2J3KA

Crystal structure of arabidopsis thaliana double bond reductase (at5g16970)-ternary complex ii
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
345
structure length
336
Chain Sequence
MTATNKQVILKDYVSGFPTESDFDFTTTTVELRVPEGTNSVLVKNLYLSCDPYMRIRMGKQAYTPGQPIQGYGVSRIIESGHPDYKKGDLLWGIVAWEEYSVITPMTHAHFKIQHTDVPLSYYTGLLGMPGMTAYAGFYEVCSPKEGETVYVSAASGAVGQLVGQLAKMMGCYVVGSAGSKEKVDLLKTKFGFDDAFNYKEESDLTAALKRCFPNGIDIYFENVGGKMLDAVLVNMNMHGRIAVCGMISQYNLENQEGVHNLSNIIYKRNRIQGFVVSDFYDKYSKFLEFVLPHIREGKITYVEDVADGLEKAPEALVGLFHGKNVGKQVVVVARE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADPH-dependent oxidoreductase 2-alkenal reductase
publication title Mechanistic and structural studies of apoform, binary, and ternary complexes of the Arabidopsis alkenal double bond reductase At5g16970.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 82
structure length 336
sequence length 345
chains with identical sequence B
ec nomenclature ec 1.3.1.74: 2-alkenal reductase (NAD(P)(+)).
pdb deposition date 2006-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF16884 ADH_N_2 N-terminal domain of oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2j3kA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2j3kA01
1LNQA 3OIGA 5C7IO 1TVEA 2VHWA 4JXKA 4RVFA 3JQAB 1X14A 5K6AA 1F0YA 1GYPA 1DOHA 3QA9A 4PLCA 4QEDA 1PJ4A 2XPCA 4KOAA 3O03A 1U8FO 3E48A 3BIOA 4H16A 4LK3A 3LYLA 1BDBA 1WP4A 1PS8A 2OOSA 1GCOA 1YOVB 3E1KA 2JJYA 4RV9A 1LEHA 2UUOA 3MJVA 4BQPA 4DC0A 3IIEA 1IPEA 2UVDA 1V3VA 1ZUD1 2GD1O 1Z82A 3ZHZA 1VJTA 2W2LA 3E18A 1HE4A 1ZJZA 4NFSA 4XA8A 1MX3A 3ZV4A 2CD9A 1HETA 3G49A 5JMPA 2X1HA 1P9LA 1LLCA 2IRWA 4II2A 4BO6A 4D43A 1HT0A 3UF0A 1QMGA 1MFZA 1P1RA 1SB9A 2RBEA 1MB4A 2C7VA 3ITDA 4KUEA 3I9MA 3TFQA 4HV4A 1KEVA 3L9WA 1ZK2A 2HK7A 4ZHSA 1YBMA 1DC4A 4WNIA 3E9NA 3OSUA 3JD3A 3ZU4A 3INGA 4A03A 4BGIA 4OOFA 4URFA 5L4SA 3TNLA 1TI7A 2FPGA 2POQX 3FNEA 1UXKA 3N74A 4I5EA 2IEBA 5DN9A 1N7GA 3WNQA 3UFXA 3K2EA 4A5OA 4S3MA 4CMHA 3ZWVA 5JDIA 4XQGA 4W99A 2X9GA 3N58A 2GRAA 4GX2A 3S55A 1BGVA 3ETDA 1PQWA 2B83A 4FOOA 2JHFA 5JDCA 4FQ8A 2C5EA 3IUPA 3PGXA 4PZCA 4MINA 3NRCA 5TRTA 5TS3A 3GZ4A 2OP0A 1O0SA 5JC8A 1Q0LA 3SC6A 4KQXA 1AUPA 1DLJA 3IS3A 4IDGA 2DBVO 1GV0A 1PGNA 3V2GA 1U4OA 3BA1A 3U9LA 4NBVA 3OJ0A 3PJEA 2PV7A 4DC1A 4TVBA 3I6IA 2FRDA 3GLQA 3FNHA 1U3UA 2DFVA 1BW9A 3GUCA 4FB5A 5JSFA 3BMOB 3W1VA 3A4VA 4CM8B 1IUKA 1DPGA 3WQRA 5L4NA 3DOOA 4FC6A 1GYQA 4ID9A 4UVDA 3QLJA 5I9MA 1DJNA 5H82A 1LX6A 1GV1A 4O0LA 2G76A 1LJ8A 4AJHA 3AUUA 1F17A 2YDYA 1T2AA 2NNLD 3KM0A 1EEHA 3QSGA 4TRJA 5FI5A 2VUSA 1SMKA 3DB2A 1K2WA 2BF7A 1K89A 5JXWA 4OKNA 1Z73A 4U0KA 5AYVA 4IJWA 4M86A 5ES3A 5HA5A 1Y6JA 2GO1A 1QYXA 1L7DA 1UH5A 1Z74A 4WUVA 1XDWA 4XZ3A 1QORA 2ZKLA 2CY0A 2W2KB 4ITUA 4XGIA 5KVVA 3I4FA 2CDCA 4R01A 3KHUA 3ZDFA 2I3GA 1T2EA 1NAIA 3NTRA 4E0BA 3KO8A 2WDZA 5CDSA 1NPYA 3GFBA 1PJSA 4BNVA 4YB8A 1B2LA 4J1NA 4LVCA 4JLWA 2JFGA 3FWZA 1JKFA 4XDZA 1JTVA 9LDBA 3BHJA 1YL7A 5JDCC 1GCUA 4WEOA 2PKQP 1UXGA 4Y6PA 3JQGA 5KKAA 3TOZA 2O7SA 2P5UA 2IE0A 1V8BA 3BTVA 1WW8A 2OUIA 1LQTA 2PD4A 3RKUA 3VH4A 5F21A 3DHNA 5HBRA 1QYWA 2CZCA 1T26A 3GVCA 2AXQA 1I3LA 2X0NA 5TT1A 1R6DA 2GASA 2RHCA 4MVJH 2BKAA 3DZKA 4TWRA 2RH8A 2YV1A 3ZWAA 1SOVA 4HFRA 2PD3A 1IZ0A 4GKBA 4OOEA 4RPJA 4RPGA 1QP8A 1VI2A 1DIGA 1GUFA 2P9EA 4J9UE 3ZWWA 1EFKA 2DM6A 1EFLA 1Q1NA 2FMUA 4CMJA 3RUDA 1ZFNA 2J3KA 4ZU3A 4BV9A 2O23A 2VWPA 3HFGA 3CE6A 3H9UA 3G79A 3F9IA 3ITKA 4P38A 3FD8A 4BKRA 4U5QA 3V2HA 3R3JA 4IGFA 3RFVA 3KV3O 3TOXA 4E2WA 3ONEA 2QYTA 4BNIA 2W90A 4O63O 1N2SA 3X2FA 1DXYA 3QJ5A 1OFGA 2I66A 2YHIA 4AJ4A 1R4MA 2AHRA 2P5YA 3GK3A 4F3YA 5A9RA 3JQ7A 3LSYA 2RHRA 4PLYA 5EL0A 3D64A 4BKOA 1ZXLA 1P0CA 3ROPA 4XYMA 2DC1A 4JIGA 1KOLA 3SX2A 1RPNA 3PHIA 4WPGA 2ZTLA 3L4BA 3EUWA 3CZRA 4ROSA 3F47A 4ZQFA 5G4KA 4P22A 4FCCA 1WMAA 4EYEA 2HDHA 3B1JA 3O38A 2AE2A 4RVSA 3H8VA 3ZWCA 5JAQA 3GGOA 1C0IA 3DR3A 4MIEA 1JW9B 3AUSA 1QSGA 2WEKA 1P45A 4M55A 1IPFA 1BTOA 3F6YA 1YL5A 2UV8A 5K0ZA 4I1IA 1GUZA 2E4AA 1GDHA 2VYVA 1KBZA 3V1TC 1HYEA 1YDEA 4GMFA 2E82A 1HSZA 5JFOA 1E7WA 1ZJYA 3NTOA 4GVLA 1NWHA 1TB4A 5COAA 3Q1LA 3WGYA 2NV6A 1A4IA 4NPCA 4YAGA 5DBFA 4B7UA 3FTPA 3BMQA 1MC5A 4L9RA 4RF5A 3ZNPA 4Q3NA 4UUNA 3WICA 3ZU3A 1GR0A 2VZ8A 5AQ1A 3GEMA 3DBRA 4Z6KA 4JJIA 3S1LA 1AHHA 1ISGA 3MOIA 5KNLA 4DL9A 4XCVA 5EQDA 5G0UA 2IZ0A 2ZB7A 1PZHA 5JPIA 4RORA 1ML3A 5BSEA 5JAMA 5HM8A 1E3LA 3F4BA 1LXCA 4YT5A 2JHGA 1R15A 4A26A 1ADCA 4L4SA 1UP6A 2O4UX 1SEVA 3DTYA 1RM0A 4CL8A 1VC2A 4ONEA 2DAPA 4M87A 1AN9A 4RZIA 1RM3A 1O8CA 1L7EA 5IJZA 4XIJA 3TJRA 1E5QA 3QY9A 1NR7A 1OBFO 1PWXA 4K28A 3VTFA 4A2CA 4BGVA 4JBHA 1SNYA 4B8ZA 4ZJUA 2O2YA 5IXYA 1MFPA 2IYOA 5DCYA 1DHRA 1Y8QA 3QWBA 3I6QA 1RJWA 3AOGA 2JD2A 4FPXA 2UYYA 4BB6A 2GYYA 3EHEA 3PFWO 5JW6A 5JS6A 5IF3A 4J16A 3A9WA 3BMCB 3L4BC 1E1NA 2Q4EA 3ZV5A 3IMFA 3CINA 2QHXA 1W73A 4GI2A 5EMHA 4YBZA 4FJ0A 2PGDA 2ZB8A 1Y7TA 3OMLA 5CDGA 4IDEA 2PNFA 3AUAA 2EJWA 5HS4A 3PEFA 4CM1A 4GH5A 5LCXA 5KVSA 4MKZA 1TA4A 2QW8A 4PLTA 3EAGA 2DU8A 3ZN2A 5CPFA 4WJZA 1I10A 5LDGA 1TXGA 4ZVVA 5A04A 3E5RA 1J4AA 3ICCA 4FGWA 1I30A 1EBUA 1T2CA 3TZCA 3WGGA 3ZHBA 3UCEA 1NQ5A 2NU7A 3JD4A 3KETA 1P1FA 3ZHXA 2NACA 3TZHA 4YXFA 2HK9A 3FHLA 1H6CA 2UAGA 4BL5A 4OAQA 3DMYA 4UULA 1I33A 4YT4A 4ND5A 4IIUA 1XQ1A 2VZ9A 3DOJA 2Q50A 4R68A 3NV9A 3QQPA 2Z1MA 4PG7A 3H9QA 1XG5A 1LSJA 3BHMA 1Z7EA 4IXWA 1SBYA 1Z45A 4KWHA 4Q3AA 4JJGA 3W6UA 1HWYA 2Y1FA 3RD5A 1GZ6A 2HLPA 3E6AA 3E9MA 3OHSX 4CR6A 3GHYA 4BMSA 4J4HA 3LZ6A 4A10A 1HDGO 1H9AA 5C5IA 4GLOA 4MVJE 1V0JA 1YH3A 4F45A 4DTIA 2B0JA 1ONOA 3DQPA 5F1PA 5KTKA 2Q2QA 4PLWA 1CERA 2XXBA 4TMFA 4IGEA 1UP7A 3DAPA 5G4KB 3WDSA 4YT2A 1K6XA 5CEJA 1CEQA 5TX7A 1D7OA 3R0IA 1KY4A 4IINA 3VOSA 1ZBQA 4IUYA 3I9NA 5ENDA 4UVIA 1NP3A 2UUPA 4B4UA 2X4GA 1E3JA 3WJAA 3ZU5A 3MOGA 3DZIA 4J6FA 2OMEA 2QQ5A 2VRBA 3CEAA 4JX8A 4YQYA 4BNTA 3TPCA 2VUUA 3UXYA 4JK3A 1U2DA 3EZYA 4IDAA 4A73A 4D46A 1IHXA 1XGKA 4MVJM 2Y1DA 1KIFA 4XRRA 2PKQO 1JAXA 3E82A 3WWZA 2XAAA 2IZ1A 1JDJA 1RKXA 5DNAA 2EHDA 4NIMA 3VH2A 3TL3A 3WX0A 3WMWA 4CMBA 3GPIA 3Q0EA 4MVJA 4OQZA 4RF3A 3RCBA 2C2YA 5JBIA 3DBRB 2C29D 4J9VA 5L53A 5ITWA 3G17A 3ICPA 1DFHA 4YJFB 3LT1A 5A03A 1DBVO 1FDVA 2EKQA 3PDJA 4GAEA 4MVJF 4CM4B 5ICSA 2PGJA 1JLLA 1LDEA 5A02A 3EZLA 1JVBA 5DOVA 3T7EA 3NDRA 4OL9A 2H1SA 4O1MA 2GNAA 4JBGA 3RU7A 1HDXA 3PJGA 4RPLA 3WSWA 3M1AA 4XIYA 4XKJA 4L73A 3JCZA 4XR4A 5BQFA 5CG1A 1NBOA 3LC2O 3D5QA 2Q49A 1XU7A 4JCOA 1H5QA 3QVSA 3JD1A 4B8WA 3RFXA 3GHHA 3PTZA 4L0QA 3PHGA 2LDXA 2Q2WA 5TSDA 2FY8A 3RUAA 4BNWA 2VOEA 3WLFA 3U3XA 1MV8A 5COBA 2CF5A 4ZQEA 5KJCA 1KEUA 4J0FA 2Z5LA 5JC1A 3E9QA 5DBGA 1PGPA 1U5CA 5A1TA 4K6CA 4YRAA 1ADFA 5HS6A 3ROKA 5U1PA 5BR7A 1ZZEA 3LVFO 2NTJA 2Y0EA 4NFYA 4NK5A 4BNMA 2TMDA 3VDRA 1YS4A 4XB1A 1HKUA 3VZSA 1GQ2A 2EW8A 1H0KA 1LU9A 2HRBA 3NJ8A 5F1KA 2V6GA 5JLAA 5ADHA 4NHEA 2EKLA 1JKIA 1PZFA 4NQZA 1X15A 3RUHA 2X6TA 1VL8A 1T25A 1UZLA 5B37A 1H9BA 2YQ5A 5ICMA 1YJQA 3FR8A 3PZBA 2FSVA 1QLJA 2A35A 2ZTMA 3SEFA 4PLZA 4II3A 2ZYDA 1V9LA 5TT0A 2ILTA 2PA3A 3K31A 3WG9A 2BLLA 3CZMA 1LQUA 2O3QA 4OGWA 2VWGA 3JQCA 4NH4A 2P4QA 5LC1A 3EDMA 5A05A 3VZRA 1EVZA 5G0TA 1E1LA 4DMLA 3QWIA 4MVJD 1DFGA 1M67A 1PGOA 4YAKA 1C1DB 2D5CA 2FR8A 3M2PA 4GL4A 3S2GA 1UDCA 3ZNQA 4P4GA 2DUWA 1YB1A 3RQSA 4R1SA 5IG2A 4K6FA 4RPHA 3GFGA 1VL6A 4U0JA 1VKOA 5GY7A 3GC6A 1XHLA 4TRMA 3D0OA 4AJEA 1DIBA 3BTUA 1JWBB 4UAGA 5A9TA 3OJFA 4D7AA 3GAZA 4EITA 2AEMA 1G0NA 3O9ZA 1EZ4A 5A5EA 2PFGA 4KQWA 4LN1A 4F6CA 1RM4A 3PIDA 1UAGA 5C7LO 5KVQA 4BNFA 3KXDA 1XA0A 3RI3A 2ZB4A 1EK6A 1LLQA 3FBGA 4HFMA 1I2ZA 4LSWA 1PZGA 5F5NA 2AQIA 2GSDA 3GR6A 4U8GA 4ZN6A 1FK8A 3UHAA 1IL0A 1RWBA 4CLDA 4NBWA 4OQYA 2YZ7A 4PCVA 3DL2A 4CM3A 1DEHA 1AGNA 2Q1UA 2Z95A 3FF4A 1ONPA 3KTDA 3LQFA 3L0DA 4GQAA 4IMPA 2O7QA 5L3ZA 3FNFA 3DFZA 5C3MA 3WIEA 1GYRA 3H9GA 1EMDA 3AWDA 4BUCA 4NJOA 1U2GA 4I9HA 5JCJD 3UKOA 1BVUA 2YV2A 4UUMA 3JQ8A 4Z0HO 3PLNA 4EI2A 1OC4A 3DMTA 4NFHA 4BNNA 5C7OO 1SO8A 1P3DA 2GN6A 2NTVA 4O5OA 2W2KA 5HRUA 4Z0PA 4ZA2A 5IAAA 4IDDA 5EPOA 4NNJA 3LF2A 3DZBA 2W98A 4TVOA 2Y66A 3AUTA 3DBLB 4I5FA 1PR3A 3ZWYA 4G81A 3W4IA 1EUCA 4E2YA 3DTTA 2J5QA 3OJOA 4N5NA 1N5DA 3CIFA 3JYPA 4NR0A 3ON5A 2WD8A 1GAEO 1QV6A 4MP6A 5J23A 1KVQA 3WOHA 1YBAA 4N5MA 5B4UA 5DBIA 4IM7A 8LDHA 1U28A 5TF4A 5A4DA 2E49A 3WXBA 4WOKA 4OSPA 3GVIA 3PHLA 2FSSA 4QO8A 2HAEA 1U5AA 1WDKA 2WM3A 1PJCA 3PK0A 1ID1A 3HNPA 4H3VA 5A06A 3SJ7A 4BNHA 2D8AA 3L6DA 1Q0HA 1SEPA 3ZWOA 1IOLA 4BMNA 4EGFA 3WGIA 2GLXA 1SOWA 4PIVA 1ENPA 5L9AA 5L7TA 3SJUA 1NHGA 1LLUA 2OBYA 4RQTA 4QSMA 3ZGYA 3KEOA 1CJCA 2EWMA 1HDCA 3I9LA 3OICA 2CFCA 3C7DB 3KSDO 4F6LA 1DAPA 4N54A 4MVJG 3GEDA 5AXBA 4FS3A 1LDGA 4BMVA 2AEJA 2F00A 3UW3A 2D5AA 2P9GA 2C5AA 1DDOA 2EJVA 1HXHA 4NG5A 4Z9FA 4KWIA 1GZ4A 4HADA 3AOEA 3UVEA 2W8ZA 5IN5A 4YJHA 1ONNA 3ETGA 2NADA 2SCUA 3NTQA 1KVRA 5BSGA 4KDFA 4CJXA 4MP8A 2JAPA 3Q2IA 4E30A 1R0SA 2DTDA 1FXSA 3NGXA 3H6KA 4AJNA 1HDRA 3VPGA 5KWEA 3PZRA 2FZEA 3IQDB 3GRKA 3DMTC 4AJPA 1B8PA 1SC6A 1PSDA 4BO3A 1LSOA 5COQA 5H81A 3MJ4A 1ENYA 3O8QB 1I3NA 3DZHA 1R66A 3FNGA 2D3TA 2X5KO 1CDOA 2FR1A 5L51A 2NU8A 4FJ1A 2Q3EA 1HZJA 2NM0A 5JAIA 1EQ2A 3AI3A 1XKQA 2EP7A 5FEUA 3TN7A 4WCDA 3TFOA 1A9YA 5JO0A 1LTHR 1AHIA 3UOGA 2QG4A 5THKA 4GVXA 1I8TA 1XSEA 5K6AC 1MGOA 3AFNA 2W4QA 2Q1TA 2EERA 1VM6A 1PS9A 1NFRA 2GGSA 1V3TA 1CRWG 2D0IA 1H6DA 1JVSA 1TT7A 2ZCUA 5CHEA 4PVCA 4YVFA 1ZEMA 5DT9A 1BDMA 1VJ0A 4J2HA 2H63A 2DPHA 3DO5A 3AW9A 4TZTA 5GMOA 2QRKA 3T4EA 1DAOA 3PLRA 4QFDA 1BXKA 2QRLA 3AY3A 4MIYA 4IMRA 2DVMA 4IJKA 4RVGA 1F8GA 1I2CA 4DMMA 1BHSA 2X5OA 3H3FA 4JJFA 4PVDA 1BVRA 1C0KA 5IZ4A 5KVCA 4IQ0A 1UJMA 1CETA 1WMBA 4L4XA 1W0CA 3JQ8B 1S6YA 3GZNB 4DUPA 3HN7A 3RJ9A 3ST7A 5TQVA 1GEEA 3AOEC 4HFNA 1YE3A 2EP5A 4I5GA 5HWSA 5FF9A 4DQUA 2X9VA 3KUXA 4X54A 1VL0A 1BXGA 2PZKA 5JDIC 1ZKMA 5IDYA 2AW5A 1I32A 1NVGA 1QRRA 4HNHA 4TROA 4W6ZA 2GZ2A 1HYGA 2FPPA 2R2GA 4NMHA 2YYYA 4CLOB 1LRJA 2DBQA 1N1GA 3QWAA 3DZFA 4FDAA 1GQYA 3M6IA 1XLTA 4Q3DA 5EJ2A 2C0CA 4WLEA 3I23A 3B6ZA 3JD2A 4Y6RA 3BMCA 5KJ1A 3H5RA 4Y98A 1VLLA 1BXZA 3DZGA 3UH1A 4ESOA 1UDBA 4RLHA 1K5HA 3ENKA 4GSLA 5LDHA 1O6ZA 1I5RA 1UZMA 3DFUA 3V5NA 2VN8A 3SLGA 1X13A 2RH4A 4ZQHA 3W8FA 3PQDA 2V6BA 1J49A 2JFHA 2VNAA 3IKVA 1I0ZA 5TGDA 2Y0CA 3B20A 4BO8A 4CR7A 3U62A 5JNLA 4XQEA 3KRTA 4ZQBA 5H83A 1O89A 3FSRA 1G0OA 4YDRA 3HJAA 2DUUA 3H5NA 2X9NA 5KJ6A 5DDIP 3GH3A 3JSAA 3ETEA 2HO5A 3PFFA 2BRUA 2O3TA 3ZWPA 2C2XA 3NKLA 3OFSA 4FIZA 1IULA 4PZEA 1U4SA 5GZ6A 4WASA 4YJHB 4BOYA 1PL8A 5GZ1A 1YL6A 1IE3A 1TEHA 1Y9EA 3CTMA 3EVTA 4C4OA 2Y99A 4M8SA 2VHXA 3RUIA 3K8ZA 3GVXA 5T8KA 1VSVA 2OZPA 3CMMA 2J8ZA 4EJMA 5L45A 4XR9A 3ONDA 4QO7A 4QQRA 1ZW1A 1NM5A 5CP8A 2Z1NA 1K6IA 4CM9D 1P33A 3KYBA 3L4SO 2X58A 3TZQA 2O2SA 2V6MA 2CUKA 4Q39A 3VPHA 4YRBA 4WLOA 3QWFA 3QV1A 1JWAB 2IXBA 3GN2A 3QE3A 3WYEA 4PRKA 3STHA 5A9SB 1WDLA 1KY5A 1YGYA 2ZYAA 4BKQA 3MJEA 3P19A 3RVDA 3WIDA 4AJOA 4CQMD 4GWGA 4D0SA 4LMPA 1U7HA 1O94A 3MCVA 1C14A 4C7JA 1BWSA 1R4NB 5CFZA 3OJEA 1LRLA 2NU6A 1F12A 4LCJA 2DLDA 2Y93A 2E6UX 2FHSA 4UEJA 4J4BA 1R0LA 3RUFA 3VC7A 3MWEB 3GOHA 4RO0A 1P31A 1HE2A 3PPIA 4ZGWA 1UXIA 2I3AA 3EYWA 3T7CA 1NXQA 3NX4A 3EW7A 4E5MA 4CMIB 4YTEA 1HRDA 2GCGA 3EGOA 4AJLA 2Y68A 4EEXA 2WD7A 1PGQA 1WVGA 4LSMA 2QIOA 3U0BA 1ZSYA 3BMNB 4Q9NA 4DQXA 3LF1A 3ZI0A 4NZ9A 3KYDB 5G4LA 4BB5A 3HADA 5DZSA 3ZNNA 3ANNA 2A4KA 2HCTA 4WOJA 1C0LA 4FN4A 1PR9A 4YJFA 1Q2XA 3TWOA 5IN4A 1T4DA 4CM4A 2X86A 3AY7A 4J2OA 3RC2A 2Q4BA 2VOJA 1ISIA 3WGOA 1QR6A 1B26A 1ZXBA 3AM4A 3W4KA 2AQ8A 3EVNA 3HFSA 3F1LA 1QYCA 4DXHA 2F1KA 2PH3A 1YO6A 4R41A 3MTGA 2Y1GA 3NT4A 4O6VA 1FJHA 2HJSA 2PGLA 2X0RA 1BXGB 3C3XA 2G1UA 3MWDB 3WGZA 4BO2A 1PIWA 1YXMA 5CDYA 2XOXA 5T8KC 4PLGA 3JYQA 3HHPA 4NJMA 4XYBA 2PH5A 4WCFA 5KJFA 4CQMB 2D2IA 5JYDA 4ZRNA 4IJUA 4YQZA 4BKUA 4ALNA 4RJTA 1HL3A 2PR2A 4XX0A 5KCZA 1FMCA 3HG7A 3OQBA 1Y1PA 1QKIA 3WFJA 3P2YA 4UEOA 1VPDA 5DCUA 1E7QA 3B1KA 5G2OA 4RQUA 4AL4A 1E6WA 4IDCA 2WSBA 4J1TA 4GMGA 1B8UA 3G3EA 1U1IA 4MO2A 3ADPA 5BNFA 3C85A 1I3MA 4R9RA 3A1NA 3UN1A 4GGOA 4DREA 2O50A 4LRTB 1M6WA 2WE8A 3E8XA 2BFOA 3E5MA 4E32A 1E1MA 4D3SA 3G0OA 1NVMB 3I1JA 4MKXA 1NQAO 1DRUA 4NBRA 1KVTA 1WLYA 2I99A 1RYDA 4KZPA 1X1EA 3WGTA 4CMEA 2G0TA 1M6HA 4GWKA 2VWQA 3ULKA 3SLKA 2AG8A 4LVUA 4BGEA 1TT5B 1H94A 2Q1WA 3H9EO 3I83A 1AXEA 5T6BA 1C1DA 3GN1A 1ZEJA 2EXXA 5IZCA 4GPD1 2WE7A 3GPDG 1GADO 2B4TO 3HQ4O 4RLSA 3WJ7A 1T2FA 4TRNA 4IDBA 1T4BA 2HSDA 4E5YA 4ZRMA 3OF2A 3Q11A 4H7PA 1Y9AA 1DHTA 1PEDA 4N18A 4A0SA 2B37A 2GR9A 1HTBA 4J90A 4AJKA 1MC4A 4IZIA 1YRLA 4IQGA 1X1TA 1GU7A 1C1XA 3NEPX 4JP2A 1DRWA 1R0KA 1G6KA 3P5SA 4WCFC 4CUKA 3ANMA 4QECA 4J4TA 3BHIA 3DEYX 1B7GO 1P74A 2CF6A 1UUFA 3I9JA 5AXCA 3NYWA 2YFQA 2YJZA 2I5PO 3K6JA 3X2EA 3Q9NA 1F8FA 4CMAA 4BO1A 5F1OA 4U7WA 3BAZA 4BO4A 2AQKA 1GFSA 4KUGA 4R54A 4CM7A 4ALIA 3TSCA 4E3ZA 5I8ZA 3GNSA 1ISMA 2I6TA 5DF1A 3HN2A 3WTBA 1ADBA 2B36A 4Y8VA 5EIOA 2WD7B 3ROQA 2I9PA 1NTOA 1YQDA 1K0UA 5FWNA 2O3UA 3TZ6A 1H93A 4R69A 4FGSA 2C20A 4XDYA 3S2IA 5L4LA 1F06A 3F4LA 3IJRA 5JO9A 1L1FA 3DONA 4DLBA 2Q99A 5L40A 5DULA 3ORFA 1H6BA 1NAHA 3GDOA 2B35A 1ENOA 3GNTA 4L8VA 4CM5A 4W9NA 3U4DA 3LDHA 1PTJA 3NAQA 3LT2A 1E92A 2GZ1A 4CMEC 4R3NA 3U4HA 2Y67A 1HZZA 2ZTUA 4J43A 3ZHYA 3DBLA 4FFRA 2BI8A 4N5LA 4XD2A 4HFJA 5CAEA 3FPLA 3FWNA 1Q7CA 1P44A 1P0FA 3GG2A 4QT0A 1BG6A 4YA6A 5IZCC 3MEQA 2NQTA 2FP4A 3V8BA 4OHUA 4KUHA 1HDOA 3C1AA 4NJMB 3CH6A 4W7IA 3RAJA 1E1KA 4WCFB 2G5CA 1QXSA 3K2BA 4OXYA 1QYDA 4B4OA 2BFMA 3C24A 3D7LA 3LC1O 4E6PA 3HB5X 2BMAA 5IDQA 1EQUA 2EIHA 3W8EA 4E5PA 3GA0A 1LSUA 3ZV6A 1E3WB 2ET6A 4E2XA 1ZK1A 4FFPA 1UXJA 4FD3A 3PJFA 2HMUA 4A7PA 1DC5A 1LI4A 2J3IA 2R00A 3AI2A 4EUHA 3TF5A 2B69A 2H6EA 2PTGA 1NX6A 1B16A 1TLTA 4IS2A 1P1JA 4WLNA 3DXFA 1I24A 4FR5A 1GTMA 4P8RA 1K6JA 2QX7A 2NSDA 5ER6A 2B5WA 3WTCA 3QVOA 4ZICA 1J0XO 1NASA 1X7HA 1M76A 3U4CA 3HUDA 1H2BA 2VYND 3I9OA 1DB3A 4W82A 2JFFA 5JCJA 4B3JA 2OFPA 4BGUA 2EGHA 4QX6A 3OETA 3Q6IA 4IJVA 4EUFA 1HLPA 4Z9YA 1EUZA 1K3TA 1PJQA 1U9JA 1U3TA 5JE8A 4R9SA 4MJLA 3W8DA 3WGQA 2VWHA 3A14A 4R3WA 3K92A 4AJJA 3DAGA 5T67A 1M2WA 7ADHA 1LRKA 2GDZA 4Q3CA 5CPBA 4IIVA 4XRGA 3WBBA 2CMDA 3Q2KA 1A7AA 2X5JO 3PYXA 4FFNA 3QW2A 4B3IA 4MKRA 4M49A 2A9FA 3DHEA 3H9JA 5I7FA 3ZH2A 3DDNA 4CUZA 4GX1A 2HKIA 5F3RA 4W9NC 3TL2A 2Q2VA 3GDFA 1WZEA 3DC2A 2ZTVA 3O8QA 4KTTE 5AVOA 4XYLA 1OMOA 2GN4A 1NYTA 4L74A 3KOUA 1U8XX 2BD0A 3ASVA 3ZWNA 1B3RA 3GVHA 5T5QA 4AVYA 4DYVA 1DFIA 1BMDA 3I9KA 3WWYA 1B8VA 1P1IA 3R1IA 1U3VA 1GY8A 2O48X 4DYDA 1C1XB 3H65A 1M75A 1VSUA 4CL3A 1IZ9A 1YDWA 4UVEA 3JQEA 2A92A 1PZEA 5BSFA 1A4UA 2Q46A 4RGBA 1O9BA 2BELA 4DIBA 4Y67A 4XYGA 3SBOA 3UUWA 3LU1A 3K73O 1E77A 3NGLA 1E7YA 1J5PA 4F46A 4DVJA 3JD0A 2R00C 3JQAD 4MIOA 4GBJA 4ALJA 1DIAA 4EDFA 3F1KA 2X7HA 3DBVO 4FFMA 5FYDA 2HJRA 1YB4A 4RL6A 3JQFA 4L4RA 1ENZA 1ZNQO 4E12A 2OP1A 2FN7A 1T24A 4JN6B 1B14A 2X0JA 3ZU2A 5I7SA 5HTOA 1ARZA 1OI7A 3GZNA 4TRRA 3TQHA 4CM6A 2OHXA 1WXDA 5JY6A 2GF2A 1PL7A 4XQCA 1QV7A 3F5QA 2O4CA 1DLIA 5AOVA 2VNSA 3LT4A 2EF1A 5MGBA 1W6UA 2NLOA 4DBZA 3Q3CA 3L9XA 2IZZA 3T4XA 4MDHA 4YYZA 3MZ0A 3H5AA 4I9UA 4CLOA 2X8LA 1KC3A 2GERA 4PZDA 1DC3A 3VVBA 4NK4A 1HE5A 2VTEA 4YR9A 3ANLA 3PXXA 1HF3A 3KZVA 4B7XA 2ZJ1A 4IDFA 1FDWA 3RU9A 2BHLA 1NHWA 2CDAA 4RVHA 1KVSA 2ZK7A 4PFJA 4ZD6A 3UGKA 4XJTA 4OMUA 2XXJA 3FRJA 3NT5A 3INTA 4DPMA 4CLXA 5ER9A 3WYCA 2P91A 3V2UA 3H2ZA 1ZMTA 4D44A 4OO3A 1WAMA 3I52A 2E37A 4WECA 2GUGA 1DJQA 3QRWA 1ISFA 2P68A 2V6FA 2YHUA 1IYZA 2IODA 4K1LA 2DTXA 1OAAA 4WGGA 3DHYA 3RBZA 1FF9A 1PJ2A 4XGNA 4EJ6A 3D5TA 3U49A 4DPLA 1KETA 3LLVA 2J6IA 3OIFA 1O95A 4IQ8A 3VH1A 5I9LA 1KC1A 1YQXA 2Q45A 2UDPA 2AQHA 4DBVO 4PLVA 4BS9A 4E2ZA 4EUEA 2J5RA 3H3JA 4E21A 3KBOA 4CQLA 3JQFC 2NVUB 4CMKA 2JAHA 4YT8A 1LDBA 4OH1A 4MOWA 1Y8RA 1Z7BA 5G0WA 3D4PA 3ZW8A 2RCYA 1NNUA 3VPFA 1PQPA 1GPDG 4BNXA 4HP8A 2Y1CA 2EV9A 1GQQA 3DZJA 3V1UA 3AY6A 3B1FA 1B0AA 2NQ8A 4TKLA 5B12A 1JA9A 2NVWA 5KIAA 4Q3BA 3GGPA 5TNXA 1EE2A 4IZHA 2NUAA 1YKFA 2DKNA 2BFAA 3INRA 3IP3A 2VT3A 1ZK3A 4IS3A 4JBIA 2NTNA 3RASA 1HLDA 4LW8A 5A9SA 3PWKA 2Q1SA 4NBTA 2I76A 4L75A 3HDJA 4PG4A 1E7MA 4FC7A 2DBZA 1EBFA 1PJ3A 3GEGA 3GMDA 4LCEA 1CF2O 1E7SA 5B4TA 3L77A 3C7AA 3F3SA 1R4NA 1Q7BA 1LLDA 3GVPA 3RFTA 3RSHA 4G65A 1A9ZA 3H4VA 4QFCA 1M66A 4FJ2A 3QVWA 2AE1A 4EEZA 4UVHA 3EY4A 4ALLA 3RC9A 5A3VA 3UCXA 2FR0A 1T1SA 3A28A 3PVZA 4BV8A 2PY6A 3RROA 3LC7O 1VKNA 4U6SA 4BVAA 1XWFA 2B5VA 1RM5A 1XELA 2IXAA 4CMIA 1PQUA 5L7WA 2EEZA 4RDHA 3GRPA 1XU9A 3OM9A 4BNJA 4RDIA 4S1VA 3ZW9A 2GN8A 1E6UA 4B7CA 2X23A 4XYEA 4CUJA 5CDUA 2WMDA 4NI5A 3BMNA 2QZZA 1A7KA 3DWFA 4R5HA 1I01A 7MDHA 3KYDA 2WYVA 4J7UA 4WEQA 4M54A 1E7RA 1R16A 1EDOA 3GT0A 1NQTA 5BSHA 3IKTA 5ENVA 4GLLA 1N9GB 2QYSA 2VRCA 2I65A 3PGJA 4ILKA 4FFLA 4ND4A 3K5PA 5G0VA 4LISA 4OJNA 2W2LD 3W4JA 1GEGA 5EN4A 4CM9A 4CLRA 2I67A 4FOSA 4DWVA 2VTDA 1T2DA 4DPKA 1LDMA 3JYOA 1FDTA 3EC7A 4RPKA 2JL1A 5C37A 4MVJP 1D1TA 4W4TA 3QP9A 3IJPA 3QWHA 4PN3A 2JD0A 2LDBA 5BNTA 3JTMA 3ASUA 5FFFA 2R6JA 4CQMA 3DAFA 1LDYA 3PYMA 4Z9XA 2X22A 5L7YA 3FR7A 4CR8A 3WR5A 4BHTA 5IDWA 4YJGB 3VKUA 4IY1A 1Q7GA 3COSA 3D3WA 3KB6A 5K1SA 3JV7A 4B3HA 1KEWA 4PG5A 1PU2A 2YV3A 3MTJA 4YRDA 2YFHA 5TJ9A 3WBFA 3RBXA 3AI1A 1BRMA 1GUYA 4NDNE 1I3KA 4WKGA 4PLFA 4FW8A 4GGPA 2PK3A 1ORRA 3G1UA 5MDHA 1NFQA 2CDBA 1JKJA 2ZQZA 3I5MA 9LDTA 3I3OA 3CUKA 4WLVA 5L95A 3OIDA 3FPCA 4J3FA 2VUTA 1HYHA 1VRWA 4YJDA 1N92A 2QZ9A 3BTOA 1NPDA 3FI9A 5AXAA 2DTEA 4H15A 2QRJA 2ZATA 4WLFA 2A94A 4PLHA 4CODB 2TMGA 3GY0A 1PJBA 1XQ6A 2JCXA 3LLSA 1EVIA 4LMRA 1NFFA 1TT5A 3ROMA 4YACA 4UUOA 3OECA 1R12A 3WLEA 4J7CA 4JP3A 4CQLB 4YAEA 2FPIA 2OGUA 4QTZA 1MG0A 3HDQA 4KP7A 1CQJA 4HNGA 4PGFA 5U4QA 1ZK0A 1KEPA 3OJLA 1Y8RB 2HMWA 4J91A 1OZAA 2VQ3A 4OM8A 1S7CA 2G82A 2AG5A 4I8XA 2VRCD 4PRLA 1NPTO 3RWBA 1B15A 1E5LA 1I36A 2PZMA 3B70A 4ND3A 2EG9A 1ADGA 2C07A 4RVUA 1ZMOA 2JKVA 1HEUA 3AU8A 4XEHA 4AJ1A 4RCVA 3GAFA 2XF8A 1LBEA 3HDYA 3PQEA 1YVEI 3AM5A 1Y5MA 1MLDA 2YQ4A 3WQSB 5IDXA 4UEKA 4BNUA 1NQOA 3QVTA 2FZWA 4AFNA 3KYCA 4B79A 2BI7A 3H2SA 4CV1A 2OXIA 1E3IA 2VCYA 3PYLA 1GL3A 2NVBA 1PX0A 1KERA 1V35A 3HSKA 1W4ZA 2HUNA 1ZCJA 4RVDA 1A72A 1G1AA 3OEYA 4DIFA 2DBRA 2D1YA 3VVCA 4XGKA 3RC7A 3OA2A 3QVXA 4BO7A 1IB6A 1JN0A 3VH3A 4JQCA 4E31A 2OORA 3C1OA 4Y9DA 3NDIA 1ZK4A 2PKRA 3M1LA 2IDZA 2D4AA 4BIIA 5EQFA 5CDTA 3VZQA 2B4RO 2J5KA 4J1QA 1B3BA 4E33A 1U7TA 3GG9A 1BW9B 3BXXA 2C82A 1CWUA 2ZQYA 3P2OA 5JY1A 3K30A 1YONA 4M1QA 2P2SA 3PWSA 1N1EA 2CVOA 1WWKA 3PP8A 3LK7A 5F5LA 1MXHA 3PDUA 3A06A 3SXPA 4DRYA 3SC4A 1ZVMA 6ADHA 3IAHA 2DPGA 2VHYA 3GF4A 3JYLA 4AICA 2WJPA 1Z6ZA 3JQ9A 3M2TA 5CEFA 4CLRB 2RIRA 1YBVA 3AM3A 5ILOA 3ZWBA 4BO5A 3QIVA 5DCWA 1LC3A 3ZWMA 3RKRA 1DRVA 2J3JA 4MPDA 1UP4A 5AXDA 3CXRA 3PHJA 4EW6A 5ITVA 3DOCA 3U09A 1EUDA 2HRZA 3UICA 1D4FA 3OP4A 3OH8A 5DOZA 3GMSA 4CV2A 4XB2A 4DGSA 4BQRA 4PG6A 2H5LA 1ZH8A 2PZLA 4J1SA 4YCAA 3D3WB 1Y5RA 1H6AA 2O3JA 2X0IA 3DBHA 1E3WA 2JCVA 2HQ1A 4E13A 3EMKA 4JROA 2O3SA 1DSSG 3E03A 3TRIA 1F14A 1D8AA 4WLUA 1U3WA 1C3VA 4D41A 2HMSA 1LUAA 1W8DA 1WNTA 3W6ZA 3HZZA 1XCBA 5JCXA 1SCUA 1YQGA 2YY7A 1KVUA 1C0PA 4FSHA 4CV3A 5EESA 2ZCVA 1EVJA 1JQBA 2CNBA 4R1UA 4DLLA 4LGVA 4CMCA 4ND2A 1KS9A 3JQGB 4YWJA 5T64A 3VPXA 3RUEA 2CVZA 5TIIA 3S2FA 3IOYA 3FTNA 2G17A 3S8MA 3EK2A 2JD1A 2OBNA 4W7HA 4WE3A 4FBGA 4K9DA 4RF4A 3WMXA 4E5KA 3CKYA 3PIIA 3IL2A 2ZJ0A 4QUKA 3V1YA 5A5FA 4NBUA 1KYQA 1HE3A 3VTZA 3GDGA 5FI3A 3VHRA 5BNIA 1D3AA 5IXSA 1X0XA 3HDHA 4UVGA 2VYVD 4P4LA 1ULUA 4E5NA 3AK4A 5I9NA 3PI7A 4M89A 3ABIA 4XJSA 2YW9A 4D0RA 4DIOA 2PLAA 1EE9A 1E0DA 1YWGO 1N7HA 3GUYA 5KOIA 1BSVA 1PJLA 3AFMA 4R4JA 4KDEA 3JQ9C 1CIVA 3H7AA 2PWZA 2VHZA 4HY3A 1N8KA 2O3RA 3AJRA 3PJDA 1FDSA 2YDXA 3VAZA 3KLPX 2GZ3A 3NDJA 3Q9UA 2BFPA 1T1RA 2EKPA 4UUPA 4HKTA 5U9CA 3KYCB 4J49A 1CYDA 5BT9A 2OL4A 4CV0A 2YHIB 1R4MB 3L6OO 1MA0A 4YEDA 3JQ7B 4OIMA 2E48A 1YB5A 4G5HA 1WDMA 1A71A 4BNKA 3NT2A 1XR3A 4GX0A 3ONFA 4C7KA 1LC0A 2C59A 1XEAA 2VYNA 2WYWA 4R1NA 5JMWA 4A27A 4HWKA 3BTSA 1RYEA 3HB4X 4OXNA 1SPXA 4Z3DA 4AJ2A 3C8MA 2NWQA 4Y6SA 4JGBA 3ENNA 4D3DA 2CSUA 5JAZA 4IBOA 1ISJA 5TLSA 3TDKA 4BO0A 2B4QA 4HBGA 1NVTA 3CMCO 1PWZA 3ZV3A 3D4OA 1SAYA 4D45A 3MJCA 3FCOA 1MG5A 4B4WA 1A5ZA 5KJEA 1A27A 4J0EA 3VKVA 3RUCA 1GZ3A 4KMSA 3F46A 3BMQB 4OXKA 3N7UA 1ZSVA 2AMFA 4D3FA 1FDUA 2PZJA 1ISHA 1E6EA 2FWMX 2H9IA 1PGJA 1DIRA 3R6DA 2Y05A 3GNQA 3CPSA 3VDQA 3WSVA 4EZBA 3KSUA 3OA0A 2ZIZA 3F5SA 6LDHA 1ZO8A 1ZSNA 1ULSA 4NU6A 5G0SA 1PL6A 4ALKA 2VZ0A 4DLAA 2V7PA 1JU9A 3GQVA 4IXTA 2RAFA 5DP1A 4LRSB 1IY8A 3WS7A 4R51A 3NUGA 4G2NA 4TKMA 5TJHA 1E3EA 2VT2A 5CG2A 2AA3A 2OO5A 3DBHB 3IUSA 2WYUA 3IDSA 2J3HA 3U5TA 3K9QO 4NU5A 2HMTA 1V6AA 3ZCXA 2DQ4A 4KTVE 2FOIA 3L07A 4XWYA 4YAIA 3KVOA 1EVYA 3D1LA 3WFIA 3JQAA 5I8WA 3WQQA 4I9NA 4CLHA 1DO8A 4U6QA 1YJ8A 2ZYGA 3D3EA 1Y8QB 1Z75A 4HUJA 1GPJA 4GX5A 1YOVA 2P9CA 3FN4A 2IYPA 3I4CA 4EBFA 1Q0QA 3UAGA 3JQBA 1DIHA 4OYRA 1V3UA 4DA9A 4EJ0A 3PHHA 4TQGA 3UCFA 5B1YA 2C7GA 4TZKA 3GGGA 3LT0A 3BYZA 4INAA 2DFDA 2NU9A 3JQ6A 2BH9A 4I08A 4WNCA 3MJTA 2NVUA 4R1TA 4XQ9A 4B4VA 4CPDA 2HMVA 3PWZA 3OQ6A 8ADHA 1WPQA 4P4NA 1X7DA 3WNVA 3AU9A 3PRJA 3S2EA 2YUTA 2EGGA 2ZB3A 4AJIA 3ZZNA 1ZIDA 3TZKA 1EDZA 5IFLA 1HSOA 4I5DA 1QG6A 5A3JA 1SB8A 4Q3EA 3O26A 5THQA 3FBTA 2D59A 3U4IA 3OBBA 4E4YA 4L76A 1OC2A 4WK6A 3NJ4A 3OQ1A 1Y81A 4RZHA 3G1TA 2IEDA 4MVJI 4GSKA 4HXYA 4TSKA 3VZPA 3R3SA 4D42A 5EINA 4GKVA 5GZ3A 2VHVA 1PJTA 1P1KA 2JCYA 2WTBA 2DT5A 1NR1A 2Y1EA 3BZUA 4JNKA 1AE1A 5I7EA 4J7XA 3MJSA 4D79A 1PS0A 4PLPA 3RIHA 3KEQA 3QHAA 1R37A 1HDYA 1CQIA 3C1TA 1UAYA 4O59O 1I2BA 4OKIA 3C7CB 1XYGA 3WB9A 1MP0A 1GD1O 3BMOA 4CM8A 3KSZO 5EERA 1SZJG 1VJ1A 3OEWA 1P77A 3O4RA 4YAJA 4CLEA 1MXFA 3SVTA 4DQVA 1NWCA 1J6UA 1UDAA 3PQFA 1UZNA 5I7VA 1QYVA 4IPTA 5ILGA 1N9GA 2GPTA 2PD6A 3CSDA 3JQBC 1UXHA 3ZNOA 5JYEA 1WZIA 2BGKA 4R5MA 4HX5A 1UR5A 4PG8A 3HE3A 1X0VA 5CEEA 2BGLA 1AXGA 3ZWXA 4ZQGA 1XIVA 1OOEA 4BKPA 4YPOA 2HU2A 4FFOA 2WWRA 5K9ZA 1LA2A 1LDNA 3WYBA 2Y0DA 3ADOA 4BNLA 1O5IA 4ND1A 1HDZA 4BO9A 4BNGA 2C54A 5T57A 5KKCA 2EW2A 2Y1OA 3RBVA 3VPSA 4R16A 2CVQA 2GN9A 4ALMA 3HWRA 1EK5A 1E3SA 4K26A 4OSOA 1IHYA 1MUUA 3RC1A 1JAYA 4YJGA 2BGMA 4RF2A 2HK8A 3P7MA 3WGHA 4N7RA 4AG3A 3KLMX 3K96A 4Z0TA 1H2HA 5TC4A 4BNYA 5DP2A 1LSSA 3L6EA 3RJ5A 4Z3KA 4CMGA 1X7GA 1P1HA 3JYNA 4MP3A 1QLHA 1VE9A 3JQDA 2P4HX 1D1SA 4BNZA 5B4VA 1DC6A 2AEFA 4QXMA 4UREA 3D4NA 3IP1A 2V65A 3IC5A
chains in the Genus database with same CATH superfamily
2VYQA 1M0EA 1TVEA 1OLXB 1V7ZA 4RVFA 4Y7CA 2HF8A 1FNCA 3VU0A 1K63A 1NJ5A 2PSEA 1ZR2A 1W5SA 1DOHA 4UJ5A 3D7NA 2AK2A 1DX6A 4LRQA 4QC2A 1PJ4A 4UDOA 1IEWA 2GN1A 1U1FA 3QEMA 2DFNA 2PA0A 3O03A 5AUOB 5I51A 4WADA 4WFJA 1GPH1 3LYLA 3THRA 2NO7A 4D6PA 3AM1A 1PS8A 1E94E 1SVMA 3E1KA 3NKVA 4MWDA 1KDYA 1TW3A 2GM4A 3OVMA 4F92B 2WHYA 4B6GA 1Q11A 1NRJB 3L40A 2UUOA 1XB2A 4AMYA 3RIXA 4YHHB 1R8SA 3IIEA 3NHJA 4PU0A 5GJWC 2F1IA 1K4MA 3E18A 2G1JA 1ZJZA 3DO8A 3OZAA 2QLJA 2R6ZA 2CD9A 4IDHA 1HETA 5E3IA 2NU9B 1TX4B 4OXRA 4PX5A 2H3HA 3PENA 4GDMA 2IXEA 4HZUA 2OPBA 2JGLA 2Q21A 2GZHA 3TUZC 3KJNA 2KLBA 3V8EA 2IZ7A 1MFZA 5JXGA 1M8GA 3V34A 1CD5A 3C6MA 4ZZ3A 4QQNA 6REQB 1ZJWA 1S1CA 1FCJA 1P2VA 1Z34A 4K3UA 4MEBA 1PV4A 3B3QA 3DV2A 4TMTA 1V4NA 5KYXA 1XQXA 3DE3X 4LXXA 2R6CA 5B2EA 5L4SA 3I28A 4GPZA 2WKQA 3N2LA 1YJBA 5FTLA 5KTPA 1WM1A 3DYBA 3A4TA 5DN9A 3LQKA 1F6DA 1W46A 3UFXA 4C1BA 1DJLA 3N6RA 4S3MA 4A5OA 2Z2IA 3ZWVA 3AJDA 2QNIA 2FZ4A 1Y0BA 2AIRA 1K8ZB 2AZDA 3K6RA 2QAGB 5EP2A 1U8ZA 1KSFX 2GPNA 3IHKA 3LHKA 3SBEA 2X9LA 4GX2A 3FFWA 3EWNA 3DW3X 1FP1D 5FR1A 2QRHA 5JDCA 3WNCA 5IX8A 4NJEA 1ZCZA 3PGXA 2ZUSA 1XROA 5AI5A 4MINA 4CTNA 1UBGA 5TRTA 5TS3A 1UBUS 1IVSA 2QF7A 4GP7A 3RSGA 2Y71A 1TZ2A 2XT6A 3QBVA 1DLJA 4Q3LA 3IS3A 2HADA 4M6WB 1Y4SA 4ZT4A 1TO6A 3KDPA 1PGNA 1G2IA 4Z2YA 2P78A 4P54A 3U9LA 1Z6YA 2FN9A 4NBVA 5IAKA 1FZQA 5FPTA 1PZMA 3PJEA 1I94B 4M9XA 4GFDA 4BCDA 2AH5A 4DC1A 1P75A 4F1KA 2FRDA 2XVZA 1II8B 3I6MA 3KTAB 4REMA 3TPZA 1AZTA 1I7NA 3QGMA 1BW9A 4FB5A 1L7QA 2A0YA 3CIOA 3W1VA 3A4VA 1UWLA 4EG7A 1IUKA 4Z4CA 4WNYA 4KFTA 1PWEA 1V6SA 4PC1A 1NUAA 2QI9C 4MWCA 3UPUA 3PT9A 2Z1DA 1GYQA 3VYWA 4GICA 1DJNA 3W5CA 2UXCB 4NQRA 1S1MA 5K8TA 1EM8A 5BW5A 4MH0R 1Z3CA 3HRHA 4XXHA 1U3GA 1LJ8A 1Q6YA 2FMIA 3QVKA 4XDHA 5LKAA 5H68A 2L17A 1XXHB 1JAZA 1SUWA 4Z54A 1F17A 5KQPA 2CMGA 5A6SA 5IKXA 1UCFA 3OQHA 2A9PA 3H2GA 3HKBA 3Q2OA 3GGSA 2O07A 3GEBA 1PO7A 5CB6A 2VUSA 1N34B 2GCOB 3PNPA 4MUIA 2BF7A 1K89A 5BMVB 2A1TS 4OKNA 4WCVA 3VO9A 1Z38A 1T9AA 1L8XA 2GD0A 3GUZA 2YZ2A 4IJWA 3IPXA 2ABWA 2H4FA 4M86A 5AYVA 1BVHA 3VKHA 2FUKA 3F8SA 5IM5A 4ENUA 4PAMA 5ES3A 5HA5A 5K01A 1N78A 2YIDA 1XEFA 1Y6JA 1YK0A 3ETCA 3E9CA 1W85A 5EJ7A 2GO1A 3VR5D 1ZESA 1NBIA 1JVNA 2ZJOA 1XI2A 5BSTA 5DWVA 3A26A 3W9UA 1XDWA 1X80B 4XZ3A 4C5BA 3KQKA 2XX3A 4KO3S 4URUR 2W2KB 2XVMA 4R01A 3GJ3A 3UWKA 1G8HA 1A50B 3F2IA 4G0WA 2I3GA 1KZ1A 4D9CA 1JFFB 3NTRA 1GA1A 4X24A 3H2YA 4AIRA 4WACA 3H13A 3JX9A 4L1KA 2R44A 3KO8A 2WDZA 1GWNA 1NPYA 3GFBA 4DCOA 1J7KA 2J6HA 3EVEA 4PXYA 1VDMA 2HSZA 2EF0A 1IIRA 3T3OA 4K6GA 4BKMA 3V4OA 1QZTA 1QRDA 1TZMA 2EFGA 3V4RA 1JKFA 2BJVA 3TK1A 1YL7A 3DXZA 4WEOA 1E3TA 2AFHB 4DV0B 2KMLA 3R7WA 3GYGA 1UXGA 2WJ4A 3TCKA 3CW9A 1T9DA 4Y6PA 3QEMB 3TOZA 2GI4A 3VH4A 1WW8A 4U63A 3PR2B 1XRLA 3THWA 4JP8A 2CZCA 4ZVOA 5DIZA 1I3LA 4QG3A 2VXBA 1YAHA 4P3NA 2YV5A 4EVRA 3GRZA 2YV1A 5INTA 1SOVA 3F7OA 3FUWA 5E3JA 3NWEA 3R6LA 4G5XA 4LJLA 2PD3A 1Z5PA 2O7VA 3P0HA 1Q19A 4IIJF 4MLDA 3FZGA 4D1YA 4JEIA 3W9BA 3AFHA 5LYYA 4Y30A 3BIXA 4HZUB 1G41A 2X0EA 4HGZA 4X64B 2NPIA 1DIGA 4DDWA 4YXWA 1GPAA 4J9UE 2FSGA 3ZWWA 3E5NA 1NYRA 3RODA 3TBKA 3ADCA 2RGWA 4PC2A 1N3BA 1Q1NA 4CMJA 2HBRA 4HDQB 4R2LA 2M6KA 5MN5A 1ZDMA 2HCRA 4MUGA 3PS9A 2J45A 2VWPA 3G1WA 3SDSA 4KIWA 5FLXA 3CE6A 3LM8A 3F74A 4RMHA 5DNVA 4B3BA 4P38A 3H1BA 2J7PA 3FD8A 3W7VA 1CZUA 4U5QA 3O4IA 4ED9A 5BMOA 4QEKA 4IGFA 3FOZA 3G8DA 1Y7IA 3N53A 1GVNB 3TOXA 1FJ2A 2PPVA 3UFXB 3GJ4A 2NXNA 4BNIA 3OIYA 4NYIQ 5CLHA 1MJFA 1P39A 1Q95A 2WUFA 1U2QA 3AEYA 4O63O 1YCHA 2QG9A 1ZGJA 2A78A 1N2SA 3EZ9A 4NZNA 4JI1B 2XUOA 4M60A 3X2FA 3E3OA 1XYYA 1KMNA 1N33B 1C4WA 1CTQA 1M9NA 1TCUA 2I66A 2XUZA 3G02A 3MC1A 4NECA 1JPVA 2W43A 4XJXA 3UMGA 4AJ4A 4QYSA 2QM7A 5K09A 1PLKA 4PLYA 2I87A 5JSUA 4NJEB 1K7YA 4V2IA 4YP0A 5K0BA 2WA1A 2O0KA 3FOCA 2ODPA 3P71T 1ZXLA 2CNWA 4LFBB 2AT1A 2DC1A 5H02A 5IJAA 1NZFA 2ISSD 5LZ7A 5FTJA 2H29A 1KOLA 4PGMA 1MKYA 5DV9A 1XVLA 1Z22A 3EE6A 3L4BA 3Q15C 4AY5A 1NVAA 3HNRA 3ICWA 2DF8A 2VT6A 1YQTA 4P22A 3WKCA 4FCCA 3HJHA 5AM3A 1IBKB 1YR7A 2HDHA 1RRKA 5HQJA 1E9EA 2AMJA 3N9IA 3WB2A 4NAVA 2B1JA 2FMTA 2VF4X 3BQMB 4W8HA 2WF7A 3GGOA 4MIEA 2DQYA 2RGRA 1JW9B 2BFCA 3FVVA 4MI6A 5J5CA 1SXHA 1KU0A 4RBNA 3F7NA 3NC4A 1VPVA 3HA5A 3I34X 1FX0A 4PN7A 1GUZA 3IB3A 5DM4A 2AWNA 5JJKA 1W0JD 3ONNA 1XHEA 3V1TC 3L1IA 1EM8B 4N8SA 1G5IA 3CKLA 4C0QC 1DKMA 2ZPAA 3KWLA 5CA0F 1RNLA 1FTWA 1E7WA 3JS5A 4RE5A 1Y8AA 3C8HA 3Q1LA 4MJ7A 2NV6A 1AGRA 5A6SB 2NMVA 4UHBA 1L5KA 1Z0ZA 1NJFA 3HKBB 3KZNA 5IYZF 1OSNA 1PRYA 2QSJA 2ZR8A 1J8DA 2BGJA 2CLIB 2PZEA 2HM7A 2C5SA 1JHRA 3GEMA 2Z3WA 2FK8A 1J0AA 5J4HA 2CNOA 2OBBA 3GEEA 1DX9A 3MOIA 4EKYA 5HIAA 1LGYA 2ZB7A 1W85B 5BW4A 1PZHA 4Q4AA 2Y2UA 5GQSA 1OB2A 1NXWA 1J2UA 2PZBA 3KXLA 5TVKA 2EBUA 3F4BA 1RXIA 1LXCA 4YT5A 5EP4A 1R15A 1SUPA 1KO8A 4PZ9A 4RUKA 1UP6A 1DUSA 1I80A 2ATIA 1RXYA 3LIIA 4W5JA 4KBYA 4D4GA 1JIKA 3GIDA 2G3YA 2R87A 4HQ6A 2AFRA 5CLGA 2Y76A 3UYKA 1Q1GA 1BMFD 1Z06A 2C3MA 2IUEA 5CDFA 4R1OA 4JYMA 5IJZA 3EGVA 4HNVA 5E4TA 3QY9A 1JMYA 1OBFO 4A2CA 4DRZA 1SNYA 1N9KA 3INYA 4I14A 4IHJB 4ZJUA 2IX3A 3ZTYA 1TE2A 3OOWA 1LPBB 1U6JA 1Y8QA 1T2UA 2OC9A 2VPTA 1RJWA 5HFJA 1IEQA 2JD2A 1UPCA 2AN5A 4FPXA 2K7FA 4B2PA 1CJBA 5JW6A 4P58A 2P7HA 1K98A 4J16A 3WQBA 3BMCB 1G9TA 3L02A 2P90A 4BDTA 4Y9TA 3THWB 3EXIA 3CZAA 4TS1A 2QHXA 1W73A 4OHPA 3VV3A 4ARBA 1TEXA 2ZSDA 5LD2C 4JT8A 4DR5B 3VI3B 3EVCA 4P08A 4EHBA 1G6OA 1E2UA 4Q00A 4JJAA 3PGVA 3S7TA 5CDGA 4IDEA 2ZXUA 1RE0A 2C7QA 4HYEA 4E1BA 3PEFA 1FVHA 5CU7A 4QLAA 1MEEA 4PLTA 3OZTA 2HWKA 1RXCA 3EAGA 2C92A 3WK7A 1TO1E 2VBGA 1NDUA 1KQOA 2PEZA 1ULHA 1JA1A 1AA6A 1A8SA 4QXRA 4GZMA 1T2CA 2EFDB 3WGGA 1SUIA 2YXDA 1J5EB 1JLRA 3UJDA 2R6HA 4LGMA 5KNDD 2RIPA 3JD4A 4Q03A 5ICFA 4XWKA 1MAUA 3PNOA 2N3ZA 5BN4A 3EXHC 3FHLA 2UAGA 2ZBDA 4UULA 5C1DA 1ODKA 3OT1A 2Q1XA 4FEGA 3FVQA 1E0AA 1XQ1A 2VZ9A 1VI5A 2C77A 3M3PA 4P7BA 1IEVA 1XG5A 1LSJA 2HPAA 1EG2A 3EFOA 3LYHA 3MB5A 4N0DA 1UZUA 4YUVA 2YS6A 3VVLA 4CCWA 3DE6X 2QGNA 3L1KA 1YTUA 1JIVA 3DE5X 4LZOA 3O1LA 1VGVA 3I9FA 4RIHA 2ODBA 3AJ9A 5DYYA 1HWYA 4KHPB 2IDKA 4RKYA 1BN6A 3GHYA 3HJTA 1J2YA 3IQIX 1YCFA 3URKA 3TOSA 2G7MC 1WQ3A 3V33A 4IRUB 3UEOA 2GAIA 2EX4A 1L8QA 1EJ2A 2AMLA 2FF7A 1H9AA 3O3OB 3G13A 4ZGGA 1SBNE 4QGAA 3OMXA 1MC8A 1V0JA 2QQ0A 2XDQA 4QODA 2G0NA 4ZIRB 4Z5XA 1FYVA 2H4HA 3DOIA 5H59A 2Q2QA 4WN9A 3E8MA 4IGKA 4QM6A 3DAPA 5AMXA 4YT2A 3U4AA 1DEAA 3FLAA 5KTSA 5F52A 4IV8A 1E58A 1CEQA 2HMYB 3HFRA 4U7FA 3USES 3IDZA 3HPQA 1LQ2A 3M3HA 3TD9A 1KY4A 3W0LB 3T99A 1ZBQA 3KU4A 2NU6B 1V7PC 2BEVA 3I9NA 3HVUA 5ENDA 2UUPA 4B4UA 2X4GA 1E3JA 1FX0B 1O87A 3B3JA 2OV4A 2QRVA 3L0BA 3GNLA 2VRBA 1D03A 3NB0A 1DWOA 4YQYA 4L7QA 3RPEA 3TPCA 1L7BA 4Z7QB 3I5XA 3UXYA 1EAMA 1CVLA 3MQ4A 4P4UA 4IDAA 4XTCS 1UPXA 3RT9A 2ZT8A 4JVSB 5CW1A 2B94A 5GM1A 4EPYA 4G5QA 2PKQO 3WWZA 2IZ1A 3LKVA 1RKXA 2RHLA 1VMDA 3WX0A 3WHKA 5I7WA 1SA0A 2M6LA 3CPEA 1KJ9A 2NSJA 2C29D 4PNPA 4J9VA 1FQWA 3VNRA 3MWLA 4LF6B 4QDJA 3DNFA 4N9WA 1MQAA 1W9HA 3H5TA 5EE9A 3LQ4A 1DFHA 1T6ZA 1TYEB 3E7PA 4EGCB 5A03A 1FDVA 3JAMA 1EM6A 1TCVA 2P9QA 4TT3D 4Q4AB 4CM4B 1B74A 4Q02A 4NENB 5IHPA 5U4XA 2LBPA 3H9BA 3OZXA 4L57A 4XUDA 2FWNA 1JTFA 3KLOA 4Q37A 4NATA 4ZOLA 2XYHA 2ZUDA 3BRQA 4TLBA 2VRWA 4OL9A 1WZNA 2NZVG 2GNAA 3KD3A 4JBGA 1CUUA 3U6KA 4M0DA 4YCNA 3O0DA 2NO4A 1AZSC 4Z7OB 3PJGA 4D0NA 4V1CB 2WSMA 3M1AA 4XIYA 4XKJA 3H1FA 1SRRA 2MOKA 5E6UA 2Q49A 5IASA 3RRYA 4MZXA 2WKWA 4S2UA 5CVTA 1WSBA 4UNPA 2JFWA 1TJYA 3KCQA 4R7TA 2QUAA 5B30A 4BNWA 3LBHA 2FFJA 1UADA 3WLFA 3Q1KA 2D2VA 4S1WA 4ON9A 4XX0B 3U3XA 4D74A 1MV8A 2PANA 4MEAA 4PSAA 4ZQEA 3WGNA 3ENQA 2E4UA 5SYAA 3ZCUA 3G8YA 5ICGA 3AKYA 5DISB 5JC1A 5JJLA 4L6AA 4KXWA 4B34A 3W2HA 1SCIA 3VX3A 4DLPA 5F23A 3DDHA 1USIA 3FMFA 1R8JA 1UKAA 1FMTA 1Y3IA 3AF2A 2WG0A 2OCDA 1B0PA 3LVFO 3LVRE 4NFYA 4NK5A 1NTRA 1ADYA 2GEVA 3VDRA 3R09A 3WLPA 1E6KA 1YS4A 4BAGA 1XJWA 4LWPA 3VZSA 5BXYA 1U02A 1V95A 2CLMB 2CLDX 3NJ8A 4N03A 4PAGA 5JU6A 1T3GA 2C2WA 4J3NA 3O4VA 2FFRA 5H70A 1PE0A 2J5BA 2X6TA 1QNLA 4Y1GA 2WK1A 4RHTA 5DYWA 1H9BA 2YQ5A 1IWBB 4ZOBA 3DDOA 1KK0A 1IC6A 1YJQA 4UBLA 1NY5A 2DEUA 2FSVA 3MT8A 1ZH0A 1GPYA 1T3HA 4EH1A 3B2EA 4MVYA 5EJIA 3DWGA 1OFTA 1OWLA 2ILTA 2PT6A 3K31A 4GW3A 2H8KA 1EK2A 4M9ZA 3WG9A 3CZMA 1JKMA 3A70A 1MF7A 3MJHA 1EDEA 1QAQA 4I8DA 3JQCA 2A86A 2QU7A 4NH4A 5LC1A 3OJWA 2PRJA 1EVZA 2Y1WA 1HQYE 3S5UA 2P27A 1DFGA 1KP9A 1WDWB 3B6IA 2OUKA 3OT1B 2NZJA 1E2JA 3VM6A 3SS8A 1T5TA 2LCQA 4IYRA 2W6JA 4BMCA 2JGRA 3EFOB 3CH5A 3DM9B 2BHRA 3H8SA 2ZJ4A 1RPJA 2EQBA 1UDCA 3G5TA 4TMXA 5EHQA 2JEOA 3U44B 4M7WA 3R8FA 1YBHA 2LZ0A 2QV7A 2Y27A 3DFMA 1OXVA 1G5HA 1E64A 3KXIA 3ZWKA 5C80A 3ZDBA 3UMJA 3OTQA 4FINA 4COKA 1VL6A 3GC6A 4FR2A 4L9SA 2QVLA 1I7PA 1YI8A 4OHOA 2GKGA 2NZ2A 2JFYA 3I8XA 4QOIA 3FW1A 4LQCA 1DIBA 3GAZA 4C6TB 4EITA 4RS4A 1JIIA 1L1QA 1S2MA 2PFGA 2VDJA 4LN1A 4G5SA 4F6CA 1RCUA 4W1RA 1RM4A 3C16C 3PIDA 2PQ0A 5FT9A 2FW1A 5JBQA 5HZKA 4MRPA 4C4SA 5CB0A 5C7LO 2AC4A 1QK3A 5KVQA 3J80A 2V9CA 2VPZA 3KXDA 3HY3A 1XA0A 1KDZA 5LOVB 2JHAA 1QFZA 1CEXA 3TLZA 1Y9ZA 1EK6A 3VYTB 2BEVB 3FBGA 4X93A 4Q05A 2JFOA 2XYVA 2MYNA 2QL6A 4L5YA 3TDMA 4EAAA 1SIWA 4ZI7B 5LR6A 3RTDA 1HFJA 1GT6A 4FU0A 2AQIA 1DQZA 1DBWA 1IEXA 1OF1A 4FKBA 3GR6A 3H04A 4MUXA 2FW8A 2RARA 2O8FA 3I4LA 3QXHA 4NBWA 4CLDA 2I2CA 1RLOA 1URPA 4Q7JB 2Q5OA 2YZ7A 2F9MA 3QYAA 2FZ5A 1OILA 2VDLB 1KJYA 3FF4A 1AGNA 4F96A 1XVTA 4JQYA 1ONPA 3MD9A 3GMIA 3JVUA 3F98A 3L0DA 3T3HA 2QPAA 1GO2A 1M83A 2QP3A 3DFZA 1SPBS 2AUNA 4AP6A 4O3FA 3U2QA 1G7CA 3K70C 1R5NA 3QI2A 4QOJA 3BK7A 1SA0B 3ZY5A 4NJOA 2Q7OE 1U2GA 1LBTA 1OFHA 3JQPA 4JBWA 2V9PA 5JCJD 2W2NA 3NJRA 1MVLA 4PPQA 3G2IA 4R31A 4GZ3A 2XCQA 3IHLA 2IV3A 4B45A 2AD5A 4WY2A 3QU7A 3RS0A 1DQYA 2VPXA 3DMTA 16PKA 4BNNA 3SG0A 1QQAA 3I92A 2GN6A 4O5OA 5DGIA 3TNJA 1CG6A 4GOJA 4ZA2A 4G4SP 2G80A 4K9QA 1G3MA 4KXVA 4MXDA 4TVOA 2F9FA 2PRIA 1HRKA 1M8KA 2ONYA 1K5GA 4Y1FA 4OBBA 5T4FA 4G81A 5F2OA 1QHXA 4L3WA 4Y0NA 1TJ4A 2IF0A 2JKYA 1W5TA 2R8RA 2Q5JA 1VHLA 4M1OA 4XSVA 1UEJA 5FBKA 2WM8A 4E2YA 3Q3JB 4KQ2A 1KQ3A 1L4LA 2WILA 4E08A 2H0AA 4QGHA 2YOGA 3ON5A 3C6ZA 3CR3C 5J23A 1X77A 2OR3A 2ZRKA 2JJQA 1KVQA 3WOHA 3IALA 4N5MA 2I4TA 1DQSA 1U28A 5TF4A 5A4DA 3HCFA 2A30A 1AQJA 3BA6A 4ZI5A 4EO4A 1IUOA 1HNZB 3PHLA 4S1TA 4QO8A 1BNCA 1OLSA 1U5AA 2E55A 4RVCA 3VMMA 3HO1A 3CX3A 3DLIA 1N0HA 2CEKA 4KC0A 4BNHA 2OWEA 5AI0A 1IY2A 4EARA 4QJ5A 1U7WA 5FUYA 1Q0HA 3ZWOA 2HA4A 1CE8B 2OHGA 4ZRDA 1NMXA 4K7JA 5HGJA 1ENPA 5ARDA 5FIUA 5L7TA 2PZFA 4R83A 2OBYA 1JBKA 3NPMA 4QSMA 4RQTA 3IE2A 1N2JA 4GEKA 1T6NA 3FSEA 1ILEA 2FAXA 3GFTA 3LUHA 4UHHA 3PE3A 5F77A 1JH8A 1UPTA 4GOND 3KEFA 2CLKB 1OFIA 4JVMA 5IJ9A 4AN4A 3LI2A 3ZI4A 3GEDA 3PGLA 5AXBA 1L5WA 1H2WA 1SKBA 1H2RS 2JAWA 1IXRC 2D5AA 2QL7A 3VR5A 1E1QD 1DDOA 4Z9FA 1IFXA 2PMEA 1EFTA 3E1SA 1KSGA 4ZP1A 4EQ6A 4B84A 2R47A 3KX2A 5ALWA 1P3JA 2WIJA 1QG2A 3G0CA 1BYUA 2VJNA 3KZXA 1ONNA 3V32A 5HF5A 1SU4A 2Y9MB 1Q3HA 4L08A 3ME5A 4J0HA 5ALEA 3UJCA 4I1RA 4XUCA 2K6GA 5BSGA 3BN3A 2JAPA 3ICQB 3C6YA 4QDOA 3ZE7A 2OOKA 1R0SA 2QRUA 1T8YA 4NCAA 2GCNA 4WKOA 1RRVA 3OWOA 1E2MA 2VBCA 2ZRIA 2YVAA 2Z2XA 1WXGA 4JSYA 3IQDB 5AM0A 1D6SA 2VHEA 3DOHA 1B8PA 3A9TA 2PBZA 3F6EX 3GRKA 1ETHA 5ITZA 1Y4ZA 1PSDA 4BO3A 2QT1A 4KBGA 4YRPA 5SYNA 3ZIUA 2G83A 3MJ4A 1ENYA 1ZXXA 1DCFA 1I3NA 1N5OX 1R66A 2GCEA 2D3TA 2MJLA 3DZHA 4K2AA 4X66B 2IFTA 2Q62A 4QU8A 4EJFA 4FJ1A 1HZJA 1EQ2A 2JB9A 3W05A 4P3PA 5SY6A 2O06A 5JO0A 1PJ8A 1A5TA 1VHTA 2JGFA 2ZYTX 1CRPA 3TW4A 2R1VB 1HURA 5LB2A 1QHHA 5CM2Z 1MX9A 5THKA 2QMZA 2BKUA 4TYWA 4GVXA 1ATIA 1W5FA 1G20A 3WKDA 1BRTA 3TM4A 3AFNA 1Z2OX 4QOSA 2FDCA 4C0KA 1DWQA 1P2UA 4YCDA 2P4SA 1JT9A 5DTJA 4X8LA 1YS7A 1QOZA 4J0CA 4C0WA 4JLJA 2UXBB 2PSFA 4Z1MD 1IG0A 4KEAA 3N86A 2TECE 1JVSA 3IEXA 3NYIA 4ESHA 4TTPA 4PVCA 2O8FB 3PUZA 1Z4PX 3H18A 3M34A 1EVLA 1BDMA 4E70A 2QTCA 3JAWA 1M1NA 4P5DA 2JLQA 4QYWA 3NNDA 3IOCA 4BJHB 4WFIA 5JTUA 3PLRA 3MJRA 4OQQA 3AY3A 1UIMA 4BLWA 1XJ0A 2H2FA 4MIYA 2ZJ5A 3C14C 1KHTA 3I37X 5HFNA 4CTOA 4G1CA 4GPTA 4KDRA 3H3FA 5EUQB 5TR9A 1BVRA 2MSKA 3BB4A 4BFCA 2GWRA 3HL0A 1EQAA 3PRKE 3HDTA 5KVCA 3BSWA 1XAJA 4L4XA 1WMBA 2FUEA 1W0CA 3UG7A 5HQTA 2OZLB 4GM4A 4M8IA 4ND8A 3GZNB 4RWEA 4QZVA 3K9BA 4DUPA 3HN7A 1NIJA 3EF1A 4LGYA 5D3MA 1JHAA 2MWMA 1GEEA 2ZJ3A 3AOEC 1UOQA 3E7XA 5FOXA 4BV2A 3H7IA 3QLUA 5DTQA 3UTDA 4YCLA 5HWSA 2GN2A 2RKBA 4B17A 5I01A 1CX9B 5IBRA 4LDPA 2IGBA 1Q3KA 5JDIC 1BZYA 1NKSA 2BZ1A 4UNSA 1M2JA 4FYYA 1E6MA 5HZHA 4TROA 2Q2OA 4W6ZA 2NIPA 3D9QX 3LK6A 4FMDF 2R2GA 3KT6A 1WSDA 1N1GA 1Z5VA 3D0RA 3AJEA 2NXWA 4LJ8A 1CUHA 4R7GA 1RT9A 1U0HC 3GCXA 5ALMA 2ZJBA 1D2HA 2YQZA 3IODA 2B2XA 4TV9A 4Y6RA 4M1ZA 1SQFA 1J9EA 4LX8A 4UTPA 1W0JA 2AWOA 5FNZA 2I7VA 1JDPA 1OLSB 2H31A 4YNBA 4UE2A 3DZGA 4K46A 1MMFB 2RGNA 5REQB 3IVGA 1UDBA 1XZPA 3WLTA 4QSHA 3Q85A 2OGWA 1Y7LA 2ZUVA 3G0IA 1O6ZA 3FYCA 1UZMA 2PX2A 3DFUA 2XTJA 4URVR 1R2QA 2V9ZA 1LFDB 4GLJA 5CT8A 5ESRA 3TCXB 1F5SA 1O97C 2VHTA 3TRKA 1UK7A 3DT6A 1F8XA 2FEKA 3B20A 2MYPA 1PF7E 3LGXA 2NPOA 2WTMA 3EXG2 5KHLB 5H83A 1OX4B 3CN9A 1QE5A 1V8ZA 2XYPA 4ITRC 4QGBA 2DUUA 1YGPA 5DDIP 2WAXA 3GH3A 3LGSA 3QQ5A 3JSAA 2XR1A 2YNMD 2BRUA 3K0AA 2OG2A 2OYSA 3GGDA 3ZWPA 4Q1EA 4M8KA 5ARBA 5ISMA 2AFIB 2VP3A 5ESWA 3ZGNA 4DLNA 4ER3A 1Z37A 2FE1A 2IU3A 3LLCA 5GZ6A 2JFVA 3DH0A 4E1VA 4F93B 4BVEA 1QU2A 1WKBA 1Y9EA 1ZJ5A 2C2GA 3I0ZA 2ZJAA 1BMFA 2WHPA 2Y99A 4M8SA 4RGYA 4ZDWA 4BEWA 2Q1YA 3GVXA 5BWOA 1H2AS 1VSVA 2WSIA 4MUMA 3CMMA 4QOEA 2J8ZA 4PAQA 3Q7EA 4GS5A 3ONDA 3GD7A 5HE8A 4WXRA 1NM5A 1G16A 4N3BA 2B9VA 3F6SA 3A9UA 5ALLA 5ITZB 4KN8A 1P33A 3NFRA 2FEAA 1K08A 3EOZA 1LTQA 2FPWA 5JJIA 1FLAA 1NMZA 1VBKA 2WJHA 3IA2A 3N07A 3ZS9A 2V03A 5EZ6B 2V6MA 3AKCA 4OJTA 1TU0A 2YCLA 1KHHA 3AIOA 2H4JA 3OO1A 3PEVA 4MW0A 3BBLA 4X0EA 4ZAGA 4D8UA 3OQNA 1N25A 2OSVA 1ZU4A 2QMUA 1PK7A 3QI7A 3TB4A 1AS0A 3A1CA 2ZYAA 1QUFA 2C8JA 2X4DA 5ESXA 2AZXA 1SK8A 3ZLJA 5IWCA 1U0JA 1TU4A 1U7HA 2WYHA 3QUCA 4HDSA 1A04A 1BWSA 1WCV1 5IP5A 4C7JA 1LRLA 1SKYB 5D85A 4RTJA 2B2CA 1F12A 1QGUA 2B8JA 4A2WA 1AD2A 1JLKA 3CVUA 1U2PA 3A6PC 2Y93A 2PS3A 2VDKB 4ZYTA 5F33A 1NOKA 4K9KA 4NAUA 2E6UX 2HF2A 9ABPA 2FHSA 4KMMA 4A8HA 2I78A 1R0LA 2C3OA 3ORRA 3DZ8A 2QXTA 1XAIA 3V8PA 4JI8B 1UXIA 4ZT2A 2XLBA 3KUDA 3FVRA 4QRHA 3ZDEA 3T9DA 3T7CA 3PR1A 3A6DA 3EW7A 3RG2A 4GF5A 4EYQA 1I1NA 1QHYA 2H4ZA 1WKVA 3ILVA 3P2IA 4G37A 5E8JA 5DBOA 4DDHA 3BIFA 4R8SA 2NVOA 5KNDA 2PT7A 2VCEA 2Y68A 3P9SA 4RKQA 4DUZB 5IJWA 3HGQA 1M1NB 5K6RA 4OQ4A 4A8JB 3U0BA 2O59A 1GN8A 2ZOSA 1ZSYA 1NOJA 3F71A 1VE3A 3GPCA 3HSSA 4F71A 3U31A 5B1SA 1LV8A 4KVGA 4WOJA 2A4KA 4K6HA 4FN4A 1KYXA 4G1MB 1CFZA 1EVQA 1Q2XA 3M82A 2MSLA 4OK5A 1S3SA 4TTTS 4ND8B 1V5WA 3OF3A 5TQJA 1XD8A 1BOFA 4AECA 1FVOA 4GMHA 1QR6A 1TC1A 1ZXBA 3W4KA 1Z0FA 4MJ3A 5D3MB 1H65A 1MO4A 1U0TA 2FVYA 2J1LA 4NTZA 1GLNA 1NF8A 4ZPXA 3UK1A 5ELMA 4ENWA 2P2CA 2QLBA 4R41A 2HJSA 1NU6A 1V8PA 1XT6A 1U7ZA 4X1IB 2IVZA 1OGIA 2PGNA 2EZTA 3JYQA 3F8TA 3MBIA 5CT5A 5BWBA 3L0OA 4CQMB 4H0FA 3OCYA 4OQPA 4X97A 3T06B 3BCSA 3WLSA 1IATA 1Q1ZA 4RJTA 5A04A 1MRNA 4CIVA 4OXXA 1WPGA 3TLYA 5EJ5A 1L7RA 1SD1A 3BGOS 3HP1A 3R5XA 4I2VA 2P9JA 1EA5A 4X41A 5AOBA 3TMKA 2JLUA 3CKMA 4U7GA 3NM4A 5J59A 1B42A 1QKIA 4UEOA 1IQRA 1VPDA 4FEAA 2WSBA 4JWTA 3IQEA 2A1UA 4X90A 1Y4UA 3G3EA 3KR9A 3OTHA 3UWDA 1O57A 4UARA 3WJ2A 3E58A 3KZ1E 3C85A 4N48A 4N39A 2FMKA 2HT6A 2O50A 2PYDA 4BX9A 1IY1A 4BASA 4YRRA 3OKFA 2VVTA 2FQ1A 4GR9A 5ALTA 3HXKA 4KX3A 3MM4A 1EP3B 2BFOA 3E5MA 3GFVA 4TL6A 2VK1A 2DFTA 1R00A 4RMIA 1CIPA 1K9SA 2DQZA 1BE0A 3NOOA 1VPTA 3P0FA 4FMPA 1Q92A 2PO5A 1IM2A 1XDGA 2H7VA 3L7KA 2E4WA 1KAGA 2DZDA 4HGNA 3RJMA 1UBRS 5DB4A 5EHGA 4TT3A 4UCQA 4Y2JA 5BRAA 1TQHA 1X1EA 3HXPA 2G0TA 2I4IA 3WGTA 2QTVA 1KGDA 2VWQA 3SLKA 1WD5A 3DGFC 3FROA 3IT1A 4JDPA 2XOKD 5A2QA 2A9JA 3I83A 4BVHA 2BZGA 4B6FA 2ZSFA 3EEBA 3ESXA 3DE0X 3O1JC 4UAVA 5DJ5A 2EGUA 2VJOA 3K9GA 3BH7A 2WHPB 4C3ZA 3E0XA 1GADO 1L8OA 1UBHS 2H2WA 3B7PA 3WJ7A 1Q50A 4JMLA 1R0ZA 1NQXA 2GCPA 2C2OA 2QM8A 2HSDA 4I81A 3U4GA 1GSHA 4GOOD 3G8BA 3OF2A 3Q11A 2JJMA 1Y9AA 5THXA 5AW5A 4N18A 2B37A 1IHOA 2X8JB 2O1XA 3MAGA 1IBSA 4WX2B 3KB1A 4MLZA 3SAJA 3PFKA 4RW0A 1ETUA 2P9ZA 5ADWA 4KVZA 2DHRA 4IZIA 2AOVA 3CPJB 4O4LF 5EP1A 3UMCA 2UVPA 3QFRA 1W4AA 2B82A 5D1HA 3VUEA 3N8KA 5KTRA 1C1XA 1Z7WA 2ZVPX 4MUAA 4PBRA 3BJZA 3C41J 3ELDA 3NBMA 3T5TA 1R0KA 2JFPA 3M8KA 1JQEA 3K5WA 3P5SA 1HTTA 3W34A 4WCFC 2UZ4A 4J4TA 5EMNA 2QNRA 1P74A 1SXGA 3EG9A 1NE7A 1QGUB 4WSOA 1ZVJA 2YFQA 4U2EA 3ZD9A 1C7FA 5B7NA 2I5PO 1EXVA 1TPYA 3Q9NA 3VHLB 2Y1XA 4WY5A 1L5OA 4FKZA 1YIOA 1K7CA 3KPYA 4QHYA 2D0DA 4D9GA 5LPNA 2JLWA 1GFSA 3BJIC 4R54A 5KTMA 4W5WA 1MENA 5LA6A 3FHOA 3TVTA 3WLIA 5JQGF 2I1WA 3GNSA 2I6TA 3ZZ1A 3ABSB 5DHAA 3I64A 5ALFA 3WTBA 5AW8A 1ADBA 1L8AA 1CJMA 3QX7A 3ROQA 5DYTA 2I9PA 3LUBA 2BGIA 2PIDA 5FWNA 1BXRA 4RIIA 1H93A 3LL7A 5L4LA 2NO0A 3IPLA 1F06A 1O58A 1J0CA 1WEHA 4E1AA 1Z5GA 5JO9A 1NIPA 5KWVA 4R2JA 3KK0A 2ERCA 2LE0A 3GDOA 2V7XA 2OV3A 3FYUC 1ENOA 1SZCA 4L8VA 1D0VA 1WXHA 4CM5A 1XZNA 5FI0B 5A4KA 2R0QC 2GZ1A 2FLWA 4LY6A 4CMEC 2Y67A 3EODA 2CJWA 4TOIA 4Q9LA 2ZTUA 3D6HA 3DT8A 4J43A 1GZHB 2VDRB 1BFUA 2VAWA 4LQDA 1Y8ZA 2O20A 4N5LA 3FYDA 3TW6A 1V5EA 4LJKA 5CAEA 3R5SA 5HZGA 4B9EA 2D0PB 1T9HA 5TXGA 1BG6A 1MOQA 2JH8A 5BN1A 4IFTA 3HU1A 3CCCA 4WDQA 1C8VB 2UXDB 1YRHA 1P0MA 4M0EA 4N7JA 1HL7A 3CH6A 4E3WA 5IF9A 2G5CA 4L51A 2X0KA 1BE1A 1Z07A 3K2BA 4OXYA 4G2TA 1Q0SA 4RD4A 1SG6A 1GPKA 1X3LA 3V42A 2BFMA 3RU2A 3D7LA 2L2QA 4YJ2F 5DM70 2P11A 4JA2A 5IDQA 3W8EA 3MIIA 5IULC 4WK4B 1GU0A 3OJXA 1DMSA 1LSUA 1S01A 3JATA 3EPLA 4AQYB 1GA6A 1LBQA 3KFLA 5B1IA 3WLKX 4E2XA 5BPFA 1R9JA 1ZK1A 3A6FA 4FFPA 1PBNA 4OFBA 4MS4A 1PUXA 1XD9A 3PJFA 1DC5A 3Q88A 5HEKA 3ZY4A 1KORA 4A7PA 2B69A 3QMMA 2YXBA 4GOKA 5FPQA 2A1UB 3A2LA 4OYLA 3JALA 5JQWA 1QFSA 1F1BA 1TLTA 1P1JA 3KSMA 4GOLD 2ASEA 5FUWA 3OBIA 5B64A 4R2IA 4AUKA 1GTMA 3OCJA 4Q1DA 4U1RA 4IOKA 2NX2A 2C5GA 2B5WA 1SCUB 3L05A 2V4UA 1AZLA 1L1EA 4HZIA 5BY2A 3MELA 2CMKA 1NASA 2AXNA 3HUDA 4KHZA 5E1DA 2FH5B 1C5KA 4X85A 3TOVA 1CHNA 3I9OA 1IBLB 5JCJA 4E09A 3CV3A 2JBWA 1B43A 4QHTA 3G23A 4L8YA 1ID8A 4BAUA 1Y98A 4D0LB 4JWKA 1T6BY 5JR3A 2X8BA 3GA5A 3STYA 4MJLA 1DOAA 3TI9A 4AW9A 3WMEA 2AJCA 3A14A 3JVIA 4R3WA 4D80A 3IQFA 5CVJA 2QTVB 4Y7DA 2GYVA 3DAGA 1L5NA 2QZSA 3TD2A 7ADHA 2REQB 2WM9B 4Q3CA 5I4KA 3V8NA 4HN4B 1Y6ZA 2VQSA 4DA0A 2X5JO 4G26A 4M9UA 3FHTA 3QW2A 1T4CA 2YY5A 5I7FA 4CUZA 4Y9UA 2XCTB 2HTFA 4Z0NA 3VO8A 3AH8A 1ESNA 3GDFA 5E4FA 3EF3A 4PNEA 1VSQA 1ZI9A 2D54A 2ZTVA 1N0IA 1SOAA 1YS1X 5TARA 2OGSA 2ACWA 1RAFA 1OMOA 4XPZA 1G8KA 1NVUQ 1U8XX 2O2GA 3ASVA 5FO1A 4KNYA 1CDZA 1B3RA 2QM3A 1GFIA 1OFUX 1GTL1 4IIFA 5EJMA 5T5QA 1DFIA 1BMDA 4L3OA 3RS3A 3WWYA 5CB4F 1O4WA 5UKDA 1ECCA 2GO7A 2VJLA 3R1IA 2A5DA 2FVXA 1QHGA 1C1XB 2LKDA 1NUHA 4CL3A 4TTRA 1YRYE 5E2AA 3JQEA 2MMGA 2PMDA 3OFND 4D82A 1MAAA 5DNYB 4HZGA 3EB9A 3LY7A 4NF2A 5BSFA 1BDIA 1YDHA 2Z4TA 4ER5A 2GM9A 4PRZA 2WMNB 3O8DA 1GGNA 2HCFA 3EG9B 4H6WA 3PB3A 3RYFB 5B58C 2QVZX 1PYGA 3B7WA 3DVQX 3LU1A 3K73O 1OQAA 3QFTA 3VOBA 3NGLA 5EPUA 3IUYA 4UBNA 1MJHA 1GAXA 2VF8A 2R00C 4EX6A 3P8ZA 3TRDA 1E1QA 3JQAD 4H3HB 3FM9A 1JR3D 1SHKA 2VF2A 1XTPA 2QY9A 5LA6B 1F8UA 4WZZA 4ALJA 3DBVO 3W6NA 2IWHA 5PNTA 2SKCA 3NTLA 5HMMA 4URXR 4N5IX 3V4FA 3NRBA 3EX7C 1VL2A 4PSCA 2GFHA 2RGCA 1FQKA 1XA4A 3J7TA 3QLEA 4E12A 2OP1A 1R4ZA 2NP6A 2NNWB 2OQ2A 1TADA 3VZDA 5HKKD 1G60A 3EWIA 1FUYB 1FSSA 1O03A 2G1AA 4M7OA 4ETMA 3DOUA 5TMEA 5AW0A 1VQ1A 4XQCA 1EGHA 3Q7IA 5TQ2A 3BWCA 1X9HA 2O4CA 5AOVA 1V4VA