA 2XNKA 4KH0A 5K6AA 3GLGA 4FR2A 3HKBA 5BT8A 2G71A 2EQBA 2BRUC 2EKDA 3MHTA 2HY7A 2I0FA 3CBQA 3MINB 3DBHA 1W6UA 1NI3A 1NXQA 2RI0A 2ICAA 3I2GA 3GLVA 1FFDA 1XD2B 3T1OA 5J59A 1O2DA 3OHMA 3B1KA 1DJMA 2VHZA 4LJ5A 3CCCA 1ZRSA 4D8WA 4EB6A 1C9YA 1ADGA 2HJWA 4E70A 2VYFA 2CN1A 1E9BA 2JRCA 2E1RA 2QAIA 1UBEA 1YDFA 4S05A 1IUNA 3EBLA 1XTPA 3MK31 2QM7A 4KFUA 5E8JA 1X8XA 3GEMA 4BMYA 3VFDA 5EHZA 4JB8A 1FCJA 1EVEA 3BREA 4RCYA 3TH5A 4IZOA 5F33A 4S1WA 1O0SA 1PZGA 3OECA 4G65A 4YMUA 3HP4A 3GPIA 1N2CE 3MUEA 2Q1TA 1FNBA 5FD8A 3DEJA 3GHYA 1R9NA 3HSYA 3TUJC 2ZB3A 1DUSA 1N0UA 2G67A 2Y1FA 1W7AA 4M4SA 2AC4A 3CLUD 3MOSA 3FWHA 5K8IA 3KEFA 2PJRA 4I7EA 1M9NA 1BVYF 1E77A 1NW4A 3IQEA 3EOBI 3H18A 3UJAA 2IRWA 5HR5A 4NBKA 1T2DA 1ZH6A 2QSZA 3HA2A 2DTDA 3I4LA 4UVGA 3ROPA 1XN4A 3W5CA 1C0PA 2GPSA 4PXSA 1GZHB 3EJ6A 2G9UA 1Y6FA 1RZRA 3GUVA 1XDGA 3G59A 2DSNA 4X20B 5L7WA 2DX7A 2IF0A 4WK6A 5AVWA 3HVKA 2XUPA 1WXIA 2H51A 2QL5A 1K5DA 3GRKA 1YCHA 2W98A 4JI6B 3DD5A 3AI7A 5FQNA 1KMQA 3S2YA 1U2QA 2VK8A 1PEKE 3U3XA 4IR7A 3ZGLA 1F4VA 1UEXC 2ADMA 2X4LA 1SKMA 2IHTA 1XQYA 1XWWA 1VA5A 2J87A 2DMRA 2OV8A 3CF0A 2A35A 2Q5CA 4AMGA 2QQ5A 5JBQA 3PGLA 2JCSA 3WK5A 1Q1GA 4ID9A 2HK6A 1XALA 3H1EA 4KXUA 4YONB 1XRRA 2BGJA 3AF5A 4BDTA 1NX9A 1P31A 4QM7A 4N9QA 4PR3A 1QVWA 3A9RA 1TJPB 2J09A 2G4CA 3AO0B 4X8LA 4I3HA 4JLBA 3GRFA 3KX2A 5K05A 2SNIE 3A6FA 3C7KA 2MIIA 4MQLA 4JENA 4UU8A 3ADDA 3B6EA 1N5KA 4Y2UA 4F5ZA 2BMFA 4BAUA 4BY9E 2O0KA 4CF6A 4TXNA 4LBYA 5LLTA 2AMJA 2JEYA 4XX0B 5FADA 2PAAA 3I5AA 3V9PA 5ALDA 4QEKA 4XWWA 1YNOA 1YQDA 4A0FA 3K0SA 2C4VA 2VBCA 5D8DA 2RGAA 1AZWA 2CZQA 5J4LA 1N9ZA 1YZQA 4R2KA 2XDWA 2YRWA 2YV1A 3LYUA 4WERA 3L7KA 3TB6A 3M9XA 2GD0A 3UYKA 2GPYA 1JEDA 5JYCA 3DJFA 4E3ZA 5F2EA 5U4XA 1RCUA 4XD2A 3HC7A 2IF2A 3QPVA 4EPWA 4B3DA 3AIKA 1E66A 3KXDA 2AOVA 2VIIA 4G5YA 4I6GA 2Y1CA 4HDSA 2X1MA 2VUTA 2IE8A 4MTLA 5ECGC 5FEMA 3L1UA 3RJ9A 3GC6A 2GLUA 3MT8A 5KI6A 4TVBA 3BFKA 4YAJA 1D8AA 3PRJA 3PNPA 4P2BA 1ULAA 2HZ7A 3G8AA 4QECA 5AK4A 5IG2A 2O7NA 4JSTA 4ZV7A 4C6SA 5IK2A 3H9BA 1HDGO 4KBGA 3R76A 1PJZA 5GV8A 3LQ4A 4JQSA 2GA8A 1QFZA 4C4TA 1RS0A 1NHGA 1KJIA 2WZCA 4NDZA 4C4XA 1NPDA 2R4QA 4XTRA 3P0JA 4OK5A 3VNVA 4QQNA 1L7EA 2OCLA 4V1CA 1JMYA 2FPLA 3T34A 3GDWA 3P52A 2IUYA 4OHKA 5EUBA 3ZTTA 1V5GA 2ZITA 4ITRC 5AHWA 2B1JA 2VJNA 3N9IA 4KE6A 1JX6A 3MGBA 4WBNA 3GLUA 1N6HA 1IIBA 1K8XB 4JL5A 4L85A 1G5HA 2Z8XA 4KQMA 4AQDA 1HE1C 1VPEA 1ZN9A 2WOOA 2I6TA 4PLGA 3GG2A 4UEOA 2ZSIA 4ZQHA 1WLSA 4EFKA 4ZFNA 2GN4A 2O8CB 2XR1A 3ZWYA 4DAEA 2NV6A 5HJEA 4JROA 3HDQA 1RBYA 2I2XB 3A6ZA 1T3ZA 3C6KA 1E32A 1WHSB 5EZ5A 1BMDA 1ZW1A 2ZDGA 3GJ0A 3L8ZA 3Q6IA 4HGYA 2HMSA 2IZ5A 3KU1A 4XJVA 3BBLA 2I2FA 1GKUB 2CZCA 4HCJA 1Z37A 2P5YA 5EVCA 2P2SA 3S70A 5KYUA 1MB0A 5BMVA 2XUKA 1CIVA 4B44A 2OG2A 4WZBE 2VP2A 1IXZA 4UATA 3BMCB 1UPFA 3I30X 3R77A 4JYPA 4NK4A 4ZGBA 4DXAA 5I6DA 4QHTA 3DTVA 4ZU3A 4WEOA 3VH1A 3H8WA 4UMFA 3JWEA 4NEQA 3LHFA 1XKLA 2UXBB 4XB6B 3EGEA 1Z9BA 3LT4A 4RPHA 1ZHOA 3S44A 5L45A 3LWZA 4BNHA 1W19A 2I3ZA 3VNSA 2M6SA 1Z0DA 4PLTA 5SYAA 4YT2A 4AYTA 2XDYA 1EQAA 2I33A 4NABA 3ZWMA 1O0BA 1SCQA 3ZCUA 1JEYB 1VL5A 1IAVA 3RVSA 3T99A 4Q3OA 1JIVA 5EWLB 5HIIA 2DSTA 2X2EA 1C9KA 2NSDA 3PFKA 3MC1A 3DBIA 4YJFB 3L1IA 5C1IA 4BGDA 5JU6A 3PDJA 3PWKA 3DVLA 3HNRA 2E6KA 1E3IA 2GBLA 3IYLW 4ZVNA 3LOQA 5A0TA 3E5HA 3ZWXA 3RVRA 5SZIA 2H4HA 2Z1DA 1YXMA 1KAQA 1EWYA 2D0IA 1FTNA 4MH0R 2YY6A 4PBTA 4OOEA 1DFIA 1YMQA 4CJXA 1A9TA 2VDVE 2Z04A 3SZRA 4TXMA 3U3JA 3H0KA 1OZAA 1QONA 4PWZA 1E1KA 1SBIA 2J3HA 3RLFA 1U9IA 1YQGA 4RO0A 5IF3A 3RTCA 1J5EB 1MU0A 3JAMA 1Y5MA 1JI3A 2PKQO 2ZYTX 3GK3A 4XB2A 4IIVA 3WGMA 5HQ3B 4H2DA 4AZVA 2ZR8A 3D3WB 3QH4A 1BRMA 4K9MA 3VX4A 1UEIA 1UZUA 3ASYA 2KLHA 4A27A 1NVBA 1NSFA 5EPUA 4YCAA 4U9IS 3OZFA 2JANA 1D6JA 2FK7A 2UVQA 1HLFA 4BWYA 3WKEA 3AM1A 4AZSA 3NBKA 4N8EA 4B2IA 1Q16A 1RQ7A 1BMFA 1Q22A 2VKQA 4RCVA 1NFFA 3OX1A 4BJ3A 5BURA 4LUCA 2ATIA 1Z88A 1BXGB 1BXZA 1ELOA 1RYFA 1SB8A 1TU4A 3FPCA 3H8JA 3N0VA 3OEHA 4LPKA 1QRDA 2BUCA 4QO8A 4W8OA 3V8MA 4J4BA 3RRBA 3VNAA 4BLOA 1YRWA 1I6MA 2OV6A 3R3JA 2DFNA 1U0HC 2HA4A 2NU7B 1JIIA 2AFIB 2JLSA 3ULKA 4AX4A 3GJYA 4A1OA 4P83A 1U0TA 3I9MA 1QYXA 4QD3A 3WGNA 4M7PA 1U8AA 1WF3A 5BRJA 1TYBE 4Q16A 4FYWA 2FR8A 1CEXA 2OPHA 3TEJA 4JL8A 1ND5A 1A5AB 2Z95A 4MRMB 5EIBC 1G8HA 1TC1A 1OW3B 3FWYA 1E79D 2VDNB 2DTXA 3O7MA 1IVYA 2ZVDA 3NHAA 2I78A 4WVLA 3C8MA 4YCJA 4ZANA 3TKLA 3D7LA 2O5CA 2QU8A 3TFQA 3B48A 1C50A 2HCJB 2GAOA 1QF6A 1J09A 2NUBA 3IJ5A 3OM8A 4LYGA 4DIOA 1N8NA 1YDEA 3OOHA 4UBOA 5HZHA 2UZ3A 1F7VA 3SYNA 3U62A 3LY7A 4AMVA 3NWOA 1RKQA 5DXFA 3TLGA 4UXHA 4HX2A 2QJWA 9LDBA 1NXSA 2GBGA 3QKRB 4EI2A 2W2OA 1QO0A 5IBRA 3BD9A 3EBOA 4UW9A 4DRXA 1U9YA 4RJTA 5JS8A 2GH1A 3SKXA 5D00A 2X7HA 1RJEA 2UYYA 4QDTA 4ARCA 4MLDA 1VG0B 4HGNA 4Y9SA 4DOMA 4EHBA 3HKDB 4GNKA 3V8PA 5BR7A 3TVTA 3HXTA 2M6RA 1KP2A 4BX0A 4X63A 2ORED 1MBZA 2JAPA 4YAOA 1Z4PX 2YR0A 4F3RA 1NYRA 4C29A 3QEAZ 3M6AA 1FNCA 1OC2A 2OP1A 3TAXA 1TAHA 2HFJA 4KBYA 3FDIA 4HQNA 1WETA 4TUYA 2GAIA 1P9LA 2ZBEA 4JY7A 1SKQA 1YBVA 2GEDA 5JNLA 4OFZA 4MHOA 4WFKA 5EYPA 4YRJA 1WEKA 3LDUA 2Z09A 4GR4A 1FP7A 2H1RA 4O4LB 1Y80A 4PLWA 3RYIA 4ZRNA 3BDAA 4HEA1 3G5UA 1UK7A 1PE0A 2BWJA 4R68A 3HRIA 3TRHA 1HNNA 3WKDA 3ZE2B 2GQ0A 3AGPA 4YECA 1SUWA 4BNJA 5JQGB 1IHDA 2JASA 1X86B 4G0YA 2M6KA 4MO9A 4QBIA 1C4OA 5T57A 1L7RA 1YKGA 2EC5A 1IN4A 1GZ5A 2Y1WA 3O26A 3PNVA 2GO1A 3W6NA 4WTOA 3OJEA 2ZVJA 2VFAA 3DMTC 3L04A 4A8PA 2P68A 5K20A 1BOFA 1OHHA 1YQQA 3HVJA 2FW9A 1AHIA 3O92A 5EJIA 3PYXA 1VKJA 4RD6A 2J07A 1E1CA 2B4RO 4QFDA 4RBNA 3TVYA 3QX7A 1L4MA 4H16A 4RNDB 1NC3A 3RC1A 1N7IA 3U7QA 1SVUA 2NZUG 1EG7A 2QV0A 5AVOA 4LF4B 2VCYA 2G1JA 4NZYA 3NKVA 1XA4A 1NA5A 1TMOA 1FB5A 5ILQA 4N48A 1QJCA 3O95A 2AN3A 5EQJB 2Q4DA 4EBBA 3DZGA 5IT4A 1W73A 3NHPA 4KQIA 3IR5A 3OUTA 4M53A 4CQLA 2BR4A 1TYDE 3F7MA 2NTYC 1PFUA 4G26A 3R41A 3P20A 2P91A 4P3KA 1UJ2A 4O2AA 5DMXA 4DGSA 3LX5A 3GDFA 1V6AA 1SZJG 2XI4A 3DW3X 1TCUA 2DM6A 3E2PA 4R1MA 1HE5A 4UBNA 2FP4A 4Q47A 2V54A 2R7NA 3LHKA 4KYIB 3STXA 8ABPA 5KYYB 3V1LA 3WBFA 3W9UA 2PLFA 4PZAA 5LXTA 5HA5A