3WLEA

Crystal structure of (r)-carbonyl reductase from candida parapsilosis in complex with nad
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
335
structure length
335
Chain Sequence
b'SIPSSQYGFVFNKQSGLKLRNDLPVHKPKAGQLLLKVDAVGLCHSDLHVIYEGLDCGDNYVMGHEIAGTVAAVGDDVINYKVGDRVACVGPNGCGGCKYCRGAIDNVCKNAFGDWFGLGYDGGYQQYLLVTRPRNLSRIPDNVSADVAAASTDAVLTPYHAIKMAQVSPTSNILLIGAGGLGGNAIQVAKAFGAKVTVLDKKKEARDQAKKLGADAVYETLPESISPGSFSACFDFVSVQATFDVCQKYVEPKGVIMPVGLGAPNLSFNLGDLALREIRILGSFWGTTNDLDDVLKLVSEGKVKPVVRSAKLKELPEYIEKLRNNAYEGRVVFNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords (R)-specific carbonyl reductase
publication title Unconserved substrate-binding sites direct the stereoselectivity of medium-chain alcohol dehydrogenase
pubmed doi rcsb
source organism Candida parapsilosis
molecule tags Oxidoreductase
total genus 99
structure length 335
sequence length 335
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2013-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3wleA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3wleA01
4IM7A 1MV8A 5KJFA 2O3TA 1O0SA 2VQ3A 5T64A 1U8XX 3SEFA 4ZQHA 2CMDA 2GN9A 2OORA 3HJAA 4YJGA 1CF2O 2IYPA 3KETA 2FSSA 4RPKA 4CLHA 5EPOA 5JPIA 1J0XO 1O89A 4L9RA 1QV7A 1WXDA 2WE7A 3KSZO 2EV9A 1S6YA 1Z82A 2BI7A 1E3WB 3GMSA 1EVJA 5JO9A 4N5LA 4BNNA 1OBFO 4MVJG 4U0JA 3K96A 4CR8A 2X7HA 5JMWA 2IE0A 1OFGA 3GK3A 4DXHA 4KZPA 2CDAA 3RBVA 3WXBA 1BXZA 4O5OA 3GVCA 1NQTA 1MFPA 4FFRA 1EVZA 1HYHA 4ALLA 4H7PA 4FFOA 3I9NA 3OEWA 5JAIA 2BLLA 1ZSVA 1H2HA 4XDYA 5DBFA 2IDZA 1B7GO 1ULUA 3QVWA 4FJ0A 3S2IA 2DBRA 1WLYA 2H6EA 4CPDA 1JWAB 1DFHA 2OMEA 1ZXBA 4UVHA 2JCXA 3JD0A 4L74A 2HAEA 3OA2A 2EWMA 3IL2A 2YQ5A 4TSKA 2DU8A 1K6XA 4D0SA 1I32A 1S7CA 4MP8A 2VYVA 4XEHA 5HS4A 2EKLA 5CFZA 1F06A 1C0LA 1HDCA 1R0KA 2OBYA 3VZPA 2BFAA 4WASA 1ISGA 1XYGA 2G17A 2HMTA 5AXAA 2B4TO 4FR5A 3HWRA 5AXDA 3AY6A 5FF9A 4UVDA 5KJ6A 3FNEA 2VUSA 1YONA 3PP8A 5BSFA 1JAYA 2OO5A 5JYDA 4BGVA 4CLOA 1FXSA 3NAQA 5CP8A 3RUHA 2AQHA 1EVIA 1FDVA 5TGDA 1IOLA 1U9JA 5TJHA 3VZSA 2J5KA 4AJOA 1LRJA 1LSOA 1GU7A 4YJGB 4NQZA 1H93A 1PJ3A 1H94A 2SCUA 3JQCA 4BMSA 1ZK1A 1I2CA 1TVEA 3QW2A 5MDHA 1SO8A 2QZZA 1KERA 1BG6A 4C7JA 2WD8A 2V65A 3DMTA 4J1NA 4KTVE 3KUXA 3ZWPA 3RUCA 3SJ7A 3V1TC 2JD0A 5AXBA 5I9MA 4DREA 1E1MA 1UZMA 4ZN6A 2J8ZA 3JSAA 4XJSA 3W6ZA 1PS0A 4RF4A 3NDIA 3PWZA 4JROA 4YBZA 1K89A 3WMWA 1RKXA 4ALMA 1UDAA 4BB5A 4FOSA 4IY1A 1E7SA 3BZUA 1XIVA 5G0WA 1XU9A 5AOVA 4AJLA 3LC1O 3WJAA 1ARZA 4N7RA 3C85A 4OHUA 1TT5B 4TROA 3MOGA 1CYDA 1KBZA 3QWFA 1L1FA 1LQUA 4BNZA 5ILGA 5IN5A 4CM5A 1JA9A 1E3JA 3L6EA 4KDFA 4BNLA 3H8VA 1DAOA 4QT0A 4E31A 2X5OA 1YL5A 2X4GA 1W4ZA 4MDHA 1ADCA 2PH5A 4J2HA 4TWRA 2FSVA 2D59A 4JBGA 1BVUA 3GEDA 2VN8A 3GQVA 4NI5A 3CEAA 1P3DA 3BMCA 2NTNA 4AL4A 3U0BA 1ZJYA 2EEZA 5I7SA 1LJ8A 3L9WA 2ZB3A 2UDPA 1L7EA 1Q2XA 3IKTA 2PY6A 1G6KA 3PWSA 3DEYX 3OJOA 4HBGA 4E6PA 2YQ4A 4BO4A 1CEQA 1ZJZA 2OGUA 4XRRA 4ZJUA 2VRCA 4OL9A 1LXCA 1BW9A 1LX6A 2JFGA 3JYNA 1PJ2A 3L77A 3WGYA 4Q3DA 4H16A 3SBOA 3F47A 4EDFA 2XAAA 2PZLA 2AQKA 3FPCA 2W2LA 1LDNA 3Q9UA 4IDDA 4PG5A 1IHYA 3CZRA 4GBJA 5COQA 4FW8A 1XSEA 2AE2A 2QRJA 2VNAA 5TT0A 4CM7A 2VWHA 4KQWA 1NBOA 1T25A 1I2BA 3INTA 4XX0A 1HDOA 1EK6A 3WGZA 1NQ5A 4JJIA 3GDGA 3H9QA 5B4TA 4YWJA 1K5HA 4XB1A 4CLRB 1Y8RB 1U2GA 5CDGA 4HP8A 3OIDA 4M54A 3QWIA 4TKLA 4NPCA 2X9GA 1NM5A 3PYLA 4DC0A 3BMOA 1YKFA 2BGKA 3FTNA 1BHSA 3PLRA 1PJSA 1ZBQA 3KRTA 4RVHA 3GG9A 4I8XA 3WBBA 3RUAA 1XGKA 4TRJA 1R37A 1VE9A 4Z9FA 2Z5LA 2QRKA 3D0OA 2VHWA 4WNIA 4DPLA 4L4SA 4LRTB 3JD3A 1BMDA 3IDSA 1E5QA 1YBMA 1Q1NA 4Q3BA 3IP1A 1AE1A 1I5RA 4IXWA 3VPFA 4PN3A 1DEHA 4J90A 1D8AA 4O0LA 2JD1A 4R9RA 1QYDA 1T4DA 3VPSA 3VAZA 2VCYA 4CM4B 3QLJA 5COBA 4BB6A 1FJHA 5J23A 1WVGA 1PL7A 5CEFA 2EP5A 4W99A 1NNUA 3CZMA 4BNWA 3JD2A 2VZ0A 4AJPA 3RSHA 3HFGA 3JCZA 4ZD6A 4CUZA 1WNTA 4Y6PA 3TSCA 3ZN2A 1ZK0A 4BNFA 2Q2WA 1JKFA 2Q4BA 3PK0A 4W4TA 2ET6A 4N18A 1EE2A 1ENPA 3ITKA 3O38A 3ETDA 5THKA 1SB8A 1XQ6A 4WGGA 4XIYA 1N7GA 4GX1A 4S1VA 1YJ8A 1U4SA 5DBIA 5L7WA 3RROA 1ML3A 3RQSA 1ZUD1 1DC6A 2Y66A 3DZHA 3H9GA 4XGIA 1BW9B 3LLSA 3WTBA 4RF2A 2AE1A 3E9MA 4RVDA 5CG1A 1X13A 4BNJA 3MJCA 4CQLA 1I36A 3C7CB 4GPD1 2O7SA 4BNGA 4CMGA 1BGVA 4I5EA 2DLDA 2VTEA 4PG6A 2EW8A 3WGQA 1U3VA 3KV3O 4OJNA 5T5QA 3JQAB 4BO5A 4CMHA 1EFKA 4RV9A 2GERA 3C7AA 1JN0A 2HSDA 1U2DA 2X0JA 1ZMOA 2Y0EA 4JK3A 1NXQA 4Y67A 2CVOA 1OZAA 1N8KA 1F12A 1CERA 2GO1A 2CDCA 5EJ2A 1T2EA 1PWZA 4GX0A 3OM9A 3PZRA 3BMQA 3H9EO 3ONEA 5AXCA 1WMBA 3CKYA 3GEGA 1K3TA 4NZ9A 2QYSA 3JQ7A 1NWHA 1X1EA 3MJEA 4TKMA 3GZNB 3R3JA 5A03A 1VKNA 4EW6A 3UXYA 4YT4A 3UFXA 3NJ8A 2CD9A 3JYPA 4R01A 2JJYA 2HDHA 2OP0A 1ENYA 3Q2IA 4DUPA 1BDBA 3AY3A 2NTJA 4TRMA 1D3AA 1NHGA 3ONFA 1H5QA 1PJ4A 4Z9YA 1IL0A 1ENZA 2NACA 3KB6A 1FDTA 3I9KA 3KXDA 4J9VA 5KIAA 5EIOA 1LC0A 2XXJA 4YACA 3OQ1A 3WWZA 4N5NA 1SMKA 2EIHA 3DR3A 3AFMA 3AOGA 5ES3A 3EAGA 1RM4A 4CL8A 2FR1A 4DGSA 3W4KA 2IEBA 1R4NA 3EZYA 3KO8A 3NKLA 4OKNA 4PZEA 3CPSA 4E5MA 3RIHA 5KCZA 4J9UE 2RAFA 2HMWA 3ETGA 2X6TA 3UGKA 1NP3A 5IXSA 2DUUA 5C5IA 2AHRA 4XGKA 3DBHA 4IJWA 2CNBA 1JW9B 1YB4A 3IP3A 1AXEA 1EEHA 2JKVA 1RM0A 3AY7A 3JQFA 4OXYA 1DC5A 1G1AA 4IDFA 5AQ1A 4CQLB 4L8VA 4L76A 1CQIA 5IFLA 3K2EA 1YS4A 2IODA 4E5NA 3B1FA 3AUTA 4YB8A 2C07A 5TQVA 3VH1A 2GASA 3JTMA 4H3VA 4JNKA 1SNYA 4DPMA 5L4LA 1GY8A 3EYWA 1MA0A 2RIRA 5H81A 4MKZA 2X9VA 1LSJA 2VOJA 1VJ0A 3NTRA 4XYGA 5TX7A 1E3LA 5EQFA 4PVCA 4CMBA 2POQX 2Z1MA 4GX2A 4AJIA 1CJCA 3WYCA 3IAHA 4YA6A 4B4WA 2FY8A 4U0KA 5GZ1A 1K2WA 2RH4A 1UJMA 1EBUA 2ZB7A 3CTMA 3FHLA 4TVBA 2W8ZA 3EMKA 3C24A 3LDHA 4RQUA 4G81A 4QX6A 2PGJA 3OJEA 4E30A 2E4AA 1GTMA 4FC6A 4B7UA 5JCXA 2Y1DA 3BTSA 2C2XA 4PRKA 3QVOA 4AJHA 4XDZA 4PZDA 3FR7A 3GNSA 2QX7A 1X0VA 4O6VA 1I3KA 4CQMA 3ENKA 4D45A 3C1OA 4ND2A 5KVSA 4K1LA 4NDNE 4K6FA 3I9LA 4ZGWA 3SLGA 2FRDA 4DMMA 1SZJG 3WNVA 3M6IA 4FFLA 4XYMA 2JFFA 1ONPA 3PEFA 2V6FA 2DBZA 2EXXA 2QW8A 2VYVD 1ID1A 4TRNA 4BV9A 2HJRA 1XKQA 4LCEA 3U09A 1DXYA 3WJ7A 1N92A 1DIBA 3EDMA 4W82A 5DF1A 1IYZA 7MDHA 4MOWA 4PLYA 4EUFA 1MGOA 4WJZA 1E7YA 1ZK2A 3OBBA 4J1QA 4Q3CA 4OKIA 1HLDA 1PJTA 2VTDA 1IUKA 2FN7A 1V35A 4CV1A 4BNYA 3ZWWA 5LDHA 5BT9A 1A9ZA 3EVTA 4AJ1A 1UP4A 3ENNA 1T2CA 1SPXA 4NK5A 2C54A 2PTGA 3RC9A 4CR7A 4AJ4A 1YWGO 2YFHA 2HMUA 2O48X 3U4DA 4F6LA 3TQHA 1DJQA 1N1EA 2QIOA 5JC8A 3TFQA 1BTOA 3QWAA 2P91A 2Y1OA 3QHAA 4YAGA 3F4LA 1VL6A 3VH4A 3MWEB 4TQGA 4RQTA 1R4MA 1X7GA 4B8WA 1W0CA 1ZEMA 5I7VA 4MVJH 2HO5A 3L4BA 4LCJA 5A9SA 2PWZA 2F1KA 3I9MA 3ORFA 2X58A 1Y9EA 2WJPA 2Y05A 4HFNA 3KTDA 3C8MA 5CDTA 4KUGA 3E5RA 2AW5A 3D1LA 5ICMA 2WYUA 5A3VA 4UUPA 2O2YA 3MTJA 3K8ZA 1Z73A 2EJVA 3WNQA 3DONA 4DQUA 1HDGO 4B3JA 3BTUA 1XCBA 3PQEA 5COAA 1HE2A 2YFQA 2WD7A 5JXWA 1NVMB 2D0IA 4C4OA 4OXNA 4F3YA 1U1IA 4CODB 3PIIA 2GR9A 3SC6A 4CQMB 5DDIP 2NNLD 1PQPA 1BSVA 2O4CA 4GVXA 4BL5A 3ONDA 3U49A 3T4XA 4WLOA 4NJMB 1Y8QB 4CM8A 5C7OO 1QSGA 4M49A 3ROPA 4LK3A 3IQDB 1Q7GA 4MVJA 1QYVA 2E6UX 4RO0A 1I33A 5JS6A 2AEJA 2AA3A 2BF7A 3GN1A 1X7DA 3D5TA 3HG7A 2Y1GA 1TLTA 4YAIA 2DFVA 3BIOA 5CDUA 2Y93A 4RJTA 2VZ9A 5GZ6A 4ALJA 1B8VA 2W2LD 4N54A 1EUDA 2WTBA 4L4XA 5EL0A 1RWBA 1E3SA 2XOXA 3IUPA 4HUJA 4E3ZA 2PD6A 1YDWA 3IMFA 1LSUA 3B70A 1GYPA 3ZW8A 2B5WA 3JQAD 3UH1A 3ST7A 1F14A 2JAPA 4HFJA 1VKOA 3JQGB 5T8KA 4MIEA 3X2EA 4CUKA 2D2IA 3KYCA 3RKRA 4OYRA 3RUDA 1R4MB 2NUAA 3JQBC 4IUYA 4AVYA 3DQPA 2IYOA 4NH4A 4D79A 4CMEC 3WGHA 4DL9A 5A9SB 2PZKA 3M2PA 5JFOA 3MJVA 2BI8A 3A4VA 5BR7A 1U7HA 4E21A 3V8BA 3QA9A 4BOYA 3I52A 5GY7A 3GDFA 1H9AA 1NFRA 1ZVMA 1RJWA 4IDBA 1XR3A 3VKVA 3U3XA 4B7CA 1B2LA 3A1NA 3FWNA 2HCTA 5ITVA 3DBLB 1DB3A 2B4RO 4NBUA 1P1FA 3OJLA 3MCVA 1DDOA 2DBVO 3DZJA 4NFHA 5IG2A 2D5AA 1PS9A 1LDYA 2PD3A 1O5IA 4BO0A 4U7WA 3V2UA 1ISMA 3D64A 2WD7B 1WPQA 2P2SA 3GDOA 4OOEA 1M6HA 3NGLA 2HMSA 1YJQA 1LRKA 1DIHA 5MGBA 1NR7A 4JCOA 1B14A 1MG0A 4B8ZA 3VOSA 4W7HA 4X54A 1AUPA 3WLFA 4R3WA 4WLUA 4XQ9A 2IXAA 1EFLA 2HUNA 4BKQA 3HZZA 2Y68A 2NADA 3M2TA 5HRUA 1UXHA 2AQ8A 4DWVA 3OETA 3UCFA 2UAGA 4LVCA 4JQCA 1P1JA 3LYLA 5JAZA 5LCXA 2WM3A 5IDYA 2GYYA 3KEOA 4ALIA 1ZH8A 4IS3A 1K6JA 3D5QA 1YH3A 3TZCA 1DLIA 1LDEA 1TI7A 2NU8A 2AEFA 2LDXA 4UAGA 4WE3A 1NR1A 3CE6A 4H15A 1HE4A 4E5KA 3H6KA 4J49A 1MFZA 3GC6A 1ISJA 5K6AC 8ADHA 2BRUA 5TSDA 4MIYA 1XHLA 4ZQBA 1PL6A 3GUCA 4FIZA 3RKUA 3BTOA 3UAGA 2J3JA 3VTZA 5JAMA 3P2OA 2B5VA 3D3EA 1PGQA 4R3NA 1VJ1A 4B4OA 5C37A 1GAEO 1YO6A 5EERA 2HLPA 3RASA 4FS3A 3RC2A 5JDCC 3GY0A 1JWBB 3E03A 3PJFA 1H6DA 4RPLA 1IHXA 4E0BA 1EQUA 3CMCO 5C7LO 1YE3A 4Q3NA 3RU9A 2OXIA 1V0JA 4OH1A 1I2ZA 1NVGA 3RFTA 1H0KA 5JBIA 5IZCA 3O8QA 3ZV3A 1W6UA 3BHMA 3I4FA 5FYDA 2CY0A 3UW3A 1PGNA 2DT5A 2O7QA 3PWKA 1R6DA 2R00C 2I65A 3KM0A 5DNAA 5DBGA 4MVJM 1E7QA 4L73A 4XYBA 1KY5A 1YXMA 2GN4A 1JTVA 4IGFA 4LN1A 1JLLA 3ADPA 2VYNA 3DTYA 3ZW9A 1NASA 1PR9A 3G0OA 4PLWA 4R68A 2VT2A 3IC5A 4JGBA 1E1NA 1SEPA 3ADOA 3HDHA 1LI4A 4JJGA 1XEAA 4PLPA 4PFJA 3H65A 3INRA 1E7RA 3IJRA 4YJFA 3V2GA 4XA8A 1BWSA 3WWYA 4DIFA 1NQOA 2C0CA 3OMLA 2D4AA 4OSOA 4PGFA 4LW8A 1ADBA 3C1TA 5BSGA 2X0NA 4UEJA 2J3HA 1UXJA 2HKIA 4EEZA 4JBHA 5KTKA 1I3NA 4RVUA 3WBFA 1GZ3A 1PZEA 3H7AA 2P9GA 4R54A 4CM1A 2PGLA 1DFGA 4RVGA 2C59A 4M89A 5DOZA 4M1QA 4D3FA 1EUZA 5HBRA 3AI2A 1GQYA 3QQPA 5FFFA 2DAPA 3I5MA 2X0IA 1ORRA 4E33A 3OF2A 3RBZA 2NU9A 3RD5A 3U9LA 1B15A 3QWHA 4J4TA 2X0RA 4CLXA 1Z7BA 4MVJP 5L40A 4CM9D 1V8BA 4BNMA 1KY4A 4ALNA 4NNJA 3SVTA 4CM6A 4CQMD 2X5JO 2Q1WA 1C1DA 1P1RA 2HRBA 5JNLA 2ZKLA 3H5NA 1GL3A 3M1AA 4G65A 1TT7A 2DVMA 2VWPA 1DIAA 1N5DA 3NDJA 3O4RA 4J6FA 1F0YA 3AK4A 1DHRA 3O8QB 3VH2A 2I99A 1V3VA 1X0XA 1I10A 2VUUA 4BQPA 3H4VA 4YR9A 4J2OA 3UVEA 3ZWOA 2A4KA 3LF2A 5L53A 4R69A 4U5QA 4B79A 5L4SA 1XWFA 1JDJA 3MZ0A 3W4IA 5FWNA 3RAJA 1M6WA 3GRKA 1O94A 3BYZA 3DOCA 1WDMA 1VLLA 4GAEA 1CIVA 3LU1A 3LVFO 5H82A 4EJ0A 2YV2A 3CIFA 4RGBA 2F00A 2UUOA 4YT2A 5BSHA 1R66A 4YJFB 4WCFA 2OHXA 2QG4A 4A27A 4FFPA 2Y99A 4CM3A 4I5FA 1GR0A 2G82A 3FRJA 1WDLA 2VOEA 3DZIA 5F5LA 4BO8A 5ENVA 1ZSYA 2PFGA 3DFZA 4E12A 1YQDA 5I7FA 4YJDA 3G1UA 1ENOA 5THQA 4B7XA 4O59O 4WOJA 4NU6A 1T4BA 2P9EA 1YBAA 2PK3A 1M2WA 2PA3A 3MWDB 3DMYA 1BDMA 4E32A 1VSVA 4BO6A 4YVFA 5L95A 3K31A 1T2DA 4GSLA 3N74A 5JC1A 3P2YA 4RLSA 3ABIA 3NEPX 4TZTA 2ZB8A 1C0IA 3D3WA 3AI1A 1LRLA 1P33A 2OL4A 3W1VA 4QUKA 1B0AA 4DC1A 4MP6A 1IZ0A 5EQDA 4D44A 1ISIA 3GA0A 2YDXA 3WR5A 3A9WA 2IZ0A 1HSOA 1Y9AA 1X1TA 4NBVA 1DC4A 1P31A 1HKUA 2EP7A 2HK7A 1HTBA 2H5LA 4ZQGA 1RPNA 1ZFNA 3F5SA 4WK6A 4CLOB 1PTJA 3LK7A 5TRTA 3H9JA 5B37A 1PQWA 2ZTVA 3JQ9C 1NYTA 3QVTA 3WSWA 3GEMA 4ZQEA 3RI3A 4IQGA 4CR6A 2HJSA 2PLAA 1JAXA 4R51A 4DA9A 5JDIA 3IJPA 1JKIA 1ZO8A 5DT9A 5IXYA 1SBYA 1SOWA 3VH3A 4XYLA 1MB4A 3QRWA 4M55A 3F5QA 4BNXA 3K9QO 3L6OO 3LF1A 1NTOA 5C7IO 2LDBA 2DQ4A 3EZLA 1R12A 1IPEA 4Y6RA 2GN8A 3I3OA 2HK8A 4C7KA 3ZWBA 5TF4A 4BMNA 3GG2A 2Z95A 4YJHA 1R15A 4MINA 5L9AA 3OHSX 3VZRA 3NTOA 4WCFB 2B69A 5U4QA 3WQSB 3D4OA 1CWUA 1EUCA 1EDZA 2I66A 3WOHA 2C5AA 4A73A 3RC1A 3JV7A 3W8FA 1HSZA 1VC2A 1B16A 3H2SA 4O1MA 5JCJD 2E37A 4Z0PA 2ZYAA 2G5CA 3MOIA 4ZRNA 1U3WA 4GLOA 3GGGA 4RF3A 1EE9A 3ICCA 4P22A 5LC1A 5L7TA 1A4IA 3SX2A 1I24A 4GMFA 1LBEA 1U7TA 2GGSA 4PZCA 4E2XA 1P44A 3BMCB 4ID9A 9LDBA 4UVGA 4ZRMA 1Q7CA 1U5AA 3KYBA 5IAAA 1ONNA 2GCGA 3JQEA 4N5MA 5G2OA 4ZQFA 2ZCUA 2CVZA 2NWQA 2PD4A 2FHSA 1LLUA 2YW9A 3RBXA 1GADO 5A1TA 4A2CA 3X2FA 1AN9A 3AUAA 2CFCA 4GL4A 2O3JA 2JCYA 2VT3A 3KYDA 4QECA 4B3IA 3C1AA 4P38A 3WG9A 2VHXA 4OO3A 5IZ4A 1FK8A 3OECA 1PWXA 3DHEA 4NIMA 1KVQA 2WMDA 3ANMA 4IZHA 3FI9A 4AJKA 2HMVA 1F8FA 4RPJA 3TF5A 3PVZA 4LSWA 2Q1UA 3QSGA 3EHEA 1UDBA 1E7MA 3E9QA 4I5GA 4XGNA 3PJDA 1XQ1A 1A4UA 4OIMA 3LZ6A 5F1PA 4Z6KA 3LC7O 3TJRA 1FDUA 2W2KA 2FPPA 2ZIZA 2I6TA 3BMOB 5KJEA 5EMHA 2X5KO 1P9LA 4R1NA 3WGOA 3WGIA 1MC4A 1QXSA 1UR5A 2VWGA 2O3UA 3DBVO 3OFSA 1WW8A 3AOEA 5KVQA 4YJHB 2TMGA 2EKPA 4GWGA 3NTQA 1ULSA 1J4AA 2P9CA 2ZJ0A 4FPXA 1FMCA 3IIEA 1QMGA 3NV9A 3V5NA 3COSA 5DCUA 2NV6A 4P8RA 3ZHBA 4MKRA 4AG3A 2Q45A 4XQEA 1NPYA 3UHAA 4XKJA 1T1SA 1GDHA 4EUEA 3H2ZA 3LLVA 1KIFA 4BO3A 2PNFA 2DBQA 4OM8A 4R1SA 2QQ5A 4JLWA 5KOIA 1PU2A 3KZVA 5G4LA 4XB2A 1RYEA 2PH3A 3B1KA 1I3MA 4IBOA 4MVJE 2I67A 1EBFA 4IDCA 3P19A 1H6AA 3GOHA 3PQFA 3QP9A 3LT1A 3WICA 1D7OA 3AWDA 3HDJA 3HSKA 2ZQYA 4ZHSA 3IKVA 5ICSA 1SB9A 1U5CA 4ND3A 2DFDA 3QY9A 1MLDA 3KYDB 1DIGA 1Z74A 4YRDA 4IXTA 2V7PA 3R6DA 3FD8A 2X22A 1KOLA 3DBRA 1X14A 3GVHA 2P4HX 3ZGYA 3WDSA 1C1XA 4GLLA 3ANNA 3PHHA 1GZ6A 1AHIA 2EF1A 3P5SA 1T1RA 3N58A 4U6SA 2DUWA 5KWEA 4KOAA 5L4NA 1ADGA 4BIIA 3ZWYA 1OMOA 2VYND 5G0VA 1O6ZA 1GV1A 1KC3A 1PR3A 5GMOA 3I6IA 3DL2A 3KLPX 4QO7A 3WGTA 1E6UA 2YV3A 1PS8A 4KTTE 4MPDA 2W2KB 1U3TA 1J6UA 2H1SA 1Y6JA 2CF6A 1W73A 3BMQB 5AVOA 5CEJA 2Y67A 5BQFA 2WWRA 3JQ7B 5IJZA 2ZYDA 3S2FA 1SAYA 1EVYA 1K0UA 3ROMA 3DAGA 4JXKA 2IZZA 4YRBA 1DBVO 3OSUA 4ITUA 4JN6B 4E5PA 1HYEA 3A06A 3OJFA 1YVEI 3GAFA 4CMJA 4WLFA 2JFHA 5I9LA 3HFSA 4J3FA 1EDOA 2EJWA 3AI3A 3PXXA 3AUUA 1SC6A 4MO2A 3FR8A 3RFXA 3PJEA 5CPBA 1N7HA 3LC2O 1IY8A 3EW7A 5L7YA 1KVRA 3NT2A 4BO1A 4NK4A 3VHRA 4R1TA 4IS2A 3B6ZA 1LEHA 2DPGA 2UV8A 3LSYA 1R4NB 4LMRA 3GN2A 3JD4A 2HK9A 2W98A 3GPIA 3UF0A 2JD2A 1LSSA 2YYYA 3GFGA 4DLAA 2DM6A 3DXFA 4NBRA 4Y9DA 2O4UX 3Q6IA 5TIIA 1QG6A 3DBHB 1E5LA 5KKCA 1UH5A 2EHDA 3L9XA 4NFSA 4FC7A 3IS3A 3S8MA 3BAZA 1X7HA 3PRJA 4RORA 4RL6A 5BNFA 1C0PA 2CUKA 1PJQA 4KUHA 1C1XB 6LDHA 4KMSA 1Q0QA 3FBGA 4UEKA 3EVNA 5C3MA 2I3AA 5IZCC 3JQ8A 4J1SA 4GGOA 1UUFA 4Z0TA 2Z1NA 3GFBA 4RZHA 4QEDA 3V2HA 5JY1A 1B8UA 3KSDO 2WE8A 5DCWA 3M1LA 3SXPA 3ITDA 1KEUA 3ZH2A 3WQQA 1BXKA 4DBZA 4A26A 3WFJA 2CSUA 5BSEA 4XCVA 1HE5A 2E48A 4J4BA 5JYEA 2UYYA 4WKGA 2PZMA 4DVJA 3ZHZA 2RHRA 5F3RA 4GH5A 1GQ2A 4HFMA 1GUZA 4UVEA 2XF8A 1U8FO 1A5ZA 4J1TA 3ZWMA 4YEDA 1UXGA 1H9BA 4D3SA 3PDJA 3I83A 2FZEA 2ZB4A 4I9NA 3TFOA 4EGFA 3HUDA 1PJCA 3U4IA 3E9NA 4WUVA 4YAEA 2X9NA 2D8AA 2VWQA 3L6DA 4R4JA 3T4EA 3T7CA 1DC3A 2ZJ1A 4IDGA 4JJFA 3AW9A 1A72A 3MTGA 3WTCA 2NQ8A 3O9ZA 4LGVA 3PYXA 5EESA 3I9OA 4PVDA 4Q39A 2VRCD 1ISHA 2IRWA 1GD1O 4FSHA 5IF3A 4ZA2A 3GGOA 4GWKA 3OQBA 2E49A 2Q1SA 1Q0HA 2YHUA 1LDBA 4PLZA 2AXQA 1RM3A 4A0SA 1Y5RA 2Q2VA 1Y7TA 3PIDA 4E2ZA 3HQ4O 3WYBA 4ZICA 4RDHA 3PFFA 4XRGA 4YXFA 2ZTLA 4K9DA 1UXIA 4NJOA 3NJ4A 1U4OA 1YB1A 4XWYA 3WYEA 2PR2A 5ITWA 5FI5A 2NQTA 3JQ8B 4D0RA 1NAIA 2UUPA 5FEUA 3FNGA 1DFIA 5T57A 5K9ZA 1CETA 1BVRA 4FFMA 4GMGA 1UDCA 4MJLA 4MP3A 4BHTA 3INGA 3S1LA 3ZWAA 1VL0A 1OOEA 1UAYA 2VRBA 5ER9A 3AM5A 1TB4A 3DMTC 1YBVA 4PIVA 2BFOA 1CQJA 4OGWA 4NBTA 3GR6A 3ZV5A 1E1KA 2FR8A 1N9GA 3RU7A 2Q3EA 4AJEA 3GHHA 4LRSB 4WCFC 4WLEA 1WDKA 4IIVA 1RM5A 4HXYA 4MKXA 2C29D 4FCCA 1KVSA 1BRMA 5JY6A 4OAQA 1RYDA 1SEVA 2GZ3A 2NVUA 4CM8B 4UULA 4D3DA 1B3BA 2GSDA 1JVBA 3D4NA 2BH9A 3FNFA 3PYMA 3U4HA 3WS7A 1W8DA 1WAMA 4EJ6A 3KHUA 1VRWA 4D46A 1DRUA 4XYEA 4IZIA 1XLTA 2O3SA 4I9UA 4FQ8A 4CV2A 3AU9A 4RDIA 3PHLA 4E4YA 4CMAA 4CV0A 1LQTA 4J91A 4E13A 2QHXA 1OAAA 3HN2A 4ESOA 2FWMX 4ROSA 5ILOA 4QQRA 3TZ6A 3EGOA 2XXBA 3B20A 1QR6A 5KJ1A 4GGPA 2BKAA 3MJ4A 1QV6A 5IN4A 1CDOA 1YRLA 4NFYA 2I9PA 2NU6A 3KYCB 5DOVA 1U3UA 4IMRA 3PGJA 1P1HA 1EQ2A 5ENDA 1DHTA 3E8XA 5TS3A 2EW2A 5JDIC 1LLQA 2FP4A 4J16A 1WZEA 4RF5A 4HV4A 4E5YA 1FF9A 3OP4A 4BO2A 1ZIDA 4IGEA 3TPCA 2H9IA 1YQGA 3UOGA 2JHFA 2IZ1A 3ZHYA 4ND5A 4F6CA 5ADHA 3JYLA 3ETEA 4IDEA 3ZNOA 1YB5A 2ZTMA 1DRWA 1UZLA 4GKVA 4EI2A 1N9GB 4B4VA 1IPFA 1UP6A 4J0FA 3CXRA 2DTXA 4NU5A 1IE3A 5H83A 5JMPA 1Q7BA 2X1HA 1MX3A 3VC7A 2ZYGA 5DZSA 1ONOA 3W8DA 1XA0A 4WLVA 5G0TA 5CG2A 3A14A 3PHJA 4R41A 4U8GA 5DP1A 1QYWA 4JBIA 4HNGA 4R16A 1GZ4A 2OFPA 2FOIA 4Z0HO 1KVTA 4JX8A 1FDWA 3UN1A 1O95A 1HL3A 5K1SA 1M67A 3DFUA 4TMFA 2EG9A 4WPGA 2BFPA 4ZVVA 4BMVA 3K2BA 5F1OA 3GHYA 1Y5MA 1LUAA 3I23A 4TZKA 3QVSA 1DOHA 4RLHA 2ZCVA 4L0QA 2Q50A 1G0OA 3HDYA 2I76A 3Q0EA 4Z9XA 3QV1A 1P0CA 4J7UA 1CRWG 5EN4A 4KP7A 2CDBA 4CMCA 1A71A 3KVOA 1NX6A 1UP7A 1QORA 3KOUA 4PLTA 2YHIA 2RH8A 1QYCA 4L75A 4YT8A 1GQQA 3HB4X 3OH8A 1TT5A 4O63O 4BKPA 4EBFA 1QLHA 4AJJA 1PZFA 1J49A 3ZU4A 4Y98A 1HLPA 1HZZA 1NPTO 5TNXA 1M76A 2A35A 1P45A 3GGPA 2AG5A 3KLMX 4QXMA 1KEPA 3ASVA 4EJMA 2P68A 3FTPA 5KNLA 5I9NA 1M66A 4BQRA 3HN7A 2BD0A 5CEEA 2VHVA 5FI3A 1T26A 5F21A 5B12A 3FPLA 1E6WA 3RJ5A 3AOEC 3ZI0A 2VUTA 5TT1A 3TZHA 4Z3KA 5U1PA 4J0EA 1PZHA 1WMAA 1NHWA 4YTEA 1Y1PA 3RCBA 3PQDA 2C7VA 3RUFA 5L51A 3K73O 3RWBA 3VDQA 3ZNNA 3GVPA 2FPIA 4I9HA 4BGUA 4MVJF 3TRIA 3GNQA 2P4QA 2YUTA 3Q2KA 2Q1TA 3JQBA 1E1LA 4U6QA 3K5PA 4CMEA 3DOJA 4YYZA 5B4VA 1EK5A 2C5EA 3OEYA 4OXKA 2QYTA 4CLRA 1Y8RA 4CLDA 3EUWA 2Y1CA 3NYWA 2NVWA 2O2SA 2R2GA 3P7MA 1MG5A 4XR9A 5JW6A 3DO5A 3WMXA 2D5CA 1KETA 4OQZA 1E92A 2BFMA 1DIRA 4PLCA 4DTIA 4UEOA 2TMDA 2Q49A 3C7DB 2BELA 3FSRA 1YDEA 1R0SA 2Q2QA 2WEKA 3JQFC 4GI2A 1A7KA 3D4PA 1ZKMA 3W6UA 3ZWVA 2V6MA 5L3ZA 3ZWXA 2DC1A 2YHIB 3A28A 3VDRA 3DDNA 1VL8A 3ZWCA 3E1KA 4PLGA 4EZBA 1MP0A 1NVTA 1HXHA 2G0TA 4R1UA 4BV8A 4CMKA 4XJTA 3TOZA 3PZBA 1O8CA 1ADFA 5JLAA 4CV3A 1I0ZA 4CM4A 4DLBA 3CUKA 4XD2A 1EMDA 1GPJA 4Y8VA 1VSUA 2JHGA 4LISA 3WSVA 5JO0A 2Q4EA 2GRAA 3NX4A 3NUGA 1MC5A 1WP4A 2ZTUA 1C1DB 1C14A 1PIWA 3DZGA 3VPHA 1T24A 1C3VA 4LVUA 4DBVO 4A5OA 3RUEA 4DLLA 2Q46A 3HHPA 2YZ7A 4LMPA 1XDWA 4HNHA 9LDTA 1HETA 1LDMA 2J6IA 4MVJD 1YL6A 4G5HA 4JP3A 3NDRA 3BXXA 3R0IA 5JAQA 4TRRA 5TLSA 3ZV6A 2UVDA 5K6AA 1OC4A 3BTVA 1PJLA 1A7AA 2B0JA 4I5DA 3TL3A 1I8TA 3WLEA 5ER6A 3G49A 3JYOA 1ZCJA 5EINA 4AICA 4FOOA 2FZWA 4WNCA 3FWZA 1ZXLA 4NHEA 3Q3CA 3JQAA 3WIDA 4YRAA 3BMNA 4W9NA 3Q11A 3SJUA 2C20A 5JDCA 3E5MA 1GYQA 4PRLA 1A27A 3UCXA 1VJTA 3ZWNA 3STHA 2R6JA 1ZZEA 5TJ9A 4XIJA 4YAJA 3NT5A 3GZNA 4ZU3A 4II3A 5LDGA 4E2WA 3KEQA 5TC4A 4IMPA 4IPTA 4HX5A 4Y6SA 1NFQA 2OP1A 1P0FA 5G4KA 1ISFA 2W90A 2R00A 2X8LA 4MIOA 4UREA 2I5PO 3WX0A 4W7IA 3W8EA 5I8ZA 5I8WA 2GLXA 3D3WB 3L4SO 4INAA 2J3KA 5DULA 1AXGA 4BO9A 3L4BC 3E48A 4FJ2A 4IJVA 2BGMA 1J5PA 3UUWA 5HM8A 1VPDA 1I3LA 1H6CA 4R5MA 3W4JA 1DO8A 2JAHA 5KKAA 4D43A 5B4UA 3RVDA 5B1YA 5HWSA 3ASUA 4NR0A 1VM6A 4M86A 1A9YA 1T2AA 1XG5A 3ZDFA 5T67A 3GLQA 2PV7A 3RJ9A 3V1YA 4FBGA 3LQFA 2OUIA 3CMMA 2Y1EA 3BHJA 3E82A 4XQGA 2O23A 3CH6A 5CDSA 3CINA 3HB5X 1IZ9A 2EERA 3MJTA 4ALKA 4D41A 4XQCA 2Y1FA 3ZNPA 3UKOA 1GEEA 2RHCA 1UZNA 1L7DA 4II2A 4W6ZA 3G1TA 3MJSA 3UCEA 4CLEA 1V3UA 1HDRA 4D42A 3GNTA 3E18A 4EYEA 2VZ8A 1PSDA 3QVXA 4F46A 2Q99A 3DZBA 4OSPA 3WB9A 2EKQA 1E77A 3BMNB 3LT0A 3HE3A 5HA5A 1PQUA 3KSUA 2HRZA 3LT4A 3NT4A 3T7EA 4GX5A 4PLVA 3K30A 1HE3A 1F17A 3TZKA 1KVUA 4BNTA 4YPOA 3WIEA 3VPXA 1GEGA 2OBNA 5KVCA 1TXGA 4OOFA 3S2GA 1QP8A 3H5AA 5CAEA 3U5TA 3N7UA 3U4CA 4EITA 4KDEA 3DAPA 3F46A 2O50A 2ZATA 5T8KC 4RCVA 1C0KA 2NTVA 3IUSA 5G4KB 1HF3A 1HDXA 1GFSA 4A03A 1D1SA 3VVBA 1LTHR 4RVSA 1IB6A 3L0DA 4E2YA 2D1YA 1DAPA 3DTTA 4TVOA 5KJCA 4LSMA 3DHYA 3PHGA 2A92A 3H9UA 1JVSA 1XU7A 3OIGA 5CHEA 2VNSA 4FDAA 5DP2A 2J5RA 3U62A 5F1KA 4OMUA 3S2EA 1NQAO 4P4NA 5U9CA 5A3JA 1JQBA 3QIVA 4OQYA 1YL7A 4QO8A 2RBEA 2WSBA 1E0DA 2YDYA 2NVBA 5A02A 1Y81A 3DOOA 1V9LA 4RZIA 4J7XA 1Z45A 2C2YA 3B1JA 4YQYA 1F8GA 3F1KA 1AHHA 5I7EA 2D3TA 4DYVA 1EZ4A 1YOVA 2JL1A 4M8SA 1H2BA 3G79A 3JYQA 4IJUA 4J43A 4ND4A 1N1GA 4A7PA 4QTZA 3LT2A 2B35A 2YJZA 3GVIA 2YV1A 1PL8A 5A9TA 2E82A 3KBOA 3RFVA 2PGDA 1Z7EA 2NU7A 4ND1A 1V3TA 2H63A 1P74A 4WEOA 3C3XA 4KWIA 3RC7A 1TEHA 3DHNA 1JU9A 2WYWA 3HADA 4ONEA 2PKQP 4IINA 4GQAA 4BVAA 3PJGA 1GV0A 3GPDG 4WCDA 1GPDG 1LLCA 1TA4A 5IDQA 2PZJA 1QRRA 3O03A 4UUMA 4AFNA 3I9JA 1HRDA 2GDZA 3GUYA 5IDWA 3TOXA 4IQ8A 5A06A 5A5FA 3VPGA 2C82A 1ZK4A 3TN7A 3JQ9A 5BNTA 3R1IA 4CM9A 1UXKA 1KEWA 1G0NA 1ZSNA 4KQXA 4DPKA 2GZ1A 3HNPA 2OOSA 3NRCA 3I4CA 2EGHA 3DZFA 4WLNA 2AEMA 4BUCA 4BNVA 1LC3A 1K6IA 1Z6ZA 2V6BA 1P1IA 3GVXA 4Q3AA 2W4QA 5HS6A 8LDHA 4M87A 4G2NA 2DPHA 4NJMA 3BHIA 3FBTA 2G1UA 1Y8QA 1HYGA 3OJ0A 2DTEA 5CPFA 4YQZA 1UAGA 3F6YA 2C7GA 1WWKA 2EGGA 3ZU2A 1H6BA 5G0SA 1MXFA 2GPTA 5F5NA 3S55A 3ZU3A 3DBRB 3ZU5A 3GMDA 2PKRA 4CUJA 4YAKA 1ZW1A 1HT0A 2XPCA 3VZQA 3GAZA 2CF5A 3MEQA 4BNIA 1YOVB 2NLOA 5DN9A 3TWOA 2V6GA 3PTZA 3QWBA 3Q1LA 4K26A 1P77A 2IXBA 3VTFA 1DLJA 1D1TA 7ADHA 1PZGA 2B83A 4Q3EA 4IJKA 3IOYA 4CMIA 1NAHA 4FGSA 4GSKA 1OI7A 2GNAA 3PHIA 4WECA 1R16A 3PGXA 3FF4A 1U28A 5K0ZA 3JQGA 3VKUA 3H5RA 3JQDA 3FCOA 2FR0A 4QSMA 3DB2A 4BGIA 4RPHA 2Y0CA 2CVQA 3PDUA 1JKJA 1O9BA 6ADHA 1AGNA 1LNQA 1R0LA 4BNUA 5L45A 4YCAA 3FNHA 3L07A 2CZCA 5G0UA 3HDQA 2WDZA 4K6CA 4AJNA 4BKUA 1SOVA 1ZNQO 4UUOA 1ZK3A 2P5UA 4EUHA 3H3FA 5CDYA 3SLKA 3AM3A 4FFNA 3DBLA 2P5YA 2YY7A 4RVFA 4BGEA 4RPGA 1GUYA 1I30A 1HEUA 4UVIA 4DIOA 2B37A 1WZIA 2GN6A 2J5QA 4DIBA 3OIFA 1LDGA 2DTDA 2JCVA 4IQ0A 5JSFA 1N2SA 4KWHA 3UICA 1PGOA 4XZ3A 3AU8A 3TL2A 2GZ2A 2NSDA 4URFA 2NM0A 5HTOA 3DZKA 1T2FA 5A04A 3JQ6A 1M75A 4B4UA 3ZCXA 1ZMTA 1E7WA 1D4FA 1LU9A 3ZNQA 4J7CA 1PGJA 2B4QA 1B3RA 3H3JA 3OICA 2GUGA 3ZHXA 1IULA 3GH3A 2DKNA 2ZQZA 4K28A 2ZK7A 3EC7A 3PFWO 4FN4A 2GD1O 4JP2A 3K6JA 4NG5A 4NMHA 3G17A 1KYQA 1BXGA 3NGXA 3I6QA 4PCVA 3F3SA 3AUSA 3K92A 2BGLA 4HY3A 3D7LA 3WFIA 4BO7A 4QFDA 4CMIB 3VVCA 1NPDA 4QFCA 1V6AA 3Q9NA 5JCJA 4DRYA 3WGGA 1PEDA 1DPGA 1QYXA 2AG8A 1MXHA 3GRPA 2QZ9A 1Q0LA 3SC4A 4FGWA 1E6EA 1XELA 3R3SA 1I01A 2I3GA 4CJXA 1LLDA 1PGPA 1B8PA 2J3IA 1HDYA 1DRVA 5A9RA 1NWCA 1HDZA 3DWFA 2O3RA 4IIUA 4DMLA 4DYDA 3QJ5A 2FMUA 3O26A 4I1IA 5GZ3A 1VI2A 2HU2A 3V1UA 4FD3A 4D7AA 4P4GA 1KC1A 1KEVA 2HQ1A 1GYRA 2AQIA 3F9IA 4HWKA 4J4HA 3DC2A 2GF2A 1DJNA 3ROQA 4AJ2A 4I08A 4CL3A 4PG7A 5JE8A 4Q9NA 3EK2A 3I1JA 4Z3DA 2ILTA 3ROKA 1E3IA 1GCOA 4BKRA 4S3MA 4NBWA 3CSDA 3RUIA 2X86A 3PPIA 1HWYA 1E3WA 3GF4A 3ON5A 4HADA 2OZPA 1MUUA 2IEDA 2WYVA 4XR4A 1FDSA 1YGYA 3WQRA 4F45A 3JD1A 3BA1A 3TZQA 3ULKA 1LA2A 1QLJA 3F1LA 2QRLA 3ZV4A 3AJRA 5A05A 4WOKA 2VHZA 3EY4A 4HFRA 4WEQA 1E3EA 1B26A 3ICPA 4GKBA 3FN4A 2BMAA 1GUFA 3TNLA 1HZJA 2VHYA 4HKTA 4PLFA 3F4BA 1NFFA 4EEXA 5A4DA 3AFNA 4PG4A 4UUNA 2G76A 1BXGB 3OQ6A 1P1KA 1Z75A 4KUEA 5A5EA 2Y0DA 2B36A 4BNKA 4DQXA 4DQVA 3DAFA 1PX0A 2RCYA 1QKIA 2A9FA 4GVLA 3AM4A 4IDAA 5AYVA 3G3EA 1OC2A 4BKOA 3PI7A 1GCUA 4L4RA 1X15A 3TDKA 2FPGA 4FB5A 4B3HA 1PJBA 3GT0A 5BNIA 4FJ1A 1ZEJA 3ZZNA 2PKQO 5T6BA 3E6AA 3PLNA 4P4LA 2BHLA 3QE3A 4PG8A 2O3QA 3OA0A 4W9NC 5DCYA 1DSSG 1YQXA 4ILKA 2X23A 4A10A 5KVVA 4MVJI 4JIGA 2A94A 1KS9A 3GZ4A 5IDXA 3ANLA 4YDRA 2NVUB 4BNHA 4R9SA 2AMFA 4YT5A 4BS9A 4R5HA 4PLHA 1SCUA
chains in the Genus database with same CATH superfamily
3EGWA 5D87A 3BSYA 5T64A 3SEFA 2DJ5A 4PO3X 1Z8FA 2JFQA 3JWIA 3CGGA 4YJGA 1CF2O 2IYPA 3PSAA 1XJ0A 4INZA 4QXRA 4CTMA 1N5KA 4D9JA 1E96A 2XHZA 2K2QB 3L6UA 2OKGA 1O89A 4L9RA 1QV7A 2WE7A 3KSZO 3M6XA 4UDOA 4CCSA 3EPLA 1K8RA 1EJ2A 1WZ2A 1F2UB 2VJBA 3ND9A 4YMLA 1W4CA 1MTOA 1EFDN 1NUPA 3GMSA 1PT6A 3IDFA 4FBMA 4N5LA 4MV8A 5CLIA 2YWRA 5EP1A 3UUFA 5H4GA 4BNNA 1OBFO 2HTEA 4MVJG 3EOZA 5JMWA 2IS2A 1RMTA 1I51A 2IE0A 1XFDA 1MJFA 2HD4A 2ZRJA 3FUWA 1T0BA 2FSUA 2Q5EA 3RBVA 2IWHA 2WJYA 4DRZA 5AW6A 3IIJA 2QAGB 1G3RA 4TKUA 1EVZA 4PPQA 4FFOA 4YJKA 3N75A 2YQZA 3CRMA 3SQLA 3I9NA 1HI9A 1CDDA 1M8GA 3DF7A 2RHBA 2IHZA 3HCPA 3LQ1A 3QUBA 2HIAA 1H2HA 4XASA 2OC4A 2OM6A 3OCJA 4P33A 3PFKA 2DH6A 3CJTA 1YQTA 4HD8A 4XDYA 3KSBC 1M83A 1W85B 1UJ4A 5CH8A 5DNEA 1T8UA 3EWSA 1GCIA 2D62A 1NN0A 2UXCB 1EWYA 2DBRA 3S2IA 2D2EA 5CFMA 4PO9A 1VL2A 2JCXA 3JD0A 4LBZA 1L4LA 3OA2A 2DQSA 3IP7A 2YQ5A 4K7JA 2QIPA 1KKUA 4NL4H 4RA9B 4TSKA 5T7BA 3DNFA 3IVAA 3JRXA 4L2IB 2ZRPA 4QOIA 1XLUA 2IUFA 2WWYA 1OGJA 2CXQA 2ZDGA 3ENQA 4OCZA 2Q0XA 3ESBA 3CZQA 3OFJA 5HMMA 2OBYA 2BFAA 2QKYA 5EJ9A 2J3LA 1ISGA 2G17A 3K0AA 2H4HA 3LX4A 3M1YA 5FBHA 3IAS1 3KT8A 1BXRB 2X19A 2ZT6A 2B4TO 4FR5A 3V3TA 3NVKI 2EIXA 5AXDA 5KJ6A 4UVDA 2JFVA 3OCVA 1USVA 3MCUA 4H4EA 5JQWA 5BSFA 2OO5A 1C30B 2MINA 3HYTA 4PAGA 4BGVA 4JWKA 3NAQA 1QVRA 1T1GA 2AQHA 1MH1A 1T13A 2CHFA 2HV9A 5TGDA 3W5JA 2RKBA 4EGAA 1TADA 1XF9A 1IOLA 2GTHA 5TJHA 3VZSA 2IYFA 2ASVA 2J5KA 2OGTA 5J40A 2XDAA 5E7QA 4YJGB 3IILA 4ODIA 1H93A 4JYCA 1MQAA 2SCUA 3WLNA 3WA7A 3SFZA 3OKAA 1JT9A 1RI3A 3QW2A 1YK1A 4I3FA 4PE5B 5MDHA 2CLEB 3ZHRA 2WWTA 1K7YA 1X7XA 1NDUA 4RE5A 2ZLBA 3DMTA 1TTPB 2PGXA 2Q1XA 2VXCA 2DFKB 5DPMA 2OZLB 4B6FA 2E4VA 5I9MA 4R9UC 1UZMA 1G21E 3JSAA 5K3DA 3VNQA 1RZVA 2YZMA 4HDOB 1IN7A 1UJNA 4P7KA 2RGRA 1RKXA 4ENRA 3UPUA 1EXVA 4BB5A 4OEHA 4TKUB 4AF6A 1HMYA 3G8CA 3ZVRA 2EDCA 2XWSA 3UKJA 4Q1VA 4B8YA 2BI4A 1RI4A 3UT5B 4DQDA 1XAIA 1XYVA 4NCIA 3K15A 1B2RA 4I4CA 1CW2B 1TT5B 4TROA 3MOGA 1CYDA 3QWFA 5EIBD 1JKMA 1U0RA 1ZINA 2XNDA 2XUJA 1HL7A 1L1FA 2JAWA 4DFDA 5EJ4A 5IN5A 4CM5A 1EIWA 1E3JA 3L6EA 3EG5A 3LDFA 4G0VA 4FNGA 1EA7A 1U7XA 1P0MA 1U2TA 1YL5A 2Z56A 1W4ZA 3A7EA 5EMJA 621PA 3MC1A 5E8RA 3SK0A 3PEEA 2OPHA 4C0XA 3RT9A 2O07A 1AJEA 4IIJB 3D81A 3KXPA 4MCAA 5A3QA 4PN7A 4P3NA 4AL4A 2EU8A 4FEYA 3EXHA 5GM1A 4EATA 4B6SA 2EEZA 2R4QA 4D2IA 1LJ8A 2B5OA 1I4EB 2UDPA 1LI7A 3MGKA 1L7EA 3IKTA 3B1XA 1SBIA 2PY6A 3FMPB 3KE9A 4ESVA 3PLAE 3DEYX 1OLUA 3BKWA 1LF0A 4IJ5A 4F7WA 4NYMQ 1CEQA 1ZJZA 2R6ZA 3PI6A 4OLJA 4RD0A 2MTBA 4OL9A 4C0QC 2A3NA 2KM1A 1BW9A 4FYWA 2MJLA 2JI9A 3WGYA 1ABBA 2XAAA 2PZLA 4RVNA 3FPCA 2W2LA 4OXRA 3Q9UA 4IDDA 1OH8A 1P2UA 4PG5A 1IHYA 1SURA 2JK1A 3CISA 3CZRA 5EIAA 2TMKA 3WLLA 2AE2A 1G1MA 2G5TA 2VWHA 1NBOA 3PX3A 4JODA 3UHPA 1HDOA 2BM1A 5JH7F 3WGZA 4QAJA 1NU8A 3AINA 4GBGA 4JJIA 1J2UA 3H9QA 4Q4HB 5ERYA 4F4IA 5A4IS 2SCUB 4MQEA 3ZLBA 4DB4A 1RLUA 1U2GA 3QXXA 4HAYA 2X1LA 2O2GA 3EXIB 3L49A 3LECA 3MCZA 3OIDA 4HDSA 5HZGA 4DB2A 4AXXA 4KE9A 4NPCA 3FVRA 1X7XB 4MR8A 4BQEA 1OJLA 3ONWA 3BMOA 4HDMB 1Y8ZA 1SXQA 2I03A 2IW1A 3CVVA 1O5OA 3PLRA 3OLCX 4MW9A 3RUAA 5M2QA 4H77A 5F3DA 4N41A 2WHQA 2QMYA 3UTCA 1QDUA 2H3HA 2Z5LA 2ADOA 3EEIA 1UBSB 4OQ4A 2VHWA 4WNIA 4DPLA 1Z26A 3TQTA 2QZJA 3KEMA 4EA7A 1E1RD 4X44A 2KLBA 1UEJA 3DXYA 3IDSA 2QLJA 2N42A 3D8UA 1G7SA 3NKVA 4Q3BA 4PZAA 3IP6A 4IIDA 4WBNF 1FFEA 5E6RB 2WWVD 3VPFA 2XNJA 3W9UA 2G25A 4KO2S 1DEHA 4J3NA 2Y6VA 4HH3C 2JD1A 1I4OA 1DCMA 2OG1A 1TKAA 2NMVA 1V39A 2ES4A 3QLJA 4NV3A 4BB6A 1FJHA 3DNPA 5J23A 1YS1X 4I5IA 5FWDA 2YJ6A 4RHUA 4W5HA 4J0QA 4W99A 1VJCA 3DE7X 4AJPA 5EIBC 1GN8A 3RSHA 2I1QA 2DHEA 1JX6A 1RAFA 3O83A 4QREA 4HNSA 5J58A 1K75A 5AESA 2F7SA 2Q4BA 5LD2C 1KE1A 2GCNA 4XPIA 3ITKA 2GNPA 3O38A 3ZVKA 4XIYA 1N7GA 1KKMA 5I7WA 2PWBA 4BU1A 5IASA 1NVFA 4AI6A 1YDGA 3O21A 4KQFA 4YXWD 1OLUB 4IIXA 3RROA 4GYKA 3TTWA 3RQSA 1ZUD1 5A2QA 2VSNA 2Y66A 3DZHA 3LPDA 1BW9B 3LLSA 1PYGA 3K0BA 2N3ZA 3V80A 4F3TA 1N0WA 2W83A 3E9MA 3IIIA 4ZT5A 4BNJA 2FSHA 3RVNA 2Z2KA 1I36A 2PXAA 2HCFA 2VXBA 3C7CB 3NP7A 4DJEC 1BGVA 4I5EA 1G9SA 1VYVA 4N82A 5ANRB 3ACBA 4PG6A 1IDOA 1AGRA 1U3VA 5T5QA 2PKCA 4BBJA 3KQPA 1G20A 1ABFA 4MQEB 3TPZA 5KSYA 3C7AA 2X0JA 4TV8F 5E3HA 2Y0EA 4HDSB 4HTFA 2PX5A 3H83A 5JZVA 1NXQA 4QYWA 4MR8B 1K5PA 1N8KA 2FWAA 5EJ2A 3WJ1A 2PRKA 5DW0A 1VCOA 1T2EA 3BK7A 3DE1X 2QPLA 2B4YA 3PZRA 4HUQA 2WOJA 3ONEA 3G2MA 4NENA 5DHRA 3GFFA 1XCMA 2YC2C 1X1DA 1Y3BE 4AURA 2HOQA 2VCEA 2JGIA 4HEJA 4HO1X 4MW6A 2GEDA 2II6A 1XZQA 3A6DA 3GZNB 3U13A 2ZULA 3QMMA 5ALDA 5A03A 3UXYA 1V26A 1XVVA 2RG1A 1GPMA 2J9GA 3WWPA 3CVJA 3OM0A 2HDHA 3OT1B 3PUHA 3UJ8A 2CLHB 3UBMA 1BDBA 4PAMA 5HDQA 5LYYA 1FFDA 1D3AA 3TLAA 3RTBA 5C5EA 3H42B 1H5QA 3LKZA 4KREA 2BW0A 2FJPA 2I7DA 2NACA 1WMDA 3LGXA 8OHMA 1FDTA 1P6XA 3HBNA 2V7XA 2BOVA 1U2SA 4QE3A 3F67A 1X2BA 3DA8A 1WSAA 3DT6A 4MJ3A 5KIAA 1PLJA 2XXJA 1JE1A 3JQPA 4N5NA 5J4VA 2EIHA 3WMFA 2XEDA 2QX4A 3C8ZA 2VBIA 4B3XA 2V3CC 4UQOA 3W4KA 3N0RA 1ISSA 1AK9A 2IEBA 1VHTA 4WIAA 3TPFA 3P20A 3EEOA 3TK1A 3RIHA 1MB3A 4IW3B 4BMOB 2HMWA 3X1DA 3A10A 4YJ3A 1NBHA 1VLQA 2PS1A 2QUZA 2ZE6A 3UGKA 1IZZA 4AS2A 5JI3E 2YWBA 2R7LA 1YZVA 2N75A 2VAMA 3BFPA 5DWDA 3VX3A 5C5IA 1N0IA 3D2AA 5FLKA 3LP8A 4GF5A 3C39A 1SIBE 4XD7A 4D9KA 1IJEA 1JW9B 3GJ0A 3IP3A 5FORA 2IFTA 1EEHA 2JKVA 3FDJA 1C80A 1NSTA 3ZE9A 4MUBA 1RM0A 4ADSG 3AY7A 3JQFA 3KXKA 2XOKD 2OZVA 5AQ1A 2Q07A 1SXHA 2HADA 3HKDA 4L8VA 1WQ4A 2AN9A 3ZU6A 4X92A 2PBFA 2BFFB 3W2TA 3K2EA 5JCZA 4F21A 2XTMA 4MUFA 1ZX1A 4ZO9A 2GASA 3Q3HA 3JTMA 2FUG6 2WKQA 1LBHA 1EP3B 2P5TB 4DPMA 5L4LA 4KDCA 1GY8A 1N6NA 2EATA 3NNSA 5E9QA 5H81A 5TF0A 4ILEA 2VOJA 4XYGA 1E79D 2AKEA 1BKDR 4RQBA 4EL0A 1E3LA 3BVPA 1RWNA 7REQB 4IHJB 3DLIA 1DX6A 2QRUA 2XODA 1GIAA 2POQX 4DLKA 4Q0MA 4GEGA 3CLKA 4HUQB 1XJCA 1PJRA 3KLNA 2DQYA 3FOFC 10MHA 1LTKA 1K2WA 1UJMA 5CAEB 5FUWA 1YR9A 3TLMA 4YX9A 2W8ZA 4CN9A 2M98A 2QZPA 3SHWA 4E30A 1LLFA 4E03A 2IE8A 5JCXA 4FGJA 2IGBA 3BTSA 2NOAA 1DG1G 1MR3F 3HWX1 1Z4LA 1TFUA 5KINB 2GLTA 3F8SA 4XDZA 3FR7A 2MSCB 3GNSA 3K0CC 3NHBA 5IVDA 2JH3A 2GJSA 3ENKA 1F6WA 1Q77A 2C77A 4Y6GB 5HF6A 5IT0A 4NDNE 4A0GA 5GONF 1OFUX 3NWEA 2A0XA 4ZGWA 3SLGA 2FRDA 4KV9A 1JTFA 2ZUSA 3WNVA 4FFLA 2Y1XA 4C1NA 1ONPA 1EPUA 1OKKD 4MWOA 3SWWA 3UJBA 1KK0A 4BV9A 3LUFA 2VJMA 3BEDA 4BBZA 3T5MA 2CYBA 4OB6A 5EE3A 3WJ7A 1N92A 2A5JA 4E1AA 3VR4H 1W0KA 3BGOS 3EDMA 5EIWA 4C7OA 2EX4A 3FWHA 1T4GA 1JG6A 2PQMA 4PX9A 4WJZA 1DVRA 3IT2A 1VIYA 4UHJA 1RWKA 4QU0A 4FDLA 2I4OA 3V8NA 4Q3CA 5LJLA 2O8CA 2HSZA 4JL6A 4YJ3B 1IUKA 2P90A 4BNYA 4MS3A 5BT9A 1CUJA 1PV1A 4OH7A 3QFCA 1ZCZA 3GLUA 4DMHA 4NK5A 2CDNA 5IDVA 5LMCA 3WK4A 5JVDA 4CR7A 2IP4A 3U7IA 3D2LA 5F98A 1P6UA 3JR3A 3TRDA 1KRWA 1PKXA 2Y6UA 3M3DA 1MHPA 2D8MA 3F5MA 1BTOA 1PUIA 1IAVA 3UWMA 2G71A 4XUGB 2IZ7A 5KOYA 2OC9A 2ZBDA 4TQGA 4RQTA 3TKYA 2ZTSA 3A2LA 1E2KA 1X7GA 1L5SA 3I12A 3LOUA 3OCUA 4YCCA 4UMDA 1MABA 4YHHB 2GHRA 1TO6A 3LUHA 2PWZA 3HRHA 1TW2A 2MYPA 4D80A 3ER9A 2I8LA 2PGIA 1I1OA 1P75A 2WJPA 3I37X 5H80A 2UYCA 4MCIA 5CDTA 4L5AA 3CPJB 2I2CA 4KQ9A 2MR5A 2PSFA 4NOMA 3TZLA 4B7AA 4DCTA 5A3VA 1C7IA 1VE1A 1RRVA 3KJHA 3PUWA 3QF4A 3IAFA 4ZCIA 4DQUA 2BIFA 4N1AA 4RZUA 2W6OA 2GOYA 3AERA 4EA9A 3PQEA 3ZS8A 4U3JB 3R4CA 4AF7A 2WD7A 1M33A 3NC0C 4KAXA 5ARCA 3M34A 2BZGA 1U1IA 2G4CA 2G3YA 5AJWA 4LDJA 4YCLA 1U2RA 3F73A 4I6GA 3EWNA 1CYEA 3BCSA 5AKZA 1SCKA 3K9HA 4LYDA 3RABA 2UZ4A 1T0JB 1VJRA 1ZHFA 2VEOA 4GVXA 3U49A 1KQPA 3KHSA 4NJMB 4RQAA 4WLOA 4DRXA 4DMCA 3N8KA 2PIDA 2HCJB 1QSGA 4Q4DA 1HZZC 3K9WA 5JZ9A 4MW2A 4RO0A 1CC1S 1QYVA 4GI3A 4YECA 1E58A 2VJMB 3THOA 4ZCPA 4OK5A 5BMVA 1CCWA 2G9VA 3QU5A 4A16A 1PUJA 3EODA 5LP6F 3C6MA 1AV7A 4YAIA 3VV2A 2XR1A 2CL0X 4U4AA 5CDUA 2G0AA 1H1TA 4H1VA 1FYFA 2OSVA 2VZ9A 4C5BA 4R71A 4PXYA 5I6DA 1OFTA 3CNLA 4KI0A 3Q98A 2CEKA 1D4ZA 2W93A 2VJYA 3ADDA 2GVZC 4ALJA 4CN8A 3RRJA 2FWRA 2OD7A 4N54A 3T8YA 1EUDA 1YQQA 2VPIA 2VP2A 4LY0A 1IEWA 1VLVA 2H2HA 3PKIA 5JVDB 3S4YA 3PJRA 4HUJA 3IUPA 3UC9A 1AXRA 3UM9A 4C88A 1Q0SA 1GYPA 2PWYA 3I28A 3VV3A 2ABWA 5EZYF 2G28A 4F1KA 2AXNA 3GDHA 4F38A 1DKOA 2OUKA 2H65A 4AIRA 2R86A 4XM1A 1W59A 4CUKA 2X7JA 3NRJA 5NLLA 4MA0A 3JQBC 4V0QA 4AVYA 3DQPA 2IYOA 3L1KA 4H59A 4DV5B 1KA9H 1JKJB 4DL9A 2P6UA 3D6FA 4XXHA 5HF9A 1GTL1 2FP3A 4ARAA 1KMHA 2FW7A 2QNBA 3BFJA 5BR7A 2BFBA 1CZKA 1R0BA 1U7HA 3JAWA 4LC9A 1E2IA 2GWRA 4DXDA 4EO7A 2J45A 3I52A 4IIHA 1H9AA 1ZVMA 2BM9A 1XR3A 4B7CA 1QCZA 1PNQA 3S2YA 2YJ3A 3M4XA 1R18A 1OFUA 4ME6A 4X6XA 1G3MA 4CHTA 1TVMA 3DBLB 5ITVA 4I81A 2B4RO 3ZPXA 5JRJA 1Y6FA 2H0QA 1CY0A 3MCVA 3GJ4A 3AERB 1LDYA 4Q7LA 2C84A 4U7WA 5DMXA 1ISMA 4MS4B 2WD7B 3MM4A 1XLVA 4HWTA 1LBQA 2Q4RA 2IT1A 2OVBA 5DJ5A 1B8OA 1ORWA 1YJQA 4K8OA 4XSGA 4Z7QB 1DIHA 4EQ6B 3RPEA 3PPYA 4HS4A 4FE4A 2H11A 2HL6A 2QTCA 3TE7A 3UH0A 1TYCA 4FI3F 5AJTA 5AK6A 3BG5A 4UE6A 1AUPA 4W7HA 2HBQA 2FQYA 4WLUA 4XQ9A 2R60A 2JG3A 2I6SA 1OBVA 2HUNA 4LUCA 5A4AA 3E0QA 2QRVB 4CEIA 5DNUA 1BVYF 2NADA 2QP4A 3IKLA 4RIEA 4QBFA 3C43A 2IYVA 2V03A 2MSLA 1A7JA 3OQMA 3MINB 2HIGA 2B8EA 3M33A 1KNXA 4TLBA 5WRFA 4KR9A 2JLSA 2ZM5A 4LVCA 1Q0TA 4J94A 2WM3A 3ROEA 1MX1A 5IDYA 3OX1A 4WDRA 2DWUA 4ALIA 1ZH8A 2B8NA 3ZQJA 4B6JA 1NBMA 2G1PA 1F7UA 1DLIA 2P7HA 1TI7A 2V5AA 4IH1A 3O73A 3R76A 1E5TA 1NR1A 3W5VA 1QDEA 1QE5A 1RKUA 3CE6A 2C88A 3EQ2A 4I1PA 2O0KA 2QPOA 2BTEA 2X3YA 1ATZA 3BWYA 2P9JA 1YMQA 5K6AC 1OXMA 5HQTA 2Q5QA 4IAOA 3F9CA 5JS2A 3C5VA 2YRXA 5D5HA 4N9QA 4YY3B 4MIYA 1XHLA 2DPLA 1JLHA 4B0OA 4CW7A 4PQEA 4V24A 1PL6A 3G5MA 4FIZA 2IZ5A 2QYOA 2YIMA 5KYYA 1ZD2P 3GLIE 3HCRA 1F2DA 3B52X 4Q12A 4EUSA 1GAEO 4M0CA 3F7TA 4G24A 4QWWA 4FS3A 1D2HA 3IAS6 13PKA 3DDZX 1TZCA 3JAWB 2BM0A 3W6PA 3RC2A 3I8OA 5JDCC 1AM4D 1EWRA 2OCDA 3OM8A 3WAKA 5TQ0A 4CU2A 1W75A 4TTTS 1JWBB 3E03A 1I6KA 2OWEA 1IHXA 3BIWA 4MUIA 4QAQA 4RPLA 5U4XA 3ODPA 2JI8A 1E1YA 1N75A 2B1IA 1VBNA 4HPXB 2O8DA 2NT3A 1U8UA 4H7KA 3A6PC 1OYVA 2EBHX 1V0JA 2OXIA 1NVGA 3MBOA 2E5WA 2ERXA 4YO7A 5HQ3B 2TS1A 1J33A 1JB9A 4HAUA 1Y6GA 4DJAA 4ENTA 4P5EA 3ZV3A 2A57A 1RAEA 1W6UA 3BHMA 2C3YA 3C7TA 3GRFA 3M4NA 5E2AA 1PGNA 3UW3A 2O7QA 1NURA 1NTRA 4QYXA 5CT5A 3K7EA 1ND5A 1R6DA 2HF9A 5AK0A 1D1QA 4AJHA 3KM0A 2AFIE 3TW8A 2O6HA 4YMHA 4OU4A 4MVJM 3REQA 1E7QA 4UHKA 4XYBA 1KY5A 1O4VA 5DO9A 4BYMA 4EFDA 1R5NA 1Z5NA 1JTVA 3BF8A 4JR2A 4PZUA 5EGSA 5LZ8A 3N2YA 5BSUA 2OY0A 3SS8A 1PRYA 4EHIA 5BSWA 4CEIB 1JQKA 1XVTA 5DHFA 4CEJA 4X00A 2C96A 2WHRA 3A9SA 4Y30A 4B3SB 1E1NA 1OXUA 4OP1A 3USZA 1KF0A 1V43A 4LJLA 2V98A 1XEAA 4N3NA 2RGBA 3H65A 5KC8A 4RPCA 3K1YA 3S29A 1KJIA 4F04A 4F4UA 4OQFA 4BQSA 1NQOA 4PGFA 4ZOEA 4P3PA 4FYPA 5DH9A 4KG7A 4LW8A 1ADBA 3CLRD 5BSGA 4INJA 1S2OA 5F12A 4BQIA 2X0NA 3DF9A 1MOSA 4UEJA 4DQLA 2JI4A 4JBHA 1XQVA 4RVUA 1GDDA 3LY9A 3WBFA 1UODA 3B1ZA 4FDMA 2P2NA 5DYGA 4BCDA 3VU9A 3D5EA 3BWCA 3H7AA 5FQOA 3HJFA 4JSYA 1N3LA 2DY1A 4R8RA 2IA5A 3SZMA 4KO8A 2Q27A 3QXJA 4RVGA 4D3FA 4E4RA 3M81A 2ZROA 3ODGA 4WL0A 4ZCTA 1Z8NA 5JHHB 2GT1A 5KNBD 1HQCA 4XH9B 1YVPA 1PNTA 2OV3A 3TM4A 2VHUA 3PNOA 1ZN2A 5HIKA 1YQ9A 3R9KA 4B9AA 1ZOPA 5CT8A 5ILQA 5HUQA 3QWHA 1N2CA 3UZUA 2NZYA 3N2GA 3C74A 4V02A 1YTUA 2FCAA 2I29A 1Q50A 1Z7BA 4D8XA 1U6JA 1JH9A 4C7OB 4Q3LA 4CM9D 4L4UA 2NZJA 1R6BX 3M5DA 4RA6A 5KAPA 2ZT7A 5TQ0B 4ALNA 2YYSA 2X3FA 3GJYA 4AUKA 1KDOA 4H08A 4NNJA 3RADC 5LWHA 4X64B 2AMLA 4CQMD 2Q6KA 2GZAA 1C1DA 2X5JO 3FPEA 4ZDJA 2RI1A 4D4LA 3CNBA 3H5NA 4HT3B 4G65A 3N8GA 5IEJA 3O4JA 1E2HA 3PFBA 1E3DA 3FHTA 2GFHA 4IUCS 4J6FA 2ZI4A 1Y5IA 3AK4A 4FMBB 5EIEA 4GL2A 3H97A 2A67A 3A3PA 4FYHA 4HYYA 2YCBA 4BQPA 4YR9A 1W88A 2JGJA 1JLSA 3UVEA 1CUVA 5K7SA 5LKRA 1NKTA 4JXXA 3D8NA 3REQB 4G09A 4CKBA 2XKKA 4RXMA 1U7ZA 1JBKA 1ZJ4A 1G20E 2J0VA 1PR4A 3BYZA 5KYKA 3DOCA 3A3KA 3KJQA 2UKDA 4Y0AA 3C3JA 2EARA 3TLBA 3FCUB 3O8OA 1P2TA 5H3LA 4CEJB 3KKKA 1C3OA 1UDWA 2FQXA 5H82A 1I5EA 3VSBA 4EJ0A 3QFFA 4YT2A 3NC4A 4TTAA 1R66A 3IP8A 4EFKA 5HX7A 3WK6A 1P5FA 4B3CA 2BEUB 4A27A 1XTUA 3C14C 4FFPA 1V8FA 3JS5A 4CM3A 5JWHA 2PVSA 4ZCRA 1DXOA 4I46A 3T7TA 3FGZA 4HATA 4X84A 4FMDF 3EJ6A 4YCBA 1DJMA 2FE1A 1ZOIA 4RPIA 3UXHA 4EARA 3WE7A 4HEQA 2VDMB 1D6SA 1HT1E 1ZSYA 2ODNA 2PFGA 3A6LA 4PTZA 4WI1A 4AUEA 4E12A 4X91A 3G1UA 1ENOA 3HEAA 4YJDA 3V7NA 3Q4GA 4B7XA 1K8ZB 1CIPA 4D25A 2G5GX 3CLRC 1YQUA 2P9EA 2XE4A 2PK3A 1M2WA 3BWDD 4O2AA 1SVNA 1BDMA 1DEKA 2VQDA 4E32A 1M6EX 4BO6A 5L95A 1QBKC 1HUQA 2NZVG 2ZYIA 3I1YA 1J8YF 2CYAA 3LQYA 4IJ6A 1NLFA 1T2DA 4K5QA 3LX6A 3CBGA 4MQ5A 2OVFA 3VR6H 1M72A 3Q3VA 3NEPX 4B3RB 4YMTA 4CG1A 3NOVA 4N8SA 8ATCA 1C0IA 1CR4A 3U6KA 1LRLA 2CZQA 4TM8A 2IL1A 4QUKA 4WXMA 1USUA 3V55A 1N2CB 1IZ0A 1RQRA 3N2GB 1ISIA 5LYJA 3K9FC 2FQQA 4DV6B 1XKTA 2YDXA 2IYWA 3WR5A 3A9WA 1S2LA 4M1MA 1C50A 3TG8A 2VS1A 2J3EA 4EG3A 1CR6A 4NBVA 4M60A 2EP7A 4RA6B 5GPBA 1WEKA 1IEXA 1O3YA 1NVKA 1OYYA 5K05A 4MMXB 1GAXA 1FLAA 5B53A 1I5OA 5FI1B 3LK7A 2QLLA 4ACAA 4HR7A 1JS1X 1NYTA 2C4WA 3WSWA 2CT8A 3H2KA 5K4HA 3UANA 4EH1A 3R7AA 2QU7A 4DIEA 1NI4A 3AHCA 4WK4B 2YZGA 2H08A 1JAXA 5LQRA 4CIDA 2FNAA 3LLUA 1VE7A 2C1XA 4X3CA 3OM1A 1JHVA 1W88B 1YJXA 1SBYA 1SOWA 3VYSB 1H2ZA 3NAGA 4XYLA 1MB4A 2PG3A 3QRWA 3ENVA 1COZA 4M55A 3TTVA 1ZD9A 2NAPA 4PHHA 3K9QO 5TGTA 3L6OO 5I01A 3DVLA 1AKMA 1UOPA 2Z9CA 1MQ8B 1YB7A 2LDBA 2DQ4A 3H8SA 4D4HA 1W36B 5IAGA 1O87A 2DHDA 1BEZA 1CUEA 3I3OA 3O8OB 1P9WA 4L3WA 1C3OB 1N6RA 2B2NA 4I55F 1EG2A 5IULC 1VA5A 2J67A 3D7NA 5CLFA 1VLMA 5L9AA 4DWOA 1KMCA 1KAGA 1KKLA 1SZCA 3NTOA 3E9DA 4H60A 3SPXA 4O2BA 3W5SA 3WQSB 1CWUA 2JGLA 4ID3A 3VDNB 1EDZA 3EGDB 4HQ6A 3CR8A 4JVSB 1YZYA 2EFYA 3W8FA 1VC2A 2W6ID 2HQSA 1G55A 1RC0A 1QG0A 2FG7C 3CNOA 5KS2A 4UU8A 1E61A 2ERCA 2FWBA 5JCJD 5KUTA 4QUDA 4QXQA 4DJ5X 2ZYAA 3QELA 3MOIA 3R7DA 4OU5A 1BIFA 4IFBA 4GLOA 1P7YA 4ZRNA 2FDRA 3GGGA 3UMGA 2GD2A 5JAOA 5KZMB 4OLHA 5LC1A 3A37A 2PL3A 3FHCB 3L92A 4WV3A 5DHUA 4A6PA 1VB5A 4L9WA 2VDQB 5L7TA 4XVQA 2ZRBA 5IARA 4FYVA 2SKEA 2ICAA 4E2XA 2ZJ5A 2R6FA 3BOSA 3ZLTA 1S8AA 3BMCB 2F6RA 3V8QA 5LQMA 4LJSA 4NZZA 1Q7CA 2IEGA 4M1WA 4ZRMA 4BFCA 4IP0A 1YMUA 2GCGA 3JQEA 1L4NA 1RYYA 4Y1FA 2NWQA 2PD4A 1FVOA 1EJ6A 3GP3A 2Q3BA 5C8DA 3IEVA 1P5ZB 3TAHA 5GTDA 2QROA 1KQNA 4FHZA 4MGKR 4R6XA 5DASA 3X2FA 1AN9A 3AUAA 4Q3KA 2CFCA 5J2TF 1PJAA 2VT3A 4B3IA 4P38A 3MRTA 3ZUGA 3C6KA 1P2SA 4D6YA 1HMPA 1C2YA 3HZRA 1FK8A 3MNFA 1SD2A 3RS9A 1PWXA 3DHEA 3A6KA 3JW8A 1W4BA 1MVOA 2PQ2A 1UOOA 2CLSA 1ML4A 3FI9A 3SKVA 5AVQA 1F8FA 5DGIA 1KO4A 3ZW7A 3TF5A 1GKYA 1U1GA 3PNVA 2Q1UA 4WK2B 1CTQA 1MW9X 1QM5A 1LS6A 4CTKA 3LBHA 2CNDA 4C06A 3RG2A 1OV6A 3PJDA 1XQ1A 4OIMA 5AKEA 2WWXA 1LW7A 5K3FA 2V0NA 1WZNA 3QJYA 1ONBA 3ELDA 3LC7O 1FDUA 1YMVA 3KD3A 4UM5A 3H2JA 1WCXA 1UMBA 2BZ1A 2FMFA 4M21A 4OREX 5HIJA 4JGIA 4QGBA 1K2VN 1BMFD 2JVIA 1E8MA 2ORIA 4FILA 1OFIA 2O3UA 4JEHA 2YHSA 3HP7A 2X0FA 4DLNA 1NU6A 3WRYC 3JVIA 3JYHA 2MOKA 3TLJA 1I7NA 1N5RA 1XALA 2J07A 1DU4A 4JASB 4EF6A 4FPXA 1ICIA 1UBFA 2HYIC 4JBYA 3NV9A 3SNHA 5I7AA 3COSA 1ODTC 5AM3A 4ND6A 3HYCA 1AHPA 5ITZB 3C5WP 3HCNA 4XKJA 5EC8A 4N7JA 5A4FS 2BHSA 5LBUA 1YI8A 2JGKA 5ALQA 2Z2JA 1P4RA 2FEPA 3H2ZA 4LWPA 3RSFA 2FGKA 3QELB 1KE2A 4U0JA 4B83A 2GCIA 2F8LA 2VO1A 1M0SA 4OM8A 2AEEA 1NA5A 4JLWA 1JFVA 4C43A 3FRHA 5H3HA 3D7KA 1G41A 1RYEA 3RYCA 2OCIA 4DM7A 3BL8A 4JB2A 5DBOA 3UAVA 3HO8A 1OZFA 4IBOA 3B1VA 3J7TA 4H7JA 3NMUF 2Z0MA 5EIXA 4IDCA 3TCNA 3W2HA 3P19A 4G4SP 1H6AA 1T5OA 4XARA 5I3CA 3PQFA 4B43A 3WICA 1D7OA 1VYUA 1T2UA 2PQ0A 4NBKA 3UMMA 3HSKA 2IYXA 2ZQYA 1C4OA 4E22A 5FBWB 4N4AA 3ZWKA 2Q4DA 3AWIA 4IV8A 5CBPA 3P0FA 4Y2XA 1MLDA 3BD8A 2W6JA 1DIGA 1MW8X 3NAMA 2IKQA 2H0RA 1QH0A 3FD8A 2X22A 1N5MA 3GVHA 4ZXFA 2D6FA 1RCTE 5JASA 3LUJA 4GLLA 4LXIA 3ANNA 3PHHA 2EF1A 1AHIA 2LVBA 2FFJA 2RE8A 4QM6A 3IVMA 5L4NA 5BNZA 3KDSE 1ADGA 3WKBA 2EDAA 4IGKA 3EZ6A 2VYND 3D3KA 3X1WA 3DT8A 1F3LA 3I6IA 2OQIA 4UASA 4DG5A 2BONA 3KLPX 4WY5A 3WGTA 3CONA 1YRAA 3I6ZA 3T3DA 2PBZA 3HPQA 1E2NA 3ZYZA 1YZ3A 1X2EA 1QJCA 4HYEA 1UMBB 2H1SA 4IOMA 4KAAA 3Q72A 4EY4A 4F6RB 4JT2A 5CEJA 2RHLA 3TJZA 2WWRA 1TC1A 3AXTA 3CFYA 2EF0A 2MU1A 3GBSA 3JQ7B 4RJKA 3UTDA 3ZD7A 2PZEA 3S2FA 2P9YA 3OO1A 2XDYA 5AKLA 2FPXA 2AI1A 3C5EA 2QW0X 3UFXB 5FPTA 2IBSA 3A06A 2VKTA 1Z5GA 3WL3A 4LOJA 3JVEA 4IDPA 5CNMA 4YRCA 1UKBA 4OM7A 4Q05A 3BH0A 2JFHA 4H0NA 3NOXA 1NYQA 4J3FA 3W5IA 1OGYA 3AI3A 1SC6A 3CEHA 1KYIA 2OFOA 1KRXA 2G72A 3PHBE 4M76B 3VR1A 2IS1A 4TMVA 4EF5A 3A36A 4X7RA 1H2AS 4E11A 4OHVA 4PO8A 5IT5A 4CQJA 2V9ZA 3EW7A 2PWPA 5KEIA 5GJVC 5JXJA 4H7HA 3D54D 4QRDA 3VHRA 1XROA 2N9UA 3FZYA 4NY1A 5ALEA 3UYKA 5J47A 3RYCB 2R87A 3K9GA 1R4NB 1JRLA 1TJNA 2C9MA 2ZRIA 1QO0A 4LMRA 3NIBA 2VJCA 4M3NA 4E3WA 2JNWA 3MAGA 4NFLA 3E3OA 3CZ4A 2HK9A 1NVVR 3IP5A 3UK7A 1IAQA 5AM1A 3J80A 2NUPA 2I8CA 2YYYA 3GFGA 1N6IA 5FQNA 4NBRA 1UJ6A 2Q0SA 3GH1A 4IO0A 3SGLA 4D98A 4EABA 6GPBA 1TF7A 4PBRA 4G26A 1QG6A 4YJ2A 1E5LA 3HA5A 3L9XA 4M9CA 3ZJYA 4NFSA 5CBPB 1NBME 3IS3A 2H0AA 2PLRA 3THYA 1PAUA 1RS0A 5HBGA 2V6JA 3PRJA 3RK1A 1C0PA 4KUHA 2YN2A 1V71A 5FTKA 4Q18A 3LA8A 1CQIB 3ZG6A 2G0NA 1UBKS 2WHPA 3FBGA 3E22B 3PVSA 4KQGA 5K8CA 3F0TA 4UEKA 4UNNA 5C3MA 2I3AA 5DHQA 1COWD 1OLSA 3JQ8A 1M0TA 4NZPA 1WV0A 1V48A 1FCJA 1KEKA 1UUFA 5KYUA 2JLXA 3EW9A 1TQDA 4QEDA 3EGCA 3RSLA 1B8UA 3BULA 3RSOA 4A8TA 1BC5A 1ADYA 4WJLA 5FO1A 3ANSA 2R11A 1KBQA 5D2CA 2OBBA 2O1EA 1U0NA 4URZR 5FJIA 1L7BA 3IDQA 2Q5IA 2CSUA 3C8DA 2IY7A 5DWQA 5BSEA 5FPHA 4F5YA 2C2GA 2YWDA 1HE5A 4D9HA 3EEQA 1ESZA 1ZGAA 2E48A 1WY7A 3MBIA 4J4BA 5CTAA 1W46A 1K6EA 1MF7A 3V4OA 1F2TA 3ZHZA 5AW1A 5F3RA 3MT8A 3ETJA 4C6SA 1GQ2A 4P83A 2GJ9A 4HFMA 2YXBA 1U8FO 3ESCA 1A5ZA 3STYA 2ZAOA 3UUEA 1D8TA 2WAOA 3O4FA 4I36A 1KP9A 2RKWA 2A2ZA 4I1SA 3PDJA 4JSRA 4JU8A 4I9NA 2XUHA 5DE3A 2K87A 4ZCMA 5BYBA 2QQGA 4ZYZA 2NUTB 1OYWA 2X1VA 5E1BA 4WUVA 3TSYA 3O94A 1Q1EA 1FL9A 1NVXQ 2R66A 4JLSA 1DC3A 1SVMA 2CVPA 4R4JA 2Q41A 4HZIA 4IDGA 4NCNA 1X1AA 1A72A 1H3NA 2H4ZA 2NQ8A 2PUHA 2WSMA 4RHFA 2R8OA 3GIWA 5F76A 1WW3A 5FH9A 5MN5A 1EVQA 1KFCB 1GL9B 2BCEA 1BAPA 3NZEA 3PYXA 2IHVA 5EESA 1AT1A 1RLMA 3I9OA 1RD4A 3COVA 3NP9A 4PVDA 4ZVRA 2QF7A 5CXQA 5HKOA 1M2HA 2VR1A 1GD1O 2ZYVX 1IHOA 4ZA2A 3D7RA 2WBLC 4FHFA 2JKZA 3OQBA 2NW6A 2E49A 4HEA1 1J20A 3FBWA 4N8EA 4PLZA 1Z5VA 2AXQA 2J9YB 2P6PA 2ZE7A 4YJ2B 3FPAA 4YP5A 1Z4MA 1Y5RA 3FHJA 1YVRA 4HH1A 4MRSA 1WCV1 4GRAA 3HQ4O 3EVFA 4NS1A 4QBGB 2IK8A 4ZICA 4XRGA 3THYB 4YXFA 1WXXA 2ZTLA 2H1FA 1TCUA 1P61B 1X39A 1XWIA 2FEMA 3VC3A 1RZRD 2D0DA 1YB1A 1Z07A 3MSXA 4RVCA 4RHCA 2XRZA 1YJ5A 2WHPB 1BFUA 4ETNA 4Z1MD 3T35A 3RTAA 5ITWA 5FI5A 5GP1A 4MGIR 1OLSB 2NQTA 3JQ8B 2O2HA 1WLSA 1SXJA 2YVLA 3PC2A 3RDPA 5FEUA 5IXJA 3FNGA 5T57A 2V3VA 4I4TF 4RLFA 4BMDA 3KOWA 2RGNC 1ST2A 4GMGA 5ADVA 1IXYA 2OE2A 2W9XA 2XV1A 1OZGA 1TU3A 1DMSA 3INGA 3KKOA 4YIHA 2VRBA 5ER9A 1M2KA 4CT0A 3DMTC 2MSDB 1IVYA 2FMHA 4UZEA 2XDQB 1WHTA 4NXNB 1T36A 2CDRA 5LA6F 2HLHA 4NBTA 1XMOB 2FR8A 3VAAA 5LWQA 5CLLA 1N9GA 4Q1DA 3RU7A 2Q3EA 3JZIA 4M36A 3GLHA 4MQLA 4WLEA 1WDKA 3FAZA 5J5VA 1F2TB 1R5OA 4B6QA 2GM3A 3INYA 3SZLA 3T7IA 3HYNA 1U8CB 2J6HA 4MKXA 3UQZA 2QD4A 5IBCA 2WF9A 1CQWA 1KVSA 2BUAA 2QTVA 1C8KA 1Z2CA 2JA1A 4IKEA 5CYOA 4GE0A 1RYDA 4NMXB 2D1QA 4RIGA 1WZCA 2GZ3A 3CZPA 2NVUA 3KR2A 4UULA 5K0LA 4D3DA 4P1ZA 1JVBA 3QI7A 3FFBA 2Q62A 2JGNA 2VSQA 4NYJR 3FNFA 4QXAA 3U4HA 1U31A 2BN4A 1WAMA 5EKUA 5IVKA 2WF8A 3A1SA 4C89A 4D9NA 3T7DA 1UC5B 3AEYA 4D46A 3GEHA 3DULA 1C4WA 1VHWA 3R3UA 2A3RA 1Q1QA 1L6RA 3EXHC 3STTA 2VK2A 4FQ8A 3AU9A 4RDIA 1IONA 5FBLB 3SR4A 2ONJA 4BJ6A 3WIVA 2I1LA 4RD1A 3KJZA 4J91A 1AQUA 2FE4A 2QJRA 4G4SO 3BWVA 4KQMA 3PC8A 2PSJA 1UBMS 4JV5B 1UKZA