5ENVA

Yeast alcohol dehydrogenase with bound coenzyme
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
347
structure length
347
Chain Sequence
SIPETQKGVIFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCELGNESNCPHADLSGYTHDGSFQQYATADAVQAAHIPQGTDLAQVAPILCAGITVYKALKSANLMAGHWVAISGAAGGLGSLAVQYAKAMGYRVLGIDGGEGKEELFRSIGGEVFIDFTKEKDIVGAVLKATDGGAHGVINVSVSEAAIEASTRYVRANGTTVLVGMPAGAKCCSDVFNQVVKSISIVGSYVGNRADTREALDFFARGLVKSPIKVVGLSTLPEIYEKMEKGQIVGRYVVDTSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanistic implications from structures of yeast alcohol dehydrogenase complexed with coenzyme and an alcohol.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Oxidoreductase
molecule keywords Alcohol dehydrogenase 1
total genus 110
structure length 347
sequence length 347
chains with identical sequence B
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2015-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5envA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 5envA01
4JCOA 3OJLA 3GLQA 4PCVA 4OO3A 4CPDA 5G4KB 1EUDA 3KEOA 3VPHA 2GCGA 3MTGA 4NNJA 3ST7A 5JC8A 3U4CA 4FQ8A 3OF2A 3WTCA 3TQHA 1J49A 2HK9A 4CV2A 1MA0A 5TRTA 4FD3A 5COAA 4J4BA 3WQSB 1EE9A 4ZN6A 3HFGA 1EE2A 1BDBA 1LDNA 4ZA2A 3RU7A 2WJPA 3JYNA 4PGFA 5I8ZA 1BHSA 5KKCA 4D44A 1ZK3A 3LC7O 3PJEA 5ER6A 3NTRA 2G5CA 3IP3A 3VTFA 1GAEO 2OZPA 4E30A 1YH3A 4FC6A 1HXHA 3OHSX 4PZEA 1K6XA 1JVSA 1HDRA 4CV1A 1YE3A 3M6IA 4YQYA 1JAXA 1K89A 3TFOA 4CUJA 5F21A 1K5HA 4YAIA 2PD3A 3NKLA 1GY8A 3K96A 4CLOB 1AGNA 2DM6A 4RZIA 5BR7A 1GPDG 4UEOA 3H6KA 3ZU2A 1YONA 3DWFA 4CM1A 3ITDA 2X9NA 4ZICA 2PFGA 4NK5A 4OYRA 5IZCC 1EVJA 4GX1A 2QRKA 1JLLA 5JCJD 2O3JA 5DBIA 4PZCA 4RF2A 2DPGA 2WE8A 1YQXA 1TI7A 1FK8A 4BKUA 3B20A 2YY7A 4ND5A 5HWSA 1PWXA 2D8AA 3HB5X 4AJOA 4GKBA 4LVUA 2CDAA 4Q3EA 1ZJZA 1Y81A 2GNAA 3NJ4A 3KEQA 2ZTVA 4G5HA 2X9VA 3TDKA 1ZVMA 5AXAA 1KBZA 1YVEI 5F1KA 2PTGA 4L4SA 4Y6RA 3NRCA 4PG8A 4J2OA 5ILGA 4BHTA 5L51A 1I0ZA 1YB5A 1Q2XA 3P2YA 2X0NA 1NTOA 3I9KA 2JCYA 3UH1A 4AJNA 1BXZA 2D3TA 4MVJM 3WGTA 1U3UA 4J1QA 1IOLA 4Z9XA 1L1FA 3TPCA 3E5MA 5KTKA 1UP4A 3GNQA 2PGDA 2I65A 3O38A 2EJWA 3L6EA 2I9PA 2X86A 2ZATA 2BHLA 2UV8A 1U1IA 3VPGA 2OXIA 2XXBA 4ZGWA 2IEBA 1JAYA 5EQFA 4YXFA 2R00A 3ENKA 3PFFA 3BZUA 1U8FO 4W4TA 1CYDA 1KYQA 4CMJA 3D4PA 1BXGB 1YS4A 4RGBA 4YACA 3U3XA 1E5QA 1R15A 4IDBA 4CM4B 4E32A 4PLFA 4J1SA 3HE3A 4K6FA 1QYWA 3LT1A 1GQ2A 3JYOA 3QHAA 4B3IA 5CDTA 3AUUA 1I3MA 3SX2A 4TVOA 3FPCA 4I8XA 4Y6SA 3BMOA 3O8QA 2AXQA 1Y1PA 5I7FA 1PU2A 2AEFA 4TWRA 3ZGYA 5EPOA 2IODA 3TN7A 3IUSA 1ISJA 5F1PA 2NV6A 3FCOA 3GR6A 3RUAA 4AJ4A 3WYBA 1SEPA 1KERA 1JTVA 1B15A 2AHRA 2PK3A 1E0DA 2P2SA 4L74A 4PLVA 1NP3A 3PP8A 4U7WA 4J43A 2PH5A 1B7GO 4OJNA 4WASA 1PQUA 2YQ4A 3GH3A 1V9LA 3C1OA 2I76A 1FF9A 1YDWA 3A14A 1P0CA 1I24A 3KSDO 1RKXA 3D4OA 3EZYA 1E3EA 5FEUA 1E1NA 1A27A 4OSPA 1W8DA 4MVJF 1EZ4A 2JD2A 1ADCA 1I2CA 1NYTA 3WFJA 4FFRA 3D5TA 3NT4A 1X13A 2Q4EA 3VTZA 4A2CA 4E2ZA 3NJ8A 4LMPA 2OP1A 2ZYDA 4CMEC 2ZYAA 4E5YA 3HHPA 4EUHA 2DUWA 4CMIB 1GZ3A 2YV3A 1PJCA 1HRDA 4GSKA 4W7HA 4BB6A 2Z5LA 3RAJA 4K9DA 1WAMA 2EERA 4JJIA 1HDCA 2I99A 3CTMA 3HADA 3BMNB 2IZZA 1YQGA 3BMCB 1SO8A 1F0YA 1UJMA 5L7TA 1I30A 5L4NA 2PKQO 3A1NA 2FPIA 4DUPA 1NPDA 4XYBA 3WGZA 4GH5A 5T57A 3V2GA 2D2IA 2AQ8A 3TZCA 1N7GA 4GWGA 4NBRA 1SPXA 4L8VA 4BO3A 5JFOA 4D3SA 5JO9A 2HU2A 4H15A 3IS3A 4RF3A 1ZEMA 4YB8A 5G0SA 5GMOA 1V8BA 4DL9A 2OBNA 2DU8A 3PIDA 2P9GA 2VHYA 4YAEA 2VWQA 5HS6A 2BGKA 2VNAA 3QE3A 3QVOA 2G1UA 3EHEA 2GZ2A 4IINA 4OSOA 3IKVA 1BVRA 1JQBA 2J5RA 3AU9A 3ETEA 4MKZA 5G2OA 3S2GA 4ZJUA 1ZCJA 4CMIA 2GZ3A 3OECA 4FFMA 5A02A 1LX6A 4XQCA 4YWJA 3GAZA 1EK6A 5DDIP 4HP8A 1HDYA 3STHA 2YJZA 3H65A 2E6UX 5BSGA 2B5VA 2RCYA 4QFDA 1M2WA 5KKAA 5CDGA 1Y7TA 3WGGA 4M87A 4CLRB 3KSUA 1DBVO 3OA2A 3QW2A 4L4RA 5B4VA 1ZSVA 1EK5A 3C8MA 1ZJYA 2EKPA 2O3SA 3WLFA 3C7CB 1R0LA 1GL3A 3WIEA 4YYZA 1Q7CA 3DOCA 5CPBA 1WDLA 1WP4A 1XCBA 4GLLA 4UVEA 1B8PA 2HK8A 1DB3A 1ZIDA 4UULA 4CL3A 2YV1A 3IUPA 1LRLA 3MJVA 5B4TA 1DIAA 2DBZA 5JC1A 3PWZA 3U4IA 4JBHA 4TRJA 1J4AA 4WLUA 9LDBA 4XKJA 5TSDA 3FPLA 3TZ6A 5JBIA 1EEHA 4MVJG 2CVZA 4UUNA 5I7EA 5J23A 4I5GA 3VKUA 1P31A 3OEWA 2XPCA 4TMFA 5IDWA 2Q1UA 3TOXA 1R12A 3DQPA 3ITKA 3N74A 3VH3A 4NJMB 3LVFO 5K6AC 3ZWPA 3ANNA 3BHMA 1E3LA 4FJ0A 1HYGA 5CEFA 3QIVA 2FPPA 3S55A 4AFNA 3B1FA 4PN3A 2PNFA 3TSCA 5KNLA 4TROA 4QQRA 3I9MA 1GV0A 1PQPA 5JW6A 1AHIA 1EBFA 5CEEA 4MVJI 1P1FA 3T7CA 2NU9A 4WCDA 3ORFA 4TSKA 3FBGA 4II3A 3G0OA 4MINA 1SNYA 5T5QA 5KVVA 4NMHA 1E3WB 2HLPA 1LU9A 3CH6A 3Q2KA 1GADO 1BXGA 4MKXA 4RPKA 1G0NA 5HM8A 4GMGA 3ULKA 1SC6A 2YV2A 4Y8VA 2J5KA 4ZQHA 3WGQA 3GZ4A 1UDCA 3JV7A 1IULA 3LU1A 1P1RA 2P9EA 1CETA 4L73A 5C5IA 1ZEJA 3DZBA 3HG7A 1IHYA 5KWEA 3UF0A 1VJ0A 2H6EA 3JQBC 1PJQA 2GUGA 2JFGA 1H2BA 2VCYA 3KM0A 4RDIA 1P3DA 3DMTC 1X0VA 1PJBA 4S3MA 3LT2A 2X5JO 1Z7EA 4E33A 4W7IA 4RO0A 2X5OA 3BYZA 3WJ7A 2QYSA 4UVDA 3ZNOA 3O9ZA 2YHIB 3CE6A 5ITWA 3JTMA 4Q39A 4KTTE 3KTDA 3ROPA 3RKUA 3WIDA 4LCEA 3UOGA 1H9AA 3INTA 4CMGA 4ESOA 3COSA 4P8RA 3GVPA 4WLOA 2BFAA 2VZ9A 2X4GA 3BMOB 2VHWA 4RVDA 2OO5A 4XIYA 4B79A 5JAMA 2OORA 3GNSA 1MC5A 1U3TA 4UEJA 4RQTA 3U4DA 3VPFA 2QZ9A 4IIUA 1LDBA 1HDOA 4MVJA 2HMTA 1NVMB 1L7DA 4L76A 3EY4A 2EEZA 1SEVA 3GMDA 1ZK2A 3P5SA 3RC7A 3KV3O 2C7VA 1NM5A 3G1TA 1YL6A 2ZJ0A 5GY7A 3S8MA 1Z45A 1NQOA 1BW9A 5JY1A 1D8AA 1B0AA 2BFOA 5HS4A 1ZFNA 3LF1A 1CQJA 3AY3A 3KSZO 3OMLA 3MOGA 1HSOA 3I1JA 4WUVA 3TFQA 3H2SA 5ICSA 3F4LA 3OETA 5HA5A 1DIBA 3KLMX 1I33A 5ILOA 5DN9A 4ID9A 1VC2A 3JQFA 3L4BA 1GD1O 1G1AA 4TRMA 1YDEA 4EEZA 5L7WA 1NWCA 3BTOA 5JAZA 1UUFA 3GVHA 1H93A 1KVQA 2J8ZA 4IQ8A 1UXJA 5A9RA 2E82A 2Y1OA 3D3EA 4AJIA 3V5NA 4ZRMA 3A4VA 3DAPA 3DZHA 5C3MA 2C2YA 3RIHA 1PSDA 3JQ8A 1GPJA 4KTVE 5A9TA 4BVAA 3D3WB 1H2HA 3LF2A 5H81A 2VTDA 4WEOA 1K0UA 5CP8A 4I5EA 4DYVA 4AJPA 1EUCA 1RM0A 2C7GA 2P91A 3RBVA 4E3ZA 5FFFA 2HQ1A 2OUIA 2VZ8A 2BF7A 4JP3A 1QG6A 3ZHXA 5JXWA 4MOWA 2VYVD 4OKIA 3ZZNA 3UUWA 4ZQFA 2BGLA 1WDMA 1ENYA 3GC6A 2GRAA 4DREA 4Z0PA 2HKIA 4BQRA 1JDJA 4IS2A 4E21A 3HB4X 5DNAA 4GAEA 1GV1A 4CLRA 3C7AA 4IDGA 2CF5A 5L95A 1F14A 3QJ5A 5DOVA 3WQQA 5F5NA 1QLJA 1DAPA 4UAGA 1EDOA 1DPGA 4WCFA 8ADHA 4IXWA 3GEGA 1BMDA 2YQ5A 1PZHA 3NAQA 4R5MA 5IF3A 3Q9UA 4NQZA 4O63O 4BNMA 5IAAA 1FDUA 4N7RA 3VOSA 1I8TA 1WMAA 1SB8A 5LC1A 3WR5A 1O9BA 1FJHA 4R1NA 3VAZA 3VHRA 3KRTA 4CQMB 4CV0A 2HMUA 2G0TA 3DC2A 3GZNA 1NWHA 1P1HA 1F12A 3SBOA 1E7SA 3ZNNA 5CDUA 3F1KA 5L4LA 1KEPA 4NBVA 4AJJA 2V6BA 2Q4BA 2Y66A 3IJRA 2PKQP 4RLSA 4QSMA 3OJEA 5A04A 3IQDB 2NVUB 3H3JA 3LT4A 4MO2A 1QYVA 1XDWA 3FI9A 3FR8A 3NDRA 4P4LA 2O2SA 3VH2A 1RWBA 2AMFA 5T67A 3GPIA 1K2WA 4R01A 3UCFA 4N5MA 5T8KC 2V6FA 3JQFC 4M1QA 4BNKA 3IDSA 3R1IA 4XJSA 1DIGA 2YDYA 5U9CA 2NLOA 1GYPA 1I5RA 4GBJA 1H6CA 1KVUA 1VL6A 4WK6A 1GQYA 4BO6A 1ZMTA 4JQCA 1E3WA 1X7GA 3VZQA 1JKIA 1LLUA 2G82A 2ILTA 4L75A 3LLVA 1OZAA 2CD9A 4J0EA 3AUSA 3RJ9A 4P4GA 2R2GA 1E3SA 4MP3A 2X9GA 1EQ2A 3RCBA 1HETA 2Y0CA 4CLHA 1OC4A 1X1EA 4BL5A 2BGMA 2Y68A 5COQA 2PWZA 3WQRA 4YT2A 4DBVO 3ZU3A 5LCXA 3DHNA 1LDYA 5DP2A 5JSFA 1R4MB 1LDMA 3PDUA 4EITA 4BO4A 3GFGA 1EQUA 4Z3DA 2PLAA 3ZDFA 1BDMA 3AY6A 4JXKA 4B3HA 2NU6A 1MB4A 2PY6A 3RJ5A 4O1MA 3M2PA 1LEHA 1F8GA 1LI4A 1DHRA 3AUAA 5F5LA 4DIOA 4E2XA 1L7EA 4IZIA 4EJ6A 2FP4A 1C0KA 2C5AA 2F1KA 2VT3A 1M6HA 4ALLA 2IZ1A 4JGBA 4NDNE 3PIIA 2EV9A 3E9QA 3R0IA 3I23A 3AI3A 1X1TA 1DC5A 4R5HA 4RVSA 4W99A 1RM4A 2PV7A 1M6WA 2VRBA 1RJWA 1ZKMA 1MXHA 3G79A 2AEMA 2DUUA 1ADBA 4XRRA 5T64A 1GYQA 4IMRA 3QQPA 2JCVA 1IPEA 1PZFA 2WSBA 2YHIA 4EDFA 1WZIA 4BB5A 3H7AA 4DC0A 2QRJA 4WCFC 4GL4A 4PG7A 3PLRA 2Q50A 3P2OA 3DEYX 3O03A 3PQDA 1PGOA 3FBTA 1Y9EA 4JN6B 4NJOA 3T7EA 4PLYA 5I9LA 4IJVA 1B3BA 2QIOA 5JCJA 3OJ0A 2ZTUA 1MV8A 4FOSA 3OP4A 3K92A 5KIAA 1NAHA 4HFRA 1U8XX 3PI7A 4ND3A 3QRWA 3WXBA 3PQEA 3MEQA 2ZKLA 3RD5A 1YKFA 3DONA 1AXEA 3MWDB 3CPSA 2PZKA 3K2BA 4XQEA 3ZWVA 3IAHA 1OC2A 2EJVA 2EP5A 3HZZA 3LC1O 1P1IA 3PHIA 3H9QA 4A26A 4A10A 2NQTA 3UKOA 1PS0A 4P38A 1GUZA 5JAIA 2VYNA 2BH9A 5K6AA 3F3SA 3W8DA 4XZ3A 4NU6A 1S7CA 5CDYA 3K9QO 4K1LA 5EMHA 3GDOA 1E1MA 4NBWA 4C4OA 3HSKA 3E9MA 3HN2A 1M67A 2DBQA 1NHGA 1MUUA 2W8ZA 2WE7A 3AOGA 3EK2A 3ETGA 4YT4A 1U9JA 3EGOA 4DIFA 1KOLA 3NX4A 3DR3A 1HDGO 3AOEC 3CIFA 1WLYA 4JBGA 4CMBA 5A5EA 3QWIA 1CRWG 3OIGA 2ZB4A 5DULA 1DFHA 3JQBA 3RWBA 2NTNA 4BKQA 3GY0A 4CR6A 4E5KA 5CDSA 2IYOA 2ZK7A 3FTNA 1H5QA 3RBXA 4JJFA 1BSVA 2IE0A 1KY4A 2J3IA 1LBEA 1E7QA 4KOAA 4KWHA 3WLEA 2UDPA 4R1TA 3QVWA 1H9BA 5DBGA 2H9IA 4CQMD 5KOIA 4GKVA 2D5AA 3PZRA 3V2UA 2B83A 1ULSA 4WLNA 4U6QA 1NFRA 1X14A 4FIZA 2X6TA 3RUIA 1UXHA 2LDBA 2B5WA 4BOYA 1QKIA 4W82A 1UDBA 1C14A 4I9UA 1EMDA 3NYWA 5A3JA 4QT0A 1PL7A 4J3FA 4XB1A 2OGUA 1DFIA 3DO5A 4JJGA 4GVXA 3TZKA 3NT5A 5KJCA 1EFLA 1T2DA 3ZV3A 4K28A 5U1PA 1N8KA 2Q1SA 2C5EA 3DBRA 1Z73A 2BKAA 4FFOA 4J90A 3WMXA 1XG5A 3DMTA 4RQUA 4A0SA 4IDAA 5IG2A 2Y1FA 1BWSA 1GTMA 3GUCA 5DF1A 1XGKA 3EVNA 2FPGA 1P1KA 4FJ2A 5TX7A 4BGEA 3AM3A 4X54A 1XU9A 2NSDA 7ADHA 3VDQA 2CZCA 2AEJA 4MP6A 4DWVA 5BSEA 3PGXA 4JK3A 3FHLA 2GD1O 4QO8A 4JIGA 1LSJA 1ZK1A 1EBUA 1YB4A 2NVBA 5T6BA 3Q6IA 4P4NA 1OFGA 3KETA 4LVCA 5EESA 5GZ3A 1ONPA 2ET6A 3I9OA 4DXHA 1C3VA 4K6CA 3W6ZA 2ZCUA 5IDQA 1FDVA 2C59A 5IDYA 1N5DA 4NPCA 2ZJ1A 3QSGA 1IYZA 4HBGA 4NZ9A 4CMEA 2BI7A 2I3GA 3F5QA 4NH4A 4BNJA 4AG3A 1ULUA 1LNQA 1M76A 4WOJA 2HUNA 2C2XA 1NQ5A 1O95A 1W4ZA 4R1SA 5I9NA 4IJWA 2VYND 3AW9A 2A35A 4DGSA 4OXKA 4G2NA 3IOYA 1XQ6A 4QO7A 2FY8A 4LRSB 4MVJE 1OAAA 3I9JA 3KZVA 2IDZA 1K6JA 4K26A 4Z0HO 5TQVA 3JQ7B 4KDEA 1E77A 4QEDA 4JROA 4NFYA 4IY1A 1PJ4A 1C1XB 4RPJA 4LCJA 1WW8A 2A4KA 1DC4A 3OEYA 4FPXA 3DTTA 4H3VA 3LSYA 3DOOA 3VVBA 4PG6A 1BW9B 1NVTA 2QRLA 4TQGA 2B4TO 2HK7A 2Y1DA 4D42A 3ZU4A 1IB6A 2X0RA 1GCUA 1T25A 4PVCA 2HJRA 2G17A 3ZNQA 1IUKA 4DVJA 3KVOA 3K2EA 2DAPA 1N1GA 4PG4A 5G4KA 4RV9A 4PRLA 4YRDA 3S2IA 5C7LO 4OL9A 1E3IA 1FXSA 4BO9A 2VQ3A 2FN7A 1KY5A 4YAJA 1NAIA 4F46A 3EVTA 4XYLA 4ZHSA 2EGGA 3RUCA 2DBVO 3FNEA 4IZHA 1PJ2A 4NFHA 1NFQA 4YAKA 3DBLB 1QRRA 2CY0A 4RCVA 2R00C 1YL5A 4J16A 1X7DA 2B36A 2BRUA 2O4UX 4XDZA 2EWMA 3ZCXA 2SCUA 1TB4A 3S1LA 5F3RA 3SJ7A 3D4NA 2EIHA 3PHJA 4UREA 3EYWA 4QUKA 3F46A 3TOZA 1G0OA 1R6DA 2I3AA 3GF4A 3JQAB 3GHHA 3JQCA 1QORA 2Q1WA 3ZWAA 2PGLA 2P9CA 3ZW9A 1TA4A 2O7QA 2Y0EA 3DAFA 1NFFA 4IM7A 3RFTA 3KHUA 1P74A 5CG2A 5JO0A 4D0RA 3UW3A 3AJRA 3OQBA 1PL6A 4PG5A 1R4NB 3VC7A 1V35A 1LXCA 4F3YA 1Z74A 1DAOA 2X23A 5A5FA 2DVMA 4FJ1A 1PTJA 5CG1A 1WZEA 3ZWNA 3I52A 1DC6A 2RIRA 3HJAA 1YRLA 4Y98A 1MFPA 2B37A 4MIYA 2CSUA 3GG2A 4B8ZA 1KVSA 3Q1LA 1LDEA 3AFMA 3JQ9C 1DRWA 3K31A 4PLZA 1PZEA 5IFLA 2IYPA 4N5NA 5C37A 5JDCA 3LC2O 3M1LA 1Q0QA 4CM6A 3DB2A 4RJTA 5CFZA 5K9ZA 4MKRA 4WLEA 2AG5A 3ADPA 4GWKA 4A73A 3PWKA 2FR1A 3GZNB 1J0XO 2Y93A 1E5LA 4BKPA 2DFDA 2ZB8A 1OMOA 3NGXA 1O8CA 4FGWA 5I9MA 1B16A 3AK4A 6ADHA 1LQUA 1EVYA 2OP0A 1HE4A 2R6JA 1R4NA 2WM3A 4YJDA 1ID1A 2X58A 1HEUA 3I6IA 2J3KA 4XYGA 4IUYA 1BRMA 4YTEA 4BNVA 4P22A 1U7HA 4WNIA 1A4IA 3Q0EA 3GRPA 1GUYA 2JJYA 1O6ZA 3ZU5A 1B2LA 3PYLA 3KYBA 4CUKA 4XGNA 2Y67A 1NASA 3MOIA 4J1NA 1V3VA 3CSDA 4CL8A 1CJCA 2EKLA 2DC1A 2V65A 5KVQA 1W0CA 1D1SA 1PGQA 5G0VA 5C7OO 1JU9A 1A4UA 3MJEA 5JDIC 1I2BA 4GI2A 1HZJA 3WYCA 3K5PA 3ZNPA 2VT2A 1Q1NA 1HL3A 2CMDA 2POQX 3UCXA 3TNLA 3GGPA 3WB9A 1P33A 3WNVA 3OICA 4HX5A 4QX6A 2DTDA 2DBRA 4FSHA 4E5NA 4JP2A 2JHGA 2PD4A 2OFPA 4R68A 4IDEA 3RKRA 5ITVA 5K1SA 1R0SA 3A06A 3INRA 4J4TA 3AY7A 1BG6A 1H94A 1UH5A 1ZK4A 4M86A 4W6ZA 3ETDA 4XRGA 3GK3A 2CFCA 4NIMA 1VJ1A 5EJ2A 3NT2A 1UZMA 1Y5MA 2RHCA 2UUOA 3NTQA 4ONEA 4HV4A 2RH8A 4MPDA 1VI2A 4O5OA 4BGUA 1N2SA 1QLHA 1AXGA 1BTOA 4BNUA 4Z9FA 1HE5A 4IGFA 1A7AA 2H1SA 3SEFA 1Y8QA 2E37A 2FHSA 2WEKA 4RVFA 4J7CA 1NR1A 3DTYA 3JQ7A 2PGJA 1A72A 1XEAA 5T8KA 4ZU3A 2YFQA 2O3UA 1QP8A 3LT0A 1KS9A 2O23A 5JMPA 4B4UA 2EP7A 3CEAA 4RF4A 3QLJA 3C85A 5DOZA 4CMHA 1UAYA 3SVTA 4Q3DA 4WNCA 3GAFA 4ITUA 3GVCA 4B7CA 2E4AA 3LLSA 3V1YA 4AJ1A 4J2HA 3WTBA 4B4WA 3ICPA 1EDZA 2ZQYA 3NTOA 3RI3A 3G49A 3MJSA 5BNFA 3BTUA 3FRJA 4BNYA 3DHYA 1ISMA 2J6IA 1UP7A 4XEHA 2VZ0A 4I9HA 4O6VA 1CDOA 1DLIA 4CMAA 3ANMA 3GA0A 4E4YA 3TZQA 5CAEA 1T2CA 3GG9A 5A4DA 2W98A 3FSRA 2XXJA 1E1LA 2QHXA 4F6LA 4YA6A 2C07A 3F47A 1PL8A 3O4RA 5DBFA 1U3VA 5CHEA 2BD0A 1QV6A 4FR5A 1KC1A 4J9VA 4UVIA 4XX0A 3QY9A 4FN4A 5IZ4A 4FFLA 1AN9A 4JBIA 4DPLA 2NACA 2ZTMA 3K8ZA 4HNHA 4C7KA 4IQGA 4ILKA 5A3VA 2NU8A 2HRBA 2ZTLA 1U3WA 1GDHA 4IXTA 1EUZA 4D0SA 2O3QA 3ANLA 3WDSA 3ZI0A 4OXYA 3CZRA 1ZXLA 2DT5A 2X0IA 4B7UA 4TZTA 5HBRA 1LLCA 1F06A 3I4CA 3TL2A 3UVEA 3IJPA 3E48A 4CMCA 4DLLA 3HNPA 4XGIA 3JD2A 1I2ZA 4OOEA 3MJTA 2WYUA 4GLOA 4YT5A 4DQVA 1T2AA 4D3DA 3BA1A 4GGPA 4RVUA 2NQ8A 4EUFA 1DIHA 1UXIA 2YHUA 1LDGA 4CM3A 1O5IA 4NBTA 5A03A 2EW2A 3JD3A 2Q2QA 1E7MA 3QWAA 4ZQBA 3AM5A 4DIBA 2WTBA 3JQGB 4D46A 3RFVA 1AUPA 1MX3A 5EIOA 3EDMA 1SOVA 5DZSA 1O94A 1ZH8A 4GX5A 3WOHA 2GR9A 3U49A 1Q7BA 4BV8A 2B0JA 2A94A 3JQAD 4RPLA 1R16A 2Y05A 4MIEA 1HE2A 4XQ9A 1R4MA 4N18A 3RQSA 3VPXA 4AJ2A 3IMFA 1TEHA 2ZIZA 1GEEA 3M2TA 4Z9YA 4KZPA 5TT1A 3UHAA 5IDXA 4WGGA 5CPFA 2UVDA 3CINA 3RUDA 4IDCA 4YJFB 3RC1A 5A06A 4XD2A 1NPYA 3E03A 4IDDA 2P4QA 3MCVA 2VUSA 2CNBA 3G1UA 4RVGA 3W1VA 3E82A 4HY3A 1UXGA 2VUTA 3Q3CA 5IN4A 5ES3A 2OL4A 4IPTA 5B1YA 1CERA 2GSDA 3SC6A 3R6DA 4J9UE 3OSUA 5KCZA 2A9FA 2GASA 4PLPA 3CKYA 1PR9A 1A9ZA 3T4EA 3TJRA 4KUGA 4E13A 3F5SA 3GEMA 4EYEA 2EW8A 5JCXA 4H16A 3QVXA 3H3FA 5C7IO 1ZUD1 1E3JA 5JNLA 4GGOA 1LLDA 1O0SA 1RM3A 4ZQGA 3IKTA 4FOOA 5JY6A 1G6KA 4Q3BA 5U4QA 1HYEA 3HUDA 5MGBA 3WBBA 4BMVA 1A9YA 1DLJA 4D7AA 3DBHB 4ZQEA 4PRKA 2NNLD 2HDHA 3FWNA 2DKNA 4EZBA 1GCOA 4GSLA 3E9NA 3NUGA 3DDNA 4OH1A 4JLWA 1NVGA 4BO2A 3JD0A 2I66A 4O59O 3PXXA 2GPTA 1N92A 3QVTA 4GX2A 5A9SB 4D41A 4LGVA 3PVZA 1XELA 4CV3A 1HYHA 1T2EA 3KO8A 3TL3A 4U8GA 5B37A 2V6GA 3GRKA 3U0BA 2EG9A 1Y8QB 4FB5A 3O26A 3U62A 1LJ8A 4FFNA 4HWKA 3AM4A 2HSDA 1MG5A 1HKUA 4II2A 5MDHA 1ARZA 4FC7A 4OKNA 1YO6A 4WECA 2O4CA 3JQEA 2X8LA 2W2LA 2JFHA 4FDAA 5DP1A 1I3KA 1P1JA 3GGOA 3SLGA 1ISIA 2CVOA 2VHVA 2FSVA 2WD7B 4TZKA 4KDFA 4BKRA 4EJ0A 5BQFA 4NR0A 3FR7A 4G81A 1I36A 4GMFA 1T1RA 2GN6A 5F1OA 3UFXA 1C0IA 3EC7A 2HMVA 3F1LA 4B4OA 3KYCA 4GVLA 3HDQA 3PHHA 2IZ0A 3GGGA 4OQYA 1GQQA 3CXRA 3JD4A 4UVHA 2RH4A 2J3JA 2X7HA 2YFHA 3OJFA 2PH3A 3TWOA 3JQAA 1JVBA 2VOEA 2UUPA 1MXFA 2QG4A 3HQ4O 3FTPA 4FW8A 3W4IA 2EHDA 4ZVVA 3T4XA 4BNGA 1ADGA 4WEQA 4HFMA 4OIMA 4R4JA 4E12A 3LDHA 1Q7GA 4MJLA 2B69A 3JQ8B 1QXSA 2ZB3A 3QP9A 4RPGA 2P5UA 1F17A 2BFPA 3D7LA 4W9NA 1ADFA 1PZGA 4NHEA 1B26A 5HTOA 2DLDA 1ZO8A 3U4HA 4IQ0A 2RAFA 3W4KA 2J5QA 2V6MA 4CUZA 3F4BA 3MJCA 2BLLA 4BO0A 4WJZA 1FDTA 5A1TA 5G0UA 3I9LA 4URFA 3FN4A 4QFCA 3GT0A 4YRAA 1DO8A 4RDHA 3RC9A 3GDGA 4TRRA 3DAGA 3PTZA 2FRDA 4S1VA 2D1YA 1U2GA 2NTVA 3N58A 4N5LA 1XQ1A 1VL8A 4R3NA 3S2EA 3ZV6A 4AVYA 3H9JA 4OMUA 2Q1TA 1DSSG 2RHRA 5JAQA 4M54A 2GDZA 2JAPA 3OM9A 4XGKA 4EEXA 5A05A 1U28A 2P5YA 5L53A 2Y99A 4UUOA 3RSHA 1HZZA 1UZLA 3FNGA 2AQIA 4NJMA 4WCFB 4R41A 2UAGA 3L4SO 4LMRA 1SB9A 1E1KA 1YOVA 4XR4A 2PA3A 2WYWA 1I32A 4F6CA 2AQHA 1GUFA 1WDKA 1YWGO 2NTJA 2UYYA 3A28A 3GMSA 3AOEA 4HUJA 5H82A 3PZBA 2WYVA 1V3UA 1IPFA 1OI7A 1TT5A 2FWMX 5TGDA 4N54A 4CQMA 5I7SA 1FDWA 2VUUA 1A7KA 5JYDA 3EAGA 8LDHA 3GHYA 5EERA 1YBAA 2WDZA 2DQ4A 4BO8A 4R9RA 1DDOA 2GLXA 3ROMA 1PJ3A 3D1LA 2EGHA 4ALKA 6LDHA 1DOHA 3GOHA 4L4XA 2GYYA 3QVSA 2CDCA 3JQDA 1P44A 2O3TA 4A27A 4TKLA 1B3RA 3OFSA 3WICA 1XA0A 3KYDB 4M8SA 2HJSA 1AE1A 2IRWA 2OBYA 2Q99A 1OBFO 2AE1A 1HF3A 1T24A 3TF5A 1X0XA 2C54A 1CF2O 5IXYA 4BIIA 1ENPA 1PGNA 3FWZA 1EFKA 1JN0A 5L7YA 1I10A 4ND1A 4YEDA 5AXDA 5TS3A 2O3RA 3V1UA 5FWNA 1J6UA 3I83A 4G65A 2X0JA 4XIJA 2VRCA 4C7JA 3WGOA 1PJLA 3NV9A 4EGFA 1HTBA 5KJFA 3V1TC 1MP0A 1TLTA 1UXKA 2EF1A 2PD6A 3UN1A 1T4DA 3ICCA 4Q3NA 3GFBA 5THQA 2GZ1A 4D79A 3PJDA 3ZWCA 4CR7A 4RVHA 2D4AA 1QYXA 3PPIA 1V6AA 3OJOA 3UCEA 3BTSA 4B3JA 3FD8A 2Q49A 2C29D 5AVOA 4ROSA 3L6DA 1NQAO 4LRTB 2GO1A 4FFPA 5L9AA 1LRJA 4AICA 3GDFA 1HLDA 3DL2A 3OIDA 3HDYA 3ZWOA 1U7TA 1DRVA 4BNZA 3RU9A 3CMCO 2VTEA 5EQDA 1GR0A 3C1TA 3L9WA 4Y9DA 4E31A 2NU7A 3P7MA 4Q3AA 2FZEA 2EXXA 4PZDA 3H8VA 4CM7A 4F45A 2G76A 4HFNA 3ADOA 3VZRA 3RC2A 5DCYA 3C24A 1W6UA 5H83A 3BHJA 4LSMA 1JWAB 3PDJA 1R66A 3ROQA 2P68A 1D1TA 4B7XA 2FOIA 2FSSA 3E18A 3JSAA 5AOVA 5A9SA 2I6TA 4YJHB 4CQLA 3ZHYA 4EUEA 1LA2A 5TIIA 4BV9A 2Q3EA 1PS9A 1YJ8A 4YVFA 3RUHA 3ASUA 3K30A 3QWBA 1DFGA 1CIVA 1X15A 3INGA 5EINA 4CM9A 3DZGA 2VWGA 4U6SA 4ZRNA 4WKGA 1DRUA 1MG0A 3JD1A 5TNXA 1JA9A 3X2FA 4YBZA 4TVBA 4PLWA 4QTZA 1NHWA 4XYEA 1Y8RB 2BMAA 1C1DB 4DMLA 3ZW8A 3MTJA 2Z95A 3VKVA 2W2KA 1DHTA 5KJ1A 2QYTA 2GGSA 2NADA 3ONEA 3VH1A 3JQGA 4CJXA 4BNTA 4E2WA 1HDXA 4KUEA 3UXYA 3IL2A 3N7UA 2QX7A 5AQ1A 4JNKA 1GEGA 1DEHA 2A92A 3JQ6A 2Q46A 3LQFA 2VNSA 2D0IA 3AU8A 4YDRA 4BNLA 1NPTO 1K6IA 5GZ1A 5HRUA 2WWRA 1LC3A 1YBMA 4YJHA 1ZZEA 1NR7A 2I5PO 3PEFA 3VPSA 4BKOA 4IIVA 2XOXA 3E1KA 2CF6A 1ENZA 2NVUA 3X2EA 2YUTA 4BGVA 4OQZA 4J7XA 4PIVA 1U4OA 2H5LA 1I01A 3KB6A 4YJFA 4IJKA 1VSUA 2WMDA 3TZHA 4D45A 4EJMA 5L45A 4DPMA 2DPHA 3WJAA 4BQPA 3PYXA 3D64A 1PX0A 4XJTA 1NBOA 4BMSA 4WLFA 1E6WA 4R69A 4IBOA 3ONDA 4CM8B 1WVGA 1XWFA 3JYPA 4J91A 2E48A 1LSSA 4WPGA 3R3SA 3RUFA 3PHLA 4MVJH 2W90A 2QZZA 1Z6ZA 4RPHA 1WMBA 1V0JA 3RVDA 2YDXA 4KUHA 1PGPA 4J1TA 5JLAA 4IJUA 4KMSA 4M89A 4RZHA 9LDTA 1YOVB 5TJHA 4BNHA 4IS3A 4ND2A 5TLSA 1LLQA 1PIWA 1T26A 2DFVA 3ZHZA 4IDFA 3WGHA 1YL7A 1D7OA 1RYDA 2CUKA 5TF4A 2JL1A 4OXNA 2AE2A 4BNXA 4AJHA 4YT8A 5THKA 3DBRB 5GZ6A 5JDIA 4RLHA 3UICA 2CDBA 3NDIA 3C1AA 4ALNA 2P4HX 2FMUA 4BS9A 4LK3A 1Q0LA 4EBFA 1WNTA 5JDCC 3KBOA 1V3TA 5KVSA 1VKNA 2E49A 5JE8A 2IXAA 4HNGA 4CM4A 2RBEA 4MVJD 3EUWA 1IE3A 1F8FA 5FF9A 1ZK0A 1HSZA 3WGIA 3WX0A 3H2ZA 3P19A 1ISHA 2VHXA 3BMQB 4Q3CA 1M66A 2HCTA 4CM5A 5L4SA 1SMKA 1QYDA 1TT5B 3DZFA 1B8VA 1MLDA 1VRWA 3A9WA 3IC5A 4WLVA 2J3HA 5AYVA 3NGLA 4D43A 2WD8A 2JAHA 3KOUA 1LSOA 3I4FA 1PR3A 5ICMA 1KVRA 4R16A 4LW8A 5DT9A 2Q45A 3DBHA 3KUXA 5CEJA 5BSFA 1NNUA 5IXSA 4BNWA 3Q9NA 1NQTA 4BUCA 3F9IA 5KJEA 3RUEA 1XIVA 1KC3A 4BNNA 1Y5RA 2PZMA 3Q11A 1LSUA 1AHHA 1XYGA 2B4RO 1RYEA 4A5OA 1B14A 3U5TA 2NVWA 3LYLA 5AXBA 3QV1A 1P45A 1U5AA 4IMPA 5G0TA 1QMGA 4QECA 1OOEA 1Z7BA 5FI5A 4LISA 2D5CA 4Y6PA 1Y6JA 4OGWA 3JQ9A 3VDRA 2ZCVA 3GN1A 2X1HA 3ZH2A 3HDHA 1ONOA 1YB1A 2QW8A 3ZWYA 4LN1A 4M55A 5IZCA 1ORRA 4INAA 3WYEA 3D3WA 4I5DA 2B4QA 5I7VA 2IXBA 2PKRA 3WSWA 4D3FA 4NG5A 4BNFA 1VSVA 3BIOA 4MDHA 1VKOA 3H9GA 4XB2A 1SAYA 2VWHA 4PLTA 1E92A 2YW9A 3W6UA 5LDGA 3GUYA 4DA9A 4EW6A 1WWKA 1M75A 4A03A 1PJSA 1BXKA 2C20A 4XA8A 4XCVA 5TJ9A 3RBZA 4J49A 1EVZA 1XR3A 4BNIA 4TKMA 2GN9A 4DLBA 3PJFA 5LDHA 1PQWA 4DTIA 5I8WA 1VM6A 1ENOA 2X22A 4KP7A 1ZNQO 1XKQA 3JYLA 5EN4A 4OAQA 5DCUA 4CMKA 4CQLB 3E6AA 2YZ7A 1FDSA 1XU7A 3QWFA 2NM0A 4ND4A 2Z1MA 1TT7A 2HMWA 3BAZA 4I9NA 3PWSA 3BHIA 4WE3A 1ZSYA 4YR9A 4CM9D 2O50A 2HMSA 4DYDA 1KIFA 3OBBA 4CLOA 4HFJA 4Z6KA 4A7PA 4B4VA 3V2HA 1SBYA 1ML3A 2AG8A 4PVDA 1H6BA 2C0CA 4R51A 3BXXA 3JCZA 4DQXA 3EZLA 2I67A 5JYEA 3KLPX 3SXPA 3OIFA 4R3WA 3PK0A 4GPD1 4Y67A 3NEPX 4J6FA 1N7HA 4OHUA 2JHFA 1ZXBA 1A71A 2Z1NA 3FNHA 1IY8A 3H5AA 3LZ6A 4IGEA 4U5QA 3ZWWA 5G4LA 3W8EA 4ALMA 3FNFA 3IP1A 3PHGA 1E7RA 3DFUA 4BGIA 2AA3A 1IZ0A 1BVUA 2TMDA 4OM8A 3KXDA 4E5MA 3G17A 4M49A 3I5MA 1FMCA 1YJQA 1GZ6A 1ZW1A 3GQVA 2NWQA 4PLHA 4E0BA 4XQGA 2Y0DA 4DQUA 3UGKA 1U4SA 1PWZA 3PLNA 5ADHA 3I3OA 4QXMA 1JW9B 2JD1A 1Y9AA 3GNTA 4RF5A 3ZV4A 5L40A 4BO1A 1YBVA 1JKFA 4BMNA 1D3AA 1DJQA 3L9XA 1T2FA 1BGVA 4J4HA 3B70A 2BELA 1GU7A 1HLPA 1K3TA 1Q0HA 2AW5A 2JD0A 3WGYA 1T4BA 1W73A 3BTVA 2VHZA 1H6AA 3KYDA 4BO5A 1N9GB 2XAAA 5EL0A 3DMYA 5BNIA 4FS3A 3E5RA 3DXFA 3WWYA 1Z82A 2DTXA 3L4BC 1H0KA 2VRCD 7MDHA 1VPDA 3U9LA 5B4UA 1UP6A 2FZWA 5DCWA 2IEDA 1YQDA 2GERA 2Q2WA 3SJUA 1QR6A 2HAEA 1RPNA 4W9NC 4DMMA 1IZ9A 2VN8A 1I3NA 3L77A 2F00A 4UUPA 3AUTA 2YYYA 4AL4A 3K6JA 5IJZA 3B6ZA 3AFNA 4TRNA 4RL6A 3ZHBA 1SCUA 1TVEA 2W4QA 3PGJA 3SC4A 3ON5A 1I3LA 3L6OO 3GN2A 3R3JA 3ABIA 3W8FA 3VVCA 3WG9A 1PJTA 2O7SA 4NFSA 2TMGA 4ALJA 4AJLA 3I6QA 2FR8A 1VE9A 3H9UA 3K73O 1C0PA 3ZV5A 4DRYA 2ZYGA 2WD7A 4R9SA 3ROKA 3DZIA 3OQ1A 4J7UA 2GN4A 4E6PA 1JKJA 1ONNA 5ER9A 1Z75A 2EKQA 3KYCB 1A5ZA 1LC0A 1B8UA 1KEUA 5ENVA 3WMWA 1D4FA 4YRBA 1LQTA 3BMNA 4JX8A 2OOSA 1H6DA 3BMCA 3HN7A 3SLKA 3VH4A 2X5KO 4PLCA 1LTHR 3JYQA 3DHEA 3ZN2A 2Y1EA 3AI1A 3VZPA 2PZJA 3L0DA 1WXDA 2GF2A 3HFSA 2XF8A 1IHXA 3ZWXA 1T1SA 1MC4A 3H4VA 5TC4A 2D59A 4YQZA 3HDJA 4CLXA 4GX0A 4XR9A 1WPQA 3CUKA 3WWZA 1ZSNA 3MWEB 1E6EA 2W2LD 3C3XA 4MIOA 4EI2A 1U5CA 3MJ4A 3GVIA 3GVXA 1J5PA 4Z3KA 3CZMA 3DOJA 5BSHA 3B1KA 3WS7A 1XHLA 3IIEA 2LDXA 4I5FA 1JWBB 4B8WA 2JCXA 3ONFA 1DIRA 1C1DA 1UDAA 5COBA 2HO5A 5FI3A 3LK7A 1KEWA 3H9EO 4AJKA 4ALIA 3ENNA 3QWHA 4HXYA 3PJGA 5JPIA 2NUAA 1PEDA 2H63A 4CLDA 3DBLA 4L0QA 1PS8A 2VWPA 1R0KA 1QV7A 3MZ0A 1P77A 2BI8A 4UVGA 4NBUA 3PFWO 4HADA 1NXQA 5KJ6A 4I08A 1LRKA 1MGOA 3RASA 3V8BA 3UAGA 2OHXA 1O89A 1Y8RA 4U0KA 1ZBQA 1GYRA 5L3ZA 3WFIA 3OH8A 2Q2VA 4NI5A 4R1UA 2W2KB 3FF4A 1CEQA 2FR0A 1KVTA 4XYMA 4RORA 3NDJA 3S2FA 4Q9NA 3TRIA 4CODB 4CLEA 1IL0A 3E8XA 3AI2A 4DPKA 4LSWA 5BT9A 1KETA 3PYMA 3WNQA 2QQ5A 4XWYA 3O8QB 1XSEA 3AWDA 1DXYA 4YJGA 1R37A 1MFZA 3D0OA 5AXCA 3RROA 1P0FA 1VJTA 2DTEA 1UR5A 3HWRA 4UEKA 1UAGA 4KQWA 4DBZA 3GEDA 3D5QA 3QA9A 2CVQA 2VOJA 4AJEA 2HRZA 4KQXA 4O0LA 3M1AA 4FCCA 1N1EA 1ZMOA 2Y1GA 1PGJA 3OQ6A 5K0ZA 3EMKA 3ASVA 4WOKA 1VLLA 1YGYA 2JKVA 3OA0A 2ZQZA 4CM8A 4KWIA 1CQIA 1YXMA 1EVIA 5KVCA 4CR8A 4E2YA 3H5NA 1E7YA 1U2DA 3U09A 2GN8A 1UZNA 4Z0TA 1ISFA 4NK4A 2AQKA 5G0WA 5BNTA 4MVJP 1E7WA 4FGSA 2Y1CA 1ISGA 1CWUA 1C0LA 3VZSA 1QSGA 3WSVA 4YCAA 1GZ4A 2VYVA 3CMMA 1DC3A 5ENDA 2PZLA 4YPOA 3BMQA 1HE3A 3PRJA 4MP8A 1VL0A 1LUAA 3DZKA 3GPDG 4E5PA 1N9GA 1S6YA 2O2YA 4YJGB 4GQAA 4PLGA 5JMWA 3B1JA 2JFFA 4L9RA 4U0JA 3L07A 5TT0A 2PR2A 4BO7A 1GFSA 2OMEA 4ZD6A 3EW7A 2V7PA 4XDYA 1X7HA 5IN5A 1KEVA 4H7PA 4J0FA 4HKTA 5B12A 1TXGA 1C1XA 1XLTA 2C82A 3ZWMA 1QYCA 2B35A 3RFXA 5FYDA 2O48X 1HWYA 1P9LA 3H5RA 4DLAA 3F6YA 1DJNA 2ZB7A 3I9NA 4PFJA 3DFZA 3G3EA 1SOWA 3ZWBA 5JS6A 4YAGA 1SZJG 4R54A 3WBFA 3PQFA 3Q2IA 1RM5A 2BFMA 4NU5A 1HDZA 3C7DB 3DZJA 4I1IA 1E6UA 1NX6A 3DBVO 4OOFA 4UUMA 3W4JA 4FBGA 4DC1A 1HT0A
chains in the Genus database with same CATH superfamily
3OJLA 3VNSA 4PCVA 2ETVA 4CKYA 3H18A 4X1YA 1M2VA 5IDVA 1CR0A 3HUUA 4WK2B 2HF7A 1EUDA 3PQ7A 3KEOA 2BUCA 2F4NA 4NNJA 4PHCA 3U4CA 4FQ8A 1SCKA 2FPIB 2ZYTX 4IV8A 4DA0A 3E7XA 1PWEA 5B1EA 1JSCA 2VXOA 5FO1A 4M37A 2QRVA 2HK9A 2VJDA 4RH3A 5FR2A 4X1KA 4CV2A 1GPAA 3I9FA 5COAA 5E4JA 4J4BA 1Y3AA 4WWHA 5TRTA 2ID9A 4G2TA 5FNZA 3HFGA 4ZA2A 3ZDDA 4LS3A 5F9MA 1EXWA 2WJPA 4K8OA 4PGFA 4NJEA 1A88A 4KXQA 5AKKA 5HIMA 2HRQA 3W8RA 4QHYA 2I9KA 1VMIA 1KJ9A 2P1ZA 4GF5A 1II8A 2G5CA 1T36B 1VG8A 3GJYA 4ZYZA 3VTFA 1ZRMA 1TTPB 4OI1A 4Q01A 3OOHA 4ER3A 3RV4A 4JKIA 1HXHA 3JW8A 2ZE7A 1YS6A 5DSXA 1OWLA 1Q1ZA 2HWUA 2I2AA 3GEIA 2VJNA 3KUUA 3SZ3A 1ID8A 3NFYA 5K2MA 3N53A 3FUXA 3QX9A 2H1HA 4C1NA 1HDRA 1DWQA 2CLMB 3M6IA 1WNFA 3WO1A 5CFPA 3P2JA 1CE8A 1W46A 3K9FC 3EPKA 1JAXA 1K89A 2K2WA 4HLQB 4CUJA 4NCKA 1JJAA 3TFOA 2PL1A 3AZQA 1BRTA 4MA5A 5KUTA 4HB4A 1T5OA 2YOGA 4I99A 4J3NA 2BI4A 2HIAA 3PC7A 1GY8A 3H05A 3NAMA 4Q21A 3TAUA 4CKZA 1CRPA 1AGYA 2ISSD 5DT2A 5FKJA 3FSGD 4LEIA 4X71A 1K86A 4WK4B 1HK7A 5JUWA 4PX5A 3ROFA 3D8HA 1JYSA 3RRYA 3T3HA 4TMVA 2H4HA 4UBJA 3OFKA 4KFTA 3IEVA 3A6HA 3H97A 3ITDA 1M1YB 2X9NA 1U2QA 5CTJA 4OYRA 3LYAA 2CXRA 2ZVJA 3FH0A 4EMUA 5KNCA 2BMDA 5JLJA 2QAJA 2O3JA 2P3QA 2VEOA 4MB0A 3SF8B 3W6NA 4CEJA 2RSLA 2R8PA 1JUDA 2UXBB 4RF2A 1DRJA 3AVQA 5CK5A 1CPYA 2WE8A 2R25B 4UTNA 2Q1YA 3UV3A 1MB9A 1PWXA 4AJOA 3F3MA 3GA5A 2GK6A 1XLWA 3OF5A 4X92A 1G5FA 5FPHA 2IX9A 3TSYA 4NXMB 1M73E 4S2UA 4LX8A 1NLMA 2GNAA 3NJ4A 1QQ7A 1FSPA 3UUGA 3R3XA 3LWZA 4D25A 1QX4A 3UKDA 1GAWA 3F6CA 1YVEI 3AXSA 4G67A 2V45A 1UBFA 4L4SA 4P3NA 5F1KA 1JG2A 3WADA 4TX1A 4J2OA 1B41A 1Z4IA 3DLTA 1EJ6A 4HS4A 4WACA 3CLUD 5IULC 2X0NA 2AYYA 4ZVLA 4LQCA 1NTOA 1RVDA 2W6PA 4US1R 1GAQA 4C3OB 1CLEA 4E08A 2NXNA 1BXZA 3B89A 2D3TA 3S5UA 3GLVA 3KB1A 3EXIB 3IAS1 3BBPA 4LQDA 1U3UA 3HCAA 3ZIAA 4EG1A 1XYYA 1DQRA 4LTMA 4RANA 3GRUA 4QT4A 4WZ6A 1TM1E 1LTQA 1JNYA 2H08A 2DQKA 3AR7A 1V5FA 3I0MA 3DA8A 1W2WB 3GUZA 2C57A 3U5ZB 1TZJA 4YGYA 1QF9A 4PCUA 3PVSA 4YXFA 2HY7A 1XP8A 3MLBA 4AULA 4QNMA 4C7XA 4CMJA 5J9FA 1E9DA 1H0SA 4W5JA 3WLJA 3VU8A 1EM8B 2G28A 2IW1A 4D0LB 1E61A 4YACA 3HVJA 3LOPA 5EJIA 1N3BA 2FP3A 4OG2A 1H66A 4CM4B 2QNBA 4PLFA 1Y9JA 5DYTA 4EZIA 4KDRA 4MVWA 4Y2HA 2X42A 5DMHA 4K6FA 1GPLA 1F20A 3D7KA 2V98A 4TM7A 3X1XA 2ZANA 1KDPA 3LT1A 2QAGB 2WWXA 2REBA 1A77A 2CXQA 3P20A 4WFKA 3UMSA 3ZGVA 4DJEC 4RZ3A 2H2GA 4I8XA 1YZHA 4Y6SA 1Y1PA 4TMTA 4P4SB 2AEFA 3ZGYA 2NPFA 1W0KD 1M0WA 3I28A 3UMFA 4A6DA 1XXLA 1NGSA 2IODA 4V03A 1SKMA 4XJVA 2JB9A 3BM5A 3R3ZA 1JALA 4ND8B 4F85A 3K4PA 1GZUA 2JI6A 2NV6A 3NUQA 5JALA 2QJTA 2NYRA 3FCOA 3PC8A 3GR6A 3W8NA 3RUAA 4AJ4A 3EAQA 4Y9UA 3AEQB 3TW0A 3D8RA 2Z5VA 1LPPA 1KERA 3BKWA 4OJMX 3V3KA 3N39C 3LUBA 2PK3A 1VQ1A 4FN5A 4L74A 2W00A 5ED4A 2QLLA 4MLDA 3EVGA 3L1VA 5IUJC 3FGZA 1J23A 1C4KA 2HW8A 2RB5A 4MUFA 1PQUA 1ODFA 2YQ4A 4CT0A 1J8YF 4FGJA 4EKYA 2X19A 3K70B 4LBYA 5JJLA 2JIDA 5EXPA 4FCTA 1YDWA 4TVSA 2CSXA 2HIHA 2P9FA 1P0CA 3THWA 3Q7PA 1I24A 4CTNA 3D4OA 4LXYA 2GT1A 1L5KA 4OSPA 3U3OA 4LJ8A 1RDFA 4C4TA 1ZR4A 1ADCA 1ESMA 1N2XA 1DMRA 1E79D 2ETXA 3IAS6 3DO8A 5HK8A 1J42A 3NT4A 1OFUX 2Q4EA 4ENQA 3PHCA 4ASUA 3ER9A 2W6ZA 3FWPA 1J1ZA 2A88A 1OAOA 2F1JA 1WZCA 2OP1A 2Q5LA 4TYQA 3H11A 5H3CA 4E5YA 3AUKA 4L6AA 2NUTB 4EUHA 1FSGA 3ZWDA 1R0CA 3SHVA 3D4LA 1GZ3A 2CJXA 3UFBA 4GSKA 3WNCA 4CMIB 4RTLA 1RBMA 2C96A 3RAJA 4UOEA 4JOQA 2F9FA 2F4VB 4DR1B 2EERA 3LHSA 4PC1A 4ZEOA 2M6LA 5AKJA 5FHQA 2XWJI 4M8IA 3QFRA 4HEA1 2I99A 5FNVF 2BMWA 5E4YA 2H5JA 4Q4DA 1MDBA 1BWRA 5MHTA 2Z56A 4F3RA 1UJMA 1KZ9A 2JAQA 1UWVA 4YX9A 1I1NA 3AESA 1TVKA 2QL5A 1J8DA 3I2KA 1G6HA 5IKEA 1R64A 1H2EA 3KL4A 1OLUA 2G9RA 3A9TA 3WP0A 1AQJA 2ZBFA 4KQ9A 3TXAA 1U7XA 3O4GA 3VDXA 4NBRA 4B6RA 2GKOA 4LOAA 1JE1A 5LIPA 2Z5GA 1QIEA 1UK9A 3DEAA 5JO9A 2IYXA 1GGNA 3ZGNA 2Z04A 2ADMA 1E6CA 4YB8A 1Z6TA 2HPVA 5FWDA 3NATA 3Q7IA 4BVFA 2V8BA 1GZ5A 1PNQA 5D7BA 4YP9A 1G8YA 3GL9A 4LF6B 2IOFK 1XPOA 4XD7A 1D2AA 2ZU6A 2HYDA 2P9GA 2I1LA 2VHYA 3OCUA 2C7QA 1TO6A 2FWRA 2R8EA 2VNAA 3QE3A 1JYFA 4WA8A 2GZ2A 2ICAA 3F6SA 3AZOA 4KITB 1ZCJA 2HNBA 4RYLA 2WTXA 4MGYR 5AM2A 4CMIA 1VLHA 4MW4A 4HB2A 1ZVKA 3OECA 2CLSA 1GFZA 4KREA 3E27A 4RHFA 1JEQB 1M74A 3KG2A 3FCAA 3GAZA 1EK6A 4UHHA 5EIBD 2BLNA 5KMGA 2JRCA 3NBUA 4M6WA 4QQNA 5A5VA 1PFYA 5CDGA 5KKAA 1CUUA 2JZNA 4F5ZA 4IKOA 1Y7TA 4RFLA 1DBVO 2CL0X 2G1KA 3R7AA 3F6EX 2QP4A 3GAMA 4JI6B 4LKOA 1MW8X 2O3SA 3AVVA 1WEKA 4RJ2A 1THZA 5K8LA 1R0LA 1GL3A 2VT6A 4TUYF 4PYOA 1Q7CA 4DLWA 3W5DA 3HKDB 4Z7JA 1E6LA 1Y0BA 2XGSA 5CPBA 2NXEA 2CGEA 3U40A 4UVEA 3U3ZA 5HUQA 3N2KA 2HK8A 2ZUVA 1JVNA 1PBTA 2JJ2D 2R44A 3HCFA 4UULA 2DBYA 2PX3A 5DTRA 1BEUB 1S8AA 3MQFA 3IUYA 2MINB 3MGCA 1D04A 1WCV1 4HH1A 3FMOB 1N6IA 2DBZA 4NS4A 1IEWA 4TRJA 4Z9AA 5J1TB 1J4AA 2FGKA 3K1AA 3IBTA 1OAKA 5JNUA 5TSDA 3TZ6A 5KAMA 2C03A 2ZSHA 4KPUA 4MVJG 5F33A 5J23A 5TMDA 3NP9A 1QOZA 2Z3VA 4Q9IA 1RS0A 2Q1UA 3CUTA 5KTPA 1FNDA 4RQBA 3DQPA 4A2WA 3ITKA 4X93A 2I6UA 2VG8A 1XXHB 5JSQA 3BB4A 2IELA 3BHMA 4FJ0A 1Z4MA 3NWBA 3Q8LA 2W37A 4WBNB 5CEFA 4IJ5A 3S55A 4CIBA 2OCBA 4E6EA 3TUZC 3P9XA 1L5SA 2PNFA 3TSCA 4UM5A 2CL5A 3ZPXA 3OY2A 5JHGB 1YCHA 4KMRA 4QQRA 4CEIA 1UFOA 1L7VC 2BEVB 3CXUA 4MWEA 1EBFA 1Z4KA 4DAEA 1S9HA 5EJFA 3T7CA 1TQ2A 2H48A 3C6QA 4WCDA 4JFAA 4UMVA 3FBGA 1UJCA 4FHFA 1SNYA 3ER6A 3C4VA 1BKYA 3UC9A 4DJTA 2HLPA 3OEHD 3ZCRA 2CLLB 3CH6A 4GUDA 3TPZA 4HVAA 5A3RA 1GCIA 1C41A 3T7KA 5AW7A 1TPZA 2YBEA 1IIRA 1WDTA 2V0CA 2YV2A 4JYCA 3HO8A 5FB3A 2C84A 4B5LA 1IWOA 3LNCA 3ZW7A 4ENRA 3K0FA 1E1QA 6CHYA 5I7HA 1V11A 3PIRA 4MV9A 4NV3A 4KO2S 4PPNA 3QXJA 4PX2A 1CETA 4Q4HB 1AXRA 4DZRA 4W8HA 3NM4A 1N3LA 1B93A 3MF4A 5H3LA 1XVTA 4RDIA 3DMTC 4R98A 1M6VA 1B73A 1X0VA 4S3MA 1PG2A 4UHKA 5ALGA 3RRNA 4W7IA 3WMFA 2X5OA 3BYZA 1LV7A 4Z4CA 2XMSA 1F38A 1YRBA 3NFRA 4GP9A 1K6MA 2FXVA 2X2EA 3CE6A 4ISBA 4Q39A 1G2IA 4JLKA 4F4JA 1P4AA 2WPDD 3NP7A 3NWJA 3WIDA 3EYAA 1RAGA 2D4HA 1H9AA 2VFAA 3EAFA 3LJKA 4P8RA 1Z2PX 2H29A 4KGZA 2BFAA 1CULC 2IYVA 2X4GA 3IBCA 3JWPA 3BMOB 2EZTA 2AKYA 1AKEA 2OO5A 3PXEA 5IT0A 4Q9JA 3SXUA 2BMVA 2LIVA 3EFEA 1PRYA 2VDPB 1BH6A 2VSXA 3HA5A 3BOSA 3HYRA 1KE2A 5AVRA 3WLQA 4MRMA 2PX8A 2QZ9A 3E5NA 4UU7A 2QN7A 3AXTA 4G07A 4R1PA 1NVMB 4B6FA 4KQCA 1QRDA 4RKYA 1SEVA 2CXXA 1PW5A 4M1MA 4YJ2F 3WIVA 3RIYA 3COPA 3P5SA 4ZVKA 3RC7A 3WLSA 2R1VB 4EA9A 4FMPA 3KV3O 3FUCA 1R6XA 1NM5A 1ES9A 1KIMA 4YRZA 5C1OA 1YZ3A 3KOMA 1KJYA 5AUPB 1JEAA 2W6NA 4BN4A 1VGRA 1Z2NX 1Z45A 2WIBA 4OQDA 1GAXA 3UJ8A 1BW9A 2YHAA 1D8AA 3GFVA 4YRNA 1TOAA 3IQEA 1RQNA 1M5UA 3TO5A 3KTOA 5HS4A 4YAUA 1VECA 5KU1A 1ZRHA 3DMFA 5DV9A 1QG2A 3OMLA 1UQUA 1SIWA 1HSOA 3ND8A 3VZBA 3WWEA 2IEYA 3DJYA 2KB0A 2HI0A 3E84A 3ECAA 3F4LA 1SELA 2V1UA 2X8AA 3C6YA 3GDHA 1I33A 2PBZA 3IMCA 3I01A 2O1XA 3JQFA 3L4BA 1ZIOA 4JJ4A 1YDEA 3NC1C 2H11A 4XUDA 3ELYA 3VHQA 1UC8A 4EP1A 5JAZA 5KB3A 1E3TA 3GVHA 3E7WA 4TN5A 5EEHA 1JEJA 4LRYA 4XCXA 3G0HA 1L0BA 1WB5A 3CR3C 3ABQB 2H59A 4IQ8A 4WNAA 3J7AC 1XE3A 3MIZA 3T0IA 2W83A 1F9AA 4Y0VA 1FTYA 5C3MA 5E1MA 1UPUA 3LYUA 5JRZA 1HC7A 1X8KA 3DS8A 3KHKA 1NZJA 3LP8A 1EESA 1ADYA 2QNRA 1H2HA 3D3WB 3A04A 2VTDA 4WNYA 5H81A 3CNOA 1L5GB 2HBZA 4EHHA 1K0UA 4DYVA 5K5EA 3SQNA 1EUCA 3PEWA 1FMTA 1RYZA 1SXPA 3MT7A 2VZ8A 3L01A 3SBXA 1NDQA 2BF7A 4X1OA 1FOEB 1QG6A 4GDFA 3GEPA 4MOWA 4X45A 4OKIA 3IP7A 4LCBA 3FYCA 3B78A 5D5HA 4Z8YA 2H0RA 3QNWA 4FGKA 2BGLA 3GC6A 1ENYA 1WCYA 4OHYA 2CVPA 4B6GA 4RMGA 5CT9A 3U7HB 5LFAA 1JDBB 2GRAA 4QXAA 4DREA 2NYAA 1MORA 4WKBA 5DGXA 4CL0A 1EXDA 1T8SA 5DNAA 1GV1A 1GPMA 1QG4A 2AN3A 1X1AA 3KT8A 2CF5A 5L95A 4S12A 5DOVA 3KQNA 2YWBA 1FTSA 3AF3A 3O8OB 5JWHA 3GGDA 3U4AA 3WQQA 1I7QB 2XBMA 1O6FA 1V16A 4UAGA 2OPHA 4UMEA 3DO6A 4HH3C 4EVRA 4P80A 1GNSA 4UFNA 1BU8A 2D5BA 5GV8A 3TKAA 1F1JA 2AOVA 2ONYA 4R5MA 4QU9A 1M2GA 3OPNA 2AJBA 4NQZA 2G88A 1GQSA 5TMEA 1FTWA 5IAAA 4N7RA 2R87A 4YP6A 3VOSA 4D9HA 3IXMA 4L2IA 1RHUA 4L8WB 1J7JA 2O0MA 2C7PA 4DNPA 1XCLA 3IXLA 1U1EA 4R1NA 4CV0A 2OCLA 3BIFA 1ORVA 3VHRA 3DC2A 3GZNA 1JDBC 2WB4A 3EZNA 1P1HA 3Q7RA 1E7SA 3ZNNA 3F1KA 3PA8A 1KEPA 1T8RA 4NBVA 2PKQP 4JB8A 5AD1A 1AKMA 2RDMA 1BCSA 1M2KA 3IQDB 2NVUB 2O5EA 5LB4A 1DOZA 4P4LA 3LPCA 2O2SA 3F3KA 3TE6A 1Z6YA 3BCSA 3R24A 3V6LA 4DCPA 5CFMA 3ISTA 1W36D 1TKBA 5HRCA 1YVUA 3OJCA 4MV6A 4YCJA 2XCQA 2GLTA 1TZKA 1N57A 2ANCA 1JF8A 2V6FA 4BNKA 2O8EA 5D3MA 4XJSA 2G7ZA 2YDYA 3OQJA 2NLOA 1N4AA 1H0HA 1N6LA 1TM2A 3TR5A 3RC8A 1H6CA 2PKXA 1KVUA 3DDZX 3REQA 2FKNA 3SZGA 3UKJA 3X43A 1ZMTA 2I7VA 1JQJC 1X7GA 5FFNA 1E4OA 3I34X 1N6PA 2FZ5A 1VHWA 1JH8A 2DQZA 1X8XA 3LLVA 4AYTA 1F6BA 4J3JA 1T0JB 3UHPA 4ZT4A 2PMBA 2B1QA 3Q98A 4QHSA 3GBVA 2BW0A 4MP3A 2YCBA 2BFCA 4UQOA 1J09A 1NW3A 3OAAA 1PVVA 1HETA 1Y7LA 2P78A 4BCBA 1OC4A 1SKYE 2F3TA 5TR9A 5HOQA 5T64A 5COQA 4X65B 2PWZA 4ZCQA 3WQRA 2PANA 3OT5A 4XSGA 2Z2XA 1A9TA 3DHNA 5LCXA 3E70C 2DHQA 1S1MA 4N7MA 3QEMB 5JSFA 3EUAA 1LDMA 1CHNA 1OI2A 1MAAA 2H5IA 1S2NA 3SDZA 1UCFA 3IP8A 5GPBA 1QTRA 2PLAA 3A9CA 4C6HA 2ZVDA 5K99A 1KOGA 2TECE 4JXKA 3V2IA 4OHCA 4OYYA 1XTBA 2PY6A 2AHOA 2C04A 3RJ5A 3G2MA 4PSVA 3AUAA 5F5LA 1L7EA 3CPEA 4EJ6A 4NVRA 1B8OA 3IQGX 3OTQA 3MWDA 2IZ1A 3FCCA 4FHZA 4J0GA 4M0LA 2YKGA 3M5PA 5H4GA 3ILSA 3E9QA 1TZCA 3I23A 4LF9B 3R7DA 5JDIA 4R8MA 5HUJA 1E2GA 2X3YA 4LYYA 5C52B 1AIPA 1WSBA 3BSWA 3MTBA 3IIKA 4R5HA 2HHJA 1I51A 1NBMA 3KKLA 3Q9LA 4W99A 1QB7A 2VRBA 3O3CA 1RJWA 3VKFA 3W2FA 3W6OA 1MXHA 4MUNA 1OH8A 3LKBA 1JIKA 4QM6A 1ADBA 3ORQA 1K9SA 1BXRB 3M5CA 1NI3A 2PFSA 1JQ5A 1Z29A 4M2LA 2X5XA 3IIIA 2JCVA 3JVEA 3HA2A 3K09C 4KVZA 1KQNA 1A4RA 2YQZA 2YHIA 3P2MA 4BFTA 4Z1MD 4HQKA 3WYAA 3H7AA 2J5XA 2QRJA 1K0FA 1ZMBA 4G0MA 1ZUIA 4JELA 2D1SA 3AP1A 4LDNA 3VUEA 1R8XA 4DB4A 3GD5A 2D74A 3O03A 4U7JA 4C3UA 5JJCA 1WX1A 1VCMA 4AB1A 4HN9A 3FBTA 1OWMA 4KXYA 5JIBA 1Y9EA 1NBEA 4FHDA 2HZBA 3PGA1 2P0EA 1R9MA 2QROA 4IJVA 4NAVA 4MQ4A 1MOZA 2IP1A 5DHFA 2JK1A 2Y1KA 5IAGA 4OSEA 4BP9A 4LZNA 2YS6A 2Q6TA 3OP4A 5KIAA 1E2IA 2Y9MB 3CX4A 1E2PA 2RGWA 3PI7A 1TAQA 3O7MA 2W2XA 1U5BA 2FX5A 3WXBA 3LW7A 2QTAA 1W59A 3BN3A 4V02A 4Q7KA 4YRQA 2ZKLA 1Z13A 4HDKA 3MRVA 3VDNB 2QK4A 1N2GA 3C6BA 2WUDA 4FNOA 3ZWVA 2YYSA 4XWAA 3ZIUA 4DR3B 1OC2A 3DL4A 3QGMA 1OWPA 4LZOA 3L41A 3DWEX 4EPVA 2PX4A 3LC1O 4QUJA 1ISPA 1P1IA 2PL3A 3UKOA 3TEMA 3KKPA 1UBUS 1Y9DA 5FTMA 5JAIA 4Q66C 5L3SB 3N0VA 3OOJA 3R5XA 4D4LA 2X0KA 5ICCA 5FPYA 3F3SA 5DRTA 1EFTA 5P8WA 4L4UA 2BTQB 1W581 2PAAA 1P4GA 1WZ2A 1FSSA 1M9NA 2AVDA 3K9QO 3GDOA 1EGMB 4K1LA 3TLXA 3WHKA 2I7DA 1AY0A 3HSKA 3HN2A 5B57C 4I66A 1R74A 4B2LA 1BDHA 3LTNC 3OC6A 2WE7A 3ETGA 4K9NA 5HHTA 3GMTA 2SKCA 5JV5A 1U9JA 4LBZA 1USUA 4KFSA 1JFSA 4H3HB 4ZDWA 2ON6A 4YRFA 3PC4A 2QY6A 3AOEC 1YUMA 2CV2A 4CMBA 1H4TA 1WBBA 3C5VA 1S1CA 4G01B 3QWIA 3TYXA 4DJJA 4YALA 4BV2A 3T35A 4LG1A 2ZB4A 4DW8A 3QVMA 4NABA 2A9OA 4PZAA 2NTNA 4H18A 3GY0A 3LDGA 3SZUA 4A23A 4C4SA 3CGGA 4DWOA 2HV8A 1IEXA 2DSTA 2IE0A 3NBMA 2YNMD 1E7QA 1XL1A 4P93A 5G1OA 5C1IA 3VZDA 4L50A 3QVWA 2NU9B 1CIPA 3OHPA 4PYNA 4BMZA 3K0AB 1GILA 3CYFA 3E3LA 3V2UA 4HUTA 1Y6FA 1WXFA 1JZTA 1GKKA 4U6QA 3NAZA 1NFRA 2E4ZA 1X14A 5KQLA 4BJ1A 3EFBA 4ZVMA 4QZVA 3LKZA 4L0DA 2IYTA 4JODA 4QU5A 5CIQA 4YP1A 2ZT6A 5FTNA 1X38A 4POAA 4QT0A 1NF8A 2R60A 9MHTA 3IHWA 4J3FA 2F2TA 2WC1A 3CLRC 3DO5A 3PGKA 1UIMA 4JJGA 2DETA 1I3CA 1I5OA 3NT5A 3NLLA 4DV3B 2WP0A 3GU3A 4RJKA 3DVSX 1KR5A 4U7GA 4HDAA 1L7OA 5GM1A 3ANXA 5TQJA 4FFOA 5M04A 1BGXT 3F9CA 3ZOZA 1ZOOA 2NIPA 2QM0A 2ZRKA 5D00A 3D2BA 3WDLA 1BWSA 1E9CA 4BRWA 4MHSA 2O8BB 2VLIA 2GVNA 2I4LA 3ELWA 3GUCA 5CH5A 3VKGA 1DAEA 1H2XA 1XTUA 3LLUA 4Q24A 3EVNA 4FJ2A 1ESEA 3AM3A 1KTVA 1XU9A 2VBIA 2NSDA 2WJWA 3EQZA 3K1YA 4X54A 5JANA 4B3RB 4AZ0A 1JHQA 4QO8A 3HBJA 2Z6QA 4HDQB 4LOHA 4TWJA 2AMYA 1YB4A 3LCJA 5KQGA 4QDUA 3CNEA 3K0AA 4HRXA 1A8QA 3P27A 4Q6WA 5ALEA 4L6IA 4CN8A 1RKUA 5H9WA 3N7TA 5EESA 1ONPA 2E55A 2ET6A 3EG9A 3EZFA 2ZSDA 3MQ2A 4C0HA 1NL3A 1GN9A 1N7IA 2PS0A 3AB3A 1WOMA 4LHWA 2C59A 1L5ZA 2OHFA 3B8EA 3HMKA 3R7LA 3EF3A 4QUEA 3KFVA 2M1XA 3DKVA 3WBKA 5EJ5A 2O0LA 5ALKA 2I3GA 4X20B 2R11A 3TIGA 3DM5A 4XVRA 1P1BA 3AYXB 2V0NA 1S3GA 2XOKA 1BHJA 3F5QA 3GFSA 1ULUA 1LNQA 1PR4A 3B1XA 4NH4A 3TOSA 5A7FA 1G38A 1VYUA 3LQRA 1NQ5A 1QGED 1W4ZA 3H5TA 1R6AA 1EU1A 4GZMA 4L1KA 3RVLA 4ADSG 5AK5A 4JQOA 2VJMA 2DPXA 5HQJA 4QJ3A 2I2DA 2FY8A 4ZAYA 3I9JA 4A8JC 1SCIA 1G4AE 2JFVA 4K26A 1FP4A 1XWWA 1E77A 4G25A 2H9AA 4IIJB 4JROA 4Q1FA 1EG7A 3SS8A 4QU0A 2G6BA 1FYWA 2CZGA 4G4IA 2DMRA 1OXKB 1FFXA 3NEJA 4IY1A 1Z4OA 1HPLA 3HU1A 4K6OA 2NO4A 1L4KA 4PRZA 4UU0A 2XEXA 2A4KA 3N5KA 1A9RA 2FEKA 4K9OA 3LUHA 1DC4A 1VLMA 1ZQ9A 1RWVA 6YASA 3RRXA 4Y2RA 4X62B 3K32A 3QEMA 4EJSA 3LUFA 3U1VA 4WDQA 2F90A 4DCGA 3L7JA 4BDTA 1WVMA 2FPXA 4AAYA 2YNMC 1J8FA 4MCHA 2B4TO 4PC6A 2HA3A 1VIVA 1B23P 2NU6B 1TZBA 3ZU4A 2X0RA 4R6WA 1GCUA 1TF5A 3IBSA 3PCTA 4HNVA 1M54A 2ZBUA 4CIYA 3A1WA 4N39A 3LCUA 4ESVA 1SUBA 2HJRA 4PR3A 3CW9A 2CLFB 1VG1A 3ZNQA 1IUKA 4Y2GA 2RE8A 2DAPA 3ODGA 1P1CA 4Y2JA 4RV9A 1JPUA 1DAGA 3RT7A 1NLZA 3SAJA 4HRVA 3V8MA 5IEJA 3SWWA 2NSJA 3FMVA 4BO9A 2VQ3A 4BZWA 1KY5A 3GLGA 3F73A 4YROA 2JAXA 2OD7A 2HJVA 3Q15C 3MTAA 3EHDA 3P9NA 4L5JA 3AB7A 3EXFA 3HXPA 3RUCA 1E6KA 1ODJA 1ZM2A 1L4EA 3VUFA 3L7NA 3GYBA 2C88A 2C1ZA 1JNXX 3DBLB 1II0A 4URVR 3OTHA 1YK0A 4RTKA 3ZC3A 2IEGA 2Q28A 5LZ5A 2ZYSA 2W0SA 4XDZA 1W85B 4KQGA 1QWOA 4M0UA 5BRNA 2FW6A 1TB4A 2SCUA 1FTNA 4TOIA 3ZLUA 3I4LA 4OBXA 2C3OA 1XRNA 3UJDA 3F46A 2P77A 1R6DA 2Z6VA 3B9BA 4UASA 2FDCA 1KP3A 3SGLA 4X60A 2ACKA 3C14C 1QORA 3P9QA 5FQOA 3HU2A 5E95A 3ZWAA 2AFRA 2BCEA 4MWTA 2O7QA 5FNVB 3OLWA 1NFFA 3CV3A 2WJJA 1P74A 3KEGA 3Q8WA 2BP7A 1OILA 5DMXA 4ITVA 4KEAA 3V4FA 2WA2A 4PZYA 5I45A 5DCLA 1UXOA 2ZRQA 4WOCA 2HSJA 3G85A 5ALNA 4C4YA 1CY7A 4N1AA 1TYZA 4UAJA 1CS0B 1GITA 2QZ4A 2ZBVA 2ZI5A 4AKHA 3BD6A 1C8VB 3FMGA 3NVMB 5C9ZA 4F6RB 3E7DA 3NG1A 3BD9A 4LYGA 4C01A 1W4AA 2A5GA 1DC6A 2G9QA 2RIRA 3BD7A 3HJAA 3G9XA 3G5UA 4KI7A 4N0QA 1MFPA 2GJ4A 2XKKA 1FDRA 3GG2A 4B8ZA 4GEKA 2O8DA 3EXFB 3Q1LA 3QKIA 1P61B 3E15A 8OHMA 4L8FA 5DYGA 3NIDB 3TB6A 4DA7A 4HH4A 3AHHA 3PICA 5DXJA 1CUEA 5EJ7A 1NIPA 2IHUA 2IYPA 2QVXX 2O59A 4MI6A 5JDCA 5ALRA 3IRVA 3NU1A 3O47A 3DB2A 3T3IA 1PFKA 1G8SA 3WL6A 2ZUSA 4C4ZA 4C5BA 2PMEA 3FVQA 5DYYA 3ZWKA 4BQNA 1OASA 2O1EA 1DEXA 1JGTA 2VP6A 2Q3FA 4Q02A 1GPUA 2X2FA 1IUOA 3K53A 4M1WA 4PSUA 4K8RB 5AI4A 2ZB8A 3EASA 5EIWA 3NGXA 5PNTA 2EFHB 4M76B 3G5MA 5GIPE 1EHCA 2WB2A 1VHTA 1NBMD 1NVEA 1P2DA 1X6VA 2OG1A 1I7NA 3AK4A 2WAMA 5G3ZA 4AKIA 4R2IA 3I6BA 1R4NA 4QOEA 5GINE 3O3MB 1KP9A 2JG3A 3OE4A 4GECA 1HEUA 4CF3A 2ZM5A 4P22A 1E5DA 2BE7A 2BGIA 3Q3VA 3BQNB 2ODAA 2AD1A 1P39A 1O87A 2I7XA 2R66A 2JJYA 3MMZA 3K9BA 4L22A 4F6RA 1B2LA 4CUKA 3WK6A 2A9PA 4URHA 1YR9A 4Q03A 3REQB 4MR7A 1WO8A 3ABRB 3SKVA 1L7MA 5CVTA 1COWA 5I4KA 1Z4LA 1VE5A 2OV6A 4J1NA 4J29A 1QHIA 4YMHA 7GPBA 4XWWA 5ALHA 3HZHA 2FV8A 3G2QA 3WE7A 2VAWA 2QP3A 2W4MA 1E2EA 2O2XA 3FZGA 4EI8A 2BISA 2V65A 1SUSA 1ZOLA 4QLOA 5D87A 4ZT6A 5JQWA 3KU1A 1IZZA 2PMKA 2IQIA 2LWIA 3F5DA 4HWTA 2RBKA 5G0VA 1VE3A 2O5RA 1DKUA 5ALWA 4RXUA 2QLBA 3KOZA 4DFDA 2WTUA 4OFZA 5AVKA 3VR1A 2VT2A 4GMXA 4MNTA 3QVGB 5ELLA 4GZ3A 1NLYA 1AGPA 1MPTA 4I0WB 2CMDA 2CYBA 3PXBA 2OTCA 1E2FA 4JYPA 4RAOA 1P17A 3NTUA 4OD0A 4P3XA 1QG0A 5FO0A 3OICA 4WFIA 4Y9TA 2Z98A 4HX5A 4DR4B 2DBRA 2DTDA 4UUAA 4LY0A 1YR2A 2H51A 2J67A 4X95A 3B13B 5LLDA 2KM1A 2ECOA 4EYKA 1HFEL 3MAJA 5F9HA 1RCFA 2GBPA 3INRA 4J4TA 4C0BA 1C3EA 3AY7A 3EISA 1M0SA 1SM4A 3BT7A 4ECAA 5SZKB 3TLKA 1PT9A 3G89A 3GK3A 4O4IF 3TUJC 1VJ1A 3G1WA 2I8LA 1Y5MA 2RHCA 4P4UA 1BCRA 4LZAA 1TYEB 2JGKA 3RS7A 1QIGA 4GKKB 1EIWA 2RH8A 3R9WA 4N0PA 1QHHA 4P0TA 3TR0A 4DSTA 1VPLA 3TQCA 5LQCA 4G1MB 4LHVA 1OYVA 2J33A 4OL0A 1SHUX 2HJWA 4BUZA 3ROXA 1HE5A 1Z36A 4IGFA 2Q7DA 1H85A 2NP7A 3C2QA 5D86A 1PQYA 1S2DA 2JKZA 2WEKA 4UEQA 4RVFA 4J7CA 1H2AS 3NYRA 1A72A 5CD1A 2VDJA 2YFQA 1ZUNA 1DTWA 3X1ZA 3L8YA 5EIEA 4BQEA 1QP8A 2ZYUX 1N4DA 2O23A 3HS3A 5AJYA 3PFGA 2EP7A 5DK6A 1AMNA 1VG0B 3C85A 5LBIA 1CDDA 2H57A 5CVEA 2ZITA 5TEVA 3JRWA 1HFJA 4UNSA 1NE7A 2J4FA 4HQFA 1RWPA 5G53C 3GAFA 3NBKA 1JI0A 1NJ5A 4F9FA 3EJ6A 2QTGA 3G0CA 4MW9A 4ITUA 4R3UC 5FBHA 3UOWA 3U7FB 1S7GA 3W2HA 4FE7A 4KAAA 1CFJA 1O95D 5K3SA 4AJ1A 1CJTC 1V45E 1U5BB 2QXYA 4QG7A 4NQRA 1B8NA 5DLDA 1EDZA 3AUYA 3M4XA 3K0CC 1M7HA 2R1UA 3G49A 2ZJ3A 1OBOA 5DM1A 3FYTA 5HILA 1YS2X 3FRJA 1NUSA 2FW8A 2RK6A 1ISMA 4Q3OA 1QO7A 2VBCA 5I4CA 3G23A 1CDOA 2Q6KA 4CMAA 3A32A 3OE7D 3UAXA 3A1FA 2OLKA 3WRYC 3B3FA 1OA1A 1QGZA 1T2CA 5AJXA 2W98A 3FSRA 2ZT7A 4UU8A 5A4DA 3U3JA 1WMDA 1L7RA 3ZIDA 3PXDA 5JS1A 4HDOB 3TBFA 3P0FA 3LQ2A 4QOGA 3L46A 1VE7A 2C07A 1FFYA 1UMBB 3BH7A 4B85A 3F2IA 4CGYA 3QBVA 1QVAA 2BD0A 1GTL1 1QV6A 3EVDA 5CHEA 4DV7B 4UVIA 4FR0A 3LXRA 3QY9A 3E4CA 3BF8A 2P11A 2XD4A 4FN4A 5F51A 5J4YA 1SXJD 3SFTA 4OAPA 1OBCA 2E6KA 2H5EA 4MLCA 2B4YA 4Z2YA 3IX7A 3K8ZA 4A1FA 2CN1A 2BFFA 3JVDA 4C7KA 3KWMA 2QUHA 4FUTA 5D3KA 3P96A 1KPHA 1NURA 3UB3A 3DV0A 4B7AA 1M0TA 2JH9A 1EUZA 3BD8A 4EG7A 4AK9A 1XEXB 2X0FA 5BR1A 2PLNA 5DGTA 3AF2A 4MA4A 1GT91 5HBRA 1LLCA 4YCNA 1F06A 1OX4A 4I4NA 2RGRA 1VJGA 3IJPA 3RSGA 3E48A 4EZEA 1U0LA 3RS8A 3HNPA 1U0HC 1PR6A 1WY7A 1GFWA 1PLKA 3JD2A 3RS2A 2Y0PA 1I2ZA 5DNYB 1Q1EA 1W85A 3VV2A 3WMGA 2AG0A 2OYRA 2NZJA 2R1TA 3E22A 4GLOA 4K0RA 3UNXA 2G3YA 4PZ0A 4D3DA 3U7GA 3BA6A 5BQ5A 1BA3A 2R65A 3GWZA 4RVUA 2ERYA 5ALIA 3ANSA 3ZX5A 4WFJA 4DVGA 2HM7A 2W58A 5IAJA 4DILA 1O5IA 5AM0A 4HPJB 4OU5A 4BFYA 4KXVA 3AFHA 4URWR 3L4KA 4WFQA 3L7IA 2QRMA 1CK4A 3QWAA 4C05A 1LD3A 1DBSA 1KS2A 4XIIA 4ZQBA 2EQBA 5F2NA 2QRQA 1CUHA 5H16A 1ZVJA 4D46A 2VHCA 1H1DA 2QXTA 3EDMA 3FTDA 2IC5A 2KHZA 4LRUA 1TYCA 5IJAA 4AC9A 4NBLA 3FPFA 3MAGA 5FA5A 4B3BA 1ZAYA 5DGHA 1XUOA 5KCMA 1Z39A 2CXSA 4P1ZA 1OPRA 2CE7A 2MMGA 3EXEB 3HR7A 4MIEA 2WD9A 3NWOA 2Q9AA 3IMFA 3BPSA 1N5OX 4EYSA 1TEHA 2VJYA 4AY5A 4HGOA 4CT5A 1GEEA 4Z54A 1VLJA 4REOA 2I1VB 5IDXA 1N6HA 2PT6A 3CINA 4ZYYA 5A7GA 3CVOA 5IMSA 3M5DA 4Q9LA 3DMRA 1TJ5A 3LDAA 3RC1A 4ITRC 2OB2A 2BEJA 1BC5A 1XK6A 4IDDA 4W5WA 3MCVA 1ZJ6A 3CUSA 3IE0A 4RVGA 4C29A 5FOUA 2AJLI 2NSLA 2WIKA 3Q3CA 1GVNB 3HGQA 3IXQA 3PUVA 2OL4A 4IPTA 3H6HA 3YASA 1ZN8A 5DBHX 5DRYA 3MUEA 5B1YA 3UWOA 3U1BA 3TQOA 3SC6A 1FFBA 3R6DA 4DEXA 3NO4A 4HN4B 4XW2A 2AMLA 1U63A 2GASA 3HCRA 2OA0A 1CQWA 3CKYA 1P9NA 5CLIA 4RC9A 4FYVA 3T4EA 3LLMA 2D2FA 5K03A 2EDCA 1EG2A 2OZLA 2WF7A 5M29A 1XFDA 3FGOA 1XCJA 3PRHA 4EYEA 3DLBA 4MQ6A 1MJGA 3HCBA 4X6LA 4ENUA 3F7NA 3Q7SA 3UGJA 3GXBA 1YFKA 1M6YA 1NUQA 5JZVA 3NIBA 1E9EA 2WUFA 3BJEA 4X41A 1E3JA 5J4KA 1Y3IA 5CW2A 2IX3A 1PUXA 1NQUA 1P75A 4G97A 4FOOA 3IBYA 2GD0A 4C76A 4DR7B 5BMVA 4OUDA 4JJZA 2FJUA 4C4RA 4B8YA 4RTMA 5J4HA 1HYEA 1RXUA 4BMVA 4BX9A 3MGBA 1WW3A 1Y7HA 1OI3A 4RIIA 4D7AA 3JYHA 4LE2A 3ELUA 3ZK8A 3BSYA 2HDHA 4EZBA 2BWJA 3BWVA 1GCOA 1C7QA 1TU3A 1CJBA 4FDUA 2F3UA 5JATA 3AVUA 1C0EA 4NBKA 1TQ8A 1D8TA 1TM7E 1K3UB 3LCMA 2O2EA 2XHEA 4BO2A 3JD0A 2FZKA 1SXJA 4O59O 4N47A 4DKXA 2GPTA 1J1UA 2JH3A 4CCSA 1A1SA 5A9SB 4LGVA 1QE3A 5C35A 4HZGA 4TT3D 3SZLA 2NV2B 2DYKA 2DHEA 4R7GA 1M72A 2V5UA 2ZRHA 3F0TA 4OPMA 5BT8A 4LHZA 5HNKA 1KI4A 2FMTA 1KMIY 2FQQA 2V6GA 2ZROA 2YZ2A 1C30B 1T5LA 3N2GA 3O26A 1QVVA 4BYGA 1JTEA 3DP7A 1RYNA 1LJ8A 1ZM7A 4WKPA 4WQMA 1X7XB 3K0EA 1FFSA 3LT5A 4FFNA 4H7DA 4RXMA 5HE9A 3T9BA 1KMHA 3QFHA 4ZYXA 1E3QA 3MTDA 5T4HA 5HFAA 3OQVA 1OXXK 2QQFA 2FQYA 1GAJA 1CJSA 1YO6A 2C97A 2ZPTX 2O4CA 1AS0A 2OD2A 3IIMA 2X8LA 3JQEA 3KVNA 1NF9A 4YO7A 5DYWA 1YKGA 5KTNA 2ZREA 1WUTA 3ZS9A 4FDAA 2ZJ6A 1OA0A 1KO1A 1RR6A 3I32A 3SLGA 3BCRA 2C7RA 4YUZA 3SE7A 1UZAA 2P62A 4EJ0A