5DP1A

Crystal structure of curk enoyl reductase
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
332
structure length
332
Chain Sequence
DQPVQLKLSEYGVIDNLNWQPMQRKTPLANEVEIEVAAVGLNFRDVLNALGLLKDYYAEHFNITSAEQLTFGFECAGKISAVGEQVSQWQVGDEVIGLLLHDGLSSFITTSVEYVVAKPKQMSFSEAATLPLTFLTAQYGLQHLAKIQPGERVLIHAAAGGVGQAAVQIAQVAGAEIFATASPSKWEFLQSLGIKHIMNSRTLDFAEEIMKRTAGEGVDVVLNSLNGEYIPQSLAVLTPKGRFVEIGKIGIWEKEQVKEKRPDVSYFPFDLQEAVQQQPGLIGQLSEELTQQWNQGKLKALPHKVFPSTEITAAFRYMQQAKHVGKVVVSMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CurK
publication title Structural Basis for Cyclopropanation by a Unique Enoyl-Acyl Carrier Protein Reductase.
pubmed doi rcsb
source organism Moorea producens 3l
molecule tags Oxidoreductase
total genus 104
structure length 332
sequence length 332
ec nomenclature
pdb deposition date 2015-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5dp1A02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 5dp1A01
1PX0A 2NADA 4WK6A 3SLKA 1AN9A 1V3UA 5JY1A 2C54A 3ADOA 1U3VA 4KWHA 1ZH8A 4LRSB 1IE3A 1PGOA 1A5ZA 4RVFA 1J6UA 3WGYA 2C5AA 3GHHA 2TMGA 1EQ2A 4WJZA 2R2GA 4BOYA 5FI3A 1D8AA 3JQBC 4MINA 3WQQA 5KIAA 1LDMA 5MGBA 5AXBA 3O38A 4FFPA 1KS9A 3FBGA 5LC1A 3HB4X 4J9UE 2PD3A 4WLOA 4E31A 3DQPA 2C5EA 4F6LA 3AUUA 1Q2XA 4XGIA 1IUKA 4YXFA 4CMJA 3EYWA 4EJ0A 1M76A 3LDHA 4Y9DA 4YEDA 4E2ZA 2W8ZA 3T7CA 1NFRA 4B79A 3L77A 3PQDA 2VRCA 5DBFA 4WASA 1PJLA 3INGA 1T26A 4QX6A 3AI1A 5K6AA 1BW9B 1U5AA 3SBOA 3PJDA 1QV6A 7MDHA 1EVZA 1E92A 1NQ5A 1AHIA 4XYLA 4NHEA 1U2GA 1VSUA 3D4NA 4OAQA 3FPLA 3GF4A 3W4KA 2FPIA 1W0CA 2OHXA 4U6QA 1B15A 1U4SA 3NT5A 4ZQBA 1K6XA 2WDZA 3KO8A 4XGKA 4QEDA 3ZWWA 4S1VA 3LK7A 4ZD6A 1ZK4A 2P9EA 3WFIA 1KETA 1I33A 4GX0A 5FFFA 4CQMA 4QO8A 1P45A 2UDPA 1I36A 2VYVA 1DIBA 1MG5A 1C1DA 3NT4A 3VH4A 1XG5A 4CLOB 1U7TA 1LQUA 3D0OA 3C7AA 5B4VA 1FDWA 2ZKLA 3RBXA 2JKVA 3ITDA 1XCBA 1WVGA 4L76A 1I3MA 2J3JA 3DOCA 4QO7A 4DGSA 4GBJA 1T4DA 4BNZA 4TMFA 4D79A 4K1LA 4L4XA 2D2IA 3EAGA 1U2DA 3QY9A 4L8VA 5EJ2A 3PGJA 1UXJA 1H2BA 1NVMB 2VUTA 3M1AA 3QHAA 4WEQA 4K6FA 2OBYA 3LT1A 5GY7A 1Y1PA 5K9ZA 4XDYA 3ICCA 3U4IA 1SB9A 4YQYA 4ROSA 1PU2A 1M66A 3ICPA 4PZEA 4BGEA 2HMSA 1X7GA 4PG7A 1UDCA 2DFVA 4MVJA 1HLDA 3VPFA 3DZGA 1PL8A 3AU9A 4Z3DA 1Y5MA 3L0DA 5MDHA 1I3NA 1CDOA 5JMPA 4EUHA 1K3TA 1HXHA 1IYZA 3PXXA 4LMRA 3AK4A 4U0KA 1IZ0A 4Y67A 3ZNNA 3G49A 3S2EA 1JDJA 1ONOA 5T8KC 5THKA 1ZK0A 3QRWA 4HBGA 4XYGA 3WJAA 3DEYX 1J0XO 3P7MA 3IJPA 2VHZA 3RKUA 4E5KA 3FI9A 2P9CA 1HE5A 5AOVA 4BHTA 1KEPA 3IDSA 3HDQA 4DBVO 1VC2A 4R16A 3KZVA 2YW9A 9LDBA 3W4IA 4EGFA 4CM1A 4BB6A 1DC3A 1XYGA 3I9LA 4BVAA 4FS3A 3RASA 5C7OO 3HFGA 3N74A 4DYDA 1X7DA 4ND5A 1T2CA 1KBZA 1M2WA 1UDBA 1YL6A 2XPCA 3UCXA 1AXGA 1XEAA 4A5OA 1PQPA 3NTRA 4JLWA 3V1YA 1GUFA 4QFDA 1P1HA 2IZ1A 1EQUA 4TKMA 1IZ9A 1ADGA 2NU6A 4NQZA 5L53A 3HUDA 1GZ3A 2GN4A 4YJGA 3ASVA 4PLWA 4W9NC 4WE3A 4CR6A 4UEJA 2RHCA 3RU7A 1W6UA 3PK0A 2I76A 1Q0LA 5G2OA 4DPMA 1HKUA 3NJ4A 3Q9NA 4RVGA 2O3JA 4HNGA 2OOSA 2HUNA 2JD2A 3D1LA 3DZBA 4NBTA 1PZHA 2GRAA 3CIFA 3IIEA 4XIJA 5DDIP 3RIHA 4PLVA 2JHFA 3HE3A 3TZKA 3EMKA 3JQBA 4P4NA 1F0YA 4CLHA 2HKIA 1Q0HA 3F5QA 1K5HA 4YAIA 4ND1A 2ZJ1A 3ZNQA 4CLDA 4DUPA 1OMOA 2W2KA 2OGUA 1O5IA 3E8XA 3FN4A 4O63O 1PJ3A 3H5RA 2E48A 4PRLA 1LSOA 1PJQA 4FQ8A 3IAHA 4ILKA 4Y8VA 2HMUA 2I3GA 2O4CA 1I10A 4B4UA 2O48X 4LK3A 3GVPA 4FGSA 1XHLA 1CIVA 4YAKA 4KP7A 1YQXA 1UXHA 2YYYA 5JPIA 3ETEA 4FW8A 5J23A 5TC4A 1LNQA 2WYUA 4JBHA 1EBFA 4NJMA 4BO3A 5KJFA 4MIEA 1F12A 2BKAA 3K30A 2NTJA 4Y6PA 5LCXA 3BHJA 4NFYA 4J3FA 4K28A 4BKOA 1WNTA 2YQ5A 3E6AA 4FFNA 4I08A 3OBBA 3QWIA 2E6UX 2NQTA 3WWZA 3IJRA 4D7AA 4O6VA 5TJHA 3ZWCA 2C2YA 4BNKA 1IL0A 2QX7A 2G1UA 1TLTA 2HCTA 4J49A 1E6WA 2VNSA 5JAIA 4TKLA 2HJSA 2NWQA 2Y67A 4FDAA 2C20A 3B6ZA 3C1OA 3VDRA 1QSGA 5CG1A 4MVJH 2DVMA 4FJ1A 4OQZA 2EERA 2GF2A 3KSDO 2BF7A 1U7HA 2RIRA 4RF5A 5JC8A 4KDEA 2ET6A 2VHXA 2X5JO 3AFNA 4TRJA 4G5HA 3D3EA 1B14A 4CL8A 1ZSNA 3PJEA 2WE7A 1DLIA 3FF4A 6LDHA 2JFGA 3DBLA 4GX5A 1GUZA 4H16A 2BH9A 3GEGA 4PLYA 5I9LA 3U4HA 1G0NA 5F1KA 1YL7A 5DZSA 4FGWA 3ULKA 3ZH2A 3WMWA 2VHWA 2PGLA 4RQUA 4IUYA 1R12A 4CM4B 3RBVA 1HYHA 4TVOA 2BFMA 2V7PA 3NTOA 3JYPA 4E32A 3PI7A 3CPSA 4M87A 3DZIA 1WW8A 4R1NA 4UEOA 1YL5A 1YE3A 4KTVE 1D3AA 1LQTA 2PY6A 3VZPA 2AQKA 5T5QA 3BMQB 5GZ3A 3QV1A 3GG9A 3RU9A 3TSCA 5COBA 1E7RA 1P44A 3DB2A 3KUXA 2HSDA 4R3WA 3ROPA 3BMNB 1KERA 1T2EA 5AXAA 1GEEA 1B3BA 3H5NA 1MFZA 3KSUA 4CL3A 5T8KA 1DXYA 3OIGA 4G81A 3DMTC 1QP8A 3M6IA 1EVJA 4J0EA 4B4VA 1NAHA 2Q2QA 3N58A 2O3SA 2O3QA 4ZA2A 5EQDA 3VZQA 5KOIA 1ONNA 4W4TA 2NU9A 3GAZA 4OGWA 2W90A 5DCWA 3TL2A 3OP4A 1CJCA 2HRBA 9LDTA 4CUJA 1W8DA 5IN5A 3PFFA 3LSYA 4AL4A 3JQEA 2X22A 4XB2A 2NTNA 4J4HA 1ZKMA 5JDCC 1N8KA 2NVUA 3RSHA 3WIEA 2FY8A 1ZJZA 4YJFA 2GUGA 4HFJA 3E48A 4RL6A 4ZRMA 4FC6A 3CSDA 4XR4A 5IAAA 2Q45A 4R01A 2GZ1A 5K0ZA 1HE2A 2FHSA 2BFOA 2Y93A 2NSDA 1FK8A 3CTMA 3F9IA 4DIOA 4CQLB 2FR0A 1ZK2A 3TJRA 2Y66A 8ADHA 1B8VA 4ZICA 1NHGA 1CQIA 1QKIA 4U8GA 2A35A 3MCVA 2I9PA 1Y8QA 5DT9A 3VZSA 1EFLA 3LYLA 3DBHA 1BDMA 3HFSA 4CJXA 2PZMA 4YBZA 1TT5B 2EJWA 2IE0A 3JQCA 1EDOA 3D7LA 5TJ9A 2B0JA 3FNFA 1P9LA 2B4QA 3GGOA 5DN9A 4Z0HO 5H83A 5BSFA 4PLTA 2GN8A 1GD1O 5IXYA 1H6CA 1U8XX 3H2ZA 4E2WA 3KXDA 1MA0A 3KRTA 3I6QA 2PD6A 3D3WB 4FIZA 4JJIA 1HRDA 3K8ZA 4NBUA 4IPTA 3T4EA 5TX7A 3PIIA 1YB1A 2FPPA 3Q11A 4PCVA 1H2HA 1B8UA 1GAEO 4IDAA 1JKIA 2HK8A 1E7MA 2VZ9A 2Y0EA 3DBRA 1A71A 3OICA 4ZRNA 4E12A 1GZ6A 3RUAA 3L4SO 4Q3BA 2B4TO 4R1SA 1YKFA 5FYDA 2YV1A 1PZFA 1HETA 3LT0A 2V6BA 2O7SA 2PKQP 1LC3A 3WICA 3PWKA 3NGXA 1AGNA 4MOWA 1FXSA 4J4TA 1O8CA 5EPOA 5KJEA 2QZZA 2EGGA 3NDIA 1HE3A 2PV7A 2V65A 4JCOA 4P38A 1KVRA 5A9TA 3TQHA 4K26A 2WJPA 3RI3A 2A4KA 3HZZA 3ZU2A 4E2YA 1E3EA 4DQXA 3R1IA 4GX1A 5I9MA 3ADPA 3GNSA 2F1KA 3PYXA 2O23A 3AI3A 1X13A 3PVZA 1DPGA 1VJ0A 1HF3A 5TNXA 3PWSA 4MDHA 2Y68A 1DO8A 5HA5A 1SZJG 3ZW9A 5I7SA 3PPIA 3KLPX 2AA3A 1HDRA 2HK7A 3SXPA 3DZJA 4F46A 1JVSA 2VHVA 3QVTA 1BW9A 1M75A 3H9JA 1LTHR 2HLPA 3VZRA 3ZWMA 3CMMA 4TRMA 4HX5A 2V6GA 1NTOA 4QECA 4H7PA 1E7YA 1R6DA 3H8VA 1A9YA 4UVIA 3L6EA 2FRDA 5IDXA 5G0TA 3UXYA 1JKJA 1Y9EA 3ON5A 2PNFA 3QWHA 1Q1NA 1ISHA 4KUHA 2CDBA 3PYMA 4E4YA 4EJ6A 1TEHA 4W99A 2BMAA 4JBGA 4IDDA 3ZWYA 3W8EA 4XEHA 4J90A 1SAYA 1J5PA 2IYPA 4BNLA 3ANMA 1GZ4A 1Q7GA 4KQWA 3U3XA 4JQCA 5DULA 3ZHXA 4OKIA 2AEMA 4D3FA 5JAMA 2EP5A 1U8FO 3JCZA 3DMTA 3F6YA 3PWZA 3GC6A 2CY0A 3BHIA 4KUEA 2BFAA 4CLOA 4UUPA 2FR8A 3RWBA 1E7QA 1NPYA 3WQSB 3JYNA 5I7VA 4PLCA 4J9VA 1QXSA 1UH5A 3AUAA 4XQ9A 2DTEA 2ZQZA 2IZZA 3Q6IA 3DONA 3SJ7A 2P68A 3W4JA 1K0UA 4D3SA 4M1QA 3ZI0A 3OJOA 4YRDA 1YBAA 2XXBA 2RCYA 5EMHA 1BVRA 4GQAA 3B70A 2XOXA 1YB5A 3ONDA 4RF4A 3AU8A 1NYTA 1O0SA 2EKQA 4PFJA 5U1PA 4Z3KA 2HMWA 1SPXA 4E2XA 1R0SA 3SVTA 3AJRA 4BNFA 3NGLA 2FWMX 4WLFA 3JQGB 4D0RA 3QWBA 2DBRA 1NPTO 1Z45A 3GH3A 3MJTA 4I5FA 4CUKA 1Y8RB 4D43A 4PZDA 1P77A 2Y1DA 4DL9A 1B3RA 1T1RA 1H9AA 1PR9A 3QQPA 4G2NA 4BQPA 2ZTLA 2Q4BA 2DAPA 2J8ZA 2X4GA 3BA1A 1MFPA 3AY3A 3OHSX 4WLEA 3VPSA 5TF4A 1R0KA 1UP4A 4R9SA 3MWDB 3OIDA 4ZQHA 3JQ7B 3WBFA 4DTIA 1N9GB 2OZPA 2PH5A 2ZJ0A 1DFHA 1Y5RA 1ZEJA 4YCAA 1AUPA 4J1NA 4YAJA 5L3ZA 2PWZA 4J16A 1YO6A 4LSWA 3CZMA 3D4PA 4WPGA 1YJQA 2YY7A 1EDZA 1KY4A 5ICSA 1TB4A 1YVEI 4FJ0A 3ANLA 3AI2A 1H0KA 4GMGA 4ZN6A 1PIWA 5KCZA 5F1OA 2O2SA 4FN4A 4L75A 4XRGA 3LVFO 1Z73A 4CR7A 4YRAA 2PR2A 3IP3A 4BS9A 2X1HA 1FDVA 3WQRA 1M67A 3RBZA 1WDLA 1T2AA 1ZCJA 4IXTA 2WSBA 5CFZA 4CPDA 5A1TA 1DIHA 2CMDA 2WE8A 3U49A 4ALLA 3IQDB 1V3TA 3GDOA 3WB9A 4EYEA 1NFQA 2OMEA 1NPDA 4OKNA 3B1KA 2Q2WA 3L9XA 1HDGO 2A9FA 5TS3A 3VTFA 3ZCXA 3LQFA 1LI4A 1VJ1A 1D7OA 5KKCA 3BTSA 3BMCB 4M86A 1XGKA 2BGLA 3PQEA 1ZJYA 3WGOA 1DC6A 3RC1A 1GR0A 5FWNA 1VI2A 1X14A 3FTNA 3WIDA 4AG3A 4U0JA 1V0JA 3TNLA 1HSOA 1UDAA 4IXWA 2ZCVA 4I5DA 3RQSA 1N5DA 2JD0A 3ETGA 4GH5A 4E30A 4I9NA 2VNAA 2Q1SA 3TDKA 2VUSA 4RVUA 4BMNA 4DIBA 3AWDA 4TQGA 2B5WA 3ZWXA 4NPCA 5JFOA 4D41A 2H63A 3O26A 1A9ZA 3GMDA 3Q2KA 2BGMA 3GDGA 3GN1A 1SB8A 2Z95A 3IL2A 1Q7CA 3DTYA 1SEPA 1PSDA 5DBIA 4G65A 1I3LA 4P8RA 1E5QA 3FNHA 4JROA 5F3RA 5JO9A 1M6HA 4Q39A 3TPCA 4A7PA 8LDHA 4ZHSA 4LN1A 4PRKA 1R15A 3WGHA 4XJTA 4B3JA 3UOGA 4ZJUA 3OSUA 1WMBA 1UZNA 3UH1A 3JQAB 3IOYA 1A72A 4CMIB 4N5MA 1I30A 4ZQFA 3TN7A 4IQ0A 4NFSA 3IKTA 1OOEA 2JCXA 1PL7A 4TWRA 5HM8A 1I01A 3FR8A 3PHLA 1I2ZA 1CYDA 5HBRA 3BIOA 2VCYA 2AEFA 1MGOA 1ENYA 2BGKA 3GR6A 3U0BA 3CZRA 4GX2A 4F6CA 3FD8A 4FD3A 4IINA 1NNUA 2VWGA 3STHA 3QVOA 1DDOA 3KYCB 1FMCA 1SCUA 4R4JA 3WG9A 4IGEA 1ISMA 4Z9YA 1NAIA 1BHSA 1X0VA 4FC7A 4WCFB 3JQAD 1LU9A 4IIUA 1DRWA 2B37A 2BI7A 1P1RA 2CDAA 3FHLA 3G0OA 3PHHA 4J43A 4JK3A 3RFVA 3HSKA 4A0SA 2OO5A 3AUTA 1LLQA 2VTDA 2Y0DA 4R68A 3WYCA 1YRLA 3W8DA 1VE9A 3HJAA 4IJKA 1BXGB 4IJVA 4GWGA 1G0OA 1MC4A 5CDGA 4CM4A 3C7CB 5JCJA 4L0QA 5G4LA 1SEVA 1H6AA 4BNUA 2YDYA 2O7QA 3PZRA 3DTTA 4XYMA 3S2GA 5L7WA 4AJEA 1HWYA 2VT2A 1R4NB 2R6JA 5A5FA 2C7VA 1W4ZA 2GLXA 3DFZA 4II2A 3V1UA 4RDHA 3OJEA 2P9GA 3BMQA 2GCGA 1GUYA 3DO5A 4OYRA 5I7EA 3H65A 1XIVA 1HDXA 1XU7A 3BMNA 3E03A 4O0LA 1Q0QA 1T25A 3C1AA 5CG2A 2VOEA 1DIAA 4CR8A 2EXXA 4XB1A 4XDZA 1HLPA 4ZGWA 3TFQA 5A9RA 4R69A 4LCEA 1RJWA 2EW2A 1KVQA 3JD2A 1I24A 1DIGA 1B16A 2HJRA 3NTQA 3A4VA 2BFPA 5KVSA 4EUFA 1PJBA 2DLDA 3CH6A 3QIVA 1L7DA 4RCVA 4D45A 1ORRA 2GD1O 2J6IA 3KTDA 3EVNA 3Q3CA 4EJMA 4BV8A 3OA2A 3H9UA 5COQA 2YHUA 3QP9A 3K9QO 4WNIA 5C5IA 4DVJA 4PLFA 4CLEA 1N2SA 2AQHA 4CV1A 4E13A 1KC3A 2H1SA 2C07A 4XYEA 5JLAA 3GT0A 3T7EA 1VRWA 2D1YA 3PDUA 3VC7A 4R54A 3RUIA 2Q46A 1SC6A 1FDTA 1E7SA 4OXKA 1Y7TA 3I83A 4KZPA 4CQLA 4BKRA 2OP1A 4Z9FA 1ENOA 4RORA 4D42A 4EUEA 2R00C 1HYEA 2GGSA 5B4TA 4ESOA 1DLJA 3WGTA 1V8BA 3LU1A 3FCOA 5C7LO 2X5KO 3WGGA 5ES3A 2D59A 3RC7A 1TT5A 3PHJA 5U4QA 4BMSA 2DFDA 2RHRA 4KDFA 4XR9A 4CM6A 3IP1A 3RJ9A 4ALNA 3L4BC 3VPHA 1TT7A 3JD0A 4BNJA 5A04A 4RVSA 4UUOA 1ISJA 4H15A 4YDRA 4MVJG 1X1EA 3DZHA 2WD8A 2UUOA 3H7AA 3RUFA 4E0BA 2YQ4A 3R3JA 3WOHA 1TA4A 4O1MA 4BIIA 4WKGA 1BDBA 1Z7BA 3I4CA 4OOEA 3BZUA 1H5QA 3GNTA 1QV7A 5IZCC 2AQ8A 3E9QA 1I8TA 4NR0A 3D3WA 5KJ1A 3C24A 2GSDA 5B37A 4RJTA 2VN8A 1U3UA 3UN1A 3KVOA 3DAFA 5T6BA 4BB5A 4J2HA 2EGHA 4PZCA 3RJ5A 1HDOA 1LX6A 1Z82A 4ALMA 3OJ0A 3MJCA 5L51A 4CLRB 3GA0A 1NASA 1E6EA 1ZO8A 3U4CA 1ZUD1 3H9QA 3PFWO 3WSVA 2JCVA 1LEHA 2QW8A 4BNVA 1SOWA 2F00A 2X0JA 1MB4A 3CINA 3FSRA 3OETA 1U4OA 4IDFA 3NV9A 1GV0A 1UR5A 2VYND 1U28A 3ZV5A 2EHDA 5IG2A 1PZGA 3GNQA 4RVHA 3WNQA 1KIFA 1GQQA 4TRNA 4AJPA 3U9LA 2QZ9A 4RPGA 4ND3A 3WTBA 1WZEA 5A03A 5AYVA 1DJQA 5KJ6A 1VM6A 1ZNQO 2XXJA 3AFMA 1PR3A 2GN6A 3JTMA 3ZWAA 1SMKA 1GEGA 5JMWA 3RROA 1BWSA 2B36A 4BO2A 5IJZA 3EUWA 1I2BA 3BTVA 3OJLA 1J4AA 4PLHA 5TLSA 4GLLA 4I5GA 3HB5X 3PQFA 4R5HA 1TXGA 1HL3A 2QHXA 4AJ1A 3LC7O 4GLOA 1DC5A 1G1AA 3PJFA 3VOSA 5JC1A 3SX2A 1PGJA 1DC4A 2EEZA 3IC5A 4CMAA 2X9NA 2Q4EA 1D1TA 1XU9A 1KOLA 3W6ZA 4LRTB 1O9BA 4UAGA 4NMHA 3VPGA 1R16A 2Q3EA 2NACA 2JAHA 3H9GA 2YZ7A 4QT0A 2D4AA 3KYDA 1LSSA 2X23A 5A02A 2WWRA 1VL0A 4WLUA 3TL3A 3H3JA 1ZXLA 1HEUA 3RUDA 1JU9A 1OAAA 3EDMA 1ZEMA 3AOEA 1I5RA 2B83A 4IBOA 4L4SA 2VZ8A 4B3HA 4K6CA 5BT9A 5TSDA 2X7HA 4WEOA 1ENZA 5A05A 4BNXA 3E5RA 1HDCA 2W98A 4UVGA 3OQ6A 3DL2A 4YB8A 5JYDA 2HDHA 4RDIA 4RV9A 4NU5A 3UGKA 1ZXBA 1A4IA 2AXQA 4R51A 4J0FA 4MP6A 5TGDA 3L6DA 5TT1A 4BO5A 5A06A 4OXNA 3I1JA 4BV9A 1T2DA 5G0SA 1DIRA 4MO2A 1EVYA 3DOJA 1DAOA 4H3VA 3AY7A 1IOLA 2BRUA 5KJCA 4WCFC 4NBWA 1Z7EA 2PZJA 5ILGA 3GEMA 2W2LD 3RKRA 1KC1A 2IXBA 5DP1A 1B2LA 3ST7A 4E33A 3RD5A 4GKBA 4L74A 2D3TA 2FOIA 2J3IA 5HS4A 1E3WB 1OZAA 3OEWA 1WDKA 3HN2A 1WZIA 1JN0A 1GY8A 2E4AA 3S2IA 3TZHA 5COAA 2Z1MA 2D5CA 4E6PA 3G79A 3ZU5A 1LLUA 3AM3A 1IY8A 1JA9A 1O89A 2ZB3A 4QFCA 1YOVB 5TQVA 2UV8A 3JQDA 4HNHA 3QVWA 3JQGA 3V8BA 1RWBA 3SC4A 1Y8RA 4PVDA 4YACA 2ZTMA 2YJZA 1QYXA 2R00A 4Z0PA 3OM9A 1E3IA 3OFSA 1E77A 4L73A 1C1XB 3GHYA 1JAXA 1M6WA 4BL5A 3QWFA 1HT0A 4WCDA 3DBVO 3JQ7A 1N9GA 3K2EA 1LBEA 4OXYA 5BNTA 1K89A 3VAZA 3L4BA 2ZTVA 2OORA 3DHEA 3X2EA 4II3A 5ENDA 1RYEA 1V9LA 3WBBA 2P5UA 1EEHA 2JD1A 4NDNE 3WLFA 1HDYA 3C8MA 1A27A 2HAEA 5KNLA 1F06A 2JJYA 5IZCA 4XX0A 4MVJM 1YS4A 2FN7A 3I5MA 4PGFA 1EBUA 3KM0A 2CSUA 5B4UA 4ND4A 4NH4A 1JQBA 5L95A 4FOOA 1JAYA 4ALIA 3VH3A 1VJTA 5KWEA 4KMSA 1R4MB 1DHRA 1AXEA 1YH3A 5JBIA 3JQ8B 5IDWA 2I5PO 3WDSA 3SEFA 3B20A 3S55A 5DOZA 4BUCA 4CV0A 4HUJA 1GTMA 4YRBA 4UEKA 3K96A 1RM0A 4BKQA 2H5LA 3LLVA 3GZNA 3S8MA 2WTBA 2O4UX 2GNAA 1H94A 5ADHA 2PH3A 4IZHA 6ADHA 3E18A 4NI5A 4BO7A 3QA9A 4YJHB 5LDGA 4QSMA 3JYLA 4OSOA 1RKXA 1B0AA 1PQUA 1EMDA 3HNPA 3V2UA 4AJJA 1GDHA 1UAYA 2D5AA 3TFOA 3BMCA 2EKPA 3W1VA 2J3HA 3DAPA 3H4VA 1H9BA 1F14A 3KV3O 1NVGA 4GGOA 5IDQA 1I32A 1MXHA 4Z9XA 1ZMTA 3ASUA 4B8ZA 3UW3A 3GPIA 1KY5A 3I9NA 1N92A 4ITUA 4EBFA 3NT2A 1MXFA 3A14A 2CF6A 4W6ZA 4NK5A 4FOSA 1LJ8A 2LDBA 3EGOA 4IDEA 2PD4A 3A9WA 3FRJA 1UJMA 4IDCA 1Z6ZA 2I99A 1Y81A 1HZJA 5A5EA 2Q99A 4I5EA 2DT5A 4FR5A 1D1SA 3I9KA 2AMFA 4J1TA 2W2KB 2Y1FA 4D0SA 3ROKA 5HS6A 3F4LA 4N18A 1PGNA 4M55A 4RPJA 3WFJA 4CV2A 1WDMA 1KVSA 1QLHA 2GR9A 2XF8A 4KTTE 4O59O 1PS8A 1GPDG 2ZB8A 1S7CA 1W73A 3B1FA 3IUSA 4GI2A 1LSJA 1GL3A 3AM5A 1DRUA 3W8FA 5ICMA 4RF2A 1Y9AA 3GDFA 4DPKA 4L9RA 4B7UA 1OC2A 1K2WA 1N1EA 3JQAA 1YXMA 1ZFNA 3G1TA 4XCVA 2AHRA 4IS3A 4MPDA 2GDZA 3VH2A 2CNBA 4CMIA 3ENNA 5C7IO 1B8PA 1PWZA 3NDJA 5IZ4A 2JAPA 4BNGA 4CMKA 4AJ4A 2ILTA 1CEQA 2IDZA 3UF0A 4CUZA 5JDIC 4OSPA 5FEUA 3ANNA 4XWYA 4FFOA 3QW2A 1ISGA 2AW5A 2GASA 5EN4A 1DEHA 2IODA 3MTJA 5CEJA 1EFKA 2NQ8A 3NKLA 4TRRA 2PLAA 3WJ7A 3KYCA 1FJHA 1NM5A 5BSEA 4CMHA 4OQYA 4WCFA 1SNYA 1GQ2A 2CZCA 1MV8A 5DBGA 2HRZA 4YAGA 3G3EA 4BO0A 4GWKA 3DWFA 2B69A 2GZ2A 3WWYA 3I9JA 1GCOA 3NDRA 4A26A 2P4QA 3MZ0A 5CDTA 2E37A 3DHYA 2O3UA 3E9MA 2HMTA 1ZSVA 3DZFA 4LISA 1BXGA 4NZ9A 2IXAA 2E82A 5THQA 2WD7B 2G17A 3CXRA 1GV1A 3V2GA 2GYYA 1U5CA 3DC2A 1F8FA 3UVEA 1Z74A 3ABIA 1PWXA 5F21A 3AY6A 5CDSA 1O95A 3ZWNA 2PKRA 4AFNA 3R3SA 1LDNA 1R4NA 2YDXA 3TWOA 1C3VA 3JV7A 3H5AA 4DWVA 2VUUA 5F5LA 1F17A 3WLEA 4D46A 1NHWA 3DFUA 1P0FA 1ZK1A 5TIIA 1JWBB 1PS9A 3PLRA 1JWAB 4Q3DA 1DFGA 1LC0A 3GFGA 3CEAA 1UUFA 4Z0TA 4AICA 3JYOA 1HYGA 1CWUA 4NBRA 5CEEA 2DBVO 1RPNA 2I3AA 2X9GA 2OFPA 1PQWA 3ZNPA 3O9ZA 5JO0A 2ZIZA 3JQ9C 3LT2A 1GPJA 3JYQA 1P74A 4IM7A 4NU6A 1LRJA 5GMOA 2TMDA 1JKFA 4TZTA 3CKYA 3HDHA 4WECA 3RAJA 1RM4A 3KLMX 4JGBA 4A10A 4YT2A 1PJCA 4OHUA 4D3DA 5ER9A 1WLYA 3BHMA 3Q1LA 4I8XA 2C0CA 2GZ3A 4EEZA 4Y6RA 4AJOA 3WR5A 4RPLA 1KEUA 4CM3A 4UVEA 4LVCA 1RYDA 5F1PA 3AM4A 2YV2A 4NIMA 4Q3NA 4XYBA 2EJVA 1YBMA 3UFXA 4BO4A 1O94A 4BNHA 4B7XA 1H93A 1IPFA 3ZDFA 1UP7A 1LLDA 4Q3AA 1EVIA 3GUYA 3GVIA 4DPLA 4EITA 1NVTA 4DRYA 2BI8A 3M1LA 1P1JA 3W6UA 3WTCA 3HN7A 1C0KA 3DDNA 1E0DA 4IJWA 3F47A 1XDWA 2JCYA 4BNWA 4CODB 4E5PA 4ZQGA 1DBVO 2UVDA 3CUKA 1G6KA 1T1SA 3BMOB 5F5NA 3LZ6A 3DHNA 5KVCA 4OH1A 4YWJA 4Q3EA 4AJIA 4EW6A 2EG9A 1NBOA 3KB6A 1NFFA 4TROA 3LT4A 3PIDA 3O8QB 2ZTUA 1UZMA 5BR7A 2UYYA 1Z75A 3DBHB 3GGGA 7ADHA 1IB6A 3U09A 1PL6A 1BG6A 3AUSA 4EDFA 1KVTA 1E1LA 4RGBA 4C7JA 2VYNA 3WYBA 5ILOA 4MVJE 5BNFA 1AE1A 4DMMA 5JYEA 4YVFA 3QJ5A 4DA9A 1QG6A 3MJVA 3PDJA 2VT3A 2PA3A 1NR7A 2B5VA 1SOVA 3ZHZA 4DREA 1BMDA 5EL0A 3O4RA 2E49A 3DAGA 4DLLA 3BTUA 4CLRA 2PFGA 1R37A 1JTVA 2CFCA 2CVQA 1R0LA 4GGPA 1H6BA 3DR3A 1UXIA 2ZB7A 3HQ4O 3WX0A 2BLLA 4N5LA 1YB4A 3GZ4A 4DIFA 1E3SA 5AXCA 1E1MA 1BVUA 2YHIB 1OC4A 3OF2A 2W4QA 4CM8B 5BNIA 5JDIA 1PJ4A 4YQZA 2NTVA 3JD4A 3KSZO 4JIGA 4BNMA 5ITVA 4XQGA 3I9MA 4DC1A 4I1IA 2OXIA 1DAPA 3F3SA 5AQ1A 4CM9D 5CPFA 1HZZA 1ML3A 2BD0A 3EW7A 5G0VA 1ARZA 5TRTA 2AEJA 2ZQYA 3BAZA 3MJSA 5JSFA 4RLHA 1T2FA 4HP8A 4WOJA 4PIVA 5GZ1A 3I52A 4GSLA 3HADA 2C7GA 1F8GA 5JY6A 5BSGA 5G4KB 2C29D 3K6JA 3MOGA 4BKPA 4O5OA 3PZBA 1BTOA 4N5NA 1VPDA 4DLBA 2V6FA 3ZGYA 4PLPA 1C0LA 3RUCA 2Y1EA 3GMSA 4DQUA 4P22A 1ZW1A 3RC9A 3QE3A 2Q2VA 5L40A 2EF1A 3KEQA 4L4RA 3F5SA 5I9NA 4Z6KA 3NAQA 2EIHA 3Q2IA 1PJSA 3H2SA 4UVDA 2W2LA 5H82A 2G76A 1VLLA 3C7DB 2YFHA 2QG4A 3LF1A 4URFA 4XKJA 1LDEA 2FMUA 4FBGA 1V6AA 1ADBA 3L6OO 4XD2A 3FWNA 1QMGA 4IDGA 3FR7A 3OH8A 4RPKA 4J7CA 4CV3A 5BQFA 4RLSA 2DUUA 2D0IA 1VL6A 4UUNA 3GRKA 2CD9A 2WEKA 4IJUA 2ZATA 4M89A 3OA0A 1KEVA 3E9NA 3OIFA 3LF2A 3JQ9A 2DPHA 2NNLD 3HG7A 4LSMA 4MKZA 1GCUA 1K6IA 3P5SA 4Q3CA 3AOEC 2DC1A 1SO8A 1P1IA 2QRJA 5EESA 5KVQA 1E3LA 2VTEA 3EK2A 2DBQA 5A3VA 5EQFA 2EKLA 2J5RA 2DQ4A 3T4XA 1E3WA 3ENKA 1UZLA 3CMCO 3D5TA 3QLJA 1NR1A 4PG4A 4YT4A 1CETA 5JNLA 2PKQO 4BMVA 5IXSA 4M49A 4OM8A 3ZV4A 4ND2A 4CMBA 4MVJF 4AJHA 3C85A 1YOVA 3MWEB 3QWAA 1EE9A 3KBOA 4P4LA 4KOAA 4I9HA 5HRUA 3Q9UA 2H6EA 3VKUA 4IZIA 5LDHA 1C1XA 2J5QA 4KUGA 4DMLA 5A9SB 4NBVA 3JQ6A 4RVDA 1J49A 2O2YA 4W7HA 3OECA 4WGGA 4R9RA 3INRA 2HO5A 4FPXA 4YR9A 1IHYA 2UUPA 3LLSA 2A92A 5FF9A 1ZIDA 4JNKA 4IGFA 3OEYA 4J4BA 4A03A 3F1LA 1RM3A 4XQEA 1V3VA 2FZEA 1OI7A 4J2OA 3Q0EA 5DCUA 1XKQA 3IUPA 2B35A 5L4SA 1HSZA 4U6SA 2ZK7A 3GUCA 1N7GA 2NUAA 2VWHA 1R4MA 4HV4A 4ZQEA 1LSUA 1GYRA 3JQ8A 3M2TA 4HXYA 3RC2A 4UREA 3ZWBA 2X8LA 2VQ3A 3MJEA 2YV3A 2FP4A 1ZMOA 4Y6SA 1GADO 3EY4A 3D4OA 3ZU3A 4ALKA 3LC1O 4FB5A 1E7WA 5G0UA 4PN3A 2IYOA 1MLDA 3ONEA 2X86A 5C37A 3PYLA 4JJGA 3TF5A 4YJHA 4AVYA 4TZKA 3GPDG 1WAMA 4DXHA 2Y99A 5EERA 3BTOA 2YUTA 4WUVA 5GZ6A 3F1KA 3C1TA 1XR3A 1A4UA 3L9WA 4BNIA 2DUWA 3JD1A 4R41A 1WMAA 1JW9B 2Y1CA 4IS2A 4FFRA 3A06A 4EI2A 4CMCA 1XA0A 3V1TC 5BSHA 1X0XA 3D5QA 5CDUA 5L7YA 3ITKA 2ZYDA 3VH1A 4J91A 5H81A 1PEDA 4BNYA 2Q1UA 2CDCA 3A1NA 2Z5LA 3ZU4A 2IEBA 1ZSYA 5KTKA 1EK5A 4YPOA 2G82A 3PTZA 2P2SA 4WLVA 3VVCA 4FCCA 4RQTA 4BGVA 4MJLA 5C3MA 1XQ6A 2FR1A 2NVBA 1YDEA 5L7TA 1YQDA 1U9JA 1ISIA 4MVJP 2NM0A 3GQVA 3FBTA 4JP2A 1BRMA 4HFNA 2DTDA 4NJOA 2PGDA 1EUZA 2DKNA 2HMVA 1CERA 2PGJA 4IDBA 2I67A 5T64A 2OUIA 5HWSA 1LDBA 3VKVA 2XAAA 3RFTA 2CVOA 3I3OA 3UKOA 4CM5A 3GLQA 2HK9A 4MKXA 2CF5A 5G0WA 3WGIA 1UP6A 3MTGA 3OQ1A 1CRWG 4AJ2A 1ULUA 5AXDA 1VSVA 1DJNA 1JVBA 1KEWA 4PG6A 4IQGA 3U4DA 3EVTA 4D44A 1N7HA 3GAFA 2POQX 3UUWA 3WMXA 1U1IA 3EHEA 2DU8A 3GY0A 3P19A 3F46A 3OQBA 1ONPA 3G1UA 3I9OA 4N54A 2D8AA 1QYVA 1U3WA 3DXFA 3R6DA 4AJNA 3WGQA 5JW6A 4XRRA 2VHYA 2X0NA 1LUAA 1E3JA 3MJ4A 4HADA 4BO8A 3ROQA 1T4BA 3QVSA 2VWPA 3B1JA 5IDYA 4CMGA 1A7KA 3O03A 1XELA 1X7HA 1C0IA 4K9DA 3TZ6A 4YTEA 4OOFA 4DQVA 4GVXA 2CUKA 3VHRA 3PLNA 2DBZA 2G0TA 4XGNA 3VVBA 4RF3A 3U5TA 2RH4A 4FFLA 3F4BA 4F45A 1CQJA 1YQGA 2ZYAA 4GPD1 4J6FA 2VRCD 5DNAA 2WD7A 1PTJA 2X9VA 1P31A 4A27A 3UICA 3GVXA 3X2FA 2Q50A 1LRLA 4XA8A 1SBYA 4FFMA 1WXDA 1ZBQA 4CQMB 2IZ0A 2Z1NA 4GAEA 1QR6A 3KHUA 4FSHA 1C14A 1NWCA 4DLAA 4M54A 1C1DB 4HKTA 2O3RA 4UVHA 3TRIA 3PRJA 2VWQA 4QTZA 4JJFA 1N1GA 3RUEA 3EC7A 3ZN2A 2WMDA 3RUHA 5CDYA 1ZVMA 1MX3A 4B4WA 4IMRA 5ENVA 1FF9A 3BYZA 3S2FA 1BXZA 5U9CA 2QYTA 3JSAA 1P1KA 3UCFA 4CQMD 4PLGA 1WPQA 4J7UA 4INAA 1XWFA 1EE2A 2VYVD 2GO1A 1D4FA 4JBIA 4LGVA 4BO1A 4E3ZA 5JCJD 3JQFC 2Q1WA 4IY1A 3L07A 1WWKA 1C0PA 2SCUA 1YJ8A 1GQYA 2AG5A 4DYVA 1IHXA 2I66A 1NQAO 5KKAA 4YAEA 3HHPA 1B26A 5I7FA 3ORFA 1U3TA 1UXKA 3QVXA 1XLTA 1DHTA 5JE8A 4R1UA 4AJLA 3HDYA 3RFXA 2FPGA 3U62A 1A7AA 4GMFA 3NJ8A 4GVLA 4LCJA 4A73A 1EUCA 2DM6A 1E5LA 1FDSA 1KYQA 3NRCA 4R5MA 1X1TA 2AQIA 4E5NA 1EZ4A 4U7WA 5I8WA 1ULSA 3N7UA 3KEOA 1DFIA 1PJ2A 3K2BA 1OFGA 3R0IA 1NWHA 4C4OA 4M8SA 1EUDA 2QQ5A 3MEQA 3FTPA 3GG2A 5DP2A 4B7CA 2DTXA 5EIOA 1QYCA 2J3KA 3NX4A 4RZIA 3ZWOA 4MVJD 3BMOA 4NK4A 5FI5A 4BNNA 3M2PA 4W9NA 4MKRA 1PGPA 3P2YA 3GVHA 5L9AA 3EZLA 1GYQA 1MC5A 4BGUA 4XQCA 1PZEA 2A94A 2NLOA 3O8QA 2ZCUA 3PHIA 3ZV3A 1XSEA 1I0ZA 4HWKA 2EW8A 5DOVA 4YYZA 1P0CA 2LDXA 1K6JA 1LDGA 2FSVA 1YBVA 1BXKA 1GYPA 3D64A 1LXCA 2EWMA 3E1KA 1VKOA 4PLZA 3TOZA 3DMYA 1DB3A 4XJSA 1NQOA 4YJGB 3S1LA 4E5MA 1OBFO 1LA2A 2C2XA 5IF3A 2Y05A 4BO9A 2NVWA 4ONEA 4YT8A 5L4NA 2IRWA 2QRLA 2RBEA 4E5YA 4IMPA 4C7KA 1T24A 1ZZEA 3K92A 2X5OA 4CMEC 3COSA 4YT5A 3IS3A 5L45A 3I23A 3ZV6A 4XIYA 2CVZA 4OO3A 4CM9A 3EZYA 1QLJA 5K1SA 2OBNA 3PHGA 5KVVA 3UAGA 1LRKA 5JAZA 3PP8A 5CP8A 3INTA 3VDQA 2OL4A 1S6YA 1ADCA 1GFSA 2YHIA 1YWGO 2X0IA 3ZHYA 1E6UA 4CM8A 1DOHA 3GEDA 3GOHA 4NFHA 3TZQA 4BO6A 1NQTA 3E5MA 5JS6A 1P3DA 4E21A 2NU7A 2Y1GA 3P2OA 1O6ZA 4YJDA 1PS0A 4MIOA 1X15A 4OJNA 5I8ZA 2J5KA 1I3KA 1V35A 4J7XA 4RPHA 5EINA 3MOIA 2B4RO 2Q49A 5CHEA 3WXBA 4NJMB 4PG8A 3GN2A 1ID1A 2OP0A 4WNCA 4QQRA 3H6KA 5G4KA 4MP8A 4BGIA 2FSSA 1KVUA 1QYWA 1Q7BA 5CPBA 1MP0A 3WSWA 4QXMA 4CM7A 2RAFA 3CE6A 1HE4A 2BELA 3K5PA 1YDWA 4KWIA 2PZLA 2P4HX 1L7EA 4IQ8A 2HU2A 3V5NA 5DF1A 3TOXA 1IULA 3NEPX 3ZWPA 5B12A 2AE1A 2JHGA 1NX6A 3SC6A 2C59A 3LC2O 3BXXA 4U5QA 3A28A 3H9EO 3RVDA 1NP3A 2HQ1A 1LDYA 3VPXA 1GU7A 3KYBA 4F3YA 2AE2A 5TT0A 2PZKA 1BGVA 1DSSG 3PGXA 2Y1OA 1ADFA 3KYDB 3GRPA 1E1NA 5ER6A 3K73O 3GGPA 1VL8A 3JD3A 4ALJA 5CAEA 4LW8A 2H9IA 3DOOA 3DBLB 4JP3A 3ONFA 4ID9A 4EEXA 4ZU3A 4R3NA 2AG8A 2GN9A 4XZ3A 5JAQA 4A2CA 1MUUA 1EK6A 4OMUA 5K6AC 2X6TA 2IEDA 4UUMA 3SJUA 3ZHBA 1YGYA 2O3TA 3SLGA 4PG5A 3V2HA 4W7IA 4HY3A 2GERA 1PGQA 3PJGA 4TVBA 5A4DA 2NU8A 3JQFA 4WLNA 3KETA 3GVCA 4OL9A 3OMLA 4EZBA 4R1TA 1LLCA 4LMPA 2QIOA 5IN4A 4J1SA 1HTBA 3I6IA 2NV6A 1B7GO 1P33A 3QSGA 4DBZA 2BHLA 2VZ0A 1ISFA 3WS7A 5HTOA 4NG5A 3AW9A 1BSVA 2VOJA 1UAGA 2JFFA 1ZK3A 2YFQA 4GL4A 4DC0A 5T67A 4JXKA 5B1YA 3VTZA 2QYSA 3KOUA 4PVCA 4J1QA 3C3XA 5JDCA 3WNVA 1VKNA 2Y0CA 4CLXA 1Y6JA 1UXGA 1WP4A 4RZHA 4B8WA 1H6DA 3ROMA 3AOGA 3I4FA 4ZVVA 5A9SA 3FNGA 4MP3A 2GPTA 4MVJI 3RCBA 2I65A 1MG0A 2PK3A 1R66A 2X0RA 5T57A 5JCXA 5L4LA 4JX8A 1PJTA 5AVOA 4B4OA 3FWZA 3NUGA 2NVUB 2ZB4A 4BKUA 2G5CA 1DRVA 1HDZA 1I2CA 2WYWA 3H3FA 3ETDA 4YJFB 3ZW8A 2X58A 4I9UA 4N7RA 4QUKA 2PTGA 2ZYGA 2DPGA 1ENPA 2WM3A 2O50A 4UULA 1TVEA 5DCYA 4GSKA 4LVUA 3WYEA 3IKVA 3HWRA 5CEFA 1TI7A 4GKVA 4BQRA 1E1KA 1NXQA 1FDUA 1RM5A 4B3IA 4KQXA 4WOKA 3ZZNA 4HFMA 5A3JA 1Y8QB 2Q1TA 4IIVA 4CMEA 4FJ2A 3ZNOA 1QYDA 4Q9NA 2JL1A 2JFHA 1JLLA 2P5YA 2P91A 4JN6B 4YA6A 1IPEA 3HDJA 4AJKA 4X54A 3IMFA 4OIMA 1YONA 3TZCA 4HFRA 3E82A 2EV9A 2EP7A 3GZNB 3OJFA 1XQ1A 5JXWA 4MIYA 2UAGA 1QORA 2WYVA 4S3MA 1AHHA 4RO0A 3ZWVA 4W82A 3FNEA 3DZKA 2I6TA 4P4GA 1CF2O 1L1FA 3WGZA 4BNTA 3UHAA 5IFLA 2RH8A 1QRRA 2V6MA 3FPCA 5ITWA 3K31A 4TSKA 3DBRB 3GFBA 1P1FA 2VRBA 3NYWA 2QRKA 3G17A 3PEFA 2FZWA 3GK3A 3UCEA 4Y98A 4NNJA 2C82A
chains in the Genus database with same CATH superfamily
3SXJA 2NADA 3O8LA 4HZUA 2O0LA 4WK6A 3SLKA 2Q4TA 1SHUX 4P3YA 1HORA 4GZLA 2R1VA 3OJWA 4RTNA 2Q4OA 1WB9A 1AKMA 3ADOA 3CLTC 3UY4A 1ZH8A 1IE3A 4IKEA 3A1FA 3FUCA 3DZ8A 5BO5A 4C0HA 5AJHA 1H8EA 1KKLA 3CRVA 5DKFA 3R7DA 3VR3A 1IOZA 4QJIA 2A5LA 5ICFA 5FPKA 4DHEA 3FWYA 2ZRGA 5FAKA 5KX5F 2PSDA 3T7TA 5LM3A 3Q8KA 5MGBA 1LDMA 2R7NA 3KKOA 4PGHA 5AXBA 3VNQA 3HA7A 4ZTZB 3FBGA 2PDAA 1CY7A 3LA8A 4WLOA 2XYVA 3I37X 3DQPA 4LF8B 1N8NA 2BEUB 2OFXA 3P2JA 5DGIA 4R9NA 1XZKA 4YXFA 3UV7A 2YZGA 4CMJA 3T1YB 2FPUA 4V0QA 1TYDE 4EJ0A 2XZDA 3DKVA 4QPZA 1NFRA 1Z06A 2CWWA 2VRCA 2XWBF 4G0PA 1PJLA 1YI8A 1ZINA 4MYHA 3BL5A 2WA1A 5FL3A 3BQ9A 4EQ6B 3TXXA 3QHQA 3EBPA 2AFIB 5AUQA 3I6ZA 4HX2A 3ZU6A 4H1TA 2I4NA 4RJ2A 2RHGB 5ALPA 5HE8A 3CZQA 1G8JA 4I14A 1IY2A 2OB1A 2C9MA 1JQ5A 1OPXA 1K4YA 2XT0A 2TRSB 1TA0A 1EDBA 3D81A 1C9DB 5FUMA 1W581 5EJEA 6REQB 2D2VA 3F9RA 2KWIA 1PFYA 4MW6A 3R9IA 1RQNA 3W4KA 5L3QB 2G5TA 2GAJA 4PX3A 5HG0A 4P36A 4U6QA 3TR6A 1ZICA 3NT5A 4NC9A 2RH9B 2WDZA 2X7JA 3PC3A 3IUNA 3RQIA 5H0IA 3UAVA 3JQRA 3JWPA 4QEDA 3ZWWA 4B4DA 4CNQA 2J32A 3HM2A 3WGVA 3EB9A 3OLXA 3M34A 1M2FA 1ZK4A 3E84A 4QL3A 3WAJA 3HCEA 2W8BA 4MVYA 1A9TA 1JVNA 1LK7A 1YU6A 4GX0A 4DLXA 4QO8A 5ALVA 1RRCA 1EA7A 1NUUA 1P45A 5ES4B 1ZPDA 2VYVA 3DFMA 3CW9A 1N2BA 1P4JA 2ZRNA 3K9GA 3NT4A 4MS4A 1SUIA 3PU6A 2WWFA 3BFPA 4MB0A 1LQUA 3D0OA 3C7AA 3RHTA 3TW0A 3AVUA 3VJRA 1XMPA 2ZKLA 5DI3A 3U44A 2JKVA 3ITDA 5IJWA 1WVGA 5FWYA 2XTNA 4QO7A 1ODKA 2QZ4A 3LSTA 2ETXA 4TMFA 4D79A 1EVQA 4DBLC 2GM3A 5A3QA 1Q91A 4NJEA 2RD2A 2EBWA 5EJ2A 2VXCA 5K0NA 5KTPA 3P9YA 1H2BA 5BQOA 3QHAA 4PBRA 1C81A 3LT1A 3LTEA 5LXTA 3BFXA 1M1XB 1PAUA 1Y1PA 2ZJ4A 4XDYA 3U4IA 2WA2A 4ER6A 2B30A 2HLNA 3C43A 4OKSA 1KU0A 3UEOA 4MHTA 3FZQA 3B1YA 4BGEA 2XUDA 1J5EB 1SCBA 1ZCAA 3BS4A 4PG7A 1UDCA 1WCV1 1G2PA 3DZGA 4RX1A 5FLKA 4B6EA 4YJ3B 4JR2A 1JECA 2IUTA 4E5UA 2UZ3A 4AS2A 4YUYA 2FN8A 2W42A 3D7KA 3FPFA 1LNSA 5F2KA 2HA6A 3TQOA 5DNYB 1BWQA 1T1EA 5JMPA 1K3TA 2P65A 4G5SA 2GH1A 5CA0F 3SU8A 3K09A 3N76A 4LMRA 3ZNNA 5GINE 4Y67A 3OP1A 1KQNA 3S2EA 3CR3C 5THKA 1HNNA 4BQEA 5SYNA 4Q34A 4RHCA 4GXNA 1ZHHA 4U2EA 3HB0A 3UMMA 3DEYX 1J0XO 4JBYA 2C8LA 2VHZA 3IJPA 1BCRA 2I33A 5TPZD 1NXOA 2O1WA 3IO3A 3RYIB 1DTWA 1PFKA 3CCFA 1K7EB 5B58C 4A2PA 5FB3A 2J4DA 1DRKA 4CM1A 1G5HA 2OHOA 4BB6A 3AJAA 4ZV4A 1OXVA 1DC3A 1RVV1 2Q4RA 3I9LA 4B31A 1Q1GA 3RASA 3QVGB 3GPLA 2YXLA 3N74A 4A9AA 5CB4A 1X7DA 1GTRA 4KQFA 4IOLA 4RHEA 1KBZA 4ESVA 4KW7A 1TVKA 1N0WA 4X62B 1AXGA 1QDLB 1XEAA 5B7NA 4BV3A 1Z6YA 1U5BB 1A8QA 2IYAA 3V1YA 1GUFA 2H9YA 2VJCA 1P1HA 4B34A 1OKKD 5FPPA 4U63A 4RH0A 3I5XA 3GRRA 1ADYA 2DWPA 3HUDA 3OZDA 4HNAA 4RANA 1GARA 4CF5A 3B6IA 4LJ7A 4R1OA 3MBKA 3ASVA 3QLVA 3VDRA 4PLWA 2QOEA 1AZTA 1CJKC 3Q98A 4GF5A 4W9NC 3G2HA 3PK0A 1Q0LA 2RHDA 4MYSA 4TUYB 1VI5A 3RVKA 2JGNA 4HNGA 2OOSA 1BOFA 3LGSA 4S05A 3RB8A 1HNWB 3DO6A 3AR7A 5CRIA 3CIFA 5E4FA 3IIEA 3OQIB 3RIHA 1RVDA 5H8WA 4C2UA 1K8QA 3F67A 4D82A 1XZDA 4R2LA 3A4NA 4O4JB 1KZGB 2HKIA 3C74A 3C41J 1Q0HA 1VA5A 1SUFA 3F5QA 4IGKA 3HA5A 3AB7A 1DAMA 4X5OA 3MA0A 3ZNQA 4EMSA 2NSLA 2W2KA 3E8XA 4ADSG 4MMXB 3TAUA 2ES4A 3IAM6 1WCYA 2N3ZA 5CD9A 2E48A 4LBVA 4PRLA 2XCIA 3ECSA 4TQAA 1X87A 4LY3A 1XZCA 4Y8VA 3EUFA 1GG5A 3R20A 4AG5A 4MYUA 2O4CA 3H2YA 4B4UA 1E2IA 1JJ7A 1Q0RA 1V8DA 3ZJTA 1TJPB 1RTTA 3FB1A 4Q7EA 4DDWA 5JPDA 1UOOA 4B9EA 1F38A 3QELB 1L1RA 4DR5B 5E1MA 4AY2A 1BXRA 4YAKA 4Q4LA 2C1XA 1AB5A 3QMVA 3KS9A 1NZDA 5EZQA 1DXHA 2C5HA 2A0YA 4B6SA 3IAS6 4ZDIA 3SN6A 4QGHA 1LNQA 1WPGA 2ZSKA 4JBHA 2ZWVA 1FVOA 1EBFA 3L0OA 4LI0A 2QRVA 3W5SA 3UAWA 1ST2A 4Z1MD 4LYHA 5DYTA 3T7SA 2VAPA 1OV6A 4RH3A 2BKAA 3K30A 2NTJA 3TMAA 5JVDF 1CY8A 4K28A 4D3ZA 3FZYA 3QSYA 4I08A 3E70C 4RTOA 2E6UX 3WWZA 2G5GX 4CF3A 2I7DA 1RD4A 1Y4ZA 4RKFA 4DEVA 1OWNA 4EA8A 3K6RA 4O6VA 5TJHA 3AXTA 1I1HA 1KSJA 3AJEA 7REQB 1B1CA 3UJAA 3U7QB 2I1VB 1UBEA 2DFKB 5I7OA 1TLTA 4TLEA 4J49A 2XZOA 4A1FA 4TKLA 1TCUA 3OUZA 1LVHA 3C1OA 4R0VA 4AECA 4KFRA 2J3EA 4OB8A 4RIEA 4RS4A 1P19A 4IAOA 1SWVA 1AKVA 2BF7A 1QIJA 1U7HA 1SCUB 2EL9A 2V1XA 3AHEA 5JC8A 4BQNA 3DFFA 2ET6A 3TQIA 3ZZMA 4X7RA 3U7IA 5JD4A 4AMZA 3D3EA 1R5BA 1MJGA 4HDKA 5ELMA 3O2SB 2VPWA 1ZSNA 2Q7OE 3STTA 4EABA 4DV7B 2P90A 2YWRA 1DLIA 2VATA 1OFUX 3FF4A 4MKIA 2J3LA 1LTQA 4Q4AB 1NKTA 1DUIA 4GX5A 1GUZA 4UFPA 4FD2A 1T5TA 2B3TA 5IYZA 2VBGA 3H84A 4N8EA 2BH9A 3FOWA 3KXKA 4G56A 4BNDB 1KAOA 1NJGA 2M6SA 5F1KA 3SE0A 5INTA 4B0OA 1GZSA 5DZSA 1BDIA 5AW9A 3CV3A 2EX4A 1I4EB 2FLKA 2VO1A 2VHWA 2YV5A 2PGLA 3K4PA 3ZH2A 1USWA 4F2DA 1IN8A 2A1UB 4CM4B 1L5NA 4CEIA 4TVOA 1Z83A 2V7PA 4ETMA 1GTL1 4QYWA 3NTOA 3PKJA 1NJ8A 3JYPA 2WAXA 4QUAA 2J59A 4FXOA 2FRDC 3OIVA 3R6GA 1POWA 2J9YB 3S2SA 2WKWA 3DVSX 4Q7QA 2J0SA 1VPEA 4DCSA 1O5OA 3K20A 2G67A 4Q66C 4LBZA 2O8BA 2QORA 2WMYA 2WNIA 3UATA 3JSXA 4JQSA 3BMQB 1Q6ZA 5T5QA 1P2TA 2VP3A 3DR5A 3GRZA 3TSCA 4X7MA 4G4JA 3L7JA 5COBA 1PRYA 1P44A 4KBGA 1UWVA 1T8TA 3NOQA 4R3WA 5F5XA 1M73E 3QE0A 1T2EA 5DLDA 1FLDA 2HRRA 1B3BA 1MAUA 4MV9A 1XAGA 1TL7C 3LPNA 3I9V6 1YSCA 5JSHA 1EVJA 2A3NA 1JSCA 4XD7A 4YP9A 4B4VA 1NAHA 4ZA2A 3L7YA 2O3QA 2O8DA 1MT0A 5EJ8A 1XDGA 2LNDA 2B61A 4JKYA 2NU9A 2GVNA 2VIIA 1X9IA 3H1AA 2CCKA 3KJEA 4OGWA 2W90A 5DCWA 4NICA 1RR6A 2MHCA 2P9BA 4MTLA 1CJCA 1QTIA 3EARA 2K5UA 1IH8A 3F6BX 4BKMA 4AURA 9LDTA 3LCUA 4ARZA 1WRBA 2YZNA 4WKPA 4AL4A 5IULC 1NMXA 2X22A 4PPYA 2NTNA 1Y6QA 5C9ZA 5CFRA 2OCYC 5LMZA 1UC9A 1QHHB 3HR4A 4KO8A 3UWMA 4ARIA 1KXZA 4MO9A 1O1YA 4LWOA 3C14C 3G88A 2FY8A 2G0NA 1OR8A 4GS5A 4YJFA 3DEFA 1M5TA 2JHPA 3RS5A 3RHSA 2Z30A 1X80A 3CSDA 3D02A 4XR4A 1X7XB 1P72A 2PUWA 4H7KA 4F0JA 4B6PA 1TQ4A 3CTMA 2DERA 3G13A 1ZK2A 2J33A 3K0FB 2RHLA 1F6WA 2Y66A 1JR3E 3TJRA 4MA4A 1T9GR 2H1IA 1PJRA 5JCZA 5JNRA 1CHNA 2W00A 4MA0A 3VU9A 3HFSA 4P5PA 3ED5A 1B6TA 1F2UA 2PZMA 1TT5B 1C3XA 1TKRA 3DCYA 3IPCA 3OZVA 1E1RA 1D03A 1G21A 2X77A 4HMQA 4TTIA 3TAXA 2IE0A 1F7UA 2YJNA 1EDOA 4EUKA 3IUYA 4L8GA 2B0JA 3BRCA 1Y8CA 3AR9A 5F4BA 5H83A 1T43A 2YXDA 1FYVA 5BSFA 3L7CA 4PLTA 2RONA 4MJ7A 2VQFB 3KALA 3Q2OA 4DR7B 1E2GA 4GM1A 3FNRA 3UUEA 3AESA 2HXSA 1L4NA 1SKMA 4G9EA 4WZAA 4EPWA 4UDXX 1AKTA 4E2WA 5KOHB 1MB0A 2PS1A 5TMPA 4C30A 1BMQA 1R74A 1HL7A 2R44A 1UOEA 3I6QA 5KC8A 4NBUA 4F92B 3NXKA 4K6GA 3NIFB 5TX7A 2Q3JA 3PVSA 4MZXA 4ZYTA 5J1SB 3F6EX 2FPPA 4QXQA 1IWBB 1X92A 4PCVA 4OATA 3IBSA 3I2HA 2POCA 4NONA 3FSGA 2VZ9A 2W0SA 3OICA 3RVQA 1L5HA 1C9KA 3CRW1 4N0MA 2YVAA 5FOVA 4QFMA 3RVLA 4WFJA 3AF6A 1IBRA 2QTRA 3WHPA 1K08A 2ZJAA 5AI8A 2VFAA 1EX9A 2XMQA 3UJPA 1XZMA 1TZBA 2PS9A 4US1R 1KAEA 3NG1A 2OWEA 2II6A 3IMKA 3LMKA 3LT0A 2V6BA 4Q93A 2QR2A 2ASVA 1DMRA 4YCDA 1WOMA 2PKQP 2FQXA 3WICA 3IAUA 4KLRA 4GD3Q 5EE9A 1FUYB 1RYMA 2HB6A 3SKYA 4ECEA 3WA6A 1X19A 2W2MA 3NHWA 4IDPA 3K9LA 4RVNA 1NVBA 5FQNA 2MSWA 4CI0B 2EGGA 3J7AC 1DKLA 3G2MA 5EE0A 3IV7A 3UKJA 4YR7A 4DQ0A 4RACA 3CLKA 2A5YB 4MCAA 1KVRA 1Z9BA 4L57A 3KQUA 2C31A 1R8JA 2IQ5A 1ZGAA 3U2QA 3V7NA 4UNSA 5JNUA 5K0EA 4BLTA 3LHDA 3R1IA 5I9MA 2BEUA 3BCSA 3F6SA 3O4FA 2O23A 2MT9A 3AI3A 3HFRA 4EY3A 1DPGA 4ROTA 5JTUA 1JDBB 1ZG3A 2NO1A 4W9RA 1DO8A 3K2QA 1KAHA 4MHSA 2GEKA 4EQ6A 5K99A 2HK7A 3SXPA 2CFSA 3FLBA 4D5EA 1JVSA 2AFIA 1HC7A 1LTHR 3MHPA 4CL2A 5IK2D 2HXGA 1WM1A 4NG4A 2O2HA 4AN1A 4NNJA 5AK0A 4OI1A 1TF2A 3QY0A 5TS2A 3LQRA 1U8TA 3WZLA 1E7YA 2MYNA 3HKDA 1VXOA 3V2IA 2J9GA 3I61A 2XGJA 3FNQA 3A6GA 1QHNA 4IDNA 2ZR0A 3C7TA 4OJMX 2FRDA 4V3CA 5CYPA 5G0TA 2OTCA 1ZZGA 3NXSA 5IDXA 2JLBA 3QWHA 5BSUA 3V7YA 4E4YA 6REQA 3H5TA 1FZQA 4CDGA 3HZRA 1P4RA 2YCLA 4W99A 4EJ6A 5L3QA 4JBGA 4D9EA 3ZWYA 1C7JA 3CLVA 1JYFA 1U8EA 4J90A 5JD3A 4YRNA 3ANMA 3VKHA 3ONNA 3UJHA 1TK3A 1VQ1A 3ANTA 5BQFA 5FNZA 8MHTA 3DAOA 3LGAA 4OKIA 3RABA 3ZHXA 2AEMA 3D54D 1Y5IA 2PYIA 5JAMA 3AIMA 3D7SA 4ML3A 5FOQA 1FQOA 1JHZA 3BCUA 1JA1A 3GJTA 3KFVA 1RXSA 4Q1DA 3HBMA 1W85B 3PWZA 1NE7A 2CY0A 1S4QA 4KE8A 1Z38A 1G66A 2GUWA 2YZMA 5IBCA 1A8HA 3DP7A 1IDN1 3ET4A 2BFAA 2VK8A 3I6BA 3WAGA 1GOTA 2W22A 1AZWA 2A0WA 4LE2A 3TOSA 2PUVA 5I7VA 3P52A 3X1XA 1UK9A 4B7ZA 2ZOSA 4V3BA 3T1HB 2V5VA 3T7KA 3W2FA 1TQ8A 3EZ6A 4H6XA 2KBFA 2ZQZA 3RS0A 1Y6RA 4P3OA 1N9KA 1AS0A 3FSJX 3R7FA 3SJ7A 2QD5A 4EENA 4C22A 3EEBA 1K0UA 1NDQA 4NYJR 4RVOA 1JIVA 3ZI0A 3A36A 4PO1A 2Q6TA 3TB4A 3R44A 1UANA 5ALRA 4JBNA 2OG1A 4GQAA 3C6MA 1OU4A 4RF4A 5IM4A 1GWNA 1Z5OA 2WJWA 3ICQB 2CYCA 3WIUA 2QX6A 1O0SA 4PGGA 5U1PA 5KYUB 4X45A 4D0GA 4E08A 4Z3KA 3A10A 4ZVKA 3T8YA 3SQXA 3FZGA 1VHLA 3AJRA 5TPZA 2WJJA 4PWYA 4CG1A 2FWMX 4WLFA 4B6OA 1IIRA 1DEOA 2FJ0A 3HO6A 4EIWA 4L0MA 2XXAB 4YJ3A 1ZOLA 3QQPA 4IQFA 1Y8ZA 1U2DC 2DAPA 2J8ZA 2X4GA 2Z57A 5SV2A 3T4PA 1TNDA 3UMGA 4DJJA 5KBYA 4JI8B 2O06A 2WJHA 1N2CB 1AKWA 2BFEB 4PCLA 1N9GB 2OSVA 2BGNA 4PZZA 1CX9B 1DFHA 2IXDA 2QN9A 4HLCA 1ZEJA 4HRVA 4N5DA 4ER0A 4M88A 3CR7A 3FG9A 1ZP6A 7AT1A 1QWOA 1FRNA 4DMGA 1EFAA 1YO6A 1TPYA 1FTSA 3FCAA 3CZMA 4MCJA 4MVWA 4AZ3B 1MR3F 3MCUA 4PS1A 4YALA 1YJQA 2XZPA 3H17A 2YY7A 5LP6F 1EDZA 2GPYA 2WZBA 4LDQA 2P8SA 4ZU1X 1TB4A 5ICSA 3EN0A 4GMGA 2I91A 3SI7A 3C70A 2AXEA 3MMPA 3TB6A 2ATXA 1O7JA 3LNCA 3LVFO 3PUVA 4YRAA 4QG7A 4MAFA 5CXXA 1YK0A 3GBPA 3BGOS 1LPBB 2XUZA 2O8EB 4FLEA 4BRWA 2Z2KA 2X1HA 2ZTSA 3K53A 4E03A 3EPPA 5H02A 3N75A 1FMLA 3P26A 1T2AA 5EVCA 1YS9A 2PGIA 2WSBA 4CPDA 5CFZA 1QVRA 4AX8A 2R6ZA 3EIXA 2CMDA 2EYQA 3IHWA 4RHXA 4ALLA 3FGNA 2X76A 2XB8A 3KD3A 2O0MA 4QVKA 3TCNA 4BZZA 4WZBA 3EG5A 3M5PA 2Q2WA 4CU5A 1YZUA 4YP1A 3TR0A 5ARDA 3KL4A 3ZCXA 3DVAB 3IQZA 2IU4A 5LMUB 2WFZA 2C8JA 4PFSA 3ZV7A 3GCZA 4RSRA 4CI9A 1MKYA 4TUYA 1MHPA 3U26A 1MENA 4LV6A 4YUAA 5GVSA 1ISPA 5HGXA 1E1DA 4RSMA 1H9CA 1TADA 3EC2A 3EVFA 4UMFA 3OQIA 1V8ZA 4WN3A 1J8FA 1OU0A 4HLUA 4XPIA 4ZV7A 1H5NA 1XKTA 4N0PA 4O4JA 1RS0A 5TGTA 4JUAA 1X1DA 5FWNA 3H2IA 2FRXA 3NS7A 2DKOA 3N5KA 2WYIA 2BHRA 2I6FA 3IQHX 4U0JA 5JJIA 5F77A 4E09A 4ZK6A 1TMKA 4FE4A 1DVRA 1HSOA 1MOZA 1RWQA 4Z53A 2PX6A 3WJ1A 1NOKA 2F3RA 5EWLB 3BJEA 5AHWA 2HQOA 2JD0A 5EWMB 3CH5A 4E30A 1KR5A 4Z1MA 3VKWA 3TTTA 2WWYA 3DMRA 1Y3IA 4I4TB 1CUSA 3EFHA 2J5XA 2VUSA 3F8TA 5DT2A 1JV2B 3R2JA 3IVXA 4TSFA 2B5WA 3ZWXA 2FN9A 2M98A 4MUMA 4D41A 3FCXA 2H63A 2WIJA 1YB2A 1O4WA 3O26A 4BLOA 1Q19A 4GBMA 1MO4A 4CHGA 4C2TA 3QELA 1AX9A 2ZBVA 1NMQA 3Q2KA 4NOJA 4MMZB 4XSVA 4G0WA 1ZYUA 1SKBA 2ZZKA 4DM3A 2G36A 3IL2A 3DTYA 4QODA 4ZCMA 2WSMA 3L8MA 5AICA 4A7PA 5HHTA 3IV9A 1J42A 1KYWA 2P69A 3DDHA 3OPYI 4PRKA 1XBTA 3HCDA 3EGWA 4JJ7A 2XX3A 1CB7A 1HDIA 1PD0A 1R8XA 2H4FA 2PU7A 1RPTA 2QRNA 2REXB 3BD6A 1WMBA 3O2QB 3OSUA 5DMHA 3B2EA 5TDHA 1S1MA 1ZITA 2ZEJA 1E9CA 5EHGA 5J4HA 1A72A 1IZZA 3GGJA 4NX2A 1LPNA 4UNNA 4BFVA 3BDIA 4MR9B 1I30A 3TW6A 2XCUA 3BGIA 4KVZA 3TN7A 4F5ZA 7REQA 2O8FB 2JCXA 3UTCA 3WBKA 4BX3A 1I2ZA 1QIMA 5DH9A 3U7QA 4EHLA 2C2GA 2IJGX 4NZMA 4YNBA 2R8PA 3R3HA 3BIOA 2CNNA 2VCYA 3AUXA 4N47A 1PL0A 2AEFA 2BGKA 3GR6A 2RB4A 4X65B 4QUBA 1TX4B 3U0BA 3AIIA 3CZRA 3N07A 4GX2A 3TGWA 2XECA 1PG5A 2HIAA 1OBOA 3EXAA 2ZIXB 2MTBA 4V0SA 1HYQA 3GW8A 1DDOA 3KYCB 1FMCA 1SCUA 5CYOA 3J80A 1LQ2A 1M2JA 4IGEA 1FJXA 2JI8A 1BHSA 2WLTA 3HL0A 1NC3A 4AQYB 3DLBA 1J7KA 4IIUA 4P3PA 1XXHE 2AGVA 3USES 4WTOA 1DRWA 1W5EA 2CDAA 2UZAA 3FHLA 2I2CA 3PHHA 1JDBC 4UXIA 3QNMA 4A0SA 4Q4AA 1E64A 4XPZA 4A91A 4JBWA 3K9FC 3I2YX 5HUHA 4BNDA 2DRIA 3QW4B 2V7WA 3HU1A 3KE8A 4R68A 1C9MA 1EAMA 1YRLA 3WYCA 1JHRA 5DSTA 4IJKA 1BXGB 4Y1GA 3UPTA 1EWVA 1JU3A 5DJ5A 4C5BA 5MN5A 2A1UA 2C94A 3Q88A 4CM4A 1T8UA 5G4LA 5KYXB 4LWZA 5AJUA 4BNUA 6YASA 2O7QA 1ND5A 1J7JA 1GSOA 3GFOA 1UEXC 3S2GA 3TD9A 5L7WA 2PA0A 2WJZB 1E5VA 4DL9A 1CJUC 1JDNA 1GXSA 1L7MA 3NDPA 4HXEB 1EGVB 2XTMA 1T0IA 1WOYA 4II2A 3V1UA 3WLRA 1S3GA 1Z39A 1SBCA 3BMQA 5BP7A 1DX6A 4OLFA 3DO5A 3VC2A 5KNCA 1XIVA 4O0LA 1N1MA 1UPCA 4FCTA 4MQ4A 1T25A 4WOCA 4WWHA 1YACA 2VOEA 1DX9A 3MRXA 2VPZA 1B1AA 3ABZA 4FHGA 1U0RA 4Y2QA 4UFNA 4GDFA 2VAVA 4XB1A 5A9RA 2WUWE 1W75A 2EZTA 4LCEA 3RYCB 5LYJA 1I24A 4NENB 4Z7OB 1VSQA 1D2HA 1I0IA 3NH6A 3QITA 4QBHA 3HCRA 5IPFA 3A4VA 3QBJA 1CZRA 1WSAA 2E21A 5JEDA 3K71B 1PJBA 5A7GA 1P2DA 1EFDN 1UOPA 3MT9A 4BMYA 1CE8B 2E7ZA 1D8TA 1FFGA 1I7PA 4JVOA 3K15A 3Q3CA 4R8RA 1FFHA 3KC2A 5B2EA 4BV8A 4D9FA 3OA2A 3H9UA 3FPHA 1QHHA 2ZXEA 4DWWA 1E2JA 2Q41A 1ZXXA 2XVAA 2ZJBA 2EQ5A 2P11A 4PLFA 1N2SA 4Q1BA 2VLIA 2AQHA 2G04A 2IYNA 4J07A 3N2NA 1TLFA 5AVKA 1CSEE 5DHRA 4N41A 3FLAA 3GO4A 3L06A 2D1YA 3LW8A 1X7XA 3UFXB 1ZD5A 2FSUA 4EMUA 4U7DA 1SC6A 4EBBA 5LUBA 1D9ZA 1Y7TA 2MYUA 3I83A 4M7OA 3QMMA 4GW3A 4B82A 3GAMA 1PWEA 2R96A 2D8MA 3K0FA 1FXWF 4RD1A 3ZPXA 4D42A 5ABPA 2K7FA 5C4MA 1HYEA 2GGSA 4MDEA 3ZHCA 2CXOA 1E5DA 5HTKA 2IDKA 3I8SA 4FNGA 1KQPA 1TYAE 3RS9A 2GF0A 3FGZA 4X60A 1OBCA 1Z6QA 5ES3A 2D59A 5HKAA 1TT5A 3ZVMA 2IU6A 4Y9SA 2OZLB 2IHJA 3PHJA 3IH5A 4TWJA 3HVKA 4CM6A 4MUJA 4ZHQF 3O8DA 4ZHQA 3N5CA 3PT9A 4Q4JB 3VYTB 3MB5A 1TT7A 3DULA 3EVAA 2BW0A 4BNJA 3BXFA 2CEAA 3GLKA 2PPLA 4NNOA 1VMAA 2WD8A 3UJ9A 1E8DA 2OFWA 2YQ4A 3CB2A 4PAMA 1GFWA 4O1MA 4BIIA 4C0JA 4OOEA 1H5QA 1CXZA 1UT8A 4P82A 3R41A 3GNTA 1LH0A 1P6QA 2RGNC 3PR2B 4E88A 3N8HA 2JEOA 2C2KA 4O4IF 4L4ZA 5KJ1A 3N2GB 5EJMA 1JFVA 1BDJA 2WF9A 1U3UA 2J85A 2NQ2C 2NO5A 3KVOA 3OAAD 3DAFA 3ZVRA 3QFCA 4KN5A 4K9KA 1YS7A 1SH7A 1KE1A 1HRKA 1AF4A 4PTYA 5E6UB 1HDOA 1LX6A 2L42A 1XP5A 3CCBA 3HPQA 3NGMA 3V8EA 1EBBA 5JZBA 1YJ5A 1KR2A 2ID7A 1ZO8A 5GP1A 5GAJA 3L93A 1ZUD1 2ZUEA 5CB0A 2JCVA 2QW8A 3NBQA 3CINA 1PK9A 4AP5A 1GV0A 1G3IA 1XI2A 1WB4A 3C97A 4DTCA 2ZYTX 3IXQA 3ZV5A 3JZFA 2CWDA 1ETHA 3TKLA 2WRZA 3TDNA 4BWVA 3HBAA 5BSMA 2WB4A 5K3AA 5A4IS 3NDBB 4YRMA 1F4PA 4O8CA 1F0NA 2AKEA 3E8SA 1M6VA 2HA2A 2C78A 4MCIA 1GN9A 1G20A 1YUNA 2QZ9A 3BXZA 1NBIA 2W6OA 4ND3A 1WZEA 3L8FA 5LOVB 3PPVA 2FV8A 1A88A 4KE9A 5KJ6A 621PA 5IKPA 2QR5A 3GJSA 1UBFA 1Y1TA 3RK0A 3OLWA 1PR3A 1PT7A 2GN6A 3CA8A 4BVFA 4ZMBA 1SMKA 3LBIA 1GEGA 3NR2A 5BOVA 1W9HA 2XR1A 2ACWA 2ZYRA 1TZMA 4DV0B 1BWSA 2B36A 1V7QA 1I2BA 1VJDA 4U1RA 4YAOA 5KNCH 3NEYA 5THXA 3C6KA 4GLLA 2P0YA 3HB5X 4AJ1A 1SHTX 1T0JB 5CJJA 4DEYA 1A9RA 3KP1A 1DC5A 4H27A 1G1AA 3DLAA 3PJFA 4IG4A 4YT2A 1M54A 1ULBA 2XZLA 4J1TC 3F8SA 2VPTA 2X40A 3BN3A 3H83A 4I6JA 3SX2A 1DC4A 5ED4A 1HE8B 2X9NA 2UVQA 3IT1A 1XU9A 1KOLA 3W6ZA 4RMHA 3JAMA 1R16A 3DV2A 2AK2A 2WR8A 1CUVA 3DMHA 1L5KA 2YZ7A 2WF5A 521PA 4H4DA 2OESA 4J94A 3HUTA 2GBGA 2K87A 1SQGA 2G63A 3F3KA 4LDPA 4WLUA 3T41A 4GYYA 4KK3A 1QGOA 5A7HA 1XCMA 3RUDA 1VPVA 3EDMA 1E3DA 1XCPA 4D9CA 1HQYE 2XQFA 3KAQA 5LNK6 2JBHA 3AOEA 2B83A 1TJYA 4KXLA 4KO2S 3ZXUB 4IBOA 2NN3C 5K0GA 1GL6A 2VZ8A 4K6CA 4ZP1A 1SUSA 2JATA 3RRYA 2FKAA 1IRXA 2VP4A 4BNXA 3E5RA 1HDCA 2W98A 1QC5B 3W6PA 3ZDBA 3BDAA 3DQQA 3FX2A 3TXAA 2CBXA 1E59A 1W85A 2AXQA 5TGDA 4MGZR 3AYXB 2FZGA 3JX9A 3L6DA 5TT1A 2ECFA 1BEZA 4BO5A 3D1JA 1NMZA 1V4VA 2KHZA 5A06A 3R24A 1G2QA 4G0XA 5G0SA 1UQRA 3SJZA 3T1QA 1CVRA 3FMIA 4Z9AA 1X2EA 2A9KA 1EVYA 1PG2A 1DAOA 3DOJA 2D74A 5KTTA 3AY7A 2FMKA 5AVRA 3G85A 1Q0PA 4WY5A 1E62A 1YCDA 3QLTA 1SC3A 4DDHA 3ORSA 2E4WA 2X4DA 4FHCA 4LJ8A 3RKRA 1CNEA 2IXBA 2ZRJA 1B2LA 1O3YA 2BE9A 2E4YA 2GX6A 2LBPA 3BJZA 2J3IA 3QHPA 5HS4A 1E3WB 2E55A 2F1RA 1SVIA 3U4GA 2FK8A 5GQSA 2B2XA 5CGZA 3TNDA 3EUAA 1TYZA 1YR9A 1P0PA 2OKCA 4PO3X 4RTSA 1CRPA 3NBAA 1GTVA 2IPNA 4YLEA 3FCUB 4TLAA 5KO2A 1N2OA 3RHZA 5KYUA 3C8HA 1ZC4A 2GB4A 5BVGB 2PJZA 2YTZA 4QGSA 1JA9A 2IIQA 1MIOB 4QDXA 3ZCRA 5H9WA 1AM4D 5CLGA 2DWQA 2EDCA 2I22A 3V8BA 3VKFA 4LZPA 5KTSA 2ZTMA 1QYXA 2C0PA 3DT9A 2XXAA 3V33A 1N3LA 1QKJA 3OFSA 1E77A 1NXXA 4F7DA 1SQ5A 3GHYA 2AG1A 3NHLA 3SZMA 4DLKA 3HXOA 1C80A 4BL5A 3THXB 3VPBA 4ZYVA 1N2CA 2QLBA 1JFTA 1OVGA 4HGNA 2VDJA 4DFDA 3D2BA 1F60A 3KX2A 2BFEA 3PEVA 3W8NA 1N9GA 3K2EA 1LBEA 4QUIA 4WXHA 1YMVA 1JKMA 1K89A 1G16A 3JVDA 2PO5A 2YIVX 1UM9B 4RYDA 1HQKA 1A2QA 3DHEA 4MA5A 4TMXA 2Q7DA 2PMEA 2FEKA 3UK0A 1E60A 2DECA 4EQZA 4NZOA 1CUJA 2P5UA 2XNJA 1O9GA 4IIJB 1VMKA 2F3UA 1JSZA 5CT8A 5IT0A 4AZ3A 3WV4A 4LJ5A 3C8MA 1A27A 4EHKA 2E3JA 4COKA 1VBKA 2RGNA 1XMVA 1YS4A 3DWIA 3I5MA 3LX8A 2JVIA 4PGFA 5GONF 4GKKB 4FMDF 5EUMA 2CSUA 5H80A 5FNVB 4NH4A 4PGAA 5J9FA 2FWJA 3BGVA 3A3YA 4EFMA 1HT2E 4ALIA 1VHTA 1MU0A 1R4MB 1AK2A 2IKSA 2HYDA 3C2QA 3AC0A 4AWBA 1DHRA 3Q9SA 4ZWNA 2O8EA 1SBTA 3HYSA 3WO0A 2HXYA 5EA2A 2FVYA 3LZCA 3ENZA 4X7PA 4QYIB 4C03A 1T3TA 2OYCA 4UTRA 1PDOA 3PNYA 3UH0A 4L5YA 5ILQA 2X15A 1JB9A 1UODA 2YBEA 2H5LA 5D5QA 1QYRA 1SXGA 2O4UX 2ROQA 2GNAA 2QL6A 1O94C 3BULA 3O6VA 4NMMA 3E18A 5JUWA 3O8CA 1W34A 2XRZA 2E0IA 3QA9A 4YJHB 5LDGA 3CGGA 3V4OA 1VI6A 3UPDA 1UEIA 3DVAA 2EKDA 3G2NA 4G4SO 3VU8A 1PQUA 5CD1A 3DPSA 5G53C 2C57A 1Q5PA 3R3VA 2XB2A 3TFOA 4NYMR 4JL6A 3RRJA 1VIDA 3SF8A 3W1VA 1TM1E 3DAPA 3Q4GA 5E9QA 2WUDA 1ZVJA 4JXXA 1OH8A 5FHRA 3EFOB 1NKSA 3N39C 3IV6A 2DPXA 4FZ3A 5CM9C 3ZOKA 3H5VA 4EOGA 5IDQA 1I32A 1F0KA 1CS0B 1W48A 2QE7D 1ZM3A 2QL5A 5EC8A 1YRHA 2I4MA 1Z34A 1E8NA 1KSHA 1XFDA 2CF6A 5TEVA 1GM5A 5EWLA 3EGOA 2LDBA 2GCOB 4G97A 3A9WA 1DAFA 4IDEA 5LQSA 1UJMA 5HYVA 2IUYA 2I99A 4RM3A 1ZA2A 1QFXA 3CX4A 4I4TA 5MFZA 1TIPA 4EAAA 2Q99A 3FZNA 2P6PA 4I5EA 5DX0A 4DLNA 1D1SA 2W2PA 3MWGA 2AMFA 2ACKA 2HCRA 3FXAA 4X8OA 3DM9B 4XM0A 1DELA 2VC2B 4J1TA 2LCIA 3B6EA 1RC1A 5HS6A 2R7MA 4BP8A 3F4LA 7ABPA 3P32A 1QH0A 3AVPA 3H1BA 1SU4A 3GFVA 3WFJA 5C51B 3LBYA 3RT9A 3G0IA 3H86A 1Y48E 1TTHA 3JAKB 4RDXA 2XF8A 4O59O 3HNOA 5JZVA 4R2HA 1XMSA 3SS8A 5I4BA 1FDRA 1H2XA 1S7CA 3AHIA 3E27A 1WTAA 2AYYA 4L8FA 4RK0A 5TQ0B 1AA6A 4HVCA 1WZNA 1W73A 2F6RA 2P6MA 1L5SA 2WKQA 2ZI5A 3GT3A 4GI2A 3AM5A 4BQQA 2C95A 1UIRA 2W83A 4PZYA 1I51A 1OC2A 5EP3A 1N1EA 3GELA 1N2ZA 1XZNA 4IS3A 4MPDA 5DTJA 3QNWA 1MJ5A 2CNBA 5C7IO 4MR9A 4NS4A 1PWZA 1TTTA 2O8FA 2VBIA 1UPFA 2I0FA 5IZ4A 2JAPA 3KKQA 4AKGA 1KDOA 2HDOA 4AJ4A 1CEEA 2VTVA 1CEQA 1L8XA 1U3CA 2CLMB 2VHCA 3AINA 3OTQA 4J0QA 3PF8A 4QGBA 2EW1A 4OSPA 4CUZA 5K05A 2Q5CA 5GV8A 3FF1A 4ZVQA 4BTEA 4LBWA 2AW5A 2Y1WA 1U0TA 2GASA 3MN1A 3OC0A 4I6GA 4UOQA 3WIOA 5CEJA 2ZIXA 2E4XA 4QDKA 3DWGA 4TRRA 4WVLA 4TV9B 4EA6A 2PLAA 3WJ7A 3KYCA 3BF7A 4B2LA 1FJHA 2YOHA 3S3TA 2FE1A 2ZANA 5HZGA 1SA0B 5BSEA 4OQYA 1KRXA 2ORED 1MV8A 1AA9A 1KBQA 4RJIA 2MIIA 1SXQA 1CR0A 3LXUX 3T7AA 2GZ2A 4LYFA 5KHAA 1J1UA 1NQUA 1N9ZA 3G8DA 4ERNA 5BR7A 1TRHA 2E37A 1QLWA 2GT1A 3LX4A 1R0XA 4QBIA 2FG6C 5G1PA 2JEYA 1MX5A 5THQA 1BXGA 1CQJB 1U0OC 4C89A 1AK9A 3VPDA 1E9FA 3K70B 3DCNA 1JE0A 1U5CA 5CX4A 5EEHA 3AF3A 4C7BA 2EG5A 1PWXA 4CN9A 5TB5A 5KYXA 3DMPA 2CKMA 3AY6A 3IEKA 1KK2A 1IVNA 2AZ4A 2FCRA 2IV7A 3ZWNA 4DDTA 4QOEA 2X5XA 4B6RA 1C3VA 2BDTA 4O02B 4ZVUA 3WZ2A 3N0RA 1RWVA 2VUUA 5HQJA 1F17A 4PAOA 4BJ6A 1VBNA 1NHWA 1TF5A 3DFUA 1O08A 1ZK1A 4V1CA 2VLBA 5TIIA 4IILA 3AYZB 5LU8A 3H99A 4JYBA 5FBRB 5AVXA 2DJIA 5KSWB 1WB5A 4B4KA 4YY3B 2AFRA 4MYTA 2ZWPA 4ZDWA 5EJIA 1Z6AA 3CEAA 4JLOA 4W1RA 2VF5X 3F74A 3K70D 1CWUA 2QMEA 1XCJA 3KJQA 3VUEA 3PFNA 1J8YF 5CEEA 1RPNA 2QLMA 3D8UA 4NENA 5G1NA 2OE2A 2I3AA 2X9GA 3JU3A 1A1VA 3U16A 1N34B 3MUEA 4P80A 1PQWA 4JJAA 3IMCA 4ZOLB 4QT4A 3THSA 1FSGA 3WK8A 3W05A 3DT6A 3N70A 3C3EA 3WADA 1CE8A 4ZVSA 2ZT6A 3AL0C 1TJ4A 2OCGA 1UZAA 3CKYA 1RDFA 3P0RA 4YRPA 4GBED 4AM8A 2E5FA 2ZYWX 1AQLA 4JGBA 2J9XB 2O2JA 5EWJB 2SCUB 4IIBA 4A10A 2PE5A 5DIFA 5ER9A 2WNSA 1XAIA 4ZAFA 1FMTA 5T41A 1Q0TA 2Z5GA 2C0CA 3DE6X 4I8XA 5B3KA 2IS1A 4LGCA 2P78A 2PLNA 3D0QA 3X2SA 4A0HA 4AJOA 4EEZA 3BWXA 1DOZA 1I4LD 3OBIA 3WR5A 4DCNA 2PMFA 3HCNA 3HPRA 5HZMA 2YV2A 3FTQA 1D9XA 1SKAA 3GCXA 3SDSA 3D0KA 4UW9A 1YBMA 4V0NA 3UFXA 1O94A 4BO4A 1EUCB 1L1QA 4B7XA 3E3MA 1H93A 1U31A 2YHSA 3UT5A 3ZDFA 1LLDA 4D8TA 1BKSB 2O20A 1EVIA 5HZKA 1RI5A 3GVIA 1ODIA 4DPLA 5HDQA 4DRYA 1H5UA 3RWMB 1JBQA 2D2FA 3KD2A 3M1LA 3W5HA 3W6UA 1NRJB 1EUDB 3WL3A 1XZJA 4EDHA 1C0KA 3EA0A 2WAOA <