5DP1A

Crystal structure of curk enoyl reductase
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
332
structure length
332
Chain Sequence
DQPVQLKLSEYGVIDNLNWQPMQRKTPLANEVEIEVAAVGLNFRDVLNALGLLKDYYAEHFNITSAEQLTFGFECAGKISAVGEQVSQWQVGDEVIGLLLHDGLSSFITTSVEYVVAKPKQMSFSEAATLPLTFLTAQYGLQHLAKIQPGERVLIHAAAGGVGQAAVQIAQVAGAEIFATASPSKWEFLQSLGIKHIMNSRTLDFAEEIMKRTAGEGVDVVLNSLNGEYIPQSLAVLTPKGRFVEIGKIGIWEKEQVKEKRPDVSYFPFDLQEAVQQQPGLIGQLSEELTQQWNQGKLKALPHKVFPSTEITAAFRYMQQAKHVGKVVVSMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Cyclopropanation by a Unique Enoyl-Acyl Carrier Protein Reductase.
pubmed doi rcsb
source organism Moorea producens 3l
molecule tags Oxidoreductase
molecule keywords CurK
total genus 104
structure length 332
sequence length 332
ec nomenclature
pdb deposition date 2015-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5dp1A02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 5dp1A01
5EPOA 3RAJA 4Y6PA 3TNLA 1QLHA 2FPPA 1QLJA 3GRPA 3HHPA 3CEAA 1JQBA 1KS9A 4K1LA 1NHWA 5IDYA 2D59A 1V3TA 3U9LA 4CUZA 1J6UA 1E3LA 3OQ6A 2QRJA 1TXGA 4AICA 3D5TA 1M76A 4B4OA 2HMUA 3BMOB 2QX7A 1ORRA 2EW8A 4CM6A 4WECA 2JCVA 1BXGA 3BMCA 4M55A 3FPCA 5JY6A 2NACA 3ZU4A 4CMEC 3WLEA 5HRUA 1PZFA 1WDKA 3OJFA 3F1LA 3I9NA 4TRNA 4XWYA 4TRRA 4IBOA 3FR8A 1AXEA 5EQDA 3D4PA 1X14A 4YRBA 1QP8A 1BWSA 1K6XA 3F3SA 4DUPA 5L4SA 5EESA 3U49A 1WZEA 2GN8A 4A0SA 5DZSA 4S1VA 4CMGA 1YB1A 2GN4A 2NVWA 1GZ4A 2DTXA 4QO8A 4E0BA 4U5QA 1VJTA 3VH1A 5TC4A 3DDNA 1K89A 4TQGA 2O3JA 1WVGA 2E49A 2Q4BA 4E4YA 3NRCA 5JFOA 3VPGA 2IEBA 5IFLA 2SCUA 2JD2A 4ZD6A 2YFQA 3ENNA 1R66A 4QFCA 3G49A 1E3WA 2J5QA 3RWBA 3DZIA 2W8ZA 3R3SA 4KWHA 4LVCA 5TT0A 3ULKA 3FHLA 2UVDA 3GHHA 3R3JA 1BRMA 1BVUA 2O4UX 3GAFA 1LSSA 4I8XA 4RPJA 2DBZA 5B4UA 2BFMA 1DRWA 4BGVA 2VWPA 1O89A 4ND1A 3WGHA 3RASA 5IDQA 4DWVA 3K2EA 2GSDA 4HWKA 2H1SA 3GEMA 3GVHA 2BHLA 3PI7A 3OH8A 4FFLA 5AXBA 3QY9A 3UCFA 4PN3A 1BW9A 4YQYA 5IG2A 1UDAA 1OI7A 3UGKA 5AQ1A 1JTVA 1NR7A 4J90A 2VHWA 2XAAA 2Y1CA 3S2EA 2R2GA 1T25A 2CDAA 1X0XA 4YTEA 4YAJA 2R00A 4ESOA 1HKUA 1X1EA 3DAPA 4E5KA 3PQDA 4XGKA 2ET6A 3CKYA 4RPHA 1C0KA 1RYEA 4J7XA 1E1LA 2DLDA 1CETA 4WLFA 4BNZA 1H94A 4QFDA 1OAAA 4OSPA 2C59A 4L75A 4PLPA 3FNFA 4XEHA 4EUEA 5JCXA 5JC1A 1B16A 1AUPA 4FB5A 1QORA 1R4NA 5EN4A 3NT2A 3MZ0A 3VZRA 2OHXA 2Q50A 2CMDA 1JAXA 3WDSA 2CDCA 5ILGA 3WGGA 1EVJA 3P19A 3TZQA 4BO1A 5B1YA 1SAYA 3JD4A 2VHVA 1ZEJA 4RF2A 5TGDA 3STHA 1JWAB 3JQFC 3K30A 2WSBA 1PL8A 2J3IA 4B7XA 4II3A 4I5EA 2NTNA 1Q1NA 2UV8A 1I3MA 1Q2XA 4LISA 1R4MB 1N1EA 3O38A 4G65A 4NU5A 4GGPA 1U7TA 2EP5A 5AOVA 3AY6A 3IQDB 1D7OA 1M75A 3E9QA 2BLLA 7MDHA 4PIVA 3AWDA 1QYCA 3H2SA 5BR7A 2DUWA 3WTCA 1CQJA 2OP0A 1GTMA 2CF5A 2GERA 1GU7A 1K0UA 2EJWA 4XDZA 3KRTA 1ZXLA 5F1OA 3H7AA 3PQFA 4XB2A 2Y1OA 3HZZA 3PYMA 5GZ1A 2J3KA 1K6JA 3HB5X 2VUUA 3GG2A 4BNMA 1RM3A 2CY0A 3EUWA 4EI2A 2EKLA 4EJMA 2Y1FA 1QV7A 1QYVA 2X9NA 4AJOA 1E6EA 3W4IA 4CLOB 1KYQA 1LBEA 5EIOA 5CPBA 5DNAA 3KO8A 5U1PA 4FC6A 5A9RA 2IYOA 4CV2A 3KETA 5GY7A 2P91A 4BKUA 1NAHA 5AXDA 1O5IA 4GAEA 3WIDA 2D3TA 1GEEA 3PLNA 1WAMA 4ALKA 3NV9A 3WNQA 3HNPA 3LT2A 4PG6A 4ZA2A 3HB4X 2X9VA 3GFBA 1LDGA 4IDEA 3ROKA 1KC3A 1MGOA 4XX0A 3GUCA 4KQXA 4J1NA 3GAZA 5B4VA 1PJ2A 5DOVA 4WPGA 4OJNA 1DSSG 2FOIA 3UICA 4RDIA 1E3IA 4R3WA 2UUOA 2HU2A 4D42A 5ICSA 4I08A 4WK6A 4A03A 1CYDA 2BELA 3G1UA 4IGEA 5JDIC 3C1AA 2D1YA 1A9ZA 1G0NA 3RJ9A 1I0ZA 5KJ6A 4M86A 4J9UE 3VPHA 5KOIA 3N7UA 5C37A 2PNFA 5I7VA 3QWHA 3OICA 3IC5A 3JQAB 4S3MA 4D41A 4NFYA 1NM5A 3C8MA 4BO7A 1PS8A 2PK3A 1SOVA 3COSA 3K5PA 3ZNQA 5LCXA 3FBTA 4EUFA 4KMSA 1ADFA 3WJ7A 1E7MA 3PDUA 3IMFA 2G82A 4XRGA 1VSUA 1ML3A 1XHLA 1X1TA 3OHSX 3VZSA 1PZHA 2I9PA 1M2WA 4GMFA 5G4KB 2B4TO 5TS3A 1SBYA 3RU7A 5CDSA 2Q2QA 3PHLA 1DXYA 1SZJG 3AFMA 1RWBA 4XQ9A 4DIOA 3L77A 2JKVA 3OFSA 2BH9A 1E1KA 1HSOA 2WE7A 3JQEA 1U5CA 1YKFA 1YJ8A 2D8AA 4B4WA 3EC7A 1P1RA 2HAEA 1LNQA 3RUCA 4CM9A 2DQ4A 1I36A 2ZB3A 4ZGWA 4C7KA 3CTMA 3W6UA 4FJ1A 4YT8A 1SEPA 3SC4A 2X22A 5I9LA 3RQSA 1BMDA 3JQ6A 3Q2KA 4W7IA 1FF9A 2QZZA 1DC6A 1DEHA 3IKTA 1YGYA 2ZYGA 3AU9A 3BMOA 4YAEA 4E2WA 2EHDA 3I6QA 3HFSA 3JQDA 3V8BA 4AJLA 3LLSA 2ZK7A 1VJ0A 3DFZA 2C07A 3RBZA 4J1TA 1GD1O 2PKQO 4HADA 2Z1NA 3GA0A 5F3RA 3RVDA 5JMWA 3T7CA 4ND5A 3NTRA 2ZQZA 4KDEA 1LDYA 4B8ZA 3AFNA 4CMIA 4OKNA 5JCJA 1AGNA 3GDGA 2Q2VA 1NQTA 3ZHZA 1Y9AA 3VTZA 2NUAA 1F0YA 4O5OA 3ZHYA 1SB9A 5T8KC 2FP4A 4NJMA 4U6QA 4XR9A 4Z9YA 1IPFA 2C7VA 3EZYA 1YDWA 1PU2A 3H4VA 1NQOA 3UAGA 1LX6A 2PGDA 4GQAA 1Y1PA 5L53A 2I3GA 2Q1WA 3KYCB 4MVJI 4A26A 4BMSA 5BSEA 3KV3O 4J4HA 1GCOA 3JQBA 1Y6JA 3FF4A 1OC2A 3R0IA 3ABIA 1EVIA 3BHMA 1PS9A 1F17A 4I9NA 4NJMB 5FYDA 3GPDG 4OGWA 2OUIA 3H9QA 1LA2A 3EMKA 4MVJP 5LDGA 4R41A 3GGPA 5JO0A 4NPCA 3TQHA 1WNTA 2EJVA 1CWUA 4MVJD 4DRYA 3WWYA 3GNSA 3RFTA 1I33A 1Y81A 3ANNA 3HJAA 4E33A 4XQEA 5TSDA 4PLYA 4YBZA 4PLZA 1NASA 2O50A 2YV2A 2AHRA 2FN7A 1XCBA 5IXYA 5JSFA 1VLLA 4CMIB 3N58A 1C3VA 4OQYA 1ENZA 5T6BA 4BO9A 3PRJA 4J91A 3GHYA 4E12A 4K9DA 3DL2A 1I01A 4D0RA 1PGQA 1NAIA 3GDFA 5CG2A 3X2EA 2VQ3A 3M6IA 1UP7A 1JW9B 3TRIA 4H7PA 2AEJA 3ZCXA 2WYVA 4FSHA 4XD2A 5CHEA 2V6GA 3K96A 3KYDB 4BNLA 1B15A 1DHTA 4ALIA 4R54A 3DR3A 3LZ6A 2B4QA 1DC4A 4JN6B 4BNHA 2DTDA 2VN8A 2AG8A 2GUGA 1GV1A 5TJ9A 1C1DB 4K26A 3PXXA 2ZCVA 1TB4A 4TSKA 4HUJA 2X9GA 2Y1GA 4XCVA 3DZGA 2FSVA 1ADGA 1B14A 3FPLA 4YT2A 2YQ4A 3VZQA 1BXKA 5JYDA 4YACA 5I7SA 3JYQA 4GLLA 3IKVA 2VUTA 4PLHA 4P4NA 4BNGA 4D0SA 3OBBA 1DBVO 1MC4A 1TT5B 2QYTA 3MJVA 5TRTA 4HNHA 1BXGB 1PR3A 2C82A 4PG4A 5AXCA 1BVRA 4UVEA 4ZHSA 2D2IA 1GYQA 3NUGA 3ZWAA 5EQFA 4IMPA 4CODB 1KVQA 3G79A 5KKCA 5G0TA 4BO4A 1GUYA 5ENDA 4FC7A 3PHHA 1MX3A 1SPXA 1BDBA 4R3NA 1QSGA 4LCEA 5CPFA 2E48A 2PD4A 1EZ4A 3OETA 3GEGA 4FFPA 4F45A 3OMLA 1RPNA 3KSZO 4L4SA 1PJQA 1KEUA 4TVOA 3ROQA 3JQ9A 5KWEA 5ILOA 1U1IA 1SB8A 3Q2IA 3BA1A 2G17A 1HDRA 1V35A 4HFMA 3TJRA 4DXHA 1E7SA 3F4BA 2VRBA 2Y1DA 3UXYA 4E5MA 1GPJA 1LTHR 3LK7A 1BSVA 4IJKA 4XDYA 9LDBA 3UF0A 5JCJD 4CJXA 1ZEMA 1P0CA 3DONA 4BS9A 1S7CA 5DP1A 3LU1A 3WQRA 5ER6A 4YAGA 3T4EA 2A4KA 4L8VA 1CERA 3D3EA 2O3UA 4HNGA 3DZFA 1E3JA 4WGGA 4BO2A 4Q39A 1DC5A 2AE2A 1I32A 1EQUA 1CEQA 3EDMA 1VL0A 3DHEA 3GOHA 1W4ZA 5CAEA 3KLPX 4NFSA 3AI2A 5L3ZA 1LQUA 4BV8A 1E6UA 3MJSA 5F1KA 1IUKA 2B35A 3WG9A 4AL4A 1ISFA 3HADA 3OQ1A 1XWFA 2DBQA 2GNAA 3NDRA 3WTBA 2PLAA 1C1XA 2JD1A 4E2XA 3D5QA 3EVTA 3KEOA 1QYWA 3Q6IA 6LDHA 1SEVA 2UYYA 2UUPA 4IPTA 4UVGA 4BB6A 4DA9A 2X4GA 1S6YA 2FY8A 3U09A 1NVTA 2NVBA 3HWRA 2VCYA 4GX1A 3I6IA 2OGUA 5EJ2A 4ROSA 1MV8A 1UDBA 1WPQA 1D1SA 5JLAA 5JO9A 1UP4A 2NWQA 1PJSA 3IAHA 1XLTA 1D4FA 1NBOA 2DTEA 2O7QA 2Q46A 2QQ5A 3FWZA 3C24A 3ZNPA 3E48A 3QQPA 4Z9FA 4EYEA 1YH3A 4XIYA 2VHYA 2PKRA 5LDHA 3ZGYA 2NTVA 3ZV5A 3WGYA 3UFXA 1C0IA 1WMAA 5DBFA 1I3LA 3V5NA 1LU9A 2IXAA 4NBVA 2FR1A 3LT4A 2HK7A 1XG5A 1XU7A 1A9YA 2VWHA 1XR3A 3RUHA 8ADHA 5COBA 3F47A 1B3BA 2Z95A 5BT9A 4LN1A 5G4KA 1Z73A 5FEUA 4NJOA 4HP8A 4NHEA 2TMDA 1OBFO 1PTJA 4GVLA 5A3VA 4UUMA 3NDIA 5ADHA 1Y5MA 1D8AA 3I23A 5I8ZA 3AOEC 3TOZA 2B69A 5B12A 3WFIA 2A9FA 4K28A 1NR1A 4IDBA 3EK2A 1RJWA 4IQ0A 3FCOA 3L6DA 2X86A 4RL6A 2C0CA 3PJFA 4QEDA 4R51A 4RVFA 3P2OA 1EK6A 2JCXA 1NNUA 3DAFA 4E5YA 1A4IA 1P0FA 2HRZA 1DIHA 4M54A 4D79A 3BMQA 1H5QA 2EGGA 2UDPA 3UCEA 1HF3A 4WLNA 4AG3A 5KVSA 3BIOA 1LC3A 4R1SA 4J0EA 3PZBA 5DCYA 1IOLA 3I3OA 3PZRA 3RROA 5TNXA 3ON5A 5C7IO 4Z3DA 1GV0A 4OOEA 2JHGA 1D3AA 4J49A 3OSUA 5G2OA 5JDCA 2W98A 2XXJA 2PV7A 3QVTA 4N5MA 3GT0A 2RAFA 1SNYA 2IXBA 2O4CA 1KY5A 1JVBA 1E7WA 1R0LA 2AA3A 3NGLA 1KOLA 4UVDA 3GNQA 3DTYA 3MOIA 2BD0A 1PZEA 2OXIA 5EINA 4UEKA 1R6DA 1D1TA 4BUCA 3LDHA 4XIJA 2P2SA 4NR0A 1A4UA 4CV1A 2BFOA 3FRJA 1N9GB 2O48X 1NQAO 1LLCA 4IMRA 3V2GA 1VKNA 1DLIA 4F6LA 4IS3A 5JS6A 1HTBA 1PGJA 5JE8A 3ZWYA 1CRWG 1VKOA 4LSWA 1UZLA 3QE3A 3X2FA 4FDAA 4O1MA 4RORA 2OBNA 3UCXA 2OP1A 1AE1A 3KYDA 2X6TA 1NWCA 3KLMX 3U5TA 4BKRA 4A73A 4D43A 3SJUA 1ZK1A 4RDHA 4PLFA 3QIVA 1TLTA 2W2KA 2IEDA 2P68A 4WLUA 3L6EA 4CPDA 4CLHA 1R15A 2VZ0A 3ZV6A 1LDMA 3EZLA 2O3RA 1HDCA 3H5NA 4YRAA 1U3WA 1FDWA 3PEFA 1ENPA 1QXSA 4FW8A 4UUNA 1O0SA 5THQA 2LDBA 3QVWA 1H2HA 1XA0A 1HEUA 1HYEA 4OXKA 3PTZA 2AQIA 2NU7A 2FR0A 2PGJA 4O6VA 4UULA 4D46A 3I4CA 2NM0A 3K6JA 3LC2O 1CDOA 3ZU5A 2B4RO 2X23A 2EXXA 3VKUA 1KVTA 1GFSA 2GZ3A 4MP8A 5G0SA 4GMGA 1HRDA 1B8PA 3D0OA 3FSRA 1Z7BA 4CR7A 2BGLA 5IZCA 2NLOA 4UREA 2AXQA 3A06A 1IPEA 2EERA 4A5OA 1MFPA 2F1KA 4P22A 2NU6A 4RJTA 1PQUA 2ZJ0A 3DBRA 5L9AA 5IZCC 3DWFA 4ZQBA 2FSSA 3JQGB 5F5LA 3RCBA 2WWRA 5CDTA 2XOXA 2BI7A 2HJRA 2EEZA 3SBOA 3WB9A 1I3NA 3LT1A 2QZ9A 3VC7A 5LC1A 1UH5A 4B3HA 1MB4A 3PJDA 3NEPX 4XYBA 4CM1A 3JQGA 3DBHA 1R4MA 4MOWA 4ZU3A 4FN4A 3VKVA 1NFFA 1H0KA 2P4HX 1JN0A 4W9NA 1VRWA 3AJRA 3HFGA 4ZQFA 2DUUA 4BVAA 2O2YA 3I83A 3MJ4A 3LT0A 4R16A 3INRA 3JV7A 4OYRA 5EERA 4CMBA 3FNEA 3TZ6A 4CM9D 3OJEA 4NK5A 4DLBA 4YR9A 1NTOA 3F1KA 3VAZA 3GR6A 4FJ0A 3MTJA 1Y5RA 4ID9A 1ZFNA 2WTBA 4JP2A 4Z3KA 4IJVA 5JAZA 4O0LA 3AY7A 5A9SA 3JQ9C 2VT2A 2V6MA 2ZTLA 4FPXA 2J8ZA 3ICCA 3QA9A 4R1NA 3AM5A 4A2CA 2WD7A 2W90A 2B5VA 1QV6A 4TKMA 3TZCA 2W2KB 3ROMA 3S2GA 4EITA 1NFQA 3PK0A 3PIDA 2JCYA 3GG9A 5FFFA 4IXTA 3BTOA 4ND2A 4J7UA 3BTUA 1ZK0A 2Y0DA 3ZW9A 4CV0A 5DDIP 1N7HA 2D5AA 1U2GA 1V6AA 2WYWA 3TN7A 4CR8A 4BKPA 3L07A 4U6SA 4GKBA 1RYDA 1KVSA 5K6AA 3QLJA 4J3FA 5CEFA 1UR5A 4J9VA 2VWQA 1ZJYA 2O7SA 1F8FA 1ADBA 3OQBA 4DPLA 5DBGA 3E03A 3TZKA 2FRDA 6ADHA 1Q0HA 3A9WA 1RKXA 4CQMD 1BTOA 1GEGA 4BNTA 1U7HA 4R1UA 4MIEA 1ZW1A 4WEQA 4GVXA 3H5AA 2EGHA 5T67A 1DO8A 4XR4A 3A28A 3WMXA 1PX0A 1UAGA 3KSDO 4JJGA 1GQQA 3KTDA 2DT5A 2VYVD 3DHYA 1T24A 4JJFA 4U0JA 3EVNA 3L4BA 3I9MA 3EAGA 5I7FA 3NT4A 4ZQGA 2P9EA 3DZHA 1T26A 1JA9A 2XPCA 2PD6A 1LRKA 4Z6KA 1Z7EA 2FR8A 3WNVA 4IUYA 4RZIA 9LDTA 3AUSA 4LMPA 1Q7CA 5T57A 4D7AA 2H9IA 1F06A 2BF7A 3ADPA 4BQPA 2YFHA 1B3RA 4IZIA 2Y0CA 4TZTA 4L76A 1YOVB 3ANMA 5K9ZA 3AUAA 3GC6A 2Y1EA 3D64A 1ZZEA 2AMFA 4JJIA 4D3SA 3IIEA 4RZHA 1UJMA 1UXJA 4AJJA 3SVTA 4RF3A 2C5AA 5CG1A 1VPDA 3HDHA 1YDEA 3U4IA 1Q7GA 1UAYA 2AE1A 1ZSYA 1NYTA 1PGPA 2DBVO 3CSDA 1LJ8A 3S2FA 4BO3A 2WM3A 5CDGA 1EQ2A 1HDOA 2GPTA 4RF5A 4MIOA 3H65A 2Q1UA 3IP1A 1IHXA 1OOEA 2JFFA 3VOSA 3ZHBA 2GN6A 5A04A 5BNFA 5A5FA 4J6FA 1MXHA 4NU6A 4NMHA 1PJ3A 5AXAA 1YBAA 4E2YA 5IDXA 4OMUA 2CD9A 4TROA 1HZJA 1YQXA 2R00C 2PKQP 5BSHA 3ZWBA 5FWNA 4JIGA 1HSZA 2HLPA 3GQVA 1J0XO 3QJ5A 1Z82A 3L4SO 3I9JA 4Q9NA 4J0FA 4EBFA 1TVEA 2VHZA 2VOJA 3QWAA 4WNCA 5KKAA 2X0NA 5L51A 1JAYA 3H6KA 3W8FA 4ZJUA 2E6UX 2VNAA 3JTMA 3EY4A 1A27A 4J7CA 1LDEA 4IQ8A 2VYNA 1T2EA 3TF5A 1MA0A 4PRKA 3IL2A 1DIRA 3PJEA 3MOGA 1GCUA 1YB5A 2QYSA 5CDUA 2VYVA 3CIFA 3A1NA 3KYCA 4QX6A 5B4TA 1HLDA 4M1QA 1LDNA 3CXRA 4I5FA 1SOWA 2TMGA 1N9GA 1L1FA 4UUOA 3W1VA 4Q3DA 4BQRA 1U2DA 1GL3A 1SC6A 1ZK3A 3OJOA 1IL0A 1YJQA 5T8KA 2DVMA 5G0UA 3VTFA 1PJLA 4XJSA 1ULUA 4HX5A 5IAAA 2JD0A 2GZ1A 5G0VA 5KVVA 1TEHA 2GZ2A 2ZQYA 4YJGB 3VDRA 3KM0A 3DHNA 1ZSVA 5KVCA 1EMDA 4Q3EA 2ZJ1A 3E6AA 3PWZA 1U8FO 1EDZA 1E6WA 4WCFB 3NT5A 3JQ8A 4K6FA 3VH3A 1WMBA 2YQ5A 5CP8A 3DZBA 1DJNA 3F46A 5G4LA 5JAIA 1A5ZA 2Y68A 2HKIA 1H6CA 3MJCA 4W4TA 1HE4A 2CVQA 1YBVA 4E2ZA 3GVPA 1QR6A 4B3IA 3VPSA 2YW9A 3AY3A 4QT0A 3O8QB 1I8TA 4RVDA 2NSDA 2O3TA 5DCUA 5BNIA 2Z5LA 3UHAA 1I3KA 4CM4A 2NNLD 4CQMA 3RC1A 2AQKA 4RQTA 4M89A 4GLOA 1BW9B 4TMFA 3INGA 1NPYA 5DT9A 5EMHA 1GAEO 1IE3A 1LRLA 3DMTC 4J2HA 5AVOA 3GMDA 2GF2A 1HDGO 5DBIA 4EJ6A 4GX5A 1F12A 3ZWWA 1YOVA 2ZYAA 3D4NA 4BNYA 1HL3A 4DC1A 4RVUA 2EG9A 1SMKA 3SLGA 4IDGA 4IJUA 4WEOA 4HFNA 4Y6RA 1J5PA 1TT5A 3ONDA 1B8UA 3L0DA 4DC0A 3C1OA 2BKAA 5DP2A 3C85A 2JAHA 3ETDA 3WWZA 1DIGA 4HBGA 3JQBC 3I1JA 2IYPA 3C3XA 3OIFA 3DXFA 2P4QA 2Q45A 1J49A 3WQQA 2C54A 4BMNA 1ZXBA 2DM6A 4FJ2A 4RPKA 4ZRMA 3BMNB 1E7YA 2RH8A 1ISMA 4B79A 1E3EA 2B0JA 1WDMA 4I9UA 3FWNA 4CL3A 4W9NC 4I1IA 2DKNA 1LSJA 2WJPA 3BHIA 4IZHA 4ND3A 3U62A 3L4BC 4YT4A 3KHUA 2JFHA 3KSUA 2GN9A 3GPIA 5JW6A 2JFGA 3PVZA 1P77A 4DGSA 3SEFA 5F21A 1WLYA 2E4AA 3K73O 3IJPA 4HFRA 1DRVA 3H9EO 5COQA 2NVUB 4CV3A 3VPFA 4EUHA 1IHYA 3GLQA 3O26A 4P4GA 1T4BA 1H6BA 4KP7A 3ZI0A 3QVSA 1B8VA 2HJSA 4YA6A 5B37A 2DC1A 4L9RA 1T1SA 4J1QA 5C7OO 2DU8A 2X5JO 3G17A 4WCFA 2BGMA 2DBRA 4BNKA 1LSOA 1YL6A 4NQZA 4PZDA 4IXWA 1C0LA 4BGUA 1E0DA 1Q0QA 1B2LA 2GD1O 2ZYDA 1Y7TA 3Q11A 4CMAA 4CMKA 5JNLA 1KBZA 3DFUA 2OORA 4YAIA 2WD8A 1EEHA 5AYVA 3KZVA 4P8RA 3V2UA 4CQLB 1ISJA 5A5EA 1MG0A 2HQ1A 3C7DB 4OL9A 3HN2A 4NBWA 3JQ8B 4U8GA 4JGBA 3H3FA 3WR5A 1PIWA 2B5WA 1JWBB 4BNIA 4BNVA 3K8ZA 1GYRA 5JBIA 1EBFA 1IY8A 3DBLA 1HZZA 1Q0LA 3PPIA 5ICMA 1SO8A 1DAOA 5HS6A 4Q3AA 1AXGA 4W6ZA 2VYND 3DO5A 1P45A 4FS3A 4R68A 2P5YA 4G5HA 4R5HA 3RUEA 5A9TA 4BV9A 4PG5A 3ZW8A 3GGOA 5K1SA 5ITVA 1LSUA 3WSVA 4N54A 3UN1A 3WX0A 2ZATA 4MP3A 4EJ0A 3PHGA 2EV9A 4FOSA 1O6ZA 1QKIA 1C1XB 3JD2A 4WLVA 5BSFA 4XA8A 4W99A 1LC0A 3OECA 4NI5A 1OFGA 4URFA 3JYLA 2VRCD 5U9CA 1PR9A 2V65A 1AHIA 1PQWA 4O63O 2OO5A 2FZWA 5JXWA 1N5DA 5ENVA 1PGOA 4XZ3A 1XKQA 2FPGA 5COAA 3ROPA 3JQAD 3B1JA 1B26A 4ALNA 3ZU3A 3DOCA 3GUYA 3OA0A 5L95A 4B7CA 4PCVA 2P5UA 1PJ4A 1V0JA 2HCTA 2GO1A 5ITWA 4Z0TA 4PLCA 4XKJA 5KIAA 2A94A 1JVSA 3RIHA 1LXCA 3GFGA 3I9LA 3K31A 1QYDA 1UUFA 2I76A 1PZGA 2FMUA 4A10A 4YXFA 2X0RA 4QECA 3Q3CA 1UXGA 3ZZNA 1WW8A 2IE0A 5GZ6A 2ZTMA 1R0SA 3AK4A 5F1PA 4RVSA 3PHJA 2C7GA 2UAGA 4TRMA 4DTIA 4CLXA 4BNXA 3NJ4A 3SJ7A 4FIZA 3RBXA 3K9QO 5DOZA 1QYXA 1VI2A 1Y8RA 1YXMA 4YWJA 4A27A 1BGVA 1UZNA 4KZPA 4BKQA 3CH6A 4RCVA 3TL2A 3ZWNA 1U9JA 2RIRA 4AJIA 4AJ2A 1YS4A 4MP6A 2D0IA 2Q99A 4EGFA 2CFCA 2Q1TA 2X5OA 3K2BA 4EEXA 3MCVA 1N8KA 3KXDA 1HE3A 2GR9A 1JKJA 1YO6A 2DAPA 2YHUA 3T4XA 4MPDA 4E32A 4B4VA 2H6EA 4KTVE 1V9LA 2HO5A 1A71A 3E9NA 1I24A 1N2SA 4NBTA 4DPMA 4NDNE 1WP4A 5A9SB 2PA3A 4IGFA 3WICA 1EE2A 1ZO8A 2J3JA 3WMWA 3BZUA 3C7AA 3GZ4A 1LLQA 2Q4EA 4OO3A 2AQ8A 4G2NA 4J4TA 3O4RA 4JK3A 1NVGA 1F14A 3U4CA 4ALJA 1P1HA 4R5MA 5A3JA 4IQGA 1IB6A 2A92A 3WGZA 4MVJG 4MKRA 4OXNA 1LI4A 1EUDA 2QW8A 3ONFA 4HY3A 4IJWA 3U0BA 4DYDA 5HTOA 1XSEA 5A06A 5HWSA 2YHIA 3DOJA 4UEJA 4OHUA 4WCDA 4RVGA 3TWOA 3WBFA 3ZV4A 4CM3A 1U4SA 5KVQA 3E9MA 2X0JA 4TKLA 4NG5A 1KERA 2HK8A 3ICPA 4JROA 5CDYA 3ZWXA 5C3MA 2Y0EA 4IM7A 3BXXA 4AJKA 1CIVA 1P31A 3DMYA 1T2DA 3FBGA 1GQYA 1EVZA 1EBUA 4F3YA 2JL1A 2C29D 3PJGA 3O8QA 1VSVA 3C7CB 3R6DA 3WOHA 3V2HA 3ANLA 2PH3A 1R37A 2RHRA 1ZUD1 3JQ7B 4HKTA 2VHXA 4NZ9A 3V1UA 4BB5A 3ONEA 2I6TA 5MDHA 3H2ZA 2FWMX 3DZJA 3DEYX 1KIFA 5KNLA 2EKQA 1BXZA 4PVDA 4OXYA 1ENOA 3UKOA 2QIOA 2YV3A 4NBUA 3S1LA 1EK5A 4H16A 3TL3A 2EW2A 1M67A 1DHRA 5DULA 2HK9A 3CINA 2W4QA 5JMPA 2BFAA 5ES3A 1R4NB 3QSGA 4I5DA 3IOYA 4UEOA 3VH4A 1EVYA 1XIVA 3QWIA 4BNWA 2JHFA 4GSKA 1T2CA 2YZ7A 1B7GO 3M1LA 4FFMA 4R69A 2B83A 2FZEA 2IRWA 1FXSA 3LLVA 2DFVA 2VNSA 2HMSA 3H9UA 3HE3A 4WOJA 2NTJA 4MKXA 4L0QA 3JD0A 4NFHA 4WLOA 4AJEA 1ARZA 3NTQA 2BGKA 3ITDA 3L9WA 1Y8QA 2V6FA 4XQCA 4FFOA 4JBHA 4LRTB 1Z75A 2Y05A 4GWGA 3JQAA 2H63A 3GN2A 1NX6A 2XXBA 2DPGA 3IDSA 3S8MA 2PGLA 4LRSB 4DIFA 2GYYA 3H3JA 2HMWA 2IODA 3MJEA 3RJ5A 5JC8A 3M2PA 4CR6A 3GNTA 1IZ9A 1BG6A 4JX8A 2GGSA 3FTNA 3D4OA 2PTGA 3PGJA 1DAPA 1U28A 5L7YA 2NU9A 2Q49A 4YJDA 4BNUA 5THKA 4YYZA 4DL9A 1W8DA 1Y9EA 3BMNA 3LYLA 4U0KA 4PRLA 4LCJA 4MKZA 2X1HA 1FK8A 1ZMOA 3P7MA 2CNBA 1GZ3A 3DTTA 4AJ4A 1T4DA 1I30A 2WDZA 1HDZA 3MWDB 3F9IA 4E21A 4MVJE 1JKFA 5DCWA 3UOGA 1PJCA 4LGVA 2HMTA 1EUCA 1BDMA 4TVBA 5KJCA 2VRCA 1ZMTA 1G0OA 2ILTA 3GGGA 3G0OA 3I52A 4XYLA 3GN1A 3ZU2A 2X8LA 3CPSA 1VE9A 3ZHXA 4J16A 2NU8A 5H81A 4CM8A 3AOEA 1X13A 1U4OA 4GGOA 3RUDA 3WYCA 3WIEA 3MJTA 3ASVA 4J1SA 1E5QA 2CZCA 2ZTVA 1MG5A 3C1TA 1XU9A 3VZPA 1YQGA 4ZICA 1KEVA 1DC3A 2D4AA 3W6ZA 3E1KA 4DREA 3L6OO 3WYEA 1ZNQO 4RQUA 4BO0A 4N5LA 5KCZA 1ULSA 2J5KA 1FDSA 4MJLA 4YJFA 2VWGA 3PWKA 1LLUA 5HBRA 4FCCA 4IIUA 3S55A 4HXYA 1W73A 2YYYA 1P44A 2H5LA 3F4LA 1R16A 4XYGA 3BTSA 4F6CA 4I5GA 4II2A 3W4KA 3LC7O 3UUWA 4BO6A 3NAQA 1DRUA 4WJZA 2IZZA 4JP3A 4YJHB 2W2LD 3VVCA 2PR2A 4M87A 5FF9A 3K92A 1FJHA 3AI1A 4DQUA 1EFKA 3DOOA 3LSYA 4N18A 5JAQA 2HDHA 4L4RA 5G0WA 1RM4A 3ZNNA 3MWEB 3PFFA 5CEEA 5JPIA 3DAGA 4P4LA 5F5NA 3B70A 3V1TC 4E5NA 1LRJA 2Y93A 3KUXA 4DIBA 5BNTA 2EIHA 1LEHA 4O59O 2HRBA 2IZ0A 4BMVA 1YVEI 3NJ8A 3LF1A 4OH1A 4RF4A 1IZ0A 2WE8A 1F8GA 3PP8A 4C7JA 3ZWMA 5K6AC 3EGOA 4KUEA 5I9NA 2AG5A 3WSWA 3GY0A 3DQPA 3NGXA 1M66A 3OM9A 1K3TA 2NVUA 4R9RA 3EW7A 4Y8VA 3GVCA 4YT5A 1Y8QB 3UH1A 1ISIA 4IDFA 1ZH8A 1G6KA 3WXBA 3ENKA 2E82A 1IULA 3DC2A 4WASA 2I99A 1QG6A 2RBEA 1RM5A 4Z0PA 4CUJA 5IZ4A 2B37A 3WBBA 3U4HA 1UDCA 4PVCA 1DFGA 1HE5A 1LUAA 4GWKA 4DBZA 1LDBA 3O9ZA 4FFRA 5DF1A 4FOOA 3CZRA 3WS7A 1HLPA 2GRAA 1H9BA 1O95A 1X15A 4XGIA 5I9MA 3SLKA 3Q0EA 3I9OA 4YJGA 4CLEA 4CM5A 4J43A 5L7WA 1DOHA 3ADOA 2W2LA 2I65A 3ASUA 2OMEA 1U3VA 1YBMA 2Y99A 4GSLA 1E77A 3INTA 2PD3A 2D5CA 3I9KA 3WGIA 4GX2A 5L45A 1DLJA 3E5RA 3QWFA 4L73A 4DMLA 2C2XA 2YHIB 1OZAA 2O3QA 4BO8A 3NYWA 5JDIA 2BI8A 2F00A 5MGBA 4E13A 4K6CA 4NBRA 4GI2A 1EFLA 3D3WA 4YVFA 3T7EA 3B20A 4CQMB 3DBLB 1G1AA 4CM7A 4JBIA 4NK4A 4D3FA 1JKIA 4RLHA 1E92A 3NKLA 4MIYA 2OZPA 7ADHA 2X5KO 3JQCA 1Q7BA 2R6JA 4OIMA 1CJCA 1R12A 1A72A 2POQX 3BYZA 2J6IA 4J2OA 1X7GA 4RPGA 3DZKA 4PG8A 3CMMA 1E5LA 1IYZA 1XGKA 4YJFB 2HMVA 4OM8A 1E3SA 3AW9A 4PFJA 1HXHA 1GR0A 2YY7A 4AFNA 4E30A 1Z6ZA 1HYGA 3TFQA 3WYBA 3ZDFA 3P2YA 4CM4B 2LDXA 3GZNB 2VOEA 1ISGA 1XQ6A 4IS2A 4PZCA 2ZB7A 2ZIZA 3FD8A 4AJPA 1MFZA 4OOFA 4DLAA 3PLRA 2IZ1A 4ZQHA 1MP0A 3QP9A 4J4BA 5TLSA 1P1IA 3LQFA 4ZVVA 2E37A 4JNKA 1YQDA 1PJBA 1OMOA 3JD3A 3M2TA 4LW8A 1GDHA 2DFDA 1JU9A 3WGOA 4KUGA 1O9BA 1YE3A 3N74A 2O23A 4FQ8A 3AUUA 4A7PA 3GZNA 1PWZA 2YJZA 2AEMA 1YL7A 3GVXA 4HV4A 4DMMA 2C2YA 1PGNA 4BNFA 4BHTA 2YUTA 3FR7A 4YRDA 5BSGA 3ZWCA 4LMRA 3LVFO 3U4DA 1O94A 1DPGA 3Q9NA 4UUPA 3JYNA 4I9HA 1L7DA 2CUKA 4GL4A 4CLRA 2JAPA 1P9LA 1Y8RB 1P3DA 2RH4A 3JQFA 3RUIA 3WQSB 4BNJA 4FFNA 2GCGA 4X54A 4DVJA 1YB4A 4AJNA 3HDJA 1N1GA 1Z45A 3I5MA 1UXKA 1TA4A 4DPKA 2OL4A 3GH3A 3QV1A 3H9JA 5JDCC 3BMCB 1K2WA 4DBVO 1PSDA 1ZVMA 4GKVA 1JLLA 3O03A 4QTZA 2PZMA 3WLFA 4OAQA 3RC7A 1VL8A 5L4LA 4XB1A 4WE3A 3D7LA 1E3WB 1H9AA 2CDBA 4WUVA 4PGFA 5KJ1A 3DBRB 1B0AA 3M1AA 2RCYA 1GUFA 4RO0A 5HA5A 4IDDA 4RVHA 3GEDA 1NHGA 1ONNA 3OP4A 4MVJM 1U8XX 4Y6SA 4B3JA 5EL0A 2I3AA 4Y9DA 1MLDA 4ONEA 4Q3BA 2V6BA 1YL5A 4ILKA 4XQGA 4DLLA 4GH5A 1NXQA 4BKOA 1XEAA 4IINA 3PGXA 3D3WB 5H82A 1X7DA 3PYXA 4KTTE 4AJ1A 1EE9A 5IJZA 4DQVA 1PEDA 3WJAA 3DB2A 3OA2A 3WGQA 2JJYA 2CVOA 3P5SA 1NFRA 5H83A 4QQRA 4E31A 4UAGA 2PFGA 3PIIA 1ZJZA 5A03A 3PWSA 3ZV3A 2VUSA 1X0VA 3DMTA 1VM6A 4JBGA 3WFJA 5TIIA 3IS3A 1EUZA 1MXFA 2QHXA 1PL7A 3B1FA 4CMJA 3OIDA 1BHSA 3RD5A 5KTKA 1KVRA 3QVXA 3RBVA 1LLDA 2C20A 2I66A 3ITKA 4PLTA 4ZQEA 3OJLA 4M49A 3PYLA 4ND4A 2AW5A 1ID1A 1GUZA 3KYBA 2VT3A 1GZ6A 4TRJA 3H9GA 1I10A 1ADCA 2FPIA 4YB8A 2ZCUA 4DQXA 5J23A 3IUSA 3OEYA 3BAZA 1PL6A 1C0PA 5L40A 1ZIDA 5DN9A 1AHHA 3JCZA 4BO5A 4TWRA 5HS4A 1DB3A 1ONPA 2CSUA 2GASA 4E6PA 5JY1A 4H3VA 3ZWPA 4CMHA 1E7QA 3E8XA 3FTPA 2GDZA 3I4FA 4M8SA 4UVHA 1GYPA 3H8VA 5CEJA 5A02A 1O8CA 3NX4A 2Q1SA 3R1IA 1A7KA 3RUFA 4OQZA 4CLRB 1XDWA 1Z74A 4PLWA 3KVOA 2BRUA 1CF2O 1U3UA 1QRRA 3JYOA 4YAKA 3ZN2A 4XYEA 3ETEA 2I5PO 2PZKA 2RHCA 3PQEA 2VTEA 2G5CA 5C7LO 5KJFA 5A4DA 4KWIA 2YV1A 5IN4A 3PDJA 1E1MA 1K5HA 4NH4A 4RPLA 3VH2A 4Z0HO 4EDFA 2YDYA 4KDFA 4YJHA 3KEQA 3W4JA 4CUKA 1DFIA 5TF4A 4BGIA 1UXHA 3ETGA 1MUUA 1DJQA 3A14A 3JD1A 4D45A 1H93A 1HDXA 2PZJA 1ZKMA 5GZ3A 3UW3A 4Z9XA 3MTGA 1J4AA 1W0CA 1C1DA 2CVZA 4FBGA 4GX0A 4INAA 4CLDA 3OJ0A 4L4XA 4FGWA 3AU8A 3HDQA 4UVIA 3UVEA 5T64A 1GQ2A 3MEQA 1GADO 2O3SA 4ITUA 3NDJA 2P9GA 4OSOA 4KOAA 1AN9A 1L7EA 1KVUA 2Q2WA 3VHRA 4WLEA 3B1KA 3VPXA 3S2IA 1YWGO 4IDAA 3PHIA 1U3TA 3QHAA 4CMEA 1T2AA 5TT1A 2BFPA 4GPD1 3GMSA 1I2BA 3OEWA 4PZEA 3VVBA 4XGNA 1X7HA 3HDYA 5K0ZA 1H6DA 2FHSA 2NV6A 2XF8A 1ONOA 3BMQB 2V7PA 4WOKA 1JDJA 1N92A 3JYPA 5CFZA 1KETA 1PS0A 2I67A 4NNJA 4WNIA 3TPCA 4MO2A 4XYMA 3F6YA 1GY8A 4JLWA 1P33A 2ZKLA 1VJ1A 1V3VA 3ORFA 3QW2A 4HFJA 4P38A 2EP7A 3JSAA 3F5SA 1MC5A 4KUHA 3ZWOA 2ZB8A 3EHEA 4NIMA 1WDLA 4YCAA 3E82A 4YPOA 3RC2A 4CL8A 3WGTA 1HDYA 4AJHA 1I2ZA 1CQIA 4GBJA 4YQZA 5HM8A 1ZK2A 2HUNA 3IJRA 4E5PA 3AUTA 3W8DA 4BL5A 4N7RA 1W6UA 3E18A 3GVIA 3KBOA 5JAMA 1HYHA 1KEWA 1WXDA 2OOSA 5IDWA 4JXKA 3HUDA 3BHJA 3FI9A 5A05A 1PJTA 1P1FA 3QVOA 1K6IA 3D1LA 1EDOA 1V3UA 2IDZA 2WD7B 1VC2A 4WCFC 3TFOA 2G1UA 2PWZA 3Q1LA 3QWBA 4FD3A 2QRKA 2AEFA 3HQ4O 3IP3A 1P74A 3DBHB 3NTOA 5T5QA 2EKPA 4CM8B 1NQ5A 1FDTA 2YDXA 2J5RA 3RU9A 1OC4A 4ALMA 4Y67A 4H15A 4BOYA 1YRLA 3G1TA 1V8BA 2G0TA 2NQTA 1NPTO 4LSMA 4IIVA 2WYUA 2EF1A 1DIAA 4FGSA 4PG7A 2GLXA 4R1TA 5L4NA 4EZBA 1HE2A 1ZSNA 4XJTA 3OF2A 4D3DA 4RV9A 3FNGA 5BQFA 1FMCA 4ALLA 3RUAA 3TOXA 4MVJA 1P1KA 1M6HA 1NPDA 4N5NA 3VDQA 1UZMA 4W82A 1XQ1A 2O2SA 3LF2A 1PQPA 4TZKA 3SXPA 2PY6A 3OIGA 3E5MA 1T2FA 2QRLA 3BTVA 2CF6A 3AI3A 3KB6A 2ZB4A 4B8WA 2C5EA 2VTDA 3RC9A 1E7RA 1PWXA 3CUKA 2Z1MA 1WZIA 1ZK4A 3CZMA 1N7GA 4QO7A 1R0KA 2OBYA 1E1NA 5C5IA 1H2BA 1DFHA 1UXIA 1U5AA 2AQHA 4U7WA 5FI5A 1SCUA 3GDOA 3CMCO 3U3XA 4ZN6A 3PFWO 2G76A 5TQVA 1NP3A 1P1JA 3AM4A 4Y98A 4C4OA 1ENYA 1KC1A 2B36A 1ZBQA 1I2CA 1XYGA 4QUKA 3HSKA 5FI3A 4BIIA 3ZH2A 2Y66A 4MVJF 3LC1O 1H6AA 3FN4A 3AM3A 4YEDA 3Q9UA 4Q3CA 4WKGA 1KY4A 3GRKA 4RGBA 3TZHA 1C14A 3B6ZA 1TI7A 4MVJH 3RFXA 4MDHA 3SC6A 3TDKA 4XRRA 1NWHA 2PZLA 1DIBA 3W8EA 1UP6A 5IXSA 4JQCA 3A4VA 3ZNOA 5A1TA 2X0IA 3DBVO 2HSDA 3G3EA 4B4UA 5I8WA 2BMAA 4QXMA 4CQLA 1XELA 1ISHA 2OFPA 3EYWA 3ST7A 3CE6A 3KOUA 4R9SA 3GK3A 1HT0A 2NQ8A 2WEKA 4R01A 4LVUA 1TT7A 2X58A 2J3HA 5TX7A 1QMGA 4Q3NA 2Q3EA 4CMCA 4OKIA 2P9CA 4BGEA 4EEZA 1DDOA 4ZRNA 3RKUA 3FNHA 2PH5A 4KQWA 8LDHA 5IF3A 5U4QA 3TSCA 3GF4A 3H5RA 4CLOA 2VZ8A 4IY1A 1GPDG 4LK3A 3AOGA 2VZ9A 2X7HA 1WWKA 2EWMA 3L9XA 3RI3A 3V1YA 1M6WA 4W7HA 4D44A 3IUPA 1NVMB 2A35A 5I7EA 1ZCJA 2Y67A 2ZTUA 3F5QA 5IN5A 1VL6A 4FR5A 3JQ7A 5KJEA 3RFVA 1FDUA 1YONA 3QRWA 4BNNA 2QG4A 1HETA 4AVYA 3HG7A 1HWYA 4JCOA 4QSMA 3HN7A 4E3ZA 4YDRA 4L74A 1KEPA 1T1RA 5GMOA 4RLSA 3RSHA 5ER9A 3ZWVA 4PLGA 4PLVA 4MINA 5L7TA 5JYEA 2WMDA 4EW6A 4R4JA 5TJHA 3SX2A 2NADA 1I5RA 4G81A 1RM0A 1LQTA 4DYVA 3RKRA 4B7UA 2DPHA 4F46A 1A7AA 4IDCA 1FDVA
chains in the Genus database with same CATH superfamily
4I0WB 3DVAA 4Q1VA 4UUAA 4X1KB 4HRYA 4Y6PA 3RAJA 1QLHA 3TNLA 4PPFA 3M9XA 1KZHA 4B9EA 2FPPA 2J6BA 2XXAA 4NYMR 3T54A 1HLFA 2HT6A 3I2FA 5A5GA 3GRPA 2Z5VA 1SU6A 3HHPA 3OOEA 3PT5A 4FYXA 1Y6GA 2O7VA 1NHWA 4HPWA 1CIJA 1RAGA 1RT9A 1PD0A 4I50A 5J43A 1SK8A 1V3TA 3MTBA 4CUZA 2HFKA 3CG0A 1TXGA 1M76A 3CV3A 2J32A 2B8NA 3E9EA 3LK6A 3NEAA 4BDTA 2EW8A 1W0JD 3OM1A 4KW7A 5JCZA 2IY9A 3II6X 3C43A 4LY3A 5FR2A 4I4TA 3UWDA 2NACA 3OEHA 2A0XA 1F0NA 3WLEA 1WBBA 2QUZA 4QXRA 3OJFA 2H2WA 1XD9A 3NTLA 3H75A 1R6VA 3R3ZA 2HFJA 1AXEA 2X15A 1I0IA 2WR8A 1X14A 1XC7A 2C3OA 3PHCA 1N2XA 4MUAA 1O5OA 1XZJA 3P2MA 4G63A 3RGWS 3UJ3X 1BWSA 1A4XA 4QOIA 2XMCA 4DUPA 2HT1A 4TMKA 5LZ9A 3CNBA 3REQB 2GB4A 2GN8A 4H9GA 3P0IA 4X41A 1YB1A 2GN4A 2NVWA 4ZP1A 4E0BA 1B0UA 3P0HA 2I91A 3DDNA 1K89A 3F5MA 4EY8A 3ACBA 1DS6A 1AK2A 1Z18A 1CJTC 1KK0A 5KNBD 3GPLA 3E2IA 2Q4BA 4AKGA 2CLOB 3NRCA 2G70A 2GJAA 3C16C 4FZVA 2ANBA 3DBIA 3KSMA 4EWLA 3CNQS 2DT8A 2H3HA 4JLUA 4NECA 4CTOA 4Y7CA 5HNKA 4UC0A 4A8HA 2JAQA 3ENNA 3JWPA 4I4TF 1J42A 2VF7A 4OQNA 5CGQB 1XD8A 3RWBA 2PUJA 2RGRA 2R4UA 2GLUA 2A7QA 1DG1G 3ULKA 4GBMA 1RADA 5EVCA 3R3JA 3TVTA 4G25A 1L6RA 5EIBD 5TGZA 2K6GA 2O4UX 3GAFA 1NXPA 3VBEA 1S9HA 2QDKA 3OP1A 3SJCA 5LWQA 1IMOA 3CC8A 2DBZA 5DVZA 2RIPA 2Q27A 2VWPA 5SZHB 2HPVA 1JQAA 1O89A 5ILQA 2ID4A 1VE3A 3G23A 5CHYA 3V34A 4ZFNA 3D7SA 1HH4A 1VB5A 4FKMA 1LBIA 3K2EA 5KOJB 2GSDA 1YDGA 3OTGA 3DZ8A 4C0HA 2A0YA 2Z6QA 3CLKA 1DV2A 8AT1A 3FTEA 5J58A 3QY9A 2YXPX 1T43A 1XEXA 2WG0A 5AKLA 4YQYA 5IG2A 3L0IB 2V58A 1QVWA 3UGKA 1OBOA 3BIWA 4BVBA 2UXCB 2OCKA 5AQ1A 3BH7A 1EFPB 3R2JA 1JTVA 1XQVA 2VIIA 2VHWA 1BQ3A 5AVRA 1P0QA 3U39A 1X7ZB 3PC7A 4YTEA 2FQ1A 2R00A 4ESOA 1X1EA 5JJLA 3DAPA 3PQDA 3S2UA 1WD7A 5E6SB 2QE7A 2WPDA 4WLFA 1K8YB 5LQRA 1O0CA 1MDFA 1Y0BA 3FPGA 4KMRA 2C59A 1U2SA 1ODKA 2X40A 2AJDA 3A6GA 4L75A 1FCJA 2WILA 1SU8A 3FNFA 5FNZA 4EUEA 1H4TA 4U3JA 3IOBA 1GTG1 7ABPA 1FE8A 3DE0X 2NXNA 3DHVA 4QUIA 1MZPA 5I5GA 2DUJA 3MTIA 1C9KA 1B42A 1NUHA 1H0SA 5DM0A 2CMDA 4WV3A 3ZOKA 1VPTA 3V8QA 3KZMA 3BSWA 2CDCA 3AUFA 1EVJA 1ZD4A 2QU7A 3WLTA 1KMQA 1IY1A 1K88A 1TD9A 4BO1A 5B1YA 1XAHA 5CITA 1ZEJA 3STHA 4ZCIA 1JWAB 3EVAA 4IEIA 3I8OA 1GQSA 4LDQA 1YU6A 3RSLA 5BMOA 1NUUA 3D8UA 1L0BA 1H1LB 1U6KA 4MRVA 1Q2XA 5BQPA 2X4DA 3E61A 2J6CA 2FFRA 1R4MB 4G65A 1U0FA 5C34B 4B6OA 1U7TA 3NOVA 3AY6A 4Q3KA 1A96A 2IUUA 4YXWD 3U1BA 2UU9B 4R71A 3EMDA 3N6XA 4ZT3A 2V8OA 1RQGA 2CF5A 1E58A 4TYQA 5DNDA 4E5VA 1N5JA 3F71A 4XDZA 1VMDA 4OHRA 3NM4A 5G02A 3OZRA 1V1MA 1R50A 4HYYA 2ZSJA 1FPQA 2NYRA 3UAXA 1NMZA 3KIPA 5F1OA 1VKHA 5IT5A 2AFIA 2W6PA 1TGYA 2ZSEA 1LH0A 3Q12A 4RXTA 1RKUA 2YXEA 4HPXB 2OC9A 2VUUA 4AMZA 1XHEA 2EARA 2VZEA 2P2YA 4N5DA 3ZHOA 4RXMA 2DCMA 2AL7A 1XRRA 2EKLA 3GJRA 4B47A 1SVKA 3DDUA 4EJMA 3IQWA 1EWYA 2CLIB 1MR3F 4X8LA 1CZHA 4Z8XA 1P3Y1 1KYQA 5EIOA 5U1PA 3ZBUA 5A5DA 3FG9A 4C4PA 4CV2A 2CLKB 1GA6A 1VHWA 1DXHA 2FK8A 4I3FA 4DNQA 5JECA 4Q9LA 4G89A 3ZD8A 4RTKA 1E2HA 5ARBA 5DM60 4EHDA 1C4KA 1GAQA 1BE6A 2B25A 2C4HA 2CN1A 4JZKA 4O08A 4QQFA 3WNQA 3EXHC 3AFIA 4ZA2A 4OP1A 2BFDB 5LP6F 4C07A 3NBQA 5JZOA 3PC8A 4HUQA 1RZRA 4P53A 2R9VA 3B5EA 1NV8A 4YRSA 2GVNA 2B7BA 3ROKA 2XWPA 5A4MS 4HBZA 1JHRA 3VYSB 4KQXA 3UXMA 3X44A 5BY2A 1B2RA 3DL0A 3MK31 1LJUA 5JEEA 1PJ2A 2G9ZA 4WPGA 4AIIA 1GL9B 4IO0A 4RDIA 4RABA 1E3IA 3ICVA 2BFEA 4MV6A 5TQJA 4D42A 4WK6A 3TZEA 4J3NA 1J9GA 3CH7A 2D1YA 1A9ZA 3RJ9A 1KDRA 1I0ZA 2VF4X 2BIFA 1L5HA 1OLSA 2Q6VA 3MWKA 4XUDA 3UJ8A 2GVDC 5ITZA 3KU4A 2PZBA 3QWHA 2FVXA 3HEAA 1GKKA 1S4MA 2CCGA 3C8MA 7YASA 1AU9A 1X3LA 3CW8X 3NBFA 2HBZA 4WN9A 4EATA 1OH7A 1PV2A 3FCAA 1DIOB 2RC6A 4DF3A 1SOVA 1XKLA 3WZMA 2B9EA 1IBKB 1ABBA 5LCXA 1N75A 2OA0A 3RVOA 5GONA 1IVYA 1IOVA 4HRAA 2YY6A 4QAJA 4X97A 1NURA 4EUKA 1O4VA 2G82A 4MUNA 3W1EA 1MAUA 1UXOA 3PVCA 4LI3X 1O08A 1Z12A 4NMXB 4R2MA 5FEMA 5HFJA 3TSYA 5BQXA 1NE2A 1O54A 1PZHA 2I9PA 2V7VA 2Y2UA 3LGSA 2B4TO 3HKDB 3OFVA 3QHPA 1SBYA 4KPGA 2I7CA 2CD7A 1DEKA 4IIBA 4P32A 2ZREA 1ISPA 2AC7A 4OIFA 5DW3A 4NDZA 5GWXA 1OR8A 1Z7GA 5HKLA 4N7JA 3W34A 1DXYA 2F4VB 2LRHA 3GX1A 5DPMA 3RIEA 1QCYA 4BE4A 4ND8B 3CUSA 4DIOA 3LXRA 2A5GA 5I7OA 2XMGA 4O2AF 4WZ6A 1KNQA 2BH9A 1E1KA 1HSOA 3VKGA 1JG3A 1LPSA 3EG9A 3JQEA 3QVJA 4DV3B 1LX7A 1YKFA 1ZL0A 1G98A 3HMQA 3WL6A 3FWKA 4B4WA 4B6EA 4CIYA 2NO7A 4M2LA 5HPYB 3R5SA 4ZPXA 4CM9A 2ZB3A 1Z68A 3FMFA 3OG9A 4UNNA 3CTMA 5CA0F 4YT8A 1W30A 3TDNA 2PZGA 1D03A 3EXFB 2ZUEA 1EFRA 1BMDA 2C2GA 2FUKA 1MPXA 3Q2KA 4OTZA 4W7IA 1QBKC 5J9FA 2CBXA 2QZZA 3F2VA 3PX3A 1AK1A 3AU9A 3BMOA 3U17A 1T6XA 3V97A 5BN1A 1JEQB 5AI6A 3HFSA 1RIIA 2J0UA 4YYEA 5KDDA 2W11A 3N2KA 1AKUA 4AJLA 2I54A 2V45A 1ABEA 3MT7A 4K6HA 1JIKA 1K7EB 2XUFA 2ZK7A 3OZAA 3RRZA 1KZ9A 2DP4E 3TMYA 3UH0A 1Y63A 2DHRA 4FYHA 4FMCF 4EHFA 3N5CA 4HADA 3DL7A 2ORVA 2QZPA 3GA0A 3KXLA 4JVMA 4K88A 1WF6A 5F3RA 2Z5GA 4KVZA 3CPHA 3RVDA 1C3LA 1I5OA 4CW7A 4EZIA 1HNZB 1QH1B 1VLZA 2ZQZA 2UUCB 3AVTA 1LDYA 2EBUA 3SSMA 4ZMRA 1AGNA 1C81A 1CBUA 1KL7A 1RHUA 2PFKA 3OX1A 4ML3A 1E2FA 1Y9AA 3E05A 3VC2A 4O5OA 4RZ3A 1SB9A 1W5FA 2XADA 3G2OA 4ETIA 3LPMA 4XR9A 4MS4A 5BV8A 3O90A 4G36A 1FTYA 3GUUA 3FGOA 4UHBA 4ZWNA 4Q34A 1LBTA 1BFUA 3WGMA 1LX6A 3EZFA 4MR8A 4TWZA 1YE5A 2V4UA 4X93A 2YWRA 4PN7A 1O9GA 2CNNA 3KYCB 1NZDA 4IQFA 1QZ3A 2DR3A 1W47A 5DHFA 3KV3O 1GCOA 4UDYX 4DWJA 4K6KA 5JZVA 3RF7A 4IQ4A 1OC2A 3O8CA 1ATIA 1Z7WA 4P7GA 3ABIA 3NIFB 5LXTB 2R97A 4FK8A 4BAUA 3HRHA 1FQOA 2YZNA 1JYEA 4KFUA 3EXEA 1F2TB 4NJMB 2VFAA 5FYDA 2PRZA 4N8DA 2CUNA 3FDZB 4KO3S 2ONJA 3W5HA 3WKAA 3OZDA 3H9QA 1LA2A 4KLRA 2WVJA 2OB1A 1WNTA 4MVJD 1ZJ5A 3WWYA 3RFTA 1Q95A 2OE2A 3H3XA 5M3BA 1AGYA 4XQEA 1HUQA 1N5KA 2DKOA 1X7YA 5JSFA 2RAVA 2G88A 1VLLA 3N58A 4CMIB 4OQYA 5T6BA 1SIUA 4F5ZA 3VNAA 2XJ9A 5F78A 3X1MA 4I55F 3DLBA 2BAGA 4K9DA 4LHSA 1PYOA 1JEAA 2FRXA 1FOEB 1KKLA 1PGQA 3X2EA 3ZDBA 1FVXA 2XQIA 1V4VA 1ZI9A 1JW9B 4WFQA 4CRWB 3GRCA 2AEJA 4EHNA 6REQA 4K1XA 5CHEA 2RGUA 5FPTA 4TLAA 1F60A 1MENA 1W5AA 3JATB 1WU7A 1ZGGA 4U4AA 1TO1E 1FP6A 2JIMA 4J94A 1BKYA 2D8MA 1XMXA 2DTDA 1UDRA 3RRMA 4EHBA 1WXGA 3DMHA 3PXXA 2ZCVA 3HLKA 4NCBA 1FFEA 2QKYA 1WMFA 1CUJA 1E1RD 2EL9A 4HUJA 4LQ4A 3DZGA 1Q22A 2ZRLA 3TNDA 3ZVMA 4LSZA 1ADGA 1P75A 1FNCA 1GNQA 4CG1A 2YQ4A 3C74A 4P2BA 1BXKA 4R8KA 1JHPA 1D8TA 1NLFA 1R8SA 4PM4A 4BX0A 1TLFA 1LFAA 4PZZA 3RYCA 1Y4SA 2OCXA 5IK2A 1FSGA 1CHDA 4HN2A 3L7JA 4O4JB 1SBNE 5JPCA 2ZTSA 3Q7IA 4FGZA 1MC4A 3MJVA 3HCBA 5TRTA 3L0YA 2C82A 2XWSA 4P3PA 5EXTA 3FZNA 1GYQA 1XAJA 2Q21A 1JBEA 1B93A 3NUZA 1CUXA 1GPH1 3A70A 3V4SA 4AXBA 1QYIA 4Q37A 4CODB 1KVQA 2BZSA 2OPHA 4DM4A 4YALA 5KYUB 3QNWA 5KKCA 3V80A 1ZWKA 1A9XA 1ZIPA 2IYLD 4O8CA 5FNVA 4KVFA 3PHHA 1BAPA 1UMBB 2P8JA 4OXQA 2JFBA 1AV6A 4R3NA 3RABA 3JR3A 1QSGA 5CPFA 4D3XA 1QH8A 1QX4A 1EHYA 1NRJB 1IFXA 1Z0AA 2MMCA 2P3SA 2P75A 3H04A 3G2KA 1TF5A 4P7BA 4F45A 5C35A 1T5SA 4L4SA 4RMIA 2BSXA 4YP1A 1M7BA 2L0XA 4B3MB 2GK3A 1PJQA 2DWQA 2N3ZA 3QBEA 2OM6A 4TVOA 4AUMA 5KWEA 1SCAA 1QHHB 2I2AA 1SB8A 2J9YB 2WHRA 2ZZKA 5JSZB 5K0CA 5IVKA 1G5IA 2G17A 3SNHA 4OCZA 3T5AA 1B1AA 3CYFA 3C3BA 5EGNA 1R0WA 1LBQA 4YUZA 3TLMA 3FWYA 3G9XA 3N5KA 3RVQA 1G5FA 3TTXA 3ZE9A 3QKRA 1GPJA 4IJKA 4ZTBA 1BSVA 3QEBZ 1QRAA 4OFBA 4R2HA 4YQEA 3WLOA 4CJXA 4E2FA 3AR4A 1G8JA 1RI1A 3E7FA 5DP1A 3LU1A 1HEIA 2V7TA 5LYYA 3MUFA 2PDAA 2ZI5A 4MA5A 5JZBA 2ZDGA 3F5FA 3GDHA 1OU0A 4L8VA 4HNGA 2O3UA 4PX9A 3DZFA 1P0PA 1A5TA 2J9FB 2AJTA 4WGGA 2ZAOA 5FWYA 5HJ5A 4Q39A 3EDMA 4YBRA 3PFNA 2W93A 2YOHA 3E58A 4CKZA 1GUDA 3TIXB 2DHQA 3AI2A 2BH2A 1LQUA 4BV8A 1IHPA 1ICEA 3MJSA 4KACA 1IUKA 5C8XA 4MDFA 3WG9A 1ZHOA 2IHZA 4AL4A 2QENA 5G1PA 3FUXA 1EFRD 2DPXA 2DBQA 4URUR 2WFAA 1W36C 5HRCA 1DJOA 4U7PB 1V8FA 3DMGA 1QAMA 4ZVRA 3TQCA 4DY4A 2JD1A 3H1GA 4JT8A 4IIGA 1E2MA 2OSBA 2ZFUA 3IPXA 2AC2A 3L8MA 3MTDA 3U31A 1T0IA 6LDHA 1SEVA 4YRNA 3GCDA 3IOEA 5F4BA 3EFEA 1YFLA 3LXMA 3CNNA 1C9EA 1OF1A 2B94A 3HJCA 4BB6A 4DA9A 4TTIA 1GPUA 1S6YA 2FY8A 4WZBA 2XI4A 2GYUA 2H85A 4GIBA 1ORTA 4HMPA 4L8GA 3DXZA 1QWSA 2VCYA 2R6CA 4MGZR 3WLNA 3C5CA 1GNLA 5JO9A 5T3UA 3WHIA 3MHTA 4LHXA 1WHTA 4E4RA 1UANA 1PFQA 1PJSA 4HGPA 1PVDA 2O7QA 1P39A 2Q46A 5HYVA 1QFJA 3Q8LA 3S70A 1DQNA 3E48A 2XTJA 3AEUB 3F8SA 3RS0A 1TW3A 3QBJA 1DXQA 5ED0A 3I39X 3CZAA 2VHYA 4OA8A 1GG5A 4XGRA 2PO7A 2NTVA 3ISJA 5EOVA 5HTKA 5AW9A 3WGYA 3Q9SA 5DHSA 3N8KA 1JDBB 1WMAA 5FOQA 4C03A 3AERA 1I3LA 1RYBA 3V5NA 1G6Q1 3NG1A 2FYTA 4HVLA 5JHHB 4QYIB 2IXAA 4EARA 2NP7A 1YASA 3W2HA 1G4AE 1SBTA 2VATA 3RUHA 3K6SB 4NMWA 1B8NA 3BSFA 5COBA 2QT9A 1CW2B 2HZBA 4D9NA 1OZGA 121PA 1U3FA 1NVBA 3VTAA 1Z73A 5FEUA 1QGAA 1U3CA 1KIMA 1UBLS 1QNLA 3LVRE 4J75A 4NJOA 1UM9B 4ON9A 4Y0NA 1XZ8A 2GEKA 3HVIA 3KOOA 4NHEA 3V4OA 4BWGA 1TEZA 2CUZA 1H8EA 2O05A 5KTOA 2P2CA 2JIDA 4MQUA 1D6JA 3EIXA 3IPCA 4UUMA 1I7QB 3IKLA 4Y2UA 2R87A 4ER6A 3BSSA 3WFIA 1K7SN 2O8FA 4K28A 4NQRA 4IQ0A 1OTXA 4DAEA 1MH1A 4BJHB 4Z7QB 1QDLB 2QTTA 2DGDA 2GMWA 3L6DA 2OLJA 4O0MA 4GP7A 2G80A 2X86A 4XM0A 3FZGA 5HJ7A 3BE8A 3NAGA 2C0CA 2QM7A 4LXUA 1EK6A 2KE5A 1JH9A 3C3AA 4M9QA 1XRMA 4E5YA 4OQLA 4DMUB 3NIWA 1F6BA 3CONA 4IFTA 1QHHA 3TXXA 1TO2E 4D79A 4WZAB 3BMQA 2FQXA 3UCEA 1TYZA 4ETMA 4AG3A 4JJEA 4DABA 3BIOA 1LC3A 4R1SA 5DN6D 3EEOA 4URYR 3QPVA 1INLA 1IOLA 4YS6A 2XUPA 4DBLC 1KZYC 2RARA 5MN6A 3PQ8A 3ON5A 2ZPUA 5J4HA 3TE7A 1GV0A 2BCGY 2FCRA 4JA0A 5AVSA 1D3AA 4TXHA 3OSUA 1MAWA 2DJIA 2WJGA 2D7DA 1E0KA 1R6XA 1USIA 3EZXA 3RSZA 4YRZA 3TRKA 2OO7A 5DFAA 1M2VB 1SNYA 2IXBA 4GOND 3FJ1A 3RJTA 1JVBA 5BSMA 3U7QA 1EVQA 4JJKA 3FUVA 4UVDA 1SELA 4MS3B 5CJPA 3D0KA 4GF5A 5E4TA 2OXIA 1N1MA 5CFQA 4UEKA 2PS1A 1IQ0A 2QW1A 3MERA 1TM2A 3VU3A 4QDXA 1EHIA 2X5XA 3SQLA 2BTQB 1YJXA 2JIBA 3VRHA 2OG1A 2CT8A 1KY3A 4CV1A 3FRJA 2P9TA 4IMRA 1T2NA 2XA2A 2PO5A 2DQSA 3E22B 1RJGA 3IHWA 3KBBA 1CLUA 5K51A 1EAMA 4S1NA 4K9QA 1UK6A 2VEOA 1F4VA 2QD1A 2P77A 2ZUWA 3HXLA 3UJAA 4ZTZB 1PGJA 4DJFC 5GZ1A 4UW9A 3IQZA 2PU7A 2VJMA 4TLBA 3PNPA 5E3JA 1IXKA 1UZLA 3W05A 2A0KA 4CF5A 4EL5A 3K7EA 4JC8A 4HQRA 4YCMA 4RORA 3LHIA 3ZHSA 3IR6A 3FSGD 2FK7A 3MUEA 1RZ3A 5AJUA 3U5TA 1ZH0A 3EASA 4D4KA 1Z36A 2IT1A 4A73A 2JGJA 2VSNA 2VYCA 3QIVA 1GIAA 1NOJA 2ZXFA 2W2KA 3SHTA 3HXMA 2VH5R 3WYGA 4D0NA 4QDOA 1U94A 1BMFD 2BFDA 2Q5OA 2QGZA 1FQWA 1N5OX 3B3FA 3HB0A 3OZVA 2HQOA 3H5NA 4HGQA 2JLWA 1G17A 4N0PA 1U3WA 1FDWA 4HH4A 3EBOA 2VO1A 2HY7A 1XL1A 2BEWA 1TFRA 2GAIA 2VXBA 1XA0A 1ZY2A 3NU1A 4KE9A 4ZK2A 4OXKA 4R1PA 2PSHA 10MHA 1ZONA 1G5PA 2FR0A 1PK8A 2PGJA 4KNWA 5H3HA 4D46A 3L40A 1HQKA 2EXXA 2NUPA 3PQ3A 4C43A 2C5GA 5G0SA 2CL7X 1BA3A 2OD2A 4X66B 4TPKA 3AUYA 2GZSA 3L01A 1I4DD 3O1IC 3OY2A 2NZJA 3EA5A 3A06A 4M6WA 3CVXA 3CE9A 3ZH9B 4AI6A 1SKAA 1TMKA 1Q0UA 1Y9DA 2I29A 4P22A 4OD0A 1PQUA 2LCIA 1PFKA 4E08A 3QF4A 3DWFA 3RVJA 4FE4A 3ORQA 3PFGA 2A1UB 2FSSA 3JQGB 4Y6OA 3RCBA 4C2AA 2CFRA 4OP3A 1UPFA 2I78A 3L5OA 2AWNA 1M9NA 1X2BA 3FE2A 1IRIA 3SBOA 3ICWA 4N47A 3WB9A 2ODTX 3LT1A 4WDQA 3V46A 1DBIA 1RHKA 2V97A 4YDQA 3VV3A 4F38A 5KTYA 2RKBA 2YIVX 4B3HA 2PN1A 4FM9A 3NCTA 4IH4A 2ZRAA 3NEPX 4KIGA 3HJBA 2NU6B 3A1UA 3JQGA 4MOWA 4ZU3A 5CT9A 3ADBA 2QZSA 1RBZA 2DFKB 4X6LA 1H0KA 5BOVA 4ARSA 4K9OA 2X2OA 1JMVA 1JN0A 3VR4H 2JFNA 2H0RA 1SKYE 4ZQFA 5IYZB 1BCSB 2BM9A 2JCBA 2C0QA 2R60A 3MIIA 1T36A 2DF8A 3I83A 2OHVA 4K9KA 4L2IB 2Q4RA 3BD7A 4ZGGA 4R16A 4CM9D 3JV7A 4OUDB 3FNEA 3TZ6A 4I7EA 3IP8A 1MVLA 2BJHA 3GR6A 1RABA 3ENZA 1XZNA 3IHKA 4E1BA 1I6WA 4Q48A 1RCUA 2MIIA 4ZCPA 4ID9A 2VHEA 1WBJB 1PR5A 2XSZD 3CY6A 4B83A 1T36B 1K7CA 4AY6A 4PCAA 1YDHA 4JKOA 5JAZA 4IFBA 1BQ4A 4MMZB 4O0LA 3LOUA 3IE2A 2ZEJA 1WKCA 1Z0KA 3JQ9C 3VNQA 2QP3A 5CGZA 1B6TA 4EVRA 1QE5A 2ZTLA 3AINA 4F2WA 4QRHA 1GDTA 1PNRA 4A2CA 1Q3HA 1GGNA 3O2NA 1VLMA 1WSWA 3IODA 3AP3A 3LO8A 4AP9A 2FWIA 2W90A 3BD9A 3BF7A 3MRVA 3TZCA 3G0CA 2RHWA 3PK0A 4H31A 2JCYA 3UAYA 1RIFA 2Y4NA 1QZUA 4IXTA 3WP0A 3RAFC 4J7UA 4KXQA 4TV9B 4ZJPA 1HT3A 3TKYA 5DBHX 2QI9F 1PR1A 2C8LA 2HD4A 1NYQA 2Z6VA 1CSEE 4CBVA 1N4DA 1BQEA 5EKXA 3B12A 3L07A 4UU0A 4FTWA 3RR2A 4BKPA 3HYTA 3WLRA 2RGEA 1CULC 4GKBA 4A8JB 1QO0A 1CQIB 1JHVA 2Q3JA 3DLAA 1XCJA 2ZS9A 3JS5A 5K6AA 4JB0A 4JODA 2KW5A 2HF7A 1WPRA 5JNVA 4J9VA 4QAQA 2VTBA 4I8DA 3WQBA 1ADBA 1O94C 2ACEA 3D6MA 1CR4A 3OQBA 3E03A 3QGMA 4RPIA 1TKBA 1W4RA 5GJVC 3G13A 4BIMA 3W2EA 2OV2A 4MH0R 1CX9B 4G5XA 3A9WA 4KOEC 2PWBA 3GBSA 1BTOA 1RVV1 2FPSA 4I3GA 4BNTA 4BTVA 5A4KA 4PO1A 4YT4A 1U7HA 3GIDA 2KWIA 2GEUA 4P84A 1QRUA 1AKQA 2BKEA 4R1UA 5EJ4A 4HX9A 4GVXA 4N6OA 4KX3A 2EGHA 1K08A 3O6VA 5K3BA 1XCPA 3QXJA 1J1UA 1TF7A 2R11A 1W85A 3SAJA 4G8CA 1TUBA 1W4LA 4MYUA 3AVVA 4U7HA 3MMZA 1V5GA 3UNXA 2HCRA 3WWCA 1T24A 4U0JA 4MYCA 3L4BA 1ADJA 5IBPA 4IHQA 4NSNA 3EAGA 4F8JA 1KDYA 1RZVA 5G40A 4U7DA 2O2XA 4Q1DA 1G38A 1NXWA 3DPUA 2V7EA 2PYZA 1RKVA 3KQPA 5B1HA 1TUBB 1X94A 4ZKDA 3LBAA 3QENA 1SHLA 2IHYA 4RNCA 1RBMA 3W06A 4RZIA 3ESDA 3QKUA 3AUSA 4LMPA 2LIPA 5A4AA 1ZD8A 3NVKI 3COVA 2DPLA 4KSYA 4QUAA 4D7AA 5BSVA 5BOSB 4KKXB 3PJRA 4OI2A 4KO1S 1IATA 3V1LA 1QFMA 3VC3A 1GA1A 1L7OA 3SK0A 3FMOB 5EWMA 2OCBA 1Q0RA 2GCOA 4H0NA 5GGYA 5H80A 4A82A 1M2HA 2Z2XA 3ANMA 5AI5A 1OFIA 4CCSA 2GHTA 2V9CA 3VOBA 3IIEA 4FB4A 3L8HA 4RZHA 4BLPA 2POCA 1QKKA 4AJJA 2QRGA 4EA8A 2D1SA 2WAYA 2C5AA 3KALA 1R9MA 1VPDA 3IHLA 4IZOA 3WWDA 2EFDB 2WD9A 3DOEA 1J21A 4K05A 1UAYA 1TVMA 1ZSYA 3ZCRA 4DLWA 5A0TA 3M5PA 1DEXA 5HR5A 1GL7A 1DCFA 3S2FA 1EFVA 1BFDA 3UOWA 4ZOQI 3QLUC 4EY7A 4AZSA 1EQ2A 1A77A 1Y9ZA 2X13A 3IUJA 3R7AA 5DNYB 1WUHS 3BXPA 3PIRA 3M8KA 1FDIA 2YMQA 2D74A 2JFFA 2ZUVA 3VR4A 2GN6A 1WU8A 4LAFA 1L8QA 1T4CB 2I2XB 4PBSA 4J6FA 3C6YA 5A04A 5A5FA 4NU6A 4GDFA 3CURA 1NNEA 1C7QA 1L7QA 5AXAA 3KLBA 4E2YA 1OI3A 2D2FA 4OMUA 1TAQA 4ZT6A 1NONA 3DEKA 4JYPA 4QUJA 4EKGA 2CMHA 4Z1MD 4JIGA 1HSZA 2X9QA 3M5CA 5IJ0B 3RRYA 1EVLA 4LZNA 3TCXB 1PNOA 3GQVA 3HBFA 3N8HA 3PRYA 1J2RA 3L4SO 3I9JA 1IWPB 4Q9NA 1P2FA 3BL5A 4J0FA 1V37A 1H2WA 2GTHA 2VHZA 2VOJA 1KJYA 4PS1A 5DWVA 4LZPA 1JAYA 1PSZA 3H6KA 1FEZA 1RNLA 1YMVA 4FR2A 4TTVA 5AJXA 1QH0A 2XUAA 1DC8A 3EY4A 3JTMA 4JUIA 2JI6A 5DNUA 3RG8A 4IQ8A 3PUVA 1I2AA 2ZJ8A 3EMVA 4X1YA 1MA0A 1OXUA 2WSMA 3H1TA 4C2TA 3IL2A 2H59A 2WHXA 4TSFD 3MOGA 2IUSA 5I7UA 1EM8B 1N3YA 1YB5A 1G42A 2QYSA 3JWIA 1M5UA 2VYVA 3HR8A 2GTIA 2MYTA 3PWTA 3AZPA 3OOHA 8ADHA 3JVDA 5JD5A 3KYCA 4QX6A 3PEYA 1EGMB 4UTNA 1HLDA 1QH1A 3GA5A 1LDNA 3CXRA 2NPOA 4H35A 1SOWA 4M1QA 1B6SA 1Y4DE 1JLKA 2B30A 1N9GA 2B7CA 2ODWA 3ABQB 3HXTA 3WYNA 4BQRA 4C4YA 5J2UF 4XLLA 5ALXA 3TBFA 3WJ1A 3HKCB 4B8YA 3KJIA 5T8KA 5G0UA 2BCEA 1ULUA 4HX5A 2NZ8A 4RACA 2JD0A 3ONNA 4YJKA 1JG2A 2H18A 2I4RA 4RK0A 2GZ2A 1SHTX 3VDRA 2IZ6A 3NBYC 4Z4GA 1UINA 3G8CA 4BVHA 3OO0A 2H16A 3Q7QA 5GP1A 4UBNA 1MX1A 3MJHA 4OB7A 1E8DA 2ZSFA 1ULBA 3EZ2A 2X2PA 1U8FO 3UT6A 4B3RB 4MV7A 4K6FA 5J4YA 3DZBA 4Q47A 3GV0A 3KCNA 4RMJA 1U9CA 5FBZA 3BFKA 3A31A 4UCWA 2J9GA 2HKIA 1VIYA 1G5HA 2HEGA 4GQIA 4I99A 3DXYA 2ZRGA 1KORA 3AFHA 3ZY6A 2C7QA 1QR6A 2J1LA 2YW9A 1EH5A 1G3RA 4PYIA 1MT0A 2CZGA 5CRIA 1I8TA 1XAIA 1DCTA 1ZIXA 4RVDA 4G0UA 2IS4A 2O3TA 4CTNA 5BNIA 4W5OA 2PGOA 2Z5LA 1I3KA 3SSNA 4YK7A 3DAHA 4FINA 5D2CA 4CQMA 2R2AA 5DNVA 5K0JA 4MB2A 1SKUA 3I6ZA 3K2QA 4RY8A 3QX8A 4YCCA 1GAEO 1HORA 2QT1A 3TVDA 4ARCA 1GG8A 2ZSHA 1C7IA 5KBYA 2GF9A 2GH1A 3I3SR 3AVWA 1O2DA 1MQ8B 2FX3A 3K4PA 2A6PA 4YH1A 3CUTA 3O94A 4FMBB 3S3TA 1HM5A 2EG9A 2H5EA 2R1TA 2WM8A 3TM5A 5C32A 1SMKA 3M9LA 4TM7A 2QMHA 5DW0A 4ZXFA 3SLGA 4B6RA 1FRNA 4B80A 5K8VA 4WEOA 1W87A 4MPRA 2ATVA 1TT5A 2GN0A 3IV9A 3EULA 4DC0A 4XIIA 4G4JA 2A30A 3JTEA 2V5UA 1CJBA 3HU2A 1JHZA 1FTNA 4HBGA 4NC9A 4QC2A 4D9KA 4DUGA 4F9GA 3C3XA 4LOLA 3OIFA 4KIUA 5IC4A 3UT0A 1NW4A 3T1VA 4G0MA 1ZXBA 4V0OA 4BMYA 4NU0A 4Y2PA 4COOA 3K09A 3BMNB 3UB4A 1JXQA 3V3KA 5M04A 3DTNA 5KMGB 4EMBA 3RSGA 2CZQA 5FNVB 2AOXA 4I9UA 1ECBA 5AVJA 4PYLA 1R8QA 4M7PA 2QA5A 1NM5C 2VCEA 4ND3A 2FW1A 1CZUA 1T0UA 4N1AA 3HLYA 4C6TA 1XUOA 3NHBA 5JW6A 2IHVA 1FXWF 5HX7A 2WIBA 4FYVA 3V7FA 4DGSA 3DZCA 2W6ID 4L3WA 4PPGA 2ERXA 5F7OA 4MZDA 3HBAA 3K73O 3TH5A 1DKMA 3AW8A 3H9EO 3KTOA 5DM4A 4M46A 4TSRA 1J2EA 1GAXA 3B82A 2H07A 4U7GA 5HMMA 4DWWA 2W2PA 3M9WA 4B6FA 4JUBA 2PL9A 4BRWA 1C4OA 2ZI4A 3VU1A 1EA7A 1AUXA 3UUGA 3ND9A 3SQWA 4M0DA 4B4DA 1FVHA 4J1QA 1TPZA 2DU8A 4OA5A 3SMQA 3HNOA 2OCPA 1ZI6A 4KV9A 2HM7A 5CLFA 4C5AA 3L6BA 4WCFA 3D8RA 1DAHA 1JIVA 4Q3LA 5HRUA 1PI3A 3RVPA 4L3OA 1OLXB 1VCMA 2IVFA 4NQZA 1HFWA 3B3GA 3O4HA 3AR5A 4IXWA 1C0LA 4PZDA 5E8JA 2WG2A 5HQJA 2ZS7A 1JHXA 2V98A 5CFRA 1B2LA 1O9HA 1T9BA 2ZYWX 2XHZA 2ZYDA 4CMKA 2HQBA 4GEGA 1WHSA 3FSGA 1O6FA 2SBTA 4R31A 1YBHA 1KSHA 5CDFE 3V2UA 3NETA 1Z38A 2DYKA 3KDSE 3R5JA 2VLBA 4ZT7A 1JFVA 3KL2A 1MG0A 4EA7A 1DPFA 5TQ2A 2HQ1A 2R7NA 2OTCA 3C7DB 3OQIB 3F96A 4F4CA 2M6LA 2NUBA 1SXHA 4ZOBA 4OL9A 4DADA 3GLIA 4HLDA 4UM9B 5FX2A 3FPJA 4UE2A 3GLTA 4JGBA 2QG6A 3R44A 4WSOA 5CA0A 4QGSA 3TPZA 1Y3BE 2ARKA 1PIWA 4LXXA 3WR5A 2B5WA 4L07A 2PR7A 4Y2HA 2J7PA 4MVYA 3VI4B 4BNIA 4RULA 4R3UC 4BNVA 3K8ZA 4OQMA 5JBIA 1PW7A 1U0JA 2XDYA 2K5UA 3S7TA 1QUEA 3DBLA 5AW6A 5FOXA 5A4JA 3VHQA 5ICMA 1F2UB 3GBVA 1CT9A 1P7CA 1J5XA 1SO8A 1GSIA 2CVHA 3TIGA 4Q3AA 4XWKA 4OFZA 3IT1A 4W6ZA 2BFNA 1YC5A 2VJOA 3DYBA 4YP6A 3OZTA 4IYJA 3SYRA 1JBKA 1IBCA 3P2KA 4G5HA 1GOTA 4OV6B 4LGMA 1V5IA 4PG5A 1DJLA 1YZQA 1EJ0A 1TU3A 3GGOA 2IYSA 3HJGA 3TNJA 2BFBA 3RFCA 4M1WA 2NXEA 3ISTA 4YC7A 3B9QA 2Q3FA 4OI1A 1J0DA 4MP3A 3SYNA 4EJ0A 4ERXA 3JD2A 2GD6A 5BSFA 4W99A 4NI5A 4QBIA 2JW5A 4U2CA 1UWKA 4URFA 3HFRA 2ZIFA 3NLLA 2IU3A 3U0VA 3UJNA 3I6YA 2YOFA 1N34B 3HDVA 1G18A 4Q7EA 4BX2A 2V65A 1AHIA 2X41A 2PS3A 3E7DA 5DGCA 4TYWA 4LFCB 5JXWA 4ER7A 2DQYA 2FSPA 2R6R1 2E3JA 4N9WA 5LQMA 2QT0A 2HPAA 5ENVA 4X92A 1S2DA 4XZ3A 1Q21A 4P1ZA 4WIAA 1BN6A 4KXYA 4WDRA 3B1JA 3T41A 4LJ4A 4P3KA 5L95A 3OA0A 5IJXA 3DEIA 1NZJA 1PJ4A 1V0JA 2DFNA 2Y71A 5E0OA 1Z06A 4PRYA 3GEHA 5ITWA 4XKJA 4UHEA 5KIAA 1NMSA 5FWXB 3CZQA 3HBLA 1T5DX 2C84A 2OC4A 3L18A 1U8YA 3I9LA 1RC1A 1JEDA 1D9XA 1PYDA 1UUFA 2D1RA 2I76A 3HKBA 3K31A 5HCUA 5DYIA 4DNOA 5C8DA 4QECA 4URHA 2HIAA 4U8HA 4YAOA 4AULA 1E32A 4OPMA 1PQYA 4V3CA 1J7JA 4HDOB 4ZRDA 1S8AA 1WR8A 2ZTMA 1GLVA 4KR0A 4RVSA 1L7PA 3PHJA 1GKIA 2UAGA 3QKTA 4DTIA 3E53A 4RTNA 3B53X 3IDQA 1ZQ9A 4LTMA 5EPEA 5J47A 1J39A 1T5BA 4TS1A 1W52X 4FIZA 4RJLA 2WKQA 4KHZA 1I14A 4BVLA 4CYMA 4YWJA 3VNSA 1BGVA 2G5TA 1KK1A 3IESA 2MCFA 5BRJA 4BQSA 4RCVA 4B73A 1SG9A 1E9EA 3TL2A 2WC1A 4HUQB 4LYYA 5CIWA 4AJIA 1O95D 4FYIA 1YS4A 2H8KA 3OLXA 4MP6A 3GMTA 1A8PA 4V0NA 4YV0A 3K0AA 1GTZA 2CFCA 2CMKA 1UPBA 3AT1A 4BP9A 2XRMA 3KXDA 3L1IA 2NX2A 1A98A 1JKJA 1V2GA 3DMRA 3T1NA 4ZYUA 4JXXA 4I8IA 1SUIA 4MPDA 4B4VA 4X20B 4KTVE 1MW8X 1ESEA 2HO5A 4KQFA 3ONWA 1I24A 1SBIA 3HY6A 4JEMA 4PQEA 4KYIB 5FPKA 1ZRNA 2Z4SA 3MCZA 1N2SA 2I4NA 3NALA 1YBFA 4TVSA 3WZ2A 3HXQA 3PT9A 4IGFA 3GEIA 1CE8B 4BDSA 5BQ3A 2QQEA 3KJNA 3BZUA 2P9QA 1UFOA 4L95C 4D74A 1G3QA 2XZLA 4BU0A 2Q4EA 4DEXA 3D2BA 4OO3A 4PPNA 4LXGA 5DT2A 5JV5A 2FMIA 1KYWA 2AOVA 1O57A 1V6CA 2K2QB 1RU3A 3QU5A 5KNLA 1FJGB 5C8VA 1FFHA 4BP1A 1CVIA 3CEPB 3U4CA 5F9HA 4R5MA 1IB6A 1K27A 4K8RB 4XLTA 2NMVA 5KX5B 5HF9A 1M72A 1Y42X 3LX6A 4DDTA 1LI4A 3N0WA 4RAOA 5BRAA 2L17A 4AM8A 4LHVA 4ZODA 3SBDA 2QSUA 1NUTA 1IU9A 3UAVA 3UFXB 1ACLA 1GSHA 4LNHA 3ZWKA 3THXB 4ZT2A 2CJXA 3ZE6A 4JGGA 1G21E 2PX3A 1N0UA 3QITA 3AEYA 4CM3A 3A1TA 5CB4A 4TKLA 4E94A 2HK8A 3V8MA 3ICPA 1V7QA 4CF6A 5CDYA 5C3MA 4JQOA 4PCUA 4IM7A 3NDBB 3VVLA 4MGIR 1MDBA 1P31A 3UK6A 5EIEA 1T2DA 1GGKA 2RAUA 1E4EA 2XMPA 4J0DA 3S29A 1EVZA 4F3YA 2C29D 4PHCA 3PJGA 3O8QA 4QU8A 1KE2A 3ANLA 2PH3A 1ZUD1 2XNDA 4MW9A 3HYRA 4HKTA 2FOLA 1L5KA 2GF0A 3V1UA 5CBKA 3MCUA 2BGWA 2QUIA 2VPZA 2VJAA 5AUNB 2XZTA