5DP1A

Crystal structure of curk enoyl reductase
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
332
structure length
332
Chain Sequence
b'DQPVQLKLSEYGVIDNLNWQPMQRKTPLANEVEIEVAAVGLNFRDVLNALGLLKDYYAEHFNITSAEQLTFGFECAGKISAVGEQVSQWQVGDEVIGLLLHDGLSSFITTSVEYVVAKPKQMSFSEAATLPLTFLTAQYGLQHLAKIQPGERVLIHAAAGGVGQAAVQIAQVAGAEIFATASPSKWEFLQSLGIKHIMNSRTLDFAEEIMKRTAGEGVDVVLNSLNGEYIPQSLAVLTPKGRFVEIGKIGIWEKEQVKEKRPDVSYFPFDLQEAVQQQPGLIGQLSEELTQQWNQGKLKALPHKVFPSTEITAAFRYMQQAKHVGKVVVSMP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CurK
publication title Structural Basis for Cyclopropanation by a Unique Enoyl-Acyl Carrier Protein Reductase.
pubmed doi rcsb
source organism Moorea producens 3l
molecule tags Oxidoreductase
total genus 104
structure length 332
sequence length 332
ec nomenclature
pdb deposition date 2015-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5dp1A02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 5dp1A01
2GERA 3IKVA 1V3TA 2I66A 2YDYA 2EKPA 1NPTO 4CM8A 1ZXBA 3SJ7A 4R1NA 3W8DA 2J3JA 5FYDA 4BVAA 2P9EA 1LI4A 2D2IA 2OGUA 4R54A 2JD0A 3DHNA 2J3KA 3DAPA 4W7HA 3WGGA 2V65A 3EMKA 3IJRA 2ZTLA 3DMYA 3NEPX 5JMPA 5TX7A 1Z82A 3ASVA 2C0CA 4LMPA 3TJRA 1U9JA 3BIOA 5COAA 1Y9AA 2AQ8A 4OJNA 4Q3DA 4NU5A 1MC4A 2AMFA 2VRCA 1GUYA 4E5MA 4RJTA 4J9VA 4E5YA 4E2WA 4CM3A 2DFVA 1V8BA 3AWDA 5AQ1A 1O8CA 2Y1DA 3WFJA 1NFFA 1JKFA 3Q1LA 4D0SA 1MP0A 1ONNA 1HRDA 1TT5B 3DZHA 4NR0A 4CQLA 4DIOA 4NBWA 3OSUA 4P8RA 4J1TA 3QSGA 1MG0A 2PGDA 5BNFA 2FPPA 4WNIA 3SX2A 1C0KA 1RWBA 3DTTA 1VJ1A 1K0UA 1KVRA 5FEUA 2NSDA 5CG2A 4TRNA 1LSUA 4BO2A 2OP0A 3R6DA 3KSDO 4U6QA 4IJKA 1YDWA 4GLLA 2PKQO 4KQXA 5TS3A 2VWGA 1SCUA 2CMDA 4QFDA 3JQGA 3DZFA 4IZHA 2OZPA 4EZBA 4R3WA 4PLGA 4Z3KA 4XJSA 3I3OA 3IUSA 4J49A 4E31A 5KCZA 2WJPA 3LSYA 1DJNA 3WYEA 1L7EA 1O6ZA 3NRCA 5KKAA 3D3EA 4LVUA 4ZJUA 2Q1TA 4RZHA 4HNGA 4CV3A 2GDZA 3LLSA 3WGOA 1LA2A 1GCOA 3C1AA 4W4TA 3ZU5A 4TZKA 3WGQA 3RFXA 3FNGA 4LMRA 3D0OA 4R41A 1PZEA 3FTPA 1PWXA 3B6ZA 4GQAA 3NTQA 4E6PA 5EL0A 1EVZA 1EFLA 3SC6A 3F3SA 4IIVA 4PG5A 1PR3A 4A5OA 4ZQEA 4E3ZA 4CV2A 4FS3A 1KVTA 4UVIA 1EVYA 1DJQA 5HTOA 3GMDA 2WMDA 2Q1UA 2FZWA 4QFCA 1HSOA 2VZ9A 3PIDA 3UUWA 1ONOA 4UVGA 5B4UA 1NHGA 4MVJF 4NNJA 4QEDA 1PJQA 4INAA 3H2SA 5CPFA 2W2LA 4MIOA 4YQYA 1GU7A 4J0FA 2I76A 1BDMA 4W9NC 3UCXA 3KB6A 3JQDA 4L73A 7ADHA 1ZO8A 1DRVA 4QUKA 3W4KA 3TZ6A 3AUUA 3E9MA 2C82A 3ETEA 2H63A 4J43A 4YAIA 5BSHA 4C7JA 3UFXA 1PGQA 1PTJA 2ZJ0A 3QLJA 3WWYA 3ZV6A 2FR8A 1WVGA 1ENPA 1V3UA 3GAZA 3I5MA 3DBLB 4QSMA 2AG5A 4ONEA 5BSFA 2C20A 1GR0A 2WD7A 4J2HA 1Z45A 1ORRA 3JQ6A 4RF4A 1HYHA 3D4OA 1XEAA 1DLIA 5DCWA 1QYXA 3KZVA 4DYVA 1H2HA 3G3EA 4OXKA 2WDZA 3H8VA 3DZKA 5BSEA 3V1YA 1GL3A 4UUMA 1C0PA 2DQ4A 2GN6A 5MDHA 1B14A 2X22A 4M89A 3K30A 4D3SA 1UXHA 2DBZA 2I6TA 2Q45A 1ZK3A 5GZ6A 3T4XA 3HFSA 3G1TA 4GX5A 1HZJA 5ITVA 1N7HA 1WDLA 4F6CA 2BFMA 2DC1A 3RFVA 2Q50A 5L4LA 2HUNA 1E3LA 3VKVA 1U4OA 1PJ4A 5GMOA 4BNMA 1X7HA 3VPSA 1RPNA 3QWFA 5A05A 3CZMA 2POQX 4XR9A 4AJIA 1GZ3A 4GSLA 4KQWA 4QT0A 3QVSA 1KC1A 4DBZA 2D4AA 3G17A 3ICPA 1S7CA 3BTSA 2VT3A 4BO0A 3DMTC 2EF1A 2XAAA 1D7OA 1VM6A 3TZQA 3F1KA 3GEMA 4A73A 2YDXA 4B7UA 1DBVO 2OP1A 4RDIA 4LISA 1R0SA 1P1KA 4II2A 3QE3A 1R37A 1CJCA 3B70A 3WGYA 4A7PA 4NJMA 3VZSA 3I52A 3DZBA 3VPXA 1E6WA 4R01A 2HMWA 4L8VA 3AUSA 5L95A 3IUPA 3WGTA 3D4PA 5KTKA 3KYDB 4O63O 2Q2QA 3S1LA 3CEAA 5ER6A 1P33A 1ONPA 5I8ZA 1N9GB 1NQTA 3DBLA 5JW6A 5K0ZA 3C7AA 3I23A 5ILOA 3SC4A 4L74A 1HDOA 4Z0PA 3WFIA 5I7FA 3OQ1A 3QHAA 2OMEA 4FSHA 4YJFB 2FOIA 2H5LA 1Z7BA 3CIFA 3PGJA 1IYZA 3UGKA 1V3VA 3WNVA 1PX0A 2WYVA 3WYBA 1EUDA 3WDSA 4Z6KA 1YL6A 2WM3A 2RH8A 4BUCA 4DREA 4CLRB 3I9OA 4J1QA 1T2EA 3OJFA 4KDEA 3P2YA 3SLKA 1KVQA 2ZB7A 2OUIA 3S2GA 3TWOA 4FN4A 4EUHA 3GVIA 1H93A 4RPKA 2HLPA 3CKYA 2E6UX 3DR3A 1JU9A 3ROQA 3W8FA 1DFHA 1M6HA 2W90A 1AXGA 2J3HA 1EUZA 1F0YA 1W4ZA 2XPCA 3DXFA 4K1LA 1PU2A 5F5NA 3RIHA 5CEJA 5KJ6A 4BNWA 1HDGO 1KBZA 4I1IA 2QRLA 5F1OA 1GEEA 5KJCA 3KLMX 2O50A 5G0WA 4KUHA 1N1GA 4M54A 4PRKA 4DGSA 2HJSA 3QWHA 1D4FA 1PGOA 4MDHA 4YCAA 5C5IA 3P2OA 1B3BA 5GY7A 2DM6A 4ID9A 5JDIC 1H6CA 9LDTA 4BNXA 3ZWNA 1HYEA 4UREA 3TNLA 2A4KA 1UP6A 5HA5A 3HNPA 4IXTA 3RBZA 1P9LA 3AOEC 1DC3A 1I8TA 2VYND 4XR4A 4LN1A 4HX5A 4CMKA 4OOFA 1X0VA 3FNEA 2VNSA 1LRKA 4B8WA 4MOWA 1EVIA 4RPHA 2NU8A 4MJLA 1XU7A 5B37A 4WCFC 1ADGA 1KEPA 2FY8A 3L4BA 3LT2A 4GX1A 3JD3A 2PV7A 5CEEA 1I0ZA 1HTBA 2JD2A 4Y67A 3AY6A 4FFRA 3F46A 3UN1A 5IDXA 1E7MA 3RJ9A 2GGSA 4QO8A 4J91A 1EDZA 1YJQA 2VHYA 4O0LA 3RROA 2ZB8A 3UF0A 4FB5A 1KYQA 1WAMA 1NWCA 1VSUA 1DPGA 3C8MA 3RI3A 4UEKA 5IZCC 4EYEA 4LW8A 1CWUA 4KWHA 3LF1A 1JN0A 1UDCA 1VC2A 3ITDA 1ISGA 4JBGA 5A4DA 2YHUA 4OGWA 4W9NA 3RUEA 5TJHA 4CLRA 1C3VA 1A7AA 4I9UA 2FMUA 1NVGA 4ZHSA 3S8MA 1E3JA 3I9NA 2EWMA 3ENKA 1WWKA 2FPIA 1HE2A 1GFSA 1HT0A 3D4NA 4IDFA 4EI2A 2BD0A 5ICSA 1Q7CA 4TKLA 1VJ0A 5A3JA 2X0NA 4BHTA 2ZTMA 4WLNA 1EK6A 1AN9A 2DBVO 1VLLA 2QHXA 4R1TA 4WLFA 1SZJG 5IJZA 2Y1OA 3W4JA 2G1UA 3ONDA 5L3ZA 1CDOA 1I33A 2ET6A 2SCUA 3ANNA 3ZWCA 3GEGA 1FDSA 4WCDA 1F06A 1R12A 3L6DA 3EVTA 4NHEA 1GQYA 2WEKA 3PZRA 4OXNA 1B8PA 4CM4A 4PGFA 1YKFA 4XQGA 1DOHA 4BMVA 3C1TA 3C3XA 2J6IA 1YONA 4N5NA 3R0IA 3HN2A 1ZSNA 1ID1A 3JQEA 3IAHA 2P4HX 3FN4A 3HB5X 1QMGA 5KVVA 2OBYA 1Q7GA 4NBTA 2P5YA 2O3RA 3KBOA 4PZDA 1C14A 3MWEB 3JQ9C 1SC6A 3TN7A 2JAHA 3FF4A 3OJ0A 2PGJA 4Y6RA 2C2XA 1OMOA 1T25A 3JD4A 3CTMA 1CERA 3QRWA 1PZFA 2A9FA 4AJHA 2FR0A 4UUOA 2GCGA 4EITA 4G65A 3PJEA 4DUPA 3DHEA 4W82A 3WSWA 4BO5A 1ZVMA 4WKGA 1GPDG 5JBIA 1T2FA 3ROKA 2I5PO 3DMTA 2IZ0A 2VHWA 4R9SA 3HDQA 1YQXA 4UVDA 3RKUA 2OBNA 2Q1WA 4JNKA 1NQAO 4EJMA 3GZNA 2W4QA 2P9GA 1UZLA 2EERA 1DIAA 1PS9A 4WNCA 2VQ3A 1P74A 4YDRA 4A27A 5KNLA 3F9IA 2A35A 3BMQB 2O3UA 4J4HA 1Y8QB 3EAGA 2OO5A 4EEXA 1PL8A 1UAGA 4LVCA 3IDSA 2V6GA 3JQCA 1L1FA 1BXGB 1AE1A 1HE5A 3IMFA 3BHJA 5I9MA 4A26A 4UEOA 4EUFA 1PJLA 3U09A 1AXEA 2PH5A 1FXSA 4L9RA 3KVOA 4UULA 1OI7A 2CVQA 4CMBA 1H94A 3DOOA 1ZMTA 1WXDA 2DTEA 1WDKA 1EK5A 3AK4A 3PRJA 5I7VA 5ITWA 4CM5A 2Y99A 2AQIA 4WK6A 3G0OA 5U4QA 1ULUA 1XIVA 4RO0A 5IDYA 4AL4A 2HQ1A 8ADHA 1ZBQA 1VKOA 4Q3NA 1GY8A 1UR5A 4WJZA 3ITKA 1XHLA 7MDHA 5I9LA 4YYZA 2JKVA 4OH1A 3Q9NA 1Z73A 2O3QA 1YH3A 4QXMA 2A92A 4ZRMA 3GLQA 1HE3A 3E6AA 3GG2A 4WGGA 3ANLA 2C7VA 4ND3A 4Z9FA 4F3YA 4CR7A 2C29D 3PFWO 2C5AA 3U9LA 1PL6A 4D41A 4N7RA 4UAGA 4AJOA 1C1XB 2RBEA 3ZZNA 5LDHA 2NVWA 4NBRA 4NH4A 4UUPA 4OOEA 1XKQA 3AUAA 1E3WA 3PQDA 3MTJA 2VOJA 2Q46A 2EP5A 2BHLA 4OXYA 5L51A 3OQ6A 4BOYA 3VDRA 2G0TA 4R69A 3GAFA 3QWIA 4BMSA 1SBYA 3GF4A 4KUGA 1LBEA 3GPDG 5JDIA 4MINA 2CFCA 3AOGA 3OIGA 3U49A 3JQAD 5C37A 1Y7TA 1E7WA 1ZSYA 5DBGA 3AUTA 1DHRA 4L0QA 4BO6A 2D1YA 3DBRB 5KIAA 3JQ7A 4FFOA 1ZK4A 3PHIA 4BKOA 4IIUA 4YAEA 4IUYA 3NX4A 4WLVA 4R1SA 4PG8A 1WPQA 1DC6A 3WICA 1IE3A 4ZQHA 4YT8A 1W0CA 1Y8RA 4WCFA 2DLDA 3WBFA 4E30A 1P3DA 4JIGA 4CM8B 3GGPA 5FWNA 3QWBA 1D1TA 4FW8A 5TGDA 2E4AA 2IYOA 4GAEA 3BTVA 1H2BA 4U6SA 2ZB4A 4JP3A 3OEWA 3WGHA 3ADOA 1DB3A 5IZCA 2X6TA 4LCEA 4DLBA 5EN4A 3QVWA 4D3FA 3VPGA 3WG9A 4EW6A 1GDHA 1WZIA 3KEQA 2EKQA 4I5EA 3WXBA 2LDXA 3AU9A 5H82A 2CUKA 1TXGA 3A4VA 4CQLB 3F1LA 3ZH2A 4MVJI 1YWGO 1E3SA 2Z1NA 1VRWA 2Q2VA 5IDWA 3PZBA 1T2AA 1RJWA 3ONEA 1HWYA 3I9KA 4ZN6A 3FPCA 4K9DA 3JQBC 4PZCA 4NBUA 2BGMA 4ILKA 1LQUA 1GYRA 1PGNA 3KSZO 3WMXA 5JY1A 5K1SA 3VOSA 2BFPA 2CVZA 3GDFA 4AJ1A 2FSVA 4M1QA 1YRLA 1C1XA 1LLCA 3HWRA 5IF3A 2QW8A 2EJVA 4N5MA 1HZZA 3I4FA 3DHYA 1HETA 1V0JA 3VKUA 1RYEA 3DAGA 3JQGB 4IDCA 9LDBA 1EQ2A 4YA6A 6ADHA 3U5TA 2O4CA 1NVMB 1QR6A 5EQDA 1KEVA 3NGXA 4D79A 4DC1A 3O4RA 1F14A 3KM0A 3F6YA 3RUDA 1E77A 2DKNA 2IYPA 4YT5A 1A4UA 5JAIA 4J7UA 1KETA 1O9BA 1EQUA 3FTNA 1ZEJA 1ZW1A 2AG8A 4KUEA 3LZ6A 5IFLA 4F6LA 3RD5A 4ZRNA 1SB8A 3EHEA 1MG5A 4URFA 1YGYA 3OETA 5G0UA 1TLTA 4UUNA 5FI3A 2P5UA 1B8VA 1BWSA 1DAPA 1GZ6A 2CF6A 2DPGA 3M2TA 4KTVE 1ULSA 4P4NA 2B36A 5FF9A 4DXHA 2YW9A 3JQ9A 2VHVA 3HDYA 4P4GA 2EV9A 1L7DA 5JO9A 2YFQA 3GG9A 3H9UA 3P7MA 4E12A 4FGSA 4CLHA 2I3GA 2B0JA 3V2HA 4MVJE 5TLSA 4XD2A 4YWJA 1HXHA 2NTVA 3GUCA 3E18A 3EDMA 4OM8A 4IGFA 3W6ZA 2ZATA 1RKXA 2GRAA 1PQPA 2JFGA 2Q2WA 3KUXA 1QLJA 4I08A 3PDUA 4HY3A 1W6UA 1KS9A 2AXQA 3E03A 3UH1A 1I30A 3QJ5A 4HBGA 5G4KA 5IN5A 4XIYA 2Y1FA 3TZCA 1HKUA 1Y5RA 1PJBA 5DF1A 3AI1A 2H9IA 2X5JO 4ROSA 4HXYA 2WWRA 4PFJA 4BNLA 1LLQA 3ABIA 3INGA 1X14A 3NJ8A 4IS2A 2VYNA 5KVSA 2XOXA 3INRA 4O5OA 4GMFA 1P77A 1EBFA 4OQZA 4BO1A 3A06A 2WD7B 1R0LA 2Y1CA 1GCUA 2RAFA 1LXCA 1YL7A 2Q99A 1A4IA 5TF4A 3S2IA 4NJOA 3WGZA 4YPOA 3PEFA 2AHRA 4MP6A 4C4OA 4MVJD 2VHZA 3PI7A 4TVBA 4Y98A 1BXZA 3KRTA 5IG2A 4E2YA 1ADBA 3WNQA 4E33A 4CV1A 3GPIA 5K9ZA 1ENOA 2X58A 1NNUA 2PZMA 1QXSA 3FSRA 4B3HA 1PGJA 3BMNA 3FR7A 3CUKA 3BZUA 3LYLA 3HE3A 1FDVA 5K6AC 4D3DA 1ZK0A 3TF5A 5JXWA 4PVDA 2UUOA 3NYWA 1T1RA 2J3IA 3NUGA 4GGPA 1I2ZA 2QIOA 3L6OO 1E0DA 1YQGA 1TA4A 4E5KA 2AW5A 1LX6A 3EYWA 3OIFA 4XRRA 3HSKA 2O23A 1H6BA 5KJ1A 2BI7A 3ZDFA 2CDBA 2B35A 4DQXA 4RQTA 3WIEA 1Q7BA 2VRBA 1MXHA 3CE6A 2PNFA 2C54A 3L4BC 1FDTA 3D1LA 3NJ4A 5H81A 5THQA 3IS3A 4B4UA 4IQGA 4R68A 4G81A 2B4TO 3EK2A 4R1UA 1HF3A 2VHXA 4OO3A 3UVEA 3K73O 2JHFA 3KYCB 3LVFO 5CDSA 4RLSA 1WZEA 3PHGA 1C1DB 4XA8A 3H3JA 4WOKA 4EJ6A 1HLPA 3FHLA 4IBOA 1LC0A 1LJ8A 1UXKA 3WX0A 3UHAA 3OFSA 4XYBA 2I65A 4Q39A 3SBOA 4AJEA 2WYUA 4NJMB 3WSVA 5TSDA 2VNAA 4J7XA 5JPIA 3RJ5A 3IKTA 1Z6ZA 5JCJD 1ISJA 2O7QA 3VDQA 4G5HA 3S2FA 1FDWA 3ZHXA 3QY9A 1VI2A 3GZ4A 1BVRA 4DYDA 2CD9A 1XCBA 1PZGA 1SNYA 3D64A 3MJSA 2X7HA 1SMKA 2VWPA 4DTIA 1QYWA 3D5TA 4PG6A 1I2BA 3O8QA 4R5MA 3E9QA 3BTOA 4J4BA 4E0BA 5EIOA 3RFTA 1UXIA 4IGEA 2IXAA 1IY8A 2D5CA 5DCYA 3ONFA 1Z74A 2VYVD 3JQ8A 4RVHA 2YV3A 2YUTA 3TL3A 2JHGA 3BYZA 2GN9A 5DNAA 5T57A 3QVTA 5A04A 3KO8A 3H3FA 1B15A 1M67A 4MVJM 2FN7A 3N74A 4PVCA 1JQBA 1JKIA 3A1NA 3JQBA 4S3MA 4FJ1A 3GHYA 4PZEA 1A9ZA 3OJLA 3Q0EA 1I32A 4IJWA 3GA0A 1GTMA 3TZHA 4LRTB 3VZRA 1JLLA 4BB6A 2X9NA 3KYCA 4HFNA 3BHIA 3ROPA 3F4BA 1NHWA 1C1DA 1U3WA 4NFSA 1PIWA 3WJAA 1DIRA 1ZEMA 1Q1NA 1TEHA 4EDFA 2EXXA 1M75A 2JCYA 1D1SA 3BHMA 3RQSA 4HFJA 1E7QA 5B1YA 2GF2A 4XB2A 4IPTA 5TNXA 1LEHA 3GY0A 4YAJA 3BA1A 4JX8A 3WQQA 5JYDA 4CQMD 3ZWXA 1LSOA 3PFFA 1HYGA 1JW9B 2B5VA 1PS8A 4QO7A 4FFLA 5AXDA 1I10A 2R00C 4YJGA 1K3TA 4AJPA 1PQWA 1HSZA 4Q3AA 5CP8A 5BQFA 2P4QA 4ND5A 3FI9A 4HKTA 2CF5A 1H9AA 5JCXA 3ZNNA 4YJDA 3SEFA 3B1KA 1PL7A 2FSSA 5TRTA 2Q3EA 3PLRA 1P0CA 1DFIA 2HMSA 1R4NA 3JQAA 1KC3A 2YHIB 1IPEA 2TMDA 4ZQFA 1SEVA 1Q0QA 3GNQA 5T67A 4HFRA 4B7CA 3PHLA 4BS9A 4BNZA 2NTNA 3T4EA 4DQUA 4CMCA 3H9JA 5I8WA 4NPCA 1G0OA 1SOWA 3ZWVA 5KJFA 3HN7A 2BFOA 4PCVA 5BNIA 3PDJA 1DIHA 4A10A 4NBVA 1H0KA 3DAFA 3H9GA 1T4BA 4PLTA 4AJNA 3PJDA 3QWAA 5IZ4A 4I9HA 5ENDA 3H65A 1BW9A 3I4CA 2RHCA 3IC5A 5ILGA 4AFNA 1FMCA 1M2WA 2RIRA 5JDCC 4JBIA 5K6AA 3ZU4A 1Q2XA 4MVJP 4CL3A 4CM4B 1IZ9A 5F3RA 3ZW9A 3RASA 2PWZA 2QRJA 5AVOA 1EUCA 4XJTA 2ZJ1A 4L4SA 3VZQA 1A5ZA 3MTGA 3NTOA 4ALKA 1GAEO 2CSUA 3O26A 3AY7A 4WOJA 1NTOA 3MCVA 1GQ2A 3EVNA 4E2ZA 1K6IA 1K5HA 2A94A 5EINA 4DPKA 2P2SA 3NGLA 1FDUA 3ORFA 1N7GA 5HBRA 5HS4A 4DIFA 1NR1A 3GHHA 2CZCA 3GUYA 3IJPA 2OORA 1N92A 1HDRA 2GD1O 2GR9A 5KWEA 3ETGA 4YRDA 3G1UA 1ML3A 1OC4A 3ICCA 1EFKA 1ZJYA 4OMUA 3ZWYA 1X13A 1UP7A 3ST7A 4XRGA 2VT2A 1K2WA 1QYVA 1RM0A 1ZIDA 2QG4A 4U7WA 2ZYAA 4GWKA 1I3LA 2B37A 3WIDA 8LDHA 2NU6A 4RCVA 1VPDA 4DIBA 3GZNB 1I3MA 5T5QA 5JMWA 1RM3A 4YTEA 3F5SA 1MV8A 3H9QA 5TQVA 4EGFA 5CEFA 3CINA 3NDJA 2GO1A 2D0IA 4GH5A 1YDEA 3AY3A 4CLXA 2PLAA 4TQGA 5EPOA 5LDGA 4BNIA 4XDZA 4Q3BA 2IDZA 3OM9A 2PD3A 4ZVVA 1NWHA 3MWDB 2YHIA 1FF9A 3K2BA 4N5LA 4U0KA 3H5NA 2BFAA 2C07A 1HDXA 2P9CA 2Y0EA 2E37A 2ZCUA 3AM5A 3V5NA 5COQA 5THKA 3A28A 1K6XA 3L6EA 4LCJA 1GV0A 2ZCVA 3C7CB 2PZKA 2QZZA 2VZ8A 5AOVA 1C0LA 1VJTA 2BRUA 3OJEA 1R66A 2PD4A 3GVCA 2JFFA 3DO5A 1J6UA 4MP8A 5TT0A 4U5QA 1NFQA 4E32A 3PJGA 1ARZA 4RLHA 1M66A 3JQFC 1KIFA 3LT0A 3K8ZA 4TSKA 4CPDA 3UCFA 4CJXA 1R6DA 5JAMA 5JSFA 2UAGA 5L4NA 2C2YA 2CDAA 3EGOA 1XSEA 4JJGA 5B4VA 1K89A 2Z95A 3BMCA 5A02A 1PJTA 1LDMA 4L76A 3DONA 4IM7A 4P22A 3RUIA 1JDJA 4CMIA 4GLOA 1DAOA 1PEDA 2JD1A 4JN6B 1K6JA 3HQ4O 3PLNA 3NDRA 1E3WB 3OQBA 3GRKA 3RSHA 2B4QA 1WMBA 2X5OA 3L9XA 1XELA 4OIMA 4BV8A 1W73A 4MVJA 1YB5A 4B4OA 4GVLA 1RM5A 2AE2A 5BSGA 3TFQA 4JJFA 2YYYA 1Q0HA 4IZIA 2GUGA 3DDNA 4BNKA 4BKPA 2Y1EA 3GGGA 1MXFA 3GMSA 4ALLA 1ISHA 3GQVA 4B3JA 1OOEA 3RUHA 2O2SA 4HNHA 1FJHA 1LUAA 1U7TA 3ZHBA 5T6BA 3JQ7B 2NQ8A 1DRUA 3L4SO 2X0JA 3HADA 1N1EA 2WYWA 5B12A 3E5MA 1SB9A 1ZNQO 1DSSG 1HDZA 4KWIA 3K9QO 3RU9A 3N58A 4J90A 3M6IA 5KJEA 5JYEA 1Y8RB 4WCFB 2CY0A 3PQFA 1H6AA 1ISMA 4CM1A 4BL5A 3LF2A 2NVBA 4BO9A 2IODA 5CDGA 2ZB3A 1B3RA 3OA0A 3JTMA 1UZNA 1U3VA 4DC0A 4I8XA 3VPFA 1Y81A 3GVXA 4E5PA 3AM4A 3WTCA 1F12A 2FRDA 3CPSA 2R00A 3UW3A 5ENVA 3ZCXA 3RVDA 3WWZA 4CLOA 4BNHA 1DHTA 2TMGA 3ZU3A 3DL2A 3INTA 1OFGA 2JJYA 1JAXA 3QA9A 5ADHA 3FPLA 4GKVA 5AXCA 1B7GO 3ZNOA 1B26A 1E7RA 3GOHA 1YVEI 2B69A 4LK3A 3GNSA 1DFGA 2EEZA 2HK8A 3QVXA 3TOZA 1UAYA 4Z9XA 3JV7A 4JLWA 1LTHR 1E5QA 1UJMA 4Z3DA 1J4AA 4HFMA 5JCJA 1AHIA 4M87A 1NXQA 2FHSA 4CQMB 2UDPA 4DA9A 5DDIP 2HJRA 2PZLA 4KP7A 1CEQA 2BGLA 3N7UA 4ZGWA 1U2DA 4AICA 1YO6A 3HG7A 1B8UA 2PR2A 3S2EA 4IQ0A 4FFNA 1U4SA 3C1OA 4NG5A 3OJOA 3OHSX 5BR7A 1DLJA 1NQ5A 3WLFA 2XF8A 3GVHA 1N5DA 4IMPA 1TB4A 3RUAA 1CQJA 5KOIA 3G79A 4LSWA 4IDEA 3T7CA 3TZKA 5JDCA 3COSA 1BRMA 4J1NA 4WECA 1R4MA 1O94A 1X7DA 3WMWA 5IDQA 2HAEA 5TJ9A 4LSMA 4WEQA 3JD0A 4GWGA 2VYVA 5DT9A 3SVTA 1O0SA 1R16A 1YOVB 4HWKA 4AVYA 2PFGA 4AJJA 2VOEA 4ITUA 1DO8A 2DU8A 3KV3O 4P38A 4TVOA 4OYRA 1TT7A 2ZQZA 4JBHA 1IPFA 3DBVO 4IMRA 4YQZA 4CV0A 4U0JA 3U4HA 2Q4BA 1IHYA 1GUZA 2DUUA 3KHUA 3LU1A 3UXYA 1HDYA 2IZ1A 1XYGA 4HV4A 1I01A 1KY5A 5T8KC 5G4KB 1W8DA 2DUWA 3DBHB 2PKQP 3VZPA 4WLOA 1KVUA 1VL8A 2AQKA 3NT4A 4RL6A 4RF5A 4QX6A 3B20A 4TKMA 3X2FA 3OECA 4FPXA 4RF3A 4RORA 4XWYA 4BQPA 1ISFA 2G5CA 4CMGA 2VTEA 1B0AA 1IULA 1VL0A 5A9SA 1DEHA 1MA0A 2QYTA 3PGXA 3PVZA 4NQZA 1O5IA 3LC1O 3QV1A 2NUAA 4TRRA 1VE9A 1KOLA 3ZNPA 3NT2A 2PD6A 3RUCA 1TVEA 2G76A 4CQMA 4PLPA 4XX0A 1QG6A 4EJ0A 3OA2A 3Q2IA 4J0EA 4NU6A 4IINA 4NK5A 3B1FA 3BMNB 3ZWPA 3DFUA 4N18A 4U8GA 5U1PA 4IXWA 1O89A 4FBGA 2IZZA 4IS3A 1IZ0A 3W1VA 4JROA 3GGOA 4EUEA 5DCUA 2IE0A 4MKXA 5IN4A 3FNHA 3JQFA 4YRAA 3H5RA 3ZI0A 4BNNA 4YBZA 1ZXLA 1AUPA 4S1VA 4PLHA 2O4UX 2O3TA 4YB8A 2HO5A 3RKRA 2Y68A 1LSSA 5L9AA 3Q2KA 1DRWA 2NVUA 3ZWWA 1YOVA 4IDDA 3SXPA 3UOGA 4OKIA 3RC9A 1XU9A 3FNFA 5G0TA 4ALIA 1NM5A 1ZJZA 1KY4A 1B2LA 4Q3CA 2B5WA 1XDWA 3DZJA 5A5FA 2DBRA 1NR7A 2FZEA 1LDNA 3RBXA 1LDBA 1EE9A 3IL2A 3V2UA 1O95A 2ZTVA 1DDOA 3SJUA 5DOZA 4GL4A 4BIIA 2AQHA 1H9BA 1LSJA 3MJ4A 6LDHA 3DBHA 3AU8A 1U5AA 1NPYA 4BKQA 3AJRA 4DQVA 3H5AA 1E5LA 1MFPA 3L07A 2HRZA 4W6ZA 3JD2A 3F5QA 4XQCA 1D3AA 1ZUD1 4H7PA 2W98A 1WP4A 4GSKA 3MJVA 2J5KA 3VPHA 3ZNQA 2W8ZA 3TDKA 5B4TA 3U62A 3RCBA 1I2CA 3RC1A 2R2GA 4Y6SA 3IP1A 2C59A 2EIHA 2VWHA 3OEYA 2ZIZA 3AI3A 4FQ8A 4B4VA 2RCYA 1EBUA 2G17A 3BMOB 2J5QA 1G6KA 1G0NA 1QV6A 1GPJA 1RM4A 2EW2A 5HS6A 1GADO 3S55A 2O7SA 5F1PA 3RC2A 1WMAA 3I9JA 3O8QB 3HUDA 1YBAA 1MUUA 4ALNA 2X23A 1UP4A 4AJLA 4DMMA 3EZLA 4PLZA 3PJFA 4DPMA 4FC7A 4AJ4A 4NFHA 5G2OA 2PKRA 3JQ8B 3LDHA 4E5NA 4Y6PA 1ZK2A 1U5CA 3G49A 3OH8A 4PLVA 3WGIA 2NACA 5F5LA 2NU9A 4YVFA 1YB4A 4TZTA 4YXFA 4FFMA 1X1TA 3BTUA 3CXRA 5G0VA 3STHA 1XGKA 4BNVA 3OMLA 4YAKA 3TFOA 4ZU3A 3RAJA 1P31A 2BH9A 4ND2A 4W7IA 3ZV4A 2I67A 1WDMA 1U1IA 3M1AA 1H5QA 4K26A 3DOJA 4BQRA 2IXBA 5CDTA 1JWAB 3IP3A 5IAAA 1NPDA 3Q6IA 3WS7A 1ZCJA 4NDNE 2EW8A 4RDHA 1LDEA 1E3IA 2IRWA 3ZN2A 3IQDB 2NWQA 2FP4A 3HB4X 4PIVA 4CLEA 4D44A 2OHXA 4ZQBA 1PJ3A 1X1EA 3JSAA 1YQDA 1F17A 3HFGA 4RPJA 3VH4A 1Y1PA 1R15A 3LT1A 3RC7A 4MIEA 2O2YA 2OFPA 2X86A 2YFHA 3TOXA 4B3IA 5I7SA 4ALMA 1LLDA 1MLDA 3DQPA 2P68A 3C24A 4J9UE 2H6EA 5JLAA 2YQ5A 4J7CA 5JY6A 3C7DB 2Y0DA 1E6UA 2ZK7A 3HHPA 4A03A 3PQEA 3VH1A 4ZQGA 1LRLA 4WLUA 5JAQA 2BF7A 1I5RA 4CL8A 3D3WB 3JYOA 1U2GA 1PZHA 2GPTA 2W2KA 3OBBA 4DMLA 4O59O 3KETA 3PXXA 1GQQA 1BSVA 3MOIA 5A03A 1J5PA 1N2SA 4WUVA 5L7YA 2YJZA 5AYVA 1P1RA 2EP7A 5KVQA 1U8XX 1JTVA 2NM0A 3NV9A 4O6VA 4E4YA 3L77A 4NIMA 1V6AA 2PA3A 4IDGA 3SLGA 3E8XA 4IJVA 2HMUA 1JWBB 4YJGB 2LDBA 2CDCA 4OKNA 1QP8A 3R3SA 4E13A 3BMOA 1MC5A 4YT4A 4RPGA 3B1JA 4I9NA 1IUKA 3NKLA 1YL5A 5CHEA 3GRPA 4D45A 2DPHA 5T8KA 2R6JA 2EGHA 4B7XA 3M2PA 4Q3EA 3E48A 3TRIA 4Z0HO 2DTDA 2EKLA 4LRSB 1OAAA 3U4IA 3LC7O 4BGEA 1TT5A 1I36A 3BXXA 3JQAB 1R4NB 3ZHZA 4TRJA 3DC2A 1DIGA 1UDAA 1JVBA 3QVOA 5AXAA 3ADPA 3K6JA 5DULA 4PLFA 1NBOA 1QYDA 1ZKMA 2HMVA 3MJEA 1E92A 3R1IA 1RYDA 3WJ7A 3CH6A 2ZYDA 2BKAA 2DAPA 2ZYGA 5DOVA 2PZJA 3NT5A 2GZ3A 2CNBA 2VN8A 1NASA 2DT5A 2O3JA 4X54A 3I1JA 1BW9B 1A27A 4CMHA 1MB4A 4Y8VA 4I5DA 2JCVA 4CMEC 2NV6A 4KMSA 4XYLA 1LRJA 4D7AA 1WNTA 2AEJA 1KERA 4J6FA 1M6WA 2X0IA 1HEUA 4DBVO 1VKNA 4R3NA 3JCZA 4ESOA 3H9EO 1SEPA 1NP3A 1YS4A 4ALJA 2BELA 3KSUA 3PIIA 2Y0CA 3AFMA 3RWBA 1ZMOA 5CFZA 3QP9A 4XKJA 3EZYA 1CQIA 3L0DA 1BMDA 5DP2A 3D3WA 3DB2A 5EESA 3H2ZA 1GYPA 3PWSA 3JYNA 3K2EA 3PHJA 3KOUA 4B4WA 1GEGA 1MFZA 4FJ0A 1MGOA 2VZ0A 2X9VA 1Y6JA 2X4GA 1UDBA 4RV9A 1E1MA 1SOVA 1ZFNA 2XXBA 4W99A 4F45A 4GX2A 3GN2A 3JYPA 4IQ8A 1KVSA 3O03A 3I6IA 4XQEA 4ZA2A 2DVMA 2IEBA 4I5GA 4PLCA 3UAGA 3VVBA 3PPIA 4WPGA 2UV8A 2VUTA 1F8FA 1DIBA 3ZGYA 4BO7A 4GPD1 2WD8A 1N8KA 2NLOA 1NAHA 2GZ2A 3GH3A 1T1SA 3LQFA 2XXJA 4NZ9A 4II3A 3DZGA 4H16A 3PWZA 1GUFA 2VUUA 4M49A 4GGOA 3GFGA 2HRBA 3EUWA 4FOOA 2F1KA 3FWZA 4XGIA 3KLPX 1ENYA 3DZIA 3X2EA 3PYMA 2YV1A 3WB9A 4DLLA 1DC4A 3T7EA 2YZ7A 3BAZA 1QSGA 2I9PA 1XLTA 4BGIA 1BGVA 5T64A 3UICA 3DEYX 4JGBA 2ZTUA 4QECA 2HDHA 2PTGA 3F47A 2V6FA 1ZH8A 4WLEA 4FGWA 3W6UA 1UZMA 3FR8A 4ZICA 3TQHA 3HZZA 4RGBA 4DWVA 5A5EA 3K92A 5C3MA 4TROA 2Y67A 1P44A 2J5RA 2PK3A 4MVJH 5TC4A 1HE4A 1YBMA 3FWNA 2GYYA 4BNUA 1AHHA 2BGKA 2DBQA 4OAQA 2JCXA 1U28A 1R0KA 4GKBA 2X5KO 1E1LA 4CM9D 2X8LA 3NAQA 1IB6A 3I6QA 3L9WA 4HP8A 5IXSA 3FBTA 2ZKLA 3OIDA 3BMCB 1SO8A 2B4RO 1WW8A 1U7HA 3VVCA 3E82A 4WASA 3NDIA 1JAYA 3VC7A 2IEDA 3FBGA 4CMIB 1OC2A 2Q4EA 3PHHA 1ADFA 1E6EA 3K5PA 4IJUA 4B8ZA 5C7IO 4BNFA 1M76A 3LC2O 2OOSA 2X0RA 3V1UA 4R16A 4CM7A 1ENZA 4QTZA 3WQSB 1BHSA 1I24A 2CVOA 2VRCD 4E21A 1EMDA 1YB1A 4K6FA 4BO3A 3AM3A 4H3VA 4Z0TA 4CR8A 1NVTA 3PTZA 3ON5A 1JKJA 4C7KA 4O1MA 2DFDA 5HM8A 4KOAA 5COBA 4J16A 1EDOA 5A9TA 4UVHA 1ISIA 1ZSVA 3P19A 2NTJA 3ZWAA 2ILTA 4NMHA 1YXMA 4CM6A 1XQ6A 3EC7A 5F21A 5J23A 2WE8A 4XB1A 3KYDA 3GNTA 2I99A 4F46A 1LU9A 1Z7EA 2DTXA 2VWQA 1N9GA 1AGNA 3DWFA 1IHXA 1X15A 4XCVA 5G0SA 1PGPA 1PJCA 3UCEA 1XR3A 2JL1A 2Y1GA 1NYTA 1VSVA 4CUJA 5BNTA 3H7AA 5JFOA 1UXJA 4YJFA 5L7TA 4YT2A 1UH5A 3JD1A 1D8AA 4K6CA 2EHDA 4Y9DA 4YJHB 1V9LA 5LCXA 3RBVA 3ZW8A 1U3TA 4R5HA 1XWFA 4CLOB 3MOGA 3TL2A 4DRYA 4MO2A 4BKRA 4HADA 1UXGA 2FR1A 4BGUA 1VL6A 1E7YA 4KDFA 1A7KA 1A72A 1T2DA 5L4SA 4XGKA 1QORA 1U8FO 4FFPA 2VCYA 2ZQYA 2E48A 2JFHA 1LDYA 4OHUA 3VH2A 4K28A 1E1KA 3ETDA 2F00A 3F4LA 4G2NA 4CLDA 3EW7A 3RU7A 3U3XA 4Z9YA 4AJ2A 4EBFA 3H4VA 4OL9A 5I9NA 3A9WA 4RVFA 3ANMA 3OICA 4DL9A 1GV1A 4YAGA 5U9CA 4UVEA 4XIJA 3ZWBA 3QW2A 2YQ4A 5A06A 5JNLA 1H6DA 4JP2A 5FI5A 5FFFA 1PR9A 4L4XA 4PLWA 4CUKA 1XQ1A 2W2LD 4BO8A 4M55A 2QQ5A 5EMHA 3U0BA 3ZWMA 5DBFA 4OSPA 3VTZA 3E1KA 3K96A 3EY4A 2QYSA 5A1TA 1EZ4A 2NQTA 3KTDA 1NAIA 2UUPA 3MZ0A 5DBIA 1KEWA 1OBFO 4CMEA 2PY6A 4EEZA 3A14A 3DOCA 2O48X 2AEMA 4R9RA 4MKRA 1PJ2A 1ZK1A 2AA3A 2D59A 4XEHA 1HDCA 1C0IA 2D8AA 4A2CA 4FOSA 1R4MB 5LC1A 2E49A 3CMMA 3WQRA 4L75A 4Q9NA 4BNGA 4D43A 4PG4A 1CRWG 2WSBA 2UVDA 2V6BA 5EJ2A 3JYQA 4GX0A 1EE2A 4YACA 4KZPA 4DVJA 2AE1A 4JJIA 1Y5MA 3WBBA 4FDAA 5DN9A 2HKIA 4E2XA 1CIVA 1F8GA 3WOHA 2D3TA 2GASA 1GYQA 1E1NA 3GEDA 3GR6A 1CYDA 5TIIA 5MGBA 4YRBA 1YBVA 1T26A 3JYLA 4R4JA 4XDYA 3C85A 5HRUA 3W8EA 2GN4A 3PWKA 5JC8A 3OF2A 5I7EA 5L40A 1A71A 1PS0A 2QZ9A 4YJHA 1EEHA 4XYGA 2I3AA 4BMNA 1S6YA 1V35A 2HU2A 1J49A 3ULKA 5HWSA 3V8BA 5CG1A 4JK3A 3P5SA 4OSOA 3I9MA 5JC1A 1WLYA 2X1HA 1CETA 4J4TA 4JQCA 4M86A 3PK0A 3VTFA 4B79A 2D5AA 5A3VA 3GDGA 3ZHYA 5C7OO 4HUJA 5TT1A 4J1SA 4ND1A 5G4LA 1HL3A 4TMFA 5H83A 5A9SB 3DTYA 1BTOA 1QV7A 5C7LO 1SAYA 2AEFA 3H6KA 1TI7A 5L53A 4OQYA 1GD1O 3ENNA 3D5QA 5F1KA 1NFRA 1XG5A 3GC6A 1NQOA 1OZAA 2YY7A 3GN1A 2J8ZA 4UEJA 4NK4A 5JS6A 1ZZEA 5GZ1A 2B83A 4XYEA 1BXKA 1Z75A 4BV9A 4MKZA 4L4RA 5IXYA 2EGGA 4R51A 5KKCA 5CDUA 3AW9A 3CZRA 1QYCA 5CPBA 4PLYA 1ADCA 3CMCO 3IIEA 2NNLD 4BKUA 3AFNA 3ROMA 3Q3CA 1PWZA 1T2CA 2UYYA 4FD3A 4XZ3A 1LQTA 4CUZA 2C7GA 4P4LA 4PN3A 3D7LA 3R3JA 4WE3A 4XQ9A 2JAPA 3E5RA 3PYLA 2GN8A 2V7PA 1QKIA 4CMAA 1SPXA 1LDGA 1B16A 2GNAA 4FJ2A 4J3FA 3K31A 3KXDA 4CR6A 3KEOA 4NI5A 1Q0LA 2NVUB 2BLLA 4TWRA 4CMJA 4D42A 3GVPA 3MEQA 2QRKA 1GZ4A 5AXBA 2O3SA 3VH3A 5JO0A 2Q1SA 3MJTA 3LT4A 2VUSA 3NTRA 4XGNA 3PP8A 4FIZA 1LNQA 2Y05A 1E7SA 5JAZA 3WLEA 2Y93A 4FC6A 5JE8A 3ZWOA 4MVJG 3ZV5A 1P0FA 2EJWA 3FD8A 2Y66A 4QQRA 4TRMA 1BVUA 3AOEA 4AG3A 5GZ3A 1EVJA 4IY1A 1P1HA 1IOLA 1U3UA 2WTBA 2GLXA 3LK7A 4RZIA 4FCCA 1G1AA 1CF2O 2P91A 1DC5A 3KYBA 3U4DA 3WTBA 3QQPA 2PH3A 4D0RA 1PSDA 1LLUA 1PJSA 5CDYA 5A9RA 3BMQA 2V6MA 3FCOA 4GI2A 4N54A 4AJKA 3GT0A 1Y8QA 4I5FA 4FR5A 1KEUA 4NFYA 4JXKA 4ND4A 2RHRA 5DP1A 5DZSA 5BT9A 1BXGA 2FWMX 3HDHA 4YR9A 4GBJA 3VAZA 2YV2A 3O9ZA 1XA0A 2NU7A 5EERA 1QRRA 4DPLA 1LC3A 4IDBA 1IL0A 2HCTA 1YJ8A 3AI2A 5KVCA 2X9GA 4RQUA 1P45A 1X7GA 3GDOA 2HK7A 5L45A 4RVUA 4YEDA 2GZ1A 4XYMA 1MX3A 1T4DA 2Z1MA 2Z5LA 3MJCA 4GVXA 2H1SA 3E9NA 2Q49A 1DXYA 1FK8A 4A0SA 3Q11A 4RVGA 4BO4A 3LLVA 2FPGA 1E3EA 1YE3A 4WEOA 4GMGA 2G82A 2WE7A 3O38A 2HK9A 2E82A 3V1TC 3W4IA 4D46A 1BDBA 1BG6A 1NX6A 1UUFA 3ZU2A 4BNJA 1P1FA 4RF2A 3VHRA 2BMAA 2QX7A 4IDAA 4PG7A 2HSDA 4LGVA 3FRJA 1QLHA 2VTDA 4H15A 3IOYA 2C5EA 4RVSA 3TSCA 3ASUA 3GK3A 3I9LA 4ZD6A 3Q9UA 5CAEA 3GFBA 3I83A 4BGVA 2RH4A 3QIVA 4BB5A 3CSDA 1PQUA 3TPCA 1Y9EA 5L7WA 5ER9A 3WR5A 4J2OA 1JA9A 5EQFA 1X0XA 4JCOA 1T24A 2EG9A 2GSDA 3DFZA 4PRLA 3RUFA 1P1IA 2PGLA 3V2GA 2BI8A 3M1LA 4MIYA 2OL4A 5ICMA 4MPDA 4M8SA 4RVDA 3WYCA 2HMTA 3U4CA 1I3NA 4RPLA 1HLDA 3DBRA 5ES3A 1A9YA 4BNTA 1I3KA 3HDJA 3PYXA 3HJAA 3ZV3A 4DLAA 2W2KB 3UKOA 4BNYA 4CM9A 4CODB 1JVSA 2OXIA 4KTTE 1J0XO 4MP3A 1P1JA 2NADA 3OP4A
chains in the Genus database with same CATH superfamily
1JQLB 3IMKA 2EKPA 2P1ZA 3PT5A 4S1NA 2EX4A 3SJ7A 4R1NA 4G84A 3NVDA 2H57A 2QVBA 5FJJA 2JD0A 3DHNA 4W7HA 3ELDA 4QDTA 5ETJA 5IABA 4ZT2A 5EJIA 4DRZA 1GRVA 3NEPX 2UVQA 5TX7A 3HK2A 1LVGA 1ZJJA 3R0ZA 4XWAA 2GEUA 3ASVA 2CFOA 2ZYUX 3E9CA 4EB6A 1QRAA 2QRGA 5HK9A 1BXRB 2QORA 1I4DD 1XQVA 3AP3A 1OYWA 2W93A 2AMFA 4NU5A 1T91A 1WB6A 2F59A 3H13A 4Q3DA 1E79D 4RY8A 2FW0A 1CJSA 1UK9A 2BE9A 3EG9B 3HNOA 2Q9BA 4L72A 4CM3A 4F4JA 1O8CA 2F3RA 3WFJA 1GL7A 4AZ3A 1JKFA 3EZXA 5MFZA 5AK6A 1MP0A 1ONNA 1C7IA 1VHJA 2IQIA 3OT1B 4UMEA 1FXWF 3OSUA 2E2WA 4P8RA 4YCLA 3I0ZA 5BNFA 2FPPA 3SX2A 3GFPA 1C0KA 2QE7A 5HSGA 4LWOA 2F1RA 4UTRA 1JSLA 2ZSBA 3SZRA 5ICCA 1KVRA 5LUAA 1LS1A 3A4IA 3EVZA 3CM0A 1V4BA 2VF7A 3QXHA 5CG2A 4W9MC 3VR5H 4KFTA 1H8HA 3VZDA 1SU4A 1VCOA 3KSDO 1CJUC 3W7AA 1E2FA 5I7UA 4U6QA 4IJKA 4EWLA 3PNYA 4WKPA 3GEEA 4M0EA 1GKLA 2WKPA 5TS3A 4D98A 1G291 2OC4A 2P2YA 3F3MA 1LF5A 3G2JA 3NBYC 1XRNA 4N3AA 1E1RD 4LJ6A 5E2BA 4N6NA 4R3WA 4FHFA 4PLGA 4Q7JB 4EZBA 4XJSA 3HYNA 3SKVA 3IUSA 2I71A 5P21A 2UZ4A 4J49A 1Z5GA 4R8SA 1E64A 2JAWA 2R6GA 4NZPA 4OHZA 4NBNA 4R98A 1HMYA 1IHPA 1O6ZA 1PJ8A 3HA3A 4Y3UA 4LVUA 1KE2A 3UJAA 4ZJUA 3ZDCA 2BEVA 3LQ1A 4KQFA 5G1NA 1JQKA 4MWBA 1XK6A 4HJRA 1FUUA 3ZKWA 1XRJA 1T4CB 2FW1A 4BWGA 5CB6A 5KINB 3ZWKA 4HNGA 1YQEA 2P6MA 3SKYA 1YKSA 3QLVC 2X8JB 3K16A 3R3XA 3IUBA 4DM3A 3D0OA 1PZEA 1CQIB 4C06A 4GQAA 4C1NA 1ZS9A 1HQDA 4E6PA 3OE7D 1VE7A 5D85A 3DDOA 1SRQA 1OAOC 2I3ZA 1D6JA 4PG5A 2G9RA 2LE0A 2AMLA 2LR0A 2QAGC 4LHSA 5BQ5A 3SIRA 2A0FA 1MX5A 1X77A 1KVTA 3GPLA 2P9QA 3LYUA 4UOQA 2RE8A 5WRFA 3CUSA 3GMDA 4D8XA 1J33A 4OB6A 1IBCA 2DT8A 4TMYA 1VPWA 4AP9A 1E99A 1VPEA 4GT1A 3PIDA 2F17A 5LNK6 1RPZA 2HJVA 4TLLB 1AK2A 4UVGA 2BEKA 1NA5A 1NHGA 3G1WA 4MVJF 1EFAA 4EI7A 3AO0B 4YUXA 2W2LA 1GU7A 1OI4A 2I76A 2HHJA 3K35A 2OD9A 4YP7A 3W9BA 1DRVA 7ADHA 2WNIA 3GUHA 3ZVNA 2H63A 1NI3A 3I6MA 2XDAA 3BCRA 4X8OA 1QGUA 4C7JA 3R5XA 1PGQA 4P7FA 1JXQA 1PTJA 2ODTX 2VJKA 2ZJ0A 2HW8A 1JFLA 1I4LD 3GAZA 1FNMA 3I5MA 3DBLB 4QSMA 1XLVA 2AG5A 5FYQA 1YK1A 2GZHA 2ZVDA 4ONEA 1ND6A 4KCGA 2I4MA 1VSTA 4J2HA 1Z45A 2HIHA 3VYWA 13PKA 4IHJF 4OQQA 1HYHA 1KGDA 2I7DA 2VXCA 2RG7A 1XEAA 4HTAA 1GZ5A 1TF5A 4I1UA 4C2BA 3QLEA 2JKZA 4EY7A 4TVKA 1SOMA 1DZIA 3BXHA 1NNLA 1ODIA 2PAAA 5I51A 1FYWA 4OXKA 4BP1A 4TV8A 2K2WA 2EP8A 2PN1A 1A1SA 2CXOA 3DMGA 4EA7A 5KMGA 1EXMA 3HJGA 1SIBE 2BM0A 1FSGA 2FB9A 3A4LA 2XCIA 5AOAA 4YP5A 4IIXA 3BL5A 1KZ9A 3S5JA 2BKVA 5AK3A 2Q7OE 4QBHA 3AERA 5GM1A 2HSGA 5J5CA 3MUFA 3U9SA 4CHGA 4D8VA 2DQ4A 4GM4A 4NZYA 5IX8A 1ZR4A 2KLHA 3GXOA 3IP9A 4EG5A 3UXEA 1X7WB 4PYLA 5FBKA 1GGKA 4D3SA 2HHAA 3OOEA 2QL9A 2Q45A 1ZK3A 2G9QA 3JVDA 5E6RB 3HFSA 3ZHTA 1QG4A 3TEJA 3GJYA 2DC1A 4FR2A 1NN3A 1TYAE 3E15A 5EHQA 1E3LA 5K3OA 1ID8A 1IG3A 2FFRA 1TQHA 4KRXA 5GMOA 2QTLA 3M6XA 3I28A 3W5IA 3ZXIA 3TQIA 4YP9A 1G38A 1Z2CA 1NRJB 1KO8A 1QHHA 3COWA 2J0VA 4C0SA 4AKSA 4W9RA 3TCNA 3J81A 2CL7X 1HFWA 2BLNA 3CSSA 3HXTA 1KC1A 3A3PA 5DYWA 4DBZA 3LCUA 4I4TB 2FQXA 2IX9A 3BTSA 3SZUA 3K1TA 3NBMA 3WE7A 3RVOA 4LFCB 3ICVA 2XAAA 3P9SA 1D7OA 2H00A 3PNSA 2AYZA 1N4DA 2VP0A 3AESB 5GONB 3RNLA 1TECE 3ACCA 5K0EA 1UMKA 4LISA 4DA7A 5BWLA 2COKA 3HA7A 1R0SA 2CYCA 1DG1G 2AFHB 5LMUB 2K7ZA 1T5LA 2P41A 3B70A 4A7PA 4CIVA 5E1DA 3DEZA 1U5BA 1OFIA 1JDVA 4NJMA 3VZSA 2ZXUA 3DZBA 3VPXA 1QP0A 2CSXA 2FG6C 3R9XA 3G85A 4G0XA 1P4HA 4L8VA 4PS1A 1EK1A 3T9FA 3ZVRA 3FKSD 3ZCUA 3CKMA 3A2KA 4KN8A 3JW8A 1UCFA 1BE0A 3CISA 5FBWB 3CEAA 3S1LA 4GRAA 1UEJA 4M9XA 3UWPA 5I8ZA 1NQTA 1VIYA 4Q9DA 4YJ3F 1GLGA 3B9BA 5K0ZA 1T3HA 2WHPA 4LDQA 5JR3A 4TPKA 4L74A 4WBXC 2XCTB 3HBFA 2VP2A 5FR1A 3WFIA 1P72A 3OQ1A 3SHWA 5C5CA 2FOIA 3U81A 1Z7BA 2HFKA 4MCHA 3SBXA 5ITZB 1PX0A 1NGSA 3WYBA 2R7NA 1WSWA 3IVRA 4ZCRA 3QVUA 4CYMA 4F11A 1UFQA 2WM3A 2RH8A 3IAS1 4KV7A 4CLRB 2MR5A 5B7GA 3MIIA 3G13A 3E3MA 4QATA 3D2CA 4MA5A 4EPWA 5MF6A 1YJBA 1FP7A 1HY3A 3A4YA 1XPRA 2O8DA 2AUMA 2P5SA 2PLFA 4GMHA 1BO6A 2YWGA 4QJ3A 3VR2D 4EUHA 4EKEA 8ABPA 5GIOE 2JGLA 4IR7A 2FG7C 1H93A 4NMWA 2XGOA 1JU9A 2H92A 4ZAYA 2NX2A 4Q4JA 5D51S 1E0KA 2J3HA 3A6DA 1F0YA 4K1LA 3G59A 3RIHA 5CEJA 2VK1A 5F5NA 1H2ZA 1G3QA 1JEOA 1HDGO 1CQWA 4TXNA 4AB1A 1U2QA 2R86A 1GJRA 5HW0A 4J0CA 1Y82A 2F3QA 3AGPA 4KQHA 4QEKA 2ZT7A 3UJ9A 1R8YA 1B1AA 2GEDA 1URPA 1O1YA 3IHKA 1U1GA 1EGVB 3MLEA 4MW7A 5CJJA 4BFCA 4YUWA 3UMYA 2FWNA 1N5OX 4LGYA 2HJSA 2EFYA 1CJTC 1X7ZA 1TM7E 2BFCB 4Q03A 4NAHA 2GYUA 2A0YA 2BCGY 5KEIA 1NDQA 5GY7A 5JWOA 4UD6A 2FUNB 4ZO6A 2XCSB 9LDTA 1EFRA 4BNXA 2NZVG 3ZWNA 3ERCA 4F3RA 1V5GA 5HA5A 5A5GA 2Z6UA 3RBZA 1O6FA 2V7QD 3L0PA 1R6VA 1L7MA 4HQ0A 5FPYA 1DC3A 3D7KA 2VYND 2ACVA 2AI2A 2OKGA 2V03A 3GBVA 3HGMA 3M81A 3N8NA 2X4IA 4NABA 5I7WA 3ABOB 4CMKA 1W88B 1S4QA 3CPJB 1JQJC 3FFXA 4JT8A 3QVJA 4E7PA 3QUSA 1KOFA 5KB3A 3PXEA 3SGLA 5D84A 1LRKA 3GLIB 5K8LA 1BCSB 4RPHA 4OHVA 4EPRA 3WAGA 1TUGA 5B37A 4GUAA 1ADGA 3LT2A 1D04A 3JD3A 4L3OA 2JD2A 1ZITA 3AY6A 4K8OA 3C3JA 4TWIA 1Z68A 3ZZMA 4LI3X 4LYAA 2IKSA 4M1YA 5BOVA 4IIHA 4TTTS 4ZEOA 2WMNB 1R3DA 2PRIA 3D6UA 3H2HA 3UF0A 5BW5A 3IXLA 3PGKA 2PYDA 1VSUA 3WP1B 4DUGD 1M1UA 1KI3A 3NMUF 3OZUA 1N6RA 4M21A 3VR4A 4LW8A 5FBHA 3PCRB 3QXGA 5F9MA 1F60A 3ZG6A 5HNKA 1JN0A 3HBAA 1JIUA 1QIDA 4HGPA 1VKHA 4OYHA 5AR1A 1ISGA 1PT8A 2Q6TA 5AM0A 4BTVA 5HRCA 3IDQA 3UK2A 2FYTA 1EEXB 1FTNA 2I3DA 2LVBA 2JHPA 2OD2A 1U80A 1RHRA 4UTPA 5A4DA 1MENA 2I9KA 2OM2A 5TJHA 2XMDA 1NURA 4PYQA 4UU8A 3TEMA 1K1EA 1K8XB 3S7ZA 2W6CX 4ZHSA 1IB0A 1NVGA 3ORHA 4HGYA 1E3JA 2OSVA 2WR8A 1YUBA 3H1AA 4P33A 1NUTA 2MSEB 2GA8A 1V26A 2QJOA 1HT0A 4IDFA 1XOIA 3CF0A 3NIDB 1L7VC 2BD0A 3OPYI 1SUPA 3CEPB 1NN5A 4GL2A 1KTVA 4ENPA 2A3RA 3GFRA 3H9BA 1L7BA 1XO1A 1QLWA 5LU8A 1MEEA 1YKGA 1EK6A 4R2HA 4TTPA 1AN9A 2HXSA 4RIGA 4YCNA 1A76A 1M1NA 2Y1OA 3AR7A 5IJZA 4FE3A 3W4JA 4Y9TA 1NDUA 3HVJA 5JNSA 1QGZA 1JS1X 4PHCA 1V11B 3NM5A 3QEMA 2NZ8A 1ZJ4A 4QOJA 5BR1A 3GEGA 4AS1A 2AZ4A 1F06A 1WABA 2Q0SA 3GGSA 1ZUIA 3BL6A 3VI4B 5JQGB 3AR9A 3SFTA 4C3ZA 3D3NA 1GQYA 2IS6A 2RI6A 4C76A 1UM9A 4DDMA 3TGLA 2RHHA 4EY5A 3T8YA 1B8PA 4NXMB 1UZUA 1MOPA 2PEZA 1MEJA 1ZU4A 1WB5A 1YKFA 2O1SA 3HBJA 3E2MA 1T8SA 3C3XA 3LO5A 1E79A 2DE0X 4Y6QA 2FW8A 2V0NA 2AK3A 2J6IA 2O07A 3NXSA 5KOHB 2AXNA 3R0IA 1VFPA 1T6YA 2ZJ8A 3JPYA 2H7CA 4G5SA 3UAWA 3D54D 3UGTA 2R8BA 2AR7A 2V96A 1QMGA 1KNXA 1ZMRA 1XN4A 3AKYA 2GYWA 2C3YA 2P5YA 4PZDA 3TRKA 2HF7A 1C14A 1PFKA 4JXXA 3F0TA 4XDGA 4RTSA 3D7SA 1ZHHA 2C2XA 4JI0B 1N5JA 4EHHA 4ND8B 1L5RA 4BGDA 4U63A 1FX0B 1LGYA 3CTMA 1ABBA 2FPOA 1SU8A 2V3CC 3H5LA 3HJRA 2FR0A 3GP3A 5I4CA 2GCGA 1AGRA 4G65A 4Q4DA 3P96A 5TIIA 3F49S 3DBIA 4AZ0A 1DOAA 2LW7A 1GPDG 4NZMA 2ZIUB 3CLUC 4FZVA 4MS1A 5KYYB 2C7QA 1EP1B 4X7MA 1W36C 2IE8A 1GILA 1GPLA 2IZ0A 2QQFA 1MO4A 2NO5A 2DZDA 3EA4A 1E1RA 3KQVA 1MJGM 2GZRA 4R9SA 5AK4A 2W7TA 1NQAO 3ABQB 3MJRA 2XIJA 3MWFA 4M1WA 2Y6VA 5A0FA 2J32A 3P5BA 3UGQA 4EEKA 2BL4A 4A27A 4GBGA 4WOCA 5JAPA 4A2WA 2O3UA 3JRNA 4GXNA 1QG0A 2MINA 4J4HA 4DCOA 4J1TC 1Y8QB 3PEVA 4AUNA 2HBQA 4S2EA 1XZJA 2VSFA 3H11A 5AHWA 2V6GA 3JQCA 3BE8A 4K2AA 3P9XA 1L1FA 5IHPA 5KOJB 2I29A 1AE1A 1DG3A 2P35A 4TN1A 4UEOA 2YY5A 4FYKA 4FHEA 2I55A 1E1DA 3BIXA 3OE7A 3A3KA 5JYBA 1H94A 2J4FA 3IKLA 5FPTA 1P1BA 4C2UA 2QLBA 3WAKA 3LRPA 2DTEA 1EK5A 4RHYA 1MD9A 4Z86A 3U37A 2HOQA 3G0OA 1NIJA 2NYUA 3N07A 5EMMA 5IDYA 3V7NA 2HQ1A 2NXJA 3RLIA 1H2RS 5CM2Z 4AL4A 4EMTA 4MULA 8ADHA 1UR5A 4EB8A 2JASA 1XHLA 5KPJA 3HBLA 3E8SA 3FNBA 3G8AA 3GIWA 2JKVA 2LCQA 2QPOA 3MD0A 2D8MA 3GNLA 4TKVB 2C04A 3TLKA 3JWGA 3ZDZB 3BK2A 1KS2A 3LVRE 3OZ7A 1OXKB 1J5XA 2HZBA 3FG9A 4K03A 3WP0A 2MOKA 3NOOA 2A0UA 1DRKA 2PYZA 3GLQA 4ZI7B 4M1EA 4EJSB 4XUDA 3DEAA 1UWVA 4ND3A 4NZNA 4HAWA 4XTRA 2YY6A 4Q21A 1UPXA 1N0VC 1I1OA 4MUKA 4HNTA 2VPZA 3UK7A 5AW2A 3HJUA 1PL6A 1FUYB 5AP9A 3T34A 4UAGA 4HNAB 1TJNA 1XCGB 2G70A 3QXXA 4UQOA 1KAMA 2FPSA 3BXFA 4QJ5A 4X8MA 5HG0A 5HKBA 5LD2B 1HMPA 4YFYA 3PQDA 2H2HA 3NEAA 2O1XA 1RTKA 2EP5A 4OXYA 5L51A 5LQKA 1WUYA 3IDAA 3ZIUA 4JB8A 3VDRA 1XMOB 4KWCA 1XD2B 4JS0A 5EZ5A 5ED4A 1RLJA 3QI2A 2Q1YA 2ZLBA 3Q2OA 1GTL1 5DASA 3GPDG 3II6X 2BGGA 3AOGA 3EVGA 2QGFA 5JBNA 1XDDA 1AQ6A 4HLNA 3AF5A 5BO5A 5EIAA 2ZVJA 3HL4A 2GTHA 2V97A 5DBGA 5CRIA 2INGX 3AUTA 4L0QA 1J90A 3T1OA 3GRVA 2PH7A 4CFSA 4F21A 2R87A 3CBGA 1ZK4A 2I6FA 2D6FA 4PIMA 3NX4A 1L3IA 5BWBA 4DKJA 1DC6A 1PEAA 4C05A 5AW0A 1Y8RA 3UV7A 2PUBA 2DR0A 1KR2A 2PQ6A 4RKYA 5AKEA 2PMWB 3I3SR 4PSAA 4QNRA 3UK0A 1R6XA 2CFRA 2O8BA 2ORIA 2SKEA 4X20B 5AESA 5TGDA 2YYZA 3QBDA 2IYOA 1ZIPA 5EEGA 4CT0A 1TM5E 3B48A 3BXGA 4U6SA 1HYQA 2ZB4A 4JP3A 5BN4B 2VI5A 4L8YA 3WGHA 3ADOA 4CDGA 2K5UA 4N5IX 3IE1A 5IZCA 2R2AA 4KIWA 1CNFA 1B00A 2PANA 3DQQA 3WG9A 4EW6A 1XZFA 1J07A 2FX2A 3C1UA 4E3WA 2FTKE 5F73A 2C5LA 1FJ2A 4MLDA 3WLOA 3RHZA 3E84A 4R9NA 3TS1A 1TXGA 1ODJA 3K6RA 1GSHA 3I62A 5BN5A 3F8TA 4CQLB 3ZH2A 4CIAA 1JJFA 4MVJI 4B75A 2B8WA 1WXQA 2Z1NA 1FDIA 5LA6B 3O7WA 1JDNA 3R0QA 3OM0A 1BROA 1ELOA 1NBEA 1HWYA 4AW9A 1SQ0A 1AF4A 2GZSA 3FKSA 1F4LA 4HX9A 3NWPA 5HCUA 1FVHA 4NZOA 3VBEA 1LQUA 4H17A 3PDIA 1GYRA 3W2IA 4EHNA 1PGNA 4P5EA 1GSOA 1OE0A 5CTAA 2AHOA 2FSVA 3ILVA 2GF9A 2WQ7A 1YULA 2IWRA 2ZVQX 1HLFA 2QW8A 3TBFA 1GAQA 4N5MA 1EK0A 2R6AA 2YS6A 5AHRA 4CT5A 1NU6A 2B2XA 4CDRA 1VOTA 1YQ9A 1V0JA 1XLWA 3VKUA 1RYEA 3JQGB 9LDBA 3ENZA 4B9AA 4KE8A 4HNVA 2O4CA 4EATA 4DLTA 4MRMA 2H1WA 2SNIE 5BV0A 4DR6B 2AUTA 4OQMA 4KAXA 2PWPA 4H1WA 1EXWA 4A8JB 1A4UA 1C9KA 4MUXA 4TKZA 5CLGA 1GXSB 1FEZA 1KETA 1H4VB 1O9BA 3FGZA 3OTIA 4AG5A 2ZRPA 1UDXA 2AG8A 1UBJS 4P92A 3SC2A 2R96A 1OBVA 1YQQA 4ZRNA 5TQ2A 2MSLA 4DCGA 2J3DA 4Y30A 4LDAA 1P19A 4GBMA 3KJFA 4URFA 1X9GA 3R7BA 5IS2A 3OETA 2P2GA 3D0RA 5FI3A 1N3BA 2BGTA 1RWKA 2XYPA 3VR2A 2DPGA 2XUFA 3B8EA 2V7VA 4PR3A 1ULSA 3IBSA 2H0AA 2YW9A 3TNJA 1MVLA 1I0LA 2EV9A 4GEKA 3GG9A 4PGHA 4O2AF 2ADOA 4NEHB 3CZ4A 1UXOA 3P97A 1KO7A 1TKAA 2A5JA 2JCBA 2VDUE 1XZMA 1B43A 3A7EA 4RULA 4MVJE 2ZJBA 5TLSA 4TVSA 4XD2A 4FBLA 2XEXA 5SV2A 3AVXA 4DMUB 3DM5A 5KO2A 2NTVA 3E18A 2Z1DA 2Y76A 3EDMA 4X8LA 2QRPA 3W6ZA 2JPDA 2WIKA 2GRAA 2JFGA 5GWXA 1Z8NA 5SICE 2V7UA 3KUXA 3MIZA 4HY3A 4F9EA 4DC9A 5J4LA 5LMZA 1KS9A 2QRVB 1SVWA 3H83A 4FCWA 3WFZA 2V5VA 1GKUB 2Y1FA 3TZCA 2Q0QA 2VDLB 4B6JA 1LBIA 2O8EB 3PL5A 3K09C 4ROSA 5BV8A 3CS3A 2XA2A 3R77A 3PQ2A 4GU5A 4N3CA 5LP6C 3B7WA 5EE9A 1LLQA 2W2PA 1PLLA 2QU7A 2V7QA 3FHOA 5JHHB 4IS2A 2IHUA 2VYNA 5KVSA 2XOXA 1HM5A 1U9IA 1YRQA 1QH0A 1ZU5A 4BZPA 1P77A 4NTZA 3RS8A 1G6HA 5E6SA 3A06A 4CL0A 4DSOA 2MDTA 3OZDA 1R8SA 3DJFA 3LZDA 4GPIB 1GCUA 3GU3A 4OM7A 2WU1A 1ODFA 2XHZA 3NLLA 4QYTA 1QK3A 1SCAA 2JRCA 3BSYA 5DKFA 5KYNA 3BGDA 1KL7A 1M2VB 4C4OA 2C9OA 1XBTA 4MVJD 2PRJA 4Y98A 4D0LB 1BXZA 1ZVQA 2V54A 3KRTA 1CRQA 2IIQA 5K9ZA 1PUJA 2YZMA 1LY1A 3QVGA 5CT8A 5EJ9A 1NNUA 5G1PA 3WLSA 1E3MA 3E1GA 4QVIA 4D9KA 1XTZA 3BZUA 1ONSA 1OTHA 1ILWA 1NL3A 3LYLA 3BQ9A 3JALB 4DUGA 2X1MA 5JVDA 3FTEA 1HNNA 2R4UA 3KB1A 3TZBA 1WPGA 4EW1A 3K70C 1RXYA 1MNAA 2I54A 1IVSA 2IYSA 2I7XA 1F38A 1I2ZA 3ZXSA 4YGXB 3L6OO 3L4KA 3I2YX 3E7FA 3MTDA 1KDZA 4A2QA 4EF6A 1BS1A 3SR3A 3EYWA 4DUYB 2OXRA 4XRRA 3UMSA 2O23A 3M82A 5CVCA 1HYBA 1RLMA 2R6R1 3OTGA 5KJ1A 2A0XA 4C4AA 2HA2A 4IH1A 4ZVUA 1HQCA 1Q7BA 2VRBA 1MXHA 1QH1B 1RWWA 4F3KA 2C54A 4HQRA 3NM6B 1FDTA 2QMOA 4LQ4A 1ZMXA 4U4AA 4ER7A 4WW0A 2V7XA 4UXJA 2G9UA 2UUAB 5E3IA 1HF3A 3CW2A 5CDSA 5JH7A 4OI1A 3ZHCA 1RRGA 1KEEA 3LTNC 3B3GA 1C1DB 4XA8A 3TB4A 3RYCA 3CF2A 4US0R 3TB6A 3W1WA 4F1KA 2MT9A 1CZKA 4AT1A 5D7NA 1OB5A 4W5NA 1KI2A 2GS9A 1I6WA 2EWWA 2N1MA 2VPTA 1HLPA 1T36A 3P0FA 1WXIA 5AKKA 4GDFA 4IBOA 1LC0A 3TG2A 1CJBA 2ZJAA 4MXDA 3MLBA 4V1CB 2O06A 5C1PA 3WX0A 1NE7A 4HGQA 1DGQA 4ZT7A 4WZZA 4ON9A 3B6MA 4GI3A 5TEVA 3WSVA 5TSDA 1M72A 2VNAA 2POCA 3P20A 1BDIA 3K0SA 3B36A 3SJCA 7REQA 4Z3OA 2RBGA 3U7EB 2WYOA 1QKKA 3O4VA 1WPXA 1CDZA 3EE6A 4G5HA 4H1HA 4RMNA 4DCVA 1FDWA 2A5DA 4DYDA 2O2ZA 4EM6A 5K05A 2XQFA 4M2LA 4K6KA 1I3CA 5IXJA 1XCBA 2BM1A 3O90A 1JMYA 2HREA 3QE4A 5EE0A 2QLTA 3MMPA 4EKYA 4DUZB 5FPSA 2C78A 3ROTA 2FEMA 2IP1A 4LZWA 4PZ0A 5JJBA 3GP8A 4B2PA 4POOA 4JHXA 3D5TA 4G5YA 1A69A 1SQ5A 3A9UA 2JC3A 3K5WA 3SJBA 3TQQA 1SBQA 1T1IA 3BTOA 3E9QA 3QK7A 3OQHA 3DLHA 1IUPA 4PX2A 3RIYA 4HLQB 4LNUA 1I7LA 1WCIB 4PC6A 4ZDJA 3WGKA 5BUSA 1K88A 1PFGA 1KKMA 1V16B 4TYNA 3M6LA 4ENRA 1ZPDA 3CURA 3BYZA 4QXPA 5CNIA 3CG0A 3GFFA 5AKLA 5DV9A 3TMKA 3Q10A 4NRDA 3V6MA 5LZ9A 3U7FB 5T57A 3AQIA 3IQIX 1G20B 4GLFA 1YJ5A 2A14A 1M67A 4B3SB 3QBJA 1ORIA 1JKIA 2ZPAA 4QNNA 3PJRA 3GZTB 2QZ4A 1V71A 1G6Q1 4PZEA 3GJ3A 1A9ZA 4PPGA 3R9IA 5CK5A 3KJEA 7GPBA 4LFBB 3MNFA 4ACBA 3S99A 3TZHA 1VG0B 3VZRA 1JLLA 2ASVA 3IESA 2HTEA 2C4KA 1D2RA 3H97A 2X9NA 2PZ8A 3JRWA 4EYQA 3D4LA 1FPMA 1RVDA 2R8OA 1RZ3A 4R9VA 4AKHA 1GA6A 3D6FA 4N0EA 3OPYA 3MN1A 1Z0FA 4NFSA 1NOKA 5KX5F 1QF6A 4OQPA 2HJGA 1DIRA 1ZEMA 1Q1NA 2WZQA 1TEHA 3GJTA 3IEUA 2NZJA 5DM1A 4YXWD 1W5SA 3Q3JB 2QRMA 4LS3A 3GFOA 3N2KA 3RQSA 2C7BA 3IB6A 3KKKA 3JTEA 3WKDA 3A25A 5B1YA 1U90A 2GF2A 5BVHB 4M88A 3WMGA 2OFXA 3HLKA 2ZT6A 4XB2A 4TQ9A 1NYQA 1IXSB 2YJNA 1XRPA 4X6UA 5REQA 5HQJA 5EUCA 3EOZA 3L01A 5IKXA 3VJKA 3E05A 4JX8A 1D1PA 1H66A 3UT6A 4BMCA 3AV0B 3QMMA 5E9JA 4OBBA 1NOJA 4GOOD 5HKAA 2EBHX 1JKXA 4JR1A 4DCMA 2QAGB 1JW9B 2BZSA 3FLAA 4QAQA 3MBIA 4EFKA 5F3WB 4R3UC 5AW5A 2ES4A 3IGFA 1OXUA 2GX6A 4OXQA 4FFLA 4X95A 2IV7A 4Z7OB 5D2CA 3DT6A 3T5TA 1RMTA 4KSBA 1HT2E 4RETA 3VO8A 5ECDA 3BMXA 4KQIA 2HU8A 5JRDS 4QTTB 1NF3A 5CM8B 3MHPA 5JV5A 3LPAA 5CH3A 2VQFB 3V7UA 3QTTA 2NUPB 1JA0A 2X41A 4ND5A 1C4KA 3DC7A 3O2JA 5HCIA 3DO8A 3H2JA 1TYBE 3MK31 2VP4A 5JCXA 3WNBA 3TXYA 2QL7A 1PW7A 1ZVVA 3OI7A 3BHNA 4BVJA 1HNWB 1PL7A 1A97A 3WZ2A 2Q3EA 3LI2A 1PZNA 3SQOA 3G8BA 1DFIA 4BMOB 1R4NA 1ULZA 2ZTHA 1KC3A 2YHIB 1O97D 4BASA 4B7CA 3SYLA 1AIPA 4BS9A 2NTNA 2CMGA 4DQUA 1KFCB 3B8HA 1TC1A 2VPIA 1G16A 2AG1A 2XUKA 4M36A 5HEKA 1MN6A 4JD5A 2BFOA 1VI5A 2YN4A 5TVKA 3UAVA 3UY4A 5BNIA 3DM9B 3KFXA 1SC9A 4FWIB 4RGYA 4BBJA 2XKAA 4Z54A 5ELMA 3N9IA 5K0LA 2Q5OA 3VX4A 2XXAA 5BR4A 3I4CA 5LUBA 3BGIA 3EXHC 1F2TB 2P7IA 1EVLA 1IU9A 2VAPA 4UUQA 1Z7GA 2AN5A 3IC5A 1TAGA 4JFRA 5E2AA 3RS5A 4D4MA 1XUOA 4LRXA 1KXJA 1NMXA 1SELA 5EY5B 1ZA1A 2RIRA 4HAXA 2JFWA 3UWMA 1DAIA 1Q2XA 3QHPA 2JIPA 2IYRA 4MVJP 3KUKA 1IZ9A 2ZKIA 1EHIA 4TSFD 1K7SN 1FDRA 1XRSB 2XQKA 3JWIA 4UHFA 2DB3A 3Q85A 1WTAA 3FJOA 3QW4B 4YV0A 4ZOQI 1Y6FA 1EUCA 5HKLA 3MG9A 5F7JA 2VHQA 1OHHD 3MD9A 4DRXA 3AL0C 1W4BA 4AG6A 2ZBDA 1GQ2A 3ORSA 4TL6A 3CU5A 4HH1A 2ZI4A 2A94A 2A9KA 1H3FA 1O57A 2GAJA 2R7LA 5HS4A 1N7GA 4LOJA 1V37A 4V0RA 3ZE0B 1BIFA 4MB0A 2CZCA 3RTAA 3V8MA 3IJPA 1QV9A 1ITZA 1X8XA 1HDRA 1Y8CA 2WM2A 4NP6A 2O0LA 3W2TA 1LNZA 2WM8A 1R64A 3ICCA 2JI9A 3ZWYA 1X13A 1UP7A 2G9ZA 5EFOA 3TZEA 4CTJA 3M89A 3WMFA 1FMFA 2H59A 1L8XA 1K2WA 3LL7A 4U7WA 2IW1A 2ZYAA 3OY2A 4A4DA 4EG7A 2P6RA 1ESZA 3DHVA 1V7ZA 1D03A 3NASA 4O2RA 4ABTA 2GBLC 2NU6A 4MCAA 4FEGA 3IEIA 1I3MA 1FXWA 4W1QA 5CX1A 5IJWA 1U0RA 2GJ9A 5DXFA 4J6EA 3F5SA 4YTEA 5CBPA 1D4ZA 2YMMA 5L3QA 1M8GA 2O5EA 4K9OA 4RM3A 3NDJA 1E9DA 4YRGA 1KOJA 2BVNA 2GO1A 1YDEA 3BE5A 1IN7A 3EVAA 3HPRA 3MPOA 4GH5A 4F7DA 2QM0A 5ENZA 4CIWA 2YICA 1M5UA 2PLAA 3IOEA 4TQGA 5LDGA 4BNIA 2FKAA 1O6GA 4IHAA 1WZCA 3RM3A 3RYIA 4ZVVA 2C5FA 2J85A 1NWHA 2KHZA 3ONNA 1UPAA 3ABRB 3ESDA 5MHTA 1ABFA 3I8SA 1BRTA 3IQXA 1F2DA 3F71A 5H68A 5CTJA 2BFAA 4BU0A 4F4FA 2Y0EA 1Y5LA 2P4SA 2VNIA 3NHKA 4YAWA 2IEIA 3BIWA 5DISB 1GRNA 2XA9A 3JVVA 3A28A 4FYMA 5K2MA 5THKA 3V5NA 3C3DA 4LCJA 4F2PA 2AVNA 4PNZA 5I9SA 1HTTA 1Q0TA 3IR5A 3C7CB 4BFYA 2C7OA 3LCJA 3T4PA 3ZXUB 2QZZA 4YYEA 2BRUA 2F9LA 1R66A 5JI2E 1D9ZA 1N2IA 4HVCA 3GVCA 4EO4A 4MP8A 3VTAA 3OVMA 5TT0A 1DP4A 1NFQA 4RAQA 3PJGA 1ARZA 4WI1A 5EG5A 3MT7A 5B1IA 4G4IA 2JH3A 3G02A 3IOBA 1Q7EA 4Q7LA 2CNDA 2UYQA 1IY0A 1JB9A 3GA7A 4YMWA 3VNUA 1WRBA 2P69A 1O0BA 2C2YA 4L5BA 2V98A 4JJGA 2CWDA 1VFNA 1PK7A 3LGAA 1RRFA 1UT6A 2WKQA 3DONA 4HWRA 4IM7A 1WCV1 1XRQA 1JIQA 2DWOA 2WJ3A 2YCLA 4P22A 5ARCA 5CDFE 1WG8A 1KRXA 3MCAA 4HZUA 1II9A 1VIVA 1VE5A 1VL5A 3MMZA 2A5YB 4D92A 1B23P 1NM5C 1N1DA 1K0FA 1WY7A 3OQVA 2B8NA 3RSHA 1WMBA 2RAUA 2EZ9A 1U7OA 1PJRA 3PXUA 5IVKA 1XELA 1MT3A 4BV8A 1IATA 1N2CE 4HQNA 4LE0A 3D59A 4MVJA 3SJZA 5LP1A 1FBTA 2OBLA 2PUTA 4GVLA 1O95C 2AE2A 3DCJA 3WL7A 3EBLA 2DHQA 2NO0A 3IQEA 3QLUA 3L0IB 3BCHA 1EG2A 3R3ZA 4UATA 3PG5A 3EDRA 3LP5A 3DDNA 2XWSA 3L8YA 4BKPA 2KQUA 4EQ6B 4JSYA 1ISHA 3E2IA 1MAWA 3EDQA 4D9FA 4G2TA 4JLJA 1QQAA 3RUHA 4GLBA 3QU7A 2FUG6 3CIOA 1AQIA 3DOIA 5T6BA 3C8ZA 1ZM9A 3DB1A 5PNTA 3ZHBA 4PNEA 1N1EA 4N0QA 2ZUFA 2PSDA 4FQ7A 1UIRA 4IHJA 3N58A 1PCXA 1UK7A 3GRUA 3P1JA 4OQXA 2BMWA 3EIHA 2FKNA 2WIDA 1H6AA 3QF4A 1DEXA 2HQSA 3VKHA 2P6PA 3KX2A 2QZPA 3AR8A 3OA0A 3FYUC 4MGHA 4QPDA 2QN3A 3BEDA 1K3FA 1TVMA 4ZAFA 3T15A 1EDDA 3ZUPA 1NZJA 2BONA 2CLMB 3K9GA 1UFOA 2PX3A 3WC4A 2FDCA 3HKBB 3PKZA 2A1UB 2I2BA 4XOIA 2MR6A 5DHUA 5FQOA 3AHJA 3CPSA 4AFNA 4E5PA 3PR2B 3WVNA 1EFUA 1Q2UA 4UBLA 4BNHA 2NPFA 2QMUA 1NT4A 1E4OA 3DL2A 3NJRA 3G2OA 3I30X 4GKVA 5EWLB 3ZCPA 1B7GO 5TMBA 5L6LB 2QUKA 4JGIA 1E7RA 3DVLA 3PUJA 3GOHA 3C3YA 2B69A 4UU1A 3VR5D 4B3HA 3ROXA 3TM4A 1QO9A 4HWOA 2Z4RA 4FZ5A 4ITRC 4Y2XA 1CRLA 1ZOOA 1YIAA 2Q3LA 2W00A 4HAZA 3HU2A 1Z6YA 3K4PA 3EFEA 2OK8A 1LTHR 3RBAA 1E1YA 3NTVA 1PSWA 4PXSA 5JPCA 2VSXA 2N9UA 1G2QA 1JSCA 4Y2VA 4KOEC 5DN6D 9GPBA 3F3KA 3L4JA 2HJRA 3SS7X 1CEQA 1SUIA 2BGLA 3IQFA 1U2DA 4LDRA 2HM7A 2B94A 4IWYA 4ZOLB 1TPYA 3P71T 2X4LA 1YO6A 4LYGA 5K3EA 2P75A 1E5DA 3HV0A 4HAUA 5ALYA 5JAOA 3QBTA 3STTA 4NG5A 3OHSX 4L4ZA 4ZCTA 1DKOA 4OREX 2W6MA 4MCJA 4EKNB 1NQ5A 1NMQA 3VAYA 2GTIA 2XF8A 2HBRA 1N5DA 1FLVA 1G20E 3COSA 4Y6OA 5HE9A 2YTZA 4H08A 4LVOA 3FPEA 3VC3A 4HX2A 1KO4A 3DDUA 1ZUNA 2WFLB 1G17A 1X7DA 3AY0A 2FEPA 3GCGA 3F9CA 1RRKA 3FH0A 3OIYA 3OT4A 3RVMA 3C2QA 3AF1A 4LSMA 3CN7A 4ZYTA 3B52X 5CX4A 1O0SA 1H5NA 1T9CA 2NW6A 4TM8A 2KX7A 3TD2A 2E7ZA 4U3JA 5CA1B 4MUYA 4NE2A 4NZZA 5EXDA 3DE4X 4M7OA 4DCCA 2DETA 3KALA 4M6WA 3F7OA 3FJYA 4IOJA 2BR5A 3UTDA 2YV5A 4B5KA 4COKA 3ABSB 3O8OB 4ASUD 1G98A 2MTBA 3T6KA 2PUEA 2ENUA 3BGOS 1KZYC 2H1CA 4Q7KA 3IPYA 3U4HA 3U3OA 3ZLUA 1Z13A 4V0ME 1NVBA 3ZK9A 3KHUA 1AOXA 4Q19A 1GFWA 1RWVA 4O29A 3JAKA 1WW3A 1DAGA 3ORRA 1RMYA 4HV4A 1I01A 4C88A 1IOVA 4OUDA 1XXHB 2BFFA 1L5KA 1ZH0A 1W36B 1Z5OA 3FDXA 1W8DA 2A3NA 3N39C 4PYOA 1EHCA 2DUWA 1U2SA 2VBCA 1KMMA 2VTBA 2HWKA 4CTOA 3AVYA 1Y7IA 4MEJA 3NT4A 3H5WA 2ON6A 5F7ZA 3AKZA 3UWDA 1SUEA 2YUIA 2I22A 2CKDA 3FMVA 1JH8A 4P98A 4YXWA 3TRFA 4QPNA 2XKJE 1QFZA 4QGAA 4L9SA 2X0EA 3OECA 3G2HA 2PJRA 2PT5A 2BAGA 4LGCA 5C9ZA 4RORA 3VMFA 4LC1A 4BQPA 2G5CA 1B0AA 2VP3A 1IEVA 3BWXA 5AKZA 4JVMA 3M7IA 3RTCA 5JD3A 4PTYA 1XRMA 1ZJ6A 3KB8A 4X1YB 5LXTF 3V97A 3IODA 2GFHA 3WMEA 1U98A 3KWFA 5HUHA 4PC2A 4O2BF 3L0OA 2NUAA 3FOBA 3VDNB 2UZ1B 5LBIA 2PD6A 4UM7A 4CEHA 3TLEA 3UMRA 5FD8A 2G76A 2DUMA 4TLCA 4EA8A 4XX0A 1JJAA 2ZIGA 3OA2A 4IINA 1UBOS 3A6EA 1Y9DA 3B1FA 3ZWPA 5CB0A 1L7AA 1C3LA 3BWBA 3FCUB 1QFXA 4U8GA 1C3XA 1IQPA 3K7EA 2XOEA 3WL6A 2J9XB 2ZAIA 4UHDA 3UWOA 4B6SA 4BAZA 3F96A 1F5NA 3IOMA 3FOCA 4RIEA 4MKXA 4LI0A 2JLYA 2YV4A 4AI6A 1E32A 3I53A 5C4GB 4HLUA 3LDFA 4R7TA 4L0DA 2A9QA 3ZDDA 4B3RB 4O4HF 1CP3A 2IGTA 4LE2A 4YBZA 5AD1A 4N0DA 4S1VA 2CHQA 1X7XA 3ANXA 3H8JA 1PNTA 5U4XA 3ZDXB 1P75A 4A23A 1DRWA 1NVFA 1Y3BE 2JKYA 1XZNA 2YINC 3S4YA 3HCEA 4CQNA 1WL8A 2YJ5A 3MWLA 3I8XA 1L4YA 1XU9A 2FP4B 4I2VA 1MW8X 2ZRIA 3DV9A 4RK5A 4Z4EA 4D4JA 1KY4A 1J8VA 1VRCA 1CZRA 4DDTA 1RCFA 1RRPA 1XZCA 4MSUA 4EGJA 2OWDA 1OREA 2PXCA 1Y4UA 2FZEA 5FO0A 1D4OA 1LDNA 1N6LA 1GQSA 3RVJA 2C9ZA 4IJ5A 3A0UA 3V2UA 3L49A 3Q72A 3IO3A 5IUJC 2ZTVA 2ASEA 5KVAA 1EM8B 1DDOA 3ENVA 4GL4A