5DP1A

Crystal structure of curk enoyl reductase
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
332
structure length
332
Chain Sequence
DQPVQLKLSEYGVIDNLNWQPMQRKTPLANEVEIEVAAVGLNFRDVLNALGLLKDYYAEHFNITSAEQLTFGFECAGKISAVGEQVSQWQVGDEVIGLLLHDGLSSFITTSVEYVVAKPKQMSFSEAATLPLTFLTAQYGLQHLAKIQPGERVLIHAAAGGVGQAAVQIAQVAGAEIFATASPSKWEFLQSLGIKHIMNSRTLDFAEEIMKRTAGEGVDVVLNSLNGEYIPQSLAVLTPKGRFVEIGKIGIWEKEQVKEKRPDVSYFPFDLQEAVQQQPGLIGQLSEELTQQWNQGKLKALPHKVFPSTEITAAFRYMQQAKHVGKVVVSMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords CurK
publication title Structural Basis for Cyclopropanation by a Unique Enoyl-Acyl Carrier Protein Reductase.
pubmed doi rcsb
source organism Moorea producens 3l
total genus 104
structure length 332
sequence length 332
ec nomenclature
pdb deposition date 2015-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5dp1A02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 5dp1A01
3TZQA 4D46A 1PS9A 2OBNA 2ILTA 2GN4A 1NQTA 2YHUA 3AU8A 3PDUA 3QWBA 4E32A 5HM8A 2FY8A 1JKJA 4ALIA 4E2ZA 1QR6A 1VLLA 1JWAB 4Z6KA 2NU6A 3DHEA 4U6SA 4NFYA 4KTTE 4CM4A 1XEAA 1RYEA 1PX0A 4EITA 2Y05A 1QYVA 4DL9A 4IJVA 5B4UA 4WLFA 3SC4A 4KMSA 2O3UA 2FR0A 1GZ6A 3CMMA 5IZCA 1EVIA 3HNPA 1NBOA 1BW9B 2EV9A 1I8TA 3WIDA 2FR8A 4ZICA 1LDEA 2LDBA 3SC6A 4B4UA 2ZYGA 2Y1CA 4BGUA 4CM8A 2J3IA 3DBHA 4ND5A 3S2FA 4OYRA 3FCOA 3C7AA 3WGGA 4LVUA 4RPGA 4KWHA 3VH2A 4EGFA 1DDOA 4KZPA 4L9RA 4L73A 4WCDA 5GZ1A 3KO8A 3DOOA 3RVDA 3D64A 1XYGA 1U2GA 3UICA 3WTBA 3G0OA 1P9LA 2P68A 1PS0A 1KY4A 4JBHA 4GL4A 4BNZA 5EJ2A 5IFLA 4C7JA 3TSCA 1DOHA 3E9NA 3H65A 1R0LA 3OQ1A 3WBBA 1YO6A 2I76A 4J3FA 5CDSA 2X0IA 1EE2A 4ZU3A 1E3LA 2GZ2A 5A04A 5IJZA 1LBEA 4MO2A 2QIOA 1WW8A 1O94A 3FNHA 3GNTA 4AJNA 4R3WA 1PZGA 4QFDA 4E2WA 4QECA 2B4TO 2YDYA 3P19A 2UDPA 3HDQA 2DTEA 5U9CA 1LA2A 5K0ZA 1PL7A 3VTFA 3QWAA 1E3WA 3JQCA 2UUPA 2GN8A 4UEKA 4DREA 1PJCA 2X86A 1T2AA 4LMPA 1QMGA 1VPDA 3KSUA 1C14A 3D4PA 5G4KB 4BNUA 2C7VA 4WEQA 2QX7A 3QJ5A 3H5RA 2OXIA 2JD0A 4OGWA 3DBVO 5L45A 1X0XA 3VZPA 3GHYA 2O7QA 4H3VA 3U5TA 4LRTB 3AW9A 3EY4A 3MJEA 4IXTA 4D3FA 4BIIA 2NACA 4MVJD 2GD1O 4CM7A 1XQ1A 1C1XB 4FPXA 4GKBA 4Z9XA 1Z74A 2PD6A 4HKTA 1N2SA 3H3FA 3TZCA 4FIZA 4RORA 1GU7A 3OICA 2VWHA 4YDRA 4Z0HO 3LVFO 5KJ6A 1EEHA 4R54A 2YYYA 1WXDA 1HLPA 4NZ9A 4M89A 4RO0A 3N74A 1WMAA 3JYOA 1ZJYA 4LW8A 5KVQA 3I4FA 4YJGB 5IZ4A 2DVMA 4R68A 3C3XA 4RVFA 2C2XA 3KZVA 3TZ6A 3JQAB 3NUGA 1VSUA 3WGYA 1UAGA 2NSDA 4PG5A 2Y93A 2PH5A 4NBVA 4A7PA 3JD3A 1H6CA 2C07A 3Q9UA 5I9MA 4J0FA 4A27A 4B4OA 1RM3A 4I5FA 1E1LA 1B8UA 1T2EA 3MJVA 1ULSA 1UXHA 4F45A 4Z9FA 1TB4A 2FN7A 3OJLA 4NBTA 3CTMA 3QHAA 4B79A 1X1TA 4EW6A 1R4MB 3RUCA 2VNAA 3ST7A 2HK9A 2XXJA 5AXAA 4JROA 3JD1A 5C7IO 3H9QA 1GYQA 1YH3A 4XGNA 4TKLA 4QUKA 5IDWA 1MLDA 4BNXA 1ZEJA 3GFGA 1JWBB 1H2HA 2DLDA 1KEPA 1ZK0A 4P4LA 5THQA 1W8DA 2AE2A 4Q3DA 3SXPA 2HJSA 3ITDA 5LDGA 2BFPA 3GR6A 1ZSNA 4ZQGA 2P2SA 1HF3A 1VM6A 2NADA 3ANNA 2CFCA 3CE6A 1C0KA 3VPXA 3W6UA 1E7WA 4JN6B 4TRRA 3ZU2A 3WGHA 3WDSA 1S7CA 4XQGA 1TT7A 1IL0A 5TIIA 4RV9A 2VZ0A 3RQSA 3JQBC 2ZTUA 4BNHA 4AJ4A 1XKQA 2PKQP 3G1TA 4K28A 1KVSA 2ZB8A 3TRIA 3D3EA 1WZEA 3W8FA 4AJLA 4ONEA 1FDWA 2X0JA 3A28A 3RFVA 2YW9A 1DC4A 4DPMA 1PQPA 4D7AA 3PFFA 3ZWPA 1LRLA 1DC3A 1JVSA 1HDYA 1E6UA 4KUHA 3AJRA 1DXYA 1V6AA 2J8ZA 3HDYA 2EG9A 3VH4A 4S3MA 4W4TA 4NJMA 4GBJA 2JCYA 2Q99A 4WE3A 1EVYA 3B1FA 4XRRA 4AJPA 4BO4A 1PU2A 4HFNA 4MP6A 3D4OA 4RCVA 3VPHA 2O7SA 3VTZA 2PZLA 4CM1A 1ZVMA 2B4RO 2GGSA 4Y8VA 1DAOA 5G4LA 1Q0HA 2VRBA 1ENYA 4OQZA 3DBRB 3GPDG 4IIVA 4TZKA 3M2PA 3JQGA 1TVEA 1BVUA 2VRCD 3F5SA 4MVJP 2FZWA 3HN7A 1JVBA 5JO9A 4WLEA 4G5HA 3ZH2A 2YUTA 5A03A 5B1YA 3WSVA 1BXZA 3RKRA 3NTOA 5IG2A 5A06A 4PG8A 3EAGA 1GPJA 4BNWA 4OJNA 2WM3A 4NK5A 4QFCA 4L0QA 1NNUA 3PWSA 1JKIA 3WMWA 3WX0A 4OXNA 3R3SA 2CVQA 2EKPA 4BNMA 4OSOA 4WGGA 4PFJA 2RHCA 5HWSA 3JQ8A 4YJHB 4K1LA 4L4SA 3V8BA 1LC0A 1NR7A 3IDSA 1MGOA 5JAZA 3FTPA 2UV8A 3JQBA 2P4QA 4TKMA 1L1FA 4CJXA 2B35A 4BB6A 1DEHA 4PG6A 2NU8A 3FNEA 5TJ9A 3IC5A 5CG2A 2ZJ1A 1NHWA 2GRAA 5JC1A 1R0KA 2JD1A 1U5CA 3NJ4A 2PZMA 2VYVD 3F4BA 1Y8RB 3DZHA 3NGLA 3PHHA 4CM3A 2AHRA 1QV7A 1E7RA 1NWCA 1PS8A 1OC4A 3PQFA 4U7WA 3U9LA 4FGWA 1CRWG 2A92A 4PZEA 4Y6RA 1T1SA 1MV8A 1KERA 3NGXA 1ZMOA 2FHSA 3JQ7A 4PIVA 4J1SA 4DUPA 4HFMA 4DC0A 1KEWA 4FQ8A 2P4HX 4CMEC 1G0NA 3GT0A 3PVZA 3I9KA 2YV3A 1NXQA 2DUWA 1JAYA 5EPOA 5A5FA 4XR4A 4OH1A 3PJGA 2YZ7A 3WFJA 4E13A 1FK8A 1LC3A 1Z73A 3WQRA 1LLQA 1TXGA 2X9NA 4BMNA 1E0DA 2YY7A 4WJZA 2QYSA 1ZK2A 2AE1A 4DRYA 3F4LA 3RC9A 3E1KA 4CV2A 4YWJA 1FXSA 4E2YA 3PP8A 4IUYA 1M6HA 2QRKA 4RL6A 4IGFA 5KOIA 7MDHA 2X8LA 4OSPA 3PHGA 3QVTA 3SJ7A 3MJTA 2VHZA 1OI7A 3WGZA 4J9UE 3ETEA 4Z0PA 1YRLA 3S2IA 3OP4A 2AQ8A 2X6TA 5EQDA 1P1HA 2DUUA 1A7KA 4R1UA 3VVBA 1IY8A 5JY1A 4CMHA 1U3TA 4KOAA 2B36A 1BW9A 2WWRA 4Y67A 2CMDA 1R66A 3B1KA 1GD1O 4FBGA 3GNQA 1LDMA 1VI2A 3AY6A 4JK3A 4BNIA 1XA0A 3ICPA 3ZWAA 4G2NA 1LI4A 3QRWA 5CPFA 4BO8A 1KC3A 3AFNA 4RVUA 3F47A 3FR7A 5TRTA 2C82A 3BMCB 1F8FA 3FBGA 3Q3CA 1E7MA 4IMPA 3MEQA 5L4LA 2Y1DA 3CMCO 3M1AA 2JAPA 3ZCXA 2D4AA 2GPTA 1VC2A 2RBEA 3G79A 2FWMX 2BMAA 3OIFA 3DBLB 2AG5A 1UXIA 1ZSYA 1PR9A 5EIOA 4ZJUA 2RHRA 3EK2A 3QE3A 4RZIA 3RD5A 5IF3A 3D3WB 3HDJA 3ZV3A 4C4OA 1A5ZA 5DCUA 5ENDA 3ZV6A 4YAIA 3H5NA 1Y8QB 2A35A 4PLYA 1ENOA 5H81A 2UUOA 3ZV4A 1ISIA 4QO7A 4ALKA 2PD4A 2G0TA 3H5AA 4J7UA 1ZFNA 2I3AA 3CSDA 2CSUA 2CVOA 2AQHA 4D43A 1JTVA 5DCWA 1HDGO 1M6WA 2W2LA 3RROA 5G4KA 3MJCA 2E6UX 4L76A 3W1VA 1WNTA 1CWUA 4Y9DA 5ER6A 1IHXA 1I36A 2HCTA 3GA0A 2X7HA 2E82A 2PTGA 4CMCA 3OIDA 4NU5A 5KVCA 1ENPA 2WE8A 5JCXA 2VHVA 1QLHA 2CUKA 3BMNB 4GKVA 4BUCA 1DO8A 3JD0A 4G65A 2HSDA 3Q9NA 3E9QA 4U0KA 1Q0LA 1C1XA 3QWHA 4QQRA 4GWGA 4ALMA 1TEHA 2I5PO 1CYDA 2VN8A 2VWGA 3G1UA 1P44A 4UUOA 4AJKA 4QXMA 2AQKA 3JQEA 1T26A 1K5HA 5EMHA 5JCJD 3K8ZA 2WSBA 1D4FA 2PZJA 2C54A 2PKQO 4DYVA 3NKLA 1ZKMA 5G0VA 4PZCA 4BNGA 4Q3AA 5F1PA 4YJGA 4B4WA 2Q4BA 3WTCA 4ZN6A 5G0SA 2ZB4A 4W82A 1QYDA 3JQAA 4B3IA 4TVBA 3O26A 4HX5A 1PZEA 5A4DA 1UDBA 4PN3A 4J1QA 4RVGA 4W99A 1LDBA 2E49A 3HADA 1U7HA 1YQGA 4K9DA 5L7WA 4CPDA 4U5QA 4WNIA 2VWPA 1Y5RA 4CUKA 2VNSA 2Q1SA 3U4CA 2Y0EA 2PLAA 2HMTA 1IZ0A 4MDHA 1AXEA 5DOVA 1K6JA 3SVTA 1DHRA 1GQ2A 1M67A 1B15A 2AEFA 1E7QA 3BTSA 1OBFO 4EZBA 4D0SA 1TI7A 3ZZNA 1MC5A 1R4MA 3ZHXA 4OL9A 4CMKA 3EVTA 5JYDA 3F46A 2EGGA 2JKVA 4O0LA 4PRKA 3EDMA 1R12A 4PGFA 3GDGA 1EBUA 1FMCA 4NR0A 4MKXA 2QYTA 1X13A 4N5LA 1MA0A 5BT9A 4CMIB 2B69A 3ANLA 2HK7A 1KVQA 3ZWBA 4XGIA 1E3EA 3FF4A 4ZGWA 2HMWA 1E1MA 1H9AA 2DBQA 1X7GA 1X7HA 4FN4A 4BNTA 1MUUA 5AXDA 3Q1LA 3VPFA 3ZNOA 2BF7A 1EFKA 1LLCA 2HMUA 2ZCVA 4R51A 3INTA 1GPDG 1TLTA 4TROA 3X2EA 4B7CA 2DM6A 1QXSA 5GY7A 2RAFA 2Y68A 3GY0A 4FR5A 2YQ5A 2O3SA 1PSDA 1Y5MA 3BIOA 3NT4A 1GCOA 3ADOA 3DXFA 1XU9A 3F6YA 3WIEA 2R00C 3DZKA 2Q1TA 1XU7A 2VOEA 4NMHA 2IODA 4PVCA 1X1EA 2YFHA 4IQ8A 3MJ4A 2EP5A 3I9LA 4M54A 3NRCA 3R0IA 2PWZA 4WLOA 4EEZA 1B7GO 3DMTC 1KS9A 4R1NA 4F6LA 1KVUA 5DULA 1NPYA 3W4KA 5A9TA 4HFJA 4OOEA 3GRPA 2VTEA 4CL3A 3LYLA 4XEHA 1N8KA 4ZD6A 5CFZA 3PIDA 1A7AA 4JJGA 4DQXA 4CM9A 4WCFB 3O03A 4NH4A 3WYBA 3U62A 5LDHA 3ADPA 1UJMA 5KKCA 1NVTA 2EJWA 3EMKA 6LDHA 1SNYA 1R4NB 5IAAA 2ZQZA 3CINA 1PQUA 4W9NC 3DBRA 3HDHA 1E3JA 1C3VA 4OXKA 1YBMA 2NQTA 4ESOA 4YRDA 3Q6IA 2Y1EA 3WB9A 1ONNA 5KTKA 4MIEA 4QTZA 1DIGA 3H3JA 3OJOA 2AEJA 4PCVA 3IJPA 3WWZA 3U4HA 3GUCA 1I24A 3MZ0A 2X5JO 3ZNNA 3QVWA 4AJIA 5CDGA 1QP8A 1NHGA 3PIIA 2YJZA 3FHLA 3L4BA 5F5LA 3NTQA 1FJHA 3JSAA 8ADHA 1UZNA 4YJHA 4UVHA 2HUNA 1R6DA 3H7AA 1HDRA 2DPHA 1Q7CA 2QW8A 4PG7A 1ZSVA 4M8SA 3QA9A 3GVHA 1GDHA 3CH6A 1L7DA 2I3GA 1ADBA 2V6MA 4Z9YA 1FDSA 1T24A 1IULA 2R00A 4BO0A 3P2OA 4EBFA 1U3WA 1ISFA 4FDAA 4NNJA 1SC6A 5F5NA 3PI7A 4IDBA 3KTDA 1VL0A 1SO8A 4K6FA 4L75A 3ZHZA 1DSSG 1Y8RA 4YJFB 4E33A 4I9HA 1ARZA 4RDHA 3DDNA 2BI8A 3JYLA 4XIYA 3DMTA 2EKLA 2GZ1A 1AGNA 2C7GA 2P91A 3KETA 3GH3A 4IGEA 2IYOA 3JD2A 5A5EA 3QW2A 1YBAA 3U49A 2HLPA 3RUAA 4YYZA 3QSGA 2XOXA 4L4RA 4YPOA 1C1DB 1OOEA 4LSMA 4MP8A 4R9SA 5A02A 1ORRA 1UUFA 2C20A 1BDMA 2V6FA 4I8XA 3WICA 3KLMX 3DHYA 2HAEA 1GZ3A 3EZYA 3I6QA 3O38A 4CR6A 2IZ0A 3ZN2A 4BNKA 2DTDA 4W9NA 1DIRA 1LLDA 5DF1A 1AHHA 2Y99A 3GVIA 2E37A 4XYEA 5GZ6A 1GYRA 4DQVA 1DLIA 4P38A 5CEEA 2Y1GA 4LISA 4L4XA 2OL4A 3KUXA 1ZK1A 3UW3A 1YQXA 2W2KB 2CNBA 3TDKA 2IZ1A 3A1NA 5DDIP 3ONEA 2BGKA 1B16A 2YHIB 2V7PA 2V6GA 3OETA 1A27A 4KQXA 1XGKA 4DPKA 2AA3A 4DPLA 2A9FA 4MVJM 2HDHA 3NAQA 4BNVA 3PLNA 3WLEA 3K92A 2BHLA 2HMSA 3I83A 3TPCA 4BO9A 2NUAA 4EUEA 1V3UA 5U1PA 3IKVA 1Y9EA 2YDXA 1IHYA 1N1EA 3FWNA 3DFUA 5L40A 4CQLB 4HNHA 4INAA 2F1KA 1I33A 1O95A 3I9JA 1U5AA 4GVLA 4RF5A 4WNCA 3HG7A 3M2TA 4RF2A 2G1UA 5KVSA 2P9EA 2OUIA 1KEVA 1CJCA 1EZ4A 3NDIA 3WXBA 1E77A 4BO5A 4ALJA 1MFZA 3BMCA 4R5HA 3PTZA 2GUGA 3R3JA 1XWFA 1LX6A 1B0AA 1RM4A 1EVZA 1XG5A 1E6EA 5T57A 5HA5A 3RFTA 1LSSA 2PGJA 2IXBA 3ZWOA 2EEZA 1LSOA 5L4NA 4YCAA 3SJUA 1I32A 3GRKA 1B14A 3VPSA 3MCVA 1QYXA 5AVOA 6ADHA 3DBLA 1P0CA 3WYEA 3E48A 4CQMD 1PJTA 1PZHA 4GVXA 3D3WA 2DTXA 3OEWA 1GV1A 1P1FA 5F21A 1JA9A 4JIGA 2IZZA 3VPGA 3RBZA 5BSHA 4MVJE 2Z95A 4UULA 1Y8QA 3GF4A 4UEOA 3PJFA 3EYWA 5DZSA 1NPDA 3QY9A 3FNGA 2GCGA 2CVZA 4WKGA 1UH5A 1BTOA 3PGJA 1HTBA 2GSDA 4YT4A 4CMJA 4F46A 3LT0A 4AICA 3OBBA 3WJAA 4KTVE 2DKNA 3ZU4A 2X0NA 5COQA 3ZHYA 4CM9D 1YB4A 1P31A 1E7YA 4BOYA 1GCUA 1NP3A 5A9RA 4D3SA 5ADHA 3DR3A 3BMNA 4J16A 3U3XA 3EHEA 2C59A 1W73A 1GQQA 1RM5A 1X7DA 3F5QA 3DAPA 3OEYA 3EZLA 1GAEO 3LDHA 2DQ4A 1DIBA 4R5MA 4E5KA 3BZUA 4UVDA 3I23A 2Y1FA 5IXSA 1LQTA 4DQUA 1A9YA 2FP4A 4FGSA 3U4IA 3LT4A 3LC7O 3AWDA 2X1HA 1M66A 3INRA 3LZ6A 1ZUD1 4LRSB 4P22A 5JMWA 1HE2A 4GMGA 3HFSA 1OC2A 2WD7B 5CHEA 1G0OA 4BL5A 1FDTA 5I8ZA 1J5PA 1EBFA 2VYND 4GLLA 4PLVA 3WJ7A 3SLGA 5F1KA 4D42A 1I2ZA 1ISGA 1F12A 4I5EA 2OOSA 3FNFA 5TJHA 3AUSA 1QV6A 4L74A 3KEOA 2OORA 1D8AA 4AJEA 4PLCA 1LRKA 1P3DA 3CZMA 4A73A 2GASA 2J3HA 3IUPA 3RASA 4IMRA 4IY1A 2Q50A 5IDQA 3F3SA 3D7LA 2IE0A 4NDNE 3K73O 3RUHA 1DC6A 1UP4A 1LLUA 4J1NA 5CDYA 1XR3A 1E3SA 3GVXA 4R9RA 1GR0A 4PZDA 4YEDA 3GN1A 5JDIC 3B20A 4E5MA 1D3AA 3FN4A 4LK3A 4DWVA 1BDBA 4WCFC 2NQ8A 3ITKA 5CEJA 1ZIDA 5BNTA 5KJFA 4KQWA 2BELA 1V35A 3OSUA 1NQAO 4K6CA 3UCFA 2H63A 4JGBA 1X14A 3BAZA 3Q11A 4OMUA 1QYCA 4DMLA 4GX2A 4B3HA 1A4IA 2I67A 3V1TC 4W7IA 1V9LA 3RU7A 4DTIA 3D0OA 5BSEA 2VCYA 4CMIA 4WLVA 4NFHA 1B26A 4R01A 4W7HA 1TT5B 2UVDA 4OO3A 4S1VA 4EJ0A 3NDRA 1DIHA 4AJ2A 2W8ZA 5G2OA 3DONA 1LU9A 4CV0A 4XZ3A 4A03A 1N9GB 4XDYA 1GUZA 4GMFA 3WGTA 3LLSA 1YOVB 1Z7EA 2IYPA 4YBZA 3IL2A 3UVEA 1L7EA 2XPCA 1I2BA 1M76A 2GF2A 4Q9NA 4BNJA 5A1TA 3BTVA 1KOLA 3AK4A 1MX3A 1A72A 4XQCA 2C5AA 4CLHA 1KIFA 2NVBA 3LU1A 1WZIA 3PYLA 4J49A 2Z5LA 4AG3A 3F1KA 2WE7A 3NT2A 2Q2VA 5COAA 4E4YA 5DOZA 4CLEA 3AM3A 1HSZA 1YL6A 2NNLD 4Z0TA 3PPIA 3RC7A 3WBFA 4IQ0A 4Q39A 1YBVA 1BVRA 5JDIA 1OMOA 1SAYA 4RVHA 5DCYA 4MJLA 1DIAA 1SEVA 3KYDA 1F06A 3OJEA 4CLRB 4JCOA 4GPD1 4HY3A 4M87A 2VHYA 4WCFA 3RI3A 3ZWMA 1JW9B 5IN4A 3UN1A 1KEUA 2B83A 2VT2A 3S2GA 4IS3A 2JHFA 1W4ZA 3EC7A 5L4SA 3HQ4O 2YV2A 1R16A 3DZIA 4PLGA 2ZYAA 1GEEA 2DFDA 2ZTVA 4JXKA 4WLUA 4MPDA 1MG5A 1T4DA 3CEAA 4UVIA 4J2HA 3GPIA 1SPXA 3WQSB 3ZWVA 1P1RA 2HQ1A 3DOJA 3GEMA 1ENZA 3C8MA 3K31A 2DU8A 2O48X 1RM0A 2XF8A 2G76A 4XB2A 5ENVA 2IEBA 4AJJA 3W6ZA 4IDFA 3QVOA 5CDUA 4GWKA 4ZQHA 4HUJA 4IPTA 1XCBA 4J4TA 5JW6A 3ZI0A 1CIVA 3DAGA 5JLAA 4JBIA 3TZHA 1I01A 4NU6A 1OFGA 1SB9A 1GY8A 5H82A 1ADCA 3MOIA 3JQ6A 3T7EA 5A3VA 2EP7A 4CM8B 4B7UA 5CEFA 4RQUA 2NWQA 1O89A 4RLSA 1MXFA 4RZHA 2AXQA 1ZW1A 3KYBA 2ET6A 4DIFA 3FTNA 4YJFA 2J5RA 2VOJA 2Q2WA 4XYBA 5FI5A 3BMOB 5FI3A 3RUFA 2FOIA 1DRWA 4EJ6A 5I7FA 1N7GA 1YS4A 1ZCJA 5TLSA 4GQAA 3VDRA 2E48A 3IJRA 4RF4A 2HK8A 5C7LO 2D0IA 2NLOA 3GFBA 1LDGA 3MJSA 1Y81A 1C1DA 1R37A 3NEPX 4ALNA 2VHXA 3ETDA 3K5PA 3CXRA 2GNAA 5KWEA 3MTJA 3E5RA 3JQFC 4OKIA 5C5IA 1IPFA 2PGLA 4ND1A 9LDBA 3BMQB 3JQDA 3HUDA 3KSZO 1DJNA 5G0UA 2BGLA 1E6WA 3IAHA 4F6CA 2C5EA 3PWZA 3FPCA 2DFVA 4DA9A 5HTOA 4NJOA 3GZ4A 1JAXA 3GC6A 4WUVA 2VTDA 3L0DA 3ZWCA 3ENKA 4OKNA 1FDVA 3DMYA 4CR7A 1Q7GA 4YAJA 4BNFA 3PYXA 1Q1NA 2W2KA 4CMEA 1U8FO 5EINA 4E12A 1HE5A 3LT1A 1UDCA 1SOWA 5MDHA 2YHIA 2ZK7A 1P77A 1VJTA 3HE3A 4DC1A 5TQVA 3P2YA 2GR9A 4Q3EA 1V8BA 1HZJA 1KETA 4NPCA 1DFIA 1ZH8A 4XKJA 4J90A 1U4OA 1W6UA 1O6ZA 1EMDA 3QLJA 1Y6JA 4YB8A 3EGOA 3OQBA 2WD8A 4RGBA 1HEUA 3DB2A 4CLOB 1EUCA 4JLWA 4O5OA 3RFXA 3GGPA 4H15A 4N7RA 4E5NA 3U0BA 5FEUA 4BKPA 4ZRNA 2X58A 4HP8A 4CQLA 2EKQA 2A4KA 3O9ZA 3RJ5A 2PD3A 3W4JA 3I3OA 3MOGA 3ZWWA 1CDOA 1U4SA 1NVMB 4NHEA 4N18A 4E21A 3PDJA 3JYQA 2O3JA 4J6FA 2HU2A 5JMPA 1B8PA 2QG4A 2FZEA 5CDTA 2RH8A 3VOSA 4LMRA 2TMDA 4BO7A 2WYUA 2HO5A 2P9GA 3HN2A 4PLTA 3OH8A 2EGHA 2CY0A 1SB8A 4JNKA 1MB4A 2NVUB 1I2CA 3VDQA 4RQTA 3WR5A 3JQFA 5FFFA 2EIHA 1HRDA 2GYYA 4GGPA 2TMGA 4BHTA 1B3RA 2OP0A 1LTHR 2B5WA 5EESA 5TS3A 1GFSA 3BXXA 3STHA 1VJ0A 4ROSA 3OIGA 1ZEMA 1EFLA 4R16A 5G0WA 1I3MA 5I9NA 4MVJF 3RC2A 1HDOA 4EUHA 2P5UA 1C0PA 4ZQFA 2JCVA 5DP2A 1QORA 5C3MA 3Q2IA 3UGKA 3WFIA 1ML3A 2IDZA 3KLPX 3W8DA 4E5YA 1V3TA 1UXJA 2FSVA 1PGQA 4TRJA 1P0FA 3I9OA 4KUEA 3KXDA 1BXGB 3QQPA 2YQ4A 2OP1A 4MKZA 1QYWA 1VE9A 1VRWA 1U2DA 4XQ9A 3A4VA 1EUZA 4MVJI 2GDZA 4QX6A 4WECA 3AU9A 1EK5A 1IE3A 3OMLA 2DBRA 2ZTLA 3H9EO 3VKVA 3C1TA 3TOXA 1ZXBA 4BO6A 1PIWA 5AOVA 4Z3DA 4DGSA 4X54A 3VZRA 5HRUA 2WDZA 3KB6A 4JP2A 5FWNA 5I7VA 4TRMA 1BG6A 2WD7A 2Z1NA 4IZIA 1PR3A 1MG0A 4IZHA 4ID9A 5F1OA 4XIJA 1ZZEA 3PLRA 4J91A 2OFPA 1ZNQO 2NU9A 3PJEA 5B4VA 4ZVVA 2C29D 2G82A 3GVPA 3M6IA 5AQ1A 1M75A 1YXMA 2FMUA 4EUFA 3QV1A 1VKOA 4II2A 4YR9A 3X2FA 1IYZA 4E5PA 4GSKA 4NJMB 3E8XA 4OOFA 4YAEA 3KYCB 5T67A 3WGIA 4AJ1A 4TWRA 2PNFA 3SBOA 2X4GA 1T2FA 1NFQA 1YB1A 3GGGA 4BMSA 5EERA 4HFRA 3QIVA 3DZGA 4FB5A 2JFGA 3UCXA 3VAZA 2FR1A 3ROKA 3FI9A 3PYMA 5JNLA 3NJ8A 5BNIA 1DC5A 2XXBA 1YKFA 2F00A 4JBGA 4LSWA 4D0RA 4WLNA 1WWKA 2HRBA 3H8VA 3TFQA 1B2LA 4R1TA 4XGKA 5ITWA 1XSEA 3O4RA 1XDWA 3RWBA 2D2IA 4J4HA 3IQDB 2O4UX 5CAEA 2A94A 2GZ3A 5BNFA 1U9JA 2I9PA 1TT5A 5H83A 4DBZA 1S6YA 3T4EA 3ROQA 3V2GA 1UZMA 4BB5A 3OQ6A 4A0SA 1LNQA 1KBZA 1AUPA 1HETA 4GI2A 3QWIA 1QKIA 2X9GA 2O3RA 2JL1A 8LDHA 4GGOA 5A9SB 3ABIA 1N9GA 3I6IA 3JYNA 3N58A 1Q0QA 3K6JA 1DRVA 4YAKA 2DT5A 1YOVA 5IZCC 3ASVA 4AJOA 3DFZA 2CZCA 3INGA 3PRJA 1D1TA 4AFNA 3HWRA 2JFFA 3NYWA 2O2SA 1PGNA 1Z7BA 5ILGA 3PQEA 1W0CA 1WPQA 4J1TA 3ONFA 2GO1A 1XHLA 4GSLA 1T25A 1ISMA 2PR2A 4NBRA 2OGUA 5TGDA 5EL0A 1Z75A 3S1LA 3GEDA 1J4AA 5HBRA 1HKUA 1WP4A 5ICSA 2W90A 4E3ZA 3D1LA 3RCBA 4TZTA 1RYDA 3BA1A 4U8GA 4XQEA 2VZ8A 4OXYA 4WASA 3LK7A 5LCXA 1D7OA 2PKRA 4CV3A 3IIEA 2W2LD 3GUYA 3GZNB 3COSA 3PHJA 3KV3O 4CLRA 2FPGA 4UVEA 2O50A 2AQIA 3ICCA 2G5CA 1C0LA 3AM5A 1HYGA 2FRDA 4NIMA 4FFLA 5TNXA 1BMDA 1YDEA 3UUWA 1I10A 1VSVA 3EVNA 3DO5A 3HB4X 2AEMA 3ASUA 5L53A 4A10A 2NTVA 3C7CB 3ZV5A 4HXYA 3JTMA 2Q46A 5A05A 3E18A 4KP7A 3E5MA 2P9CA 2AW5A 3V2UA 5C37A 3PWKA 2JFHA 1I30A 1YVEI 5I9LA 3AUAA 3UCEA 1N7HA 4HV4A 3DAFA 1ZJZA 1PL6A 4XYMA 4NQZA 1PJ2A 5DBGA 4CMBA 2Q49A 4ZQBA 1WMBA 4NBWA 3T7CA 3D4NA 2RIRA 3KOUA 3GMDA 3JV7A 4FCCA 4GLOA 5EQFA 2V65A 1N5DA 1PGOA 1NM5A 2RCYA 3NDJA 2QRLA 4HNGA 3L4SO 4FJ0A 4IJKA 3JQAD 2POQX 5KCZA 1NFFA 4XJTA 4BKRA 1Z6ZA 1HE3A 1J6UA 3VVCA 2O4CA 3ZGYA 1DAPA 4XWYA 1QG6A 4FOSA 3OA2A 3K2BA 2D5CA 5TX7A 4RPKA 4B8ZA 2Q45A 1E5LA 4QSMA 5AXBA 1O0SA 5EN4A 1CQIA 3AUTA 2JCXA 1IPEA 4DXHA 2Q1UA 1Y1PA 1O5IA 1ID1A 1PJSA 1DLJA 4RDIA 4H16A 4J43A 4JJFA 4AL4A 4J0EA 4QO8A 1UXKA 4JQCA 3BMOA 5DBIA 1NQ5A 1ZBQA 3H4VA 4FC6A 3ZU3A 4A26A 4Q3BA 1LXCA 9LDTA 3IP3A 1NAIA 4NFSA 5B12A 3VHRA 4M49A 2B0JA 1DPGA 3C7DB 3KHUA 5L95A 2VRCA 2Y67A 3AY3A 3SX2A 1IZ9A 3L07A 3UFXA 4BO2A 3TJRA 1NX6A 1T1RA 1VL8A 3LT2A 3GDOA 3KRTA 1P1IA 4CL8A 1SMKA 3WGQA 2Y0CA 3ONDA 3L6EA 2WMDA 5ES3A 2BGMA 3BMQA 1ZK4A 3UH1A 2OO5A 2ZB3A 4K26A 3QVXA 4BVAA 1U28A 2VUSA 5B37A 1FF9A 1UAYA 4WOKA 3G3EA 4Z3KA 1JU9A 1IOLA 3L6DA 3DZFA 4GX5A 2UAGA 2PV7A 2FPPA 4XDZA 4UUNA 3W8EA 3PZBA 1ISHA 5GMOA 3L6OO 4C7KA 1GQYA 3WMXA 4BQRA 4PG4A 1U1IA 2QZZA 4IBOA 5GZ3A 4WK6A 1QSGA 2VYVA 4Y6SA 3OFSA 2WJPA 1O8CA 4TRNA 3GHHA 1QRRA 1G6KA 3DTYA 3LQFA 4L8VA 5DP1A 1N92A 3RIHA 4CLOA 3IKTA 2D8AA 3GNSA 4XX0A 3TQHA 2ZJ0A 2EJVA 1LQUA 4I1IA 3B6ZA 1K6XA 2ZCUA 4BNLA 1ZXLA 4A2CA 4XA8A 3GAZA 4CV1A 4LGVA 3PK0A 2PGDA 1PJ4A 4XR9A 2HMVA 1PZFA 4RPJA 3TF5A 5KJCA 1EUDA 1GV0A 1I3KA 1F0YA 2G17A 5ICMA 1JKFA 4MOWA 3AUUA 2X0RA 4P8RA 1YJQA 4I5GA 1ISJA 4DBVO 4XRGA 2X5KO 2HJRA 4Y98A 1VKNA 4O59O 1CERA 3RJ9A 2PA3A 1EK6A 3GQVA 4E31A 4JJIA 4PRLA 3BTUA 4YA6A 4DIOA 1R0SA 2NVUA 2W98A 4AVYA 3U4DA 4AJHA 1HWYA 3WLFA 5KVVA 3P5SA 4IJUA 2J6IA 4MIYA 5JXWA 4EEXA 1PEDA 1SZJG 2CD9A 3AI2A 3ANMA 3UXYA 4MIOA 1EDZA 3L77A 1JQBA 2RH4A 3PGXA 1NASA 1NPTO 2EW8A 2EHDA 3K30A 3JQ9C 4FSHA 2J3JA 4UREA 1XIVA 2ZQYA 4F3YA 1HDCA 3RKUA 3FRJA 3TL2A 1WDLA 2I66A 5F3RA 4GAEA 2X9VA 4ITUA 1J0XO 2UYYA 2EERA 3Q2KA 3KVOA 4I08A 1I3LA 1K2WA 1SOVA 5IDXA 4N5MA 3CPSA 2HKIA 3GDFA 4BKQA 4CLDA 4N54A 1LDNA 2IEDA 3K9QO 1BXGA 3WS7A 2VQ3A 4UUMA 3CZRA 4IDEA 4H7PA 2P5YA 2Q4EA 4BV8A 1JDJA 3C24A 3O8QB 5KKAA 1DRUA 4CUJA 2ZYDA 1H94A 3UHAA 2Y66A 1BXKA 4O1MA 3FR8A 5JE8A 1B8VA 4O6VA 3OF2A 4UAGA 1PJQA 3RBVA 1HE4A 1F8GA 3L9XA 5TT0A 1BGVA 4WOJA 4XB1A 2O3QA 1X15A 3UAGA 2OBYA 4ND2A 3SEFA 4R4JA 4YQYA 4BS9A 5ILOA 1H93A 4P4NA 4CQMB 3VH3A 4ILKA 3MWDB 1PTJA 4N5NA 5J23A 1LSJA 1NAHA 3SLKA 4HADA 3QVSA 1P1JA 3E03A 4I9UA 2B4QA 1KYQA 1PJBA 3UOGA 1YJ8A 3MTGA 1WVGA 3I9MA 4LN1A 1UP7A 1DHTA 4DLBA 5BR7A 2JHGA 3H2SA 1RWBA 1AXGA 3VZQA 1HLDA 3I4CA 2QRJA 3TWOA 4EI2A 7ADHA 4NG5A 4CR8A 3LC1O 3TN7A 3GG2A 4DLLA 3IUSA 5B4TA 3KYCA 4I5DA 1YDWA 4YJDA 3RU9A 3VZSA 1B3BA 4A5OA 3PFWO 4FFOA 1MP0A 5HS4A 4CLXA 1C0IA 2ZKLA 2OMEA 1P33A 3WQQA 4ZHSA 5DN9A 4BKOA 1MXHA 3V2HA 1XLTA 3HFGA 4GH5A 1Z45A 5JAQA 3JQ9A 4M1QA 5AXCA 5L7YA 2B5VA 1IUKA 2I6TA 4TMFA 1RKXA 4JX8A 4B4VA 1NR1A 4UEJA 5CP8A 4DVJA 4Y6PA 4MP3A 4FC7A 1NQOA 1ZK3A 1A9ZA 3JCZA 1U7TA 4NBUA 1LDYA 3TL3A 1KVTA 3C1OA 3F1LA 4TSKA 5JCJA 4YAGA 3AM4A 3GVCA 3PZRA 5HS6A 3ZWXA 1PGJA 2AMFA 3ORFA 4J7CA 4NK4A 3UF0A 3I1JA 1WAMA 4Q3NA 1E5QA 4BKUA 3VC7A 4FD3A 3OJFA 3DZBA 4CM6A 4ALLA 2NVWA 3KBOA 4R3NA 1R4NA 3BTOA 4XJSA 3VKUA 3WOHA 1BWSA 3HB5X 2ZB7A 5A9SA 3AFMA 4CMAA 1XELA 5T6BA 3ULKA 4YVFA 4YT2A 5LC1A 1PWZA 2WEKA 1P1KA 4UVGA 3JYPA 1DB3A 1HZZA 3DOCA 1YL7A 3HSKA 3BHIA 1I3NA 2EW2A 4IJWA 3HHPA 1PWXA 2IXAA 2QQ5A 3GN2A 2D5AA 4HBGA 4QEDA 4PLZA 1Y9AA 1RJWA 3A06A 4R41A 2O2YA 4CM4B 3GMSA 3E6AA 3ZNPA 2JAHA 2XAAA 1PGPA 1E1NA 3I5MA 1ADGA 1PQWA 1DJQA 1H0KA 2B37A 4R69A 4PLFA 3QWFA 5L51A 3ZDFA 3ZWNA 5TT1A 3LSYA 3BHJA 1PJ3A 3D5TA 2VT3A 1E92A 1I5RA 1V0JA 2EXXA 3ROMA 4M55A 4ZRMA 5AYVA 4BO1A 1H6BA 4Q3CA 4YACA 4DLAA 1HYEA 3GZNA 1YQDA 3DBHB 3H9UA 2JJYA 2VHWA 2C2YA 4HWKA 4M86A 4LVCA 2JD2A 4BMVA 4D45A 5JC8A 1ONPA 4XYLA 1N1GA 2QHXA 2YFQA 2PH3A 4TVOA 1R15A 2BRUA 4E30A 1O9BA 1DFHA 2PY6A 3G49A 5ITVA 3F9IA 4J4BA 5COBA 2E4AA 2VUUA 4FJ2A 1LSUA 4IINA 2FPIA 2Q2QA 4FFNA 3ZW8A 4P4GA 5JY6A 3ZWYA 5TSDA 5K9ZA 1GYPA 3HZZA 4E0BA 3W4IA 3B1JA 3JD4A 4E2XA 5JO0A 2GN6A 3RSHA 3FWZA 1K0UA 1Q2XA 2W4QA 3PXXA 3DZJA 2R6JA 3QP9A 2ZIZA 2Q3EA 4BO3A 1EQUA 5K6AC 1LEHA 1ZMTA 4FS3A 2V6BA 3LC2O 3P7MA 4IQGA 4FJ1A 3S2EA 1SEPA 2NU7A 1E3WB 4RJTA 3FPLA 4BNNA 1T2DA 1YE3A 1QLJA 4DIBA 5L7TA 3BYZA 1LRJA 5BSFA 4J2OA 4D79A 3V5NA 4ND4A 1KC1A 1MC4A 3NV9A 1UP6A 4MKRA 4RVSA 2LDXA 3G17A 3PHLA 4U0JA 3ETGA 2DC1A 4YRBA 4EDFA 4YT8A 4FFRA 4IIUA 5CPBA 1PJLA 2NM0A 2WYVA 3MWEB 1YONA 3FBTA 5TF4A 1XQ6A 2I99A 3RC1A 3A9WA 1UZLA 3CIFA 3TZKA 3VH1A 1HYHA 5JDCC 2DAPA 2PK3A 5IDYA 1E7SA 4D41A 1T4BA 4D44A 4NI5A 2BKAA 3WSWA 1WDKA 3WNVA 3C85A 3RUDA 3ZW9A 3DQPA 4GX1A 4OIMA 5U4QA 3AOGA 1HDXA 3H9GA 3A14A 3S55A 4BGEA 1BHSA 3OECA 2QZ9A 4ND3A 2EWMA 4TQGA 1NVGA 4BGVA 4YXFA 1X0VA 2GLXA 3EW7A 1H5QA 4KWIA 3WG9A 1HT0A 3C1AA 1E1KA 3N7UA 1Q7BA 5T5QA 4IDCA 4IM7A 2ZTMA 3FD8A 2H5LA 1RPNA 5G0TA 1U3UA 3TNLA 5I8WA 1H2BA 1V3VA 2R2GA 5CG1A 4FOOA 1EE9A 2WTBA 3I52A 5I7SA 3OJ0A 3OA0A 4J9VA 4QT0A 1GZ4A 2ZATA 5T64A 5L9AA 4E6PA 1NYTA 3U09A 4IDDA 4IDAA 3K2EA 1HXHA 4D3DA 3ZU5A 1CETA 1GADO 1HL3A 3DWFA 5FYDA 4UUPA 3ENNA 4URFA 3ON5A 1AN9A 2NTJA 3B70A 5KJEA 2Z1MA 3IP1A 1AHIA 5KNLA 2D59A 4YT5A 3HJAA 1WLYA 5K6AA 2OHXA 1P74A 4LCEA 2AG8A 5JAMA 1ULUA 1T2CA 5FF9A 3KEQA 4YTEA 4B3JA 3K96A 2VZ9A 2PZKA 3KM0A 5IXYA 3Q0EA 4XYGA 1SCUA 4IDGA 4CMGA 2BH9A 4LCJA 2FSSA 3GGOA 4J7XA 3WWYA 4B7XA 5JYEA 5MGBA 3DL2A 2VUTA 1DFGA 3AI1A 1U8XX 4KDFA 1CQJA 2BFOA 4DYDA 4EYEA 1JN0A 2X22A 1KY5A 5JDCA 2HRZA 2EF1A 3IOYA 2C0CA 4KDEA 5THKA 4GX0A 3PJDA 5T8KC 1VL6A 3WNQA 1OZAA 3RUIA 1M2WA 5DBFA 2BI7A 1YL5A 3PHIA 1DBVO 1PL8A 1YWGO 4WEOA 1VJ1A 2WYWA 5BSGA 2GN9A 4BNYA 2NTNA 2Y0DA 4PLPA 5DNAA 3OM9A 2X23A 1HSOA 3OHSX 3DC2A 3NX4A 3NTRA 4FFMA 1ZO8A 4PVDA 3TFOA 1NTOA 3IMFA 4U6QA 1EQ2A 1E3IA 4BQPA 3H2ZA 1FDUA 5KJ1A 1ONOA 3D5QA 5KIAA 1EDOA 2YV1A 3BHMA 4IXWA 5A3JA 1LJ8A 2CF6A 4YQZA 1GL3A 2BFAA 3ROPA 4MINA 5C7OO 1K6IA 3AI3A 2CDCA 3LLVA 5K1SA 3GAFA 1SBYA 2BLLA 3E82A 1EVJA 3T4XA 2H1SA 1HDZA 5JAIA 1F14A 3IS3A 2O3TA 3GG9A 3KSDO 4YRAA 1H9BA 4RLHA 2GERA 3AOEC 3O8QA 1BSVA 3L4BC 4RPLA 2J5KA 3L9WA 4ZA2A 1GUYA 1ADFA 5ER9A 3FSRA 1BRMA 4MVJA 1P45A 1TA4A 4XCVA 3JQGB 5DT9A 4I9NA 3WGOA 3WYCA 3TOZA 5JBIA 1U3VA 3H9JA 1D1SA 3PQDA 1K89A 4PLWA 4B8WA 4ZQEA 4DMMA 3RUEA 3LF2A 4CQMA 1UDAA 4II3A 5JPIA 4EJMA 3RBXA 3GEGA 2J3KA 1GTMA 4OM8A 1Z82A 3UKOA 4RVDA 5BQFA 3NT5A 4KUGA 2Q1WA 3RAJA 1WDMA 5JSFA 2I65A 1LUAA 2SCUA 4XD2A 4JP3A 1I0ZA 3CUKA 5T8KA 3DEYX 3JQ8B 5L3ZA 3LF1A 1YB5A 3S8MA 4WPGA 4O63O 1IB6A 4IS2A 2BD0A 4W6ZA 4OQYA 3ZHBA 4BV9A 4CODB 3GOHA 3AY7A 5JFOA 1AE1A 2CDBA 3KYDB 3DTTA 1GEGA 1F17A 4RF3A 2D1YA 2J5QA 4G81A 1K3TA 5I7EA 3R1IA 2BFMA 2PFGA 2DBZA 4OHUA 2DPGA 1J49A 3CKYA 3EUWA 4MVJH 2O23A 2IRWA 3GK3A 2VWQA 2CF5A 3PEFA 1UR5A 1G1AA 3V1YA 4PLHA 2H6EA 1CEQA 1MFPA 3DHNA 5IN5A 4CUZA 3JQ7B 1A4UA 1NFRA 5TC4A 3E9MA 1H6DA 3M1LA 1GUFA 1CF2O 3V1UA 2Y1OA 1NWHA 4CM5A 1A71A 1YGYA 1KVRA 4FFPA 3H6KA 4OAQA 2NV6A 2OZPA 3GLQA 3AOEA 2VYNA 1H6AA 2D3TA 4R1SA 4FW8A 4MVJG 1JLLA 1Y7TA 2CDAA 4BGIA 1OAAA 3I9NA 3R6DA 4RPHA 1UXGA 2X5OA 2DBVO 3ZNQA 2H9IA 5JS6A
chains in the Genus database with same CATH superfamily
3UH0A 4IDOA 1T36A 2ZUEA 1PS9A 1SBIA 2O2DA 4Z86A 4MUHA 5CLFA 3HB1A 4ALIA 1VE7A 2GBLC 1QR6A 4NE2A 1VLLA 1JWAB 2FQ1A 4GMXA 1X1CA 1PJZA 3KYIB 4NFYA 1YZUA 4HAIA 5HKBA 3I62A 2GAFA 1VXOA 4DLVA 2KHZA 2QX9A 2IWHA 1MAUA 1RVDA 4IJVA 5E1BA 4F60A 3C3BA 2WLTA 2WJJA 4KMSA 5F2OA 3SC4A 3DSRA 4U2BA 2H1IA 1B6TA 1SXJC 5DM70 2I78A 3HNPA 2C7RA 2GK4A 5DPMA 5BSMA 1I8TA 4B3FX 5BWMA 2Y0PA 4K8OA 5CVJA 3EEOA 1YVUA 3OIUA 2LDBA 2OYRA 2ZYGA 3PNYA 1RE0A 3GUHA 1VRVA 2H31A 3DUFA 4GNKA 2J3IA 3HU3A 4PCUA 1MO4A 3IDZA 3FCOA 3CF6R 1Q6YA 1VHDA 3OZCA 3Q8XB 3MILA 4OYRA 1HX7A 1PR6A 1XALA 1OX5A 2FZLA 3AJDA 3MRVA 3NW9A 3O8LA 3V8QA 4RPGA 3ZTYA 4EUSA 5ABPA 1F4VA 1M73E 3L7YA 4LGYA 4EGFA 1N78A 5HR5A 5J4HA 3VNVA 2Z30A 2WIAA 1WDTA 4G8CA 1ZH6A 4ME6A 3C6XA 1Z83A 2OD7A 5GZ1A 1RYHA 3T3DA 1QGYA 1R10A 4GPTA 3URKA 3D64A 3UICA 1ZLXA 3D6TB 5JJKA 4PGMA 4WJKB 1PS0A 1KY4A 1MTOA 4LV8B 5IFLA 3MM4A 4OD0A 4X62B 2UZ4A 1FMTA 1R0LA 1X1DA 3IVAA 4W8GA 1OKKA 2J0UB 2PRKA 4O29A 1CUAA 4RGQA 4DMGA 2I76A 4BEWA 5EJ5A 2QB5A 1EE2A 2X0IA 1E3LA 4EL5A 3AL0C 1O87A 3BERA 3CB2A 4AZWA 3FM9A 1ODFA 4Y30A 4ZVTA 4MO2A 3HNRA 2Q3JA 4R3WA 3STVA 1FU4A 4QFDA 5CM2Z 2XIJA 5E3HA 4EG1A 2OWDA 2YDYA 3HXOA 3IUQA 2OKCA 5AVXA 2QLLA 2ZJ2A 3RFUA 2HIMA 5K0ZA 5AWFC 1TVMA 1NNSA 3JQCA 3FGZA 4DWWA 3GRVA 3URMA 1XAIA 2NV2B 3KSUA 1C14A 2TYSB 4BEJA 4LMBA 3M6UA 1YK1A 3AHFA 4G1CA 1QOPB 4NYMR 3RVSA 3RO7A 1XVAA 4WEQA 2OXIA 1VDMA 3H5RA 1GRRA 4D0GA 3A31A 4C0LA 2C1EA 2VEDA 2JI6A 4RD3A 2PZAA 1UPCA 1XYVA 2IHJA 3G2JA 3MJEA 5AW5A 1SQ5A 2EX0A 3JX9A 3M0EA 3TE6A 2NACA 5JWOA 1XQ1A 1N6RA 1S5PA 2I8AA 1ZVKA 4FPXA 3ZG6A 1G5FA 2ICAA 4N65A 4HNAB 2A67A 4N6GA 4Z9XA 5JPCA 3THWB 1SKMA 4HKTA 2VL7A 3V4OA 4C2TA 4LQCA 1UJ2A 4FCVA 2PXHA 2AZMA 1QDLB 4ROTA 3UO8B 2JBAB 1ZGGA 2BGRA 3GRUA 4Z0HO 4EKEA 5KJ6A 3G2LA 1NYQA 4HWOA 1X3SA 5IM4A 3VYTB 1ISSA 2IHVA 4M89A 4NZ9A 4EAQA 3DDOA 5DGCA 5CB4F 1DBWA 2ZIXB 1FFHA 3D0RA 3JYOA 3WMEA 5KNDH 4M7WA 6CHYA 4R8KA 2VDLB 4X64B 3WAGA 2ZJBA 3A9CA 3I4FA 4YJGB 3MYRA 1M1YB 2DVMA 4R68A 3REQA 4WH0A 2PMKA 2HLDD 2Z2KA 5CFPA 5JXJA 3JQAB 4NL4H 3LY5A 3T1NA 2PS0A 3U13A 2C1ZA 3A9SA 4WKPA 3U3DA 3DPSA 2V97A 2NSDA 3IDOA 2VJPA 3AL2A 2ZBDA 2ATXA 2VNIA 3P9QA 4PG5A 4ZKDA 5K4HA 2YKGA 3NDBB 1A5SB 1EGAA 4AD8A 4A7PA 1P8AA 5FL7D 5DYGA 3QUQA 5BOVA 5A0TA 3JD3A 2B2NA 2C07A 2ZUWA 2QL6A 3Q9UA 4JHLA 4OQNA 4W1QA 4BLWA 4PPNA 4I5FA 2ZZMA 2BGTA 1U0SY 1ULSA 3G7UA 4M88A 4HVLA 1EXMA 2MTBA 5KS2A 3CPEA 2ERCA 3O73A 4MUGA 1TB4A 4CTJA 1SVIA 1OFUX 3CUUA 2FN7A 2XMGA 3L8GA 4ARZA 4IUBS 1KFEB 1JA1A 4WK2B 1A8IA 1R4MB 3RJMA 1FP1D 1XNGA 3RUCA 4R0NA 2FWRA 1JEEA 3R9KA 2ONZA 4CBVA 3NXSA 2HK9A 5ESRA 4TYMA 3JD1A 2DFKB 2FZGA 4PINA 1HT2E 4TKLA 4OQFA 2GM9A 1QO9A 1RD4A 2ZRLA 2ZRPA 3JZIA 4DKJA 1IB0A 3PIRA 3X1YA 1SZCA 1D1PA 1JWBB 4I4IA 5JJ5A 4RBNA 1VZ3A 5HGXA 2P6UA 2PE5A 2AFRA 2C2GA 3PLAE 1JIUA 1OJ7A 1DKQA 2ZBGA 3H2IA 3MIZA 4JMPA 3GARA 2AE2A 4GRAA 3SOZA 5EMMA 1ORDA 1H1DA 5E9QA 3FPJA 4K9KA 5HTKA 1Z0IA 4EGCB 2HXSA 4X20A 1PQYA 4JSRA 3ZY5A 4ZQGA 3LTEA 1EX1A 5D7BA 1UWLA 4US0R 4EPVA 3ANNA 4ENUA 3ZD7A 2CFCA 3MSCA 3KHSA 1C0KA 4HEA1 3VPXA 1E7WA 1P4GA 4F5EA 3OUZA 5KTTA 1A9OA 3MQ4A 4FWBA 1FFXA 1G5PA 1L4BA 1COZA 3I28A 1TT7A 1IL0A 2XNJA 3PUWA 4B80A 3CIOA 1MAHA 1TYCA 3B5IA 3B9BA 4H3KB 3Q15C 4PGAA 1Z2OX 3RQSA 3VKGA 4BNHA 4MW0A 1XKQA 4K28A 2XCTB 1TW2A 2ZB8A 5JSUA 1LD3A 3D3EA 3EWNA 1HUQA 3W8FA 3EPLA 2D7DA 1WMSA 4COKA 3PD7A 3B82A 3VDMA 1GITA 4GF5A 2I6UA 4G1UC 4KN6A 4UBMA 3DDUA 2WHPB 2WJZB 3PFFA 4D7AA 5B7QA 1WIWA 1HDYA 5ICFA 4A16A 1E6UA 1X8JA 4YPFA 4ZK6A 2FDRA 1EXNA 3ME5A 4DLYA 5H4GA 1DXYA 3D8TA 4NZPA 2J8ZA 2HHJA 1N4AA 1AGPA 1UPFA 5HGJA 4RKYA 3CN9A 3QVMA 4LJ6A 4NJMA 4W4TA 2IYEA 2JCYA 3KE8A 1IOWA 4KSYA 3QYPA 2BDUA 2A1UB 1G3UA 4FHZA 3P27A 4P6VF 1PU2A 2SBTA 2J9YB 1OBCA 3V55A 4MP6A 4BP9A 4KXYA 3C3DA 2OGTA 3OZWA 2JLSA 3VPHA 3L6RA 3P0EA 3OZVA 4BPRA 4XDGA 4JJ4A 1RZ3A 4YASA 3SZLA 1ZVMA 1JDBC 2GGSA 3QH4A 1OXBB 1Q0HA 4NMLA 1ANKA 3SXUA 4IILA 4OQZA 3UGJA 2XZTA 2IXDA 3M2PA 3LPNA 2LE0A 5TQ0B 3V3KA 3ZDAA 3WLIA 1XOIA 2VRCD 3F5SA 5FUBA 4EYQA 1RPAA 3LYAA 3VR5A 3CRVA 4Z51A 3I2FA 1WBDA 1TK2A 2YBEA 1J99A 1M2NA 1KFKB 3O8BA 4WLEA 2IUEA 4D9EA 3DCNA 2P75A 2X40A 3PXUA 1IQPA 3JQPA 4QATA 4HO1X 3RKRA 4JYAB 4BNWA 2WM3A 3KZXA 1QPBA 2W2OA 5LR6A 2XUHA 4L0QA 3LY9A 2VCEA 3F78A 4MR8A 1ZU5A 4GM4A 2VDJA 4JDPA 1D5CA 5E2AA 3WX0A 3IIIA 4LE0A 2EKPA 4OSOA 3BH7A 3D8HA 1C7EA 4I3FA 4PFJA 3RTGA 1IHDA 4W5HA 4KDCA 3WMFA 1VMEA 2YWHA 3G5MA 4TKUB 3DOHA 4HNQA 5HXAA 2P2CA 4KFUA 4FHGA 5E2IA 3SQXA 5BSUA 3WISA 1DEXA 1FP4B 1MGOA 2HCBA 4RE6A 4MCAA 5MHTA 2CWDA 4OK5A 4AP6A 5CVTA 2MOKA 3WLOA 4BB6A 4Z4CA 3EMVA 1KK2A 3IQHX 3DV2A 1HFWA 4HB2A 5A7GA 1AY0A 1XJCA 1NHWA 3BUSA 3HHEA 5TJ9A 3ROZA 1RXCA 3VNQA 5IJ0A 1U63A 3UHFA 5ILQA 3D4BA 3MXOA 1P4SA 3EGDA 4UHJA 4WZZA 1KQOA 3L05A 4RSGA 3PHHA 5CX1A 4HZIA 3WBKA 1XRLA 1C41A 2BFNA 3IOEA 4M7RA 5I45A 3SU8A 1NWCA 2V98A 1OC4A 3GZJA 3PQFA 2FSPA 3T54A 2CJXA 3U9LA 3WWDA 1IBLB 1GZSA 2JGNA 2A92A 2QZ4A 1H2AS 4NV0A 2OHHA 3U19A 1B0UA 4PIVA 5AKIA 4DUPA 4HFMA 1DWPA 2R8ZA 5JVDB 4UFPA 1UFRA 1E8NA 1QVAA 1YU9A 4WN9A 5FPQA 2VXCA 2CMHA 3S44A 4JA0A 1IUNA 4XR4A 3COPA 1BC5A 4OH1A 4WY8A 2W58A 3NVDA 4FSDA 2Y9PB 3SZ3A 1FK8A 1XBTA 2EL7A 2X9NA 1TXGA 3FPGA 4G67A 4NESA 5FBLB 5IP5A 4RK1A 5JISA 2I7DA 7ABPA 4IH1A 3WK5A 2VHCA 3KJGA 2PZGA 3QIAA 3TR6A 1J2UA 3R7BA 2PMEA 5E3JA 5HF9A 3E1KA 4LS3A 2Y2VA 1SOAA 4IUYA 3O8RA 2IQ5A 1OWLA 3CF4G 5FOTA 1NBIA 1Y6FA 5CM8B 2VNKA 1OA1A 4RL6A 2EYQA 2ZROA 4IGFA 3IUBA 2XWBF 7MDHA 3DS8A 1Q0ZA 2QV7A 1L4GA 1Z8FA 4QU0A 1ACLA 1ZGCA 3UGQA 5ITSA 5DWQA 2OBXA 4JWKA 3ZYCA 5IJ9B 1N2XA 3WGZA 4J9UE 3KUUA 2PEZA 4Z0PA 1ABBA 5B2EA 1YRLA 1T3ZA 3S2IA 1NF3A 1N8TA 1WMEA 4L16A 3TLKA 4BLRA 1P1HA 4R1UA 5CFMA 4KR7A 4OX9Y 4CMHA 5K5EA 3ELWA 4RH3A 1QHFA 2WWRA 2I2DA 1M6YA 1DKNA 2CMDA 4G4GA 4Y67A 4BQFA 5C5CA 1J06A 2OV3A 4FBGA 4KYIB 5KAMA 1CD5A 3PB3A 1QH8B 3QXGA 1VI2A 3AY6A 3SYNA 5JRZA 5LMZA 1XA0A 2F3RA 5C7YA 4IHKA 3ICPA 1G7TA 1CJUC 1JHXA 1SU8A 2PEYA 4HNRA 2O1WA 2RGUA 3V6LA 1PCXA 1VE3A 4GYJA 5CPFA 2XYVA 4BO8A 3AFNA 4RVUA 4GWLA 3EFEA 3B36A 3L01A 1BFUA 2AR0A 4KE7A 4FGLA 1W19A 4QKQA 1XFDA 3S7ZA 3PDWA 4LOHA 2Y1DA 2HSJA 1PFGA 2QTVB 3CMCO 3N2NA 4H4DA 4GR4A 1XKLA 1QFMA 4MW6A 1LS6A 1TMKA 1ZESA 1ODTC 3DWIA 2E5FA 3ZCXA 2XRMA 2D4AA 1UKAA 1NUSA 2XUKA 2ZLBA 2RBEA 1RZVA 4KK3A 4ZAVA 4N0DA 3AVPA 3NETA 3T7JA 5DISB 3AR2A 1WKVA 1GPMA 4RPCA 5EWLB 3DBLB 3T35A 1S4MA 2J0UA 3IP7A 1FLAA 3TW0A 1YASA 4HPWA 1RE1A 1XDZA 4JC5A 5JROA 3QE3A 1HOXA 3RARA 4ZYWA 1Z36A 1XHFA 4C4OA 1A5ZA 5FLXA 2CLEB 1U8TA 2P90A 1V1MB 5ENDA 3ZV6A 4TV8B 4YAIA 3ZDBA 3G0HA 1EP9A 4PTYA 4QWMA 3T5MA 3W7BA 1T1EA 2Z6UA 2WPDA 4FX2A 4ENSA 4YCSA 2PD4A 3HP7A 1Y6RA 4N8SA 3H5AA 1B8OA 3MUFA 3OE7D 3H2HA 4O4HF 4RAQA 3V8EA 3KNZA 1EA5A 3CSDA 4WKNA 1G291 1SZPA 2BE7A 2CSUA 4IV8A 4IW3B 4D43A 6GPBA 4QULA 1HDGO 1GNPA 2AK2A 1W6RA 3IMKA 4MGKR 1N3BA 3VYSB 3W1VA 2V4ZA 2J9FB 1WNTA 1FSZA 1RKBA 2VYFA 3ECCA 3QGMA 5ER6A 4OKSA 3TKAA 3GA0A 2X7HA 4D6PA 1H1LB 3M4YA 1KH2A 4CMCA 3OIDA 2PQ6A 2PX6A 1EUDB 1HOTA 2WE8A 4KQCA 3BT7A 5K3SA 3F5FA 4DOMA 1QLHA 5B1SA 2IXEA 3IEXA 2QWXA 1DO8A 4G65A 2HSDA 3Q9NA 4RQAA 2B0CA 2W6ID 3FW1A 4U0KA 2Z2XA 4B6OA 3THWA 4NYIR 4BX2A 3JPWA 2QROA 2JCGA 1TEHA 1VDZA 4HNAA 3G1UA 4LA4A 2VN8A 2VWGA 3UM9A 3V7WA 3ZZTA 2R6CA 4UUOA 4DSTA 2HBQA 3CCFA 2PUFA 2IIBA 2P2DA 4QDTA 3L1JA 3O95A 3RANA 2JBAA 3K8OE 3A2LA 2HLHA 3BOSA 4YNBA 2XGSA 1CVRA 1PDOA 4HDKB 5EMHA 3R3VA 2H4WA 3K8ZA 2WSBA 3KQWA 5KMGB 2C5FA 3D4LA 3EVDA 3E84A 2ZIXA 1FUEA 1DWQA 4BBZA 4J29A 5G0VA 4BNGA 1E89A 3QBEA 3S2UA 3L0SA 1CR6A 1JHAA 1KXJA 3ASZA 4YJGA 1K0FA 1M1YA 3WTCA 1FJXA 2LGJA 3GROA 4NVRA 1QTNA 1NI4B 3R24A 4W82A 3JQAA 4PBRA 1TM1E 4TVBA 2WTEA 4HX5A 4AQ7A 4N39A 1UANA 1C7RA 1TX4B 4EVRA 4EZIA 2CZQA 3SK0A 4B0OA 2JLVA 1Q0PA 3H11B 4JVOA 1LDBA 3OTWA 4MV8A 4POAA 1W76A 5H5JA 5JNVA 3FTEA 2XOEA 2BWJA 3SDZA 2XMRA 3HK2A 4A6XA 1G4AE 4E15A 5F35A 3SAJA 5LFAA 1XQXA 5UKDA 4CUKA 4GICA 1X70A 4HJXA 4WESB 3QVJA 4ZI5A 3U4CA 1PBTA 1H2ZA 4MI9A 3I2IA 3NUZA 4R0VA 1DHRA 3OFJA 1M67A 1V48A 4MKIA 5H9WA 4D2IA 3QX9A 1E7QA 3KR0A 4EZBA 4D0SA 1L4HA 1BN6A 2QMHA 1EM6A 1PQ4A 2QL5A 1R4MA 3CG4A 5CYFA 3KT0A 1XAJA 3LOUA 1G63A 1RVV1 2HXYA 4QHTA 4R98A 4QU5A 3SG0A 3CEPB 2DWUA 3F46A 3UZUA 5JAPA 3RRFA 1R12A 1U04A 3GDGA 4G1BA 1FMCA 4MV9A 3WL8A 2JLRA 3IAAA 4NR0A 5CCDA 1BIFA 2EFGA 4O1IA 4ZT4A 4N5LA 4NAVA 1XP8A 4DY6A 2B69A 2ZOSA 3HB0A 4IKOA 1ESCA 3OPQA 1F7UA 1IIRA 2DB3A 3FMPB 4S1TA 2V03A 1HORA 4HTAA 5BN5B 4JLOA 2IYNA 5TVKA 2HFJA 2QNIA 1CR4A 3JQQA 1DQPA 1CUWA 3Q1LA 3W6OA 2BF7A 1EFKA 2GCOB 2ZCVA 4R51A 4UBNA 3THYB 2A8YA 2ZPUA 3M6WA 4X6YA 2YJ3A 3WGLA 2GXSA 2WHYA 1TLTA 5I7WA 1RADA 4B7CA 5HOQA 1VHLA 1QXSA 4RANA 1USGA 3IEKA 2ZREA 5C5DA 2AOUB 4OBXA 2P9FA 1Y5MA 1KH3A 2BZ1A 3BJIC 1UJ6A 3NT4A 4OSEA 1IWBB 1NXTA 2YXBA 4P86A 2QTTA 2F3TA 4U2GA 1PI3A 5TMEA 2QRHA 3V8RA 1V2GA 1ZMXA 1A7JA 2Q1TA 4NMHA 3O74A 2GB4A 3GT7A 2WUFA 3IA2A 2XKKA 2P6RA 2WHPA 4QC2A 1NVWQ 4QVIA 2E4ZA 4XCXA 2EP5A 3I9LA 2FE1A 3G85A 2PWZA 3PICA 1QQ6A 4WLOA 4Y2XA 3ZPXA 5IUNC 3HBNA 3R75A 5EJ4A 4WZBE 3EVBA 1G19A 1MN6A 1AKNA 1ULZA 1V4BA 4J03A 3HUTA 2D2VA 1IM5A 3GRPA 3N1UA 3C5HA 4D9GA 1UIRA 1N36B 1EX9A 2A1UA 4DDHA 1QQ5A 2WHXA 3K5IA 4JJGA 4GECA 1DUSA 1DRJA 1TK3A 4KREA 3U62A 1AV7A 3ADPA 2C03A 4CTNA 3I42A 3FVTA 4KIWA 1EFDN 4PTZA 3A1VA 1UFVA 2EJWA 3WB1A 3KKMA 3WRYA 3H5WA 4Z3KA 3NCTA 5IAAA 4Z99A 1Z47A 2Q4DA 1J9ZA 1NM5C 2ORED 2LCFA 3W5SA 4N7JA 4KKVA 5G1NA 3PPVA 3IOMA 4ZO6A 5TQ0A 3OQPA 1EP1B 3U56A 1DKUA 2Q7DA 1ZNYA 2UZ1B 4AKGA 3J7TA 3D8NA 2C00A 3AUKA 3BK7A 4MUYA 4WX2B 3ZGLA 1UINA 2X0FA 3UXEA 1Y82A 3H3JA 1CU1A 1WCYA 2X8BA 3IODA 4UM8B 1MJHA 2B2XA 1ZUNB 2OBBA 4PCVA 3SSOA 2O2EA 3U4HA 2F8SA 1YVDA 2G25A 3ZNNA 3CLHA 3A3OA 3PIIA 3IQXA 1T35A 2YJZA 3FHLA 3L4BA 2BKLA 4JC8A 2PYDA 5AOCA 4Z4IA 4XQ0A 2W9XA 4US2R 2JI4A 2QJTA 1FJHA 2ETVA 1BMFA 2C97A 1IJEA 2OXRA 4M9RA 4WRRA 5HG0A 3JSAA 5DBOA 3ZIDA 1RPZA 1NVFA 1J90A 2HUNA 4M4SA 4X60A 5BW5A 5HKOA 3QE4A 1PK9A 1Q7CA 2QW8A 3TO5A 3D59A 4KKXB 1FP4A 1L7DA 1W5AA 3OF5A 5A3QA 1X77A 1TF7A 2V6MA 2XYQA 1WUTA 2QM3A 1FDSA 4I19A 3VV2A 1IULA 1DX9A 5DI9A 5FXMA 4MV7A 1U3WA 2QRQA 2DQSA 1OI2A 3E7FA 3A11A 5F5NA 2WAYA 3Q41A 3STTA 3KHKA 4DCPA 2Q5EA 1EPUA 4MR9A 4K6FA 1SO8A 4AF6A 2LCQA 5FAKA 3FCSB 3GLHE 3I1IA 3ZHZA 1VG1A 3KQVA 2P7HA 1S2OA 1ARZA 4KQMA 1QC5B 3M4XA 4IOMA 2EKLA 4Y2SA 2ZXUA 1U7XA 2P91A 3GH3A 3KKKA 4RTSA 5BYBA 4IVNA 3CF2A 4LSZA 3UJPA 1YBAA 4ZAXA 1SIOA 5KOHA 1QNLA 3RUAA 4F12A 2WG0A 3FNBA 2VBCA 5LJLA 2LIPA 1C1DB 2NNWB 4LSMA 5J1TB 5C31A 3F7MA 4RMIA 4DAOA 2GK3A 2IP4A 4CQNA 3COZA 5JVDA 1BDMA 2V6FA 1I4TD 4I8XA 3WICA 2LW7A 3EF3A 3KLMX 2FJ0A 3DHYA 4HCJA 1GZ3A 3V9AA 3EZYA 3I1YA 4HAXA 1Y37A 2N9UA 4TV8F 1CSEE 2DR3A 2IZ0A 2WTNA 4PTLA 3A36A 7MHTA 1T13A 3AP2A 2W42A 3GVIA 3TAXA 1JIQA 2AKAB 2Z3ZA 4TPKA 4P38A 2WT8A 1SIWA 3V1NA 3PD0A 4LISA 5HIKA 5B58C 3A9UA 3FCAA 1KI3A 1ZK1A 1NXWA 4OHFA 1Z62A 1D2RA 4QYIB 5EPUA 4AM8A 1Q1GA 5IH7A 2VK2A 3NHPA 3RS9A 1Z0DA 3ZDYB 5ALMA 3VYWA 2OZEA 5IJ9A 4MPJA 3OETA 1A27A 2L2QA 3FH0A 4XIFA 4MLDA 2JB9A 1XGKA 2GXUA 2ALJA 3NKVA 5GONB 2AA3A 1ZOSA 1OTYA 2B6HA 2Z43A 3PEUA 4Q1DA 5JS2A 5FUMA 5H8WA 2YWCA 3CRW1 4J16C 3CHYA 4FYWA 3SICE 4M0EA 1OD6A 4F0JA 1LW6E 3NAQA 1DAEA 4D26A 4H7EA 2EZUA 2C1XA 3PLNA 3NQ41 3K92A 4N7BA 5J4LA 1PFWA 1V3UA 3CO0S 3W5JA 3IKVA 5EIAA 4LBZA 4B3GA 1JT2A 1QH8A 3FWNA 3QU2A 2F1KA 3I9JA 4RZQA 3HG7A 1DKMA 2G1UA 2QN7A 1XZHA 2O1SA 3UJ9A 1CJCA 1YRBA 2VAVA 5EJEA 1W0KA 4BO5A 2PLRA 5FO1A 3VPBA 3U9TA 4U7HA 4PYJA 4F91B 3IUYA 1XTTA 2GUGA 3H5IA 3K1ZA 1E6KA 2WAMA 3DJFA 5KYUB 2VFAA 2QTVA 5T57A 2ON6A 3ZOZA 1JL3A 5K0FA 1Z26A 2XBMA 2JFWA 2PGJA 5HKKD 1C8BA 3NU1A 5AK3A 2PBRA 4UATA 4YCAA 5F2KA 2PL1A 2QTWB 1TO6A 1FFEA 1KOFA 4NNPA 5IMBA 1QOZA 3KPYA 3TPFA 2CYBA 3MERA 2Z83A 3TSWA 1QYXA 4D56A 2UUCB 3OY7A 5E0KB 5EWLA 1RXVA 4LMAA 3DBLA 3E61A 1P9RA 1OX4A 3E48A 3EVAA 3RS0A 1BJTA 3VI4B 5C8ZA 2ZUFA 3CJRA 4ZJZA 3M9LA 2GPBA 1PZHA 3L4EA 1BQEA 2FFHA 3HA3A 1CEXA 4GVXA 4KQGA 1GV1A 2QGZA 1P1FA 5F21A 5I47A 3R6LA 4ZODA 4RXMA 3VPGA 1V1MA 5BSHA 4TV8A 5IAEA 4DZTA 4H1VA 3LMKA 1M5TA 5DZSA 3U1BA 1NPDA 1P61B 2VP9A 4MWCA 4BP1A 2FK7A 4YUZA 2HF2A 4B6FA 1DIOB 1HTBA 3FUXA 3EQZA 5BUQA 3SVLA 1QF7A 4P36A 3BN3A 4CIXA 4D82A 1Q1ZA 4EO4A 4X66B 4RTRA 2O8DB 4KTVE 1Z63A 4HLUC 4IZ6A 3ZU4A 3LX6A 1FFDA 2CNOA 4B48A 4EUNA 1NMZA 2J9FA 3ZHYA 4RTJA 1K7YA 3E1SA 1E7YA 1KYVA 1H1LA 3O91A 3ZU6A 4UXJA 5LYJB 3VA7A 1U2EA 2HFKA 2DLNA 4DLPA 4FHEA 1NP3A 4F8YA 4D3SA 1EUYA 4LDRA 3R5SA 4J16A 3NWBA 2NIPA 3WWPA 2C59A 5I7OA 5E4YA 3TIXB 4NYMQ 2OCIA 2CMGA 3DAPA 3UMSA 3W3AD 4H7DA 5AESA 2DQ4A 1DIBA 2OVBA 4R5MA 4E5KA 2Y1FA 5E1MA 3PUHA 1A8QA 1GHTA 3MWYW 2OLEA 2WU3A 3E15A 5K2MA 1LQTA 2KBFA 3LE8A 1QRSA 1RHUA 1XRNA 3CY6A 4MQMA 2VJDA 3U4IA 3LT4A 2PJRA 1U9IC 4HDKA 5A3SA 2J3MA 5CR9A 5EKTA 3LVRE 4ZJPA 5KMGA 1A77A 2WIKA 5DNUA 1G0OA 3BD8A 3A6DA 5I8ZA 4BL5A 3V4PB 5BQPA 2VYND 3WJ7A 5K3BA 4M0FA 4IDNA 2FQXA 4KACA 2AF4C 1Y4AE 3OZIA 4YR7A 1IRIA 1IIBA 2OOSA 4K5QA 3FNFA 4QRIA 3NLLA 3VYRB 1QV6A 4G41A 4L74A 1NI4A 3HCNA 3DLTA 2ATIA 3F5DA 3PPXA 3GB9A 3A2KA 3IUPA 4GFDA 5FOVA 1TK9A 2GPJA 4YRZA 2QK4A 2YW2A 1JEQA 4IMRA 5A6VA 4AY2A 5IARA 1KRWA 4NDNE 1TCCA 3K73O 3H11A 4J1NA 2ZR0A 3BB1A 2HV8A 1XR3A 4NS4A 4HQ6A 1AK2A 1I1HA 2F64A 2FFQA 1MJFA 1PSWA 1DCKA 2P6MA 3GN1A 1X8XA 3WYAA 1ZC4A 4PU0A 1D8TA 4WESA 5J1SB 1DKPA 4LK3A 2I62A 1CUSA 4QQ8A 4DWVA 3QVLA 3B7PA 4YDHB 5DW0A 1N33B 2G4LA 1FNBA 3TLXA 2E0IA 5CEJA 1TF2A 2JLXA 3HR4A 4KQWA 2G1JA 3H5OA 1V35A 4RSHA 1V6SA 1MJ5A 1GNTA 5J47A 3VM6A 3GCXA 3UCFA 2BEJA 4JGBA 1O08A 4OMUA 4C6SA 4TLEA 4DMLA 3A58B 4HLUA 3CRZA 2W6NA 4PX9A 1HZZC 3V1TC 5G02A 4JI3B 1V9LA 3TOSA 3IESA 2VCYA 4UQPA 3KCQA 3ZYZA 1EVQA 5TMPA 1EG7A 4M3NA 1TT5B 3I8XA 1ZGAA 2R87A 3DOFA 4XVRA 2ZWOA 3A9RA 5F7JA 2NO7A 5BN5A 5TVGA 2XBLA 3NDRA 4G84A 2Z8XA 5AOAA 1DEKA 1Q17A 3DEZA 2IPMA 3QPUA 4PHFA 3RLFA 1ESMA 2D6FA 4A03A 1ZR4A 2P2YA 1S2GA 2ZSEA 3OSZA 1EFPB 2GCOA 2Q0HA 4XDYA 4AO8A 2NV0A 4B76A 4PYMA 2WU4A 4IVQA 1UK6A 4Q24A 2A4MA 2QNBA 3WGTA 3THYA 2OLJA 1XEFA 3OWHA 1SC9A 1KE1A 2IYPA 3ZCSA 4DIEA 4CTOA 1U9IA 3ZDZB 1FVXA 2C99A 2VF2A 1KJ9A 3RAGA 4FGUA 4PAOA 4UNIA 2GA9A 3FB1A 1ACJA 4NXNB 1Z3IX 2CN1A 3RYHB 1KOLA 2P78A 3AK4A 5FHQA 1I0LA 3WOVA 2Z6AA 3I6BA 2C5AA 2ZU0C 1O94D 4LNUB 4CLHA 2MDTA 1C9KA 4TOIA 3IE2A 1WZIA 3PYLA 5FX2A 1N2HA 3RT1A 4ED9A 1TRHA 1JZSA 2QE7A 1KHTA 2UYHA 3G89A 5ANRB 2IWRA 4HLQB 2NSJA 4L5IA 2GTPA 3EIXA 3AM3A 1N2CE 4CKZA 4Z0TA 2JGRA 3K4QA 3ILYA 4B84A 4DSUA 1P2UA 5J5VA 4DJAA 3LYUA 1ZRSA 3WK6A 3GP8A 1YBVA 1BVRA 3G2IA 5ARDA 1ZA2A 3QUBA 2QRUA 1SEVA 5I5GA 1F06A 4JJ8A 1IBRA 4CF5A 1EDEA 4X85A 4HY3A 4EB3A 1IOZA 3RI3A 4YRTA 2ZJ4A 4MI1A 1KEUA 421PA 4RTMA 1KPGA 1UPUA 2NXJA 4PZAA 3TIFA 4RTNA 3KVNA 3THRA 3S2GA 4IS3A 4TMTA 4MJ3A 2FN3A 1W4ZA 3EC7A 2AJTA 3ANXA 3R0JA 3HQ4O 1ZNWA 1YCDA 5FO0A 3KQLA 4DSZA 3DZIA 4G1EB 2ZYAA 1UM9B 3CH4B 4J0HA 4DHEA 1K8RA 2UZ1A 2ZTVA 3PR1A 1T4DA 4BVHA 5KTOA 2BH2A 5K8JB 4F5DA 1DO0A 2B7BA 4PPFA 1RPJA 2P0YA 3GPIA 3IA7A 4EY7A 3WQSB 3AL3A 4ZEVA 2XEDA 1T9CA 2HQ1A 3DOJA 2Q5JA 3K70B 2YWXA 1E58A 1ZUNA 3I53A 1JQLB 3AEQB 2O48X 2G1AA 2XF8A 4RA9B 5ENVA 4AIIA 2NSYA 2AMYA 2QJFA 3K0HA 4CG1A 3IPYA 2BKUA 5CDUA 4GWKA 4ZQHA 3R0ZA 5A0FA 2YASA 2H7XA 4IPTA 2AI1A 1XCBA 4BTVA 3LAWA 3UHOA 5DT2A 4FZRA 2D1FA 5DLPA 5JLAA 4LSGA 3TZHA 1L5ZA 1T6BY 4V0MA 1CG6A 1I01A 4AZVA 1OFGA 2WTAA 4D9BA 2BMDA 3C6ZA 1S0UA 2O7NA 8OHMA 2ZS8A 2EP7A 4PSDA 4RCYA 3U37A 3D02A 4CM8B 1MF7A 4B7UA 5C46F 1O89A 1P1CA 1T1JA 3HI6A 2AT1A 3WDKA 1ZW1A 3CX6A 3KYBA 3TQIA 4KU4A 4LTNA 2ET6A 4RSRA 3MSXA 4W8OA 4XLTA 3U7QB 1NBEA 4G36A 5FI5A 3SD7A 3NEYA 1TMYA 2VLIA 1HDIA 1OQAA 3DEFA 4BFCA 1KDPA 2FOIA 5I7FA 1N7GA 1YS4A 1ZIPA 3P9PA 2A1TS 1CT9A 3X1KA 1B2RA 4GQAA 4DE5A 4QIHA 3OZTA 4RF4A 2AJLI 3U44B 2HK8A 2NLOA 1SURA 5A62A 1C1DA 4ALNA 4RDCA 3IP6A 1J22A 1RKUA 1SGWA 3K5PA 1RWPA 3BFKA 4AO7A 4EI7A 2D1QA 1OZGA 3X1WA 1Z4NA 5B2ZA 5C5IA 1OIWA 1YQWA 2MR5A 3MA0A 4OHBA 2PGLA 3FY4A 4PBTA 9LDBA 2W4IA 3MAJA 5K01A 1OYYA 3KSZO 1E6WA 2FU5C 5SICE 3PWZA 2XDYA 5HTOA 4NJOA 3GZ4A 3TQCA 1JAXA 1V1RB 3R5TA 1AA6A 4K6HA 2VTDA 1SULA 3L0DA 2D4HA 5C8DA 4UM9D 4UMVA 5T4HA 2F9MA 2I33A 2NT3A 1LPPA 2B9EA 3NZEA 3W8RA 4MW1A 5GM1A 4QYIA 1NZJA 4YAJA 2ILVA 2ERYA 4LDNA 4E11A 4ZFNA 1MTZA 4BVFA 3GQBB 1MHPA 1UDCA 2QPAA 3WRVA 1ECPA 3ROEA 5HNKA 4EQZA 3JSXA 3EXEB 4F2PA 1TJNA 3K4HA 5LYJF 1AB5A 1SCKA 3KTAB 1LPBB 4DC1A 1U0JA 1C4XA 3AKDA 5GONA 1HZJA 1LV7A 2Q6KA 1DFIA 1TJ3A 3A0UA 1ZH8A 4H7KA 4TXHA 1CRLA 2JJMA 4W5WA 3D6HA 3TIIA 1CZOA 1E2EA 2VS1A 4B2IA 4JXXA 4CDMA 4Q34A 1K3FA 2P1ZA 3R3YA 4KJZA 4ZCSA 2WD8A 3FF1A 4PSKA 5EC8A 1VPWA 3RFXA 1UMDB 3LHKA 3GGPA 1IFXA 4XX0B 3U0BA 4LIPD 2WUGA 3DE6X 5EUCA 1XMJA 2DHCA 1PG5A 3DYVA 1AKWA 4UAJA 5GJVC 2A4KA 3RJ5A 3NPMA 1NN0A 4K9LA 2PD3A 4HOYA 3RHFA 1VSTA 3I3OA 3QKRA 4AROA 1CDOA 3G9TA 4KFTA 4EJSB 5FAXA 2XBUA 1ZCBA 2OCKA 3OPNA 4MYDA 1ZP6A 4HDSB 1WW2A 5KYUA 4J0KA 2F1HA 3NAMA 5HJ5A 1BGWA 3PKIA 3PSHA 4LTDA 4N9QA 1AX9A 2HU2A 5L3QB 4IR7A 2RH8A 2IYVA 5C34B 1RW4A 2OLKA 4FYIA 3ED1A 3PQ3A 3C3EA 4LMRA 4C4SA 2TMDA 3SQOA 3C70A 2W4MA 5T4BA 1NVKA 4BO7A 5K4GA 2D06A 1EDBA 1FJ2A 3SHQA 2CY0A 3A6ZA 2XH8A 1X7YA 4M21A 4PO3X 4RQTA 1E8MA 1BD3A 1ZNZA 3KKOA 4P1ZA 5FFFA 4JJZA 3EXIB 1BE1A 2FMTA 2DHRA 3RSCA 4LAFA 1KO5A 1NQXA 1HRDA 2PWBA 2R66A 1TEZA 2TMGA 3OFVA 3EX7C 1B3RA 1JILA 1V2HE 1F51E 4QGGA 2PVCA 2WP8J 2F4NA 1AG9A 1GFSA 1RRKA 2KLHA 2K6GA 4D9MA 2Z4RA 1TTHA 1ZEMA 2CE7A 2PCJA 3PL5A 4NU8X 5G0WA 4D81A 5A1JA 4RUKA 3KYJB 1M34B 1MVOA 1OU0A 4EUHA 2P5UA 5SYAA 4CKBB 3GYBA 4GZLA 3LXRA 4C89A 3WFIA 5SZJA 2C57A 4M1OA 1BA3A 1GPNA 2VQ6A 3VSAA 5K0JA 2O8DA 3LPAA 2MSEB 3G8YA 4TRJA 1NLFA 4EL0A 4I4TB 3NATA 2O0JA 1XDGA 2IF0A 3HLTA 2I4TA 3ORRA 3R0VA 1A50B 4JIMA 1O96B 5C2JB 1ODJA 3QQPA 5LYJA 2YQ4A 5F64A 2OP1A 4HEJA 3PX7A 1GO2A 3I73A 2WJGA 2J7PA 3PI6A 4XQ9A 4E2FA 4MVJI 1R88A 4QX6A 3Q0IA 3U3RA 5KB3A 3AU9A 4Z1OA 1SKYB 3FAZA 3LBFA 1H05A 1LPOA 4V3BA 1IBMB 2CUNA 5IBCA 1KPHA 2CB9A 2JHPA 3TOXA 1ZXBA 3N70A 5A2QA 3IELA 1PIWA 3WYGA 3UT0A 1WUKS 4DM7A 2HJ9A 2P1DA 4DGSA 3HWWA 4ZIRB 1KZGB 1LKZA 4N6NA 1BOOA 5FI0B 2WDZA 4JP2A 2IU0A 13PKA 1O6CA 3JWGA 4TMKA 4X45A 5FWNA 3FA2A 2ZYWX 3K9LA 2CXUA 4BVGA 4M9CA 5L6LB 4KMOA 5B58T 5I4IA 4ID9A 1OV6A 5JS1A 2RIPA 1ZZEA 3CX4A 2CZGA 3LHDA 1YDFA 3MBKA 1TA9A 1ZNQO 3KIPA 3FDIA 2YOFA 4KIFA 3KZCA 2C2KA 1G9TA 3FWKA 4CKCA 3VC1A 1KOGA 3NC0C 1EFRD 4X93A 3OTOB 3E9CA 2R48A 3AFGA 5D87A 2J9RA 3T1QA 3TLJA 4MA4A 2C9ZA 1ZY2A 2QYOA 4X9XA 4HRAA 1U7DA 3WLQA 4YR9A 4E5PA 1P81A 3V4LA 2BKXA 3QHQA 5KZMB 5T67A 2NT4A 4IDPA 4AJ1A 1P2FA 1SBNE 1YAJA 4I6EA 2QT1A 1YDMA 1YB1A 2WP0A 2NO1A 1VJ5A 5DVZA 4BMSA 3DKVA 4RZUA 2H4JA 3SLRA 4HFRA 4HI0E 5DB4A 3ZE8A 2P27A 3HVJA 3NFYA 1R6XA 1JV2B 1SUAA 4IIXA 2OFFA 1I2MA 1Y3AA 1E9BA 2AD1A 1NMEA 2FRDC 5LMNB 2DUMA 2FR1A 2YMQA 3SSAA 1UK7A 1NG9A 3PYMA 4L2IB 4LHWA 1WETA 2JKYA 1UPBA 3WGYA 1OB5A 2HEGA 4IMJB 1JDZA 4IWYA 4BE4A 1T91A 1UODA 1WWKA 3OWOA 4JLDA 1A4RA 1OR8A 3H8VA 3ZK7A 1YUBA 1OU4A 5F7ZA 2ODPA 4OGLA 2RJNA 3SMVA 1XDWA 4PE5B 3TECE 5CXSA 1CR0A 3MCZA 3BGWA 5LIRA 4AXBA 1Z4PX 3AXSA 4J4HA 1SWWA 1OPRA 4HWTA 1WUHS 1TT5A 5KTMA 5AJUA 5H83A 3K70C 3DVAB 1S6YA 4E4RA 3FVVA 4BB5A 3OQ6A 1JPNA 3GH1A 1Z07A 2PJZA 1E2MA 4O2AB 3QWIA 1ES9A 2X9GA 2BJWA 4Q6WA 4DT1B 2OOKA 1YJAA 3LWDA 2ODBA 1JFFB 3UUGA 1EFPA 1M2HA 1Q0QA 2NPOA 3DXZA 4BYGA 1PTKA 3K6JA 4YAKA 3SF8B 5JJIA 3QU4A 2IGTA 3QU9A 4I14A 4V02A 5LZ9A 1XMVA 4MYCA 1NW4A 2IW1A 3NYWA 3W7VA 2P9BA 4ND6A 4MUFA 3RYHA 5ALHA 3AHHA 2JS7A 4B71A