5DP1A

Crystal structure of curk enoyl reductase
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
332
structure length
332
Chain Sequence
DQPVQLKLSEYGVIDNLNWQPMQRKTPLANEVEIEVAAVGLNFRDVLNALGLLKDYYAEHFNITSAEQLTFGFECAGKISAVGEQVSQWQVGDEVIGLLLHDGLSSFITTSVEYVVAKPKQMSFSEAATLPLTFLTAQYGLQHLAKIQPGERVLIHAAAGGVGQAAVQIAQVAGAEIFATASPSKWEFLQSLGIKHIMNSRTLDFAEEIMKRTAGEGVDVVLNSLNGEYIPQSLAVLTPKGRFVEIGKIGIWEKEQVKEKRPDVSYFPFDLQEAVQQQPGLIGQLSEELTQQWNQGKLKALPHKVFPSTEITAAFRYMQQAKHVGKVVVSMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Cyclopropanation by a Unique Enoyl-Acyl Carrier Protein Reductase.
pubmed doi rcsb
source organism Moorea producens 3l
molecule tags Oxidoreductase
molecule keywords CurK
total genus 104
structure length 332
sequence length 332
ec nomenclature
pdb deposition date 2015-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5dp1A02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 5dp1A01
1Q0QA 1ZZEA 1ULSA 1WWKA 3SC4A 2PH3A 3OJLA 4YJGA 3X2EA 4BUCA 5KKAA 2QRKA 1HSZA 5B37A 5ADHA 5EQFA 4RQUA 4TZTA 3QWIA 2DTDA 3DHEA 1QYVA 2X1HA 2FP4A 4YJDA 3ADOA 1V6AA 3RROA 2AXQA 4FFNA 5BQFA 1C0IA 5I9NA 1YDWA 1VSVA 1I10A 4DVJA 4DPMA 3I6QA 3INTA 1AXGA 1PX0A 4UEOA 1YH3A 3G0OA 3VHRA 4B79A 5KVQA 3RFTA 4DRYA 4TZKA 2BGLA 2IYOA 4XYEA 2XPCA 3RC7A 3ZW8A 1PGQA 1AN9A 4TKLA 3RUHA 3GGPA 5TF4A 3S2IA 2W8ZA 2C07A 4JGBA 1NHGA 3D7LA 1DHTA 2ZATA 4MOWA 1JKIA 4W9NC 4D45A 3FTPA 5H81A 4BNZA 1M6WA 2WD7B 1HWYA 3DBVO 3RKUA 3K30A 2EJWA 5L9AA 2DPGA 2PKQO 5F5LA 1EVJA 3WBFA 5A06A 4XJSA 4ZRNA 4RVHA 1P1JA 4G65A 2YQ5A 5DBIA 4CV3A 5DDIP 1C1XA 4A03A 3NT2A 1GYPA 1RM0A 1K3TA 3DAPA 5JCJD 3ZI0A 1UXIA 2V6BA 1K6XA 1A5ZA 2VUSA 1D1TA 2VCYA 4HP8A 3LVFO 4FD3A 4TRRA 3CEAA 1M6HA 1GYRA 4GGOA 1HRDA 2PH5A 4BO9A 1UH5A 1U5CA 2IRWA 3KLPX 1CERA 3GVPA 5G2OA 1HDGO 2V6GA 3KYDB 4WGGA 1MXHA 3Q0EA 4BGIA 3A28A 3VDRA 5EJ2A 1PZEA 2PD4A 1PJ3A 4GBJA 4DYVA 2OFPA 1E5LA 1ID1A 4XYLA 3UW3A 4EGFA 1HDZA 2GD1O 3NEPX 3GMSA 3JYNA 1O8CA 5HA5A 1ZJYA 4JBHA 4GSLA 2NQTA 3DAGA 5T67A 4BGUA 4U0KA 1KS9A 1NFRA 4CLOA 4NFSA 2C7GA 3AM4A 4OH1A 4P4NA 3RBZA 2EV9A 3KSUA 1FXSA 3L6OO 1Q1NA 4RPHA 4ND1A 1G6KA 3GFBA 3GRPA 1GUYA 3ZNNA 2CDCA 4Z0TA 4YAGA 1MA0A 3QA9A 1ONPA 2P4HX 4J91A 4E2XA 4FOSA 2AQIA 4MDHA 3ZU5A 1EK6A 4J49A 3PHHA 3QVTA 4BNXA 4CM9A 2XAAA 3GG9A 1DLIA 1RM4A 1UP7A 3AM3A 3MOGA 3IDSA 3BHJA 3AOEC 1NASA 2JKVA 4MINA 3ZWOA 4Y98A 3RU7A 4IDCA 4BNKA 1EBUA 3AI2A 3UXYA 5FI5A 2POQX 7MDHA 1DSSG 4JP2A 4FC7A 1GPJA 4WNIA 1B16A 2NU9A 4AVYA 3EMKA 1PJQA 4OO3A 2Y1DA 4OSPA 4D46A 1ISHA 4HBGA 1E7QA 2NTNA 4UVGA 1NPDA 1Q0HA 2DBZA 3JQAB 3GR6A 4ND4A 1VC2A 5DNAA 3W8DA 4BGEA 3BTUA 3EC7A 2A4KA 5T6BA 5CP8A 1R0KA 1BMDA 4O6VA 5EQDA 3WNVA 2CMDA 3LT4A 5CDYA 2B69A 3ZWCA 1E7WA 4RLHA 3LC2O 1MG5A 3KETA 4YXFA 1ZJZA 4BO0A 4CMGA 4F45A 4BO3A 4OXYA 4YCAA 2R2GA 1BW9B 1I2ZA 4J1NA 3COSA 1TI7A 4R1TA 1M2WA 1EUDA 3WMXA 1C1DB 5L4SA 4AJKA 4FBGA 3O26A 3PK0A 2Q4EA 4QUKA 1DC6A 2FWMX 3D5QA 3WLFA 2FRDA 4BO4A 5FEUA 1J49A 1WPQA 3BHMA 3OECA 2B5WA 3LT0A 3P19A 3WIDA 3TPCA 4JBGA 3PJEA 3DAFA 3OQ1A 1WAMA 3WJAA 1JTVA 2HJSA 4TRJA 2J5QA 1H2HA 1EDOA 1TEHA 2D59A 4RVFA 2DQ4A 3W8FA 4GX0A 3VZRA 4GI2A 2C54A 2X58A 1BG6A 2YW9A 2IEBA 5JCXA 3HHPA 5C37A 1N7HA 3ICCA 1MGOA 4YDRA 1XGKA 2YFQA 3IJPA 3ROQA 2VHZA 2FR1A 5B1YA 1DRUA 4MIEA 1P74A 3FBGA 3I4CA 2OP0A 3U4HA 3VZQA 3NYWA 2C59A 2VN8A 4CUJA 1U3TA 3JQEA 4UVIA 3L9WA 3E5RA 4J4TA 3ZHXA 5G4KB 2YV1A 4HADA 4I9HA 3ZNPA 3H3FA 3JSAA 3AY6A 1ZK1A 3WYEA 2C82A 1YOVA 1D3AA 2O3TA 2VYVD 1GAEO 4J2HA 1JN0A 5IZ4A 3ZNOA 1VRWA 4NFHA 1NVGA 1VL6A 2ZB8A 1PJSA 2R00C 5TGDA 3IS3A 4NJMB 3JQAD 3SEFA 3GNQA 2Q1WA 4GKVA 4WCFB 5IG2A 4UAGA 3UN1A 1DC3A 5JSFA 4WLNA 1A4IA 3KZVA 2EKQA 2ZTVA 3GEMA 4BO5A 3GGGA 3G1UA 3GNTA 1ZXBA 2Q50A 4Y6RA 2CDBA 4EUFA 3P2OA 5TT0A 4OQZA 1A72A 1DRWA 3INGA 3S2GA 2V6MA 1L7EA 1M76A 3PGJA 2BHLA 2GZ1A 3HFGA 2GN8A 3KBOA 4WKGA 1EUZA 4XB1A 4YJGB 3TZHA 3I23A 3PHJA 3D3WA 1J5PA 3ON5A 3NUGA 1QYWA 2X4GA 3V2GA 5B4UA 2AE1A 3DTYA 4ZQFA 1P44A 1F8FA 3E9MA 1DC4A 3H6KA 1GCOA 1H0KA 4D79A 1T4DA 5CPFA 1I36A 1CDOA 1UP6A 4PLYA 5F1KA 4CQLB 3AUUA 4EJMA 4IJKA 3W4JA 4XB2A 4YAIA 1IPFA 1E6EA 1JDJA 1YB5A 5I7EA 4OMUA 1EUCA 2NTVA 1HDXA 2AHRA 1HETA 1ZFNA 2QRJA 5C7LO 1Q7BA 5JDIA 5JXWA 4IJVA 4IS3A 1YO6A 3MTGA 4AJ1A 3E03A 2HMSA 3DB2A 3FN4A 4FB5A 2CF5A 4NJMA 1F06A 4IGEA 1H2BA 4MVJP 1MFPA 3KM0A 3H65A 2JD2A 2IZZA 1GADO 4WEOA 5KKCA 4YA6A 4Q39A 2X5KO 4ZQHA 4MP8A 4IM7A 4M54A 2VWQA 2UAGA 1V0JA 3KEOA 4UREA 1I3MA 1ZKMA 2VT2A 3R1IA 4CUKA 3IL2A 3FNGA 4A73A 3ITDA 4B7XA 3ZDFA 1VM6A 2O7SA 1NVMB 4CMAA 1DJQA 1ZSVA 5EPOA 2PGDA 3I1JA 5TLSA 3I9JA 4XJTA 1K0UA 4XX0A 1KYQA 4EUEA 3ETGA 3RASA 3E9NA 4R41A 1RM3A 2AEJA 5L4NA 4KDEA 2VYND 1ADGA 3T7CA 1RJWA 4WOJA 3WYCA 1FDUA 1U9JA 4CV2A 1I2CA 1XLTA 1YBAA 4XZ3A 1MFZA 4P38A 4BB6A 3QVXA 4D7AA 1B8PA 1R0SA 4IDBA 4ZD6A 2OGUA 2D5CA 3V2HA 3HZZA 4GQAA 3AU8A 4BKQA 1LSSA 2OMEA 3HFSA 5CPBA 3K9QO 1PL8A 2B4RO 2F00A 2GO1A 3DMYA 3IQDB 1S7CA 3GZ4A 3I5MA 4PZEA 3U49A 4W4TA 4KWHA 2B0JA 4XDZA 4AJ2A 5KNLA 4BKPA 3GVIA 1B26A 4XEHA 2VRCA 5JNLA 1XCBA 5A5FA 3WX0A 1LBEA 2JD0A 2O2SA 4MIYA 1NWHA 3SVTA 1HE2A 3F4BA 1LEHA 4HX5A 5I7SA 3H5RA 3GPIA 3ZWVA 1PZHA 5CG2A 3ROMA 4LN1A 2VHWA 4FJ0A 3LC1O 5G0TA 1T2EA 2PD6A 1W73A 4I08A 4YB8A 4C4OA 1QMGA 3LSYA 4CMEA 1HTBA 3QVSA 2CY0A 4WLOA 1ONNA 4TQGA 1BXGB 4E5PA 1HZJA 3PYLA 4FR5A 5EINA 1R4MA 1X7GA 1LJ8A 2G82A 1LUAA 1HYGA 3S1LA 4FGWA 2WE7A 5JFOA 1KC1A 3E48A 4IDFA 1SPXA 3I9OA 3PQFA 2FZEA 3FI9A 4P4GA 5COQA 5THKA 5A9RA 2RHRA 1LI4A 1UXHA 4KQXA 3BTVA 3DWFA 4J0EA 4Y6SA 4B7UA 1UXKA 1Q7GA 4IIVA 2NVWA 3IJRA 3PFFA 2B35A 4YT2A 4RCVA 2C5EA 4NBTA 3PEFA 3T4EA 1N2SA 3BMQB 4QFDA 1ARZA 4PLZA 3KB6A 4DTIA 4L74A 3BTOA 3AI3A 4BQPA 1MG0A 1AXEA 2CNBA 2D4AA 2P9CA 3EK2A 3RC1A 2HUNA 4DLAA 2ZB3A 2E82A 1MV8A 3PJFA 2E6UX 2NVUA 2VWGA 1DIGA 1O9BA 4NNJA 3QLJA 3MJSA 2HU2A 2VZ9A 3BYZA 4IS2A 2VTEA 1OC2A 2I9PA 4XGKA 1JAXA 4CLEA 2FMUA 1EFLA 5HS4A 1XDWA 5A02A 3LT2A 5I9LA 1R6DA 3GZNA 5CEFA 3D64A 4I5FA 1BVUA 1X15A 1EVZA 4MVJM 3TJRA 2HDHA 2GRAA 3TL2A 2JD1A 3AFMA 1GZ3A 1I3KA 3GAZA 2BKAA 4XGIA 5IZCC 3UVEA 5JBIA 1KEVA 1CIVA 3Q1LA 4Z6KA 4BHTA 3QHAA 4E2ZA 3MCVA 4BOYA 1ZMTA 1P9LA 3Q2IA 5L45A 3JYLA 4QXMA 5ES3A 5HTOA 3WSWA 2C7VA 4DLBA 2EJVA 1YBMA 5F1OA 4NBWA 1PS9A 3MJCA 1B8VA 1A71A 3TZQA 2Q2WA 4MIOA 3I3OA 3LK7A 3GY0A 2BGMA 3SLGA 1UDBA 1JVBA 4QTZA 4B4OA 1O94A 4J4BA 2BRUA 4Z9FA 1R37A 3M6IA 1IUKA 1LLCA 4WECA 4A5OA 1E1KA 3I9MA 3IKVA 1Y9EA 1I3LA 4E21A 3ENNA 4B3JA 2YHIA 1T4BA 2J3JA 5KOIA 5I8ZA 2O4CA 4NH4A 1EZ4A 1QRRA 3P2YA 4H7PA 5L7TA 1NPTO 1FF9A 4OJNA 1EBFA 4CMIA 2H1SA 4ZQBA 3VTZA 3BMNB 1SAYA 1U8XX 3FPCA 3QVWA 4DQXA 3IP1A 5TSDA 1E7SA 3GUYA 1PS0A 3RBXA 3LDHA 5EESA 2J5KA 2Q99A 4K1LA 1V3TA 4HWKA 1VJ1A 4JJFA 3DL2A 3TZCA 3GC6A 4DYDA 4GVXA 2X7HA 4WCFC 4CV0A 2EGGA 4OM8A 1FDSA 3TL3A 2HKIA 1GQ2A 4YR9A 2YQ4A 1XQ6A 3H9UA 4YJFB 3ZN2A 2CSUA 3OBBA 3VC7A 2X0JA 3RVDA 1YWGO 1U8FO 1ML3A 1MC5A 4BV9A 1YDEA 5IAAA 3OQBA 3VH1A 2NU7A 4YBZA 2BI7A 1I01A 4R51A 4R01A 2Y05A 1XR3A 2YV3A 4H3VA 3IIEA 3WS7A 4LW8A 3G1TA 3RAJA 3TSCA 3RUCA 2VYVA 3FD8A 4UUNA 4AJOA 1A4UA 2CVQA 1Z74A 2PFGA 1PJLA 4N18A 4R5MA 4II2A 4PLWA 3DQPA 3WGZA 3E18A 1LLQA 2VHYA 2LDXA 4WPGA 2VTDA 2X6TA 3TFOA 3ZWNA 3FBTA 1QORA 3ONDA 3A14A 1VKOA 2CVOA 1LDGA 4IDGA 3S55A 1WMAA 3ZU3A 1PS8A 4WLEA 4BNWA 4CMBA 3H5NA 1HDCA 1V3UA 3F4LA 3KHUA 3O4RA 3VKVA 1IL0A 1TT5B 1B7GO 2Y0DA 4F6LA 1N1EA 1A7KA 2RIRA 2VNSA 4MKZA 2NADA 4CM3A 2PKQP 3V1YA 4DIFA 4YJFA 4HXYA 1HT0A 1XELA 4WOKA 4GWKA 3PPIA 4L73A 2G1UA 4RPLA 1EEHA 1SBYA 1YONA 3RBVA 3L4BA 2NQ8A 1ISGA 1J4AA 3OMLA 4JNKA 4LK3A 2D5AA 1D8AA 2PWZA 4MO2A 5DP1A 2Q1TA 4TRMA 4DLLA 4N7RA 4FC6A 4BB5A 1DFIA 5KJ1A 3RSHA 3LT1A 3R3JA 4AJNA 1YL7A 2JJYA 3PWZA 4GX2A 4NFYA 6LDHA 1LC0A 3BMCB 4J2OA 3F47A 3QV1A 4N5MA 2JCXA 4WEQA 1QG6A 3HB5X 1BHSA 3P5SA 3UHAA 4YJHA 1ISFA 4FJ1A 1HKUA 1Q7CA 4YT4A 1KVRA 4Q3DA 1XSEA 2O3JA 4RO0A 1GQYA 4U5QA 4JQCA 3ABIA 3JTMA 4CM6A 4CLXA 4EBFA 3LF2A 2ZB4A 5TIIA 4EJ0A 3EZLA 3FPLA 5IDWA 3WGTA 2ZB7A 1CETA 1P1KA 2JFFA 4CPDA 1E7MA 1MC4A 4CQMA 3SLKA 1Y81A 1Z73A 4OYRA 2JHFA 3OEWA 4ZN6A 1QXSA 1BXKA 4Q3AA 2WE8A 3N74A 4OXKA 1HYEA 3ZWXA 2FPGA 4GWGA 2B5VA 3F46A 3K73O 4MVJH 1EQUA 4EYEA 3Q9UA 4W7IA 2JFHA 3M2PA 4IDEA 3PXXA 1DOHA 3DZBA 1DIRA 4LISA 3WXBA 4YT8A 3C1AA 1V3VA 1U2GA 2Y1FA 5CDUA 1N92A 4J4HA 3CINA 2DBVO 3AW9A 5FYDA 1UDCA 4FDAA 4K28A 1HE3A 2P68A 4RVSA 3H2SA 3FTNA 4JJIA 4PG6A 1ZW1A 2C0CA 4NDNE 1P1HA 4E2YA 3QW2A 4JIGA 3NTQA 5CEJA 3Q9NA 3ZV6A 3WNQA 1H93A 3TNLA 1D7OA 2CD9A 5FF9A 2F1KA 1UAGA 3K31A 4XR4A 3BAZA 4UUOA 3ZWYA 1YQXA 3R6DA 3FR7A 1KVTA 5COAA 4IPTA 2P4QA 4N54A 3E1KA 1AHHA 3I9KA 1OAAA 2BD0A 2NVUB 2V65A 5BSFA 4BNUA 5K9ZA 2CVZA 1FJHA 1X0VA 3H4VA 4ZQEA 1I0ZA 1C1XB 2D0IA 4GKBA 1YQGA 1QR6A 5F3RA 3IUPA 3WBBA 1KY4A 3DBLA 4CODB 1NFFA 2GUGA 4UUPA 5A9SB 4TVOA 3HDQA 3GDGA 3EDMA 2IE0A 5JW6A 5T5QA 3PHLA 3Q2KA 3Q6IA 4BV8A 4DQVA 8ADHA 4NBUA 4OHUA 4U6QA 1ADBA 4GGPA 3SBOA 1YS4A 5L7WA 2ZCUA 3OHSX 4KMSA 4HNGA 4LCJA 3JQBC 4DMMA 2Y67A 5DCUA 4B8ZA 3F9IA 4ZHSA 1OBFO 4W7HA 2EG9A 5TT1A 3MWEB 4GX5A 3ST7A 3ZWMA 2FSVA 4EI2A 3QQPA 3VH4A 4DBVO 5BR7A 1H94A 4B4VA 4WCFA 1H6DA 1ZCJA 1DBVO 3G49A 4JN6B 3O8QA 2ET6A 4I8XA 4XGNA 4AJ4A 5ICSA 5JAMA 3F6YA 3EUWA 4IMPA 2CZCA 2WYUA 3QY9A 1Y5MA 3B70A 4PN3A 4D3SA 2HK7A 3H8VA 1CQJA 1PQUA 1NQAO 4FCCA 2C2YA 4XD2A 1ENYA 3VPXA 3S2EA 1N8KA 4FFLA 4U8GA 1QKIA 1C1DA 1I3NA 1NX6A 3L4BC 2PLAA 4YWJA 2HRZA 4QQRA 5JS6A 2GN6A 4ILKA 2RBEA 5CEEA 1U1IA 4JROA 2Q49A 1I5RA 4I9UA 4CM7A 2C29D 4E30A 4TROA 3GPDG 3SJ7A 4RVDA 4INAA 1DAPA 5L53A 3DBHA 4M1QA 4BNNA 2FR0A 4A27A 3AY7A 3DO5A 5G4LA 1ZXLA 1Y1PA 4Z9YA 4RJTA 5JO9A 4ZA2A 1BRMA 3GA0A 4EEXA 3CUKA 4YQZA 1XKQA 4KZPA 3TF5A 1JKFA 1YGYA 3HN7A 1C0LA 4XQCA 3EW7A 2Q3EA 2NVBA 2Y1CA 3GN2A 4CM9D 3GT0A 3PWKA 1NHWA 2QG4A 2DM6A 4Q3NA 2DFDA 5K1SA 3PTZA 3NX4A 4PLFA 3KLMX 2E37A 2QHXA 1UDAA 2B37A 3F1KA 1N9GA 4GMFA 4EITA 3BXXA 4K6CA 2GLXA 3OF2A 2FZWA 4LCEA 4J6FA 2C5AA 3JQBA 3WICA 2P91A 2I6TA 3WWZA 5B4TA 4JXKA 4CV1A 1KOLA 4CM8A 2ZKLA 2I5PO 1K5HA 3TFQA 3WQRA 1BDBA 4XYGA 4HKTA 2GPTA 3DZGA 5GZ3A 3F5QA 3CMMA 1K6IA 1VKNA 1IYZA 3UAGA 4MKRA 4DUPA 1WNTA 5TX7A 1PZFA 4QT0A 5BT9A 3PQDA 1RPNA 3RFVA 2W2LD 3R3SA 5A03A 2E48A 4J7XA 4YYZA 4DBZA 1K6JA 1O89A 1L1FA 1JU9A 1ZK0A 1B15A 1DFHA 4J3FA 2PR2A 4F46A 5JY6A 4MVJI 2BH9A 3PIDA 2XOXA 4R1SA 4RLSA 2X9GA 3D3EA 4AJIA 4XRRA 5KJCA 1ZVMA 3R0IA 1E3LA 3ZCXA 4D0SA 4XR9A 4E12A 3B1KA 5ILGA 1H6AA 1GUFA 3H3JA 3U62A 3VZPA 3JYOA 1NVTA 1P77A 2WD7A 4HY3A 3JQCA 2IEDA 4R16A 6ADHA 1U28A 3HUDA 4ALKA 2HRBA 3C24A 3CH6A 4MVJG 5COBA 4ZGWA 3VTFA 1O95A 1UZNA 3KO8A 4GH5A 2O3QA 1F17A 1JAYA 3U3XA 2DVMA 1NAHA 4NK4A 1UZLA 5T8KC 4B3HA 5T8KA 1Y6JA 3NJ4A 4HFRA 3E6AA 4FOOA 4Z3DA 4BMVA 1TXGA 1OFGA 2ZTMA 3NJ8A 1HXHA 1B2LA 4RGBA 5EN4A 4CQMD 1T24A 2Q1UA 3DBHB 3EVNA 3HN2A 2EKPA 3HG7A 4BNGA 1PZGA 3DTTA 3QWAA 1FK8A 3M1AA 1X1TA 1DAOA 2B36A 4TRNA 3UUWA 1P1FA 2IXBA 5DULA 5U9CA 4CLHA 2YZ7A 1NQ5A 1PJBA 5U1PA 2C2XA 2SCUA 3GF4A 4OSOA 5ENDA 2A35A 1UXJA 3TN7A 3U4IA 5CDSA 4ALNA 4KQWA 4BMSA 3NDJA 2OORA 5JE8A 5A4DA 2O23A 2DBQA 5U4QA 4M8SA 4A7PA 4JK3A 2NLOA 5AXBA 4R3NA 1KIFA 1O5IA 1LNQA 4E5YA 1M66A 2HAEA 1T1RA 2PZKA 4RV9A 1WDMA 3NGXA 3WGOA 1WXDA 3DXFA 1K2WA 2YFHA 3BMOA 2Z95A 3OQ6A 3JD3A 3PGXA 2NU8A 4CM4A 3NAQA 1IHYA 1PL7A 1C0PA 4B8WA 2WJPA 5KIAA 3GVCA 4WJZA 1N7GA 3CZMA 1HDRA 3IC5A 1Y8RA 5IDQA 3C1TA 2Y66A 1YE3A 2ZYAA 5IF3A 4ONEA 4PZDA 2VOJA 1A9ZA 4WCDA 1KY5A 4XCVA 3NDIA 4CLOB 1XG5A 2BFPA 3RC2A 4MVJA 3ZWPA 8LDHA 4OIMA 4YAKA 5KJ6A 3RUDA 2LDBA 2Q2VA 3NT4A 3I4FA 3NV9A 3OJ0A 3ITKA 5TRTA 3JCZA 3EGOA 3AI1A 4KWIA 1D4FA 3WSVA 3OIDA 3PQEA 5I7FA 4RPJA 1E6WA 2P5YA 2UDPA 3E9QA 3PDUA 5C3MA 1F0YA 3FR8A 3KTDA 3L6DA 3BHIA 4LRTB 3HNPA 2Y1EA 2OP1A 1SNYA 5A05A 2PZJA 1KERA 4UUMA 3RQSA 3DOCA 2V6FA 2OZPA 5JO0A 2Z5LA 1X7DA 4QO7A 1KEWA 3TRIA 5JYEA 2Y68A 1QYDA 1XYGA 2ZK7A 3ICPA 4PLTA 4ND5A 4TVBA 1DIHA 3BA1A 1GFSA 1I2BA 1EE2A 1LU9A 1NM5A 4WNCA 5J23A 5IN5A 2VWPA 3W8EA 3G17A 2W2KB 2EGHA 5IDYA 3L0DA 1XA0A 4BGVA 1NPYA 5L51A 4XKJA 1NFQA 2OOSA 4NZ9A 1ZH8A 3ROKA 3OA2A 4PCVA 2Y1OA 2YHIB 1O6ZA 1HDOA 4IQGA 3BMOB 3WTCA 1EVYA 3ULKA 2O7QA 4E13A 3G79A 2TMDA 3MOIA 3O8QB 2HMTA 2VWHA 2AG5A 3WB9A 3FF4A 1ENZA 3HDYA 5L40A 4F6CA 1UZMA 5JCJA 1E6UA 1PGOA 3MTJA 4BO7A 3PHIA 5IZCA 4O0LA 4E0BA 1ADCA 2X86A 2DPHA 4PZCA 4BIIA 2EHDA 1JWBB 1HE5A 1PL6A 2J3HA 1QLHA 4Q3EA 1PEDA 3V5NA 3GAFA 1V9LA 2VRCD 4WK6A 3KSZO 4AL4A 1CF2O 1PGPA 1U7HA 5JAIA 1GZ6A 2AEMA 3PHGA 1XWFA 4R1UA 5C7OO 1PQPA 1IZ0A 4DC0A 1BSVA 1VJTA 1LDYA 4RZHA 1RYEA 1J6UA 3GRKA 5AOVA 4I1IA 5IJZA 3GN1A 2EERA 2EP5A 4PLPA 3C1OA 3SX2A 4BQRA 4AICA 4DREA 1KETA 1V8BA 3V1UA 2GN9A 1DDOA 5FWNA 1E77A 1BWSA 1LXCA 4XQGA 3LLSA 4BNMA 2I66A 1JLLA 1UJMA 4WLVA 1Z82A 3OP4A 2CUKA 3HE3A 3LU1A 2W2KA 4NBVA 4DXHA 1EK5A 4M87A 2DUWA 2QRLA 3GVHA 4Z3KA 3VZSA 3IP3A 3JD1A 4BNFA 1ZIDA 1HZZA 1SMKA 3EAGA 1KBZA 5FI3A 3ADPA 3L77A 4E5NA 4NQZA 3AK4A 3K2BA 3TDKA 5KWEA 3QIVA 3WIEA 5JDIC 4GLOA 1JVSA 4FS3A 1YKFA 2Q45A 5L3ZA 4NG5A 3VPFA 1DFGA 1LQUA 4L4XA 4BNYA 3KYDA 4Q3CA 4J9VA 5FFFA 1B3RA 2HK8A 4FFMA 4XWYA 4JX8A 2BGKA 3SJUA 3VVBA 4PG8A 5BNIA 3AUSA 1MB4A 4E4YA 2O4UX 4W82A 3RUAA 2H9IA 4NK5A 1DLJA 3CPSA 1YJQA 1DJNA 4LVCA 3UCFA 2EW8A 3LZ6A 3OFSA 1B0AA 4RF5A 4ALMA 4OQYA 5JDCC 4HFMA 3QWHA 4TSKA 1F8GA 2RAFA 2QYTA 1AHIA 1GU7A 4IQ0A 3H9JA 1LDBA 3PJGA 5KTKA 2ZYDA 2BI8A 4CL8A 4AJHA 3EZYA 4BNHA 1GR0A 2E49A 2PKRA 1NQTA 4KOAA 2RH8A 1CJCA 5GY7A 2BF7A 2HO5A 4FSHA 5BNTA 1OZAA 1R66A 2EW2A 1LLDA 1QYXA 5DCWA 4EDFA 5JYDA 2YJZA 5A3VA 2AQ8A 3FNHA 4OAQA 2JFGA 3MZ0A 4OKNA 1A27A 2C20A 5JY1A 2OL4A 2G17A 4I9NA 2FY8A 2XF8A 1PSDA 3BMNA 2RH4A 4X54A 4GPD1 4JBIA 3CMCO 3PZRA 1LA2A 3WGHA 3FNFA 3TQHA 2EXXA 4J1TA 1ZUD1 4Y8VA 4BNTA 1DRVA 1U3UA 3ENKA 4CMCA 4GVLA 3ZU4A 3H9GA 4PG7A 2X0NA 5HBRA 4E33A 3U9LA 5I8WA 1ZK4A 1I8TA 3T7EA 3ZZNA 2B4QA 2PNFA 4M49A 1LRLA 3FWZA 4J7CA 4XYBA 2DC1A 7ADHA 3GOHA 1M67A 1GUZA 3MJVA 3WMWA 3IAHA 1WW8A 2WYWA 2OXIA 2B83A 5L95A 2NWQA 4YVFA 1DEHA 4RQTA 1JQBA 4B7CA 5HRUA 2XXJA 3B1JA 5EL0A 4I5DA 3O38A 3ETDA 2DAPA 5DOVA 4XRGA 2YDYA 5KVVA 1P0CA 3WDSA 2GR9A 1GCUA 3JD4A 4GAEA 3B20A 2NUAA 1YB4A 1E0DA 3DHYA 2IXAA 1Z7BA 4P4LA 1YQDA 3KUXA 3ASVA 4IJWA 1NNUA 5ICMA 2O3RA 4RZIA 2BFAA 1K89A 2FHSA 5JDCA 2PY6A 1I30A 5AQ1A 4ZICA 1DO8A 2Q46A 1G0NA 3ZWWA 4PIVA 1UP4A 1UUFA 2I65A 3KYCB 3OA0A 4FFPA 3TOZA 2IDZA 1DPGA 4R5HA 1T26A 3BTSA 3GEGA 3JQDA 1BTOA 1XIVA 3DDNA 1P33A 1ENPA 3AJRA 1BDMA 4URFA 5BSEA 3AY3A 1CQIA 1ZSNA 4YPOA 5JMPA 4BNLA 1NAIA 4E2WA 4Q9NA 1E7YA 1E1NA 3PFWO 2AE2A 2R6JA 2AQHA 3CXRA 5CDTA 3A1NA 5TQVA 1SEPA 3X2FA 3L9XA 4PLGA 3BMQA 3EVTA 3HQ4O 5C5IA 1HE4A 2NV6A 3GVXA 4CMEC 3EHEA 4Z0PA 4ESOA 2PGJA 2UYYA 5AVOA 2BFMA 4LSWA 1DIBA 5DT9A 1LX6A 4ND2A 3VAZA 1C3VA 2VOEA 4IGFA 3RD5A 3V1TC 3GQVA 2I67A 1ADFA 4BKOA 1ORRA 2YDXA 5BSHA 4GX1A 3F3SA 3GHHA 1H9AA 5B12A 2VUTA 5KJEA 5B4VA 1LQTA 3VVCA 2FPPA 4IDDA 3GDFA 4DWVA 2VRBA 4XYMA 2VZ0A 3RUEA 1I33A 1TB4A 1BGVA 3OM9A 3UH1A 2PZLA 5BNFA 1XQ1A 3GEDA 2HMWA 2FPIA 2WWRA 5DF1A 3C7AA 5F5NA 3U4DA 1ZEJA 3JQ7A 3ANNA 5ER9A 2GASA 3ZW9A 3DBLB 4W99A 1UR5A 1IOLA 1HEUA 1JWAB 1YJ8A 2GSDA 4NJOA 4YAEA 4GSKA 4Q3BA 2EIHA 4ZQGA 3BMCA 3JQ9C 1AUPA 4K6FA 4IZIA 2D8AA 1LDMA 4D43A 2PGLA 3K8ZA 1IZ9A 2PA3A 3KYBA 3WTBA 4J16A 1E5QA 5T57A 5IN4A 1Q2XA 2ZYGA 5TS3A 4TKMA 4IMRA 3DEYX 1PWZA 3RC9A 1JA9A 2X5OA 1VL8A 4PGFA 5KVSA 1Z45A 4EEZA 4DIBA 1GZ4A 1PR3A 3EY4A 4F3YA 3KXDA 3G3EA 3E5MA 3ONEA 4UVDA 1ISIA 2J3IA 4Y67A 4E5KA 1KEPA 4B3IA 9LDTA 4II3A 1BW9A 2GYYA 5K6AA 1ISMA 3T4XA 3INRA 1ZSYA 4QX6A 2GCGA 3JV7A 2PD3A 3WFJA 4CM5A 5H83A 3WG9A 4PLHA 1T1SA 5A9SA 1KVQA 1BXZA 1LSJA 4CL3A 5MGBA 1JW9B 3DZFA 3E82A 4MVJD 4RDHA 1CEQA 1E3IA 1TT7A 1P0FA 2ZQYA 1OMOA 1RYDA 4IZHA 2HQ1A 3JQFA 3UCXA 5GMOA 1U3VA 3I9LA 2XXBA 4CR6A 1X14A 1O0SA 1U5AA 4OKIA 3O03A 3NKLA 3Q3CA 4P8RA 3JQ7B 4S3MA 4L8VA 3H9QA 1GDHA 4RL6A 2Q1SA 4O5OA 5L7YA 4A2CA 4C7KA 1LLUA 5HM8A 2GERA 4S1VA 5A1TA 1R12A 2A92A 3I9NA 3QWBA 3ANLA 3ROPA 4CMHA 5KJFA 5G4KA 2YUTA 4MKXA 4R68A 1IB6A 1KVUA 3AUTA 5JMWA 2O48X 4E32A 3ANMA 3OSUA 4YRAA 4FFOA 4IBOA 2X23A 5TNXA 5ER6A 3B1FA 1MP0A 2P2SA 2JAHA 4TWRA 1IE3A 2UV8A 3OJEA 3H7AA 4WE3A 1E7RA 4R1NA 1YOVB 3DR3A 5CDGA 4YAJA 4BO6A 3DZKA 4IUYA 4BKRA 4Z0HO 3PYMA 3DBRA 4O1MA 1LDNA 1WZIA 3KSDO 2Z1NA 3A4VA 3N58A 4PVCA 4U0JA 5H82A 4B4UA 3ZHZA 4HFJA 1KC3A 3DOOA 4ZRMA 3D4PA 1P31A 1TT5A 3TOXA 3Q11A 3IUSA 3RJ9A 4GL4A 4PFJA 3DZHA 4CQLA 3JD0A 1H6BA 5LCXA 3CIFA 1T2CA 3GFGA 1Z6ZA 3FSRA 4YTEA 3ZV3A 4AJPA 1FDWA 1PIWA 4QFCA 3UOGA 1ENOA 3GH3A 4L75A 1LC3A 4J0FA 3WR5A 2NACA 4MJLA 5A04A 1N9GB 3STHA 1N1GA 1X1EA 2WSBA 3UICA 3LQFA 2ZTLA 2JAPA 1VPDA 1RKXA 3GLQA 5CFZA 2GZ2A 1B14A 3C85A 1QYCA 1GEGA 1H9BA 1ZK2A 1DC5A 1QSGA 2ZQZA 4FW8A 5LC1A 4JJGA 3JQAA 3QE3A 1YL5A 4YJHB 4NR0A 2VHXA 3FRJA 1NBOA 4JCOA 3VPGA 3PI7A 1U3WA 3ETEA 2AEFA 4D44A 3OIFA 2NNLD 5TJHA 1FDTA 1WP4A 3UCEA 2D3TA 2J8ZA 5DP2A 1ZMOA 1PJ4A 3ZH2A 1U4OA 2NM0A 4IJUA 1FMCA 3ZWBA 3L6EA 4BMNA 4G81A 2ILTA 1DHRA 4AJJA 3DZIA 2DTXA 2GF2A 3FHLA 1SCUA 3JYPA 4FFRA 4CQMB 3N7UA 3ZU2A 1W8DA 4UEKA 1LSUA 5L4LA 1WZEA 1EFKA 2DUUA 4FPXA 5LDHA 1CYDA 1PTJA 2WMDA 3VH3A 1ULUA 2VYNA 4UULA 5F1PA 1NR1A 2H63A 2ZTUA 2DLDA 3K6JA 2RHCA 3VKUA 5TJ9A 4ZVVA 3ONFA 3RIHA 3D4OA 3RUIA 1VI2A 5GZ1A 4UEJA 4L9RA 1WLYA 1N5DA 2VHVA 3GK3A 1CWUA 3GNSA 3NTOA 5DBFA 4BNVA 1WVGA 3VPSA 3GMDA 4UVHA 2WDZA 1T2DA 2EEZA 2X9NA 4N5NA 5CG1A 4LMRA 2QW8A 4WASA 2G76A 2I3GA 4KP7A 4ROSA 5JPIA 1RM5A 2UUPA 4YEDA 3PWSA 4R3WA 3GHYA 1HF3A 1E3JA 3MWDB 4B4WA 3HDHA 1T2AA 4I5EA 1VLLA 2YHUA 3QSGA 1Y7TA 4J9UE 2UUOA 2AMFA 3NGLA 3RCBA 3HB4X 4ZJUA 4XDYA 2HMVA 1SZJG 1DB3A 2DT5A 1GV0A 1PR9A 1JKJA 1VL0A 1U7TA 1BXGA 4NI5A 4NU6A 1LDEA 3F1LA 2IYPA 2OUIA 3JQGA 3NRCA 3PZBA 3ZHYA 3ZNQA 2H5LA 4E31A 4H15A 3AWDA 4R54A 4MPDA 1WMBA 3A06A 4M55A 5ITVA 1I32A 1MLDA 3O9ZA 2J3KA 2QZZA 5ITWA 1KVSA 1E1MA 3W6ZA 2W4QA 2QZ9A 1OI7A 3JD2A 1HDYA 3RI3A 1R15A 3OH8A 1HLDA 4O59O 4XIJA 3TZ6A 3DZJA 2Y0CA 3JQ8A 3WQSB 2G0TA 1NTOA 3AFNA 2WYVA 4E6PA 3HADA 5ILOA 2DFVA 2YY7A 4BNJA 3RKRA 4LMPA 1DIAA 1SB9A 3S8MA 4CM4B 3WWYA 1HLPA 3M2TA 3QVOA 4RVGA 2GGSA 5DZSA 1SC6A 5IDXA 1SOWA 3PDJA 4PG4A 1ZBQA 2DBRA 3DFZA 5A5EA 3CTMA 1D1SA 1Z75A 1J0XO 3D3WB 3JQ9A 1LTHR 1NWCA 2DKNA 1F14A 3UGKA 5IXYA 1GPDG 4WLUA 3VPHA 3D0OA 2FR8A 2QQ5A 2H6EA 3I52A 1NXQA 4DIOA 4RF4A 4PRLA 2AG8A 5GZ6A 1MX3A 2R00A 1X0XA 2O2YA 1VJ0A 4GLLA 3UFXA 2Q2QA 4L0QA 1YVEI 1P3DA 3JYQA 4H16A 5TC4A 2W2LA 1E3WB 1F12A 3KEQA 1PU2A 4CLDA 5K6AC 1U2DA 1NR7A 3AM5A 1VE9A 3CZRA 4J7UA 2JHGA 2OBNA 1MUUA 4HFNA 2PZMA 1C0KA 3WGIA 4ALJA 1LRJA 4NIMA 1GEEA 1Y9AA 3PRJA 4IINA 4LRSB 3HSKA 4U7WA 1EE9A 2HJRA 4G5HA 3QRWA 1GQQA 3LC7O 3MJ4A 4KUHA 3DBRB 4CJXA 1UXGA 2CDAA 1SO8A 1GD1O 2J6IA 3UKOA 3IMFA 3D1LA 1BVRA 4CM8B 2IODA 3JQGB 1R0LA 3UF0A 4OOEA 2UVDA 3LF1A 1PGNA 2GN4A 3BZUA 1HL3A 2HK9A 2Y99A 1IY8A 3DC2A 4RDIA 4J1QA 1NQOA 2VUUA 4KUEA 4PRKA 2CFCA 1EVIA 4L4RA 1PQWA 5MDHA 4CMKA 3VDQA 2ZCVA 2O3SA 2E4AA 1IPEA 1OOEA 2VNAA 2OHXA 4IDAA 1HYHA 4CMIB 4E5MA 4RPKA 1VSUA 4KTTE 4AG3A 2X9VA 2V7PA 1YB1A 2EKLA 4N5LA 5T64A 2FOIA 4K26A 3IOYA 4FQ8A 4D3DA 2I3AA 4FJ2A 5EIOA 4BL5A 3KVOA 2ZJ1A 5I7VA 3CE6A 4DQUA 4J43A 1EQ2A 2EP7A 3NTRA 3GUCA 3PIIA 5DOZA 1PJ2A 2I76A 2JL1A 1R16A 3PVZA 2X5JO 5AXDA 2WD8A 3OICA 2QX7A 2BLLA 4R9SA 3AOEA 2AA3A 2IZ1A 4FGSA 4PLVA 5AXAA 5JAQA 3D5TA 3JQ6A 5DN9A 4NMHA 4TMFA 1AE1A 4ID9A 4CM1A 4BO1A 4D41A 4YACA 5EERA 4NPCA 3VOSA 2HMUA 4J1SA 1PGJA 4RORA 3CSDA 4KTVE 1I24A 1PJTA 3ZV5A 3K96A 3AOGA 1EMDA 2PV7A 1XU9A 2X0IA 2CF6A 4IIUA 5G0WA 5JAZA 3FCOA 5CAEA 4HNHA 4DPLA 3AU9A 1KEUA 3QJ5A 4ZU3A 4MVJF 5C7IO 1ZK3A 1W6UA 4A0SA 2FSSA 5JC8A 3V2UA 5LDGA 1L7DA 4RF3A 5JLAA 5HWSA 2O50A 2O3UA 1GV1A 3C7DB 3TZKA 2JCVA 4BO2A 1X13A 2BMAA 4LVUA 3RFXA 4ALLA 3GZNB 4BVAA 1Y8RB 1XU7A 2AQKA 3HJAA 1C14A 4O63O 2FN7A 3DONA 3P7MA 1DXYA 3AUAA 4EZBA 1AGNA 2HCTA 1YRLA 2VT3A 3WFIA 3F5SA 3PJDA 4MP6A 4MP3A 3HDJA 1YBVA 4BO8A 1TLTA 1P1IA 3W4KA 1LRKA 4P22A 3S2FA 5K0ZA 3A9WA 1Y8QB 3K2EA 1B3BA 3SXPA 1HSOA 5THQA 3RJ5A 1G0OA 2QIOA 1EDZA 2EF1A 3ZGYA 1V35A 2YYYA 3EYWA 1A7AA 4YRDA 3WQQA 3GDOA 1ZEMA 1QLJA 1H5QA 4DMLA 3U4CA 3NDRA 3OETA 4LSMA 4Y9DA 3TWOA 2NU6A 3E8XA 1QV6A 3WOHA 3ZV4A 4AJEA 4BS9A 3OIGA 1GYQA 1QP8A 1GL3A 4CLRB 3DFUA 2ZJ0A 3L4SO 3M1LA 5JC1A 1IULA 5I9MA 3VH2A 3FNEA 1P45A 4EJ6A 1YL6A 4HUJA 1YXMA 2W90A 1ZO8A 4M89A 1UAYA 1S6YA 4Z9XA 1XHLA 3H9EO 3KYCA 3FWNA 4IXWA 3D4NA 4W9NA 4L4SA 4JP3A 5DCYA 4FIZA 1Y5RA 3WLEA 1NYTA 5IFLA 4RPGA 4C7JA 3PYXA 1OC4A 4UVEA 3WGYA 1W0CA 1E3SA 1RWBA 1SOVA 4PG5A 1XEAA 4WLFA 3V8BA 5HS6A 3H2ZA 2HLPA 2BFOA 3K92A 1MXFA 3DOJA 3CKYA 3OEYA 2WEKA 5IXSA 5DBGA 3ZHBA 4DL9A 4JLWA 5F21A 1TVEA 2BELA 3MJEA 4YT5A 4XQEA 3C3XA 1E1LA 4IXTA 4M86A 1GTMA 4EUHA 3IKTA 3DHNA 4DA9A 4NU5A 2Z1MA 2PTGA 3MEQA 4K9DA 4DGSA 3PLNA 4XIYA 2WM3A 2OBYA 5KCZA 1ONOA 2W98A 4RVUA 4LGVA 5A9TA 4ITUA 3WGQA 4DPKA 1P1RA 1IHXA 4IY1A 3U5TA 4NBRA 2NTJA 2P9EA 1ISJA 4CLRA 3PP8A 5KVCA 2X22A 4U6SA 4MVJE 1NP3A 3C7CB 3PLRA 4XA8A 2B4TO 5AYVA 3JQFC 4EW6A 1E3WA 3ORFA 4CMJA 3K5PA 2I99A 4IQ8A 5AXCA 5ENVA 2P9GA 4W6ZA 4QSMA 2P5UA 3OJFA 4E3ZA 3ASUA 3W4IA 2OO5A 2JCYA 3HWRA 2RCYA 2NSDA 4A26A 1SB8A 3I6IA 1T25A 1A9YA 2HSDA 2EWMA 5A3JA 1Y8QA 2DTEA 3GGOA 3C8MA 4PLCA 2Q4BA 3B6ZA 3NT5A 4CR8A 1R4NA 2AW5A 4BKUA 3GG2A 4KUGA 1ZNQO 4AJLA 1PJCA 4YRBA 1CRWG 4GMGA 4D42A 4R69A 1G1AA 3WYBA 3KRTA 5EMHA 3LYLA 4G2NA 2GNAA 2Y93A 3LLVA 1SEVA 2D1YA 2TMGA 4PVDA 3WJ7A 4FN4A 2DU8A 2A94A 4CUZA 3I83A 4QEDA 4A10A 4YQYA 4I5GA 4QECA 4Y6PA 1QV7A 5G0VA 3W6UA 4BNIA 4ALIA 4CR7A 2J5RA 1TA4A 2Y0EA 3QP9A 1W4ZA 3H5AA 3W1VA 2D2IA 4QO8A 2X0RA 4DC1A 5CHEA 1GY8A 2GZ3A 4R4JA 1E92A 4KDFA 2PK3A 1WDLA 2IZ0A 2X8LA 1Q0LA 2A9FA 3RUFA 4ND3A 4OL9A 4OGWA 2QYSA 3U0BA 1B8UA 4OXNA 2YV2A 3L07A 4J90A 1R4NB 4D0RA 4NHEA 3MJTA 1M75A 4D3FA 4HV4A 3ZWAA 1FDVA 5BSGA 1WDKA 1PWXA 9LDBA 3BIOA 2WTBA 5G0UA 2G5CA 3KV3O 4AFNA 3KOUA 5G0SA 3SC6A 2GDZA 1E3EA 3DMTC 1X7HA 3DMTA 4L76A 3QWFA 2VQ3A 2VZ8A 1U4SA 4R9RA 3RWBA 1H6CA 1T2FA 3RU9A 4OOFA 1Z7EA 4XQ9A 3U09A 2ZIZA 2Y1GA 4WUVA 1LSOA 3JQ8B 3WGGA 4RF2A 1R4MB 3OJOA
chains in the Genus database with same CATH superfamily
2QUHA 2OV4A 1ULSA 1WWKA 4IIDA 3L49A 4BWFB 1L7NA 3OJLA 4BUCA 4UXHA 3N70A 1TVKB 4UMEA 2X1VA 2KLHA 2TECE 2DTDA 4WD3A 3KUUA 3INYA 2AJ8A 1EB8A 3BG5A 3DTNA 2PNJA 2QLMA 1TQ8A 2AXQA 1YU6A 1IM5A 2RGAA 2V1XA 3OD1A 3TMKA 4ETIA 4EL5A 4MNTA 2PL5A 2Y1WA 3W3ZB 3BRWA 4NJEA 3OQMA 1G5RA 2NXCA 3AUJB 1JXMA 1XWIA 2G7MC 3Q12A 2OG2A 3REOA 3M5WA 2Q9AA 4MUEA 4LKRA 3P2JA 4DVJA 2P65A 1G59A 2IT1A 1AXGA 2WAAA 3AMVA 3I8XA 1PX0A 1SVSA 4IIXA 4KC0A 1YH3A 4ZI5A 1QS0B 2W6CX 3VHRA 1SXJD 3VYTB 4UU1A 4H27A 4H6XA 5KVQA 1WQ3A 4MR8A 3WBJA 4ESHA 1WUJS 2LIVA 2BGLA 2PZBA 2JLAA 1FFEA 1VIDA 5ESWA 1KAQA 3AL2A 1OGIA 2JZCA 5TF4A 3S2IA 1ZR2A 2C07A 2JCGA 4JGBA 2H4XA 1SG0A 5EWJB 3GV0A 1S7GA 1WBJB 1T43A 1X3SA 1J1ZA 1PN3A 3NHUA 3CF2A 5KYXB 2CV2A 1EE1A 3BXFA 4DMRA 1ZLXA 5H81A 4RFVA 2H29A 2H1OA 1GAWA 2VF4X 3Q7IA 2WD7B 4EFKA 4A16A 2G80A 3BZWA 5EC8A 3RKUA 3TSAA 4C0SA 3QEOA 1VMEA 2EJWA 2P2LA 5AJYA 4O5AA 5IC4A 1BU8A 2HQRA 2BEWB 3KZCA 4K0RA 3HA5A 4KE9A 4RVHA 1JDTA 4MS4B 4ZYXA 4GUAA 1X8XA 4KR2A 2WV9A 4G65A 2YQ5A 2RAVA 2LIPA 5F2EA 2QAGC 1C1XA 1SHLA 1KJ9A 1RM0A 5F9MA 1EM6A 3ROFA 1P81A 5JCJD 4TLMB 2V6BA 3NRCA 5G02A 3U17A 2D2XA 2VUSA 5DYIA 4DLSA 1H8EA 4EA6A 4YAOA 6AT1A 2WHPB 4Q37A 4JJ6A 4TRRA 2R85A 2HF7A 2HF2A 3IQHX 2JFVA 1YS9A 4YPFA 2IYXA 5CB4F 2FLVA 1OXXK 5FRDA 2IU6A 4G9EA 3KLPX 2P2YA 3GVPA 4L51A 5AVUA 1LPPA 1HDGO 1A0OA 3DLHA 3AF0A 2FEMA 1A9OA 1FDOA 3ILYA 3DEAA 3QU7A 4IWNA 2XBUA 4MUXA 3RRXA 4J0HA 3A28A 4PZUA 4KSBA 5T4FA 5TVGA 1PJ3A 1X1QA 2QL5A 3WLPA 1FMJA 1KDOA 2GESA 2ZBVA 4QYXA 2DWPA 1WX1A 4GBJA 4X1IA 2WQZA 4BB9A 4B6JA 1E5LA 1ID1A 4DYVA 2H7YA 4BX2A 2P30A 2W6JD 5BOVA 3BFXA 3BFPA 3WL7A 2GD1O 1HDZA 1JU4A 1IN5A 2NYAA 5AKZA 4QJ3A 1H3EA 3JYNA 1WB4A 3AM1A 1U0BB 1Q92A 2PX4A 3PNLA 1YU9A 2H9AA 2XB8A 2PKCA 1VG0B 1P5ZB 4GSLA 1DDIA 1XCJA 4WBSA 3NOOA 4DKJA 3HPRA 1XMJA 2JFZA 1X1CA 1VFNA 2C7GA 3AM4A 3RBZA 2O2ZA 4P4NA 3UAOA 5P8WA 1E4EA 2EV9A 4F2GA 1FXSA 1EWVA 4PW0A 5B6IA 1ZGAA 1E98A 4C7XA 3EIXA 1MOPA 2ZT5A 3EPKA 3ZNNA 4G2TA 3G2KA 1AB5A 1H8HD 1LB1B 1U0RA 4CQJA 2ECPA 2QMEA 5TY0A 4K6MA 4NE2A 3U3DA 3ZU5A 3CN9A 3FWPA 4N49A 1B23P 5C53B 1Z7YA 4P93A 4G6ZA 2J07A 4WJLA 4IAOA 4WN9A 3U1BA 5F7OA 2ON6A 4J0GA 3OY2A 4BNXA 1BVHA 3TS1A 3FTCA 1IIRA 1KFCB 2DY0A 1NASA 4MINA 4U9UA 4Y98A 1L5KA 4DHWA 4X62B 3QV2A 2O8FA 3ICEA 3G6WA 3EGIA 3IERA 1Q17A 3T5GA 4DARA 1J22A 7MDHA 1DSSG 2FX2A 2Q28A 3EWSA 5DGIA 4DJDC 2GF9A 4AVYA 2V4ZA 2RDMA 4JEIA 3R3WA 3HRIA 2XZLA 4R3UC 1PF7E 2Y1DA 1ORVA 4RY0A 1UDXA 1ZH4A 4UDXX 3UJPA 4D46A 1E7QA 1SUIA 3DB1A 3IOMA 3AB3A 3JQAB 3S2SA 4D9IA 1QE5A 1VC2A 3OOSA 2ZJ8A 3MC1A 1ZYUA 2A4KA 5CP8A 2O1SA 2XQVA 3B7PA 4URUR 1BMDA 5EIEA 5FXMA 2VQDA 3R23A 2B69A 1E7WA 1XN4A 1MG5A 1TW3A 1PNVA 2XCUA 2B8JA 3E53A 4HNRA 3TCXB 4BO0A 4CMGA 4G84A 4YCAA 4BLVA 4F85A 1CU1A 2CL7X 1B41A 4FT2A 3AVVA 1I2ZA 1VLHA 3COSA 4HMPA 4J1NA 4BAZA 1M2WA 1KZYC 3ZD7A 1IONA 5CNIA 5L4SA 1PX2A 4L9SA 4AJKA 2I54A 3L40A 2B3DA 5NULA 5J2UF 2ZI3A 5LM3A 4C4ZA 2IY9A 1PL0A 1JEJA 3OAAA 4OFWA 4WKNA 3ZIDA 3ASYA 1OA0A 2CHUA 4WDQA 2QT9A 3EY9A 4WGFA 1DDGA 3TPCA 2HF8A 2V1UA 2BONA 4Q3KA 2HZ7A 3WJAA 1JTVA 5K8IA 2A0WA 1WXIA 3F7MA 1SCBA 2M2IA 5D8DA 2C84A 1H2HA 2J5QA 1EDOA 3FDIA 4IG9A 4RVFA 4X71A 3W8FA 4BXOA 1BG6A 3RYHA 3H2KA 3K3PA 4LJ8A 5L8VA 5JCXA 1T0PA 3MFQA 5NLLA 1CUDA 1TKRA 1J06A 4C88A 3IJPA 2VHZA 1VLQA 2FSVC 2OHHA 1XZKA 4LG1A 3FBGA 3I4CA 4Y1RA 3KB1A 4H1HA 2C59A 2W00A 3OE7A 1U3TA 4F2PA 3I2KA 3NBYC 3FUCA 1DKRA 3O90A 4YMUA 1FY2A 3KZMA 1NF8A 5CA1B 5G4KB 3MHTA 2QVCA 3HCBA 4EW3A 2BHNA 1VQ1A 4I9HA 2YXNA 2IP1A 3VU0A 1ZK1A 4TLBA 1G9SA 1JAZA 1I9CA 2OHFA 3AEUA 7AT1A 1JN0A 3EPLA 4GPTA 4G67A 1VRWA 5BT8A 2ZB8A 4Q4DA 2GKSA 3DZCA 4M76B 3SEFA 1U2QA 1O87A 4LHSA 4Q1EA 3D7MA 4GKVA 3NXSA 5EA2A 4BLTA 4X66B 1QF9A 1QVRA 3E84A 3QI2A 4EWLA 3KZVA 3AW8A 2EKQA 1INLA 1SUBA 2LRHA 3MCUA 1EUDB 4H0CA 4QXOA 3PXGA 4JODA 3C6BA 3GGGA 3GNTA 1JXOA 2WMYA 1R10A 1J8MF 1ELOA 3VJLA 1E2DA 2CDBA 1N78A 1ZGBA 4OQZA 3SKYA 4D97A 1Z5VA 1A72A 1EG7A 2PZEA 4HTAA 2V6MA 1EXWA 3S2GA 4RTQA 4MUIA 3UPTA 1X94A 5HJ2A 1DWQA 1RAHA 4WKGA 5DHAA 1P1CA 3TZHA 2CEAA 2PS3A 3WLFA 1Q0TA 3I23A 4KRYA 1J5PA 3I05A 4TWZA 2W7TA 3MGGA 3V2GA 1PP4A 2XBLA 4PYMA 5B4UA 2HSWA 3L2OB 3H9BA 2GTPA 2QP4A 4ZQFA 3VNBA 4BASA 1KDZA 4E7PA 3E9MA 1YDMA 1DC4A 3OY7A 1GCOA 2ISCA 1T4DA 3IBYA 4X1KB 5F1KA 4KCGA 1NY6A 4OI2A 5LQUA 4EJMA 4X3PA 3UJDA 3ZCRA 1UKCA 3W4JA 1Z13A 1E6EA 1BFDA 1XN1A 2NTVA 5E2AA 1JHMA 1HDXA 5C7LO 4WI1A 5DISB 3E23A 3OEHD 4H6VA 3CSSA 3O2JA 3L18A 3W7BA 2WUFA 1KJWA 2Q6IA 2R2AA 3EODA 3E03A 4AJ1A 3A9RA 3A25A 3KTFA 2XE8A 3DB2A 1Y7LA 5HIKA 1KAEA 4KQCA 3L4KA 3WLLA 1F06A 4IGEA 1H2BA 5BW6B 3KM0A 1WKVA 3H65A 2JD2A 3E9EA 1U90A 4AF8A 4YO7A 1U7OA 3IVXA 3VPBA 4EABA 1Y6FA 4L8LA 4MGHA 3MJRA 1OROA 3EE6A 3FFBA 3I30X 4F12A 4ZQHA 2QPOA 3CLRD 1R6XA 2BR3A 2X6QA 1XDZA 2BFNA 1YA8A 3ETNA 1NQVA 1Y6ZA 2UAGA 1XLTC 1V0JA 3HN6A 3NYQA 5EE9A 4U39A 5FAXA 4C0QC 4CUKA 1G8MA 1UOQA 2MMCA 4U1RA 4DXDA 3LI2A 1TYEB 2WFZA 5CIQA 1VPEA 1Z7GA 3BK7A 1MJGA 5HZGA 4B46A 2XDAA 4NS4A 4MDFA 3C3CA 5E9JA 5EJFA 4AURA 4YRRA 2C92A 1PFYA 3I9JA 1K0UA 3OT5A 1KYQA 1A5TA 2QJFA 4O08A 4EUEA 5KOYA 5D7BA 3LWBA 5L4NA 4KDEA 2VP0A 4R54A 1X2EA 2VXOA 3QBDA 1L8OA 3USZA 3WB2A 2VYND 3CNQS 3R6LA 3OM1A 4HB2A 2AOTB 1ADGA 1XB2A 4RK1A 2ZRLA 4NU8X 4KQFA 3T7CA 3W2HA 1FDUA 5EVCA 1NQXA 1MRSA 3RG8A 2BYTA 4MW2A 1Z2CA 1NTRA 1PKEA 3CWCA 1JAIA 3H99A 4FSDA 4OJYA 5FTWA 1R8QA 2B7LA 3QVXA 5K3SA 1R0SA 4N5IX 2PWAA 4D7AA 4YCJA 1OU0A 2OGUA 4QDXA 2D5CA 2LZ0A 2XCIA 1KMQA 1HE8B 1E4YA 1VHJA 1ZGHA 4FYIA 3ZEIA 3OTOB 3HU5A 4J0DA 5CPBA 2FN9A 4TKVA 4RE5A 2GO1A 2X3FA 3DMYA 3RVLA 2CV0A 4KXMA 3ZXIA 2WYHA 4MS3B 4RXUA 2PT5A 1CYEA 4NG4A 1XNQB 1X8LA 1PKXA 3HCFA 1P1BA 1PEKE 2VAWA 4WDRA 4ZZ0A 4POOA 1FSSA 1B26A 3LCUA 3VZCA 2ZOSA 4GNKA 4BUJA 5IBCA 3WX0A 3FPFA 1VJDA 1CZOA 3WZ2A 5JNLA 1DUSA 4MIYA 1GKUB 3RJZA 2Q3BA 5FD8A 4MW9A 3F4BA 4UQLA 3G02A 3H5RA 5DYNA 1OX5A 1G21B 1RHRA 1ZH6A 4ZWNA 5IVIA 2PX3A 3ROMA 4LN1A 5JYBA 3BWBA 1FA9A 4LXUA 4OB8A 1XZFA 3G88A 1ZAYA 1T10A 3T9AA 3T5BA 2PD6A 2XB9A 2Q0XA 1AB6A 1W73A 4P36A 1TQHA 1LPBB 1KS2A 1QMGA 1YB7A 2C8VA 3NATA 1HTBA 3SS9X 4C4OA 4CMEA 1ONNA 4KQMA 4YUWA 4E5PA 1HZJA 3ICVA 3MRVA 2C5BA 1QGUA 3PYLA 4FR5A 3Q5GA 4TSRA 5EINA 4IDPA 3ZCUA 5LYJA 1K8RA 5EHXA 1HO3A 3QXHA 1HYGA 1OFTA 2GCOB 4IOKA 3RIXA 4F5EA 3S1LA 2Z2IA 4RGVA 5JFOA 3I2FA 4IDFA 5DLEA 4LYYA 4K81B 3K9NA 4UM9D 4FSXA 2DR0A 3AERA 1GAXA 3QBEA 4D0RA 3CZQA 2YS7A 5AJZA 3T3OA 3COZA 5HCNA 4KQXA 1QZTA 2ORWA 1EZZA 1PR0A 4Y6SA 3HL4A 3ZHRA 1N2CA 4B7UA 1Q7GA 1DVRA 1MN6A 4FKZA 4IIVA 4IV5A 1A9RA 3UKDA 3IUYA 2HWXA 2A1UA 2B35A 2HXGA 3JZFA 4GEKA 3UATA 4NQRA 3TW0A 2OXCA 2I2WA 3HCEA 4KACA 5DGDA 3T4EA 1N2SA 4PGHA 1WNFA 2ZSDA 4QDUA 3DMNA 3RC3A 4L74A 1OGYA 1YCDA 2QTHA 3GIDA 1EFPA 4P3XA 4P81A 3UOAB 4YJKA 1VHLA 4UHEA 1Q22A 2HRQA 4PX9A 5JSUA 1MG0A 4DWJA 2GB4A 2ZIFA 2D4AA 2P9CA 3EK2A 3O4HA 3ZGVA 3PT5A 2FK8A 2ZB3A 4DBLC 2YWCA 3H0CA 3QEJA 4IICA 4HX9A 4K9PA 2E6UX 3F2IA 2NVUA 3L8FA 3VU8A 1HURA 4QTUB 3ESDA 1O9BA 1QFYA 4TLCA 2PLNA 4XWTA 4IDNA 4ZVNA 4DSUA 2ERXA 1SKBA 3JARA 3KPYA 3BYZA 4IMJB 4IS2A 4N01A 1N6OA 1OC2A 1PEAA 3GB9A 1JAXA 4PPFA 3S8EA 2K6GA 3EFEA 1U1GA 4PBSA 2PJDA 4N4AA 3CLTC 4L08A 1KYYA 2IS1A 4Z9BA 2AFIA 3OESA 1SUEA 4S2UA 1BA2A 4HX2A 4K9KA 3KLNA 2LCFA 4ZYVA 2B82A 3SFZA 2N42A 2ZJ2A 3CO5A 3GYGA 5CEFA 3D64A 3KT3A 4I5FA 4IRXA 4ZP1A 4MVJM 4V0RA 3M6LA 3OE5A 3V3TA 2BKXA 3MELA 4ER0A 2GRAA 3A7DA 4GR9A 2BBSA 2JD1A 1NQWA 5AHOA 3KKEA 2H2AA 2YN2A 4X92A 4XUCA 2HT6A 3THYA 1C7ZA 3KE9A 4TWAA 5IZCC 4D6XA 3L0CA 1T9GR 2PPVA 1ESMA 5JZSA 3Q1LA 1I4LD 4D8VA 1RBMA 2W2XA 3A1TA 4Z6KA 5HGXA 3QHAA 4GQIA 3G2LA 3TQTA 1PUIA 4LDQA 5JSKA 3JYLA 4QXMA 3WLSA 3WSWA 2WQ7A 4DLBA 4HLNA 2ODTX 3ETLA 1TO1E 2Y0PA 4QODA 2B3TA 3U4GA 4AJ9A 1YBMA 2AXNA 1F0NA 4DDKA 3R8FA 1PS9A 2ST1A 2A0YA 1B8VA 3DPSA 3MJCA 1X7XB 1RJ9B 1ZBDA 2ZI7A 3H11A 1X39A 1TQ4A 1QZXA 3I3OA 4KK4A 4BDSA 5HOEA 3U31A 2ZJYA 4B4OA 3ELDA 3FZYA 1FFXA 4LRXA 4G1BA 4Z9FA 1R37A 2BEVB 4YUVA 2XOEA 2ODEA 4WECA 3U19A 1ZAKA 5HE8A 3N2NA 4AXXA 1RPAA 4P0QB 4N9QA 3KQYA 1Y9EA 3OTQA 5AI8A 3WC4A 4E21A 2ZSHA 3ENNA 4EYKA 5BSVA 1Z5NA 1T4BA 3L7YA 5IM4F 4XOIA 2AJTA 2KM1A 3HBAA 4AP9A 5CIYA 4AY4A 4F92B 3U7GA 1CQZA 1DRKA 1FF9A 4OJNA 3ZY2A 5CITA 2M6LA 3PKZA 1EBFA 3HMKA 4ER3A 2PRKA 2I1VB 1ZD5A 2C97A 3ZLVA 2HB6A 1BE6A 2ZBGA 4ZQBA 3ZCPA 2X40A 3BMNB 2ENUA 3SK0A 5HQ3B 3HUFA 3IP1A 3LUFA 1I5OA 3BE8A 4DJ5X 3ZDYB 3RBXA 1Z0AA 3LDHA 2H7VA 1OKKA 1QH9A 4QYIB 2Q99A 1CV2A 4HWKA 4BMCA 2GSWA 1JL3A 4KFUA 3GD5A 3DL2A 1V45E 5IKPA 1F0KA 1V8PA 1U2ZA 2X7HA 2CFIA 2EGGA 3P4XA 1LVHA 1TF7A 3ZHVA 1IJBA 2YQ4A 1T0IA 1Y4DE 2AG1A 2WIGA 3AVQA 2RJNA 1T4CB 3AHEA 3OEED 3N6VA 3OBBA 3RSZA 1RJFA 3S8YA 4YRFA 2X0JA 3SZ3A 3SR4A 4UW9A 4RA6A 2WU1A 1U8FO 3OTIA 3V9PA 2A9PA 2IYFA 3G9XA 1US8A 3OPXA 4D96A 2EYUA 1Y1SA 4I81A 2XSZD 3OQBA 3VH1A 5KNCA 1I01A 1P6QA 1UM8A 4UUBA 3VC3A 1SXHA 2PHZA 2XVMA 3JYHA 1O6FA 2PJUA 3LRTA 1MR3F 2VBGA 2EGUA 5BMVA 1I6WA 2CHGA 2J33A 1SU4A 3FD8A 2VJNA 4HQNA 4TQ9A 2PS1A 1TM4E 3BF8A 4IKEA 1PJLA 1TGYA 3LDFA 3CUUA 4PLWA 4F45A 3I5XA 1MEJA 2P2NA 1LLQA 2VHYA 3ZTTA 4WPGA 1IY1A 2X6TA 3IAEA 3NHPA 4TN5A 4EG7A 1QORA 4O8ZA 3B3GA 3A14A 1E1QA 1LV7A 1XZJA 2C1XA 1CY1A 2CVOA 2AOXA 4JIMA 2CC2A 3TR5A 3W9UA 3PFBA 1UIRA 2V9ZA 2AOUB 2DWUA 1P73A 5FWYA 2HW8A 3ZU3A 1PS8A 3FYUB 4WLEA 4N8SA 1HDCA 3F4LA 2NZ2A 3Q5EA 4F1WA 1OH8A 4KR6A 3O4RA 1JPNA 1IL0A 3K16A 4R1QA 1B7GO 1N1EA 1A7KA 1VCHA 4H2DA 3VV2A 5A4JA 1ZLYA 2PUJA 2V9CA 3AR8A 1RYFA 2NUTA 2QTBA 2WM2A 4KE6A 4DIFA 4BTEA 1Z0SA 4D9FA 2IS2A 3MB8A 2W11A 5GOTA 3W0LB 2I3BA 4CKZA 3T7SA 2QLJA 3ES9A 4LYFA 5KQLA 3DD5A 5IAKA 1YONA 4MQ4A 1KPGA 2NQ8A 4JNKA 1WULS 4LK3A 4MR7A 4O4HF 3RYTC 3MA0A 4C9BA 1Z26A 3TM4A 1OTYA 1PFWA 2ID9A 2EFHB 1IMOA 2BFBB 3KELA 1YK1A 4BAGA 4BB5A 5H4GA 3SSNA 1H2WA 1V16A 1Q0RA 1YL7A 1RMQA 4GX2A 4L3OA 4M0FA 2H8GA 3IEUA 3A70A 4UMVA 1DE0A 4DSAA 2VP6A 4J2OA 4LJ7A 2C4KA 3SBEA 3ZLBA 1ZI8A 3A36A 3C3DA 2VYCA 3P5SA 4IIBA 4L8WB 1ISFA 5K3AA 4UATA 2MR5A 3I6MA 4RO0A 1GQYA 2RC6A 5F7ZA 1SIWA 3Q4GA 2Q4DA 3JTMA 4EBFA 2FFBA 2AL7A 1C3OB 2ZRNA 2ZB7A 4RPIA 5EIHA 4D9EA 3C3YA 2K4MA 2DPXA 1P1KA 2JFFA 2WUVA 1MC4A 3KCQA 4HEHA 4GYWA 4QQKA 1Z73A 4TXMA 5K51A 3SLKA 3OEWA 1UFRA 1KDYA 4LV5B 4Q3AA 1UQRA 5JALA 2ZAGA 1P39A 5JD3A 2PUCA 4F71A 5KTYA 1Z5UA 4GWGA 2B5VA 4EYEA 4MVJH 2HO4A 3K2QA 3Q9UA 1FQKA 4JJ4A 4ERXA 1MHPA 1QQTA 3PQ3A 4RZSA 2FRVA 1QIJA 3EWAA 2X4LA 5K3BA 1YJAA 1U5BB 3HTXA 2MSLA 4IDEA 4LISA 1D2HA 3KJXA 1T91A 1TZJA 4CDRA 3C1AA 5BSRA 2ZPUA 1U2GA 2Y1FA 4FU0A 4HR7A 1N92A 4RADA 6GPBA 2DBVO 1ILWA 3AW9A 5EWMB 4ZVLA 3K70C 2JANA 3NUZA 3DE6X 4OATA 4R31A 5KO2A 2HLNA 3IAUA 2BVNA 3GFSA 4X90A 2QUJA 3U4QB 2GM4A 3VNUA 1DBQA 1UPFA 2IYSA 3CPJB 3H2SA 4Y9RA 2DFPA 2RAUA 2V3WA 3NHBA 2CYBA 3C39A 4JJIA 4YWHA 4EJSB 4EGAA 4NDNE 4Q7QA 2O1EA 2PUGA 1W35A 2ZTHA 3DKRA 4LTDA 3FCEA 3NTQA 1JYSA 3ZE8A 1DCKA 4LUCA 4WXYB 2CZQA 4KX5A 3AIOA 5DNDA 4NATA 4HVLA 5J58A 2DLNA 2VC2B 1G4AE 4RIIA 1BD3A 4XXHA 5CVJA 5ESDA 3K31A 3TNLA 4ARIA 3EUFA 1N2OA 4XR4A 2ACEA 3BAZA 3EQZA 1EWKA 3SC2A 1YACA 4B81A 1Y4UA 3F4KA 3FR7A 4MQEB 3ZDXB 4RFSA 3DAHA 4D99A 2W2QA 4F56A 1SXJC 2GK6A 3FVQA 2I33A 2JZOA 1I3OA 3I9KA 2BD0A 3L7DA 1MX5A 2FJUA 3UMGA 2ODWA 4LDJA 2EKDA 2QE6A 1FJHA 1X0VA 1ZRNA 2VDWB 5B57C 6YASA 3HCRA 1IQ0A 2DSNA 1TYAE 1PFQA 2IXGA 3MT7A 3U40A 5DWDA 3M4ZA 3C8DA 4MK4A 4E09A 2GUGA 5A9SB 1HFWA 1AXRA 3GDGA 3PA8A 1GQFA 2F1JA 4DEXA 1KQPA 3QPVA 5IJ0A 5T5QA 4ER7A 2J32A 1JXQA 1ZCBA 8ADHA 4ZI7F 5UKDA 4HMOA 3EZXA 4OHUA 4O4IB 1C7EA 2E5FA 2PM8A 3D6VA 2C3OA 5TGTA 3SBOA 5CFOA 5L7WA 1N7IA 5IX8A 2BTEA 3D3QA 4KH0A 1F7VA 1ZN9A 4OFXA 4C4SA 5AJVB 4LCJA 4FNAA 10MHA 4A8JB 1DXHA 1ECGA 3F5DA 5DCUA 4ZHSA 3F9IA 1OBFO 1NXPA 4URVR 4W7HA 4EFMA 4FILA 2GETA 4UXJA 4HLUA 5LOVF 2BBTA 1DO2A 3BJIC 1B6RA 1H94A 1JQKA 1H6DA 4R8KA 3NGMA 5F7JA 3C3EA 3QF4A 1SBTA 3GXOA 3TLBA 1KYZA 5ICSA 2IOFK 2YRXA 3W90A 3A6PC 1W8IA 3EUWA 3F6YA 4IMPA 1KFEB 1ZRHA 1K8QA 2W5UA 4O4JF 5IDVA 4DJFC 3OIYA 3B70A 3TGPA 2C95A 3AO0B 3WL5A 4CU2A 1IM8A 2Z4RA 1W94A 2JVKA 2C2YA 1DJPA 1ENYA 2A9RA 4HDKA 4HYEA 4MV4A 3S2EA 5JARA 1G1MA 4HZIA 4KRXA 5DRYA 1U6KA 3PFKA 3PJRA 4RX1A 4Z4FA 1KARA 4KR0A 5AT1A 5DHFA 3VR4A 6Q21A 1CJUC 3CYFA 4KSYA 4BMXA 4GO1A 4QSHA 3TR0A 3ZTYA 4YWJA 1I7LA 3CLTD 3BULA 1TZ2A 1Y1QA 4ILKA 3I37X 2PL3A 5E6RA 4UMFA 1UF9A 4CM7A 3VNVA 1U1DA 1XD2B 3GGDA 3OF5A 2IU3A 4Q7EA 5I9TA 4E30A 4F2HA 4X1YB 3OZRA 4DIEA 3GPDG 1JEQA 3O31A 3B1ZA 3QVGB 2YNMD 4BVKA 2KE5A 3OOYA 2VDLB 3UXEA 4D3YA 2IYVA 2ZRIA 4M1ZA 4UTPA 1ZICA 5AI5A 3QXCA 4JR1A 1Y1PA 3KPWA 4J1TC 3CLSC 5TMBA 4RJTA 1VGRA 1VL5A 2EU8A 3GA0A 3FBWA 2AMVA 3L1HA 2X0FA 3BXEA 4YQZA 3SOPA 3TF5A 3CNBA 2FPXA 1KI2A 3CHYA 4YN3A 1YGYA 4DEVA 4BMYA 2Z2ZA 1C0LA 3O93A 3VBCA 2OAP1 3K09A 4LF9B 4L2IB 1T15A 2NVBA 1KGSA 2Q3LA 2Y1CA 3FTEA 1RADA 1NHWA 4Q3NA 2DFDA 3RIEA 3CLKA 3PTZA 1RBZA 5A5DA 1KI4A 2VI5A 1N8NA 2B37A 4Z4CA 1S2NA 2FQWA 4EITA 5JAPA 2X3YA 1NVUQ 4K6CA 3WGVA 2II6A 2GCEA 2OGTA 4UHKA 3DW3X 4NCAA 421PA 1D0SA 2R7KA 3TE6A 2XA2A 2FZWA 2RFLA 2XGOA 3KAPA 1SQFA 1UWKA 2C5AA 2HA6A 2I6TA 3D6UA 3O1JC 3WICA 3WWZA 2PX0A 1KOLA 4CV1A 3ED5A 1LWNA 3QKUA 1UJNA 3FVTA 4GPBA 1Y4ZA 2JW5A 2OPHA 1U2SA 3JS5A 1GPKA 3TFQA 4DLTA 1A97A 2Q3FA 4DY4A 1E2QA 2VATA 2WKPA 2YWRA 2UUAB 5GZ3A 4Y6LA 4GC5A 3SZOA 2EFYA 2LNDA 1BOOA 1IYZA 4HN4B 4DUPA 5K0SA 3UHFA 3L6CA 5TX7A 2GILA 2FZKA 1RCTE 3SXUB 3WYNA 2V54A 3F2VA 1TC2A 3FYUA 4CETA 3DXYA 1OIVA 1IDOA 5M3BA 5LL6P 3AJDA 4NENA 1CUFA 4ZQCB 2W70A 3CCFA 5CR9A 3PHCA 4I3FA 4Z1MD 4XM1A 5A03A 1SZPA 3BL8A 3OZXA 2ETVA 3A4MA 4R6XA 1L1FA 1ZK0A 1TQ2A 4J3FA 3EXEB 2ISQA 1RKBA 4F46A 1U7DA 4MVJI 1OH5A 1U98A 2BH9A 2HBYA 5IJ9A 5KC9A 4QBIA 3F67A 4GKKB 2ZYWX 2AMLA 2X9GA 4KQGA 4DV2B 1XLVA 5KJCA 4L3WA 4BXOB 1M1UA 1ZIXA 2H08A 2O07A 1H6AA 3OSZA 3VU9B 3Q88A 1IJFA 3H3JA 2P3OA 2IV7A 3U6KA 4X1YA 1NVTA 1P77A 4TT8A 4PAQA 2ZRAA 3JQCA 1T9GS 1PO7A 4R16A 3RKSA 4G36A 2F8LA 2JRCA 4AX8A 4F9EA 3HUDA 6ADHA 4IJ5A 1BA3A 5B2EA 1EJ6A 3LSTA 3ERCA 2SKDA 3ZXXA 1Y0BA 4MVJG 4L0DA 1E79D 1NW8A 1XTSA 2ZWAA 2XWPA 4X3CA 4Y9TA 1O95A 2H1LA 3VSDA 1UZNA 5DASA 4ABYA 4B5LA 5K8UA 2CK3A 3TD9A 3L1KA 1B4DA 1GPNA 3F3KA 3KQSA 5FOTA 1NAHA 1ULTA 2W2VA 4DZRA 4ZVUA 2IHJA 5T8KA 5JI3E 4HFRA 3GBVA 4FOOA 4D57A 4HT3B 3MGKA 3VAYA 5K4GA 2ZTMA 1SWVA 2R48A 3H11B 1B2LA 1RAFA 3N2KB 3NJ8A 1JDPA 2D2VA 4YV1A 3HLTA 5EN4A 2OCAA 4J29A 3TR6A 1T24A 2Q1UA 4CIWA 1JS1X 2IQIA 3QKRA 1GRQA 3RU2A 2CHEA 2XQIA 2OR3A 3M1AA 1X1TA 1DAOA 2H4FA 2CBGA 4GXTA 4LECA 2YY5A 4Q15A 2IXBA 1GSHA 3MLAA 5EL0A 2P9BA 3TJMA 2YZ7A 4PGGA 3IUJA 1NQ5A 3ZCQA 2WICA 1PJBA 2C2XA 4OSOA 2AZMA 2XB4A 3QKSB 1UXJA 4NENB 3TN7A 2PN1A 3KT6A 4KMMA 2C31A 4QBHA 4LFBB 3L4EA 2FQYA 2GJ9A 4L72A 4BMSA 3EA0A 2OORA 1KK0A 3NR2A 5A4DA 5M34A 2V7GA 4A7PA 4OGLA 3OLYA 4FW9A 4CRWB 5CLLA 3KBBA 1M66A 2VA8A 2HAEA 2X15A 4KIFA 1YB6A 3NGXA 4I50B 5EI5A 5GPBA 4RM3A 1YBFA 2C61A 2ZWOA 3K35A 4B48A 1WS6A 1TAUA 1JA1A 2BCJQ 1HL7A 3OQ6A 2VJKA 1IRIA 4CM4A 2YL2A 5DNEA 1YI0A 5HHTA 4B8WA 1C0PA 2VJDA 4GW3A 3AHJA 4DNFA 3GVCA 2FZLA 4LXQA 4Q1AA 1JHPA 3CZMA 5LA6A 2WWFA 3BE5A 5H70A 1NJ1A 3OLCX 5E38A 3NHAA 4J94A 4PZDA 1NUQA 4AF6A 3LPDA 3MJFA 5DM0A 2OV2A 3HKBA 1O08A 1OZ0A 1KY5A 2JFBA 1Q1QA 3NDIA 3OWHA 4JI5B 4CLOB 3ZWPA 5FTJA 3CUWA 2C1ZA 1I1OA 3VMMA 3KQTA 3RUDA 2Y1KA 1QU2A 2LDBA 2J09A 3PU6A 3VKHA 1JT9A 4YRGA 4MQFB 4AZ3B 1HY3A 2DHCA 2PSFA 3JCZA 1I2AA 5BSUA 4GE3A 5F78A 4UBMA 2PXCA 3ETJA 5B5SA 4KWIA 2P1ZA 4BFSA 4WY8A 1QQ6A 4I6EA 1GGHA 1OTXA 1V8ZA 2UDPA 3AJ8A 4I1RA 2PUBA 2XI4A 4FYPA 1YJBA 4JVMA 1SUCA 3KTDA 3L6DA 3BHIA 1XCLA 3PG5A 3IV9A 4FGLA 3C1UA 3IUBA 1MQ9A 4N0PA 4Q1CA 3K9CA 2NGRA 4RHYA 4HS9A 3K6SA 3IEVA 1SNYA 3A4NA 3BWMA 4FR0A 4P3YA 5G1PA 1WXEA 3ZHTA 3Q40A 4Z7JA 5A05A 3AEYA 4DV7B 1KERA 4IO1A 3D6FA 4UUMA 1OXKB 3RQSA 3M1IA 1AZSC 4NMMA 4KOEC 5T4BA 5JO0A 3N2YA 5FAKA 3ADDA 2X76A 1RRGA 1YQUA 1QYDA 4QOFA 4H7EA 4ND5A 1T5IA 3S29A 2VF7A 4WNCA 2J9RA 2ZBEA 3T38A 2A1TR 1M74A 1CZHA 3HGQA 2NZWA 2EGHA 5IDYA 1RXSA 1XA0A 2F43A 3LY5A 4UCQA 5EP2A 1NDHA 4MVXA 3D6TB 4RSGA 3W2IA 2PUVA 2JIDA 3EXIB 4NZ9A 4PZYA 3ROKA 5A3QA 1KO5A 1TUIA 2IPMA 2X1LA 3T7IA 1F2UB 3WNDA 3UMVA 2Y1OA 4GNRA 4A8TA 1G7RA 4GVPA 2JK1A 3CB2A 4PTYA 4QNMA 1CJVC 2O2XA 1QAQA 4TKVB 1X1BA 1JU3A 2AG0A 1MF7A 3FZQA 3MT9A 1EVYA 4E13A 2I6UA 2KBEA 2B61A 4C6TA 4DB2A 3KKNA 3MOIA 2OILA 4ENUA 4PSUA 5JCOA 2VWHA 3BL6A 4KLAA 3IJ5A 3NUQA 2ZWIA 2HNKA 3AHDA 4ZOCA 3WB9A 3E3LA 3NDBB 4CKWB 5L40A 4C4TA 1K9SA 1NUHA 2EF0A 3TD6A 3A1DA 1QRSA 4F9TA 3WB1A 2F3UA 3KKQA 4DR3B 2VDNB 4UFPA 5FWXB 4D92A 4W1QA 2AD5A 3L1IA 3Q7QA 4QYIA 3BBLA 4O0LA 1YHZA 1ADCA 2DPHA 4PZCA 2BGJA 1JMVA 3F6PA 3TRKA 1PL6A 2FFRA 4H1WA 1GL6A 3V5NA 1EWRA 1P5FA 1WQ1R 3A1WA 3QYFA 1IWPB 2O14A 4YP7A 1PGPA 1U7HA 1TJYA 1GZ6A 1W75A 2AEMA 3UQZA 3UT0A 5JAIA 3PHGA 1XWFA 4R1UA 3RC8A 2PL9A 1HK7A 5AI6A 1E8DA 2VDUE 4P53A 4HDMA 5HCIA 2CL6X 2TMYA 2PGXA 3BRWD 5IPFA 1GPH1 1RS0A 3R7WB 1BSVA 1VJTA 1LDYA 1DEXA 2EZTA 1J6UA 2V8OA 3HC7A 3OC6A 4MDYA 4WZ6A 4KNYA 4N76A 1P8AA 5AVSA 1RXVA 1FFHA 2A0UA 3SX2A 2W4IA 4ZTZB 2Z98A 3DCJA 3EOZA 4AUEA 3ITNA 4CFZA 2WTMA 4KXVA 1LXCA 1E20A 1JLLA 2I66A 2W6MA 4HH3C 5DU2A 3AESA 2CUKA 3HE3A 3RS9A 2W2KA 4GICA 3BXPA 5BN4B 2BEKA 5BUSA 1EK5A 1RI5A 2WSSA 5EWMA 1PDWA 1VLVA 3C74A 2FPOA 1CRLA 4G0UA 1EBBA 1LV8A 3RSLA 2OO7A 2W2NA 3JD1A 3FW1A 2HPZA 3X3HA 3BGIA 1EI9A 4BNFA 4ENWA 1Z63A 2CL0X 3GT3A 1CQXA 4EJSA 3FHJA 1CQWA 3ADPA 1SCIA 2EIXA 3L77A 1EVQA 1DBRA 2FWBA 2C0PA 4NQZA 3T9CA 4C4XA 4UHJA 1WMFA 4TV8F 1UIMA 4WKCA 3V4SA 4AN0A 2YYZA 1Z5OA 1YFKA 3HU2A 1YKFA 4PZPA 3RODA 3AR7A 3N7TA 1Q91A 1YB2A 2XNJA 2VQ6A 2UYHA 1MJFA 4ZKDA 4K9MA 4QPCA 1LKZA 3UIEA 4BNYA 4HOYA 2XMCA 5TQ2B 2VP5A 4J9VA 4FKBA 4BBJA 2Y6VA 5EUCA 2HK8A 2R68A 4FFMA 4JASB 3CBGA 4B75A 3DVSX 3M6XA 4N3AA 5CD9A 3UJ8A 1YOBA 3RREA 4QPPA 3UA3A 1PBNA 2R44A 3QUTA 4KG7A 3AUSA 2NSHA 3L8YA 2I4IA 4XGRA 2BKUA 4E4YA 1HI9A 2DCUA 4W82A 2O2IA 5I9SA 3CF4A 4K9NA 3RUAA 3CVJA 1M1NA 1GZSA 2XDWA 1DJNA 1XI2A 3ANXA 4ICIA 4LVCA 3UCFA 2DQYA 4JP5A 3LZ6A 4V24A 1N5IA 1NRJB 5KI6A 3AFHA 3M6WA 4HFMA 3K09C 3QWHA 1QCDA 2IHTA 3ZQUA 5B30A 1F8GA 2RAFA 5B64A 1AHIA 3C4JA 3THXB 2H92A 2N3ZA 2P6UA 4IQ0A 4WX2B 5DRTA 3Q7EA 5EG5A 1IOZA 1BX3A 4ML3A 4CHGA 4YBRA 2ZYDA 2BI8A 4PSVA 5CDFA 3R9IA 3SYKA 2PKRA 1V7QA 1XWWA 4KOAA 4PINA 1E89A 4DCUA 1GRCA 1CJCA 4QA9A 1S9DA 4RH3A 1K3UB 1OZAA 1R66A 2EW2A 3OUUA 4AMGA 5DCWA 4M1EA 1GUAA 1UK6A 1Q6ZA 4QHSA 5TQ0B 5HXAA 5JH7B 1CFJA 5IVKA 2J9YB 2AQ8A 4MV8A 3FNHA 4RUKA 1R7RA 2JFGA 2QTFA 3AI7A 2C20A 2W9XA 3UYKA 2L69A 1SBIA 2OL4A 1KU0A 4PAWA 2G8NA 2FY8A 5LN1A 4LJLA 1ECBA 1N3BA 1NMXA 4JBIA 1D0VA 3BGOS 3SIXA 4Q24A 3V42A 2O8BB 3ELWA 2NVOA 4B3RB 1YKGA 1LA2A 3K9WA 3WGHA 2QTLA 1GFWA 4TZ0A 5HQTA 1QGZA 3CLUC 1JPVA 2RGGA 4NCIA 4Y8VA 2GPSA 2O5VA 4DKXA 1U3UA 1YS6A 2XITA 1U02A 4CMCA 3DE7X 3PXUA 2BDUA 3IHKA 4UM8B 3VU3A 1ZY2A 4BJ5A 4KMRA 1P18A 1NBMA 2IP4A 3D6HA 4Z3OA 5I8WA 1W87A 3X1DA 1ZK4A 4B6RA 1I8TA 2CWDA 4YCCA 2HIHA 1O0CA 2P75A 3ZZNA 1NVFA 1Q19A 3T5TA 4MVCA 2PNFA 1NSYA 1KDRA 1X9GA 3A1UA 3KU4A 2ZIXA 4RQBA 3NC4A 2ZU6A 5LA6F 1GG8A 4A8JC 2VDJA 2JC3A 1M67A 1UT8A 2PJZA 3BKWA 1RP1A 2XRFA 3GOHA 3KTAA 3EULA 2HRRA 1FJ2A 1ZJWA 2B8WA 4D0NA 1MORA 3OU2A 2OXIA 5L95A 1T8WA 4YDQA 2CXSA 3HGTA 1DEHA 2GHQA 3HM2A 1VHTA 4RQTA 4REQA 2D0DA 2J0SA 5JECA 4R2IA 1GLNA 1OLSB 1SCAA 1YIDA 2Q6OA 2XXJA 4URZR 3DOHA 1JQ5A 4I5DA 4MUNA 3O38A 2BFFB 1F2TB 5CBPB 3CCBA 3O8OB 4E5DA 5B3JA 3R9KA 4XRGA 1P0CA 1TGVA 1GPUA 4LHZA 1GCUA 3JD4A 1GGMA 4GAEA 5IP5A 3HXOA 1YTUA 3ADBA 5E3IA 1BHQ1 1DU4A 4JQSA 2I4TA