5DP1A

Crystal structure of curk enoyl reductase
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
332
structure length
332
Chain Sequence
DQPVQLKLSEYGVIDNLNWQPMQRKTPLANEVEIEVAAVGLNFRDVLNALGLLKDYYAEHFNITSAEQLTFGFECAGKISAVGEQVSQWQVGDEVIGLLLHDGLSSFITTSVEYVVAKPKQMSFSEAATLPLTFLTAQYGLQHLAKIQPGERVLIHAAAGGVGQAAVQIAQVAGAEIFATASPSKWEFLQSLGIKHIMNSRTLDFAEEIMKRTAGEGVDVVLNSLNGEYIPQSLAVLTPKGRFVEIGKIGIWEKEQVKEKRPDVSYFPFDLQEAVQQQPGLIGQLSEELTQQWNQGKLKALPHKVFPSTEITAAFRYMQQAKHVGKVVVSMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Cyclopropanation by a Unique Enoyl-Acyl Carrier Protein Reductase.
pubmed doi rcsb
source organism Moorea producens 3l
molecule tags Oxidoreductase
molecule keywords CurK
total genus 104
structure length 332
sequence length 332
ec nomenclature
pdb deposition date 2015-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5dp1A02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 5dp1A01
5COAA 1A72A 1ZCJA 3GVXA 4XZ3A 3WNQA 4EITA 2P9CA 4FFOA 3KBOA 1SZJG 5TNXA 1VL0A 4XD2A 5A9SA 4CUKA 2WMDA 4J2OA 4NU5A 1LQUA 3JD0A 1I3MA 1EVJA 2VT3A 3EGOA 3WTBA 3SLGA 4CQLA 3L9XA 2LDXA 4BO7A 1U4OA 3VHRA 2X4GA 3MJVA 2VTEA 5IJZA 5K6AC 3C3XA 2NU9A 3H9GA 2GCGA 4XJSA 3W8EA 4CMCA 1R4NB 2VUTA 3C1TA 1A7KA 3PK0A 1AHHA 1ISIA 1LSJA 2V65A 5IAAA 1M75A 2G17A 3X2FA 5KJ1A 5CG1A 3U4CA 1ZH8A 4J4TA 2H9IA 1BWSA 3BHJA 4E2WA 1PZFA 5K0ZA 1YH3A 4F6LA 1Y5MA 1K3TA 3V1YA 1HE4A 3INGA 3QVSA 4L73A 4RDHA 1JW9B 1PGJA 3ANMA 1GQYA 1PZGA 2PZMA 3E18A 2C29D 1B16A 1IZ0A 4TVOA 1KEWA 3TL2A 4ILKA 3KSDO 2ZJ0A 3KSUA 1HRDA 4DMLA 4XYLA 3DZBA 3JYNA 1A9YA 2VOJA 2J6IA 1L7DA 4PVCA 1E6EA 5AXAA 2R6JA 3DFUA 5DNAA 1PZHA 1ARZA 1H93A 3GHYA 3TOZA 3L4BA 3DZKA 5U9CA 2JHFA 3JQ7A 3ZNNA 1MA0A 4OGWA 4CMIB 1HEUA 2QIOA 4OO3A 4GKVA 5CHEA 5DOVA 3WGHA 4WLEA 3NGXA 1WXDA 3IL2A 4GVLA 1JVSA 4CLOB 4FGWA 1TT7A 3BZUA 1LLCA 3KYDB 1HLPA 3GG9A 2PTGA 4MVJP 4XYMA 1K89A 3ZH2A 2GZ2A 1KC1A 3GA0A 3VDRA 2VHZA 1AGNA 3DHNA 2ZTMA 3UHAA 1MB4A 4RF2A 3RBZA 3TJRA 1LSSA 3RUCA 4YR9A 5HWSA 5GZ1A 3H4VA 1PS9A 2ZCUA 2GO1A 2VWQA 1HL3A 3AFNA 3BIOA 3OJFA 5TGDA 3DBHA 4B4VA 1ENZA 2WSBA 3RC9A 4GAEA 4BNHA 4DGSA 2VYVA 4FW8A 1ONOA 3NUGA 3MCVA 3VVCA 3ZWAA 3M2PA 2VQ3A 1SEPA 2YFHA 1X13A 4CUZA 4CLOA 3JTMA 4BGEA 4FFPA 1KEUA 1QLJA 4FIZA 4JGBA 4ZQHA 3INTA 1I0ZA 1O6ZA 2NU7A 5F5NA 2VHYA 1XQ6A 2I3AA 3GDOA 2VHXA 1RWBA 1B8PA 4I9UA 3JQ9A 1WP4A 5DT9A 2GZ1A 2X22A 3KM0A 3VTFA 1EUDA 5TF4A 2Y1OA 3LU1A 2BF7A 1GQQA 4RLHA 3VDQA 4E2YA 3AOEA 4HNGA 1PEDA 3PPIA 1QR6A 2Y93A 1L1FA 4D0SA 4LN1A 3NGLA 4MOWA 3WGZA 1ONNA 2EV9A 2W90A 1UP4A 5CPBA 4MP6A 1QRRA 5G0TA 3TZ6A 1K6IA 1JLLA 3EDMA 3ZWBA 4OOFA 4PRLA 4ZU3A 3I4FA 2ILTA 3F1LA 4OYRA 4GI2A 3ONDA 3U4HA 3WSVA 2PH5A 4CQMA 1QP8A 3ZV5A 3MJ4A 3QSGA 1ZSNA 2HK7A 1TB4A 2D5CA 4I5EA 1NR7A 1OC2A 4KOAA 4LMRA 5THKA 4XYBA 4Z0PA 3HUDA 3OJ0A 3DZFA 5L4LA 2DFVA 3WDSA 5IZCA 1HE5A 3PZRA 4I08A 3CH6A 4AJEA 2FSSA 3UN1A 4CM6A 1KVSA 3MEQA 1NXQA 2FSVA 1NBOA 2WEKA 3FCOA 4FN4A 2UUOA 1GD1O 4YWJA 4YDRA 4WCFC 1H9AA 3QIVA 3B6ZA 2EEZA 2ZIZA 3GNSA 1YDWA 1PJ3A 2GYYA 3KVOA 4YTEA 1EFKA 4OQYA 3ZU3A 5LDHA 4MPDA 5A9SB 1BRMA 1Y8RB 1DFHA 1A7AA 1B3RA 2BD0A 2POQX 4FOSA 1TT5B 1ZJZA 5AXBA 5JC1A 4QUKA 3NKLA 5A05A 4CLXA 2EJWA 4WPGA 2H5LA 3E9MA 1Y8RA 2WJPA 3ICPA 3C7DB 4F6CA 5CEEA 1F06A 4FSHA 2O3QA 4I9HA 1ZJYA 3L9WA 4YT2A 3HHPA 4E5YA 4YQYA 3COSA 3FR8A 4JLWA 2G76A 2WM3A 2GNAA 3JQDA 2B4RO 1X14A 1OZAA 3GN2A 1ZW1A 2Y1CA 1E3WB 3K30A 4HADA 1YB5A 1RM3A 2A92A 2RIRA 3FR7A 4PLCA 1WDKA 4XR4A 3E5MA 3G0OA 5HA5A 3ZNOA 4U0JA 3GZNB 3RWBA 3IOYA 3WWZA 1C0PA 1YJQA 2WYUA 3ZCXA 5B37A 4DYVA 4MDHA 4RQUA 1VJTA 2EERA 4WEQA 1M67A 3AM5A 3JV7A 2H1SA 3OIDA 3ZWXA 2PZKA 5A02A 1VL6A 3JQFA 4KQXA 3SEFA 1T25A 2OZPA 5DP2A 3QJ5A 4A5OA 3V2GA 3DDNA 3FRJA 1FDVA 2YV1A 3VOSA 3QQPA 5HS4A 1HDXA 1CWUA 1N1EA 2JCYA 3LT2A 4EJ6A 4CMGA 5LDGA 4KWIA 3CZRA 3SC6A 1YWGO 4TRRA 1LLQA 4AJKA 6ADHA 1SO8A 1QXSA 1RYEA 4IDEA 4TQGA 3VKVA 3CZMA 1HDGO 1Y9EA 2AXQA 3HADA 3INRA 3NTQA 3D64A 5KKCA 3IKVA 3G1TA 2Z1NA 1QG6A 2EWMA 3LT1A 1JQBA 1QMGA 1YVEI 9LDBA 4IGEA 4I8XA 2A94A 5CDYA 1BW9A 1N2SA 1ONPA 4GMFA 1JU9A 5EJ2A 5F1PA 2O23A 4HWKA 1YJ8A 2EW2A 4XJTA 3ONFA 1PS8A 5KJEA 1I5RA 3W4KA 4CMEC 3JQAA 1H6BA 1U9JA 4BB6A 4CMBA 4R5HA 4YPOA 2YHIB 3QVXA 4QXMA 4S1VA 3V2UA 1XG5A 4RF3A 1E1NA 3VC7A 3PJFA 4JP2A 1SPXA 2NSDA 4PFJA 2B37A 4DUPA 3PWKA 1ORRA 1PS0A 4LK3A 2VUUA 1DIRA 2WTBA 1T2DA 3GGOA 2AQKA 4P4GA 3S2IA 3BTUA 3ANLA 4WNIA 2LDBA 1UH5A 2VRCD 1Z75A 3VH3A 1KVQA 2PY6A 3GPIA 3HDJA 3H5AA 1DJNA 4I9NA 1YXMA 4U6SA 4BNTA 2FWMX 3GRPA 3WB9A 1RM0A 3KHUA 1HXHA 3DOCA 4E5PA 1NR1A 1YE3A 3BMOB 3JQEA 3HJAA 1EFLA 4GX5A 4LRTB 2C54A 1TT5A 4MJLA 4ND4A 3ZZNA 2Q2VA 4QFDA 3RFVA 2GERA 1YS4A 4EUHA 4CM8B 3EK2A 1ZEJA 3L6OO 5LC1A 3RD5A 4ZHSA 2V7PA 3I9LA 4W6ZA 2NU8A 1H6AA 2R00C 3UUWA 1DC6A 3EMKA 1IYZA 2FRDA 4UVIA 1Q7CA 2Y1DA 4UUNA 1YONA 2GN6A 5B4UA 3PIIA 4AJJA 2H6EA 3RROA 1AXGA 4DRYA 2FHSA 2X9VA 1U3UA 2JAPA 1ZMTA 1XU9A 4NBRA 2X5OA 2ZQZA 3OA0A 3C85A 5FYDA 2I6TA 4RL6A 4RPGA 2C20A 4I1IA 3EC7A 2X5JO 1MLDA 4TRJA 4GVXA 4HFNA 3PHLA 3OJOA 1KC3A 4R41A 2G5CA 1O95A 1A4IA 2E49A 3I9JA 5DULA 3V5NA 1ZK1A 2BMAA 4P22A 4UUMA 4BNMA 3RFTA 1E7WA 1DRUA 3MJEA 1LX6A 1BDBA 4NFYA 2HKIA 3WYBA 3V2HA 5ITVA 1P74A 2DPHA 4RGBA 4LCEA 2GSDA 1VI2A 3GAZA 1Y5RA 3JQ8A 1Q0LA 4LGVA 3AOGA 2NU6A 4XIYA 5KJ6A 1WDMA 2JD2A 2VTDA 1OI7A 1QYDA 2GDZA 3RU7A 2GD1O 4BNGA 1ZXLA 3JQ6A 4GPD1 3WGTA 3F6YA 4XB2A 2X0JA 1GZ6A 4BIIA 1V6AA 1UUFA 2AE2A 5AXCA 1DAPA 5IXSA 2EKQA 4MVJG 2D59A 1XEAA 4UVEA 5H83A 4BGUA 1E7YA 4CUJA 2AQIA 3ROQA 2D3TA 2E48A 3T7CA 4IDDA 3UOGA 3HSKA 3IJRA 1I32A 2Q3EA 4MP8A 4UVDA 3NTRA 1WWKA 4M8SA 2EKPA 1GR0A 4WGGA 5JDIC 1NASA 3DAGA 3LC1O 3ZW8A 3OFSA 1Q0HA 1FDSA 2PWZA 5HBRA 1PJCA 3HQ4O 3NX4A 4BKOA 4UVGA 4Z3DA 1Y8QA 4UEOA 5IDWA 1HYGA 4EUFA 4J7UA 3EW7A 4PLTA 5KJFA 1GADO 1ZIDA 1P0CA 3HFSA 3H9UA 3ZHZA 3EAGA 2EP5A 2VNAA 3KYCB 4KUHA 4AJOA 3GG2A 4P4LA 2WWRA 4QQRA 3GVIA 3DZJA 4CODB 1L7EA 4Y9DA 2NTNA 1ZO8A 1ISFA 4NK4A 3U62A 3CIFA 3RC2A 4D41A 4M89A 2CDCA 2Y67A 4J1TA 3CINA 2FZWA 3BMCA 1DIGA 2DBQA 2ZJ1A 4G65A 1HE2A 3PYXA 1NWCA 3DAPA 3IUPA 1HYHA 1P1RA 4Y8VA 4ESOA 2DFDA 1G0OA 4IJWA 4OHUA 5JFOA 4NBUA 1P1IA 3IP3A 3GVCA 1KEPA 3PGXA 1ADFA 5G4LA 4IDCA 1ULSA 3DHYA 4RF5A 5CFZA 4BMNA 1Z73A 6LDHA 1T24A 1N7GA 1DC4A 1VL8A 1BW9B 1ZNQO 1B8VA 1HWYA 3RVDA 3K2EA 4IDBA 4DPMA 2DBVO 3RFXA 1C1XA 4ZVVA 4D45A 4II3A 3E48A 3A9WA 4H3VA 4TKMA 4EJMA 1CERA 1BVRA 1ZMOA 3OSUA 1CEQA 3D3WA 1B2LA 2H63A 3RKUA 4CM1A 4ZQGA 3OJLA 4XDZA 3LT4A 4D3FA 1T26A 5F21A 1JWAB 1FXSA 4B7UA 4AJPA 1E92A 3OA2A 2WD8A 2Q99A 4KTVE 4CMJA 3O38A 2ZKLA 4B4UA 4FFNA 2HJSA 3NT5A 7MDHA 4UUPA 3LC7O 5DCWA 3K5PA 3GEDA 1ADCA 5KVQA 3KTDA 4IZIA 5JCJD 2YV3A 1Z7BA 2UUPA 4MP3A 4DLLA 3O9ZA 3S2EA 1XLTA 4Z3KA 4JBGA 4J9VA 4J0EA 4NJMA 3LVFO 1HDZA 1YDEA 5L7TA 5K1SA 3X2EA 1KS9A 3E9NA 4E4YA 4FR5A 5ILOA 3RAJA 3JQ8B 4YAJA 1ZK2A 3ZU5A 4CV2A 1QORA 5I9LA 4JBIA 3H65A 4O63O 3PVZA 3PJEA 4A26A 2OMEA 2HMSA 4CM8A 4NDNE 1EQUA 1H6DA 3B1JA 4E5KA 3GK3A 4R1UA 1HTBA 5JDIA 4WLOA 2RCYA 1N7HA 2CVZA 2Y05A 3H2ZA 4E6PA 2FP4A 3WICA 1OC4A 4XB1A 4EI2A 1TEHA 2D0IA 4MVJH 4E5MA 3RBVA 1EVZA 1GCUA 5DZSA 4CR7A 3PYLA 3PTZA 2DLDA 2C59A 1X1EA 2YV2A 1O9BA 3FNFA 4CMKA 2PH3A 2JFFA 3A14A 4JP3A 1GUZA 4IXWA 4CLEA 5A5EA 4BMSA 1WMAA 1C14A 1VSUA 1LJ8A 1EUZA 1DO8A 2ZTUA 1OAAA 5T57A 4WASA 2EP7A 3GGPA 3QRWA 1PWXA 2B36A 1E3SA 1UJMA 5JE8A 4FFRA 3IJPA 2O3TA 2HDHA 5COBA 2DKNA 2Q1UA 3UCEA 4JROA 1O0SA 2QW8A 4ZJUA 4DWVA 1LLDA 1JAYA 3NDIA 4FFMA 1LDEA 1GZ3A 1X7DA 1NNUA 4CM7A 1MV8A 2X9NA 3FPCA 1KYQA 1ENOA 5KOIA 2OUIA 3JD4A 2VT2A 1Q2XA 1ZK4A 3VZRA 3ZNQA 3AI1A 3JYQA 1R0KA 3QWAA 1KVUA 1B7GO 3OH8A 2J5KA 1NFFA 2QHXA 3TZHA 3GDGA 4AICA 1CF2O 3OIGA 1VJ1A 1NPTO 1R37A 1XR3A 4D0RA 4CMIA 1YGYA 3K73O 3FBTA 1YL7A 1XA0A 4KZPA 3PHIA 4QFCA 4QECA 2I99A 5I7FA 4E13A 2Y0EA 4PLYA 2IEDA 4NPCA 3F9IA 2B5VA 1C1XB 1EZ4A 5EQFA 3QHAA 4JBHA 3QW2A 5THQA 2DPGA 1T2EA 4RPHA 3FWNA 4CM5A 3SX2A 2NTJA 4CQMD 1GEEA 2GGSA 3GRKA 5HM8A 1MFPA 1X7HA 2HUNA 1U1IA 3N58A 4HFRA 2OBNA 4XX0A 1YO6A 3VZPA 2OL4A 1G1AA 2PKQO 4A27A 8LDHA 2F00A 3LC2O 4QEDA 3HG7A 5TLSA 1XYGA 3EYWA 1E7RA 1H6CA 3DBLA 3OICA 3MWEB 2O7SA 5A9RA 3L07A 4ND1A 1LTHR 5IZ4A 1V8BA 3AY7A 4J1QA 3ZWMA 3MJSA 4HXYA 2Q49A 2ZB8A 1SOWA 1V3TA 3G1UA 1YQDA 4QX6A 4ZICA 4PRKA 1E3WA 3VPFA 3WGOA 4R01A 5L4NA 4LRSB 1C0KA 2C7VA 3I83A 3SJUA 2PZLA 4YB8A 2Z5LA 2W98A 3A28A 4K1LA 3U3XA 2HO5A 4J7CA 1ADBA 3OQ1A 3F46A 4CLRB 4MIOA 5EPOA 2J3JA 2HMTA 2JKVA 3BHIA 3LDHA 2JJYA 3DBHB 5L7YA 2I65A 4HY3A 2TMDA 3IS3A 5A4DA 3TF5A 5I7EA 4TSKA 4UVHA 5JW6A 4EEZA 3O8QB 4OM8A 1QLHA 4PZEA 2PD4A 3Q2KA 5TJHA 5BSEA 1FDWA 5L4SA 1WAMA 3GHHA 4B3IA 1BVUA 1G0NA 3DMYA 4INAA 5B4TA 3WNVA 4J0FA 1GYRA 1MXFA 2AG5A 4TKLA 4ALLA 3QE3A 4BO5A 4DREA 2CNBA 4O5OA 2BGKA 1ID1A 4ND5A 1I30A 1GPDG 3SVTA 1XDWA 2P9EA 5MDHA 1HE3A 1G6KA 2O2SA 3WFJA 2I9PA 4R9SA 4W82A 2PFGA 1W4ZA 4MKXA 2BI8A 4U7WA 2Y66A 4W99A 4DLBA 2VOEA 4J49A 3JQFC 3ICCA 3PFFA 3IC5A 3PFWO 3AUTA 2C7GA 3K6JA 3WMXA 4NBTA 1ISGA 4YJDA 1EE9A 3H5RA 1MFZA 2QYSA 1P31A 2NADA 3ZWWA 2O4CA 3T7EA 4KQWA 5KIAA 5IF3A 5EMHA 1JAXA 3PDJA 3H3FA 2OP0A 4Z0TA 3ZWPA 4AJNA 1DHRA 3ROPA 3RC7A 2Q4EA 5H82A 1NYTA 2E6UX 2AE1A 2DC1A 2GN8A 3CMMA 1T1RA 3ZWOA 3BMNA 3U5TA 3KETA 4KTTE 3AU9A 5BT9A 3AM4A 4BKQA 1UXIA 4WEOA 1EE2A 2V6BA 4BO1A 4EDFA 4Z9FA 5DCYA 3U49A 5KTKA 1B3BA 5ADHA 4RVFA 1SB8A 5DCUA 3WBBA 5FEUA 4AJIA 3PQDA 4U6QA 1V35A 5BSGA 1S7CA 2FPGA 1PU2A 1GTMA 3PHGA 4FB5A 4XDYA 1ENPA 2OBYA 2DUUA 4CM4B 5L40A 4HFMA 3Q1LA 3OIFA 1IB6A 4AJ1A 2V6FA 1AN9A 3KYCA 4CM3A 4K28A 5EN4A 4B3JA 3KEQA 2GF2A 3PHHA 2QX7A 4DXHA 1PJBA 3GNTA 5CDUA 1NQTA 3KYDA 5ENDA 2BFAA 5A3VA 4BHTA 4JN6B 1DC5A 1AHIA 2WD7B 2NTVA 2ET6A 3OHSX 4R54A 4J43A 5IFLA 1PTJA 4GGPA 5BQFA 3DTYA 4IPTA 1LU9A 4Y98A 4IMRA 1I24A 3JQGA 2X58A 3C1OA 3OJEA 3VH2A 5CEFA 4KWHA 1KVTA 3AUAA 5KCZA 3UXYA 1PL6A 2C82A 2O3SA 1RYDA 4RVSA 3GFBA 1UZMA 1CETA 2YZ7A 4UEKA 4EGFA 5I9NA 2J3KA 1Y8QB 4GMGA 3S2GA 4FBGA 4M1QA 3C24A 2SCUA 3B70A 3IMFA 4YAIA 1U4SA 2VZ0A 4M49A 3NRCA 1RM5A 1LXCA 2RH8A 1DAOA 1WZEA 3R0IA 1UXKA 1LI4A 3I52A 1XGKA 3O4RA 1AE1A 1Y9AA 2J3IA 3KB6A 1C1DB 4Z0HO 3WQQA 3MTJA 1PGPA 3HB4X 1Q1NA 3JQ7B 4IUYA 4WLUA 2VWGA 4KDFA 3BTVA 4O0LA 3ZHYA 2DTXA 3K92A 4WE3A 5AOVA 4FJ2A 5BSFA 5J23A 4TMFA 1ZSYA 3DBRB 5EIOA 1LLUA 2DU8A 1GQ2A 4WJZA 5FFFA 2EJVA 3N7UA 3E8XA 4PG7A 1H2BA 1Z82A 4IDGA 3WLEA 3JSAA 3KXDA 4ALNA 1RJWA 4ALIA 1HZJA 1A27A 4BOYA 2PKQP 4MKZA 4QO7A 4X54A 4PIVA 2EGHA 3MOGA 4OH1A 4GWGA 4BNUA 4YJGB 3R3SA 3K9QO 4PZCA 4N54A 1VKOA 3BMQA 2YJZA 1QKIA 2XPCA 5DN9A 1W8DA 4E3ZA 1JVBA 3GPDG 2W4QA 4YEDA 4NK5A 1GPJA 1PR3A 2HJRA 1R4MA 3M1AA 3UICA 3WLFA 4YRAA 3DEYX 4K6FA 4WK6A 1JDJA 3GMDA 4ZQFA 4YT8A 3AUUA 5A03A 3P7MA 1C0IA 1SAYA 1D1SA 3RIHA 5KWEA 1EBFA 4XGNA 1NPDA 2W8ZA 3ORFA 3CXRA 3D7LA 1NVGA 2C07A 4MVJI 3PGJA 2X7HA 4NJMB 2Q4BA 3PDUA 5G4KB 1K2WA 5G0UA 3WOHA 4DIBA 2IZ0A 2C0CA 1P0FA 4YXFA 4TZKA 1V0JA 3W8DA 1VC2A 1D1TA 4FDAA 3BA1A 4Y6RA 3PJDA 2RBEA 5JAQA 2OFPA 3ABIA 3VPXA 4ONEA 4QSMA 3TQHA 2TMGA 3R1IA 1U8XX 3ZWVA 4K26A 1ULUA 2FR0A 3F5QA 3ENNA 5K6AA 1K6JA 1YB1A 4W4TA 3LT0A 3B1FA 4FJ1A 4YVFA 4Q39A 1VLLA 5TRTA 1N9GB 1Y1PA 2P5UA 1YOVA 2CSUA 3VKUA 3DAFA 2OGUA 1WNTA 4UUOA 4CM9A 4J6FA 3SJ7A 2D2IA 1MXHA 1EBUA 4HP8A 2JD0A 1R6DA 4A10A 4IQ0A 4DPKA 2VZ8A 2X0RA 3IKTA 4WLNA 2NV6A 4OQZA 3W6UA 1Q7GA 5I8WA 4FD3A 2W2LD 2ZQYA 2D1YA 4PLGA 4IDAA 3D5QA 4Y6SA 1GYPA 4XEHA 5L95A 2E4AA 3JYOA 4RVHA 4PG8A 1T4DA 4Z6KA 4E2ZA 4NFSA 3G49A 4ID9A 3E82A 4Q3EA 5A1TA 2YQ4A 4JJFA 2PGLA 3RUIA 3EVTA 1SB9A 3HDQA 3VVBA 3V1UA 4GX2A 4RVDA 2HU2A 3DFZA 3WGQA 4BNKA 3GUYA 3UW3A 4ALKA 4JXKA 5DDIP 3PEFA 4CR8A 5I7VA 3DZHA 3UCXA 3RASA 1XSEA 4M86A 1K0UA 1OMOA 2IDZA 3IIEA 1NVTA 3FBGA 1VJ0A 4J91A 1J5PA 2BH9A 4CM4A 1PQPA 3K2BA 1Z6ZA 2YUTA 1ENYA 3E5RA 1GL3A 3FNGA 3G17A 3L6DA 3RUHA 3U09A 4NNJA 1EVIA 1ZKMA 2PKRA 2VN8A 2EG9A 2IRWA 4IJKA 3CPSA 4R1NA 1U7HA 4U0KA 4XQGA 3WQRA 4CL3A 2XOXA 5FF9A 3LF1A 4W7IA 3AU8A 1Z7EA 4A03A 1BXGB 4DYDA 2PGDA 3HDHA 1S6YA 2PD6A 1E6UA 4KDEA 3QV1A 3IUSA 1E3LA 2EIHA 4DIOA 4XWYA 1LRKA 3DXFA 3IDSA 1UZNA 3UVEA 1ZEMA 1YQGA 2VRCA 3G3EA 3BMOA 4JQCA 4EYEA 2XXBA 3M6IA 4D46A 2J3HA 1WW8A 2VUSA 3ZU4A 3KEOA 4L4XA 3UF0A 2VYNA 5BNIA 3WX0A 1BTOA 3QLJA 4LSWA 2HQ1A 4XA8A 2X8LA 4HBGA 5AVOA 3O8QA 5G0VA 3VPHA 3BAZA 4E21A 3DHEA 5IN4A 4Y67A 2BFMA 4EW6A 4FOOA 5ES3A 5T6BA 5KKAA 4TRNA 4DC0A 1P1HA 3S1LA 1XU7A 5JS6A 1O8CA 5L9AA 1YQXA 4QT0A 3ETEA 2NQ8A 4BL5A 4CL8A 3D4NA 3D5TA 3ADOA 1U3WA 5EINA 4WLFA 4IBOA 4GX1A 4PGFA 1UAGA 4L9RA 4AJ4A 4F46A 1U5CA 2HSDA 2P9GA 2I76A 2NM0A 3DC2A 4B7CA 2EHDA 5FI5A 4BKUA 1BMDA 2YHUA 4YJHA 2CMDA 3OEYA 1PZEA 1MG0A 3GUCA 4GL4A 1PQWA 2O7QA 5C3MA 2X1HA 4ZD6A 4J9UE 3AM3A 2C5EA 1KY4A 2ZTLA 2ZYDA 1WDLA 1ZK0A 5U1PA 1R12A 3GQVA 2UVDA 4FGSA 3NJ8A 1TLTA 1WPQA 2WYVA 1I33A 4NHEA 3IAHA 1SNYA 1GV1A 4H15A 1PGOA 3NTOA 1J6UA 4LCJA 1OOEA 4GBJA 4J4HA 3H9QA 3VZSA 4AL4A 1DIBA 3N74A 3W4JA 4D44A 5DP1A 1AUPA 2CUKA 4YRBA 3AOEC 4CPDA 5JDCA 5JCJA 2CD9A 4GKBA 1V3UA 3NT2A 4CV3A 1PGNA 3W4IA 2D5AA 1Y6JA 3JQ9C 1MX3A 2GR9A 4Z9YA 5HRUA 2PLAA 4M54A 1N1GA 4JK3A 1LDMA 4RCVA 1E7SA 2VYVD 1E6WA 4YJFB 1YB4A 3F5SA 2X5KO 4MVJF 1JKFA 4MVJE 3WS7A 1H94A 4BNJA 1NWHA 5I9MA 3ZWYA 2X23A 4YBZA 4PLZA 2X6TA 3U4IA 3Q2IA 3I9MA 4TVBA 4WCFA 5C5IA 1A71A 1A9ZA 3H7AA 1H5QA 4E2XA 1UXHA 5GMOA 3KSZO 1ZBQA 1AXEA 3E9QA 2BELA 4GH5A 4R1SA 3UH1A 2DQ4A 5IZCC 3GLQA 3GEMA 3I23A 1IUKA 4EUEA 1HZZA 1P1JA 5JAZA 1PWZA 1FK8A 4XGIA 3LZ6A 3ANNA 4FPXA 1P1KA 3VTZA 1ZVMA 3TNLA 5KVCA 3ZGYA 2VYND 4I5DA 1LDBA 2PR2A 3NDRA 3S55A 4BV8A 4PZDA 2QRLA 4DQUA 2V6GA 4ZGWA 1V3VA 2EGGA 3AWDA 4ZQEA 1UXJA 2OHXA 4R1TA 5TJ9A 4D3SA 2UAGA 4Z9XA 4YACA 3ZU2A 4BMVA 2FN7A 4N5MA 2JCXA 4HFJA 4DA9A 3PYMA 4N5NA 3RKRA 3LF2A 1JWBB 4NFHA 1GV0A 3FI9A 3L4BC 4Y6PA 2GPTA 3Q6IA 5KVSA 3ZV4A 1NFRA 3QA9A 4R5MA 5G2OA 4ALMA 3K31A 1B8UA 4XGKA 3I6IA 5DF1A 3E1KA 4RORA 3ZV6A 1NQ5A 3T4EA 4Q3CA 5JBIA 1E5LA 1OFGA 3TZCA 4CQMB 5L3ZA 3JQAD 5U4QA 3FN4A 1IHYA 2YDXA 4IJVA 3OQ6A 3CE6A 3OECA 2A9FA 3QWFA 2EXXA 3AK4A 4PG4A 3M2TA 3WBFA 1PX0A 4ZRNA 1LA2A 1PJSA 3KYBA 4DPLA 2YQ5A 2AQHA 4YCAA 2I5PO 1SBYA 1YL5A 2O3JA 1HETA 1DEHA 1B26A 3R3JA 4FCCA 5JPIA 2NVWA 4DBZA 3C1AA 3ONEA 4ITUA 2HRBA 3LYLA 1KBZA 1QV6A 4JCOA 1X15A 2YDYA 5G4KA 2CY0A 2CZCA 2Z95A 1VRWA 1CIVA 1YL6A 2NVUB 2QRJA 2QG4A 1BXGA 3E03A 2NWQA 4G2NA 4CMHA 2B0JA 1PGQA 2B35A 1CRWG 4RF4A 3DOOA 4RDIA 1GUYA 3EHEA 3VPSA 1MUUA 3TZKA 3PWZA 3QWBA 5EL0A 2BFOA 4RVUA 4F3YA 5GY7A 4YJGA 4BGIA 3ITDA 3RQSA 3TFQA 4GQAA 3HFGA 3VH4A 3GNQA 1NFQA 4J1SA 1T1SA 4LVUA 1OBFO 3MOIA 4GLLA 1GFSA 5HS6A 1DJQA 5JSFA 1E7MA 4FC7A 1HLDA 4UAGA 2B69A 1LC3A 3RUEA 2JFGA 4O1MA 2FOIA 4YAKA 2Q1SA 4R3WA 2Y68A 2PNFA 2VCYA 4BB5A 3OF2A 3LQFA 3DBRA 4EBFA 1M66A 3SC4A 3NT4A 3PRJA 4BNXA 1RPNA 2J5RA 3CKYA 3DL2A 3GEGA 3GT0A 3F4BA 5C7IO 4L4SA 2Z1MA 3PZBA 2HAEA 1D4FA 1EUCA 2YFQA 3DZGA 4XKJA 3P2OA 3OBBA 1BSVA 1GU7A 4TROA 3WJAA 1BXZA 1UR5A 4IIVA 4JX8A 2R00A 3ST7A 1VSVA 1NHWA 4BNIA 5B4VA 2UDPA 4R4JA 3JCZA 4B3HA 4CR6A 3I1JA 4L8VA 1WMBA 1YBVA 1IY8A 5IXYA 1FMCA 2P2SA 3DO5A 3OP4A 1ISHA 1SMKA 1BDMA 1X0VA 3DOJA 4PG6A 1F8FA 1N9GA 3E6AA 1VM6A 4NI5A 1R16A 2ZCVA 4RLSA 3SXPA 2C5AA 3F47A 3DBVO 5L45A 4I5GA 1BG6A 1XCBA 4AJLA 2IEBA 4FJ0A 1DOHA 1U28A 3Q11A 1DRWA 3QP9A 2DBRA 7ADHA 1LC0A 4HV4A 3GOHA 2AQ8A 3TDKA 3DMTC 2R2GA 3P2YA 4BUCA 5B12A 3ZV3A 3NV9A 4DMMA 5EESA 1F14A 1J49A 5L7WA 1GZ4A 4PLHA 3ASVA 1IULA 3A1NA 3RJ5A 5KVVA 4GSKA 5A3JA 3PHJA 5T5QA 2ZTVA 3MJTA 3LLVA 5T64A 3ETGA 3AUSA 2XF8A 1TI7A 1DRVA 1PSDA 1XIVA 2CF5A 4BO6A 4NJOA 8ADHA 5IDXA 1GAEO 4DIFA 3H9EO 2HK9A 1ZXBA 2OP1A 2OO5A 4CMEA 3EY4A 4BNFA 3HZZA 1GYQA 2P5YA 3BMNB 2DAPA 2CVQA 1I2BA 4D42A 5JY6A 1CQIA 4LVCA 3A06A 4NIMA 3U4DA 1BGVA 3D4PA 3I5MA 4BO2A 3AY3A 1PIWA 3RU9A 4NBVA 1GCOA 3S2FA 3C7AA 1N5DA 5DBGA 1B0AA 3FNHA 5TX7A 4JJIA 5TT1A 1E1LA 1E3EA 4MINA 3I4CA 2E37A 4R68A 4TRMA 4OSOA 1DLJA 4MVJA 4D79A 2HRZA 1PQUA 4S3MA 1F8GA 3P5SA 3MTGA 4XYGA 1TXGA 4R16A 2YW9A 2D8AA 2VNSA 4MVJM 3VZQA 1P77A 1WVGA 5TS3A 3ZI0A 1PJTA 4ZQBA 4J4BA 5JNLA 4D7AA 4PLPA 3JQBA 3TZQA 1MC5A 2FPPA 5IG2A 1ISMA 1LRLA 1XELA 4IMPA 2Q2WA 2X0IA 2Y0DA 2BFPA 2Y1EA 3BMCB 4LW8A 4NR0A 5F1KA 3ROMA 5JO9A 5BNTA 4AVYA 3AFMA 3TWOA 3KLMX 1I3NA 5JMWA 1KY5A 3RUFA 3U0BA 2AEFA 3QWIA 4K9DA 3ENKA 4NH4A 5JYDA 2HMWA 4E30A 3D4OA 3OMLA 3U9LA 1X0XA 4WECA 4DQVA 4DVJA 2Q45A 5FWNA 1CQJA 2WE7A 3DONA 2GZ3A 3QVTA 1YBMA 3KO8A 1PL7A 3FSRA 2O3RA 3JQGB 4G5HA 5F3RA 1IPFA 2WDZA 5A5FA 1HDCA 3EZYA 4J90A 1Y81A 2QYTA 4J2HA 3ADPA 1DIAA 3IP1A 3KV3O 4KUEA 1ZK3A 1LRJA 3WJ7A 2AG8A 3FD8A 3SBOA 1I2CA 4C4OA 4RO0A 3W6ZA 2JHGA 3BMQB 2PD3A 2I3GA 5KNLA 4BQPA 4W9NC 4EEXA 1O5IA 1ZZEA 3HN7A 5BR7A 1B14A 2GASA 1HDRA 4HUJA 3ULKA 1LSOA 5JLAA 4PVDA 3L77A 1P45A 4ROSA 1MG5A 4E33A 4C7KA 3PP8A 4KUGA 4XQ9A 3DQPA 1LSUA 2NVUA 1HSOA 4JNKA 1P33A 2I67A 1PL8A 3RI3A 1N8KA 1NX6A 3DWFA 3DR3A 4NQZA 2YYYA 4OXNA 1I36A 5IN5A 1UP7A 2OXIA 5AQ1A 1KOLA 3GDFA 4BNVA 3H5NA 3Q9UA 2BI7A 4G81A 4RPJA 5DBFA 1I10A 3KOUA 1EDOA 2Y1GA 4IQ8A 3VPGA 3ZHXA 5BSHA 1K5HA 4URFA 2PK3A 5HTOA 5DOZA 3PLNA 1C1DA 1UZLA 3M1LA 4H16A 1I8TA 4Q3NA 4PLFA 1BHSA 4WUVA 4CV1A 4PG5A 3V8BA 4IINA 4B8ZA 2ZYGA 5JXWA 2BKAA 5AXDA 1VE9A 3T4XA 5C37A 3V1TC 1GEGA 2UYYA 4Q9NA 2JAHA 4U5QA 5F5LA 2XAAA 3H9JA 2GN4A 1Z74A 3CTMA 3AJRA 3JQCA 3FNEA 4WKGA 4NG5A 4ZA2A 2PGJA 2ZK7A 4J1NA 3G79A 2AEJA 5EQDA 4BO4A 4R69A 1D3AA 3GZ4A 3IQDB 1IPEA 1FDTA 3HDYA 3PIDA 3BYZA 4RZIA 3B1KA 2PZJA 1W6UA 4NBWA 1P1FA 4YA6A 2CFCA 2P4HX 1SEVA 4RPLA 1TVEA 2PV7A 5T8KC 4YYZA 3GVHA 4OJNA 4R3NA 5ICMA 1WLYA 4B8WA 2G1UA 3JYPA 4JJGA 5GZ6A 1A4UA 1IE3A 2QRKA 1U2DA 4UULA 2ZYAA 4L4RA 1HSZA 5L53A 1FF9A 3PWSA 3H2SA 1HF3A 2JFHA 3RSHA 2VHVA 1JKIA 4WOKA 5C7LO 1CJCA 2V6MA 4OOEA 1DLIA 4OXYA 2JD1A 4K6CA 2DTDA 1PJ2A 4PCVA 3BXXA 2AMFA 1JN0A 5JO0A 4ZN6A 1FDUA 1ZUD1 3GN1A 1QSGA 3WIEA 2NQTA 1J4AA 4IDFA 4KMSA 4P8RA 1R0LA 4IY1A 1NVMB 1O94A 3OEWA 4LSMA 3WXBA 1UDAA 3O26A 3TFOA 4EZBA 1HYEA 2A35A 3NDJA 2FMUA 3P19A 1K6XA 4B4OA 3I9OA 4E32A 5IDQA 2C2YA 2FZEA 4WLVA 3RBXA 4FQ8A 4DTIA 3GAFA 5LCXA 4D43A 3FHLA 2VRBA 1U7TA 4N7RA 3L0DA 2W2LA 3NEPX 4PN3A 3TRIA 1F17A 1TA4A 1B15A 3WGGA 4A7PA 1EDZA 1I01A 2RAFA 3GZNA 2RH4A 1GDHA 2I66A 5TQVA 3PJGA 3TL3A 1M6WA 3AI3A 4M55A 2BGLA 1IOLA 4WCFB 1WZIA 3B20A 3H6KA 3AY6A 3HNPA 3WMWA 4IZHA 5GZ3A 1PR9A 1E1KA 3ZNPA 1U3VA 2YHIA 3WYEA 2B83A 1LEHA 3STHA 3NAQA 5CDGA 4DBVO 2O2YA 5JYEA 3JD1A 1E7QA 1QYVA 1V9LA 3I9NA 3TOXA 3W1VA 3MJCA 5KJCA 2QZZA 5A04A 4DLAA 5FI3A 5C7OO 2GRAA 1SC6A 5MGBA 3QY9A 4IIUA 2IODA 2P4QA 1E3JA 1U2GA 4BGVA 4FS3A 1RKXA 5TT0A 5CG2A 3NJ4A 1C0LA 3WGYA 4Q3BA 5COQA 2F1KA 4XR9A 1KVRA 2NUAA 1C3VA 2ZB3A 3BTSA 5JAIA 1Q0QA 3I6QA 1BXKA 1A5ZA 5CDSA 3WQSB 5JCXA 2DTEA 2P91A 2X9GA 3GR6A 2Y1FA 1EMDA 3UAGA 4MKRA 3WTCA 4TZTA 3RCBA 1QYCA 2E82A 3DZIA 1DFGA 1UP6A 3DTTA 1DPGA 4O59O 2Q46A 3UKOA 3PI7A 5A9TA 2O4UX 4RVGA 5TIIA 1T4BA 4UREA 5F1OA 4M87A 4CQLB 4MIEA 4BNZA 4NZ9A 2EF1A 3DBLB 2FY8A 4ALJA 4OSPA 4BNYA 4P38A 3CMCO 5ER9A 3Q0EA 9LDTA 4GSLA 1EVYA 1NAHA 4Q3DA 4WNCA 4CLRA 1ADGA 1CYDA 5TC4A 1E1MA 5I8ZA 3JD2A 3I3OA 1E5QA 4RPKA 4BO0A 3EUWA 4E31A 2B5WA 3C8MA 4IGFA 4KP7A 2GUGA 2XXJA 1CDOA 2RHCA 3ZDFA 1JTVA 1KIFA 4BV9A 3O03A 1DDOA 2AA3A 5DBIA 2IE0A 1HT0A 3R6DA 3WSWA 4L0QA 2ZB7A 4BS9A 3TSCA 4XQEA 4YT4A 2HK8A 1QYXA 1PJLA 1DB3A 3OETA 4CV0A 1T2CA 1X7GA 1H0KA 4IS3A 5JC8A 3GF4A 5ER6A 3UCFA 3HE3A 1MP0A 1W0CA 3LK7A 5CPFA 4O6VA 1NM5A 2HLPA 2JL1A 4NMHA 1P9LA 3D3EA 4YT5A 2VHWA 4L74A 1M2WA 2Y99A 4HX5A 4YQZA 1IZ9A 4XYEA 2HMVA 1U8FO 4QO8A 4DL9A 4RZHA 3GH3A 4IXTA 1U5AA 2PA3A 3KLPX 4YJHB 4XRGA 1T2AA 3TPCA 3WFIA 4B7XA 4OKNA 1LDYA 4CMAA 3GGGA 2J5QA 4RQTA 5T67A 5CDTA 1P3DA 3S8MA 1VPDA 1YOVB 2G82A 4AFNA 1R4MB 2CVOA 4XRRA 2BLLA 4B4WA 3GMSA 2X0NA 3WIDA 1F0YA 1U3TA 3GC6A 1MC4A 2Q1WA 2AEMA 3LSYA 5CP8A 3L4SO 4II2A 3AI2A 1GUFA 1F12A 1YRLA 2B4TO 1HDOA 1P44A 3H3JA 4YRDA 1DIHA 3MWDB 3MZ0A 5EERA 2J8ZA 3WWYA 2DT5A 4A73A 4YAGA 1VKNA 5T8KA 2VZ9A 2UV8A 1O89A 2CDAA 3D1LA 1DXYA 3ON5A 3RUAA 3VH1A 4N5LA 1GY8A 3GVPA 3FTPA 5A06A 1J0XO 4IM7A 2NLOA 3GY0A 2IZ1A 3JD3A 4AJ2A 1QV7A 5ITWA 1HKUA 4NU6A 4GWKA 5H81A 1UDCA 5AYVA 1LNQA 3F4LA 2G0TA 1LBEA 2JCVA 4CJXA 3KRTA 3WGIA 4LMPA 1HDYA 3BTOA 4W9NA 4J16A 2EKLA 5G0SA 2WE8A 2CDBA 5K9ZA 4ND2A 4IQGA 4B79A 3I9KA 1UDBA 3GFGA 4XIJA 5I7SA 2FPIA 3C7CB 5BNFA 4XCVA 1PJ4A 3LLSA 5JDCC 2W2KB 3K8ZA 5IDYA 5B1YA 5JAMA 1PJQA 3ZN2A 5ICSA 2C2XA 3RC1A 5CEJA 5CAEA 2QQ5A 3PXXA 4ZRMA 1W73A 3UGKA 3FPLA 1Q7BA 1JA9A 2NACA 1LUAA 1Z45A 1LDGA 4HKTA 5L51A 1H9BA 3SLKA 4D3DA 3D3WB 4FC6A 1NQOA 4BKRA 3BHMA 1I3LA 2IXBA 4EJ0A 3F1KA 4FFLA 4J7XA 3ASUA 4BNLA 3L6EA 2IXAA 3ZHBA 1E0DA 1XHLA 3DB2A 4RV9A 2A4KA 2O48X 2AHRA 4WOJA 1LQTA 1RM4A 1DC3A 4GLOA 1SCUA 1JKJA 1NP3A 3FWZA 5ENVA 2IYPA 2W2KA 1QYWA 1SOVA 4DQXA 4OMUA 4C7JA 3JQBC 1NAIA 1NHGA 4J3FA 5ILGA 4GGOA 4PLWA 3OQBA 2GN9A 1UAYA 2Q50A 4OKIA 4CLHA 2ZATA 4XQCA 1EQ2A 3K96A 3W8FA 1NTOA 4MO2A 1D7OA 4A0SA 4E0BA 3KZVA 2VWPA 5JMPA 1M6HA 3Q9NA 4Q3AA 2ZB4A 3VAZA 4TWRA 2VWHA 1M76A 2FR1A 3NYWA 4GX0A 3WYCA 4BNWA 4YAEA 2DUWA 4P4NA 2O50A 4QTZA 3F3SA 5TSDA 4CLDA 4BQRA 1XKQA 4BNNA 4RJTA 1E3IA 4IJUA 4BO8A 1R15A 3JYLA 2BGMA 1ML3A 4OL9A 3ZWNA 3ZWCA 1KEVA 1N92A 3HN2A 2OORA 1H2HA 2YY7A 4A2CA 4DC1A 1IL0A 1ISJA 1XWFA 3FF4A 3CEAA 4H7PA 1E77A 3EZLA 2GLXA 2DM6A 2WYWA 5JY1A 1MGOA 2DBZA 2HCTA 3HWRA 3KUXA 1YBAA 4IS2A 3JQAB 3AW9A 4CM9D 3RJ9A 1UXGA 4E5NA 3PQFA 2NNLD 3Q3CA 4BO3A 2HMUA 2EW8A 5G0WA 1DFIA 1I3KA 2Q2QA 3DMTA 4I5FA 3WR5A 2DVMA 4U8GA 1X1TA 4LISA 1DHTA 2P68A 4E12A 1R0SA 3ITKA 3TN7A 4BO9A 4HNHA 3CUKA 4WCDA 1DBVO 1ZSVA 3UFXA 2Q1TA 3OM9A 2B4QA 2D4AA 4BVAA 3ETDA 3ROKA 3QVWA 3WG9A 3QVOA 1EEHA 2QZ9A 1KETA 4N18A 4YJFA 1DSSG 2IZZA 4MIYA 2Y0CA 1NPYA 2RHRA 4L76A 3D0OA 1R4NA 1ZFNA 4UEJA 4F45A 1R66A 1FJHA 1KERA 2IYOA 2NVBA 3H8VA 4ND3A 4OXKA 3A4VA 1YKFA 4PLVA 1XQ1A 3FTNA 1I2ZA 4R51A 3ZW9A 4MVJD 1LDNA 4BKPA 2CF6A 1Y7TA 1IHXA 4OAQA 3HB5X 2BHLA 2O3UA 3PQEA 4OIMA 2OOSA 2BRUA 4JIGA 2X86A 3CSDA 2WD7A 3PLRA 4AG3A 4AJHA 1EK6A 2FR8A 3RUDA 4R9RA 1D8AA 4L75A 1NQAO 1EK5A 1T2FA 3QWHA 3EVNA 4W7HA 2AW5A
chains in the Genus database with same CATH superfamily
1D2HA 1P0IA 2ZI4A 2UVPB 3GVXA 4MV6A 2P9CA 4OU4A 3RVSA 1H2AS 2B94A 3K0AA 5GIPE 2QTAA 4CUKA 2WMDA 1I6WA 1OXXK 4I2VA 4J2OA 4PTYA 5DNUA 5FKJA 4QQKA 3RS3A 1EVJA 1NW9B 1PR2A 3EGOA 4GI7A 5KREA 1Z4OA 2FX2A 4IGKA 4CF4A 1OYVA 4BO7A 3TLYA 3WP1B 4PZUA 4B7ZA 3MM4A 3HYNA 4H0FA 2WJGA 3VHRA 2X4GA 3COZA 3IV7A 3MJVA 4B2IA 3L05A 2C4VA 2PRYA 4PPGA 2RI0A 4ZU6X 2IVZA 3ZXYA 4B6OA 1M8KA 3N2KA 1YMUA 4KR6A 1QBKC 1WBJB 3MXOA 4H6VA 4C7MA 3W8EA 4R1LA 3ELBA 3B3JA 4MPRA 4ZI7F 3ZGVA 3ZGXA 4FX5A 4HH1A 4RADA 4BB9A 4CIVA 1QS0B 1SG9A 3PITA 1QK5A 2QSYA 4HG2A 1Q20A 3BD8A 1ISIA 1LSJA 2PL3A 4C6RA 1EWKA 3USCS 2FWRA 4OG2A 4Y2PA 2D5IA 5KJ1A 3RIYA 2WWVD 3TLJA 1ZOPA 2N0SA 2ORED 1VHDA 2B1QA 1OFHA 4JLDA 2J9RA 3LXUX 4LZWA 4YDHB 5K0ZA 3LYHA 3ZQKA 1JAZA 1JEOA 2BP7A 3H5LA 3Q8KA 1S2DA 2DWCA 2PQ6A 5JNVA 4ECEA 2DPLA 4F6LA 4G0XA 2DY0A 3KDPA 4ARUA 5LVAA 4Q4JA 1M6EX 3INGA 2L17A 3QVSA 4PX5A 2I1WA 1L5ZA 3AHIA 2H8KA 3PC6A 4YQFA 1PZGA 3E18A 1P5HA 1QH0A 3UUFA 2QTVA 2PUEA 1U3FA 4TMYA 1IRIA 3QBDA 4GBMA 4ILKA 4OJTA 3TL2A 3KSDO 3FE2A 1WEKA 1XU4A 1NT2A 2ZJ0A 1HRDA 2OM6A 3I12A 5AMXA 1YRYE 1Z7WA 3RAFC 3OD1A 3C6YA 1UWVA 2I22A 1AKNA 1TOAA 2EBHX 2J6IA 2JJ1A 3DMRA 1DJLA 5AQEA 1PZHA 2IDKA 1ARZA 5ILQA 3LJKA 4FMDF 3IIKA 3L4BA 3OSZA 2CVPA 3DZKA 3OY7A 2ZRCA 2IZ6A 4JHLA 4LXYA 4N0MA 2JIPA 4TUYF 4LE0A 3ZNNA 3Q12A 1ZD1A 4B2YA 2FSGA 4ZYLA 2JCGA 5DOVA 3ZTTA 3BSFA 3FW1A 4RD1A 1WUYA 3EF3A 2ZDQA 4GVLA 4M21A 4U3JA 3TLMA 5LD2B 1UWLA 2WG2A 5ED4A 3GG9A 2PTGA 1OX4A 1C2TA 1KGDA 3IGFA 1IK4A 4H7IA 3IB3A 4EGAA 4AZWA 3SJZA 1ONSA 4KGDA 1NUAA 3CLSC 3GA0A 5EHQA 4BMOB 1WW2A 1RE0A 1AGNA 3KSRA 4LIPD 1OLSA 2ZTMA 3UHAA 4RF2A 2BY4A 2BCJQ 2LCIA 1L2TA 1T15A 2OV1A 5FR1A 5A6SB 3H4VA 1PS9A 2GTIA 3BCRA 4Q16A 4E22A 1H1TA 3WWDA 1IHUA 2W6IA 1L5NA 4YHBA 5TGDA 3FFAA 1QHXA 2EQAA 2GF0A 3RC9A 2I2WA 4GPBA 1ZH0A 4GAEA 4RTMA 2YIMA 5JS8A 4BNHA 4QOFA 4RC9A 2ZULA 1WUHS 2V7BA 5LKRA 2ZRDA 1Z2NX 3DL0A 3D81A 3M2PA 1SEPA 2YFHA 1CPYA 2O2GA 4B1FA 4CLOA 2RKBA 1W30A 3JTMA 3Q4GA 4BGEA 4D2IA 4FFPA 1MZPA 1J8YF 2WAOA 1JHPA 1QLJA 1GVHA 1J20A 1TC2A 2ONCA 2NU7A 4BZZA 1QG0A 1NY6A 2NXJA 1SXJC 3K16A 1IK6A 4Q4HB 3JWEA 3PD1A 3TLKA 1DU4A 2DERA 3MC1A 4I9UA 1B8PA 4M76B 4TSRA 5DT9A 5A4KA 3KL4A 4IKPA 3L8MA 4HVAA 4IF6A 1RTKA 3BOSA 3EGIA 2Y4NA 1HL7A 4MUAA 1WLSA 1UBCA 4FE7A 3AOEA 4TLEA 3CLHA 2XUQA 1L1FA 2NZ2A 3UC5A 4HNQA 1QJ4A 2EW1A 1ZVQA 2GN2A 4EG0A 1N2CB 3QEOA 3QELA 1JL3A 4HRXA 5DVZA 1RACA 3TZ6A 5G0TA 3ZBQA 3ZI4A 2VSOA 2Q41A 5TGZA 3TQRA 2R8PA 1J2TA 1GRQA 1U99A 3OLQA 4MS1A 2HIMA 2AV6A 1DWPA 3K6RA 4OYRA 3OKCA 4BQNA 1Z4PX 1RRGA 1TW3A 4H7FA 2QQ0A 4FBMA 3ZE8A 1Z47A 4E70A 5BW8A 3MJ4A 3H5WA 5K01A 3HSSA 2FU5C 3NRJA 5HF5A 1LD3A 1ZBDA 1ACJA 2DQZA 4P84A 4XYBA 2IEAA 2RI1A 3DZFA 3ONWA 3ZDAA 3QVGB 2GN0A 3NHSA 3PDCA 4LKRA 1USVA 3WDSA 3PZRA 1VLMA 1WABA 4FR0A 5IT5A 4AJEA 1XWWA 3IESA 4U63A 3IEUA 3FCXA 3PUHA 2WEKA 2XW6A 3NUZA 2ODWA 3FCOA 1MO3A 4UDNA 2PAAA 1GD1O 1OILA 1YACA 3C5VA 4YWJA 5LQAA 3X0DA 4WCFC 2FEPA 5TPWB 1H9AA 3EIFA 1YUNA 3B6ZA 1Y3CE 3QQ5A 2C77A 5HMMA 1YDWA 4FI3F 1XMQB 1JG2A 1PJ3A 2VT6A 4TV9A 3UWKA 1CZNA 1ANKA 2GYYA 3KVOA 4OQYA 5F98A 5A9SB 1Y8RB 5A3QA 2WG0A 1JR2A 2QDKA 3NBUA 2YHBA 2CE2X 4FOSA 1Q77A 2IF2A 3KPUA 4GYJA 3QU2A 5JC1A 1RLIA 1ECGA 2QA5A 2WA2A 5HOQA 3E9MA 5CVEA 3A9TA 4PC3A 4WACA 3AR7A 5CEEA 2COEA 2XRYA 3HHPA 1A9OA 2DJ5A 3QEKA 4N7JA 5JG7A 4YQYA 1KK1A 3UWDA 1F2UA 1W9MA 4UEQA 1KJQA 1WULS 5HCUA 3VAYA 3RJTA 4B48A 4M0LA 4A8PA 1X14A 4GVPA 3LA6A 3REOA 1T9DA 2Y1CA 1E3WB 2ZUUA 4K05A 1UEJA 4LV5B 3AHHA 1QCCA 1RM3A 1MORA 4PLCA 5EXEA 4DE5A 3E5MA 3QUAA 4PS0A 3RWBA 3V4LA 4TTQA 3RVKA 1C0PA 3EG9B 3P8ZA 1ZD2P 1VJTA 4YAWA 1ZM3A 2EERA 4OXQA 4PBTA 4CEIA 1B0UA 3AM5A 3LO8A 4HYEA 2GLUA 5A7GA 4EPTA 2H1SA 4KU4A 2NMVA 2PZKA 5SZIA 5BQXA 1U5BA 3JQFA 1GKIA 2Q29A 2OZPA 4R40A 5J2UF 4JB8A 3C3YA 1OXVA 4YO7A 2YXDA 3FRJA 1FDVA 2RHLA 2WNIA 2A0FA 4IRXA 4R8KA 1HDXA 1X6VA 1TVKB 1TO2E 4KR9A 5BRJA 4CMGA 3A27A 2Z4SA 3UV6A 3CZRA 3SC6A 3X1ZA 1L5QA 1LLQA 4BLTA 1GL6A 1L3BA 2MTBA 3NBXX 3MJFA 4KK3A 4B6PA 4YYEA 1G8MA 1RYEA 3PT5A 2F4NA 3U7HB 4J7AA 2AXQA 1FU4A 2JFPA 1I7PA 3LDAA 1EJ0A 3FOCA 3NTQA 5KOYA 5KKCA 3ZKAA 1VB3A 3IKVA 1HBJA 1P18A 2EWMA 4D4HA 3ZQ4A 3LT1A 1JQBA 1QMGA 4HQFA 1UJCA 5JATA 4JVNA 3M81A 2ADOA 4DV4B 2O23A 3Q15C 1FRNA 2EP8A 2FF5A 1YJ8A 3GYBA 3K2QA 4HWKA 4MI6A 1WHSA 4URWR 3CTPA 4UOQA 5EP1A 2QP9X 3EGVA 1O0CA 4OBXA 3JQAA 4D99A 2CXUA 1SIBE 1R3UA 4BB6A 4CMBA 4YPOA 2UYCA 2ZWOA 2BMDA 3I2FA 5CYFA 4S1VA 4JC0A 2C2GA 1XG5A 4UE3S 3VC7A 3PJFA 4JP2A 4MQMA 5KTYA 2NSDA 4PFJA 2P2DA 4DUPA 3PWKA 1F6WA 5GQSA 5J4VA 3PE6A 1GSOA 1BWPA 3FLBA 1ORRA 1PS0A 1KZ6A 4D8VA 1ESMA 2VUUA 2GB4A 4TT3A 3SG0A 3B1YA 1WSDA 1YQ9A 3HBJA 4P4GA 4J03A 4MYHA 3BTUA 1GAQA 1KJYA 3AX6A 1R2QA 2LDBA 2VRCD 3HDJA 3H5AA 3W6PA 3ZW7A 1QPGA 2OD7A 3HS3A 5CVDA 3USZA 3FYTA 3SSMA 5JAOA 3GLHB 4YUVA 3QYAA 4OV6B 4D3YA 3WB9A 3M9XA 2GESA 4KPUB 4KMOA 1VIDA 4FHCA 4LQCA 2CSXA 4KFCA 5AHKA 3I2IA 1FJ2A 4E5PA 1OPRA 4LQDA 1A9XA 2G67A 4G0ZA 4UARA 3JQEA 3W1WA 5FDFA 3RBAA 2WZCA 2G09A 3UOAB 5B58C 1DADA 1EFRD 1XZIA 4CM8B 3PXEA 4G5SA 2HT1A 4WERA 1JRLA 5LC1A 3RD5A 4B34A 4XM2A 2YYZA 2GAIA 1P8AA 1D8TA 2QPLA 2V7PA 2M98A 4KQJA 1JF8A 1H6AA 2O1WA 2R00C 3TTWA 1PFGA 1DC6A 2BTQB 4XW2A 4DJDC 2FRDA 4EL0A 3FB1A 5EKUA 3N0WA 1B8OA 3H1EA 4I1SA 3RNOA 1U6KA 1YONA 3ABQB 2HQOA 5B4UA 3PIIA 4MHOA 4MRVA 4A8JA 2OV8A 2K7FA 2H9AA 2FHSA 1ST3A 2XUKA 5CH5A 1N2XA 1ZMTA 1XPRA 3UNXA 3SR0A 3ZH9B 2VJDA 5FYDA 1PZXA 3R6GA 2C20A 4RPGA 4PCUA 4I1IA 5MN4A 2JGFA 3HXOA 3F0TA 5IJ0A 3FUUA 5AOBA 3ESBA 5A5GA 4OCZA 2FMXA 1NNLA 2I4RA 2ZUTA 2XAUA 3DEAA 3I6BA 3DOEA 5K3FB 4D6XA 3WC4A 2Z3WA 2VPZA 3AGQA 3PCXA 4B32A 2BN4A 4C78A 3K71B 1POXA 4UC0A 3DNMA 3OCJA 1TUGA 1GGHA 1XF9A 2GAFA 2VK2A 2VQ6A 2BEWA 3OT1A 4KR0A 3RFTA 1R4ZA 3BKWA 4JYPA 4U9IS 3ZYZA 6REQA 3B3FA 2EKZA 5J1TB 1JSZA 3MWDA 1VKJA 2I2AA 4EF4A 3V2HA 5BOSA 2H65A 2X14A 1YRHA 3F7TA 2OC4A 1TUEA 2O07A 3AZQA 5TR9A 2ZAYA 3OX3A 5TQ2B 3EG5A 2VT7A 4LCEA 1CS0A 1VI2A 3HJUA 1J2UA 3JQ8A 1Q0LA 2QTFA 3KKOA 3W5UA 1PWEA 3VTAA 5BV1A 2NU6A 3ZR4B 3ZU6A 4C0SA 1WDMA 3ZC3A 1CV2A 2CXXA 3KNZA 3RU7A 3MGGA 4W1QA 1L7VC 4GPD1 2X4LA 3BA6A 1J8MF 2H1RA 2FDXA 1GZ6A 2FQQA 3F6CA 3LXMA 3O8OA 4XB2A 3H83A 3QKRA 2DRIA 4GKAA 1P3Y1 4BIIA 5CA0F 1UUFA 5HQ3A 3D59A 1I7NA 1DAPA 1HOTA 2XCLA 4MLPA 3PC3A 4MVJG 2JFYA 2IE8A 5ELXA 4UVEA 2ZWMA 2ZBUA 3EPRA 4UNNA 4MS4A 2AQIA 3DUFA 4JMLA 3T7CA 1WM1A 3TOCA 3UOGA 1KAGA 3HSKA 3K72B 4MP8A 3NTRA 1E2NA 1WWKA 2IUFA 1NASA 621PA 1L8OA 1NBHA 4HC4A 5AR1A 3L7OA 4BP8A 3R76A 1Q0HA 2YWDA 1B41A 1RI1A 5ECWA 2PWZA 5HBRA 3OKPA 3NU1A 1RAGA 3LFUA 1RJEA 2QXTA 4UVGA 3IP8A 4KDRA 4Z3DA 5A4FS 3O2QB 1EAYA 1XF1A 4IQFA 4BP9A 1USWA 3BDAA 2ZE5A 2A30A 4IDNA 3SJBA 3IOMA 5FUVA 1Y7IA 3EAGA 3WGNA 4KJZA 4AJOA 3GG2A 3VSDA 1CX9B 2QGFA 3GVIA 4KE8A 3EWSA 2RH5A 4LX0A 3KCNA 4NK4A 3U62A 1DEAA 3LE8A 5TDHA 4D41A 1UK8A 5K8IA 2Y0BA 3GEHA 5J47A 2DBQA 2W2MA 3T9AA 3PYXA 1J7KA 3HY4A 1NLYA 4Y8VA 5ALWA 2DFDA 1R8SA 2XMQA 3ND8A 4OHUA 5I9IA 2A33A 2G70A 3D4BA 2PGNA 5ICCA 3KOYA 2GBPA 1KEPA 1AM4D 4YNBA 5GPBA 5HM6A 4KIFA 1ULSA 3B12A 4JP5A 4A16A 4AZVA 1Z73A 2WP8J 4D9CA 4Y2HA 2I29A 3ZTWA 1Z4JA 3PKZA 3KQUA 2J7PD 1K3UB 5CT4A 3DCYA 4EG6A 1C1XA 2X8WA 4EJFA 1KO5A 3CLKA 1FRZA 1V1RA 1E1DA 1O6CA 4V1CA 1G21B 4QYSA 4TKMA 2Q9CA 1OV6A 4DLUA 3UG6A 4LXIA 4F2WA 4TZ6A 3PICA 2H57A 3URKA 1AKVA 3AFIA 3RVRA 1SIOA 2JZCA 2XWQA 4LNUB 3RKUA 1YJCA 3H7IA 1W6RA 3ILYA 1T26A 3DDCA 3T7IA 5LIRA 3BD7A 4BNDA 3SLRA 3KTFA 3DDHA 2F8SA 4B7UA 4PQYA 3LXRA 1JDVA 1VGQA 1VQ1A 2A9KA 4OMFG 3SQMA 2BONA 4KGZA 3D3NA 9GPBA 2XYHA 2C2OA 2JAOA 3WNZA 1VPLA 1X92A 2I6GA 1P6UA 3MUFA 4KTVE 2PVSA 1ZUIA 1JU3A 3JVVA 4U9HS 1DO2A 1UM9A 1VE6A 2ZKLA 3AEQB 1E4EB 3V1LA 4HJRA 4ARSA 3DT8A 7MDHA 4UUPA 3IV6A 1OZGA 1TF7A 3PR3A 1UMBA 3GEDA 5KVQA 1Z9BA 2IYQA 3Q0TA 2FPXA 2YV3A 2G9VA 3H99A 3FOZA 3T3IA 2OVFA 2WJVA 3ECSA 2A67A 2W2VA 4YLEA 1TCBA 3CEJA 1G2QA 2WHYA 4O2AF 1ZU4A 4TMTA 5EMJA 5IBQA 3TIIA 3L8DA 4JBGA 4J9VA 4FEAA 3T3OA 5DSTA 4NJMA 4F3CA 3AVPA 3BULA 1PV2A 1Z36A 4KXQA 1DO0A 3TLGB 3NATA 1FBTA 3UZUA 4D9EA 1YDEA 5B3JC 3BRSA 2Z2IA 5DCLA 4EY3A 4E4YA 5CFPA 5ILOA 1LQ2A 2NPFA 1ZUWA 5FXMA 2JC3A 4YAJA 1RXYA 1OQAA 2I1QA 1QORA 3K70B 3OZTA 4G26A 4P3XA 1X2EA 3OHMA 4GNRA 5I9LA 3HKEB 2FEWB 1OXSC 1P0MA 2A2ZA 1DQRA 3F7NA 3MQFA 4DSNA 2ZYHA 1NA5A 5KYTA 4AY4A 1OROA 1ZN9A 4Q9KA 5KI6A 2PKXA 4AG5A 4YBRA 3RC1A 3CBQA 1HTBA 2WWXA 2JJ8A 3OMWA 1YULA 2PL5A 2GPNA 1YJXA 3ZCSA 2FP4A 2JANA 3EDYA 3FUTA 3L7MA 4GFDA 3M5PA 4M38A 5FBZA 1LPNA 5CW1A 4JYAB 1ZN8A 4JI4B 5FUYA 4EI2A 2O5RA 1NBMD 1ETUA 1OFTA 1VGRA 2AX4A 3OOSA 4I1RA 4MRSA 4C7BA 3RS5A 3BXGA 1BWRA 1L4BA 3OPMA 4CDGA 5KC8A 1JBKA 1E60A 2QRZA 3NI2A 3LS2A 4M9CA 4BV2A 2DLDA 3FDIA 2C59A 2IEZA 2YV2A 4TQUS 4F3KA 1TCUA 3C3WA 4WY2A 4DUGA 2XT9A 4BMSA 3OX1A 2MSWA 4JI1B 4QNRA 1C14A 2E5LB 4D8YA 3OC6A 1EM8B 2MT9A 2I6QA 2Z04A 1QHHA 3V33A 3ZXSA 3QRWA 4G67A 3OFNA 1V7CA 1XZFA 2B36A 4O4IA 3P9PA 3WGJA 1IU9A 3LV8A 1EFUA 2O3TA 1RAFA 5COBA 2Q1UA 4KXMA 1XRSB 1N2IA 4FK8A 2PKCA 3UCEA 1O0SA 1QOPB 3O84A 4LZPA 3RK4A 3NDIA 4IIEA 4BEJA 3LWNA 4ZJZA 2XCIA 4AIIA 1X7DA 1NNUA 2WF8A 1SD5A 5I47A 1DKUA 4D9KA 3I0NA 4OQFA 1PP4A 4OLHA 3IDFA 3TE6A 5EUCA 4EG1A 5IK2D 3PX7A 5BRNA 2QRNA 1Q2XA 4L4YA 3ZD8A 1ZK4A 3B6KA 4I99A 3IAM6 1AKWA 1R0KA 2IY9A 4LE1A 1CRPA 1GQSA 1AF4A 1NFFA 4C3OB 3GDGA 1YZLA 1VIYA 4GLJA 1QPBA 3OCYA 4PQRA 4UPEA 5K2MA 1XXHE 1R37A 4KQEA 3VX4A 1OH6A 4R81A 3K73O 2Z6VA 4KE6A 1O95D 1QRSA 4MX8A 2MJLA 4KZPA 1U0NA 3H9BA 3QUSA 3QU9A 2Y0EA 4OHYA 2IEDA 3CGWA 3CLSD 3CWZA 3F8TA 5LLTA 1FPQA 2ENUA 5EE0A 1TPYA 1YHNA 5EQFA 5K7SA 1RC8A 1KP3A 2BBOA 3QW2A 5THQA 3SMQA 4FP9A 3VTKA 3SZMA 2SICE 1T2EA 5EZYF 3FWNA 1TDJA 4CQMD 2NTJA 1RXVA 3NHBA 2Q6IA 4M98A 1KAQA 5HM8A 4FXOA 3QEJA 1JXQA 2GO7A 2J6HA 2WOJA 5HCIA 4YRJA 1WTCA 1ZRMA 1YO6A 1ZI9A 3O1IC 4Y6GB 2OL4A 5KU7A 1RP1A 1KJNA 2PKQO 4K9RA 4NLLA 5HIMA 3FGNA 4A27A 5AM3A 8LDHA 3JY6A 2XZLA 3OU6A 4KGXA 4P3OA 2X7JA 2YIVX 1UINA 3KDSE 3NONA 4DRXA 2BUAA 4C4XA 1H6CA 4QJBA 4WNYA 4L22A 1AA9A 2H07A 2PSHA 3GLIA 3QTBA 2BFFB 2HIGA 3S1AA 1H65A 5K8TA 1NVUQ 3Q3GE 5IZ4A 1V8BA 1CUWA 4O4JB 1U3DA 1JSCA 2ZR9A 5AKHA 3I61A 4LF4B 1T13A 5TQJA 3I53A 2WYIA 3PSAA 1RWWA 3MWYW 3NHJA 4BFUA 4G8DA 1Z2OX 1YK0A 2ZYUX 4FDUA 4DEXA 4JH0A 2AFVA 1YAHA 1YIOA 3EBOA 3KPYA 3KEFA 3WGOA 1KH3A 2WU0A 2PVCA 1T9GR 2C7VA 1UBLS 2NO5A 2OZLA 5LZ2A 2FA9A 5KEIA 3AEQA 2AJBA 4YB8A 3GFSA 4YS6A 5JZMA 3JAMA 4QT4A 2ZT7A 1V96A 3A28A 3HZOA 4JOQA 3LBFA 4ER0A 2HO5A 1MZVA 2AG1A 1X70A 2R4TA 4L15A 1ADBA 5HG0A 4R7ZA 2V0NA 4TLDA 5EPOA 1OH5A 2HMTA 2JKVA 2VDRB 3LDHA 3MSCA 4MGEA 4N49A 4DC9A 1EP9A 221PA 2WIBA 2TMDA 1GXSB 4FHFA 4GRAA 5A4DA 4JL6A 4TSKA 5JW6A 2OV4A 4EEZA 4MUJA 4U39A 4JAVC 3SIWA 3OLVA 5ERXA 4BCDA 3KUDA 3GJ7A 1N2OA 3OCZA 4XDGA 3UG7A 4EMTA 1BX0A 3QEAZ 1G0NA 1G20B 1UMBB 2XE6A 5AO9A 3WNVA 4TMKA 2D0OB 5IMSA 2AG5A 1D6SA 3QE3A 4BPRA 4DREA 2P9HA 4N6GA 3CEMA 2DCUA 3DE7X 3SF0A 2F3TA 2XBLA 1GPDG 4YC7A 3QFFA 1E0AA 3ZHVA 2H3EA 3T9FA 1CR0A 5CBPB 1RRCA 4QHSA 3FMGA 4LVNA 4Q93A 2I9PA 4WFKA 4HAUA 4UZSA 4HT3B 4ZVTA 4W82A 5K99A 2JH8A 1W4ZA 4HQ0A 2DX7A 1ODLA 3A4IA 3IUNA 4U7WA 1FU8A 1TU0A 2FE1A 2VOEA 3BAFA 4DLPA 4QKQA 3JQFC 4KO2S 5HK9A 1OGJA 4M7RA 1FNSA 1YZNA 2AG6A 4YCSA 3K6JA 2C7GA 2FLWA 5IWCA 4HB2A 5LFAA 4D80A 3DC7A 1Y98A 4EIWA 1EE9A 3X1JA 4TWAA 5B3JA 1MFZA 3OE4A 3QEMB 4OHWA 3EVEA 2GK6A 2QUZA 3HCCA 4KQWA 3T7EA 3R3HA 4NEQA 5IF3A 3W8NA 3P2MA 1JAXA 3LPAA 4JU8A 3PDJA 5LU8A 4PSKA 2LIPA 4AS3A 3VKGA 2OP0A 1RXSA 4RPCA 5AHOA 2XGJA 1UPCA 2RC5A 4GXQA 4F2HA 4ETNA 5GGXA 5KX5F 4J6EA 3ZWPA 4BE7B 3HACA 3NVMB 1ZVVA 3RC7A 5H82A 3DMHA 1TQ6A 1DRJA 3W90A 2E6UX 2J5XA 1EDBA 1UIRA 4MRMB 5H16A 2PMEA 1FBNA 1BEUB 3P2EA 3ZJUA 1CUUA 1P7VA 1T1RA 1ZD8A 4XIFA 3BMNA 4LRWA 1FMLA 2VK8A 5IVIA 2A7QA 3TSAA 5JNRA 5EYPA 2GCOB 2V6BA 1J99A 2XZPA 4LY3A 3WO1A 4D74A 4FZVA 1THZA 1PJ8A 3EXIA 5I7UA 2G3YA 3KV1A 4YI5A 3UXMA 1JB9A 1G8HA 1SB8A 3JQQA 3PR1A 4R2MA 5AW4A 2ZR0A 1CUAA 2JLRA 5BSGA 1V35A 2Q5FA 1P8JA 4ZAYA 2IU4A 2VAXA 5LJLA 1SXGA 2Q6TA 3VNUA 2X19A 4XDYA 5D1NA 3ZJVA 5FWXB 3IMGA 2YZGA 5HQTA 4V2IA 3B7PA 4XM1A 4A15A 4AQDA 4MMZB 2WSSD 2V6FA 2QU8A 1ZGAA 3VR0A 4UD6A 3USES 3RFFA 1Z6AA 3VBEA 5KYWB 3R2JA 2PUGA 1PCXA 1L1QA 4B3JA 2CLOB 2GF2A 5E9AA 2PX5A 5BSVA 1ZQ9A 3E23A 4DXHA 3V9AA 3CR3C 5CDUA 1RCFA 1ZGGA 2OSBA 3H2JA 2QTZA 1O58A 1PI3A 2WD7B 3L0BA 2HNBA 4IPTA 1E18A 1LU9A 2FN3A 3O83A 4XX0B 4BBJA 2ZXUA 3JQGA 1U2RA 2D06A 4XVQA 4YFYA 3VH2A 1ZQ1A 4K9PA 5REQA 4AULA 2FW7A 1N1MA 1JIVA 1KVTA 1MO4A 2P2LA 4IW3B 3WLLA 5KCZA 2XQIA 1G5QA 1EZ1A 3UXYA 1N3BA 3AEUA 4P86A 2O3SA 1RYDA 1F6BA 2FP3A 1ZCAA 3OC0A 4LNAA 1UZMA 4UEKA 3U7IA 2XWSA 4BRWA 1A2QA 1G16A 4EGFA 2ZBQA 3T1OA 2J3KA 4QJ3A 4RK0A 3LBNA 5ALEA 5LB2A 5E1MA 4RY8A 5JZBA 1U65A 2NSJA 3LPNA 4UPDA 4CCYB 4QRDA 1KJ8A 4M1QA 3C24A 3JWGA 7YASA 1HFKA 4HQNA 1J8QA 3FNIA 3O73A 4KBFA 4U7FA 2PXCA 2QEQA 4Z4IA 1W4CA 3N05A 4DDUA 5LQSA 3NKFA 2D00A 2JHPA 1AUXA 1LK7A 1SHTX 1AHPA 3VR1A 3UMYA 1U4SA 2VZ0A 4YDSA 2J9FB 1UFQA 1I4DD 2ZRQA 3OCVA 3V1KA 3VVMA 3KEMA 1HR0B 1PJAA 1Z7GA 3R0IA 5CXXA 3B5EA 3D0RA 4V1CB 3PUVA 5LP6B 1HEYA 4LOAA 3STVA 3O4RA 4GQIA 4I4TA 4JUCA 3DKPA 5HUHA 4RTNA 7AT1A 4MWEA 3P9QA 3SDSA 3TR6A 2Y9PB 2W4IA 3COPA 3HB4X 3JQ7B 1ETHA 3M6VA 4IUYA 4I3FA 3UV7A 4FB4A 2ADMA 4QUIA 3BTVA 2PQ2A 4WE3A 5C1OA 1J24A 4MQFB 5CFLA 1Y3FE 1PNOA 2XTZA 3ILHA 4JL8A 3EFOB 1GQ2A 4QU8A 1S1MA 2CJYA 2F8LA 3E8XA 3PPYA 5FBHA 4PG7A 1D2RA 1C30A 1H2BA 3DTVD 4IDGA 4ACBA 2PXAA 1N1DA 1OCEA 1RJWA 3A6HA 1W29A 4OMCA 4FLMA 4ZVKA 1Z0AA 4DDMA 3HYSA 2B30A 2L18A 1UKZA 3DMFA 3NM5A 2BOVA 4JS0A 3ZX4A 2PKQP 1FFCA 1TLFA 3ZS8A 1J7JA 4ZZ2A 3EVAA 3TQSA 4ES6A 2EGHA 4BX8A 2YCLA 3KS9A 1N6NA 5I7AA 4I4TB 4HAWA 4QUJA 4OH1A 2PUVA 2RG7A 3L1IA 2WJWA 4M1KA 4YJGB 3GEBA 3K1JA 3W6NA 2O20A 1YRWA 3BFKA 1VKOA 4N54A 4OBWA 2HHHB 4R71A 2PEYA 4RA6B 2AUNA 1Y3DE 5D6NA 2WKWA 3TEFA 3NP7A 1RR6A 1T0JB 2NV0A 3GJSA 3M1AA 1R4MA 1RYZA 4M83A 3WKAA 5KWIA 2O2EA 4URHA 1MEOA 2I2CA 5ALKA 4YRAA 5JNUA 1FOEB 1SWWA 2PH7A 2XGSA 3GMDA 4ZQFA 5H0IA 3SKVA 5KWEA 3UJ3X 2Z8YM 1TFRA 3RIHA 1SZPA 3SFTA 5JZOA 2HJWA 1PK8A 4QIHA 4XGNA 5DGTA 3ORFA 3CXRA 4DEYA 3K0BA 1YR7A 2A1TR 4MVJI 1RYNA 3RTBA 2QTGA 2DHRA 2ZUDA 1EDEA 3Q7PA 1KKUA 1RW4A 2X7HA 3LKBA 4JP1A 3TQIA 3VR5A 2C61A 3OIUA 1K2WA 3WOHA 3T3MB 4W8HA 2H1IA 3DSRA 3DGFC 3SFZA 1Z5ZA 4ERNA 1SCIA 1D1TA 2IEIA 3BA1A 4Y6RA 4LWQA 3BIJA 2QI9F 3E15A 4ONEA 3GJ8A 1GNLA 1U2SA 3DWIA 1INLA 1XZKA 3HHEA 5K8LA 4OGKA 1ULUA 3RS9A 2FR0A 1M7BA 2HN9A 4P81A 1Q7TA 5EE3A 4W4TA 3TNFA 3LT0A 1OWLA 5F2EA 5AKIA 4X1KB 3HCBA 1SK8A 4YVFA 5H3CA 2X0DA 1JHQA 1XXLA 1N9GB 3QUTA 3UC9A 4QD3A 1YOVA 4TTTS 1NBEA 4OHBA 2ZYSA 2GAAA 1QFSA 2II6A 1SURA 1T5HX 1U2EA 2WHEA 2YL2A 1A97A 3P96A 1L4NA 4PQEA 5CVCA 2JD0A 4A10A 1N7JA 3UV3A 2UU9B 4IQ0A 3RW9A 1OR8A 2VZ8A 5HGJA 3AM1A 4LYJA 2YRXA 1EX6A 2XECA 4NBLA 5GJBA 1GPAA 3COVA 3F6EX 3EIEA 2J07A 4EFNA 3IDQA 2D1YA 2BGJA 3RB8A 2NUPB 1GN9A 3D5QA 1ZWLA 3R3YA 3OU7A 3R5HA 5L95A 1IUPA 4NE9A 2RHMA 4E2ZA 4UTVA 3IX7A 3LAWA 4TN1A 5EPEA 3WL3A 1ULZA 3CUYA 2M32A 3EEYA 4JJFA 1CUZA 2PGLA 2PO5A 3DLPX 4XIIA 1ZUNA 1UK7A 2JIOA 3H4TA 2ZJ6A 5B53A 3HA5A 4GX2A 2HU2A 3RRXA 2ODBA 2OKGA 2Q3DA 4LZJA 3WE7A 1ZD4A 2MINA 5KDOA 3K8YA 1K66A 3T38A 2W2TA 5AUQA 4JXKA 4XIGS 3CZ9A 2OO3A 5J40A 5JD4A 2OXRA 5J4KA 1UFRA 1TM7E 1CSEE 4Q9DA 1JDSA 4PYQA 4I4TF 3UCXA 1EXWA 1EZZA 3PA8A 4B0PA 5LMZA 2OTCA 3COWA 4UMFA 2YBDA 3WNCA 2GXQA 3G8DA 1X39A 4J91A 3UJ8A 4F4IA 2BH9A 2A3NA 2HBQA 3HBFA 1AA6A 2RGGA 2O7NA 1Z6ZA 2YUTA 1ENYA 4OUDB 3W5DA 3G17A 3PF9A 3CF2A 4F96A 2XMPA 3HCNA 2IP1A 1ZKMA 2PKRA 1SVWA 5AHWA 3VU0A 4BFVA 1FYXA 5A4IS 1TCVA 2IRWA 4OAOA 3K5WA 1BD3A 2XF2A 1ZP6A 4NSNA 4XQGA 3T4PA 4C01A 4CL3A 2QTNA 1QFZA 1TZBA 4TLBA 4PS1A 4XH9B 5KNDH 2P9YA 1Z7EA 1SXPA 3DVRX 1V8DA 2R751 4DYDA 5CFNA 4IWNA 3L8GA 3UMRA 2QX8A 4AP6A 1D03A 2EWWA 2PD6A 1WB5A 2Q3JA 3FSEA 5EJIA 4EG8A 3KPWA 4IEIA 2AOVA 2IYNA 5AKJA 5HMLA 3G85A 3WADA 3X1WA 1E3LA 4EX6A 4K86A 5ICFA 5T7BA 3OM8A 1QTQA 1U0EA 2X0KA 3QXXA 4EVIA 2XBMA 5KWJA 1ZEMA 3U13A 2WPDD 4QVIA 4LJLA 2ZJ3A 1K92A 3ZJTA 3A6PC 1WO8A 3M5WA 4TYYA 3STTA 3M6IA 1WW8A 1XQWA 4GRDA 2ZBFA 1WZUA 5BNIA 3WX0A 1V71A 2Q7XA 2BMJA 2CXRA 4BB0A 1QQ7A 2ACWA 4MNTA 1C3XA 3W2FA 1CF9A 4RWEA 4RHYA 3VPHA 4BAUA 1SKUA 4JC5A 1FPMA 4MB2A 4RMIA 2PGAA 3QEBZ 4REMA 3V8VA 3DEFA 3P32A 1J1IA 2D2VA 3MA0A 1WSAA 4GMKA 4ARBA 1IZ8A 4Z7OB 1G5FA 2WPNA 3S1LA 5KSWB 1XU7A 4DV1B 1O8CA 2RGNC 2YQZA 4B76A 4FM9A 2I3BA 5JT1A 3UHPA 4BL5A 3LUHA 3D4NA 3I2KA 1RFLA 3Q5GA 4NCBA 3A11A 5DWQA 1OTYA 3HI6A 4X45A 4D81A 3NMUF 4H31A 3MCWA 4YMUA 2AK3A 4IF4A 4PGFA 1UAGA 3CF4A 4L9RA 2BIFA 1P7YA 1S0UA 1ZH2A 5J2UA 2HSDA 3HXTA 2P9GA 2I76A 3AUYA 3OLCX 4RMHA 5DBHX 1H2EA 1WCIA 3KHSA 2VKQA 4IIBA 3OEYA 1PZEA 1Z07A 4NAVA 2EYUA 2AXNA 2XADA 3K5HA 3MN1A 4L6AA 1FE8A 2BL4A 2JEZA 4O8ZA 2FWIA 3P0JA 4EAQA 4EFLA 2CNKA 3A3KA 3KKQA 4MWBA 5JROA 4ZAGA 3NPAA 2JAXA 1DBWA 3EXFA 1RVV1 3GW8A 1JYSA 4JLJA 4P4TA 2XCTB 4OLFA 3I04A 2ZTLA 5H1YA 4DMGA 3WY9A 2BBSA 3OZ7A 3TLEA 1WDLA 1TADA 3UTDA 1LNSA 1G66A 4I81A 3WB0A 3DV0A 3RS7A 3O9MA 2NTYC 4A9AA 1XNQB 1UT5A 2IF0A 4DQLA 5CT5A 1XZJA 1SCBA 1SQ6A 1GNVA 1RC0A 2RHDA 1PFKA 4EM6A 1J8DA 4OB7A 5E38A 1YZTA 1QK3A 3A6GA 2X13A 4B44A 2XKAA 4LJRA 3IAHA 2X0FA 4CKEA 2IIQA 5LZ5A 1LPOA 3DCNA 2RD2A 1SH7A 3A31A 1K7FB 2E4ZA 3C3KA 5AW1A 4TYNA 1Y89A 1GARA 2RHWA 3BGIA 1NJ2A 2NO7A 1PD1A 1J0AA 3E9CA 4J4HA 4AL4A 5JSHA 1DIBA 3W4JA 4WK0B 5A62A 1EGQA 2P79A 3CRQA 1C7ZA 3M9WA 2IZ5A 4ZEXA 3ZXXA 4LUCA 1GG9A 3KZNA 4IG9A 3RARA 2GVDC 3N76A 1RRFA 2WNSA 4DJEC 3H9CA 4HTFA 5CFOA 3M89A 3OU2A 2FGJA 4FEGA 1V3UA 3KKLA 3NT2A 4WKBA 4CV3A 3I34X 1FP2A 5FPYA 1BOOA 4EKEA 5THXA 5K4GA 3BGVA 1KGSA 3EPJA 1A88A 3GDWA 2ISCA 4GMHA 3NW9A 4M54A 2HA7A 4B3GA 1HM5A 3QXSA 1E9RA 4BLWA 1R6XA 2C57A 1MPXA 2I0FA 2IC5A 3L7AA 3N2LA 1YB4A 3QOYA 1O6FA 4WN9B 5AM0A 2X5KO 4MWZA 2ZUFA 5A0VA 4OXIA 3IDAA 3WS7A 1C7JA 1H94A 1TKCA 5I9MA 1GUAA 3HXKA 4YK7A 2KBEA 4PLZA 4CBVA 2GN1A 2C83A 1DNPA 2QMOA 2UVQA 2X6TA 3I9MA 3Q2IA 2XUDA 3NEJA 4NZPA 5F33A 5KSPA 1A9ZA 5C5IA 1H5QA 4RBNA 4HNTA 1CUDA 4E2XA 5CLLA 1PO7A 3R7LA 2PZGA 5FL3A 5D1HA 2VEOA 3R23A 4ND6A 5GMOA 2W2NA 2ADFA 3HJNA 1R88A 2Y6UA 1AXEA 1C3OA 3GCDA 5LNK6 5FOTA 2DQ4A 2G5PA 2QX6A 5DGHA 4C3VA 1PK7A 3GEMA 4AMBA 9ATCA 3A6LA 1M0EA 1ZNWA 2C2HA 5C1BA 1Z13A 1IUKA 4QA9A 4X1YA 4Q7MB 5AUPB 4F86A 3LO5A 4FVTA 4X1KA 4BN4A 1PWZA 5D84A 3W78A 3OAAD 3ZQJA 4S1TA 1I4TD 2Z57A 4FCTA 3ZHTA 4NCKA 3VTZA 1YZUA 3HRHA 3IOBA 2V0GA 3FZEA 1ODJA 2QNRA 3T0IA 5KVCA 4ZVLA 1QB8A 1I5EA 4RY2A 1IOWA 4XFJA 4LE2A 1OW3B 1RIIA 4ZGWA 2FWAA 2QLNA 1KRXA 1XQYA 1SVUA 4UCXA 4NXMB 3LWBA 1NI4A 5TJ9A 3IUQA 4OI4A 1PDVA 3R7WA 1MAVA 4YACA 3IJEB 3CNEA 2JCXA 3G9ZA 4F38A 3PYMA 2PZ8A 1MRSA 1Q1EA 2NSLA 5ETJA 2ZBVA 4MA0A 1JWBB 4NFHA 1X1QA 2X6RA 4XWOA 5F7OA 3SJCA 3Q6IA 2O5EA 1KNXA 5EUBA 3IEXA 1MNAA 2VJMA 4ALMA 3A1TA 2B20A 3D1JA 3I6IA 1J07A 2O05A 5HP4A 4K3UA 1WZ2A 3T4EA 5TQ2A 1LI7A 3OTQA 4PCLA 1E5LA 1OFGA 3TZCA 3W8RA 1OBCA 4EKYA 2YWGA 4QVGA 3L7IA 2BR3A 4A36A 4JFRA 1GNPA 3FCEA 1QG4A 1QIHA 4KBYA 1FVFA 1R27A 2I4NA 4G23A 4LY6A 4ZO6A 5E1DA 3F98A 3RFCA 5LIPA 1NMSA 3AR5A 3AK4A 4PG4A 5CB0A 3M2TA 5JXIA 1GIAA 4XLLA 3SM3A 4Q0MA 3LGXA 3IT3A 1LA2A 4EMBA 1B2RA 3CBGA 2GTPA 2XWPA 3ZK7A 3IHLA 3R7SA 4RPIA 2I03A 7REQA 4C14A 1YL5A 3EJWA 2O3JA 4XI9A 4AO7A 1HETA 1DEHA 2FGKA 2FN4A 3T7KA 3V00A 2PSDA 4ZYUA 2Z98A 4Y9RA 1J1UA 1P73A 4DBZA 4X65B 2QN6A 4RTKA 4JQYA 3LH5A 1LPPA 1P3JA 3LYLA 1FW6A 3NASA 1E63A 1X15A 1OT5A 1T9AA 1X1RA 2AD5A 1RBZA 2ANCA 1VRWA 2CY0A