2J3KA

Crystal structure of arabidopsis thaliana double bond reductase (at5g16970)-ternary complex ii
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
345
structure length
336
Chain Sequence
MTATNKQVILKDYVSGFPTESDFDFTTTTVELRVPEGTNSVLVKNLYLSCDPYMRIRMGKQAYTPGQPIQGYGVSRIIESGHPDYKKGDLLWGIVAWEEYSVITPMTHAHFKIQHTDVPLSYYTGLLGMPGMTAYAGFYEVCSPKEGETVYVSAASGAVGQLVGQLAKMMGCYVVGSAGSKEKVDLLKTKFGFDDAFNYKEESDLTAALKRCFPNGIDIYFENVGGKMLDAVLVNMNMHGRIAVCGMISQYNLENQEGVHNLSNIIYKRNRIQGFVVSDFYDKYSKFLEFVLPHIREGKITYVEDVADGLEKAPEALVGLFHGKNVGKQVVVVARE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NADPH-dependent oxidoreductase 2-alkenal reductase
publication title Mechanistic and structural studies of apoform, binary, and ternary complexes of the Arabidopsis alkenal double bond reductase At5g16970.
pubmed doi rcsb
total genus 82
structure length 336
sequence length 345
chains with identical sequence B
ec nomenclature ec 1.3.1.74: 2-alkenal reductase (NAD(P)(+)).
pdb deposition date 2006-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF16884 ADH_N_2 N-terminal domain of oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2j3kA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2j3kA01
3HN7A 5L4LA 1B16A 4FSHA 1DHRA 1HF3A 1T2DA 3HADA 1P44A 1PL6A 1VRWA 3GC6A 2W2LD 4TROA 5CDGA 3ZWNA 2E48A 1CDOA 4ZD6A 4BKQA 3KZVA 2BLLA 4GKVA 4J1NA 3PJGA 1W0CA 4RLSA 3VH3A 2EG9A 1LDNA 4M89A 1LNQA 3FCOA 2VQ3A 3I6IA 2JFFA 4ND5A 3DZIA 4P4NA 4YAJA 4TMFA 1DFGA 1XHLA 4CV3A 3Q1LA 1QXSA 4AJ4A 3B1KA 4RVFA 4CM9D 2X1HA 4AJNA 2GDZA 4J4HA 4O5OA 1DIRA 4EEXA 4RF3A 4FFPA 4EZBA 3ABIA 3HB4X 1ZBQA 1P3DA 4DTIA 4CODB 3H7AA 5JXWA 1YJQA 3TF5A 4B4WA 1XKQA 2ZB4A 1YL6A 4JIGA 4W82A 5G4KB 4RDIA 4UEJA 2VZ0A 3M2TA 4RVSA 1Y5RA 3GFBA 1E0DA 3PWSA 5G0UA 3DHEA 2ZTMA 1UZNA 3PQFA 1I8TA 4PLWA 4YYZA 4BS9A 1E7MA 1U5CA 2CUKA 2B37A 2XOXA 3ROQA 1PQPA 1LDGA 2Q99A 4PZEA 4OL9A 3KLPX 5JLAA 2R00A 4XCVA 4A7PA 4ITUA 3FPLA 2DPHA 3ADOA 1DXYA 3WMXA 1PWZA 3F1KA 2AQIA 2VHVA 2YUTA 3BMCA 4BB5A 2CZCA 3VH1A 3F9IA 1MC4A 4CM7A 3DMTA 1J6UA 2IDZA 3HDYA 5IN4A 3R6DA 4DLLA 1KBZA 4FN4A 4IMRA 1L1FA 1DIHA 1NAHA 3KSUA 3Q11A 4H16A 4OHUA 4A26A 4I9UA 4GLOA 1ZZEA 3BTOA 1SBYA 3WG9A 3TRIA 1N92A 5EJ2A 2EIHA 3A06A 5CAEA 4FQ8A 1DLJA 3BXXA 1RKXA 1OBFO 1PQUA 4AG3A 1P1KA 2IYOA 5A5FA 3O9ZA 3PTZA 1NFRA 2Y0CA 3GGPA 4M86A 4UUNA 3NX4A 3PDJA 2IZZA 5KJ6A 3D4NA 4BO5A 1NTOA 4WKGA 1E3JA 3TZCA 2PNFA 4GX5A 4BKOA 1P77A 4I9NA 1B8UA 4ZQGA 3C85A 1DAOA 1NWHA 3BMQA 3LT2A 1YB1A 4NBTA 3ONFA 4A5OA 1YOVA 3V1YA 4BO4A 1K2WA 2O3QA 3FSRA 4IJVA 2WJPA 2POQX 3QVWA 3CEAA 3FWZA 5B12A 1HKUA 4R9SA 1TT5A 4S1VA 4UEOA 4BL5A 4IY1A 3EK2A 4B7UA 4DPKA 1PJSA 1CRWG 2FWMX 3AM3A 3C7DB 4MIYA 5CPBA 4B3HA 4D0SA 2ZYGA 5ITWA 1R66A 1AHHA 1MX3A 1JN0A 2J3KA 1X7DA 1JWBB 3KV3O 4B3JA 3FNFA 2OORA 4IIUA 1HRDA 1U2GA 4G65A 4GX1A 3VZQA 5BSEA 1I3LA 1BTOA 1PJ3A 1T4BA 3GMSA 4BO6A 3R3SA 3JYPA 4DIBA 3BTSA 3DBRB 3EHEA 3DTYA 1D4FA 3LLSA 3PHHA 4XEHA 1X0VA 3S55A 1R0KA 4LW8A 3W1VA 2DM6A 3W4IA 3FBGA 4Y6PA 1E7QA 5HS6A 4ALKA 3RUCA 3I83A 2UUOA 1HE2A 2CVQA 1J5PA 1VPDA 8LDHA 1R4MB 4XQCA 3H6KA 2PKQP 1XA0A 4BMNA 4YWJA 3U4HA 3B6ZA 4NH4A 5MGBA 1H2HA 3CH6A 4FOOA 1ZNQO 4XR9A 1KEVA 3DOCA 4FFRA 4MVJE 5CDYA 5TNXA 2HMSA 3WIEA 1YS4A 1HDOA 4IDCA 5KOIA 3HFGA 2CNBA 2HRBA 1NYTA 3JD4A 3IJRA 2CDCA 3G1TA 1H9AA 2V6BA 1VL8A 3L4BA 5C3MA 1LRLA 3N74A 1PZGA 4JP2A 1GADO 1AE1A 1GL3A 3IMFA 2RH4A 5F5LA 3EDMA 2O4UX 4F6CA 5JS6A 5A5EA 1ZUD1 3AWDA 2BFMA 4JN6B 5CEJA 3GVCA 2GZ3A 1WAMA 5T57A 4E13A 1PJTA 4IQ8A 1AN9A 1FDUA 5JNLA 1LDEA 4B8WA 2AEFA 5I7FA 3QV1A 4AVYA 4RCVA 4ZU3A 4CMIB 4R5MA 3WLFA 1NWCA 1T1RA 3RU9A 2FOIA 3MWDB 2R00C 4CR8A 4BO3A 4GVLA 3VKUA 5L9AA 1H6AA 4OSOA 4EUHA 2VCYA 3W4KA 1CQIA 1PJLA 3A28A 3GMDA 9LDBA 5AOVA 1YJ8A 2TMGA 3ZI0A 3DMTC 3PIIA 1TXGA 1UAYA 1BHSA 5C7OO 1XG5A 3P2YA 4IZHA 2JCXA 2B69A 1OI7A 1PZEA 4CUKA 2IEDA 5BT9A 3BMQB 4E2XA 3COSA 1DDOA 5JCXA 1LDMA 5F5NA 1YOVB 1Z75A 3UXYA 4NK5A 4XR4A 3NDIA 4Y98A 2NSDA 5A06A 2O7SA 2V6GA 1SO8A 4WOJA 2BI8A 4PG8A 5AQ1A 1LC0A 1FK8A 3JD3A 1NVTA 1BGVA 1DO8A 1UXIA 2GCGA 4UEKA 1E5LA 2EERA 5KJEA 1VLLA 1ENZA 4ZVVA 5JAZA 1PL7A 1OAAA 3RUEA 1KIFA 3HNPA 4D46A 5L40A 2I65A 3MWEB 3E18A 4DUPA 1RM4A 4NQZA 5DCUA 4E32A 5HTOA 4URFA 3U4IA 3I3OA 2ZCUA 4WGGA 2A9FA 2HSDA 1T24A 1JAXA 1DC6A 4MVJM 2BGLA 4GAEA 3H3JA 3OBBA 4L8VA 1BXGA 1I2ZA 1M2WA 1DSSG 5JY1A 1U5AA 1YBVA 2FPPA 4DXHA 1EUDA 3TFOA 3WOHA 1BXZA 1MXHA 3PIDA 1ZIDA 3OMLA 4D3SA 2HRZA 5KJ1A 1QYVA 3B1JA 1NP3A 1NQ5A 1XIVA 4RQUA 3LT4A 2PFGA 4O6VA 3TWOA 1NVGA 3PRJA 4YT5A 4IPTA 4J49A 1YVEI 3MOIA 1PU2A 5BSGA 2TMDA 4QX6A 3PHIA 1NAIA 5JO0A 4CQMD 3K9QO 1DIBA 2YV2A 4NPCA 1FDSA 2X9VA 2W2KA 4CL3A 2QIOA 4FW8A 4U0JA 1BDMA 4CLRB 3OICA 3GNTA 3PHGA 4INAA 3S2FA 4BNLA 3AI3A 4A0SA 1LC3A 3V5NA 1EVZA 3GT0A 4NMHA 3NTOA 3ZU4A 4LVUA 5JW6A 3JQCA 5A3JA 1ADGA 3ICCA 1I33A 2EWMA 3OJOA 3VPXA 2NVBA 4W9NA 2HJRA 1ADBA 4H15A 4WCFA 2VT2A 4W6ZA 1ULUA 3L4BC 2IZ1A 3ZNQA 2CD9A 4B3IA 5L7WA 2PZMA 4P38A 4UULA 2W2LA 4KUGA 4W7HA 4FFOA 2ZCVA 4AICA 2ZIZA 1RM3A 3EYWA 4YBZA 5KVQA 3ZWMA 2VWHA 4LMRA 1PS0A 2GYYA 1P45A 4RZHA 4JBHA 2Y67A 3QWHA 4R51A 4I5EA 2LDXA 2DTEA 1E1MA 1NNUA 3UCFA 4WE3A 2YQ4A 2XXJA 4EJMA 3E82A 1GDHA 4CM9A 4E2ZA 3GN1A 3WQQA 4BNUA 2OBNA 5J23A 1C0IA 2QYTA 3F4LA 2AA3A 4F3YA 1IE3A 1B8VA 2IEBA 2NQ8A 3NT2A 4R1SA 3E03A 1Q0HA 1YKFA 3H2SA 5HBRA 2CVOA 3R1IA 2J5KA 4L76A 3UN1A 1T1SA 2VZ9A 4M1QA 1I2CA 4PLHA 3JSAA 1I3MA 1MG5A 2F1KA 2GD1O 2O7QA 3KYBA 3HHPA 5BSHA 4HX5A 3I23A 1T2CA 2RHCA 4JGBA 4ALNA 1KEWA 3SX2A 3DL2A 4R1TA 3I9MA 3Q2IA 1XSEA 2FHSA 3DXFA 5ICSA 4MVJD 3KBOA 1O94A 1ISFA 1XWFA 4B7XA 1ZXBA 2VTEA 7ADHA 4TZKA 1ZXLA 3T4XA 5I9MA 4NG5A 4WNCA 2P2SA 1A7AA 2O3UA 1SOVA 3RUHA 5DP1A 4NFSA 2UAGA 3G49A 2IYPA 3OJEA 2AHRA 4GVXA 4CMBA 3EC7A 4CM4B 4BO0A 2WD8A 4IDBA 5GZ3A 3RJ9A 3FR8A 1B14A 4BO9A 3LQFA 4YVFA 3K30A 5I7VA 1Z7BA 3ASVA 3EVNA 3VPGA 3C1TA 5DN9A 3VPSA 2Y93A 4PZDA 1A27A 2I99A 3ZHZA 4I9HA 1I36A 2Q4EA 1Q0QA 2AEJA 4CJXA 2X5JO 4HFRA 4UVIA 3GDGA 3GEGA 1UP7A 1R12A 1R0SA 2O2SA 1H2BA 2D1YA 3OJLA 1ZK0A 1GUFA 4XB1A 4WCFB 4I5GA 4OMUA 1SZJG 4ALJA 3EW7A 3ZWBA 3AY3A 4O63O 5TJHA 4CLEA 4J1QA 5GMOA 4ZRNA 4LSWA 1GQQA 2LDBA 1UAGA 2YHUA 4PLVA 1IULA 2PV7A 4E31A 1GPJA 4KTVE 4ALIA 3AY7A 5THKA 2VYVD 4BB6A 3WS7A 1VE9A 3BIOA 2GZ2A 1OOEA 3F5QA 5KTKA 3CINA 2UUPA 1CJCA 4W9NC 2X7HA 5A05A 2E49A 3GDFA 4WCFC 3GG9A 1UZMA 4DGSA 3ZDFA 4C4OA 5JAIA 4UUMA 1NQTA 1PR9A 4CMKA 1YQXA 3WTBA 3GVPA 3LF1A 5KVVA 1E1LA 1EBFA 5ER9A 2O50A 1PL8A 4QXMA 3P5SA 4UVHA 1GV0A 1A4UA 4D3FA 3GAZA 1SC6A 1AXGA 2SCUA 3PZBA 4GGOA 5CDUA 4KDEA 4RF4A 5CFZA 3QWBA 3VDQA 2EGGA 2JL1A 4DPLA 3UCXA 3VPFA 3VTZA 1JQBA 2OP0A 2ZYDA 4J4TA 4BNYA 1B8PA 3TPCA 1DIGA 3AM5A 2Q3EA 1F0YA 3GAFA 4E0BA 1X7GA 3NV9A 1ENOA 3ZHYA 2JFHA 4OXKA 3MTJA 1PGPA 4OXNA 6ADHA 4QT0A 4OM8A 2DQ4A 4BV9A 3VZRA 1LRJA 1E6WA 1R4NA 1V3UA 2Q45A 3QIVA 3V1UA 1Z82A 1Z7EA 4BVAA 5FFFA 4XYGA 4FS3A 3GK3A 5JO9A 4IZIA 3NTRA 2I5PO 2Z1MA 1YONA 4RPJA 5TF4A 2C29D 3UKOA 2AEMA 3UH1A 5TT0A 2IZ0A 4YRAA 3ZN2A 1RM5A 2OXIA 4Y6SA 2DLDA 3AW9A 3B20A 1AUPA 3V2GA 5TLSA 2QQ5A 1QYWA 1YB4A 2P9GA 4DWVA 1EVJA 1NHWA 1Y1PA 4GWKA 1IHYA 3V2HA 5A03A 3CPSA 1QV7A 4Q3NA 1GPDG 2VTDA 3INRA 3RAJA 4DPMA 2WSBA 3F6YA 2I76A 2BMAA 2PTGA 4TVBA 1JVBA 2P5YA 3Q0EA 2W4QA 3BMOA 2BFOA 3TDKA 3LT0A 1H0KA 3L6EA 2FP4A 4HFJA 4YAIA 1KYQA 3KXDA 3DBHA 3FTNA 1RYDA 1TI7A 3OJFA 4R1NA 2PGJA 5G2OA 1F8GA 2X6TA 1Y8RB 4E4YA 4L0QA 4WEQA 2Z1NA 2E37A 4J2HA 1C14A 1CYDA 2NACA 4J7UA 4KZPA 5ENVA 3WGZA 1HYGA 4A03A 4XB2A 1I32A 1GYRA 4XYLA 1V0JA 3X2FA 3OM9A 4EEZA 4LRTB 2B4TO 2DAPA 5LCXA 1DFHA 2O3RA 5HM8A 1E1KA 2R2GA 4BNHA 1E92A 1JDJA 1QRRA 2I67A 3GHHA 3PPIA 4HNGA 4KQXA 4J0EA 5T8KA 3DZJA 4O1MA 3WGGA 1M75A 1GY8A 4BNZA 3WLEA 4IINA 5T6BA 4MP8A 2R6JA 1QYCA 3MJCA 3ETGA 3Q2KA 2Q49A 1HSOA 4TKMA 3ZV5A 3V1TC 4BNTA 4R41A 4PLFA 2EKPA 4ZHSA 1Q7GA 1GCOA 1EE2A 2ZQYA 3ANMA 1BVUA 1WMAA 4AJPA 1B3BA 3GPDG 3VHRA 3WGQA 3W8FA 1C0PA 4Y8VA 3SLKA 1HLPA 1S6YA 3JD2A 1CF2O 5BQFA 5AXAA 1R4NB 4Q3AA 5TJ9A 4D44A 1LLUA 1H5QA 1H94A 3RSHA 3AUUA 1NASA 3NDJA 1K89A 3WBBA 2P4QA 3IAHA 4NBUA 1HXHA 2WD7A 3L77A 3OH8A 4O0LA 1SNYA 1IY8A 4CMHA 1A5ZA 1V3VA 4CM8A 4HFMA 5ICMA 2J3HA 5I7EA 3VVCA 1B26A 1GEGA 3IOYA 4YQYA 1SEVA 4E5KA 1HDCA 5AXBA 5EMHA 2HMTA 2P91A 1SMKA 1YB5A 2X8LA 4B8ZA 4R4JA 1K5HA 1UH5A 4BO2A 1P33A 4EGFA 3IC5A 3AOEA 4CQLA 3PGXA 2JKVA 1EQUA 3DAFA 2OP1A 2ZYAA 4D43A 1YQGA 2ZB3A 3T7EA 2NU6A 3B70A 2QW8A 3DZBA 2G5CA 4ZQBA 1N9GB 1TA4A 1C1XA 2A94A 3BMOB 4EW6A 4EJ0A 1E6UA 2DU8A 4CUJA 1LLCA 3LT1A 5ITVA 3V2UA 1HEUA 1TEHA 5DT9A 3ZWYA 4BNXA 1HT0A 3OQ1A 5U9CA 2AXQA 4K6CA 4OOEA 3JV7A 4WLUA 1DAPA 2Y05A 1VL6A 3PHJA 5G0VA 1Y7TA 2PD4A 1LEHA 3S1LA 2B36A 2OO5A 5BNTA 1PJQA 2PD3A 1ZMTA 1NFFA 3DBVO 3QWAA 1N8KA 3PJDA 1Z74A 1WW8A 3KB6A 4L9RA 4Y67A 4E5NA 1B2LA 4E2WA 4FIZA 4N7RA 1QYDA 1P1JA 2Q1SA 4Z0TA 3EZLA 4EJ6A 3ONEA 4WECA 2YDYA 4BGUA 4DMMA 3CE6A 2C2XA 3D4OA 1DIAA 3ZZNA 4MVJA 5JFOA 1KEUA 3WWZA 4DMLA 1M6WA 3R0IA 4RVGA 1UP4A 3RC7A 1GQYA 5LDGA 5C7IO 2EXXA 4JCOA 3IKVA 3VVBA 1MUUA 4E5YA 5KKCA 4PLYA 2BI7A 3PHLA 2V65A 2X9NA 1D1SA 1I3NA 1R15A 2BFAA 3U49A 4IQ0A 4NFYA 4OSPA 4UVDA 4KWIA 2BGMA 3FBTA 4WK6A 2H63A 3IUPA 2H1SA 1DBVO 2QX7A 4IDAA 4CQMB 1IB6A 3AM4A 2BKAA 3HUDA 3L0DA 4PZCA 4E5MA 1X15A 4MOWA 4LK3A 3RFXA 2Q2VA 2VYNA 1C0LA 3CSDA 5T8KC 2B4QA 1K6XA 1PZHA 2WTBA 3LSYA 2DKNA 5KKAA 3SBOA 4PG4A 2CF5A 2E82A 3FF4A 2UDPA 4Z0HO 3MOGA 1MLDA 1CETA 1FJHA 3H9UA 5CP8A 2JAPA 3GY0A 1BXKA 3DEYX 2EGHA 5EN4A 1K6JA 3JYLA 3PFWO 3B1FA 1ZEMA 2FN7A 3D3EA 3KSZO 4IXWA 1SB8A 1ORRA 3EZYA 3FD8A 4CLDA 1G6KA 2D2IA 4YB8A 4CM8B 3JQ7A 1OZAA 1D3AA 2FY8A 1I0ZA 4WOKA 4E2YA 4IJKA 2OUIA 1YDWA 1G1AA 2NU9A 1GZ4A 3SXPA 1UDBA 4HNHA 1MFPA 4J6FA 2YFHA 4GSKA 3F1LA 2X22A 2AG5A 4H7PA 4XYBA 1UXGA 2C07A 4QEDA 2VHZA 4CV2A 3ZU3A 5B4UA 1ZK2A 4YJDA 2VYVA 2JHGA 4DL9A 1B0AA 4CQLB 1DOHA 5JY6A 4N5NA 3U3XA 3DTTA 3RFVA 1H6DA 2UVDA 4JK3A 1NX6A 4BHTA 1JLLA 3LC1O 3HB5X 1NVMB 3QP9A 3X2EA 3ZV3A 4MKZA 5T67A 1X1TA 3S2GA 1UXHA 2Y1EA 4DQVA 3D7LA 5GZ1A 4KOAA 4Q3BA 1LXCA 3EGOA 3F5SA 1KY4A 3WJAA 3INGA 1ZFNA 2VZ8A 4QSMA 3RASA 3ANLA 2BRUA 3ZHBA 4TRJA 3ORFA 3VZSA 3OA2A 3E9MA 3BMCB 1RJWA 4J90A 2HMVA 2RHRA 5EINA 3AOEC 5FYDA 5L7TA 4QECA 2NVWA 3GRPA 3RJ5A 1XELA 3RC2A 1R16A 2PK3A 3KYCA 2X23A 3MJVA 3QVTA 5L3ZA 4YAKA 3K92A 5EPOA 4CMGA 4DVJA 1DPGA 5F1OA 3O8QA 4CMCA 1SOWA 1R37A 1LSUA 2I3AA 4NU5A 5G0SA 1T2AA 1EK5A 3HDQA 3CZRA 1PS8A 1PJCA 2C5AA 3C7AA 3LDHA 2OFPA 1FDTA 1NPDA 1X1EA 3I9NA 1DLIA 4XJSA 2BGKA 3I4FA 1L7EA 1H6BA 4HWKA 3RI3A 5CPFA 1MB4A 4YACA 2JFGA 3GZNA 3GR6A 4ND1A 1UJMA 9LDTA 4L4SA 2GASA 3HG7A 2GN4A 1JW9B 1CEQA 3IKTA 3DDNA 2HUNA 1BW9A 2J6IA 1NPTO 1PTJA 3GFGA 1E5QA 1QG6A 4ZA2A 3VH2A 2ZTVA 2VNSA 4CUZA 1DC4A 4I08A 4S3MA 3NKLA 5FF9A 2PGDA 5B4TA 1TT5B 1VJTA 1WZEA 3AUSA 1XGKA 4XGKA 3KOUA 4E33A 1E3EA 1C3VA 2CFCA 3JQAA 1KY5A 4N54A 4PRLA 1P74A 1KVUA 1A71A 2YV3A 1O89A 3BTUA 4MIOA 3ZWVA 3DFUA 3G3EA 2Q46A 4TZTA 2DFDA 5IG2A 4DYVA 1I2BA 2WYVA 5JYEA 3I9OA 4WCDA 3CZMA 3I4CA 4M87A 1TLTA 3AJRA 3K5PA 1HYEA 3OFSA 3M1LA 4FB5A 5A02A 2NUAA 1DRWA 3L9XA 4PG6A 1MC5A 5DZSA 4GMFA 1U3WA 4Q3DA 3IJPA 3RWBA 3JQ7B 3AU8A 2WM3A 4MVJP 3U09A 2EKQA 3FNEA 1Y8QA 5IFLA 2RAFA 2B35A 3AI2A 2VRBA 3HE3A 4E6PA 2X0JA 1VSVA 2X0RA 2OZPA 4Y6RA 3IQDB 1GFSA 4RLHA 4B4VA 1S7CA 4WLVA 4TVOA 3GNQA 5JMPA 3DHNA 2FPIA 3I1JA 4BO1A 5JC8A 4MP6A 1NQOA 5I8WA 4IIVA 1UXKA 2H9IA 4MKXA 2QZ9A 2Q1TA 1T25A 3H9JA 1KVTA 2QYSA 3RD5A 3AFMA 3MCVA 2ZJ1A 3AY6A 2AW5A 4JROA 2HO5A 4BGIA 3JQ6A 4D41A 2DBRA 1WNTA 2PA3A 3VAZA 4YQZA 4BOYA 2X5KO 1EVIA 2Q2WA 4XKJA 3RUDA 1A9YA 4FGWA 3W6UA 4FFMA 1N1GA 1D1TA 2YDXA 5G0TA 1HYHA 3FNHA 3CUKA 4QFCA 2VHWA 1ISHA 4Q39A 1IYZA 2D59A 2IXBA 3KYCB 1M76A 2AE2A 1WDLA 1PX0A 3SLGA 3K6JA 1C1DA 1W4ZA 4AL4A 3D5QA 3WICA 3WNQA 1W6UA 5I9LA 4XQEA 3O8QB 3U5TA 2O23A 2OOSA 1ZSVA 2P4HX 1MFZA 4UVEA 2ZJ0A 2D4AA 1E7YA 3I5MA 1X13A 2CF6A 3I9JA 3FNGA 1PR3A 1RWBA 1VKNA 2DPGA 2WEKA 3C1OA 5EERA 1GTMA 1PJBA 1VM6A 3AU9A 3RC9A 3FR7A 3BMNA 1M66A 3OIFA 3TOZA 4MVJH 5A9RA 1ID1A 1JA9A 2NM0A 3NGXA 2Q50A 4HUJA 4NJMA 3M6IA 4U6QA 4XZ3A 1E3SA 3LVFO 3O26A 3GRKA 4CM1A 4RPHA 2CY0A 4II2A 3TL3A 1DC5A 3E1KA 1DFIA 3DMYA 3ZHXA 3OIDA 4KUEA 4CMEA 1FDWA 5JDCA 3FTPA 5TGDA 3IL2A 4N5MA 3WJ7A 2P9CA 4UUOA 1YBMA 4XDYA 1X14A 3ZWOA 3JCZA 1AXEA 1GZ6A 4C7JA 2F00A 1HDZA 5EQFA 1L7DA 2G17A 1OMOA 5DDIP 2H6EA 2NTNA 3I9LA 4FFLA 2PY6A 1KETA 2GO1A 3AUTA 4YJHA 1R0LA 1XLTA 2CVZA 2DC1A 3NEPX 3WBFA 3WSVA 4BV8A 1KVSA 3VC7A 1BXGB 5G4LA 1RYEA 4CMAA 1X0XA 3IS3A 2C5EA 4H3VA 3K8ZA 2YHIA 2AE1A 4NNJA 4U7WA 4PLPA 4FJ1A 5I9NA 3MEQA 3DAGA 3NDRA 1I10A 1PGOA 4HADA 3GDOA 1YL5A 3OF2A 2X9GA 4L4RA 5H81A 1EDZA 2Y0EA 4MJLA 4MVJF 5FI5A 4BIIA 3ON5A 2PZKA 4J9VA 3PJEA 5CG1A 3I9KA 3AOGA 2OHXA 1SPXA 3BAZA 3RUFA 1W73A 2W2KB 1E3LA 3KSDO 2VYND 4U6SA 5IDXA 1GAEO 1YE3A 4QQRA 1EFKA 2HJSA 2C0CA 3WGIA 2NVUA 3H3FA 4IDDA 4YA6A 2RIRA 2HMWA 1UUFA 2QRLA 1F12A 3ENKA 4HP8A 1YWGO 3HJAA 1FDVA 3WQSB 1LLDA 1I3KA 1IUKA 4NBVA 3RBXA 1C1DB 3CIFA 4CV0A 4G5HA 4F46A 4CL8A 1ZMOA 5A9TA 1M67A 1QYXA 1PJ2A 3OEWA 3UW3A 4YXFA 4HFNA 5L7YA 4I5DA 4LISA 4WLNA 1QKIA 4ZQFA 3HQ4O 1ML3A 5GZ6A 1EDOA 3FHLA 3E5RA 4UUPA 3BHIA 3RBZA 4Z0PA 3VTFA 2D8AA 1PEDA 3LU1A 4UREA 1ZVMA 4G81A 4NU6A 4P4LA 4CMJA 4RVHA 1XQ6A 4YR9A 2A4KA 2I9PA 2EEZA 1T4DA 2FSVA 3PFFA 2C54A 5ADHA 4JJIA 3U9LA 3Q9UA 4IDGA 4JQCA 2GNAA 3RUIA 1IPFA 3OIGA 5AXCA 3ETDA 1DJNA 4DLBA 1U4OA 2DTXA 4JBIA 4WPGA 3TZQA 1B3RA 4NK4A 1IHXA 3DZFA 4XX0A 1KVQA 1NBOA 4QUKA 3PJFA 5DBFA 1N2SA 2RCYA 1QSGA 1EUZA 1VC2A 3GVIA 3P7MA 1HDYA 3N58A 3JQ8A 3ZWWA 2VNAA 4GKBA 4N5LA 5DNAA 4OYRA 2EF1A 3PEFA 3SC4A 3IDSA 4F6LA 1JWAB 2PKQO 4RDHA 3RFTA 3ZWCA 4DIOA 5JE8A 1ENPA 3NJ8A 3C3XA 2EP5A 4YJHB 5JPIA 5HS4A 5KIAA 3QQPA 5LDHA 3F47A 4IJWA 2VRCD 1UZLA 4IJUA 3PLNA 4OO3A 1GU7A 4YRBA 4WJZA 3RKRA 2Y1GA 4CMEC 4II3A 5JDCC 1WPQA 4GH5A 1Z6ZA 4JNKA 5DP2A 4Q3EA 3ULKA 1MG0A 3CKYA 1E3WA 2YHIB 3F3SA 5EIOA 1LI4A 3ZCXA 1YDEA 2EW8A 2NADA 2DUUA 4BUCA 1P0CA 3WGOA 3JD0A 4BNVA 4YT4A 3H2ZA 4B4UA 5A04A 5K0ZA 2XXBA 1P31A 1LQTA 5DULA 1PQWA 4XYMA 2HU2A 4IGEA 4BNGA 2BELA 2IE0A 4R5HA 4FOSA 1QV6A 3EMKA 3JQAD 4DLAA 3GGGA 3I6QA 2I66A 4ALLA 2H5LA 4WASA 1N7HA 1I30A 1Y9EA 1ZJYA 5G0WA 3PYLA 4PRKA 1YGYA 2PZLA 3WMWA 3D4PA 2NVUB 3WR5A 3ZNNA 4PIVA 3HFSA 3L6OO 4WEOA 5TS3A 3T4EA 1KERA 2FRDA 2VUTA 1ARZA 4PVCA 3WYCA 1OC4A 1RM0A 1NFQA 4A10A 3INTA 2PD6A 4CPDA 4DC0A 1WP4A 3SEFA 5COAA 1G0NA 3HSKA 3QWIA 3GQVA 4J7XA 1GD1O 2UV8A 5JSFA 2EKLA 4Q9NA 4XD2A 3QWFA 1OC2A 4RQTA 4XJTA 5MDHA 2Z5LA 4WLEA 1H9BA 5TC4A 3I52A 4A27A 1YL7A 2A92A 2HLPA 3U0BA 2Q4BA 3MJTA 3KHUA 1WDKA 5EL0A 3RROA 3U4DA 4AJIA 1HE3A 3GH3A 4AJLA 5K9ZA 5JCJA 4YJFA 1Q2XA 1LSOA 1ZH8A 5IZCA 2B5WA 3KRTA 5JAMA 3LLVA 4DC1A 2O3SA 3JQEA 3JQFA 4ZQHA 3WFJA 1MGOA 3JQ8B 5F3RA 4BGVA 2BHLA 2PWZA 4P8RA 4Z9YA 3WGTA 5BNFA 2DFVA 1F06A 2RBEA 2ZB8A 1H93A 1HWYA 1XR3A 2J8ZA 1LDYA 1EUCA 1OFGA 5ILOA 5L45A 2CSUA 3L6DA 2C7VA 2FMUA 3GEMA 3PZRA 1IZ0A 3NRCA 3UF0A 2JCYA 1O5IA 2AG8A 4CM5A 2V6FA 4TRRA 1NR7A 3TN7A 1EE9A 2JHFA 1CIVA 2YQ5A 3ZU5A 1JKFA 3PYXA 3E48A 3W8EA 4C7KA 1K6IA 2GPTA 2O4CA 4MIEA 2X0NA 4XWYA 3U62A 3L9WA 3OEYA 1D7OA 4J0FA 1ZKMA 2NU7A 3QE3A 4BNKA 2V6MA 1C0KA 3Q6IA 2CMDA 2YV1A 3GNSA 4W99A 5JYDA 2QHXA 4J7CA 3ZWAA 3ZGYA 4ND2A 4IGFA 3E9NA 3H5RA 1YXMA 1ZK1A 3JQ9A 2BD0A 4X54A 1E77A 4RL6A 2G0TA 3PQEA 4QTZA 5JDIA 2GZ1A 3HWRA 4BMVA 1ONOA 2O3JA 3ZW9A 4DBZA 1A4IA 1U3TA 2PKRA 2JCVA 1CQJA 3DBRA 3VKVA 2C20A 5KWEA 3JYQA 4JXKA 4XRRA 4Z9FA 4AJ1A 3TNLA 3O4RA 4LN1A 1R4MA 1HTBA 3VDRA 1U7HA 2D5CA 2JD1A 3DR3A 3PVZA 1YBAA 3A1NA 1VJ0A 1AHIA 2ZB7A 4EITA 3DBHB 3PLRA 1XEAA 4OGWA 4XQ9A 3OETA 2EHDA 2OGUA 2Z95A 5CHEA 3OJ0A 4RORA 4EI2A 1HE4A 1U4SA 3DZKA 2YW9A 4FC7A 1Y81A 3ZV4A 2X5OA 3NUGA 5F21A 1VL0A 4D7AA 5AYVA 1ZSNA 3UVEA 1UDCA 3H9GA 4M8SA 5TT1A 3ROKA 3JQBA 3WX0A 1P1FA 4BNIA 5JBIA 4LCJA 1PWXA 4PGFA 3NTQA 3OQBA 4XQGA 1T2FA 2CDAA 1K0UA 4GI2A 2B4RO 3WDSA 1XCBA 1GUZA 4OH1A 3QHAA 4YT8A 1BMDA 4HY3A 4YJFB 4RF5A 5BR7A 3C24A 1E7RA 1ZK3A 3DZGA 1WDMA 4IMPA 4PG7A 1G0OA 1VI2A 2C82A 3L07A 4IDFA 4CMIA 1PZFA 1DB3A 2J3IA 1TVEA 2BF7A 2Y0DA 1V8BA 4BKUA 3W6ZA 5IDQA 4BNMA 2QG4A 4AJJA 1EMDA 3BHJA 4FCCA 2WDZA 4L4XA 3VZPA 2WMDA 3D64A 3DB2A 1A72A 3ONDA 3P19A 4BNWA 2VUSA 1DEHA 4Z3DA 7MDHA 5IZCC 1BWSA 5ILGA 3DBLA 2ZTLA 1LLQA 5TQVA 3GGOA 1KVRA 3DHYA 4D45A 1DJQA 1HDGO 3RC1A 4BO8A 3JQFC 2C59A 3A9WA 3RIHA 3W4JA 5H83A 3GEDA 4R9RA 5U1PA 1P1HA 5THQA 4N18A 1T26A 1ZK4A 1PGJA 5IJZA 4RF2A 2JJYA 4CLHA 2WD7B 3D5TA 2NTJA 3BTVA 4MPDA 1LSSA 1LBEA 3KVOA 3GN2A 3ASUA 3RBVA 5IZ4A 5JMWA 3GVHA 1HSZA 2O3TA 1ZCJA 2GF2A 4IS3A 5JAQA 3O38A 5L4SA 3TZKA 1TT7A 4DIFA 3RCBA 2YYYA 4XIYA 4CR7A 4ALMA 1V3TA 1Q0LA 4FDAA 4DBVO 1IPEA 1D8AA 2X58A 1R6DA 3C1AA 2J3JA 3RVDA 4UAGA 4FPXA 5FWNA 2VWGA 4GBJA 3PQDA 1MXFA 3RQSA 3DOOA 1B7GO 2I3GA 1PGNA 2FR8A 3TFQA 3GUYA 1C1XB 1HZJA 3G17A 4JX8A 4AJHA 5AXDA 2UYYA 3N7UA 3JQ9C 4KP7A 1U2DA 4GSLA 5DCYA 1A7KA 2NLOA 2G82A 3JD1A 5JDIC 4Z6KA 2CDBA 3ST7A 1QLJA 3DONA 4QO8A 3SJUA 3S2IA 3FPCA 3ADPA 4LRSB 3TQHA 3NGLA 4K6FA 3DOJA 5CDTA 3LF2A 2IODA 3AK4A 4FD3A 3WYBA 3C8MA 4CLOA 1F14A 1ISJA 1Q7CA 3HDJA 4RPLA 4CLRA 1WMBA 2Y1CA 4GL4A 4BGEA 5DOZA 4BQRA 5C37A 1BRMA 4ND3A 4BMSA 2VRCA 1QR6A 4PN3A 2PR2A 3E9QA 4D79A 4GPD1 3ZNOA 5HRUA 4J4BA 1LRKA 4TQGA 1Y5MA 3H4VA 3UAGA 1Y9AA 2BFPA 2WE7A 3KO8A 3LYLA 3WFIA 3DC2A 5EQDA 4JLWA 1NPYA 4OJNA 1XQ1A 5IN5A 4XGNA 4OKIA 3JQBC 4A73A 4J1TA 5C5IA 3QVOA 3QSGA 3QRWA 1O6ZA 4YPOA 1P1IA 1ZW1A 2GUGA 2XAAA 4BQPA 1UR5A 3SJ7A 2A35A 1NM5A 4RVUA 4PG5A 4XRGA 1J0XO 1JVSA 3OSUA 8ADHA 4HKTA 1UP6A 3TL2A 5DF1A 3U4CA 1RPNA 2P68A 3DBLB 5HA5A 4I8XA 3VH4A 4JJFA 4NZ9A 1AGNA 1U8XX 4U5QA 3PI7A 3NT5A 2G1UA 1LX6A 4J9UE 4KUHA 2GGSA 3CTMA 1XYGA 1JAYA 3GUCA 3JQGA 3R3JA 4IUYA 4DQXA 3SC6A 2VHYA 4XA8A 3H5NA 4MINA 4R01A 4PLZA 4XDZA 1U3VA 4RPGA 3WYEA 1HDRA 1EQ2A 2VHXA 5JCJD 5TX7A 2FZEA 2QRKA 5LC1A 1WWKA 3RU7A 1U28A 1VSUA 2BH9A 5TSDA 3WQRA 4R68A 2FR1A 1QP8A 4PVDA 2DBZA 1UDAA 4R16A 5B37A 1MV8A 3G79A 2WWRA 1F8FA 4YDRA 2OBYA 3KYDA 4EUEA 5ER6A 2D0IA 2FSSA 1LUAA 3D3WA 3WIDA 4AJEA 2YJZA 1GCUA 3GHYA 5B1YA 2ZK7A 2YZ7A 2HK9A 4I5FA 4W7IA 3M2PA 4EBFA 3K31A 3LZ6A 1I5RA 1LSJA 4Z3KA 4FJ2A 3F46A 2OMEA 2NQTA 3VOSA 4NJOA 1E1NA 5DBIA 2IXAA 4YCAA 4FBGA 5A3VA 4G2NA 4WNIA 2Q2QA 4EDFA 4LSMA 1LTHR 4MDHA 4Z9XA 4TWRA 3E8XA 4TRMA 1N7GA 3ENNA 2PH5A 5I8ZA 3S8MA 5CEFA 1T2EA 4GX2A 4NI5A 4DA9A 3EUWA 1U7TA 2D3TA 3C7CB 2ILTA 3HN2A 1SB9A 4NFHA 3WGYA 5IXSA 4E3ZA 4J91A 1UXJA 5KVCA 2JD2A 1K3TA 3TSCA 3G1UA 4E30A 4CLOB 1ZSYA 2Y66A 1LA2A 4CM4A 1ADFA 5AVOA 3KM0A 3QJ5A 4IDEA 4FJ0A 1DRUA 1U3UA 3FI9A 4O59O 3WSWA 5IXYA 4RVDA 4MO2A 2QZZA 2G76A 4NDNE 1LDBA 1GYPA 1V6AA 1I24A 3OECA 4ROSA 6LDHA 4M55A 5L53A 1HL3A 3E5MA 1YRLA 2VOEA 3D1LA 3GZNB 3OHSX 4ZJUA 3D0OA 4R54A 4AJKA 3UFXA 5IDWA 4Y9DA 4RPKA 3CXRA 3JQDA 3H9QA 3CMCO 4M54A 5CEEA 3MJ4A 1WVGA 4PLTA 2VN8A 3ZH2A 1BW9B 1EK6A 4CM6A 2XPCA 4Q3CA 4P4GA 3STHA 1J4AA 2HMUA 2QRJA 3CMMA 1O9BA 3KUXA 4IM7A 3ROPA 3IUSA 3NAQA 3H9EO 2NNLD 3JQAB 4GWGA 5COQA 1GEEA 1P1RA 2FZWA 3ZWPA 4FR5A 3TJRA 1HETA 2HAEA 1U1IA 3H65A 3UHAA 3ZV6A 2W8ZA 3ZNPA 3ANNA 1QLHA 4YRDA 3L4SO 4TRNA 3JQGB 4OAQA 4E12A 2B0JA 1PGQA 4K1LA 4RO0A 4RZIA 5EESA 4YTEA 3E6AA 4YEDA 4GMGA 1NXQA 3OP4A 2Y99A 5DCWA 1I01A 1ZO8A 1SCUA 4B79A 3UGKA 1VKOA 5HWSA 4IBOA 1DC3A 2ZATA 1Y8QB 2O2YA 3QA9A 4F45A 1ENYA 2PZJA 3G0OA 5TRTA 1M6HA 2EJVA 3V8BA 2WYUA 3MZ0A 1SAYA 2YFQA 4IXTA 3KEOA 3KYDB 5U4QA 4L75A 4BNJA 3D3WB 4NBRA 4R1UA 4J43A 1QORA 4ND4A 2W90A 2Q1UA 2WE8A 1NR1A 5KJCA 3DAPA 4BKRA 1BDBA 1KC3A 1PIWA 4D42A 3MJSA 4PFJA 1EVYA 4L73A 3H8VA 3ITKA 4JBGA 4GQAA 1Q7BA 4FFNA 5BNIA 2ET6A 2GRAA 5L95A 2P5UA 3W8DA 2NV6A 5KVSA 3HDHA 4K28A 3PGJA 4CV1A 1ONPA 2GN6A 4CR6A 1ONNA 4LVCA 1NQAO 4KTTE 1JKIA 5L4NA 4AJOA 2YY7A 2ZTUA 3AFNA 4J3FA 1F17A 4QFDA 2Y1FA 3DZHA 2FPGA 4MP3A 1N5DA 2X86A 3IIEA 3MJEA 2V7PA 4I1IA 4YAEA 1XU9A 2D5AA 2P9EA 1ISMA 2J5QA 3PK0A 4NHEA 3QLJA 3Q9NA 4BNFA 3UICA 1JTVA 4OQYA 1WLYA 3AUAA 2C7GA 3KETA 1J49A 5K6AA 4YJGA 4WUVA 3BHMA 1WZIA 2DUWA 2HK8A 1Y6JA 2X4GA 1FMCA 2XF8A 4LGVA 5A9SA 1LU9A 3DWFA 2HK7A 2HKIA 2EV9A 1FXSA 3ZW8A 3BMNB 1NHGA 1HLDA 2Y68A 1QMGA 2NTVA 3ITDA 1BSVA 3M1AA 4IS2A 4MVJI 3WWYA 3FWNA 4HBGA 2DTDA 4R3NA 1BG6A 1U8FO 1GV1A 4NJMB 4DREA 3K2EA 4GX0A 1X7HA 1Y8RA 2VWPA 2ZKLA 3K96A 1O8CA 3PWZA 3OQ6A 4OXYA 4K9DA 4XGIA 3TZ6A 1ISIA 4DRYA 5DBGA 4OQZA 3S2EA 1DHTA 2PLAA 5IAAA 1E3IA 3JTMA 2DVMA 4FGSA 5K1SA 3EY4A 3ZU2A 4K26A 2O48X 1BVRA 1GR0A 1Z73A 1Z45A 4FC6A 1A9ZA 2PGLA 4LMPA 1PS9A 2AQHA 4RV9A 4ESOA 2VT3A 5IF3A 5TIIA 3DQPA 2GSDA 1HDXA 1E7WA 3PXXA 1XU7A 3KLMX 1SEPA 4R69A 2DT5A 2PH3A 2W98A 2IRWA 5GY7A 3GOHA 3FN4A 4JJGA 3H5AA 2GLXA 3GLQA 4TSKA 4EUFA 5A4DA 5CDSA 4P22A 2VWQA 1V9LA 5IDYA 2E6UX 3OA0A 4ZRMA 2NU8A 3VPHA 3WTCA 2VUUA 4UVGA 4W4TA 4YT2A 2RH8A 4KDFA 1W8DA 4L74A 2EP7A 3UOGA 4WLFA 5F1PA 3DFZA 1GYQA 1E6EA 5T5QA 4HV4A 3O03A 4J1SA 4NR0A 1HE5A 3GZ4A 4OIMA 1HZZA 4ZQEA 5FI3A 2OL4A 3EAGA 3GPIA 3GF4A 5C7LO 2NWQA 3T7CA 5BSFA 4IQGA 1GUYA 2GERA 2GR9A 3A14A 3LC2O 4ILKA 3UCEA 5A1TA 1VJ1A 1IOLA 1ADCA 4U0KA 2GN8A 4JP3A 3LK7A 3F4BA 1JU9A 5B4VA 2B83A 4PLCA 3GVXA 3KEQA 3LC7O 4PLGA 1P0FA 2J5RA 3GG2A 3K2BA 1P9LA 3IP1A 1LJ8A 4HXYA 3SVTA 2Q1WA 4QO7A 2GN9A 2EJWA 3GA0A 4J16A 2HCTA 2HDHA 3PP8A 1KEPA 1ULSA 3BA1A 3PWKA 4B4OA 1DRVA 3HZZA 1GZ3A 4ZN6A 4CLXA 1EEHA 4KWHA 1B15A 2Y1DA 5G4KA 4LCEA 3WGHA 2AMFA 3TOXA 5KNLA 4GGPA 4NBWA 1E7SA 2JD0A 3QVSA 1EFLA 3PDUA 1ISGA 4J2OA 3ZWXA 1KOLA 5ENDA 1ZEJA 3P2OA 1GQ2A 5CG2A 3FRJA 3Q3CA 3ETEA 3WNVA 5H82A 4RGBA 1MA0A 1YH3A 1N9GA 4RJTA 4YJGB 3QVXA 4ONEA 1FF9A 5A9SB 5L51A 4DQUA 1IZ9A 2DBVO 4OKNA 4A2CA 5T64A 3QW2A 1KC1A 3QY9A 4WLOA 4B7CA 3RKUA 1O95A 3NJ4A 3NT4A 1PSDA 4ZGWA 5KCZA 1IL0A 1CWUA 2AQ8A 1O0SA 3UUWA 2Y1OA 2C2YA 2B5VA 1MP0A 1CERA 1YO6A 4R3WA 4U8GA 5I7SA 1EBUA 5COBA 3A4VA 4E21A 4BNNA 3WXBA 1V35A 5K6AC 4ZICA 3ICPA 4TKLA 3PYMA 4AFNA 5FEUA 4BKPA 2VOJA 3MTGA 4KMSA 1ZJZA 3ROMA 1XDWA 2E4AA 2ZQZA 5KJFA 3BZUA 4NIMA 1Q1NA 3TZHA 3WB9A 1N1EA 3DO5A 3EVTA 4EYEA 4XYEA 4CM3A 3RUAA 3AI1A 4E5PA 4MVJG 4ID9A 3K73O 4DYDA 2JAHA 1EZ4A 2AQKA 2DBQA 3JYNA 4XIJA 1JKJA 1KS9A 5ES3A 2HQ1A 1PJ4A 4D3DA 4BO7A 3JYOA 1LQUA 4MKRA 5DOVA 2I6TA 1U9JA 3IP3A 4GLLA 2FR0A 4D0RA 1E3WB 4PCVA 2X0IA 5JC1A 4AJ2A 4YAGA 4KQWA 5F1KA 1H6CA 1YQDA 4CQMA 3BYZA 1TB4A 1WXDA 4OOFA 2EW2A 3NYWA 4M49A 2WYWA 3KTDA
chains in the Genus database with same CATH superfamily
3WAJA 4A36A 1HF3A 3HADA 1VYUA 2VAMA 4WXHA 1PL6A 2CLIB 3GC6A 4OPMA 4TROA 4DF3A 1UJ6A 1V16A 3TGPA 4DA4A 4WD3A 1V25A 5ITSA 2V7TA 1QG0A 3K9LA 4QUDA 2UYCA 5B7PA 1M8GA 2BLLA 1H5UA 1XHFA 4L8YA 1J2RA 4RLSA 2ZVQX 1DWQA 1QCDA 2EG9A 3AYXB 1JR3A 2JLQA 1SZCA 2YHBA 4ND5A 5DN6A 1OLXA 2ZJ8A 3I34X 4KV7A 2D1SA 2GBCA 2OFXA 1CTQA 5HCNA 4WCVA 5FULA 1FZTA 2JK0A 1WQ4A 2P3SA 1Z6TA 2GEJA 4B3DA 4AJ4A 3B1KA 4CM9D 5LOVA 1POXA 4AJNA 2C7PA 1T34A 1Q20A 4O5OA 4ZEWA 2C4UA 4FFPA 2IUYA 2C94A 2GM9A 1NSTA 3NIGB 4EZBA 3CNHA 1ZBQA 3EEQA 4M1SA 4XGRA 4DTIA 4IIJB 3H7AA 5EIFA 5JV5A 4IVNA 4B4WA 5BMVF 1KK2A 2ZB4A 4JIGA 3CX7A 4W82A 4EA6A 4R0NA 4UEJA 2VZ0A 1T43A 2V55B 1PBNA 4F9TA 1G41A 4RVSA 4DEXA 5A3RA 4A2QA 3GFBA 4DEVA 2HM7A 3MINA 4H6PA 5D6OA 1UZNA 1JAHA 1JPJA 3PR2B 1XPUA 3NHJA 1RHJA 2GILA 3ZHSA 4BS9A 1E7MA 1U5CA 1XZEA 2DHRA 2PKXA 2ZE5A 4HNAA 3FYCA 3AW8A 3LDFA 1QKKA 1TUBA 1P5HA 1DKRA 2Q99A 3JVEA 4PZEA 4P35A 4BQOA 1TRHA 2DZDA 4IV0A 1RAFA 2PPLA 5K0BA 2FQWA 5M04A 4MYUA 1NIJA 3E7DA 4MGZR 5CW1A 3F74A 5GONB 1Y4AE 3DD5A 3L0ZA 4MS3A 2BEWA 3FPLA 3EH2A 4OP3A 1DXYA 1GXSB 4JYAB 4U7HA 1GRNA 3F8WA 3PGKA 4LY9A 1G3MA 1KJYA 2NSLA 4UPEA 1D2MA 2JANA 2VHVA 1XUOA 3NNDA 5TGZA 1P2DA 2EP8A 3TRHA 4AY3A 3OEHD 4ER6A 3HDYA 4HYYA 5IN4A 3UHPA 3WE7A 4DLLA 1LPPA 4FN4A 4IMRA 2VDWA 1NAHA 2QRHA 1Y80A 1YHNA 3KSUA 5DGCA 5SV2A 1YC2A 3AHFA 3VYVA 4ASUA 1GOTA 1WCIB 3MYYA 1SZPA 3ESYA 3MGAA 4Q4HB 4Y2QA 4D57A 1H2WA 1WTCA 2PRJA 3TRIA 4DV2B 1N92A 4YP6A 1MAUA 1RJDA 2V6JA 1B42A 3MILA 4FQ8A 1DLJA 5CAEA 2IHNA 4MVCA 4N7MA 4L85A 3DGFC 4AG3A 2PCJA 3PTZA 1E69A 2WWFA 2Z9BA 2PXXA 2ZBRA 1O6CA 2Y0CA 3M6MD 4JR0A 4ZT7A 3RRJA 4M86A 3T1HB 1SWVA 3PDJA 3D4NA 2WIJA 1JIXA 3IUJA 2JI9A 3TTWA 4D4IA 4H7FA 1TYAE 1US8A 1E3JA 1GNSA 4JVMA 3IQWA 5KWVA 2GM4A 4HDOB 4HQRA 2ZFUA 4BKOA 3I73A 1SUWA 1P77A 2BEJA 1QBKC 3C3CA 1P2VA 1O58A 3V3TA 2XITA 2QM7A 5MN4A 2YYAA 3GJ5A 2WIKA 4EHHA 2V9CA 4ARUA 2X2EA 3ONFA 1USVA 3BSSA 4NF2A 1E9BA 2FW1A 2GTHA 2OE2A 4LV5B 4YCDA 5EP4A 5E7QA 3FSRA 4IJVA 4DBLC 5KZMB 1F48A 2JA2A 1CRQA 4HQLA 1M5UA 2HJHA 1IBSA 1VHWA 2BGNA 2NU7B 4MI6A 5CHYA 1TT5A 4HGRA 3T3DA 4F3CA 5AW6A 4IY1A 4BB9A 1IZZA 1U8EA 2C5SA 3BD8A 3M5PA 1JHVA 1Y3AA 2OZVA 4B7UA 1KI1A 2EJUA 3AM3A 3BG5A 4DR4B 3MTEA 2ZYGA 2XGJA 4Q6WA 1W36B 1RR6A 2XVZA 1TK9A 3NOXA 2ONCA 2ICAA 1JWBB 3IQZA 5EPEA 1V95A 3MT7A 5HBGA 3L0PA 4NFLA 4EH1A 4HVCA 4MROA 2OORA 1VIAA 3GEBA 1U2GA 3MWEA 1OZFA 4MULA 4MA0A 3GMSA 3JYPA 5LZ4A 1EPUA 1JFLA 1MIOB 3DBRB 3PHHA 1DRJA 3DTYA 3ETLA 3BK7A 4XEHA 5FJIA 2O8CB 1R0KA 1D0IA 2GOYA 4GKJB 1PNRA 1QTNA 5DTIA 3I83A 2AFHA 2C77A 5DMXA 1HE2A 4R3UC 1XDGA 2OCPA 2WJJA 1YMVA 1J5PA 1VPDA 1E4YA 5EKSA 5HZMA 4XQCA 3H6KA 4HLUA 4PWYA 1G55A 4OBEA 4X1KB 3BQNB 3U4HA 1DDGA 3B6ZA 3L79A 2LBPA 1JA1A 3PDIB 2YRFA 4M1YA 4P3OA 4RKWA 2GAAA 1ZGGA 3W3AA 4L51A 3MAAC 1A77A 5CDYA 4OHFA 4CT0A 4NDZA 1J9EA 4ME6A 4IDCA 3LQRA 1EX6A 2VPXA 2X8JB 3HFGA 4WY5A 4C4AA 4AZTA 2G5TA 1NMZA 1NYTA 1EIZA 4M6WA 4ZOCA 1CYEA 2G1KA 2NYUA 5JJLA 2V6BA 3MLBA 3L4BA 1M0WA 1LRLA 4Q7QA 1PZGA 1GADO 1DMRA 1SVSA 1KFJB 3I3SR 3LIIA 4F2DA 4OHRA 2YS7A 4OAPA 5C8DA 3EBPA 3IV6A 4NYMR 4TT8A 1ZUD1 3AWDA 3HY4A 1ZBDA 3BB3A 3U3MA 2YXDA 3IMKA 2Z0MA 4JLPA 3GVCA 2GZ3A 2WPDA 3CNNA 2CYCA 1OHHA 2HN9A 4IIXA 3UATA 3B9QA 3VR4H 5SY9A 3HJUA 1NQUA 1AN9A 1ZNZA 3W5JA 4GLFA 1V7CA 2IIPA 3ABRB 4EAAA 3AH8A 3RE1A 3GRZA 5ALIA 4B8WA 5I7FA 2Q7XA 4WERA 4RCVA 5CJJA 2ODWA 1UL1X 3TRFA 4ZYXA 1T1RA 3OT5A 1WZNA 2IP4A 3ZQJA 2XMZA 4YMWA 3U44B 3BPSA 4GYYA 1ZJ5A 4PGMA 4BO3A 4OHKA 3W8RA 2A9KA 5J9FA 3G0CA 2VCYA 4M9RA 1CQIA 1D5WA 4G86A 2FUG6 3Q15C 1VMKA 2BP7A 9LDBA 4Q1CA 3QBVA 5AOVA 1JGTA 3HV0A 2ZUDA 3ZI0A 4IUDS 1MAHA 3PIIA 2FLKA 4HDNA 4UE3S 1TXGA 1UAYA 5C7OO 4WNAB 1XG5A 3P2YA 4MYHA 2P11A 2JCXA 5KQPA 1ZVJA 4F72A 2X4LA 3EXAA 1NE2A 2PFSA 4C6HA 3O3MB 1ZDMA 4C89A 2NYAA 2IEDA 5BT9A 4OI1A 4E2XA 3OLCX 3G23A 5FI1B 4LY6A 2R84A 3LCRA 2VTVA 4LXUA 1TF2A 3GOQA 1Z75A 3UXYA 3MT8A 3OU2A 1RCTE 4NK5A 4XR4A 3NDIA 4EY6A 2VJMA 5FWYA 3FNRA 1E3TA 1N7JA 5A06A 3FRIA 4GD3Q 5DTJA 3T4PA 2BMJA 3DTVD 1CE8A 3PRHA 3BREA 1YNOA 4M1KA 4WOJA 1O95D 3TYXA 1FK8A 1NVTA 2ESRA 3PUYA 4J0CA 3K70B 1ISPA 2JFNA 2JPDA 2YXPX 4UEKA 1E5LA 4Z3OA 5KJEA 4E08A 4QAJA 3QFCA 3IEPA 2XYVA 3IALA 4NNPA 1NU6A 3DEJA 3NC0C 2NZ8A 4YRMA 2I65A 3IR5A 1JT2A 5FWAA 1QF6A 1QHNA 3E18A 4ZC1A 1RM4A 2MR6A 5KSPA 3BRSA 5TF0A 1GKIA 1OKKD 2OSVA 4URFA 4XM0A 3I3OA 1VGRA 1DBPA 2OC4A 2OTCA 3NYRA 1E9VA 3AFIA 3MGKA 4LTMA 4R0MA 1NG9A 1L6IA 3CWQA 2AKEA 4K8OA 1V8FA 3NKFA 3TG2A 2BTQA 3I2HA 2ZUVA 4NCXA 1X80B 2W8BB 2X5XA 3OBBA 5J5VA 3TSWA 2JFQA 2G5PA 1CVIA 2DH6A 3HVHA 4OMCA 3F6EX 4Y2UA 2C1XA 4DXHA 1EUDA 1Q91A 1I6KA 2JDID 3FZYA 1S89A 3C5HA 5KOHB 5IKMA 3M4ZA 2HRZA 4Y1RB 5EXTA 1QYVA 4INZA 5KJ1A 4MWEA 5F2EA 3TQRA 4XCQA 1DEKA 2QTVA 3VNUA 1LPSA 3I6YA 1QPBA 1UJNA 4UQPA 1FP4B 3ORQA 3PRJA 4LQ4A 2Q1YA 4GP7A 2VTBA 2GK6A 4IPTA 1YVEI 1V6SA 5GQSA 4NZMA 4RE5A 5BSGA 3S2ZA 4V0RA 5AHRA 1UADA 3C8HA 4IIHA 4L9WA 1Z38A 3OPVA 3TFWA 1VHQA 2JA1A 5IPFA 2YV2A 4HPXB 3ZGLA 4EYGA 3B85A 1T36A 3BQMB 4LOLA 2Q3JA 3CFYA 5DBOA 1BDMA 4CKXA 4Z9BA 4OYHA 3A1TA 4Q5IA 3M6AA 2PH7A 3B9RA 2QV0A 1R0YA 2V8OA 3PA6A 1V3QE 2ZUEA 1IATA 1Z07A 2YXEA 3V5NA 4X93A 1IIBA 2I6XA 1ZWKA 4NMHA 1IMJA 1XI2A 1MX1A 2GEFA 1T5SA 1OW3B 3TUIC 2G9VA 3JQCA 2DQSA 5A3JA 2HQRA 2P7IA 1I33A 2EWMA 2D2XA 3OJOA 2PWPA 4E09A 2HJRA 3R7LA 2BFEA 2YCBA 4J0DA 2JC3A 4KU4A 4G4JA 3CQ9A 1XF9A 1YZYA 2IZ1A 3HLTA 3IAM1 3LL4A 5IBQA 5FUBA 4B3IA 5LBIA 4CZ2A 4CQNA 2W2LA 4OLJA 4KUGA 5IDVA 4JR1A 2ZCVA 3BSWA 5I9TA 3EYWA 3GRVA 2YXBA 1VA4A 3RU2A 3BWVA 4OHBA 4WN9B 2VI5A 1SXHA 2GYYA 2I6UA 2PUFA 4YH1A 1GTL1 5CA0A 1JB9A 1QOPB 3D0KA 4RK1A 2Y67A 5F35A 5KTRA 1LTKA 3GBPA 4I5EA 1CQXA 3WYGA 1SXQA 3UCFA 1VJCA 3CWCA 2AG0A 4WK0B 4TXJA 4O4HB 3NVKI 5DSTA 1E3DA 1CLUA 1WP9A 3I37X 1OXBB 3WDMA 4TYMA 1WETA 2PT6A 4E2ZA 2WKPA 1ORTA 3GN1A 1UEIA 2C5LA 3DOIA 3B6EA 1DI0A 3T0IA 1E6CA 1ODJA 1OYOA 5E4TA 521PA 5J23A 4CKBA 2FPMA 1W0JA 4UE6A 1HT2E 1C0IA 3SN6A 3CT4A 5HX7A 2CLKB 1SUFA 2W2XA 4DR2B 2C9MA 4PPYA 2IEBA 1Y6RA 1RJFA 3NT2A 4FUQA 5FFMA 4OGFA 1Q0TA 1F2UA 1R6UA 4O4JA 4TUYB 2YOFA 2H54A 2XWJI 4X7BA 3L92A 1EFRA 3KXLA 2VZ9A 4M1QA 4TWAA 5AVJA 2BDTA 3PD7A 2EZTA 5BV8A 5HKKA 4GC5A 1O3YA 1MG5A 2O7QA 2W2VA 3ILHA 3O2SB 5LWHA 2IA5A 3IJ5A 1Z2DA 3QYFA 4HX5A 2FFQA 1CD5A 4W5WA 1ZIOA 3WYDA 2FFHA 5CA1A 3FY4A 2RHMA 2YWRA 4OQPA 5I7RA 3DWEX 2PL5A 1XSEA 1NJGA 3NEJA 2OM6A 1FW8A 1S4QA 3EPLA 1DEAA 1R0CA 2IZOA 2QZJA 3R7AA 3S3TA 4MVJD 1OJLA 3ENZA 5AM3A 2VUIB 5EHQA 1O94A 3I39X 1ISFA 1VECA 2JJMA 2E18A 1KZYC 3B13B 4B7XA 1IVSA 2V6IA 2XF2A 3M7IA 1FFYA 2DH5A 3N0VA 3IHTA 1YB6A 3FOWA 1CHDA 5KDLA 3THWB 4L6CA 3OQNA 1T8UA 1SC1A 4B81A 5BRNA 4AJ9A 1A7AA 2DCMA 2O3UA 3EEBA 2RGBA 4MUYA 4OK3A 2A3NA 5DP1A 2VK1A 1YA6A 4QDTA 3V80A 2AYZA 2P0EA 3HACA 4YBRA 2ZBPA 1EP9A 1R4ZA 4S0ZA 2OZLB 1RKQA 5A1JA 1OH5A 1NDQA 3OWHA 3EC7A 5IH7A 4AD8A 1VGQA 2BKUA 3ENWA 3FWYA 1T9CA 3RYFB 5FUMA 1ACLA 3K6SB 4XUDA 1B14A 5KX5F 2QRGA 2OGWA 3IQIX 1Z7BA 1M2FA 4URZR 4BZWA 1P61B 2BGRA 1KQNA 3VPSA 3VBEA 3HU1A 2YWFA 3WLRA 2I99A 2IPAB 1CP3A 1L4KA 3HB9A 1E2GA 1ICIA 2Q4EA 1CRLA 4I1PA 2AEJA 4KC0A 2XB6A 1T9GR 3GEGA 1R64A 1H2BA 3SIWA 1XWWA 4GXRA 1A1VA 1GUFA 5L3RA 4OMUA 1COWA 3JAWB 2JVIA 4RDCA 4OLFA 3HM2A 4ALJA 3EW7A 3ZWBA 2O6LA 5DEOA 1N2GA 4D0LB 2EW1A 1WY5A 4R2HA 1GQQA 2L42A 3I5XA 3I0MA 1UAGA 4MK4A 4PZLA 2ID7A 2PV7A 4D02A 1O1YA 5KTSA 1JHAA 2W58A 4ALIA 1E2NA 3B7WA 3AY7A 5IJXA 3L7JA 5CYPA 5HUHA 2YZKA 1EX9A 1D2AA 2XNDD 3HKEB 3WS7A 3HU3A 1M1YA 2QP3A 3BCUA 2PM8A 1OOEA 2B6NA 1CJCA 3DZCA 4W9NC 1WU7A 1DG3A 2X7HA 4N0QA 1M8JA 2RD2A 2Q07A 4Y0VA 4EJSC 3C43A 3GG9A 4C4ZA 2P1RA 3EAFA 4C4OA 5JAIA 3QPUA 4BXOA 3KL4A 5I4BA 4NAHA 3T5GA 4NRDA 4YMGA 4X71A 4TLMB 3JRNA 2VAXA 1KSFX 2IGTA 2XUFA 1EBFA 1I1OA 4C6TA 3L6RA 1T8TA 1S02A 2ZBDA 3N6RA 4IRUB 2WAMA 3MJHA 3PXUA 3EC1A 3AVOA 3SHTA 5CFZA 5K0SA 2DERA 3HUFA 3CLVA 1DBIA 5BN5B 3VPFA 4PSAA 3WOVA 2ZW9A 2OP0A 1ESEA 1Q0PA 2X3UA 4J4TA 3JWGA 1H1LB 3GJQA 4ZI7B 1L7AA 2I8LA 3EZ2A 4V1CA 4KH1A 4OQFA 3GAFA 4KXYA 3KPJA 1ZNWA 4OXKA 4NE7A 2C97A 10MHA 1CXZA 1ZISA 3LHFA 3MTJA 2XSZA 4LJ9A 2FQYA 3HCCA 3C3AA 1ZICA 1P9OA 4RCZA 1H5NA 3QIVA 5CTAA 4EHIA 3DP7A 4KR7A 5DYWA 3T52A 4XYGA 1ZQ1A 2R6DA 1JNYA 3NAZA 3NRBA 4IZIA 3NTRA 3CJRA 4ZGGA 1YR9A 3HS3A 3TKLA 3D3KA 1Z7GA 4AIRA 1GPMA 1N2CB 2NZ2A 1WPGA 5KWJA 5J40A 4NATA 4BBAA 2OY0A 3O1LA 4MR7A 4LQDA 3L6BA 2AEMA 1CZHA 3OCWA 2IZ0A 1ZC3A 3JX9A 1UWKA 1JFRA 3ZN2A 5B64A 2NW6A 1RM5A 3IDAA 4HH0A 2VS1A 3E05A 2DLDA 4Y6SA 1XXHE 3V2GA 4DSUA 2WVJA 5G3ZA 1QYWA 4DC9A 1X1QA 5J1TB 3PX7A 4PFSA 4TTTS 1EVJA 2HK6A 4GWKA 5AVZA 4G3XA 1TZKA 1QVZA 3FM9A 1SBZA 4KR2A 2GHQA 1NG1A 3KKEA 2H1HA 4EB0A 1GPDG 1K6EA 2VTDA 2WSBA 2DB3A 3CVYA 4TVBA 1JVBA 4N5DA 1HE8B 2PRIA 1VBKA 1BE1A 2BGIA 2P5YA 3O83A 1NUTA 2W4QA 3K05A 1Z5PA 3NWOA 3NVAA 5EQTA 5DTMA 1XCPA 3TB6A 5A0TA 1Z25A 5GWXA 3ZWDA 5FO1A 2D5LA 2F9FA 4I55A 4ILEA 4XWWA 3EGXB 5DVZA 3N2ZB 1NNEA 3IDQA 4R1NA 3DBHA 1CZLA 1RYDA 3FTNA 1GNVA 3OJFA 3NW9A 1TU0A 2C2ZA 4QLBA 1XZCA 2IUUA 1PT5A 4B6GA 1OLOA 4P7BA 2AJCA 3IAS6 4RSRA 1RP7A 5HHTA 2FMHA 1ZVQA 2JZOA 3WYAA 3E70C 2ZTSA 5E0OA 4AY5A 4E4YA 1T9DA 3OWOA 5GADl 4Z4QA 3ADBA 4J2HA 1JS1X 5AVTA 5M2QA 3E27A 3QPDA 2NACA 5F7XA 2WQZA 2ZWVA 4LXHA 4ZQCB 3MC1A 3GLFE 4EMUA 4UM9D 3P2MA 4EDHA 2QGNA 2G9UA 5IUJC 2I2WA 4X6YA 4I46A 1PYDA 2F8MA 2GUWA 3FVTA 5AKKA 7MHTA 3TTTA 3I8SA 1TU3A 1U04A 1DFHA 2O3RA 3D4BA 2FA9A 3H1FA 3VX4A 1I0LA 1XAIA 4ZCTA 1E92A 1ZRMA 2O5VA 5DK6A 5D3MA 2YMMA 1E2FA 4KODA 2BFDB 4WMLA 1ZJWA 2G4VA 1RYMA 1KBOA 5CX1A 5T8KA 3B6JA 3O73A 1F3LA 1EWVA 1OLUA 1QZTA 2F48A 4O1MA 5C3UA 3IR7A 5E7JA 4B40A 4MWGA 3B78A 3ICWA 4QPDA 5LSAA 4HDQB 4DV4B 1E9EA 1OXMA 1UODA 3DLIA 4OB7A 5F76A 5FBVB 2HQOA 5I48A 1EXNA 2V45A 2FZVA 3WIOA 5F1YA 2QL6A 3MJCA 3HCOA 3Q2KA 1L3IA 4JZKA 4MB2A 4TKMA 4XIIA 3RRNA 1Q5PA 1FP7A 1Q7GA 3THSA 1GCOA 1GT6A 4A6XA 3ZVRA 4ZHSA 2F3TA 3ANMA 4AJPA 3LKBA 5LMUB 4ZCRA 5EXXA 2UZ1B 3FDZA 3CKKA 4I3FA 3SE0A 5FX2A 5F78A 4LWQA 2QTNA 2A84A 2LW7A 3SLKA 4G25A 1E9FA 1HLPA 4Q05A 5FBKA 3L8HA 1NW4A 4KNYA 1CF2O 5K3SA 4TKUA 2C4TA 2GLUA 5A62A 1KP2A 1XRSB 2OO3A 2QLNA 2FVYA 5TJ9A 3MUFA 4C78A 4ZDIA 3QIAA 1LLUA 3W5HA 1D1PA 4IWNA 5IBCA 4QDOA 3W7VA 1T9AA 4MW2A 3HU5A 4EX7A 4GBED 4BWGA 3O8RA 4A8JA 2AR7A 5EWJA 2ADFA 1NF9A 2I2FA 1QGAA 4Q1FA 4NBNA 3ND6A 1K4YA 5AW2A 3ABSB 3VVCA 1B26A 1GEGA 3IOYA 4E5KA 1SEVA 3W5UA 4JCCA 2P91A 3D7RA 3PQ8A 5FUVA 4M1ZA 4EB6A 3RYCA 1P8AA 4ZTZB 2X8LA 4AMUA 3MF4A 3K0FB 4R4JA 1K5HA 5CU7A 4B45A 1P33A 3BRQA 1E0AA 3AOEA 4CQLA 1GVNB 2NP7A 5JJIA 3IIJA 2HZ7A 4D43A 2QRZA 4L6AA 4KXVA 1UK8A 4QUIA 4W1SA 3K6RA 1K86A 1RMYA 3SJZA 1WM1A 2QW8A 9ABPA 3R0XA 4ZQBA 4Z4EA 1N9GB 1TA4A 3BMOB 1G7RA 1OWMA 2F2TA 2QMQA 4EJ0A 5LJIA 2FEAA 2G28A 2RARA 4EK9A 3HBLA 3PITA 5ITVA 1CUCA 5IABA 1CUZA 5DT9A 3LTEA 4Y2GA 3KOMA 4UTZA 4ZPXA 1MO6A 3OQ1A 4PPNA 1JEJA 1R3DA 1VOTA 4WJKB 1IBKB 3HV2A 5AP9A 5HP4A 1C3JA 3X1XA 5KPJA 1WXEA 3U48A 1BKDR 2B6HA 1GG9A 1VL6A 1G21B 3DWGA 3A1VA 3ODGA 1XKLA 2VDLB 5ALDA 2BM8A 1P6QA 3CNOA 1NYRA 2DULA 2VKQA 3BFXA 2OO5A 2VRWA 3FYTA 5CA1F 5F23A 2AUNA 1V5GA 4J7AA 4BBPA 4EL0A 4QARA 2WIAA 5DB4A 4AKEA 1NFFA 1Z5WA 2QTFA 4BRZA 5KTNA 4Y67A 3Q87B 3P20A 1B2LA 3JAKB 2C7QA 4BN0A 1SOUA 2Q1SA 3VR0A 4PHCA 4K9LA 4MPRA 4L95C 3D81A 4HVAA 4O1HA 3SQLA 2YDYA 5K0LA 1M7GA 1QO0D 1XMOB 3CE6A 5D5QA 2NYRA 1DIAA 1Q1AA 3D4OA 3IUMA 2HLDA 3ZZNA 4M7PA 2P35A 4TKZA 5HIKA 4KIGA 4XSGA 1M6WA 2KHZA 3CEMA 1BCSA 3VSBA 5AJXA 3RC7A 2EXXA 2EWVA 3EN0A 4DJFC 2CHUA 3RNOA 5IM4F 3NATA 2XQJA 2OECA 2DUMA 4EJFA 3C2QA 1JE1A 1I3NA 2YZNA 5TDHA 4LRYA 2CXSA 1LW7A 1SOMA 2BFAA 3Q7SA 1XEWY 4IIDA 3K4PA 4J6EA 4AF6A 4BMYA 2B2CA 2YHAA 3QE4A 4BCCA 5I7WA 3ABZA 4BN5A 1JU4A 1JEQB 5G1PA 1IG0A 1BS9A 2HCJB 1G8KA 3RNLA 4PXAA 4GOMD 1AM4D 4C01A 3BIWA 3RSZA 1IB6A 1G63A 1MN6A 3I2GA 1QJ4A 1MRZA 4PZCA 5L3QA 3ZZ1A 5CCXA 5AW0A 4MOWA 1OASA 2H1IA 2RONA 4N39A 4RELA 4B34A 5I01A 2VQFB 1RW4A 2VBIA 5C80A 2RAPA 2HMAA 5IAJA 4XTCS 3H42B 2VZEA 1Y3HA 1T9BA 2HJVA 4G5XA 5EWLA 5EMJA 3UJNA 4C0QC 1TMGE 4YLEA 1CETA 2XT0A 1FJHA 4BN4A 2FTKE 3RO7A 4W6QA 2E2WA 5AKLA 3P26A 2OYRA 1H3NA 3PFWO 2HSWA 1PP4A 3B1FA 3CNEA 3MVEA 2YVQA 2EBFX 1QH8B 3KSZO 1J0EA 2C9ZA 4HI0E 3TR0A 3UKDA 4GI7A 3DW3X 3WHIA 3FD8A 4EIWA 1A5TA 2JGAA 3HU2A 4QFMA 4K0KB 3JQ7A 2W43A 1D3AA 2IXTA 3DYBA 4MRPA 5K1ZA 5K4GA 2RAVA 2UVPB 4IHAA 5K0CA 4RTKA 2C1ZA 1C9KA 5SICE 2HRRA 3EGCA 4MPTA 1UDBA 4X60A 4J6FA 4YJ3B 1YULA 2YFHA 3K0AB 3T3MB 3T0FA 4GKKB 1OBOA 2C07A 3SYNA 4OI0A 4RU1A 2VHZA 2C3UA 4LZPA 3U9SA 4YJDA 3PG5A 4DL9A 4IHJF 2FRVA 3RSCA 1DOHA 4GBGA 4N5NA 3O3OB 4GPTA 1H6DA 5CITA 5KNDH 1ZL0A 1U8ZA 1U2SA 3FKSD 1OI2A 1KS2A 3HB5X 3WGMA 1Z6XA 1AS0A 1Z22A 1GU1A 2XRMA 1VE6A 3ACCA 4DQVA 3OE4A 5J4KA 1ZOIA 3LHIA 1DAMA 4LIPD 5AHWA 4FE7A 4YRLA 1XMXA 5FKJA 3OG9A 4PQRA 3ZE2B 3A7EA 5C52B 1L4HA 2ZRGA 2Q3HA 1JQKA 4QSMA 4EPVA 3TPZA 1NA5A 4TRJA 3BS4A 2Q6IA 4KGZA 1PFWA 5F77A 4DNXA 1PFYA 1W9MA 5I8PA 3E9MA 2FHPA 2P30A 2PMBA 3BN3A 3FH0A 3GLIE 4GL2A 1IU9A 1KQOA 5EKDA 2PXHA 1G8MA 1I6WA 1RI2A 5G3YA 4C9BA 1R16A 2PK3A 3QU4A 5E9AA 3UUEA 1HC7A 5F64A 3G8AA 5EPOA 1VKHA 2ZYSA 3S5JA 4HAUA 2I2BA 4NU5A 1T2AA 1RLMA 3CZRA 1DBSA 1PJCA 3K15A 5FOVA 3WJ1A 3F0TA 13PKA 3H2YA 2XOKD 4MGHA 4UZFA 3B52X 3I9NA 3IE1A 1E79A 4LTDA 2BGKA 4A82A 5JRZA 3UJBA 4I4LA 4EF4A 4Y2VA 2VK8A 3UNXA 1RE1A 2REQB 3ZH9B 2AJLI 2OV1A 1X19A 4EM6A 2D1QA 2H00A 3LH5A 4ZMSA 1UJMA 4UEWA 9LDTA 3NBXX 2BT4A 2GASA 5FTKA 3HG7A 4YMIA 5L6MB 2ZVPX 1V1MA 2GN4A 1DCKA 1JW9B 3MUEA 2LKDA 3EULA 3ILXA 4KQJA 4WDQA 3IKTA 3QBEA 1II9A 5LUBA 3RTCA 2G0NA 1QRTA 1P8JA 2HUNA 4MICA 2J6IA 5KQMA 4NKRA 2D0DA 4EPRA 1FIUA 3MWJA 4LJ6A 4ZA2A 1J07A 4OJKA 1DC4A 4TV9A 4B3BA 2I6SA 1F4VA 1WZEA 1GAQA 3DKKA 3AEKB 1PG2A 4FEEA 4R2IA 4S2UA 1M9NA 1MX9A 2IBTA 4N54A 2I3BA 1EXMA 3BE4A 4I36A 3BTUA 1O08A 1DUVG 3VU9A 3ZWVA 4TZTA 2IVZA 3WL6A 2DFDA 3AJ8A 5IG2A 1I2BA 1ZRHA 6Q21A 2WYVA 1TQDA 4I55F 1F8XA 2IXGA 3HP1A 5FTNA 4BQIA 5JYEA 3VSAA 2MINA 3DVAB 3I4CA 3F3KA 2Q5QA 4KGDA 4Q18A 5BWOA 2H7YA 1I1QB 4OH7A 5LPNA 3AHGA 1IDOA 3K5PA 3OF3A 2GNOA 1HYEA 4Y1EA 5TPZA 3QY0A 1FNNA 1XO1A 1UKVY 1DAIA 3PKZA 2G8LA 3KBBA 4PG6A 4MV1A 4R8RA 3LYHA 4TZ6A 4HGYA 1ZH0A 1JTEA 2Q3BA 4LE0A 3RWBA 2F9MA 4B83A 4D8VA 5K5EA 4OV6B 4DR3B 4LYYA 2WWGA 3GAMA 1L4NA 3DR5A 3ZVLA 1TF5A 2GESA 5TR9A 4HGQA 4D2IA 2QUIA 4JAVC 1OFUA 4H60A 3NP9A 4COKA 2XCOA 1A7UA 1SIWA 2RAFA 2QEQA 3AINA 3HE3A 3O8OB 3UHJA 5IFLA 4UFOA 2OZPA 2R6CA 2QPTA 1I7NA 4MGEA 4RLHA 2A4MA 1OTYA 2HGSA 2QT9A 1H66A 2ACVA 3PRKE 4WLVA 2E5LB 3H8SA 5ECGC 3DHNA 1FSZA 3I1JA 2SKCA 2D3WA 2WSYB 1UXKA 4LOKA 3C41J 4MKXA 3KPUA 1ESCA 1KAGA 3H9JA 4ENTA 3MUNA 2QYSA 3LECA 3TKAA 4C0JA 3SM3A 5ERXA 1PHRA 1ZQ9A 4UMEA 3RSGA 3H4TA 3JQ6A 3BFKA 3LY5A 2H2WA 4N03A 3NHBA 2ODNA 4I4TA 4Q66C 3GQBA 2QN1A 4YQZA 1H65A 2QQGA 4CKCA 3EWAA 3HUUA 2FKNA 3L6CA 4RYDA 1A76A 2YC2C 2QVZX 4PGAA 2P2YA 5TMDA 3S0JA 2KS6A 1SBHA 2CUZA 4NU8X 4C4TA 5FPSA 2GWRA 2WHEA 3IUBA 5KVAA 2VEDA 1FYEA 5TVKA 1QE3A 3ZTWA 3FNHA 1P7YA 3H13A 3VC1A 3R9WA 2H0AA 1XQVA 4IJ5A 2WU3A 2D59A 3C6ZA 3KYCB 3L8MA 4OK5A 2AE2A 3QENA 4R1OA 2BTEA 3K6JA 1W4ZA 1Q84A 3SP1A 3WICA 3G5AA 1W6UA 4FBLA 1IC6A 4BPRA 3TLXA 1N8SA 1K88A 3FCUB 4EHJA 4YCBA 4B4KA 1HT1E 1Z37A 2XNJA 3K5HA 5CH3A 3QEAZ 4YY3B 1MFZA 2YR0A 3O4FA 1Z7YA 3GELA 2VP4A 4MX8A 2B1GA 5EJ7A 3A27A 1W4AA 3OIVA 5BOSA 3PGVA 5DW3A 4QZVA 4DSZA 1PR3A 5AOBA 1VA5A 1IQUA 1QFJA 3FGPA 5ALVA 2J0QA 4B84A 1VKNA 1Z33A 2FP3A 3EMVA 5TPWB 3O5AA 5D6NA 2I4RA 3C1OA 2R8OA 1GTMA 1PJBA 4U7PB 2R1VA 3VR2A 2AN4A 3I2IA 3SXUA 1M7HA 4C4SA 2X9LA 3NM6B 3NWJA 3I5UA 5LLTA 4OGGA 4NYJR 5FHRA 2VPQA 1ID1A 1RJEA 3NGXA 2XGGA 1V7QA 2YVAA 1G64A 3M6IA 2JBAB 4U6QA 2PBZA 1OT3A 3RAEC 4XZ3A 1AHPA 2FQQA 4FZRA 1HY3A 3M6XA 1RWQA 4RPHA 1YR7A 3Q7PA 1XROA 2CZQA 3N1UA 2CY0A 1F7VA 3VU8A 1DFIA 3Q0IA 5IMBA 3OIDA 3RREA 3RS9A 1FDWA 5ECWA 4E6EA 5KNBA 4N5MA 1Y9DA 2NO1A 4HEQA 3DLHA 2V58A 4WFJA 4UUOA 5AKYA 5HKLA 4F91B 3LKZA 3ZWOA 3TXAA 4MEAA 4BYMA 4X3CA 3JCZA 1UINA 1SKAA 1GZ6A 2PH1A 1FQOA 2IW1A 4FZVA 3I05A 3OC0A 1CF4A 4MS4B 1L7DA 2G17A 3MTDA 1OMOA 1U80A 2Y76A 5DDIP 4PSVA 1DKUA 1PTJC 5K0JA 1TQ6A 4JKIA 2A78A 4DFDA 2E4VA 3IE0A 3AUTA 1SKBA 5IKXA 4F38A 4J94A 1OXSC 1V1RB 2DC1A 5AR1A 1U4NA 5EUQB 2X7JA 3SI7A 1KO1A 1DWPA 1KVSA 2AJBA 4AZVA 1OSNA 1DEXA 2AD1A 4L0MA 5G4LA 8OHMA 5JAHA 1TZCA 3ZDRA 1O03A 2C5EA 2J3DA 4ERXA 3K8ZA 2IL1A 3OFJA 2Q6OA 3UK7A 2ZYIA 3DB1A 4KR3A 4ZOLF 2QRVA 1EK2A 1G8AA 2PSHA 2VUHB 1SD5A 5KTMA 5I9NA 3MEQA 4XTRA 3H05A 4OKSA 4IVQA 4E3WA 3F3YA 3NDRA 1I10A 3GDOA 2PEZA 5T7BA 4EPTA 2X9GA 1PF7E 1EDZA 1D4AA 4BIIA 5JSQA 2PEYA 1NVAA 3ON5A 3V8QA 1RC8A 1L7VC 3ZKWA 1NZJA 4J9VA 5BWCA 3W3AH 1USKA 3AF5A 3L3BA 5AKZA 2QW1A 3BAZA 2BOVA 3RUFA 4DARA 3E7WA 1BQ4A 2FKAA 3LWDA 2WIBA 2VYND 4RA6A 1LNZA 1H3FA 5FUWA 3PDHA 1BN6A 1E60A 2HJSA 4UTPA 4GE0A 2C0CA 1CV2A 1UBKS 3EZNA 3GNLA 2G40A 3HABA 821PA 3H3FA 2GBIA 1E2DA 2IEAA 4IDDA 1ZN9A 4FILA 4MNTA 2Z4RA 3U6KA 4K3UA 3RYHA 2E89A 4F84A 1TAGA 1IN6A 3NCTA 4NENB 3CZQA 1O6FA 3OZGA 3RBXA 4GMXA 3G2KA 4X20B 5FNVF 1J2UA 2XYGA 4CV0A 4XX1A 2JZCA 3RTGA 1ZMOA 1OX6A 1XCJA 1CUVA 1NXOA 1M67A 4PICA 4RXUA 4N8EA 4EJSB 2B20A 3UW3A 4YXFA 5L7YA 4RTPA 1ABEA 4JLJA 3I01M 1MU0A 1P1BA 1KJ8A 3LZDA 3MBOA 3UQZA 2CXUA 1JJAA 1MRSA 1W93A 1YS6A 4HH1A 4GR9A 4KR6A 2ZJAA 1DXQA 1J0DA 4XW2A 3H19A 3OOHA 4UUPA 1I14A 3RBZA 2XMRA 2PSJA 2D8AA 1GM5A 1T9ZA 4CIBA 2RC5A 3PE6A 4N7JA 3FCAA 4A0RA 2R8RA 1PTKA 3NFRA 5C9ZA 2L19A 5GPBA 1CUBA 1CDZA 1KA9H 4OATA 4UFPA 1L5QA 3SC2A 1ZUHA 2CV2A 1ECGA 1ESMA 4HWGA 2GNAA 1CB7A 2FX5A 4QU9A 4EECA 3OIGA 4YX9A 3ETDA 2IU6A 2R11A 1RQGA 3DEFA 1K7FB 2GK7A 2AT1A 1QCZA 4J07A 2H4JA 4XX0A 1KEEB 5JNTA 1NBOA 2HWXA 4QUKA 1VC2A 2XTAA 1XN1A 2ZRMA 2Q5OA 4HDMA 3WDKA 5DNAA 1CB0A 4XB6B 3Q8XB 1NT4A 2J08A 3UMRA 1P0QA 3EOAI 3VXKA 1Z2EA 1N8NA 5HZHA 2DFTA 2C7BA 9ATCA 4F6LA 1JWAB 1VCNA 1RWPA 4K46A 4HEHA 5IKEA 1Z2CA 3F6RA 4URHA 4Y7DA 4EA7A 4AKGA 2EP5A 4O2BA 3IMEA 4KX3A 4NP6A 4I2VA 5F52A 2C9BA 5IC5A 1ZZGA 1T8PA 1Z6GA 1X7WB 4I9FA 4KAAA 4YRBA 4WJZA 3GLFA 2K2QB 1SRRA 1QMPA 4X8OA 5EXSA 1WPQA 1AKQA 3HA5A 4GH5A 4JNKA 4YFYA 3ZI4A 2PUDA 2CL6X 2Q8PA 2ASEA 1BD3A 3FOAA 4UKDA 3SZ3A 5JSHA 5KOYA 3RS0A 3LUCA 1YNSA 1BS1A 3PUIA 3W05A 1E18A 4B2IA 1JYFA 2DUUA 3RVNA 4BUCA 3NC4A 5F2OA 4BNVA 5CB4A 3L04A 2Y6UA 4MCAA 5K0ZA 1E3MA 1L1EA 2XXBA 3R20A 1YA4A 4NMXB 3W7AA 1LQTA 4S24A 1L5SA 2BHTA 1O97C 3G2QA 5IVHA 3QUQA 2GYWA 2BELA 4HQOA 3SEZA 1OFTA 1IPHA 2E7ZA 3AF0A 1QAMA 4FD2A 3CW8X 4FFSA 1QV6A 2CD7A 5DHPA 2H9AA 1E9CA 2WWWA 2CZGA 3JQAD 5EC8A 4EHKA 2VTKA 5ALUA 2LZ0A 3D4LA 1TYDE 2ZIFA 1G7CA 2IEYA 3DV2A 4DLRA 4MEBA 4WASA 1ZJYA 5GOTA 4YRCA 2YNMA 1YK0A 1F2TA 3KQSA 1LK7A 1YGYA 2H2FA 4IX1A 3RHFA 3WMWA 1SKYB 2NX2A 4I2NA 4ACAA 4TV9F 2O1EA 3Q9LA 3L6OO 5TS3A 2FPOA 1P17A 3FPSA 1IVNA 1C7RA 2ZWPA 4QYIA 3T7TA 2DBYA 1AZLA 3P0IA 4KN5A 4PFQA 4JSRA 1FQWA 4ZDJA 2R5WA 3TMAA 1RM0A 3KE9A 3QUSA 5BSTA 4BWFB 4ER7A 4NZYA 2EFJA 5E4YA 4DC0A 3THYB 1S8OA 4C0KA 4DABA 3D2BA 4JT4A 3SEFA 1DS6A 3IOCA 3HVJA 1VL1A 1G6OA 1SXJE 3GQVA 2Y1XA 3ROGA 2YFKA 1IRIA 1EESA 3W5SA 2EKLA 2JFWA 3LDUA 4INOA 4Q9NA 4XD2A 3DMFA 5E6SB 5MDHA 4XJTA 1QO9A 2K7ZA 1ORVA 1H9BA 3P9XA 4M9QA 3SDBA 3L7MA 3P32A 2ZVJA 3Q3GE 3VBCA 1XQ9A 2WLTA 3TO5A 2VDVE 3O84A 5ICFA 1X1DA 1L1QA 1VPLA 2ATVA 2AXNA 5KQSA 2D06A 5GONA 4MJ3A 2X2PA 2XDWA 2VA8A 4NHOA 1C8VB 3TJMA 4DT1A 1WDKA 2DR2A 1ZM4A 1GXSA 4Y2RA 5EL0A 3A1SA 1KE1A 3RW9A 2B8TA 5T3UA 3EPJA 3HO8A 3IO5A 1B00A 1WXQA 4MYCA 4NJEB 5IZCA 2PBFA 4DIEA 3LBHA 3IGFA 2B5WA