5DP1A

Crystal structure of curk enoyl reductase
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
332
structure length
332
Chain Sequence
DQPVQLKLSEYGVIDNLNWQPMQRKTPLANEVEIEVAAVGLNFRDVLNALGLLKDYYAEHFNITSAEQLTFGFECAGKISAVGEQVSQWQVGDEVIGLLLHDGLSSFITTSVEYVVAKPKQMSFSEAATLPLTFLTAQYGLQHLAKIQPGERVLIHAAAGGVGQAAVQIAQVAGAEIFATASPSKWEFLQSLGIKHIMNSRTLDFAEEIMKRTAGEGVDVVLNSLNGEYIPQSLAVLTPKGRFVEIGKIGIWEKEQVKEKRPDVSYFPFDLQEAVQQQPGLIGQLSEELTQQWNQGKLKALPHKVFPSTEITAAFRYMQQAKHVGKVVVSMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CurK
publication title Structural Basis for Cyclopropanation by a Unique Enoyl-Acyl Carrier Protein Reductase.
pubmed doi rcsb
source organism Moorea producens 3l
molecule tags Oxidoreductase
total genus 104
structure length 332
sequence length 332
ec nomenclature
pdb deposition date 2015-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5dp1A02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 5dp1A01
5K1SA 3LT4A 2Q50A 2GN8A 3CH6A 5CPFA 2TMGA 1P74A 3ST7A 2ZB8A 2X86A 4EYEA 3AJRA 3AI2A 2VTDA 3WOHA 2R6JA 5ER6A 1ADGA 1RM3A 1EMDA 5I9NA 1IL0A 2OORA 5JMPA 4M87A 4YEDA 3PYLA 3W8FA 5JC8A 1E92A 3ZV5A 5EQFA 5JW6A 4WCFC 3DWFA 5EMHA 1B15A 2JAHA 4MJLA 3O4RA 2EJWA 4Y6PA 3HN7A 3JQ9C 4BNMA 1OC4A 1WZIA 2WD8A 5FFFA 2ZIZA 1LU9A 4WLNA 4IJKA 4E21A 4WCFA 4N5MA 4N7RA 3WGOA 1BVRA 4NU6A 1E77A 4J3FA 1IYZA 3JQ9A 3L6OO 3JD4A 2D59A 1ZMTA 1KEVA 3QHAA 3D64A 3GOHA 3E03A 3F9IA 3TZHA 4E5MA 5IDWA 4QFDA 4GL4A 3U4DA 1GL3A 5A9RA 4PG5A 5IG2A 6ADHA 2CFCA 3CMCO 1NFQA 3LYLA 2O2YA 4R01A 1WNTA 3D5TA 4BIIA 4B4OA 2B4TO 4IBOA 1DFIA 3G17A 1H0KA 4PFJA 4Q9NA 3UFXA 3JQFC 4AJ1A 2H6EA 3LK7A 2DVMA 1E3IA 1Y5MA 3VZRA 2WJPA 3E18A 2VYND 1KY5A 4DIBA 3Q6IA 4CM4B 4YR9A 5DBIA 3JQFA 1B8PA 4RVDA 2W90A 3OF2A 1U4OA 4J91A 5F1KA 4MVJP 1UXKA 3K96A 1ISHA 1HZJA 1E7WA 4BNNA 1CRWG 3DHYA 3MJCA 4D79A 4PZEA 4FJ0A 3FR7A 2W8ZA 2DBZA 3KOUA 4TKMA 1MX3A 5JO9A 4R5HA 4HNHA 3F4LA 2Y0CA 2QQ5A 4XR9A 2O4UX 2UUPA 1I24A 3V1YA 2PKQO 3VH4A 4YA6A 2R2GA 1D4FA 1KYQA 2J5KA 3DBLA 3I1JA 4Q3BA 3M2TA 4CM5A 4OYRA 3L77A 4BGIA 4CQLA 1GPJA 1UR5A 1PJQA 2HJSA 1OOEA 2DFVA 2C7VA 3QWFA 2EGHA 1YJQA 4XYLA 4HADA 1Z45A 4YT4A 3DHEA 3S2GA 1NWHA 2UV8A 1EFKA 1P33A 4DPKA 1DBVO 1DSSG 2ZTLA 3DTTA 2GLXA 4IGEA 1PR3A 3C1AA 3ETGA 1EK5A 3FI9A 1B7GO 1BW9B 5JY1A 3K31A 2Q2VA 3I83A 1F14A 2I67A 3BMCA 4YCAA 3UHAA 4XKJA 3S55A 4AJLA 1TT5A 4JBGA 4OOEA 2C2YA 3LLSA 3ORFA 1GZ3A 5FYDA 1AXGA 1KBZA 3NUGA 4GX5A 2HU2A 3KYBA 5L4SA 1HSOA 3CZRA 2OFPA 3ICCA 4BHTA 3K30A 4XGIA 2B4QA 4PG7A 4RDHA 3SBOA 1A72A 1F0YA 3FTNA 1P1RA 4UUPA 1EBUA 2GD1O 1K2WA 1QYXA 3OECA 5A5FA 4OXNA 1WPQA 2DLDA 5L45A 4U8GA 3AOGA 4OL9A 5A9TA 4WCDA 1B8UA 3HFGA 4E5NA 1T2FA 2BH9A 3BIOA 1ZZEA 1LLDA 2NNLD 1NASA 4J2HA 1DDOA 2I5PO 4XQEA 4DIOA 2VHWA 2X23A 1ZEJA 3TRIA 5JSFA 4D3SA 3PQDA 3V1UA 4RPHA 3O8QA 2HRBA 3DMTA 4DA9A 3PGXA 4NNJA 1J6UA 1JN0A 4TRNA 4IXTA 1BVUA 2VZ0A 3RFTA 4E32A 1I32A 4QO8A 2GO1A 4NJMB 2IYPA 2HKIA 3F6YA 3ONEA 4OHUA 4BV8A 4C7KA 4HFNA 3ZNQA 1E3JA 5C3MA 4MDHA 2GGSA 2IYOA 3MTGA 1ENOA 1VI2A 1Y8RA 5BNTA 4XQCA 1BDBA 1SEPA 2HAEA 2Q1WA 2NSDA 3HDHA 3BMQA 2CVOA 1Y9EA 1EFLA 3AWDA 2X0IA 1PJCA 3C7AA 4J90A 4PLCA 3TZ6A 5BNIA 5IXYA 5CEFA 3GVIA 3KYCA 3DTYA 1O8CA 4M86A 4MVJM 5G4KB 2EF1A 3BHIA 4GGPA 5AQ1A 4O63O 2X1HA 2Z5LA 5LDHA 1YOVB 4BMSA 5H81A 1PWZA 1HWYA 2BHLA 3L6DA 1PQPA 4BNWA 1NX6A 1M67A 4A0SA 1E3EA 1QXSA 4BO6A 1WW8A 4Q3AA 4DREA 2JCXA 2O3SA 1VPDA 4JP3A 3L07A 1M66A 1ZK3A 4TVBA 3M1LA 1UH5A 2X5JO 3O26A 4BGEA 3KVOA 3PYXA 5G0SA 2CF6A 3WB9A 4U6SA 1UDCA 1H94A 4AJ2A 1B3BA 4W9NC 1V3VA 3KSZO 3JD1A 1NPDA 4UEJA 1YQDA 1MXHA 4IJWA 3UW3A 4OXYA 4GX0A 3JD0A 4BMNA 5TJ9A 4W9NA 1ZO8A 4BNGA 1JTVA 1X13A 5LCXA 2O48X 3DXFA 4QFCA 5HBRA 4XA8A 2Y66A 1XU7A 2E82A 3LSYA 4HUJA 1HDCA 3EY4A 4Z0PA 2IXAA 3MOIA 1JDJA 4JK3A 4PN3A 4R5MA 2C59A 4IDFA 5L4NA 1IOLA 4IGFA 2IEBA 1Q1NA 3GFBA 3F5QA 1ISGA 4FDAA 3A06A 4K26A 3K92A 1PZFA 4HX5A 2BRUA 2Q49A 1NM5A 4BNKA 2UUOA 3AUSA 4R51A 4PZDA 1X15A 2RBEA 4CM1A 2HMTA 3I4FA 3WDSA 3GHYA 4CM4A 4YJFB 4WOJA 4E2WA 3PFWO 3R0IA 2P4QA 3SLKA 3GMDA 2UVDA 3N58A 1PTJA 4BVAA 1SB8A 3ICPA 2GR9A 4LSMA 1NAHA 2FRDA 3BMNB 2NWQA 2JL1A 4JX8A 3RD5A 4JXKA 4D7AA 4ZN6A 2PWZA 3M1AA 1NQTA 3VOSA 4RL6A 4FD3A 4TQGA 2PZKA 2YFHA 4L74A 2VT2A 5B37A 3K2BA 1QR6A 1W6UA 1DB3A 2Q99A 2AEJA 3OBBA 4IMRA 1ZVMA 1CF2O 1HKUA 4TSKA 2VCYA 3AOEC 4YAIA 4L4SA 4J7UA 2CZCA 4CM9A 2AW5A 3U3XA 4DBVO 1P1FA 1MA0A 3ZHXA 3CMMA 1MC4A 4B7XA 3FWNA 4CMEC 4N5LA 1LQUA 3AOEA 5BSGA 2Q1UA 1KEUA 1BW9A 1PSDA 1QG6A 3WYBA 4J16A 3ZWAA 2ZK7A 3I3OA 4II2A 1MP0A 1DIAA 3I5MA 1CQIA 2OP1A 4BB5A 3JTMA 1N1GA 5T57A 5I8WA 4CMAA 4PIVA 5KJEA 4TRMA 1A7AA 1T2EA 1YVEI 4PRLA 1H6AA 1H93A 3U9LA 1VSUA 2VN8A 4J1NA 2HMWA 2I6TA 3PK0A 4OMUA 1LTHR 4MP8A 2CVZA 3A4VA 4DQVA 3WGGA 3VKUA 1PR9A 2AA3A 1VE9A 3NTRA 4QO7A 3E6AA 1EDOA 4MKXA 4YJGB 3UF0A 2E6UX 2DAPA 3I9NA 2WD7B 1PZGA 4P22A 2EP5A 1EVZA 1N2SA 1X7DA 4TWRA 5JFOA 1DC4A 3H5AA 3TZQA 3ZWCA 4IQGA 1E5LA 5CDSA 1M6WA 2A92A 3QWHA 9LDBA 1NPYA 2P2SA 4GKBA 3KZVA 1HTBA 2ZYAA 4B4WA 3KV3O 4NQZA 5ICSA 3FNEA 4L0QA 4LVUA 4U6QA 2WE7A 3WLEA 5LC1A 4I5DA 4A5OA 4OAQA 3Q2IA 4ZQHA 2EP7A 4NJMA 4RZHA 1PU2A 2CNBA 3IUSA 4OKNA 1LLUA 1YBVA 4CMBA 1O89A 1A4IA 1CJCA 1X1EA 4FFNA 4Z6KA 1HDGO 1PJ3A 2GERA 3JQ8B 4J9VA 5KKAA 3RC1A 3ZU2A 1HE2A 1NNUA 3QQPA 4ITUA 1Y1PA 4H16A 4FJ2A 3I9MA 4YT2A 5TC4A 5TSDA 1C0PA 3RC9A 3DC2A 4XR4A 4LMPA 4BO5A 4ZJUA 4LCJA 1DC3A 4HWKA 1YB5A 2R00C 4FFLA 5T67A 2GF2A 2JAPA 1P77A 5G4KA 4CJXA 1VRWA 3LZ6A 3PWKA 4CUJA 4WEQA 1KVTA 1YOVA 4FC6A 1OI7A 3X2EA 4YQZA 1ZNQO 4BKUA 4PLWA 3C1OA 2UDPA 2VNSA 5F5LA 2EJVA 4HFMA 1ZCJA 2UAGA 1JKFA 3PLRA 4XYGA 3WQQA 4F46A 2Q4EA 1YB4A 3ITDA 2O3UA 2PGDA 5DP1A 4E2YA 1JAXA 1OAAA 3SC6A 5IFLA 3T7EA 1HDZA 3ADOA 1YJ8A 4AJOA 3F47A 5JE8A 1YBMA 3ASVA 3RBVA 1WMBA 4D0SA 3BXXA 3W6ZA 3N74A 3HE3A 3JYNA 4J4TA 4YVFA 4O1MA 2VUTA 5KTKA 1DC6A 4HP8A 4UUNA 3GVHA 1K6JA 4E2ZA 3SVTA 1SOWA 4BNZA 4RLSA 1Q0LA 4UULA 2ZTMA 3V2HA 3ZH2A 4J2OA 2EKQA 4GWGA 1YBAA 2FY8A 4II3A 1DFGA 3DZGA 4WLEA 1N92A 4KUEA 1WZEA 4XJSA 1Z73A 5HS4A 4R1NA 3ANLA 3GEMA 3GGOA 3GRKA 3TOZA 2BGKA 3QIVA 1PJTA 2H63A 3ZWMA 4EBFA 4IDDA 2CMDA 1M76A 3LT0A 2C2XA 1Q7GA 2GN6A 2G76A 1UAYA 3QSGA 4PCVA 1HT0A 1FDSA 5L3ZA 1R4MB 1S6YA 5I9LA 4IINA 3RASA 2AE1A 3DOOA 5ILOA 4QSMA 4RO0A 5DOVA 1KC1A 5BNFA 5F3RA 4CMIB 1R6DA 5ER9A 1U4SA 3FBTA 4YJFA 3HQ4O 3IJRA 1GY8A 4HFJA 3KB6A 4XDZA 4Z0TA 3GMSA 3R3SA 3ITKA 3DL2A 2I3AA 3NGLA 4NH4A 1T24A 5IDYA 1U9JA 3RCBA 3S8MA 3WNVA 4A73A 4DUPA 4IJVA 4RPLA 3EUWA 4Q3NA 1R4NB 3AFMA 1F06A 3ZHBA 1CIVA 3BMNA 3PDUA 1GUZA 5CDYA 1PQUA 2OZPA 3JQ6A 1KVRA 3ROKA 3M6IA 2QRKA 5ES3A 4TMFA 3GA0A 1I3NA 3GAZA 2WYUA 5DDIP 4J0FA 3BTVA 4CQLB 5L51A 1SEVA 2GNAA 2NTNA 2VWGA 4ND5A 4K9DA 4QX6A 3VTZA 4UAGA 4R41A 1I2ZA 3FRJA 3BAZA 3ZWOA 1V3UA 2BMAA 3ZWWA 1MXFA 3OSUA 4MIYA 4MVJD 3DAPA 3DFUA 4HFRA 1Y5RA 2HO5A 4WLOA 1LLCA 4CV1A 1H6DA 2FPIA 3VH3A 3KLMX 3QW2A 5DNAA 1SO8A 5A3JA 3T4EA 5L7YA 4GLLA 3QA9A 4J1TA 4LW8A 1K0UA 1ORRA 5EN4A 5T64A 4Y6RA 2EW8A 1DLJA 1J4AA 3TQHA 1LLQA 4Q3DA 3ZHYA 5BQFA 1RYDA 2JD1A 4RZIA 4IQ0A 1V8BA 4B3JA 3MWEB 4JBIA 4J7CA 3GEGA 4KDEA 3WIDA 7MDHA 4R54A 1O95A 4F6CA 4ID9A 1DAOA 1G6KA 1I2CA 4CLOB 2JFGA 3PP8A 2DT5A 4YJGA 2Q1SA 1UZMA 5BSEA 1H2HA 4FIZA 2WD7A 5HTOA 2P5YA 1QYCA 2HRZA 1EUCA 2CUKA 1ZK4A 4FGWA 2EGGA 4EW6A 1ISJA 1UXIA 1KVQA 2PK3A 2B5WA 3WYEA 2EV9A 4YAKA 1HLDA 2VT3A 4FS3A 5HM8A 3KXDA 2ZJ0A 1W0CA 1Z75A 1T2AA 3W8DA 2Z1MA 4OSOA 4EUHA 4GAEA 3H8VA 5IDXA 4B3HA 1YL6A 3MCVA 1E7MA 2EG9A 5JAIA 2QYTA 3PFFA 2NU6A 3LC7O 2LDXA 4XYEA 2FOIA 1BWSA 3JQ8A 1MV8A 1PJSA 1YL7A 3TZCA 5B4VA 2A94A 1IPFA 4E3ZA 4FN4A 2GN4A 4A27A 1E6WA 4RPJA 3OH8A 4CV3A 1P44A 1Y9AA 2Z95A 4IIVA 1Y6JA 1DXYA 2WMDA 4BO7A 2E4AA 2FHSA 1SOVA 1XA0A 3DBRB 1YL5A 4RVFA 5U9CA 1GD1O 1GQ2A 2V6BA 3DZIA 3GEDA 1ZIDA 1PL6A 4O59O 5A9SB 1HYEA 1P31A 3RC2A 4KOAA 3QRWA 5KJ6A 3KLPX 1N8KA 2Q3EA 4FBGA 4MVJI 2O50A 2LDBA 3DZFA 3EGOA 2EEZA 1E1KA 4WJZA 5K6AC 2C7GA 4EJMA 3RUAA 3TDKA 3NX4A 5COAA 2RAFA 1PJLA 1XHLA 3A14A 2H1SA 3LF1A 5L40A 1E1MA 4IZIA 3ZN2A 1BXKA 2PD4A 3LLVA 2BI7A 1KC3A 5K6AA 5KVSA 2PTGA 1R0LA 3OQ1A 3AUTA 1YQXA 1MB4A 2NM0A 1EEHA 4BL5A 1Z74A 4INAA 2DC1A 1QP8A 4JROA 5H82A 4CV2A 1DO8A 3HHPA 3PDJA 4W82A 2YDYA 4CMJA 3ZZNA 2W2LD 5HRUA 1ARZA 3TL2A 4EDFA 4BV9A 3W4JA 1E6UA 1X0XA 2NVUB 2I76A 1ONNA 2WYWA 4GKVA 2B4RO 3DFZA 3H3FA 4FB5A 5AXCA 3UXYA 2IEDA 3CEAA 2RIRA 4YRBA 1LDBA 1R4MA 3V8BA 3PJGA 2QIOA 4ALKA 1XQ6A 3KRTA 1ZK0A 2VUSA 4ND1A 1FDWA 1DJNA 1U3UA 1VL6A 4WGGA 4CMIA 2H5LA 3U62A 2SCUA 4P4LA 1QV6A 4WLUA 1PZEA 2Z1NA 3H9JA 1ML3A 3E48A 1I0ZA 4BMVA 1PGOA 4IDBA 1NFRA 1LSSA 3AY6A 3GVXA 4AJKA 1R4NA 3RFVA 4D46A 1F8FA 3TNLA 1N7HA 1RM0A 4YRDA 4DMLA 4DQXA 1ONPA 3IUPA 4WLVA 3Q11A 3GZNB 4WE3A 3FHLA 3S2IA 3OHSX 2Y1GA 4R9SA 2PD3A 1KIFA 5TX7A 1L1FA 3GG2A 4R1UA 1Y8QB 1YGYA 1U3VA 2DTEA 2YDXA 4OGWA 4O5OA 4PVDA 1GCOA 1DIBA 3IOYA 3W4KA 4FOOA 3HADA 3TN7A 3JQEA 3ZWYA 4B4VA 2B35A 5B12A 2X0RA 4NFSA 5A5EA 4WNIA 1LDYA 5JCJD 3IP3A 1X7GA 4OO3A 1Q0QA 5KOIA 3RJ5A 1BG6A 3K73O 1GYQA 5MDHA 5T5QA 2YHIB 4WKGA 1ULSA 4YYZA 4I8XA 5THQA 1UZLA 4RF5A 1R12A 4RVHA 3WTBA 2DQ4A 3JQ7B 1RPNA 3K6JA 3O9ZA 1QKIA 4RV9A 3MJSA 1J0XO 2O7SA 4CPDA 1E3SA 2JHGA 4PLTA 3TJRA 5BR7A 2H9IA 5DN9A 3NTQA 4ZQFA 4CM8A 3CE6A 1XLTA 1A9ZA 1YS4A 3GT0A 1ZKMA 4CODB 3U5TA 1D3AA 5KJFA 5A05A 3GDOA 3D5QA 3DDNA 3HDQA 4ND4A 3Q3CA 4UVIA 2JKVA 4CLOA 3ZNOA 4CM7A 3HWRA 3IKTA 3O38A 3F1LA 5FWNA 2GDZA 1Q7CA 2E49A 3DR3A 4XGKA 1N7GA 1NVGA 1U1IA 3B1KA 3FNGA 2ZJ1A 3GRPA 2VOJA 3DMTC 5T8KC 3VH2A 1ADBA 2AXQA 4AJPA 1U2DA 1QYVA 3LT2A 3MOGA 2NTJA 2DBVO 3AUUA 5HA5A 1NXQA 5T8KA 2D2IA 1LBEA 3NDRA 4YRAA 1LA2A 1KETA 3WG9A 1WLYA 2AG5A 1KOLA 4LMRA 3SLGA 2PZMA 2VRCD 4CV0A 1YKFA 3DBVO 3DZKA 4YAJA 3UICA 3H2ZA 4L4RA 1HEUA 1LUAA 2EIHA 1O9BA 2JCVA 1GU7A 1P1HA 4O6VA 1QYDA 1C1DB 3DBRA 1TEHA 2D8AA 3LC2O 4IDAA 4YQYA 1GAEO 1VKNA 4XRRA 5CFZA 3FBGA 4B8ZA 3D4PA 2JCYA 4J1QA 2G17A 4KZPA 5A9SA 4R3WA 4JNKA 1UZNA 5DF1A 1E5QA 2VZ9A 1DIHA 2NQTA 2PFGA 1KS9A 3E9NA 5DCUA 4BNIA 5CG1A 2HCTA 1V0JA 5CAEA 3PHJA 4Q3EA 1ZEMA 5A03A 3KETA 2NQ8A 3NTOA 2Y1DA 1HETA 3UVEA 3RAJA 4DL9A 4NR0A 4WASA 2POQX 4DLLA 5EPOA 4ZQGA 1H9BA 5I9MA 1WDMA 1LC3A 3IJPA 5ITVA 1GTMA 1Y81A 2YV1A 3A28A 3EZYA 4NG5A 3B70A 2D1YA 1MUUA 4D43A 1RJWA 5JDCC 3PHHA 4IY1A 3DZHA 3G1UA 1AN9A 2QZ9A 4H3VA 1U28A 4XB1A 3CUKA 4IQ8A 4XIJA 5IF3A 3H6KA 3H2SA 1YRLA 5KCZA 2YW9A 2ZCUA 2VWPA 3ONFA 5JDCA 1TXGA 2Q45A 1VJ0A 5BSHA 2NVUA 5CP8A 1D7OA 2YQ4A 4TKLA 2X22A 1VC2A 4BS9A 4XJTA 1ISIA 2J5RA 3EMKA 7ADHA 3CPSA 4WEOA 4YXFA 4D45A 3JYQA 2E48A 2FMUA 4FFMA 4NFHA 3ZWVA 1WWKA 3AY7A 1SMKA 1ULUA 1I8TA 1CEQA 3GDGA 5A06A 4Y8VA 5JDIC 2ZCVA 5ICMA 4YJDA 4P4GA 5TS3A 1TT7A 3N7UA 1E1NA 4AJHA 1UDAA 4L73A 3VTFA 5IXSA 1BSVA 5JDIA 1QV7A 3IIEA 4DTIA 1GCUA 5TRTA 5DULA 1EVJA 4LVCA 4OIMA 3OA2A 2DM6A 2W2KB 1ISFA 4E2XA 2I65A 4CR8A 5TT1A 3GZNA 4Z0HO 4J1SA 3E82A 1NP3A 5EJ2A 1PS8A 1PGJA 1LRJA 1X7HA 3KSDO 3RUCA 1U2GA 2NU7A 4RQTA 3S2FA 4DMMA 5JYEA 1Y8QA 4Z3KA 2HLPA 5TLSA 2ZQYA 1UXGA 2C54A 4FW8A 3COSA 1DFHA 4RLHA 1IUKA 1OC2A 4E0BA 3JCZA 1RM4A 1JVBA 2EXXA 4A26A 1W8DA 4RCVA 1UP4A 5COBA 5AXBA 2EKPA 3ROQA 4E31A 1ADFA 1XKQA 3NV9A 2VQ3A 1V35A 2YHIA 3G1TA 4L76A 3UH1A 3I6QA 3NEPX 3F3SA 4CUKA 1CETA 4OSPA 3HJAA 2IXBA 1CQJA 1XELA 3JQ7A 4B79A 2VWQA 4M89A 3GNSA 3GK3A 4BO1A 1YO6A 3OA0A 2I3GA 1W4ZA 3OIDA 4J0EA 1EQ2A 1WVGA 4HKTA 3INTA 4A2CA 4E4YA 1IB6A 2DFDA 2EHDA 3FTPA 1TVEA 4GGOA 4KUHA 1ZBQA 1VL0A 1E7SA 3HFSA 3FNFA 1LSJA 3WGYA 5DT9A 4BKRA 3WMXA 8ADHA 1YWGO 3T7CA 3RUHA 2FR1A 3A9WA 2PY6A 3PJEA 3WJ7A 1JKJA 1B26A 4AJNA 1HE3A 3NT5A 1HL3A 1DC5A 1GQYA 3ZWPA 4C4OA 3I52A 4I5FA 4UREA 2VHZA 3LU1A 3W8EA 1L7DA 1P1JA 3GPDG 2X4GA 3G79A 5TIIA 3HN2A 5L7TA 2O3RA 4MVJH 5KIAA 4UVHA 3F1KA 3VPFA 2J3JA 3CKYA 3ETEA 4XWYA 5FI3A 3QE3A 4ZQBA 5G4LA 2D4AA 2F00A 3QWBA 1P0FA 2IZ0A 3RUIA 1ZXBA 3MJVA 2P9EA 1E6EA 4MVJE 4LISA 3BHJA 3HDJA 3EC7A 1EUDA 2OP0A 4Q39A 4I5EA 3BTOA 8LDHA 4XDYA 4U0JA 4BNHA 2X5OA 2BFOA 2X9VA 4LN1A 2BFAA 3HNPA 1BXZA 3KHUA 3R6DA 1P45A 2ZTVA 1JLLA 2B69A 4CL8A 3MEQA 4MVJA 4DVJA 1R16A 2QYSA 4CR7A 3DB2A 3DEYX 1K6IA 1RM5A 3C7CB 4R1TA 3ZU4A 2QG4A 1KEWA 1C1DA 3OEWA 4KDFA 3TPCA 3DAGA 1X0VA 4R3NA 3WBFA 4DBZA 4FCCA 1MC5A 1VKOA 1YQGA 3ZU5A 2QW8A 3L0DA 2PGJA 3IL2A 2PV7A 2EERA 1HZZA 2YJZA 4PLGA 3ZV6A 3NKLA 4NBWA 2Y1OA 4QTZA 2V6MA 3EVNA 3U4CA 4YJHB 4NFYA 3KYDB 1WMAA 1A7KA 1BDMA 2I99A 3Q0EA 4XB2A 2CSUA 3G49A 3GZ4A 4XYMA 1LDNA 3A1NA 1MG5A 2WTBA 2OHXA 4XIYA 4NJOA 3PRJA 3V5NA 3WYCA 2QZZA 3I9JA 2RHRA 3C7DB 4CLRB 2ZB4A 1IHXA 3HZZA 3C1TA 2VNAA 3NDJA 3PLNA 4NBVA 3PPIA 1EVIA 3OFSA 3ZDFA 3UAGA 3BA1A 1H5QA 5H83A 1BMDA 2PKRA 2WYVA 4RGBA 4M1QA 4NBUA 1ADCA 3GAFA 5I7SA 4G5HA 4HY3A 1GYPA 4I5GA 3VZPA 3S1LA 4GQAA 4F3YA 1H6BA 5JAZA 5KWEA 1KVUA 1GPDG 3UUWA 1NQ5A 2PKQP 1JWBB 1PX0A 1YONA 3E5RA 2WM3A 1PWXA 2A9FA 4H7PA 2C07A 4WK6A 4G65A 4ESOA 1LXCA 4JLWA 4RORA 3L4BC 3WICA 5KJCA 1C1XB 4HNGA 4XGNA 1OBFO 3SEFA 4E13A 2Y68A 3VPHA 4QT0A 1K6XA 1A5ZA 3L4BA 5AYVA 5IDQA 1C3VA 2NU8A 2XPCA 4ALMA 4H15A 3EW7A 3HB5X 3INRA 1O6ZA 3NT4A 4EUEA 1Q7BA 2FP4A 2WWRA 4I1IA 1E7RA 2OBNA 1KERA 4MIEA 3AUAA 2W2KA 1D1TA 3RI3A 3FR8A 2EW2A 1AGNA 1OZAA 2XF8A 3F46A 4D3DA 1LNQA 5A1TA 4EZBA 4KP7A 3WBBA 1EVYA 2X6TA 3NGXA 1H9AA 3PHGA 2RCYA 5AXAA 5JYDA 1ENZA 1MG0A 2Y93A 5CDTA 2HMUA 2VHVA 3ZWXA 1MFZA 3UCFA 4J6FA 2I9PA 4Z9FA 5THKA 3WSVA 3BZUA 4UUMA 1IZ9A 5CDUA 2PNFA 3FN4A 4MP3A 5GZ1A 5JCXA 4J4BA 4JJIA 2HK8A 4PG4A 2Y1CA 1PS0A 4GI2A 4Z9YA 3UGKA 4PLYA 1ZUD1 1XU9A 2IDZA 2GSDA 3I4CA 3OETA 4JQCA 1EQUA 2W2LA 3ZV3A 4LRTB 2AEFA 1JVSA 2HMVA 2ZATA 1Q2XA 4L75A 3GY0A 4FQ8A 5A02A 3BTUA 2BI8A 4CQMD 1GV0A 2NLOA 5T6BA 1O94A 4QXMA 3GFGA 1M2WA 4ZGWA 3CINA 1BXGB 3AW9A 4CM8B 2BFPA 2WEKA 3ROMA 4KQWA 2J3HA 1OMOA 1HXHA 4MO2A 2YYYA 4WNCA 6LDHA 3AFNA 5KVQA 4RF2A 3ZWNA 1JKIA 4B8WA 3GR6A 5C7IO 3TFOA 3ANNA 1DRUA 2IZZA 2ET6A 5ILGA 2DUUA 4ALNA 1XSEA 4AJJA 2VYVD 4DPMA 2ZB3A 3EHEA 4QQRA 3R1IA 3B6ZA 3WQRA 2Y1FA 3ABIA 1AE1A 1LQTA 4IMPA 4KUGA 3GVPA 4E6PA 2RHCA 4AL4A 4OM8A 2Y0DA 4P4NA 1QRRA 1ISMA 4ND3A 1XG5A 3WGIA 4KQXA 4NU5A 4ZVVA 5C5IA 1DEHA 2NV6A 3WGHA 1R37A 1A27A 4IS3A 1G1AA 4J49A 3QY9A 4WECA 4BNYA 3ETDA 2NTVA 2B5VA 3ENNA 4S3MA 3ENKA 1G0NA 5DCWA 2J5QA 5JCJA 3VHRA 1U3TA 1N9GB 1IULA 1LEHA 3LDHA 4R69A 5ITWA 3OJLA 3ZNNA 4AFNA 2JHFA 4FR5A 3WMWA 2A35A 5F1PA 3HUDA 5U1PA 2DUWA 2ILTA 3TOXA 4M8SA 4BKOA 3ON5A 1EE2A 1PL7A 2A4KA 3JQAD 4BKQA 3PYMA 3AU9A 2RH4A 4GX2A 2PH3A 4NHEA 3WLFA 4KMSA 2G0TA 1EZ4A 2YZ7A 3JV7A 1T2DA 1GADO 1I2BA 3PQEA 1HYHA 1Q0HA 2VOEA 1LI4A 1U7HA 1DAPA 2VRBA 3C8MA 3EDMA 3P2YA 4MPDA 2FR0A 4W6ZA 2FZEA 4YJHA 1V6AA 1LSUA 3KYDA 4Z9XA 3I9LA 5IJZA 2Q2QA 2QX7A 2V7PA 3ZW8A 5JNLA 1B0AA 3BHMA 3H5NA 4ALIA 1GUYA 3DZBA 2C82A 3JYOA 1I3LA 2CF5A 1DOHA 2WE8A 3AM4A 5B1YA 4XX0A 2GASA 4BNXA 1C14A 4CLRA 1QMGA 3WGQA 4G81A 1FDVA 1SPXA 3AI3A 4BNJA 1KEPA 5B4UA 5HWSA 2B37A 4M54A 1JW9B 2WDZA 4UEOA 4R68A 4CMKA 3WS7A 2XAAA 3WWZA 2NVBA 2OBYA 4BB6A 2HSDA 4QUKA 3FD8A 3ONDA 2I66A 1I30A 1J49A 1H2BA 1AHIA 3H9QA 4ZU3A 2X7HA 3ZNPA 4GBJA 3KO8A 3L9WA 1T4DA 4GMGA 4O0LA 1WXDA 2VRCA 3KSUA 4KTVE 3GUYA 1HRDA 3ROPA 1AXEA 4YACA 4DQUA 2PR2A 3E9MA 2GZ1A 2IODA 1ENPA 1GUFA 4FFRA 1PGQA 3RJ9A 5I7FA 4NBRA 2E37A 3AM5A 4CM3A 1FK8A 4XRGA 4PZCA 4ROSA 1LC0A 3GHHA 3NJ8A 2HDHA 4C7JA 3T4XA 1TA4A 1HSZA 5B4TA 1R0KA 1C1XA 2W4QA 1YB1A 3INGA 2G5CA 4JBHA 1F17A 3JQGB 3E9QA 1RYEA 3NT2A 5JAQA 5I8ZA 5JLAA 1K5HA 2Y67A 3KBOA 3KEOA 3OJ0A 4LSWA 3RU7A 3UCEA 3H9GA 4ONEA 3VH1A 5G0VA 1DHTA 2Y05A 4UVGA 3DONA 3RQSA 3TFQA 1BRMA 5AOVA 4IJUA 5GZ6A 2O3QA 4PLPA 3UOGA 3LQFA 2GZ2A 3RUFA 3D4OA 4K1LA 4RDIA 4D42A 5L53A 3DO5A 4UUOA 5JPIA 4DLAA 4M55A 4XQGA 5IZ4A 2OL4A 3GF4A 4BNVA 3VZSA 3PHIA 3D1LA 4YT5A 1ZSVA 5JC1A 4AJEA 1PQWA 3L6EA 2YV2A 4P8RA 4BGUA 1NAIA 1AUPA 3P5SA 4BO9A 1D8AA 4ZHSA 1YDWA 5JY6A 3PJDA 1T4BA 1LDEA 1KY4A 1RKXA 2Y99A 5FI5A 4N5NA 5KVCA 4D41A 3PTZA 5MGBA 2FSSA 4JN6B 3LT1A 1JU9A 1P0CA 1LRLA 1WAMA 3BMOA 4QECA 5CEJA 1T25A 4NBTA 1DLIA 3GVCA 4YTEA 5CEEA 1KVSA 2PZLA 3WGZA 4DIFA 3TZKA 4U5QA 3WXBA 5A04A 2O4CA 4L8VA 4PVCA 4TRJA 4CLHA 3EZLA 1TI7A 4I9HA 3JSAA 3GG9A 2P68A 4EJ0A 2BKAA 3QWIA 2IE0A 4TVOA 5J23A 3I6IA 3PIDA 2DTDA 1E0DA 2TMDA 2YUTA 4YWJA 5DZSA 5G0UA 3VVBA 2NUAA 2OO5A 2NACA 5KNLA 3WSWA 4NK4A 1BXGA 3O03A 3PHLA 1JQBA 4IDEA 1WDLA 3H3JA 4S1VA 3OMLA 3OICA 2PH5A 3RSHA 3GN2A 1NBOA 1FMCA 4MKRA 1VLLA 4W7IA 3AU8A 3ZU3A 2B83A 5EL0A 2GYYA 3K8ZA 3QVWA 5CG2A 1CDOA 1UP7A 4IDCA 3SXPA 1GFSA 3QVXA 1HDXA 4RVUA 4TRRA 3WJAA 1B8VA 2WSBA 4WOKA 3X2FA 3CTMA 4F6LA 3VAZA 1UDBA 2O3TA 1LDGA 5C37A 1HE4A 5EIOA 2NU9A 4E30A 4IXWA 3GPIA 1EK6A 4LGVA 4ND2A 5U4QA 4DC0A 1LDMA 2HK7A 2B0JA 4OKIA 2O7QA 4CMGA 3Q9NA 2DPGA 5DBFA 4JIGA 2BD0A 1ID1A 4I9UA 3OIGA 3GN1A 3W6UA 2FPGA 2FR8A 1TLTA 1B3RA 3JYLA 4BO0A 4UEKA 2JFFA 4PLHA 4ZD6A 3KEQA 1V9LA 2OOSA 1NHWA 4QEDA 2PGLA 1N9GA 4Y67A 3W4IA 4GSKA 3ZW9A 5EQDA 1BTOA 3MJ4A 1XWFA 3WWYA 4MVJF 1SBYA 4PLZA 4CL3A 3CZMA 5C7LO 3VC7A 2P91A 3QVOA 1Z82A 1P9LA 1N5DA 1M6HA 3HG7A 3B1JA 3PVZA 3KUXA 1LSOA 5L95A 1CERA 3DHNA 1EE9A 4GLOA 3IKVA 2BGMA 4CQMB 4F45A 1NYTA 1P1IA 3UN1A 3VKVA 3PZRA 1HLPA 4IDGA 4E5YA 1BHSA 2VWHA 2EKLA 5KKCA 2DKNA 1GZ6A 1U7TA 2O3JA 4U7WA 4ALLA 1HDRA 2DBRA 4ILKA 4L9RA 4GPD1 3WFJA 2YQ5A 3GGPA 5CHEA 1LRKA 2AQIA 1VJTA 3EK2A 3V1TC 4LCEA 3K2EA 2XXBA 3E5MA 3MJTA 3S2EA 4B4UA 4PGFA 5IAAA 3JD3A 3RKRA 3OQ6A 2X5KO 2HK9A 3C85A 4GVLA 3WTCA 1PJBA 1Z7BA 3H65A 3ZHZA 3QV1A 4JJFA 1QSGA 3GNTA 4Q3CA 1FF9A 1PL8A 4PLVA 4EUFA 2D5CA 9LDTA 4GVXA 3LVFO 3RVDA 1B16A 1VJ1A 4FSHA 4BO4A 5FF9A 4A7PA 3MTJA 5G0TA 2X9NA 1A9YA 3D4NA 3L9XA 1BGVA 1JA9A 1UXJA 4RF3A 5AVOA 4D0RA 3GDFA 3FCOA 1IE3A 1XCBA 1L7EA 4YT8A 5JS6A 5C7OO 2G82A 4GX1A 2GZ3A 2JFHA 4CLDA 5TF4A 2VHYA 3PWZA 3RUDA 4AJIA 1SB9A 2RH8A 4N18A 4IIUA 3NYWA 3WNQA 3SJ7A 5JXWA 4DRYA 3IAHA 3GQVA 5DOZA 3JQAB 1HE5A 3JQGA 3FSRA 3D0OA 1XIVA 5IZCC 3BTSA 1NR7A 4MKZA 4IPTA 3IS3A 3B20A 1JWAB 1B2LA 1D1SA 2D0IA 2VHXA 5ENDA 4YPOA 4A03A 2CY0A 2NADA 1N1EA 2B36A 4JJGA 4BKPA 5IZCA 1T26A 4RJTA 1XQ1A 4W99A 5ENVA 1I10A 4XYBA 3RWBA 1ZSNA 1SC6A 3ANMA 5BSFA 4BQRA 1QORA 1HDYA 4GSLA 4ZA2A 2J6IA 4NDNE 4PG8A 3U09A 4FOSA 3IMFA 3OJOA 2O2SA 1IHYA 1E3WB 4OJNA 2V6FA 3I23A 3IC5A 3JQCA 3WQSB 4ALJA 5I7VA 1PJ4A 2BF7A 3PI7A 5BT9A 3VDQA 3ULKA 2CDBA 2DU8A 1FJHA 3W1VA 4CMHA 1C0IA 1OFGA 3BYZA 3CSDA 3AK4A 4Y9DA 2J8ZA 2AEMA 4R4JA 4AG3A 3EVTA 3RU9A 1XDWA 2CDCA 4MOWA 3IQDB 4R1SA 2ZTUA 5F5NA 5JBIA 4Y6SA 3PJFA 5DP2A 2GUGA 1GEGA 2YFQA 3PQFA 4YB8A 4YBZA 4BQPA 4WUVA 3HB4X 3V2UA 4TZKA 4A10A 4Y98A 2YHUA 4BO3A 3TL3A 1EDZA 5JMWA 2X0NA 3NAQA 4I08A 1ZFNA 3D3EA 3P2OA 4W7HA 3GGGA 3CXRA 1V3TA 3M2PA 4E33A 4J43A 4JP2A 1ZJZA 1M75A 4I9NA 4FPXA 3C3XA 3SC4A 1B14A 1Z6ZA 1ZW1A 1F8GA 4FC7A 4YDRA 4AICA 3FWZA 2VZ8A 4KWIA 3IP1A 5TGDA 3DQPA 4CMEA 5IN5A 2IZ1A 2PLAA 3ADPA 2DTXA 5COQA 4B7CA 4BGVA 4E5PA 4DLBA 2VTEA 1DRWA 4MP6A 4UVDA 3MJEA 1U8FO 4PLFA 2JD0A 2XOXA 4J9UE 3ZWBA 4MINA 4OQYA 4MIOA 4BNFA 3RIHA 1IZ0A 2PD6A 2FSVA 4TROA 1E3LA 1PJ2A 2F1KA 4RVGA 1X14A 2FPPA 4AVYA 3D3WB 1NVTA 2DPHA 2O23A 3WFIA 3VPGA 2AG8A 1E7YA 4P38A 3ZGYA 4WLFA 5CPBA 1PGNA 4RPKA 4W4TA 1PIWA 1R66A 2GN9A 5I7EA 3Q2KA 5DBGA 4ZICA 5KJ1A 2XXJA 4K28A 3K5PA 4GH5A 2OXIA 3WR5A 1LJ8A 3RKUA 2ZB7A 3AM3A 3H9UA 4FFPA 5K0ZA 1ENYA 2AQ8A 3F4BA 2C29D 1U5AA 4NPCA 3MWDB 4X54A 3I9OA 4CMCA 5TNXA 3DBHB 1NFFA 3E8XA 3AI1A 1DIRA 2NVWA 2GRAA 2Q2WA 2AHRA 2OMEA 3KM0A 4DYVA 3B1FA 5LDGA 2AMFA 4CQMA 1I3KA 1W73A 3GLQA 3PGJA 3QP9A 3TF5A 2FWMX 4HXYA 3VPXA 1MLDA 1C0LA 3LC1O 3ZV4A 1FDTA 2C5EA 2YV3A 3OQBA 4FGSA 4NZ9A 5TQVA 1IY8A 3DMYA 3RUEA 5K9ZA 3GUCA 1DJQA 1MFPA 4KWHA 1I5RA 3DOJA 3OJEA 1YH3A 4G2NA 1PEDA 4BO2A 3P7MA 2BGLA 3K9QO 2CDAA 1QLJA 3VDRA 3GNQA 4K6CA 3QVTA 5GY7A 2JJYA 1X1TA 2R00A 3U4IA 5G0WA 1CWUA 1NQAO 1DPGA 1A71A 1R15A 2VYVA 4DXHA 4B7UA 3KTDA 1I01A 4ZRNA 1QYWA 1EBFA 1SCUA 2P9CA 4E5KA 5IN4A 1QLHA 3GH3A 1UUFA 1XR3A 3ZI0A 4DWVA 3PWSA 1F12A 4OOFA 4R16A 2Q46A 4BUCA 1AHHA 5TJHA 3R3JA 4PRKA 2OUIA 1CYDA 1A4UA 2HUNA 2ZYDA 2PA3A 3E1KA 4NI5A 1NTOA 1NHGA 1Y7TA 2X9GA 1P1KA 1VL8A 3LF2A 4OXKA 1ZSYA 4CM9D 1S7CA 1K3TA 1U8XX 3F5SA 1DIGA 4IS2A 2X58A 2BFMA 4TZTA 2D5AA 4EEXA 1IPEA 3JQAA 4WCFB 1ZK1A 3FF4A 4DPLA 4BNTA 5F21A 4KTTE 2FN7A 4CM6A 5L4LA 3PZBA 5CDGA 3NJ4A 4NIMA 1NVMB 3EYWA 3UKOA 2X8LA 1GYRA 4EEZA 1XGKA 2Y1EA 1GDHA 3AY3A 4RQUA 4XQ9A 4N54A 1T1SA 2J3KA 1UJMA 1MGOA 4MVJG 3OJFA 4RPGA 3QVSA 1ONOA 4HV4A 3MZ0A 1EUZA 2X0JA 3U4HA 4EI2A 4YAEA 2Y0EA 1ZJYA 3OM9A 4XCVA 2C20A 4FJ1A 4CLXA 3U49A 2QHXA 5L9AA 1HDOA 1E3WA 3OEYA 3EAGA 5JO0A 1DHRA 4M49A 5ADHA 1GV1A 1J5PA 1WP4A 2YY7A 1NR1A 1FDUA 3PIIA 3FPCA 4EITA 1GR0A 5HS6A 3IDSA 3BMOB 3VZQA 1GQQA 2V6GA 2P4HX 1WDKA 1YXMA 3RFXA 1UP6A 3WIEA 1T2CA 1ZMOA 2Q1TA 2JD2A 3G0OA 3JQDA 5TT0A 1C0KA 1PGPA 2VUUA 2P9GA 1SAYA 4EJ6A 3DBLB 3U0BA 3JQBC 4NMHA 2ZKLA 3H4VA 1VM6A 3H7AA 3D7LA 1XYGA 2AQKA 4L4XA 4HBGA 1UXHA 1GEEA 2ZQZA 3HDYA 3JQBA 1P3DA 3Q9UA 4YAGA 2G1UA 3FNHA 1K89A 2DBQA 2OGUA 3SJUA 3WGTA 3P19A 1I36A 3DAFA 1YE3A 3PEFA 2AE2A 2BLLA 1ZH8A 3VVCA 1NWCA 2CD9A 2HJRA 1HYGA 1YDEA 2PZJA 4J7XA 2D3TA 3V2GA 4D44A 3BMCB 4E12A 3VPSA 2UYYA 1DRVA 1TT5B 1ZK2A 3NRCA 2Q4BA 5EESA 5AXDA 1I3MA 2GCGA 2ZYGA 3NDIA 3Q1LA 4RF4A 4NK5A 2C5AA 4GMFA 4XEHA 2QRJA 3ZCXA 1O5IA 1LX6A 3QJ5A 3GC6A 5DCYA 3UCXA 3PXXA 1I33A 2W98A 2VYNA 3G3EA 3D3WA 4BOYA 2J3IA 1RWBA 2EWMA 5GZ3A 5F1OA 4XZ3A 3CIFA 3OIFA 1Z7EA 3DOCA 4PG6A 2AQHA 1T1RA 1R0SA 3DZJA 1U5CA 2HMSA 4CUZA 3HSKA 1NPTO 4OH1A 3TWOA 4IM7A 3JYPA 5EINA 1VSVA 4Z3DA 3O8QB 1ZXLA 4U0KA 4CLEA 1G0OA 4LK3A 3DBHA 5KVVA 4ZQEA 3FPLA 1XEAA 2GPTA 4GWKA 4JGBA 1UAGA 4BNLA 1U3WA 5A3VA 3SX2A 2FZWA 2HQ1A 1PZHA 1E7QA 4JCOA 4LRSB 4J4HA 1PS9A 1H6CA 5L7WA 1NQOA 1Y8RB 3QWAA 4RVSA 4XD2A 1TB4A 3BMQB 5A4DA 3RBZA 3WX0A 4D3FA 2CVQA 3TSCA 2BELA 4B3IA 4FFOA 4R9RA 1O0SA 5EERA 4BO8A 4URFA 4WPGA 3RC7A 3KYCB 1SZJG 3OP4A 2IRWA 3H9EO 4IZHA 2P5UA 1GZ4A 3I9KA 4OQZA 3RROA 4DGSA 3ASUA 4K6FA 1E1LA 5FEUA 5JAMA 2C0CA 3RBXA 5G2OA 3C24A 3QLJA 1FXSA 4UVEA 3L4SO 1HF3A 4DYDA 4DC1A 1JAYA 3H5RA 2V65A 4IUYA 5GMOA 3STHA 4BNUA 1SNYA 2QRLA 4EGFA 4AJ4A 4ZRMA 4CR6A 3JD2A
chains in the Genus database with same CATH superfamily
3OPXA 1QIFA 1XZDA 3QI2A 3AV0B 1QS0B 1QZXA 1ETUA 2BEJA 2ZB8A 1G3UA 1VJCA 3N0XA 4TQUS 4QELA 3E9RA 4OF4A 4ARZA 3Q5DA 3L8YA 4HXGA 1BHJA 2R6JA 3HGQA 3NHRA 3E22B 1NLFA 3KFVA 2VUIB 4R1OA 5AK6A 1KR5A 1M1UA 3RFUA 5KYYB 4Y1FA 2IPNA 2DXIA 1C7ZA 1EM6A 5KPDA 3PYLA 1HMYA 2ZSHA 3BBPA 3RSQA 3UOAB 2HYDA 4TKZA 1QC5A 3L6RA 5JW6A 1N34B 1ZUIA 1B15A 1K06A 2JAHA 4XIFA 3O4RA 2EJWA 1GPBA 1J42A 3HEBA 3HN7A 1VYVA 4F84A 1OC4A 2WD8A 4FGZA 1VLZA 2ZIZA 3KKLA 3T95A 4DA7A 3IT2A 4IJKA 5AJZA 1N32B 1H0RA 4C7OB 1PP4A 3DUFA 1BVRA 3PR3A 3WGOA 3TEMA 4OX9Y 2P62A 3JD4A 1K2VN 3OCUA 5AVTA 1KEVA 1YZYA 3D64A 3GOHA 4Y2RA 1SOAA 1C80A 3STUA 5FA5A 1BNCA 2IDJA 5BWMA 5IDWA 4GL4A 1F0KA 1Z4IA 3U4DA 1GL3A 3L0ZA 4TWBA 1JSRA 4G5FA 1PI3A 3DV0A 3E3LA 3HCAA 4ZMRA 5HXAA 2PH1A 1GGNA 3RS8A 4HBZA 1OY1A 4NMMA 1WM1A 3D5TA 4NZMA 4BIIA 1U1CA 3PKZA 1NJ8A 4B4OA 4NC9A 4UASA 4XW2A 4XGQA 3UFXA 1H0KA 4PFJA 4J94A 2ZT6A 5TR9A 1WBBA 4S0XA 3LK7A 1E3IA 2QVYX 2ZSFA 2AL7A 2ZZKA 4FQ5A 3FCEA 4D4HA 3E18A 2VYND 1Y98A 3KZNA 1JLMA 1Q0SA 2H59A 3O9VA 3M9XA 4H7IA 4MB0A 5LZ4A 1B8PA 1KARA 1QFJA 5DT2A 5EZQA 2W90A 5CVVA 3ADKA 5BY2A 4N0PA 4G8DA 3C8DA 4KE9A 3OTIA 1UXKA 1Z5GA 2C2GA 3K96A 3OP1A 4ZT6A 1SRRA 3ORHA 2Q41A 2I7VA 1ZINA 1WVIA 2W8ZA 1IZZA 3MM4A 4C7VA 5C2JB 3BERA 4BPRA 3P4XA 2OO3A 2IYLD 1ULTA 3AUYA 1D2HA 1G5PA 3L82B 3P2JA 3ICQB 4KGXA 2FWIA 3DBLA 5IKEA 4Q3BA 3DT9A 3M2TA 1NXVA 2GZHA 3CVYA 4CQLA 4ZJZA 3DNMA 1UR5A 3IQGX 1OOEA 1QHXA 2IPLA 3KDPA 2GMWA 3QWFA 4M88A 1QDEA 2EGHA 2PR7A 4MYHA 4HUQB 4EO9A 4XYLA 3ZDDA 4YT4A 2BVNA 1C7RA 3RFCA 2I4MA 3PNPA 3MT0A 2UV8A 5EXPA 5AW5A 4DAEA 2OHGA 1NX9A 5I7RA 3JU3A 4IGEA 2PX4A 5AW7A 1VL2A 4PSDA 2CUTA 1GGEA 3FG9A 3C1AA 2XKKA 1EK5A 1B7GO 1UBEA 1BW9B 3WLMA 4J0DA 1IOVA 5LLTA 4JQSA 3I83A 1F14A 1NLYA 3HUFA 3M4ZA 3PUKA 4MMZB 4XKJA 3S55A 4N41A 4U2FA 4FLMA 4O2BA 3Q98A 4XM1A 1XTQA 4JBGA 3L18A 2Z6QA 4Y2JA 1XEXB 2PHZA 1EHCA 2YMLA 3QPWA 5L3RA 3ESQA 5TQ0B 2WFZA 1WPGA 2OFPA 4GXRA 4HX2A 1FJXA 4BZXA 3PA6A 1L4MA 1OV6A 4LZLA 2Q7OE 1YU9A 1VHTA 1UMKA 4INZA 2A14A 4PCUA 4IIEA 4UUPA 3TLAA 2NYVA 4QIHA 1K2WA 1K7CA 3NW9A 8ABPA 2DLDA 4J75A 4XAQA 3QFTA 2GEVA 3AOGA 4OL9A 1GPYA 2IHKA 1GNTA 4FW9A 4JC0A 1B8UA 1GCAA 3CF0A 4M1KA 5ERYA 1H4SA 1VB5A 2IH2A 1G16A 3HCDA 4M0FA 1KO1A 4HZIA 1JEYA 1FW6A 3BIOA 3ZR4B 1JE0A 3IB3A 1SUFA 1Z29A 1ZZEA 1LLDA 3ABSB 2NNLD 1KMHB 3OM8A 2XT9A 3UKDA 1NVFA 2PO7A 1BMFA 4ARVA 4LJRA 2AMJA 2JH9A 2PZAA 4AO6A 5DTRA 2CMKA 3V8RA 2P3QA 1J20A 4DIOA 2FNAA 3OQHA 1JQ5A 4S05A 2X23A 2IU0A 4CHGA 5CDHA 5EMKA 2B7LA 3QBJA 2F8MA 2HRBA 4RPHA 3TQQA 4Z49A 4A82A 4KITB 3N2GB 4XB6B 4OTZA 3FVWA 2V3WA 1PR2A 2QBYB 1DAEA 3VV2A 2I6XA 2VJMA 3BRCA 3F9RA 4QO8A 2GO1A 1ZVJA 4KPUB 2IYPA 4NJMB 3F6YA 3C74A 2YXBA 1FMTA 2VJLA 3KT6A 4G1UC 1YR2A 4TWZA 2BUAA 2VJCA 4C7KA 5C3MA 4LQDA 4MDHA 1YZVA 1XJQA 3LD9A 3V1NA 5DLPA 2SHKA 3QF4B 4XQCA 3RRMA 4JL8A 3WO1A 1ZW6A 2WZBA 2WG2A 4PYKA 3MB8A 1YRHA 2ILVA 2DWQA 4R9VA 2X0IA 3HLKA 1PJCA 3C7AA 3TZ6A 5BNIA 3GEBA 1ZWKA 2NSYA 1NC3A 3JPYA 3AESA 3KE9A 4PINA 3O1IC 5CEFA 1T8UA 3BXOA 3AEKB 5KC8A 3VC2A 4B6PA 2OY0A 1HYQA 3OQPA 2HJWA 2GQ0A 1GTJ1 4KLNA 4F4UA 3PC8C 1U2TA 2EF1A 1WD5A 1M74A 2ECFA 2ZBRA 2V5UA 1YOVB 1ZN9A 2H2FA 3EUFA 2ZWOA 2W7TA 3MMNA 5GJWC 4B71A 4BMSA 4EQ6A 2YWBA 3OQMA 4PQEA 1LB1B 3T3MB 2XGSA 1XVIA 2BHLA 2PH7A 1VRCA 1NX6A 1WP9A 3PC8A 1M67A 3O3CA 3PNBA 5DI9A 4A0SA 4ZAFA 1MEJA 3LIPA 4MUKA 4QDTA 1DKRA 1QXSA 3WHIA 3QEOA 2XECA 4KB5A 2REXB 4Q3AA 3VM6A 4DREA 3EPKA 1QS0A 5CLFA 2V7XA 3S0JA 3T7AA 3GLHA 3NNSA 1ZK3A 4TVBA 1E9VA 1UH5A 2NO9A 2P6PA 3NFYA 4GYKA 4AZSA 4M0EA 2CLOB 4NYIQ 2JA2A 3PYXA 4RENA 5G0SA 4Z9BA 3E22A 1MOPA 5KYYA 2I7DA 5E3IA 2OXFA 1H94A 2V0NA 1MJFA 1EHIA 5T7BA 3PTLA 5FEMA 1KYWA 3N6XA 1QRAA 3QUAA 1SXJE 3JD1A 3CF6R 4QLOA 4UEJA 2G06A 1Z0ZA 4KR2A 4JD5A 2XUHA 4QUGA 3DKVA 1E0SA 1E79D 1MXHA 1WF3A 1WMSA 2JFOA 3C6MA 5GONF 1RFGE 3TTVA 1R9JA 1NMSA 4LKOA 4X8HA 3HBAA 2J5BA 4MW4A 4DA8A 5TJ9A 4CDMA 3H87A 1ZO8A 4KDCA 4X5OA 1COZA 4IKOA 2B8NA 3WP1B 5FPQA 4C7OA 3CBQA 5KDOA 2O5CA 2D13A 2O48X 5AW2A 4F12A 3WI7A 3DQQA 3WYAA 1IXYA 5ALNA 3KSRA 2X41A 3BT7A 4R9NA 2Y77A 3UB3A 4JR2A 3NGMA 4GE3A 1QHYA 3BSFA 3UC5A 3E15A 4X8LA 4AG5A 2PL3A 2YMQA 2EKBA 4U5XA 4BWYA 3HVJA 4GOMD 5L4NA 3P26A 2PSDA 3KV1A 2A0KA 5I01A 1VP9A 2BCGY 2V9CA 1EVQA 3F5QA 3KT8A 1LFAA 3Q72A 5IXJA 1PZFA 2QT9A 4QGSA 4GRAA 3TL6A 1Z5PA 4AD8A 2NXNA 2UUOA 3AUSA 5BSUA 4AQDA 4R51A 4YXWD 1NN1A 2FI1A 4CM1A 3I4FA 1NONA 3OZCA 2JDIA 4WZAB 1TF5A 3FGPA 3FCAA 3GMDA 3HN6A 4ZAWA 1RFLA 4EUSA 4CTJA 4N6OA 1PTJA 3N9IA 4CDNA 3PJRA 3C14C 4BVAA 2QEQA 5J2TF 1KNQA 4Z4IA 4WHMA 1BJTA 3WDKA 2GR9A 2R44A 4MYSA 1NAHA 5D7NA 3VKFA 4H0FA 3W04A 2HIHA 2P9BA 2OYRA 4F4JA 3CUSA 4G23A 4JVMA 2PBFA 3QLEA 3RD5A 2E9SA 5FO1A 1I13A 2RFLA 2WWTA 1WCXA 5EKTA 1YSCA 1DEXA 5ESWA 4TQGA 5KSOA 4H4DA 2ZUFA 4JXJA 2ZSAA 4WDQA 1QR6A 2XWBF 3K0FA 1W6UA 1DB3A 1K3FA 2AEJA 1MDFA 2CYCA 4HUQA 1CUZA 5FI1B 2VCYA 1FYWA 3C5HA 2H4JA 3W2IA 2OB1A 5JNTA 3U3XA 2ZQ5A 1Q0UA 1EDEA 2VUHB 4TYWA 1MA0A 2ZJBA 3CEPB 3CMMA 1MC4A 3TGWA 3MJFA 3FWNA 4CMEC 5I4CA 2PRYA 4O1HA 1OB2A 3TRFA 2CHUA 1LQUA 2DY0A 2OXRA 2Q1UA 1BW9A 1BROA 2OBLA 2IYTA 2ZSIA 3A1WA 3AR9A 4BX0A 3PF9A 4G07A 4FN5A 3B9BA 4II2A 1Z2CA 1JSXA 3UZUA 1EKXA 2QN3A 1MP0A 5B7PA 2VJYA 5AKJA 5JSKA 3USZA 1BRTA 2WU3A 1SWVA 4UM9B 1XEXA 5I8PA 4XGRA 1QOPB 4YFYA 2VTVA 5TQ0A 1QRUA 4HDAA 3RTGA 1ZQ1A 3AQIA 1H93A 4MGZR 4OKSA 1RWOA 3D2AA 5A4AA 1VLHA 1VSUA 3ET5A 4JLAA 4JVOA 3IAM6 2HA2A 1WKBA 4UXJA 3AP2A 2WUGA 2OHIA 1NSFA 1MTOA 4ZTUB 2F1RA 3VKUA 5KSZA 1O08A 1XCOA 4H7FA 4QO7A 1BGWA 3NTRA 4U8HA 1EDOA 3WJ1A 1OXTA 3T4UA 5LMCA 4RMIA 4QNMA 3O1JC 2E6UX 2DAPA 1N2HA 3I9NA 4HX9A 3TLKA 1KMHA 1PTKA 2KWIA 4L08A 1RHMA 4P22A 4EKIA 1EVZA 2BP7B 2ORWA 4KXFB 4QXQA 3TZQA 3MWLA 1SUBA 2OSBA 1E5LA 2NP6A 1C4OA 4TTIA 4B4WA 2ZYAA 1PZMA 1RNLA 4GOXA 4KN6A 1R3DA 3N2GA 4D8YA 5FBVB 5I45A 5FKJA 2X0DA 3S8YA 1J33A 2QBYA 4HGRA 1WHTB 1DBSA 4A5OA 2IP4A 4OAQA 5FA8A 2XYGA 4KPUA 4NJMA 2PUVA 4I3GA 4YLYA 3NYQA 3IUSA 4OKNA 2YICA 4B5LA 3KU1A 1O89A 1JJBA 2WKRA 4OGKA 1XQYA 4S2EA 1HDGO 1PJ3A 3I2FA 5KKAA 3BJIC 3RC1A 4KR7A 1NNUA 2PQ2A 3QQPA 4QARA 3GCXA 3FOBA 1EXDA 1T4CB 3NWBA 3PIRA 4MI9A 4A0HA 1EESA 3QF4A 4QREA 4ZEMA 4KPYA 3I9MA 4FP9A 2B3TA 1RXCA 5NLLA 2XUOA 4LCJA 2OZEA 4K0RA 4RD0A 4DWOA 2QR2A 2KSQA 1RLUA 2ID7A 2P30A 3OZBA 3A3KA 4FFLA 4X7RA 4A8JB 1T1EA 1P4HA 2GTPA 3AEKA 4KREA 2DPYA 1XCMA 4F7DA 4M7OA 1VE7A 3TAXA 5AW4A 4MW2A 5JYBA 1QQAA 2VXBA 2AK2A 3A4YA 1LPPA 5E1MA 3RSZA 2CJFA 1XMVA 1VRWA 1SKBA 2JIDA 1RKVA 3D02A 4KXYA 4CJXA 3NASA 2FE1A 1YOVA 2OV8A 4DBLE 1CD5A 2NP7A 1OI7A 3ZGLA 2JIOA 2OAP1 4I14A 1SCNE 3H2GA 1ZNQO 3GFOA 3E9CA 2NNWB 2EJVA 1NQWA 3RK1A 3WWEA 1L4GA 3PNMA 4XYGA 1K88A 3C48A 4P5PA 4GVPA 5E7QA 3WQQA 2AYYA 2ERXA 3HY4A 3VOBA 1YB4A 5J2UF 4NDZA 2W6ID 4JXXA 2PGDA 4E2YA 3BSWA 1YMVA 4UOQA 5G40A 4RV5A 3T7EA 1XTJA 3ADOA 4AJOA 1YJ8A 2YJ6A 3GEEA 3USCS 1F9AA 1YBMA 3ASVA 3RBVA 1TUGA 3FYCA 2GAFA 3SHQA 3N74A 5E2IA 3RRZA 5FUMA 3HCCA 1H3EA 3LHSA 1HUQA 3HE3A 3JYNA 4DV4B 4LGYA 4RACA 5ALDA 4B3GA 3DKPA 3NTXA 2RK3A 1QF9A 4O1MA 5LOVB 3E05A 1DC6A 3FJOA 1XRNA 1RHUA 2G3YA 3WIUA 1C9NA 4EECA 2V3CC 1K6JA 1SOWA 3U60B 4BNZA 2NUTB 1Q0LA 2O7VA 4QDZA 4MYDA 4UULA 3S2SA 3ROXA 3U37A 2CE2X 3K8QA 4LZAA 4F5WA 1YBAA 1KKLA 3CFYA 2RHJA 1O3YA 1DFGA 4X3OA 4YCDA 4WLEA 1TYAE 1QVVA 1HL7A 1KZ6A 2FX2A 4XJSA 3TW4A 2CNLA 2YZ2A 4R1NA 3GEMA 1Q22A 1NV9A 1WBJB 2UVPB 1ACLA 4YPFA 1EWQA 5UKDA 4L3VA 4MS4B 4ER5A 1CJMA 1NVAA 2CMDA 3ABRB 4A6XA 2C2XA 2WHPB 1UAYA 3ZLJA 2EFJA 1HT0A 3TXAA 3HR4A 3TIVA 3AF5A 2W43A 3RWMB 4WKPA 1KJQA 5TVKA 2QN2A 1T9BA 1TW3A 2GVNA 1S9DA 4K9QA 2IHJA 2J4FA 4FSXA 1TC2A 4QSMA 4PXYA 5ED4A 3KXPA 4ZZ0A 2OG2A 5BNFA 3KCNA 2XCSB 3S7ZA 3I92A 2QP4A 4YRCA 3FBTA 2Z2KA 1Z6GA 1E9BA 4WZAA 4G4JA 2IHZA 2QPOA 3R3SA 6REQB 2CLLB 3DL2A 5IDYA 3RCBA 1T24A 2QV0A 3PGA1 5DCLA 4A73A 4KXNA 4BLRA 2X13A 2Z2IA 4JSTA 4UNSA 3EVCA 4BLWA 4EF6A 4A6DA 4COKA 3EUWA 5JJLA 3B5JA 1SELA 2QK4A 2XD9A 2ZUWA 2Y2VA 5C4IA 2A9JA 1PK9A 5KTTA 2VNKA 3PEVA 1PQUA 1YCFA 1NDQA 2GWHA 4LEIA 3MUFA 2OZPA 1KVRA 5BO5A 4CF4A 4FNGA 4YV2A 4X00A 3GAZA 5D7BA 4MYTA 4B7ZA 2YR0A 1Z4OA 5BWLA 2F4NA 1O5TA 4TV9F 5BW8A 7YASA 2VWGA 4ND5A 3TRJA 2LD4A 2ONYA 3FUXA 3ESZA 2C7RA 2IYYA 3CZ5A 4NFLA 3VTAA 1E3DA 3DPUA 4MUJA 4MRPA 3NI2A 1XCGB 4C4ZA 3G9QA 1MXFA 3IDFA 1CJUC 3O73A 4OL0A 3K05A 5CW2A 4C3ZA 4EPXA 4EYSA 3DAPA 4V2IA 4HFRA 3FHCB 4Y2VA 5K8LA 1WQ4A 1P2DA 2HO5A 3C7KA 1LLCA 3G2PA 1AKEA 3I28A 1JYFA 3DFKA 4P86A 2OPBA 3GXOA 1KNXA 3LCCA 1XCPA 1KKMA 3KLMX 1XVLA 5A3JA 1USKA 4B3CA 1NYQA 3PEEA 4TSFA 3HNOA 3QVJA 1U1GA 2GHIA 1RJ9B 4LW8A 3ZDYB 5LKAA 1ORRA 5IYZF 2H1IA 4B82A 2EW8A 1U94A 1OYOA 1XZCA 4NAHA 1LLQA 4Q3DA 3ZHYA 2Q0XA 3WIOA 4RZIA 4AF7A 1N7JA 1O4VA 4QFBA 1GRRA 1SZPA 2Q4RA 3MWEB 3R3ZA 5ICFA 3DFMA 2SICE 4HN4B 3PX7A 3ETJA 4KDEA 3V6MA 3WIDA 3IJ5A 4R54A 1JE1A 4F6CA 5ABPA 4EFMA 1DE0A 2HIAA 3WNBA 1NP7A 3DSRA 2I6UA 5EJ5A 1QONA 3ACDA 1H65A 5AHOA 2JLXA 2BP7A 2FW8A 1M9NA 4CKBB 2AFVA 1V39A 4FGWA 3OTOB 3AJEA 1B00A 2FSFA 3RSGA 1ISJA 5C8XA 1OI2A 2VCEA 2YWGA 5IBRA 1KVQA 4E15A 1P75A 2OAGA 4YAKA 1HLDA 2FJUA 2VT3A 1YC2A 3Q7QA 3NIFB 5JWOA 1VCMA 4FS3A 1H4TA 3N76A 1YB2A 1A88A 1WHTA 2FPSA 3HYRA 2EAUA 5A6VA 1T2AA 3W8DA 3B3FA 1NNSA 4OSOA 1PV2A 4QU5A 1IG3A 5SYMA 2PZFA 3FPFA 3MCVA 2EG9A 2RGXA 4QPDA 4ARBA 2A0XA 1TIPA 1MV8A 2D54A 3IVXA 2PKXA 4S2UA 3OY7A 1DCMA 4IWYA 1Z28A 5FBHA 2BDTA 3WYDA 1RZRD 3GXBA 2JRLA 3EVZA 4RH3A 1E6WA 5KNDH 4A8JC 3K1JA 5FL7A 5H3CA 4CIVA 3ICWA 5IWAB 1VJGA 4C88A 3N2NA 1U3DA 1F4PA 2Z95A 1GPAA 2XYVA 1YRBA 2E4AA 5LYJB 2VDPB 3EIEA 3AZOA 4RVFA 1YL5A 4A8JA 4FNMA 1EAMA 2HIGA 2R7MA 1PG0A 4MJ3A 5U9CA 1GD1O 1XAHA 3VX4A 4C05A 2FEXA 4JL5A 5B58C 1FDOA 1XTSA 1CUFA 2J0VA 1RC8A 3N28A 5EJ6A 2EFDB 1UBRS 4DSZA 4DMUB 3ZD9A 4KOAA 1QPZA 5HFJA 1XZMA 3T9EA 5AVZA 3KLPX 1N8KA 3O1HB 5JCZA 4MVJI 4PYOA 3QFCA 3UO8B 3MWGA 4HVTA 3EQ2A 3WRVA 3EGOA 2IZOA 1TVKB 2EEZA 5F4ZA 5CAEB 1ORHA 2C7GA 1XZGA 2IHBA 3NX4A 4HQ0A 4RKYA 2CLKB 2H1SA 2ZBDA 3LOQA 1U6IA 1OREA 3ZN2A 4RD2A 1BXKA 1THMA 2F2TA 2IYVA 5JMOA 3LZDA 3EY9A 2XY4A 1XJ5A 3D3NA 4LWPA 3D6VA 4LY9A 5TPZA 3LX4A 2VJBA 2QLBA 5LOVA 3W78A 4HS9A 3GFPA 5FCDA 1CUXA 4PO8A 4EGJA 3P2MA 4MCIA 5F12A 3DM5A 3IEPA 4XOUA 4C3OB 4JT8A 3K0KA 3GJ8A 1ESNA 2EC5A 3GV0A 3HHPA 4G4SP 1SJ9A 4IQ4A 4X6UA 5TARA 4DDWA 3PDJA 5CFRA 1MAWA 1YQUA 4PN7A 3GRZA 1EWTA 3ZZNA 4NATA 5DHSA 5BNWA 4MWCA 3TL2A 5FTWA 4CKEB 2YRFA 4LE1A 2IU3A 4BFZA 1UJBA 5FLYA 2UVPA 2FPUA 1ONNA 3BIFA 5F64A 1ESDA 1X2EA 1V8OA 2J7PD 1RPTA 5HQTA 2WHPA 4FB5A 3CEAA 2RIRA 4XE5A 3TUIC 4YRBA 1TEZA 1OBCA 4M9QA 2N1BA 2RK4A 1SXIA 1Z62A 3NS7A 4ALKA 1GVNB 3ZCPA 1B93A 2C5FA 5LA6B 3KRTA 2OE2A 3IO5A 2LXNA 1G64A 4KQKA 4M99A 4NV3A 1BD3A 1FDWA 1DJNA 1RRVA 2H4ZA 3W8NA 2G1KA 2YTZA 2GVZC 1B23P 1OCEA 2H4HA 4MRAA 3S1AB 3KUCA 1V37A 4YRNA 3GLGB 1BJRE 2PNJA 1PZEA 1T1IA 4YWHA 1XPRA 1NRIA 2UUCB 1HG1A 1L9KA 6REQA 1I0ZA 2XVMA 4HXFB 4BMVA 3ENQA 3F3MA 2G0NA 1QV9A 1NFRA 2E7ZA 2HA0A 1AK9A 2Y2UA 3AY6A 3HV2A 1MPTA 2PUBA 1PFKA 4PYMA 5AKGA 1U81A 3TNLA 1N7HA 1J56A 3IE2A 2HSEA 3AETB 8AT1A 5FR2A 1RRMA 5HIMA 1TAQA 1DC7A 3CZPA 5M3BA 1SKQA 2NXCA 1WABA 2BGJA 3OHSX 2HV8A 3FYSA 1KIFA 4MDFA 4FFWA 1KI7A 4KXWA 5A3RA 1Y8QB 3JZMA 4YDHB 1CUAA 2YDXA 4OGWA 3UK6A 3KQNA 3DOEA 4JB8A 4ZO4A 1PR6A 2BKVA 3ZWYA 1R6TA 1Z4LA 3OE5A 3OZSA 4EKNB 5A5GA 4Y6QA 4F5EA 5B12A 1VPLA 4AYWA 4DMKA 4UCWA 2ODBA 3E81A 5FBQB 5JCJD 4IYRA 4H1TA 2BEKA 4ID3A 1X7GA 2LZ0A 3E7WA 1Q0QA 2ADFA 4N5IX 5EP1A 1QIHA 3BE4A 5FT9A 1BG6A 3SSMA 4IKEA 4ZDJA 4Y30A 421PA 5J43A 4D8VA 2YHIB 5MDHA 3MJRA 1RADA 3DH0A 5CNIA 5H9VA 4O4LF 2Q07A 2LPMA 1ULSA 3C3BA 1E6CA 4D9IA 4PX9A 4RVHA 2IJGX 4MUEA 4BFXA 3KJNA 1X7ZB 2BEVB 621PA 1WB4A 2DQ4A 2AJLI 1WQ1R 3K6JA 1QKIA 1F3LA 1JG1A 1UKEA 5KQGA 4CPDA 5B57C 1RJ9A 4YRTA 2H9IA 2NXWA 2OZVA 2FB9A 3OIVA 4RETA 3B2EA 3GCDA 3QKWA 3AQ4A 2HU5A 4MMYB 4P53A 5K3AA 4NZYA 3MWEA 4OQNA 4IOKA 3R0XA 1FYDA 3ZE0B 5K05A 1K6EA 3D5QA 3DDNA 3U1TA 5AJWA 2JKVA 3RTDA 2BKXA 5JH7F 2N75A 3Q6MA 4N48A 1QE3A 1W4CA 2LGJA 3UW1A 3B9RA 2TECE 4FMBB 3DR3A 1FMLA 2HX1A 1N7GA 1FQWA 3V80A 3B1KA 4CIAA 2ZJ1A 5IT4A 2PCJA 3ES9A 1SVLA 1SKUA 3A1UA 3DMTC 1UC9A 4CKBA 4GNKA 5HYVA 4D80A 4EA6A 4N5DA 1H5NA 4RSGA 1KO8A 4ZCLA 4A8PA 1QYVA 1X8LA 2PIAA 3H2BA 2DBVO 4WZBB 1KFCB 3ICOA 2WUWE 1WDWB 4OHPA 1SBZA 3IEKA 2WZDA 3NC0C 2D2IA 4TTVA 2VDWB 3NDRA 3ZUPA 3WG9A 2AG5A 4F60A 4LMRA 4N0MA 2F48A 1TGYA 3AKDA 3SLGA 4A9AA 2R6CA 3A6PC 4FCVA 1YKFA 4CV0A 1HMPA 3M6MD 4YRLA 4L1KA 4YAJA 1PVVA 4URUR 1UKYA 2QTTA 3D7KA 3NEYA 4BVGA 2BGTA 2IX3A 2R11A 3H84A 2PGXA 1NP6A 3A9TA 2YJ3A 5K2OA 2JCVA 4PBTA 1CUUA 1GU7A 1NVUQ 1P1HA 2C1XA 3PF8A 4FYVA 3TLMA 1O87A 2HPZA 1OZ0A 5C8ZA 4G0QA 4J8PA 5LYJA 4PGHA 3LC2O 4DDHA 1TEHA 1VKJA 3BL8A 4IDAA 1GAEO 1NNI1 1ZPDA 2ATXA 2JIZA 3HI6A 4M76B 4XRRA 3J81A 2YZNA 3CRW1 1UFKA 2WB2A 2RGDA 4RLFA 5GOTA 4J1QA 2G17A 1DXQA 2B92A 3RSLA 4G09A 1VE3A 3N39C 3RVPA 2CDRA 5DF1A 3NHAA 3MGCA 2JAXA 4L15A 2WOOA 5H8WA 1FFSA 4GSYA 3KC2A 3S8EA 3REFA 4NYJR 3SJZA 2VZ9A 2QR5A 4QBTA 2NQTA 3E9NA 4HXEB 5DCUA 4UHHA 1Q0PA 3WLRA 3QVMA 4K9RA 2V7GA 1TVKA 1LVHA 1V0JA 3LY9A 1OGJA 1P5ZB 2ECQA 3Q5GA 1E8MA 2YV5A 3FUWA 2HJ9A 3QKRA 2H06A 2NQ8A 2OXEA 1FQKA 3JTEA 4IILA 4E94A 5JD6A 2PUFA 4AZ0B 5HFNA 5GV8A 2Q3LA 4BATA 4GQBA 3AVVA 5GQSA 4YUAA 1J5XA 2Q5LA 3S70A 1QH0A 4GUAA 3V7FA 3GLTA 3KKOA 3LKBA 3RC3A 3HSSA 3VPAA 1P19A 1T8PA 2H2WA 3V8VA 5JECA 3RS2A 2HH9A 3B70A 3OZTA 1E2KA 1P91A 3EXHB 5EUCA 3V3TA 4YNBA 4C4YA 4H1WA 4EW1A 1AN9A 2QZ9A 3RVLA 3L0IB 1UOPA 3CUKA 4IQ8A 3H2SA 1XBTA 5LD2B 1J23A 1ELOA 2RGNC 5C8YF 5KCZA 2YW9A 2ZCUA 1JU4A 2CT8A 2Q45A 1UJ2A 4KLRA 1P4GA 1VJ0A 3CSSA 3S5JA 4CKEA 5BSHA 2VH2A 3GJRA 4GUDA 5E4TA 2JFVA 3MGKA 1YS2X 1H05A 2RGNA 4BS9A 3WNZA 4EOGA 3E7PA 1QG2A 4P2GA 4PPYA 3X1XA 2J5RA 4B3SB 3CPSA 3D7NA 4WEOA 3IPCA 3FFAA 1OFIA 2E48A 3GUHA 3P9NA 4CCWA 4HRXA 3OLYA 3HU2A 3BJEA 4DNFA 1WWKA 5LA6A 5JNRA 2Y71A 1T9HA 3AY7A 3JZDA 1DBWA 4UHCA 1I8TA 1NNEA 3EGVA 3U3MA 3FTQA 4YRJA 4AXBA 1IC6A 3B6JA 2ZCVA 5ICMA 2EU8A 4XM0A 5KOJB 1AY0A 1GTSA 3N7UA 5KQMA 3S1AA 3GLGA 3L43A 2ZSJA 2DKFA 1F9EA 3MOSA 4G8CA 4L73A 5ENZA 5ALHA 2O8FB 5IXSA 3EZ6A 1JHZA 2XZOA 1T91A 4DTIA 2ZE8A 2PFSA 1U63A 2Z08A 1KYXA 3OJWA 1C1YA 5CCDA 1WBDA 3EXFB 4LVCA 3G02A 1X7YB 2Q6OA 2A6PA 1M8JA 1TM7E 1CRZA 1MJ5A 1XRJA 1YS6A 2R4QA 1Z5OA 2CUZA 2I65A 2QTCA 2W2KB 1R6XA 2HGZA 3AETA 3HP7A 4QVKA 5LZ2A 3RT9A 4B2PA 2XUQA 4JENA 1SUCA 1ZUWA 1NP3A 4C14A 2Y1KA 3RUCA 5AI6A 3DYBA 1X74A 1YIAA 5GGYA 1YFJA 1OF1A 4DCCA 1Y8QA 3IYLW 5FBWB 4Z54A 1K5DA 2ZQYA 5BQXA 1V4NA 2DX7A 3G5MA 4RA9B 1AKNA 1K9VF 5DHRA 1J0CA 3COSA 1IUKA 4ZVTA 3SQOA 4ISBA 2WWHA 3JCZA 1MOZA 2AN5A 3T5CA 4A26A 4KNYA 2PN1A 1U7WA 1W8DA 3GH1A 3F8SA 4ZALA 3GDHA 2JG3A 3AEUB 3CURA 4TMWA 3ZZ0A 2DSTA 2VQ3A 4UE2A 2YHIA 3RK4A 1CP3A 4DY6A 1PQYA 5HOQA 3WLIA 3QTBA 3ZD6A 5K3DA 2XYRA 2DLNA 4LJLA 1X7ZA 2BEVA 4OFXA 1ZD3A 3HJBA 4M89A 3IMCA 2WA1A 3E35A 2EDAA 2FK8A 1K4MA 1ZOSA 3OIDA 4J0EA 1QAOA 3INTA 1I2MA 3WK7A 4A2CA 1PQ4A 1NC1A 3A36A 3TNDA 3UWOA 1RXYA 1Y7PA 2DFDA 2PUAA 2O8EB 3H0KA 1TVEA 4GGOA 1MJNA 1M5RA 1UWCA 3O8DA 3CGGA 4TTJA 1LV7A 3L8DA 2JGFA 3PNLA 3K3PA 8ADHA 4LTDA 5EGNA 3L8HA 5JATA 4OI2A 3N87A 4R8SA 2QTMA 3WJ7A 1NVVR 1VL1A 2V96A 1B26A 4PC3A 1F8UA 1JH8A 1J8FA 1XROA 4D56A 4DR4B 1DBQA 1L1RA 4RXUA 1E1RA 1GQYA 3GT3A 1D2EA 5FV7A 4D9HA 1FS6A 2EW1A 4U9UA 4UREA 3TQIA 3LU1A 1KZ7B 1VMIA 1OWMA 3P8ZA 3PGVA 4BC1A 5I5EA 1P4JA 2E21A 2X4GA 1U9YA 2HRCA 3DMPA 4TT3A 1KA9H 1R5OA 1OW3B 2BC9A 5KIAA 3WE7A 1EFTA 5FI3A 3UG6A 2ZJ8A 1OAKA 4HLNA 3FCCA 4ZQBA 2D4AA 4WZBA 3GB9A 4OJMX 3VR5D 2O2JA 3E4CA 2B8WA 4DADA 4BN5A 1YZQA 1KSJA 3MJVA 1TM2A 1E6EA 4B3BA 3OWOA 3TEFA 3BHJA 4H7EA 4O1IA 3EC7A 2VDWA 4EG4A 3UAXA 4DSOA 1FLVA 2OQ2A 3LDFA 4Q39A 4RTOA 1R6VA 3BCUA 8LDHA 1SH7A 3GLVA 4U0JA 2IVFA 4WCVA 5KX5B 5BMOA 4Q24A 2JJ8A 5I6DA 4UE3S 2H17A 2O2XA 3IP9A 5LBTA 1Q3HA 1O5OA 1TCUA 3L7LA 1GTRA 1YR3A 2AKAB 3GIDA 3CEMA 1BMTA 4JOQA 1PG5A 1QVRA 4A5SA 4Q9HA 1J97A 2YWFA 2JLAA 1JJIA 1OZGA 3LL4A 1K6IA 3VU1A 1XWIA 2W4IA 4LUCA 3QGMA 3ZU4A 4EW3A 3W2EA 4PC2A 4RHTA 2XUJA 1S8NA 1ZOPA 2ZI7A 1ZIOA 3P9KA 5DGCA 2EQ5A 4BVHA 4K9NA 4ARSA 5ANRB 3A2KA 1X0VA 3G9UA 4PTLA 3U44B 2FWJA 3WBFA 2R1VB 1QU3A 4EI9A 4EHLA 3ILHA 2QW8A 2C77A 4I81A 4FLEA 1Z33A 1Z7YA 2BR4A 1Q44A 3HYLA 4JYMA 4E3WA 2EERA 4POOA 3AG6A 4PAGA 1POWA 4PLGA 3ZV6A 1V7ZA 5ADUS 5A4FS 2A58A 2Y1OA 1TADA 1R6UA 2PEZA 3MTQA 5A4MS 3U4CA 4A0QA 2H4FA 2HSJA 2Q4TA 4DDUA 5BPHA 4NFYA 3PT5A 2HF9A 2I99A 4L27A 4J0QA 1DV2A 2CSUA 4LHZA 5AD1A 1E89A 1HORA 1C0EA 2CVHA 1HE1C 1ODJA 2AZTA 5CLLA 4AZ0A 4DT1B 1CY6A 4WOCA 1TAGA 4RNDB 1BQ4A 1JSZA 3EXHC 4ETIA 3HNRA 1MVNA 2VNIA 1RJEA 4FZVA 4NJOA 2DH5A 1QRSA 3WRXC 1ECGA 4XSGA 3E70C 3WSTA 3PRKE 3CNOA 3HZZA 3MCTA 3NDJA 2PZBA 3DEIA 4JOBA 3T3GA 2YXDA 1WXWA 3EXHA 3OFSA 3QBVA 4M1EA 2I7TA 2CK3A 3A7DA 3UAGA 2Z98A 3WRXA 2I2DA 2XKJE 2C5BA 3R8FA 4NBNA 1NUUA 5IAGA 1MHPA 1E3QA 3PS9A 5KCMA 3TNFA 1SWWA 4M1QA 2DRIA 2ORVA 2QX8A 2FMXA 4MJXA 4RYDA 4V1CB 1V16A 2W37A 4QKQA 5IS2A 1KMQA 4C29A 4Z53A 1OJ7A 3G89A 1ILWA 1XK7A 2VK4A 3EGXB 3GRUA 4LXTA 3WYFA 4O4HF 2UU9B 1N2IA 1U7PA 2WU1A 5HG0A 3JVIA 5JAZA 3DE3X 3F90A 1ZD2P 2A59A 2FPKA 2QTHA 4E46A 2PKQP 1O77A 2VZEA 3E3AA 4IR7A 1EG7A 4HQRA 2ETVA 2R5WA 4K3UA 4ZARA 1FFHA 2QGZA 3X1YA 2A9FA 4NU0A 3G5AA 3BWMA 4TXMA 2ANCA 5F52A 4ESOA 5LP6F 2WD9A 2ASVA 4PHFA 2CB9A 1LXCA 4IZ6A 4KVZA 4NZZA 4OX9B 2ZT8A 1LY1A 4PGGA 4FYPA 1FDRA 4RPCA 4B75A 5KJCA 5K3EA 3SEFA 3TH5A 3K0EA 3BXGA 5KOJA 2Y68A 4QT0A 3JYHA 2O8FA 1K8QA 3LBFA 4KMOA 5AYVA 5B7GA 5CFNA 2NU8A 2NAFA 4ALMA 4OA8A 1J06A 3ED1A 3PUIA 3EW7A 3HB5X 4K2AA 4MWTA 4DHEA 4FVTA 3QPAA 1Q7BA 2FP4A 1JIVA 4I1IA 3EXFA 1KERA 1X7YA 4MIEA 2W2KA 4A2WA 1WOYA 1YCHA 5LYYA 2XF8A 3IIIA 1JZTA 1XE3A 4JBXA 3WBBA 3NGXA 5AXAA 1H9AA 1SK9A 2J7KA 3PHGA 4HB0A 2GN2A 2Y6VA 2Q3MA 2RSLA 3B7PA 5AKHA 1ODSA 3A4MA 4IWXA 1RVDA 3CCBA 3UCFA 4J6FA 4M7RA 4RA9A 5KNBH 4NBSA 5JCXA 1KIMA 3H1TA 5CDUA 1DRKA 1VPVA 5GZ1A 4ICIA 2COEA 2HK8A 4Q1AA 1OT5A 4XCQA 3OCVA 5J5CA 4AY6A 1J2TA 3NO4A 5AUQA 4GI2A 4I19A 4TLEA 4KO8A 3AEUA 2WTMA 3FVRA 3RPEA 2H2AA 3OUZA 3REOA 4DLPA 5ARBA 4LDZA 3NBYC 3E1GA 3IHTA 2IDZA 4QULA 1AF7A 1H8EA 2RC5A 3FWYA 2GM5A 3I4CA 1WMFA 4KAFA 3K94A 1MABB 1DRJA 1FZQA 4HAVA 2MYNA 3FZYA 3KKEA 2FXVA 3ECAA 2ZATA 1Q2XA 2AJCA 4L75A 2O0MA 4KXVA 3U17A 1BH6A 1EB9A 3GY0A 1Y3CE 1DT3A 1YMQA 1Y5IA 2F3QA 3HXLA 3STXA 4QNRA 3BTUA 5KNBA 1ZMBA 1UPFA 2NLOA 3BD8A 4HH1A 5T6BA 3ZGZA 3CNQS 3MT9A 1SA0B 3GFGA 4GFDA 2ZBUA 4NPHA 1CUSA 2NUAB 3CINA 2R3SA 3ZCSA 3AW9A 1CU1A 2M32A 4CKZA 3PPXA 1FBTA 4KQWA 1EXNA 1OMOA 1YZNA 3AERB 1HXHA 1AQ6A 3L1KA 2PVPA 1K5PA 2WF8A 4KQFA 4WNCA 2IHNA 1CJBA 1K4KA 1KI3A 2HA4A 1JKIA 1G5HA 1IBRA 1Q21A 1VG1A 3FZQA 1UK6A 3RTAA 2X0EA 2R25B 3ZWDA 3QOXA 2D0OB 2P9QA 5I7UA 1VPWA 3ABQB 2IZZA 2IPXA 2NO1A 2RAVA 4FINA 5D00A 3P94A 1XSEA 3SE7A 4UU8A 1WL8A 3HUUA 4I0WB 1S2LA 5JXHA 5JJKA 1AKTA 2I2CA 2I3BA 3ABIA 3AVQA 1WZCA 4Q4HB 1WTCA 5H0IA 4AULA 4EMTA 1D6MA 1E2FA 1TCBA 3BFJA 5I51A 1V5WA 1OGYA 3OY2A 2P35A 2ZAYA 4P4NA 1T8YA 2B99A 3ASYA 3KFXA 2C78A 3SX4A 3UMFA 2X2EA 1PFYA 2HQRA 3QU9A 4ZVVA 1P17A 1B2RA 1ZNWA 2G72A 1R37A 3KPUA 3LUCA 1A27A 2C4NA 4KO2S 4EVQA 1HA3A 3QY9A 3R2JA 4WK0B 4BMXA 4FDUA 2G8NA 2NTVA 1Y1RA 3ENNA 3V4OA 5GPBA 1G0NA 3K1YA 4D9FA 5MF6A 4B3XA 4BNDB 3I9V1 3LDHA 5F7OA 1KF0A 3M33A 3P9QA 1FNNA 3OJLA 5AK5A 2MHCA 4O2RA 1ND6A 4AFNA 3JATB 1NL3A 2GA8A 1CLUA 1U7DA 4E6EA 2ZUSA 5LIPA 2A35A 5F1PA 5U1PA 1E5TA 4F2DA 4JA0A 1J9GA 1ZMRA 2HBYA 2HM7A 4LV5B 3I2KA 4BKOA 1LJUA 3L05A 3TB6A 3JQAD <