5ENVA

Yeast alcohol dehydrogenase with bound coenzyme
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
347
structure length
347
Chain Sequence
SIPETQKGVIFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCELGNESNCPHADLSGYTHDGSFQQYATADAVQAAHIPQGTDLAQVAPILCAGITVYKALKSANLMAGHWVAISGAAGGLGSLAVQYAKAMGYRVLGIDGGEGKEELFRSIGGEVFIDFTKEKDIVGAVLKATDGGAHGVINVSVSEAAIEASTRYVRANGTTVLVGMPAGAKCCSDVFNQVVKSISIVGSYVGNRADTREALDFFARGLVKSPIKVVGLSTLPEIYEKMEKGQIVGRYVVDTSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alcohol dehydrogenase 1
publication title Mechanistic implications from structures of yeast alcohol dehydrogenase complexed with coenzyme and an alcohol.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Oxidoreductase
total genus 110
structure length 347
sequence length 347
chains with identical sequence B
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2015-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5envA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 5envA01
2GERA 1OBFO 3LC1O 5H81A 3GDGA 1I32A 3JQGA 1X15A 2TMDA 3ETGA 4BNJA 2ILTA 4AJLA 2EKLA 3NTOA 5A03A 1YRLA 3AW9A 3F9IA 2VYVD 4QXMA 5CPBA 1E3WB 3QRWA 5EINA 3NRCA 2G76A 5TIIA 5DF1A 4BNNA 4A7PA 1ZJZA 4X54A 3IMFA 4ALNA 4E30A 4XJTA 4E2ZA 4D44A 4JCOA 3VC7A 3EYWA 3S2EA 5ICSA 3PHIA 4U0KA 1EVJA 3DHNA 1LDNA 3TFQA 3C1OA 1KETA 1NPYA 4OXKA 4U6QA 2OBYA 3BTUA 1NQTA 3QWAA 2XXJA 5IJZA 3C7CB 4XDZA 4M89A 4U0JA 4A2CA 1DIGA 2D0IA 2DFVA 1X1TA 2UUPA 1VJTA 4J91A 2CDAA 4K9DA 5A1TA 1M66A 2PKRA 3KBOA 4XIYA 4XZ3A 4R16A 4BNFA 1UDCA 3LU1A 1LI4A 2HKIA 1EBFA 4FW8A 3GN1A 3SLKA 4R1UA 1Z82A 1NHWA 4FQ8A 1DDOA 1BXZA 3BIOA 4ZQGA 1TB4A 1FK8A 3GRPA 2IYPA 3WMXA 3KLPX 1UXKA 4WGGA 3V2HA 1V6AA 3NEPX 4ND1A 5JW6A 1MFZA 2Q3EA 4RO0A 4DBZA 1NQAO 3GGOA 5CEFA 1OC2A 3F5QA 1QYVA 4EUEA 4F46A 3EVTA 1P1RA 2V65A 4L4SA 5T5QA 3JQDA 4BIIA 3PFFA 3H9GA 4KZPA 3HFSA 3OA2A 3Q1LA 1NTOA 5L40A 4F3YA 3JCZA 3BTOA 3H3FA 3N7UA 4NBWA 1C0LA 4ROSA 1PS8A 5G0VA 2I99A 2PY6A 4CMBA 4EJ6A 1H9BA 1YBVA 1MXFA 2EP5A 2C0CA 1QYDA 4Y6RA 4AJKA 1XHLA 2EEZA 2X0JA 4JXKA 1LLDA 1A9YA 1YQXA 5EQDA 4HUJA 3GHYA 3L6DA 2EKQA 3KYCA 4N54A 2CMDA 3H5AA 4YAKA 3OJFA 5AVOA 5CPFA 3F46A 4PVDA 1B0AA 3WFIA 4KQWA 1N92A 4U5QA 4I5DA 4M87A 4NJMB 1UP6A 1GUZA 1PWXA 3IQDB 5IFLA 4A73A 2CSUA 2P5YA 4JJIA 3VKUA 2HMUA 2ZYAA 5G0TA 4OH1A 2VHVA 1BWSA 2CD9A 4BO6A 3GUCA 3V1UA 4EGFA 3RKRA 1GZ3A 3C1AA 1V8BA 5EPOA 4WEOA 1Y8RA 1T1RA 5IZCA 2JFGA 5GZ3A 1ID1A 1NVTA 4XQCA 3DQPA 2P9GA 3W6ZA 4YJFB 4DRYA 1C1XA 3A4VA 4Y6PA 5B4TA 4PZCA 1IYZA 4CLOB 4Z0PA 5LDGA 2RAFA 3LT0A 2DKNA 4FGSA 3ZHBA 2VT3A 3ANLA 2PZMA 4OQYA 4AL4A 2QZZA 3RUFA 3GG2A 1NXQA 3WGTA 4G5HA 4BKPA 1WNTA 3ENKA 4TVOA 1B15A 2JFHA 3G79A 4ZRMA 5U1PA 1EZ4A 5T57A 2C2XA 4CR6A 4CLDA 2BI8A 2FP4A 4IXTA 3SEFA 5L7YA 3MZ0A 3AI2A 1B2LA 4E5YA 5HTOA 1KC3A 1ZUD1 2DUWA 2F00A 5BNIA 1P1FA 3ZV3A 2AW5A 5EN4A 2DTXA 1YOVA 2X4GA 3WNVA 2P68A 2BELA 1UZNA 4BL5A 1JA9A 1T4DA 5IDWA 1H2BA 4RF2A 3VH4A 3ZWVA 3GUYA 4CR8A 4YRAA 4Q3CA 2X5JO 5KOIA 5C7IO 1MC5A 3VH2A 1U3VA 1KVTA 4RJTA 3F4LA 4OL9A 4YJGB 3M6IA 4WOKA 1IHXA 1SMKA 1Z7BA 2GDZA 2Q99A 3RWBA 2ZIZA 3GOHA 4I5FA 3VTZA 2RH8A 1EQ2A 3ONEA 2BGMA 4BNVA 1N2SA 3O4RA 1PJQA 3JQFA 4BKQA 4EW6A 3DAPA 4D0RA 2YQ5A 5I7FA 5EERA 1VSUA 5KJ6A 2JHGA 2GN9A 2HRZA 2OBNA 1PJBA 2QQ5A 3BXXA 1H9AA 3G1UA 3Q11A 4I08A 4CMEC 1RJWA 2E4AA 1Y8QA 3E18A 3GY0A 3VZQA 4B4VA 4CUKA 1UDBA 2PH5A 4OKNA 2G82A 2PNFA 3WSVA 3D7LA 3DDNA 1PSDA 2X1HA 1DLJA 1GY8A 3WJ7A 4U7WA 1KEVA 1ZKMA 1MX3A 3G0OA 1C3VA 2EIHA 2BKAA 3DOCA 3RC2A 4MKRA 5KVSA 1U7HA 3F1LA 4BO1A 2LDBA 5IXSA 1JAXA 2IEDA 1Y9AA 4PLPA 4CMEA 1CYDA 2C07A 3NGLA 2DQ4A 1VJ0A 4CM3A 2PGLA 2BRUA 4BNMA 3CIFA 4AJHA 4Q3DA 3AY3A 2EGHA 2H63A 2Q46A 4J2HA 1HE3A 2OP0A 2J3IA 4P4LA 1EUZA 3FWNA 4DREA 3HSKA 4P22A 1RWBA 3L9WA 5I9LA 2IE0A 3HWRA 3KZVA 1Y5RA 1AUPA 3AUSA 3B20A 1G0OA 4PLHA 2H6EA 1F8FA 3DBVO 3OQBA 1F06A 1MV8A 1U1IA 3K30A 1XU7A 1GYRA 1ZEJA 1VPDA 2X23A 1T2DA 3OJLA 3GQVA 5JDIA 2AE2A 2D4AA 3LC7O 2Y1OA 5KVVA 2VRCD 1N9GB 1QLHA 3KTDA 3NKLA 3WQSB 1MGOA 3M2PA 2VT2A 2P4HX 3FRJA 3D5TA 4A26A 1PJLA 4Y6SA 1ARZA 1ZSVA 4R5MA 1ADGA 4R1TA 4YQYA 3H8VA 3INGA 4R01A 1LBEA 3R0IA 2EXXA 2WM3A 5G0SA 3EMKA 5HS4A 3EK2A 2UUOA 3I9JA 3NV9A 5ICMA 4B8WA 4AFNA 4XR4A 1BXGA 3RKUA 2ZJ0A 2I3AA 4E33A 2V6BA 4OGWA 2C54A 2WD7A 3DTYA 4DLLA 3BMNB 5ES3A 1GTMA 4TQGA 4EUFA 4GMGA 3ZV6A 1GYPA 3KEOA 4D41A 4RORA 3GVXA 4EYEA 3NJ8A 3ZV4A 1PJSA 2HCTA 4UREA 4PCVA 4YJHB 2C2YA 1XSEA 4A5OA 2O7QA 4DQVA 2J6IA 4LCJA 4Z6KA 1E7RA 4ZICA 2HAEA 3PWZA 4J1NA 1YL5A 4XX0A 4IIUA 1MC4A 4OSPA 1J4AA 3DB2A 3JYQA 4NNJA 3U3XA 2X9NA 1HDCA 3DFZA 2NUAA 4O63O 5HA5A 4BO2A 2P2SA 3WJAA 5L95A 4OOFA 2B83A 4A03A 2IEBA 1H0KA 5BSHA 1QMGA 2W2LA 5BT9A 2BMAA 1UXIA 1B7GO 1ZSNA 2RHRA 5G4KA 3K92A 5IN4A 1AGNA 1M67A 2FSVA 3AY6A 1FDWA 1PJ3A 1Q2XA 1ZO8A 1VM6A 4Z0TA 1BRMA 4IINA 3V1TC 5C3MA 1XWFA 4EEXA 4MVJD 3RIHA 3VDQA 1DIAA 3KO8A 4MVJP 4MKZA 5C7OO 4UUOA 2O50A 3DBLA 2PGJA 4YEDA 5BSFA 4ZRNA 2PWZA 1IB6A 4CUJA 2EKPA 3RJ5A 3ORFA 1GCUA 2H9IA 2VTDA 4BGEA 4NFYA 4WLNA 1J0XO 1Q7GA 3AFNA 4ZJUA 1MG0A 2IZ1A 5I8ZA 2VWQA 4BO9A 2AQHA 3SVTA 3BYZA 4IQGA 2O4CA 1LDMA 3AK4A 4JGBA 3LSYA 4CMKA 3CPSA 3I9OA 3VH3A 2Y67A 3JQBC 1PL6A 4XGNA 1NBOA 3BMQA 4HP8A 5A02A 4BMVA 5G2OA 3VKVA 4PGFA 3QA9A 4NBTA 4I1IA 1VL0A 1LDEA 4YT8A 3HDHA 1Y6JA 3PGXA 1HETA 4PFJA 3T4XA 4ILKA 1JAYA 3GT0A 2D3TA 4CL3A 1KBZA 5ILGA 1PJCA 3A06A 3AOEA 1YO6A 1UH5A 3GEDA 3NJ4A 1EE2A 2OFPA 2VNSA 3BTSA 1GR0A 3EHEA 4GSKA 3RJ9A 1X14A 1LX6A 3JQBA 4Q3NA 2GZ1A 3DHEA 3GVCA 5TRTA 2NLOA 5AXAA 1HE4A 3EVNA 3PGJA 2X9VA 3QP9A 5K0ZA 1O8CA 1OOEA 3AU9A 1PL8A 1ZXLA 3DO5A 4YWJA 4BNYA 4BNIA 1Z6ZA 1E7WA 4Q3BA 1GUYA 4G2NA 1NYTA 2DC1A 2Q2WA 3RUAA 1EBUA 4C7JA 1ONOA 3JQ7B 5U9CA 2AA3A 2O48X 1CIVA 4R54A 5GZ1A 5F3RA 4Q3EA 3QHAA 2GZ2A 3VZSA 3WIEA 1IUKA 1T2EA 2YFHA 3PQFA 4D3FA 1BMDA 2Q50A 4LVUA 3I83A 1DBVO 1E1MA 1NVMB 4BV8A 5JCXA 1X0XA 2YDXA 4OKIA 3JQ9C 3LC2O 2Q1WA 3M1LA 3QE3A 4MIYA 1GFSA 4UVIA 1ADCA 1E3JA 2NU9A 2C20A 1EFLA 4LGVA 2NVBA 2Y1GA 2BGKA 3PTZA 1GAEO 2X5OA 3ETEA 3F4BA 3K6JA 1ENOA 4WKGA 3WSWA 4IGFA 1N5DA 2EERA 3DONA 1V0JA 4C4OA 3MCVA 1I33A 3I6QA 4PLVA 1P9LA 2PZJA 3BHIA 4PLWA 1DHTA 4UVEA 3VOSA 5CG2A 1O94A 2FHSA 1E3EA 3VAZA 4XGIA 5A9SA 3HUDA 4BS9A 5GZ6A 3DMTC 2YY7A 4D46A 3W4IA 3WYCA 4HFNA 4B4UA 3FR7A 3KSUA 2Z1MA 3DL2A 2NM0A 4DBVO 3DZKA 5KCZA 3ONDA 4QEDA 4WCFA 1I3KA 3OIFA 2VWHA 1GYQA 1MA0A 3DOJA 3NT5A 2FOIA 1KYQA 2VWPA 2YV2A 3OH8A 3GNSA 2AQIA 1VSVA 4GL4A 2A9FA 1I3MA 3Q6IA 2GN6A 2ZK7A 4IDEA 4ITUA 3GNQA 4OMUA 5JSFA 3STHA 3UW3A 1C1DA 3NT2A 2PLAA 4QO7A 3ZWWA 4B3JA 2NVWA 4F45A 4WE3A 1GUFA 2WJPA 2FRDA 1KEWA 1UZMA 1ZK1A 3GVHA 3ZWNA 3SC4A 4GVLA 2Q4BA 4JLWA 3IIEA 3OJ0A 4YBZA 1KIFA 1HE2A 1N1EA 1R4NB 2OO5A 2GUGA 4YT5A 4BNHA 4BMSA 4YVFA 2PH3A 4J7CA 1IZ0A 4RF3A 1PGPA 4MO2A 3O9ZA 4L4XA 1UUFA 4IGEA 2VZ0A 5G4LA 2YHUA 1UAYA 1LSSA 2JD0A 1PR9A 4CODB 4NPCA 3L4BA 1R12A 5G0WA 3D4PA 1SC6A 4XRRA 1XEAA 4LSMA 2OXIA 1DSSG 1NPDA 4II2A 2WYUA 3A1NA 3I4FA 2Y1EA 1BW9B 5JO9A 1P1HA 2DM6A 4G65A 4JIGA 5TSDA 4CV1A 2C5AA 3LT1A 3O8QB 4J2OA 2J5KA 2V6GA 3L07A 1A7AA 4BO5A 5L9AA 5KWEA 1DC5A 5T64A 1N1GA 1E7MA 1ZJYA 2HSDA 1YBAA 4DIBA 3I23A 5ENDA 3R6DA 2UYYA 2W98A 5JE8A 2NVUA 5JLAA 3R3JA 2CF5A 2DUUA 1MFPA 2PTGA 4CLRB 1LSJA 3DZJA 2ZQZA 3WLEA 2JAHA 5T8KC 5MDHA 1O6ZA 1HKUA 2E48A 5DCUA 3WBBA 4E5NA 3WFJA 1U2GA 4CM4A 3PHLA 3ADPA 2FPGA 3WYBA 5DBGA 2Q45A 3D1LA 1NR7A 3IUPA 3DMYA 3T4EA 1UXJA 5EJ2A 4DMMA 5F5NA 2OMEA 1Q7BA 3OIDA 5CHEA 1SZJG 3TN7A 3H3JA 3OSUA 4BO7A 4NDNE 3MEQA 1GZ6A 1PZGA 1T26A 3RUEA 1L1FA 1YB4A 4KUEA 1FDSA 3HHPA 1LQTA 3IP1A 2NQ8A 4KTTE 1R15A 4B3IA 2VHWA 1HDXA 3U49A 1ISIA 1NWHA 3TPCA 2I5PO 4PRLA 2WE7A 3DBRB 4ALJA 4NK5A 5BQFA 3K31A 2D5CA 1TVEA 1EQUA 4I9UA 4FOOA 5KKCA 5JAMA 2RIRA 4XWYA 4CQMD 1D1TA 4K1LA 3ROKA 2PZLA 1P1JA 3UICA 2YV1A 5DP2A 2XXBA 4K26A 1P74A 3HB5X 1R4MB 1OC4A 4J4HA 2GF2A 3ZHYA 4D7AA 4MVJH 2GN4A 3ZI0A 3T7EA 2QW8A 3P19A 1EUCA 4CM9A 1KY4A 3LF1A 1QV7A 3QVTA 1I5RA 3C7DB 1DO8A 2P91A 3OA0A 4H16A 2ZYGA 2JHFA 1I3LA 4HFRA 2O7SA 1PGJA 3PYLA 1BVRA 4PG7A 4CQMB 4AJNA 2OL4A 1E7QA 2G0TA 3F3SA 4IJVA 4OO3A 1VJ1A 3WGOA 1CEQA 2HJSA 4UVDA 4IMRA 1M76A 4KQXA 4WUVA 4LCEA 4FFPA 3NYWA 4FFNA 4XGKA 4LK3A 4I5GA 4J90A 2NTVA 1F8GA 3Q0EA 3AY7A 1CQIA 4H3VA 4HBGA 4I8XA 4XYGA 3E9NA 5C5IA 3OIGA 4K6FA 1YJQA 1SEPA 5K1SA 4E2YA 1T2CA 1MB4A 2IODA 5KJEA 1SO8A 5JY1A 4DXHA 4DL9A 3FF4A 4TSKA 5CFZA 4E13A 1UZLA 5A06A 1DRWA 3INTA 2Y93A 1N7HA 5TS3A 1LU9A 4JP3A 4W7IA 3FPLA 3NUGA 3QY9A 3IS3A 1XYGA 2FR8A 4RPJA 1P77A 3B70A 5DCWA 5THKA 2X9GA 2VHYA 4FD3A 3WB9A 3WQRA 3H5RA 4DQUA 1LDYA 4CV3A 4DMLA 5IG2A 4XKJA 3P2YA 4J9UE 1I2CA 4RCVA 4BNZA 3FNGA 5IZ4A 2HRBA 3JQAB 3ZNNA 4HX5A 2AEJA 1E3WA 3E9QA 3S1LA 4UEOA 1DAOA 3P7MA 3H9EO 4WK6A 3ZW8A 2NV6A 1P45A 2X8LA 1E3LA 1K6XA 4RVSA 2GNAA 2YZ7A 1PGOA 4BNKA 1YXMA 2DTEA 4HKTA 1QR6A 5FWNA 3C7AA 3JD1A 1SOWA 2CVQA 3WR5A 3WQQA 1KS9A 2EW8A 3RU7A 2H1SA 4B79A 5G0UA 2FWMX 5TJHA 5JNLA 2VYVA 3GFBA 2YYYA 1A5ZA 3AI1A 3NTRA 1U9JA 4JQCA 3WGGA 4YAJA 3ZGYA 3IL2A 2FR1A 2RHCA 1LLQA 4O59O 3V8BA 3IKVA 1W4ZA 2X58A 1XIVA 3JD3A 4KUHA 5FI5A 3GG9A 2AE1A 4BQPA 4GWKA 4UVGA 3NDIA 2AMFA 3OEWA 4Y98A 3WG9A 3RBZA 1TT5B 4IXWA 4CM6A 1GPDG 3D64A 4E0BA 4PLGA 1GZ4A 1A7KA 1I10A 2AQKA 2R2GA 3LF2A 2IRWA 1TA4A 1D4FA 5LCXA 3GA0A 3PI7A 4WLFA 1GDHA 1WXDA 1Z7EA 1R66A 1H5QA 4IM7A 3VPSA 4PG5A 4PLFA 1NNUA 1D1SA 1NM5A 2DPGA 3CH6A 3BMOB 3BMCB 2ZJ1A 5JYDA 4CMCA 3IP3A 3E5MA 1QXSA 3JSAA 1JN0A 2R00C 1PWZA 2Q4EA 4TRNA 1LUAA 3FWZA 1PS0A 4RL6A 4RVDA 4LVCA 4WCDA 1MG5A 2QYSA 5TX7A 5CDGA 1OFGA 1IE3A 4YB8A 4FC7A 4FOSA 4P4NA 3K2EA 3I5MA 4PLTA 4E32A 3KOUA 4NJMA 3VTFA 3UOGA 4OJNA 1I3NA 4CV0A 3HDQA 3PXXA 2YJZA 2JD2A 3DHYA 3OM9A 1I30A 4IJUA 4O1MA 4OM8A 3GGGA 2YQ4A 2WYWA 4RZIA 3BHMA 3H7AA 5DP1A 5L7WA 1DIBA 4ZGWA 2PGDA 3E9MA 5KIAA 1N8KA 4YRDA 1O5IA 3JD0A 3OETA 4YJFA 4CLXA 1W8DA 3GAZA 3TNLA 4M54A 1WLYA 1Q1NA 4Y9DA 3FTNA 4CLOA 1T2FA 3V5NA 2WD8A 1V3UA 4LMRA 2HMTA 1GQ2A 3Q2KA 4XYMA 5JS6A 1WWKA 4QO8A 1JW9B 4R69A 4BB6A 3HN7A 1BG6A 1X7GA 2GO1A 1CQJA 1ML3A 2ZKLA 3D0OA 1C0PA 3IC5A 1HDRA 2Y05A 3RUHA 1DHRA 2EWMA 2QRKA 3E6AA 3PDJA 3UHAA 2G17A 3K5PA 4MVJG 3ANNA 4MIOA 4W99A 2YHIB 4DC1A 3G49A 4N5NA 3ASUA 2Q1SA 3PJGA 1JVSA 1NWCA 1ONPA 4GKVA 5J23A 1ONNA 1W0CA 2VYND 3VZPA 6ADHA 3AM5A 4ZQHA 1Z75A 4I9HA 1XLTA 3U4IA 1ADBA 1WZIA 1H94A 4L4RA 4CM7A 5KTKA 1PJ4A 1D7OA 4RF5A 2EF1A 3IKTA 3KYDB 4XQEA 4ND5A 4TRJA 4ZA2A 4B8ZA 3IJRA 1O95A 4ZN6A 3LLSA 4GQAA 4YJGA 2WSBA 3CEAA 3S2IA 5FI3A 5EMHA 4GLOA 3DBHB 3X2FA 3RUCA 4UEJA 5K9ZA 5KVCA 2ZCVA 4Z9FA 4DQXA 5EL0A 1G6KA 4NIMA 2UVDA 3QVWA 1KC1A 2WWRA 3GMDA 2QX7A 3RUIA 4XIJA 3RC1A 1AHIA 1Q0LA 4IMPA 1FDVA 1L7DA 3TL3A 4EITA 3OBBA 3QVXA 4II3A 4XDYA 2VWGA 3MJSA 4WLUA 5GY7A 3OICA 3Q9UA 2DPHA 1HDZA 3U9LA 2PFGA 1EVZA 1HTBA 2HDHA 4CQLB 1ULUA 1ISFA 1AN9A 1LC0A 1U5AA 4GVXA 3CXRA 1NP3A 1HDGO 4XQ9A 1GADO 5JDCC 5DULA 2Y0CA 4ZHSA 3IUSA 4PN3A 4XQGA 3H9JA 4L76A 1K3TA 2ZQYA 1H6CA 3AWDA 2JAPA 2O3QA 2O3SA 4FB5A 3IDSA 5K6AC 3QW2A 2BF7A 4YA6A 1NQOA 1P0FA 2NACA 3VZRA 3QWBA 4JP2A 1R16A 4UUMA 5B12A 3ZCXA 4J43A 3B6ZA 1KEPA 1Q7CA 2CFCA 4N5LA 1YL6A 4KP7A 4URFA 5JDCA 4GWGA 1BHSA 2P9EA 1E5LA 5ER6A 5ILOA 1A9ZA 1U3TA 2H5LA 4IDGA 1DJNA 3DZIA 5IN5A 1ZIDA 5HM8A 1W6UA 1MLDA 4TROA 3E5RA 1UP7A 4XB2A 5BNTA 3WX0A 1KEUA 3ZZNA 1GQYA 3LYLA 3RCBA 3HQ4O 1IULA 3VHRA 1A27A 4HNGA 4CMGA 3RD5A 5COAA 1N9GA 3ZNQA 5A9RA 3U4HA 4QX6A 4CMHA 1RYDA 2WEKA 1A72A 2O3JA 4PZEA 4Y8VA 4S3MA 5JCJD 4JJGA 4BNTA 2I65A 3JD4A 3H9UA 4KUGA 3W6UA 5L4LA 3C8MA 1QSGA 1NFQA 3K9QO 1G1AA 3PRJA 4B7UA 4XD2A 3TJRA 4YJDA 2PKQP 1M2WA 3RBVA 2X0NA 1PS9A 1J6UA 1WP4A 3D3WB 4RV9A 3QWHA 1BGVA 3H5NA 4ALIA 5F1OA 5I9MA 7MDHA 2VRCA 3RROA 1FXSA 1XA0A 3PYMA 3X2EA 3AI3A 4DGSA 5L4SA 2Q1UA 1I0ZA 3K73O 4OSOA 2ZB3A 3BMNA 3PLRA 1PZFA 4A0SA 1CETA 2OZPA 2BFPA 3PZBA 1DIHA 4PLYA 4BMNA 1YGYA 1KOLA 4FJ1A 2WTBA 4QTZA 2E82A 3RI3A 2VN8A 2DTDA 2PD4A 4Q3AA 1HYEA 3UXYA 4DC0A 4YJHA 4YT2A 2OP1A 2F1KA 2LDXA 3MJ4A 1FMCA 4O0LA 2VQ3A 3SJ7A 3PQDA 5JXWA 4WEQA 5FFFA 3D5QA 3JV7A 3AM4A 5JC1A 4BGIA 1K0UA 3WICA 4NG5A 1UXHA 4FC6A 2C82A 3O26A 3JYNA 1CJCA 1YQGA 3E8XA 4FFMA 5C37A 5F5LA 5B1YA 3INRA 2HU2A 4BVAA 2VOEA 4R1NA 2VHZA 4IPTA 1ZMTA 2AG8A 3W8DA 2GRAA 1GL3A 4LSWA 1AE1A 3B1FA 5EQFA 1M75A 1YE3A 3DZBA 3ZV5A 4RDIA 1UAGA 1VKNA 1F17A 1LC3A 3MOIA 4GI2A 1N7GA 1H6AA 3OP4A 3QWIA 3EW7A 4PIVA 2YFQA 3KSZO 4R68A 3E03A 4J4TA 3TOXA 3F6YA 1T4BA 4J1QA 1EK5A 2UV8A 3I9LA 3BTVA 4LISA 1I2BA 4D45A 1E7SA 3AUTA 3W8EA 1JLLA 4WECA 4M86A 3PJEA 3MWEB 1WW8A 2VNAA 3PDUA 3RAJA 2GZ3A 4IBOA 4DA9A 2W2KB 1CERA 4H15A 3U0BA 5JBIA 2GD1O 2OOSA 3UUWA 1ENYA 3COSA 3CZMA 4MVJA 4PRKA 3WDSA 4MOWA 1LRJA 3NTQA 5BNFA 3S2GA 6LDHA 3FR8A 3NDRA 4Z9YA 1DJQA 2VCYA 2ZATA 4UUNA 1NAIA 1Y81A 3BHJA 3OF2A 4BGUA 1B8UA 3DFUA 5LDHA 4FGWA 1QYCA 1R0LA 1P31A 2RBEA 9LDBA 3PPIA 1JWBB 3RFTA 4DLAA 2DVMA 3QSGA 5BSGA 3ICPA 3K96A 4AVYA 5DDIP 4NBUA 3U09A 5COBA 3TOZA 2Y99A 1E6UA 2VUUA 2POQX 4XR9A 4DUPA 4W82A 4E2WA 3WWZA 3PJFA 1GCOA 1JTVA 5THQA 4PG4A 3ZHZA 3L9XA 2J8ZA 1LDGA 4BKRA 3ETDA 1WMBA 3UKOA 2DBQA 4PLZA 1YKFA 3V1YA 3FI9A 2HO5A 3JQ7A 1F0YA 3H2SA 5I7EA 3JQ9A 4E12A 2JL1A 2B35A 4D0SA 2HQ1A 2ZTUA 1P3DA 2Q2QA 3UGKA 4XEHA 1P1KA 5TGDA 3ANMA 4DYDA 2C59A 2RCYA 1LNQA 4Z3KA 4CM8B 4RVHA 4LW8A 3TQHA 3FSRA 1QP8A 2WMDA 3FPCA 1YQDA 3KUXA 3FCOA 3LVFO 3RQSA 4WOJA 5BR7A 3GZNB 3ZU4A 1IL0A 4UEKA 4D42A 3PHHA 9LDTA 2YV3A 3A9WA 2D1YA 3PEFA 5F21A 3WLFA 1YS4A 4LRSB 4ZVVA 1XU9A 1JQBA 1DFHA 1YB5A 3DMTA 3SXPA 3ZU2A 3OHSX 1FJHA 2DFDA 4YQZA 3HFGA 3M1AA 3SX2A 4QT0A 1KVSA 4UVHA 2Y68A 4JBHA 4Z9XA 2BFAA 2O23A 4DTIA 3MJCA 4EBFA 2OHXA 4YTEA 3LQFA 3OJOA 5JC8A 3WTBA 1R37A 3L0DA 2DU8A 2Z1NA 4NFHA 4MINA 5AYVA 1P33A 1WVGA 4PG8A 2E49A 2ZTMA 4R9RA 2FMUA 1R6DA 5T67A 2J5QA 1ZMOA 1XCBA 3EDMA 5DOZA 4D79A 4N18A 4O6VA 3FBGA 3EGOA 4ND3A 1PJTA 2C7GA 1NR1A 1DEHA 1NAHA 3EC7A 4NK4A 4W9NC 3WNQA 4ALMA 1TXGA 4BKOA 4NU5A 1TEHA 4P38A 1NPTO 4TVBA 4WASA 4OOEA 1OAAA 1PR3A 1LJ8A 1H2HA 4W4TA 4CL8A 5JYEA 3I9MA 1IZ9A 4TRRA 2G1UA 1QYXA 2B5VA 2JD1A 2X5KO 4HY3A 4EZBA 3GVIA 2J3JA 2O3RA 1VRWA 1ZK3A 3WGQA 5IDXA 2JCYA 4A10A 1JU9A 4WNCA 3ROPA 4F6CA 5JMWA 1J49A 1R4NA 3UFXA 3ABIA 2E37A 3AM3A 1PGNA 4BNWA 3JQ8B 1E1KA 3CTMA 1LSUA 2EP7A 2GYYA 4TMFA 3V2GA 2GN8A 3C1TA 1V3VA 2A35A 4GH5A 4GPD1 3ZWXA 2Y66A 3WXBA 4KWIA 4CMIB 4HFMA 3MTJA 1CDOA 1HZJA 1DC6A 1VLLA 5I7SA 2CDCA 3O03A 4BO8A 1BW9A 4OXNA 3ZWOA 3EAGA 2FN7A 4DVJA 5CEEA 3O8QA 5B4VA 5T8KA 4BNLA 3QLJA 1PQWA 2O3UA 4GBJA 3GNTA 4J16A 1FDUA 5KNLA 1UXGA 3OJEA 1ZCJA 3HB4X 4IQ8A 3DC2A 2DLDA 2HLPA 3C85A 1SBYA 4CLRA 2X6TA 3ST7A 2B4TO 4BGVA 1I24A 3PJDA 1RM5A 4XRGA 3FTPA 3OECA 1CWUA 2Y1CA 4EEZA 4BQRA 1PU2A 3NAQA 1LRLA 3W4JA 1E92A 1PGQA 2QRLA 5IAAA 5COQA 3LLVA 3H4VA 4ZD6A 1Y9EA 1B3RA 5DBFA 3RVDA 3JQGB 2BFOA 4TKLA 3KLMX 4EUHA 2EV9A 3G3EA 4D3SA 2D59A 1SPXA 3PHJA 4IDDA 4J7XA 1LRKA 1IHYA 1SOVA 3ROMA 1KVRA 3MWDB 3GK3A 5EESA 2ZCUA 1QRRA 4CJXA 1BXKA 3EZLA 4IIVA 4TZTA 1LDBA 3GF4A 3TZCA 2W8ZA 2FPPA 2Y0DA 5EIOA 1ENZA 3QVOA 1SB9A 1U2DA 3EY4A 1M6HA 2CNBA 2HJRA 3ITDA 4J9VA 4MJLA 4MP3A 1F14A 4GX1A 3DBRA 5F1PA 4M49A 1ULSA 4YAEA 4E21A 1EFKA 3TF5A 1K6JA 3PZRA 1XKQA 4QSMA 4DIFA 4IJWA 3E48A 5TQVA 8ADHA 4B7XA 3JQAD 3UF0A 1ZXBA 1DAPA 1A71A 1R4MA 3GEMA 4CMAA 4QFCA 2DT5A 5BSEA 5U4QA 4AJPA 1WMAA 4AJ4A 1OMOA 2PD3A 3RBXA 3KXDA 4BOYA 1K2WA 4H7PA 3ZU5A 4NQZA 4WLEA 3PFWO 4GGOA 4JN6B 1JKIA 2YW9A 1Y5MA 3AFMA 1U5CA 3ON5A 4CUZA 2GGSA 3ASVA 4NH4A 4U6SA 4N5MA 4GMFA 4RVGA 4M55A 1LQUA 4CQMA 3KB6A 1DFIA 5CP8A 5DNAA 4BNXA 2NU7A 4J1SA 3ZNPA 4OAQA 4GX2A 5FYDA 1BDBA 3E1KA 3ULKA 4TWRA 3WGYA 5TJ9A 2X0IA 5C7LO 1XR3A 1ZSYA 4YRBA 4MIEA 1DRVA 3I9NA 4OYRA 1RKXA 3A14A 1E6WA 3GRKA 2NU6A 3K8ZA 1NVGA 5DBIA 1EDZA 3KYCB 3NGXA 3TL2A 2RH4A 4HWKA 2XAAA 2NTNA 1PQUA 2QZ9A 4A27A 2D5AA 2PR2A 3CSDA 2FZEA 4WLOA 3VDRA 3UCEA 1V3TA 2QG4A 2EJWA 3MJTA 4IDCA 1CRWG 4W7HA 4WLVA 4YCAA 3UCFA 1U8FO 2AEMA 5KVQA 5F1KA 1FDTA 2J3HA 3JQAA 2JFFA 5L7TA 4MVJM 4RDHA 2D2IA 1OZAA 4ND4A 3GR6A 1UP4A 4IJKA 4NBRA 2XPCA 4ID9A 4KWHA 1F12A 1S7CA 1R0SA 3DTTA 3SC6A 3GH3A 3OEYA 4QUKA 2J3KA 1Y8RB 3G17A 3CE6A 1FF9A 1YDWA 4YXFA 4MVJI 2DBZA 3I9KA 4I9NA 4E5PA 1Y1PA 3HG7A 3PWSA 2BLLA 1C1XB 5T6BA 1VE9A 2Q1TA 3TFOA 1YJ8A 3BA1A 1ISJA 3PWKA 1BVUA 4R3WA 1IPEA 3GVPA 1E0DA 3GN2A 1AXGA 5IZCC 2VTEA 4L73A 2CY0A 1DC3A 1EDOA 4WPGA 3VPGA 3FN4A 4R9SA 1HSOA 5B37A 3RFXA 4JBIA 1X1EA 4BB5A 3DWFA 5CDTA 2C7VA 2GPTA 5A4DA 3WOHA 8LDHA 3KV3O 1P44A 4JNKA 5TLSA 1T25A 4RZHA 4FFOA 4GAEA 4IZIA 2Y1FA 2GASA 3NDJA 1HRDA 1TT5A 1LTHR 4FJ0A 1KY5A 4WNIA 2EW2A 2TMGA 1SCUA 4IY1A 3VPFA 1JKFA 4CV2A 1I8TA 1HEUA 3TWOA 2JCXA 3PP8A 4ALKA 1EUDA 1JVBA 3VPXA 2D8AA 4FFRA 1YOVB 5TNXA 1PJ2A 1DOHA 1O9BA 4AJOA 3PLNA 3VPHA 5KJCA 3HJAA 3EUWA 3M2TA 2R00A 4YACA 1ZZEA 1H93A 2GR9A 2P4QA 2QHXA 3TZQA 4DPKA 4NMHA 4EJMA 4UULA 3BMOA 3BMCA 5JY6A 5MGBA 1ZK4A 1EEHA 3RC9A 4PG6A 4YT4A 3LT4A 3Q2IA 3HZZA 1NX6A 1ZEMA 4QQRA 4NBVA 4RPGA 3R3SA 4J3FA 1GQQA 3DZFA 4YDRA 1XQ1A 3IAHA 1HE5A 2PD6A 4IDAA 4L9RA 1V35A 3TZ6A 3JYPA 3LDHA 3G1TA 4BO3A 3KYBA 4ALLA 1X7DA 1BTOA 1SAYA 2P5UA 4R41A 4EJ0A 1SNYA 5JAQA 3RSHA 1U8XX 2VZ9A 1VL6A 1HDOA 3MTGA 4FFLA 4RF4A 4RPLA 5FEUA 1BDMA 1Y8QB 2I66A 2OGUA 1Y7TA 3S2FA 2IXAA 3PVZA 1E3IA 4FIZA 3JQFC 5TC4A 1B26A 1LA2A 1Z45A 4M8SA 3RU9A 1IY8A 3ZWCA 3FD8A 4XYEA 4KOAA 1K89A 4AJ1A 5AXBA 2I9PA 1HZZA 3GAFA 5A5EA 5IF3A 4QECA 5IXYA 3GHHA 1WDLA 2E6UX 3K2BA 2A92A 4I5EA 3PYXA 1HWYA 1T2AA 2BH9A 5TT0A 1JDJA 3SBOA 1HLPA 5CEJA 1KVUA 4NJOA 1EVIA 5L4NA 3QJ5A 2NTJA 2JJYA 4DWVA 1W73A 1Q0QA 4MPDA 3C24A 3U4DA 5A04A 3FNHA 2VUSA 2EGGA 3LK7A 2J5RA 2QYTA 3F1KA 3D4OA 4R5HA 5ENVA 3ZNOA 3ZWPA 4PVCA 4RLSA 4LN1A 1NHGA 4J0FA 1RYEA 3CMCO 1ZK0A 1H6BA 1HDYA 4OHUA 2HK9A 4KDFA 1K5HA 1PZEA 2NU8A 1DRUA 1E1LA 4GX5A 5L53A 1UR5A 5CAEA 1ENPA 1LLCA 2YHIA 3GGPA 1HXHA 4N7RA 2C29D 4L74A 3TSCA 1NASA 3AJRA 4E3ZA 1PX0A 3DEYX 5JPIA 5AOVA 5FF9A 3I3OA 3ONFA 3P5SA 4FPXA 5JDIC 3D3EA 1DPGA 4RPKA 1B8PA 2HMVA 1WDKA 1DIRA 3KYDA 1PTJA 2VZ8A 2Y1DA 1S6YA 4NR0A 1WDMA 4DLBA 2EHDA 3DOOA 2B69A 2DBVO 4MVJE 2ET6A 1PZHA 1BXGB 1ZNQO 3VH1A 2QIOA 3DBHA 4B3HA 1MP0A 3H65A 3IOYA 1WPQA 4INAA 2VYNA 2WD7B 4OXYA 1HYGA 1Q0HA 4NZ9A 5A05A 2O2YA 2SCUA 3AUUA 4F6LA 1ISHA 3KSDO 1NFFA 4S1VA 4YAGA 1DFGA 3Q9NA 2W2LD 3LZ6A 4M1QA 1GPJA 4J0EA 1XGKA 4JJFA 3BAZA 2OUIA 3ZWBA 4YPOA 5DN9A 4CQLA 1YH3A 3I1JA 3NX4A 4Q9NA 4R3NA 5HWSA 5K6AA 1B8VA 2WDZA 3DR3A 3GFGA 4BUCA 4DPMA 1VC2A 1HT0A 3GLQA 4NI5A 4RVUA 1G0NA 1MUUA 1XELA 3OMLA 4HNHA 2Y0EA 4BV9A 3GPIA 4BNUA 3ZDFA 1RM4A 1DLIA 2OORA 3RUDA 3ZW9A 1GV0A 4CMJA 4FN4A 1B3BA 5GMOA 1BSVA 3WMWA 4YYZA 3RC7A 1R0KA 4HXYA 3WGZA 3GDOA 1H6DA 4OIMA 5G4KB 1D8AA 2CDBA 3RFVA 5DT9A 2AQ8A 2QRJA 5JAIA 1VKOA 4NU6A 4MP6A 3HADA 4PZDA 1AHHA 3U62A 1U3WA 3UAGA 1EK6A 3JQEA 1B16A 4RGBA 3A28A 4RVFA 4XYBA 1TI7A 3F47A 3DBLB 2O3TA 2FY8A 3TZHA 4P4GA 5CDSA 3WGHA 2IYOA 3CINA 3ROQA 3ZN2A 3PK0A 2ZTLA 5HRUA 4R4JA 2AG5A 1XG5A 1EVYA 2YUTA 4L0QA 2A4KA 4IUYA 3L77A 3R1IA 3V2UA 4ZQFA 4D43A 3BZUA 2CVZA 2PKQO 3TZKA 4UAGA 4TKMA 4B4OA 5AQ1A 1QYWA 2FPIA 3L6OO 4GKBA 3I52A 1X7HA 4NHEA 1E7YA 2HMSA 5DZSA 1KVQA 2IZZA 4IS2A 4C7KA 1I01A 2CUKA 1M6WA 1ZFNA 1TLTA 3BMQB 2FR0A 1ZK2A 1HF3A 1E3SA 5TF4A 2WE8A 3HNPA 2HUNA 2I3GA 3D3WA 4FJ2A 1GU7A 1AXEA 3KETA 3HDYA 3UN1A 3QVSA 1YDEA 2A94A 5HBRA 4J7UA 4E31A 5JCJA 5ITVA 1E5QA 4RQUA 3GZ4A 4WJZA 4LMPA 4HADA 1GV1A 1ZVMA 3TDKA 2CVOA 5A9TA 2W4QA 4MVJF 2Z5LA 1U3UA 4AJJA 1MXHA 2B36A 3KM0A 4MDHA 4JX8A 3AOEC 3ZWMA 5JAZA 2GSDA 2PZKA 2ZB7A 5ADHA 1TT7A 2X7HA 4ZU3A 5CG1A 2I67A 4E2XA 4U8GA 1RM0A 1PIWA 4B4WA 4OQZA 4J4BA 3S8MA 1K6IA 3AOGA 3B1KA 2G5CA 1IPFA 2P9CA 3H2ZA 4JBGA 1EMDA 2C5EA 4Y67A 4XYLA 2IZ0A 1YONA 2VOJA 3ZWYA 4GX0A 5CDUA 1X13A 3HDJA 1WZEA 3PIDA 2IDZA 1HL3A 4ZQBA 1YVEI 1C0IA 3W1VA 1EE9A 4BHTA 2Q2VA 2B4QA 4UUPA 3U5TA 5A3JA 5L3ZA 1O0SA 1GEGA 4FDAA 4KDEA 5DCYA 1RM3A 4ESOA 3HE3A 4YR9A 3N74A 4TZKA 2XF8A 4DYVA 4AICA 5HS6A 3DXFA 3U4CA 5KJFA 1YWGO 3PQEA 3OQ1A 1RPNA 1DC4A 4BKUA 4E6PA 3CZRA 1T1SA 1QKIA 2X86A 3EZYA 4FSHA 4JK3A 3L6EA 5A9SB 3ADOA 1P0CA 2X22A 4GLLA 4TRMA 1E1NA 3JTMA 3DZHA 2O2SA 3VVBA 5A5FA 3ZHXA 2B0JA 2W2KA 3WBFA 1E6EA 3LT2A 2DBRA 3ZWAA 4XB1A 4JROA 2JCVA 4HFJA 5I9NA 5JFOA 2I6TA 2UAGA 2O4UX 4EDFA 4WCFB 2Z95A 4J6FA 3CKYA 4AG3A 3H9QA 1U28A 1PQPA 1HSZA 4KTVE 4ONEA 1NQ5A 4Q39A 1A4IA 1SB8A 4Z3DA 3IJPA 4J1TA 1UDAA 3OFSA 3N58A 1LSOA 4WCFC 1C1DB 1DB3A 1XQ6A 3PIIA 3WS7A 3VVCA 3KEQA 1ORRA 2BD0A 4XCVA 2CF6A 4Z0HO 3WIDA 3WGIA 2JKVA 1XDWA 3QIVA 4G81A 5LC1A 4BO4A 1U4SA 4PLCA 4FBGA 2YDYA 4R51A 4AJEA 1PL7A 4AJIA 4P8RA 4D3DA 1ISMA 3I6IA 3GEGA 1I36A 3MJVA 4YAIA 1V9LA 4FS3A 1C0KA 1VL8A 3MJEA 3NT4A 4GSLA 4K6CA 3RASA 5H82A 3ZU3A 1Z73A 5I8WA 3W8FA 4E4YA 4IS3A 2VHXA 5L45A 4ND2A 4RQTA 4EI2A 5IDQA 1QG6A 3KVOA 1Z74A 1E77A 3PHGA 3TRIA 4MP8A 3GMSA 3CUKA 2B5WA 4CM8A 1T24A 3P2OA 3ZH2A 1LEHA 5JO0A 3L4BC 2NVUB 2BI7A 4L75A 2VRBA 5ER9A 5CDYA 4HV4A 2B4RO 2HK8A 1YB1A 2V7PA 5KKAA 4LRTB 4DPLA 2AEFA 2UDPA 3GZNA 1JWAB 1QV6A 5IDYA 2HK7A 3S55A 1L7EA 5AXCA 2X0RA 4CM4B 1LXCA 1ZW1A 3H6KA 4BNGA 1B14A 4IDBA 1JKJA 1O89A 4CM5A 3FNEA 1YBMA 3JQ6A 5L51A 3OQ6A 3ENNA 3GPDG 2ZYDA 3HN2A 1C14A 4XA8A 1P1IA 2AXQA 3DAFA 2WYVA 4CLEA 4ZQEA 2HMWA 2ZB8A 1GD1O 2B37A 3GC6A 1PEDA 1ZBQA 3ITKA 4IQ0A 4IZHA 4K28A 4MKXA 4W9NA 2BHLA 2EJVA 3UVEA 4FR5A 1LLUA 3DZGA 5TT1A 3F5SA 2NSDA 4CM9D 4CPDA 4KMSA 3SLGA 3AU8A 3W4KA 4AJ2A 3WYEA 1HLDA 1I2ZA 3GDFA 3QQPA 2ZTVA 4BO0A 1U4OA 2PK3A 4QFDA 4FCCA 1X0VA 3WTCA 1UJMA 1OI7A 1A4UA 4R1SA 3E82A 1NFRA 1U7TA 1ZH8A 2ZB4A 2DAPA 3WWYA 3QWFA 2FSSA 1ADFA 2VUTA 3D4NA 4E5MA 2PV7A 2BGLA 3Q3CA 4RLHA 7ADHA 3ICCA 2I76A 3T7CA 2BFMA 4RPHA 2PA3A 4CLHA 3B1JA 3JQ8A 3UH1A 3O38A 2AHRA 1DXYA 2Q49A 3SJUA 5DOVA 2W90A 5JMPA 4O5OA 4CMIA 2EG9A 4CM1A 2XOXA 2V6FA 3JD2A 4L8VA 2GLXA 2NADA 5KJ1A 1YL7A 5A3VA 2NWQA 4W6ZA 2V6MA 4CR7A 3AUAA 4XJSA 2CZCA 3UCXA 3I4CA 3C3XA 2NQTA 3MOGA 3KHUA 5B4UA 2NNLD 1J5PA 3QV1A 1D3AA 1SEVA 4J49A 1QORA 3FNFA 2FZWA 3CMMA 1CF2O 1VI2A 2IXBA 5AXDA 3DAGA 3JYLA 3KRTA 2GCGA 1KERA 3FBTA 3JQCA 4GGPA 3L4SO 5I7VA 1WAMA 4E5KA 4NFSA 3FHLA 1ISGA 4B7CA 1IOLA 2R6JA 1GEEA 3JYOA 4IDFA 5ITWA 5H83A 4DIOA 1QLJA 1HYHA
chains in the Genus database with same CATH superfamily
2IPOA 4ARAA 3LC1O 2XOKD 4FT2A 3CN7A 4IOMA 2BHTA 2QBYB 3AERB 2Z8XA 2EKLA 3KQTA 1C0EA 1SVSA 1LJLA 1RRPA 1YRLA 2F9FA 2VQ6A 2ZWMA 2E0IA 3D3QA 2Q3FA 4QXMA 4WNAA 5DLYA 4LXGA 1E3WB 3Q8WA 3QRWA 4RBNA 3IB6A 3R9XB 4BNNA 4I1SA 2FG6C 3D2AA 4ZZ0A 4DR5B 2I4TA 3H1PA 4R9NA 4X54A 2FK8A 3UB4A 3EZ2A 5BN3B 4E30A 4I2VA 1K86A 3GDWA 4D44A 4E2ZA 5MFPA 2QQGA 3OPQA 1OB2A 5ICSA 3PHIA 1OLSB 4P81A 3O8DA 2D1QA 1Z2AA 1M72A 3Q3IA 4MQFA 3TFQA 2QLFA 1W36D 1PNRA 4FNMA 1RBYA 4U6QA 4HDKA 5ES4B 3QGMA 3TBHA 4BNDA 2PWBA 3QWAA 4HH1A 2XIJA 1Y4UA 3RTDA 4XDZA 4M89A 2A1TS 5BYJA 3A7EA 1K92A 1JFFA 4D6PA 4TM8A 4DMGA 2AVNA 2GESA 5AVRA 4K9NA 2G28A 5EZYF 4RHTA 4XZ3A 3G8BA 3LU1A 2QVLA 1YZLA 2I80A 1Q57A 2ABWA 1SU6A 4B3BA 3T5GA 1PR2A 3SLKA 6ABPA 4E5SA 4R1UA 1Z82A 4JCCA 4FQ8A 4JOBA 1DDOA 1FBNA 5CX1A 4UARA 2DWOA 1PR1A 2X14A 5CH5A 3WMXA 2IYPA 3THRA 1V6AA 3K72B 1P2BA 3ZK8A 5JW6A 2DBYA 4NV0A 3N8DA 2Q3EA 2FWIA 2CUZA 5H80A 1OC2A 3F5QA 4F46A 2PS3A 1OVGA 5ALSA 1RQ2A 1P1RA 3EVTA 4PIPA 4AP5A 2QD2A 3JQDA 4QA9A 2HMAA 1JILA 5LPNA 1V48A 1BS9A 2FPUA 3IOEA 1SBTA 3KZMA 4DMHA 2FDCA 4ZO6A 1OI3A 2PKYX 1Q44A 4NBWA 5ALZA 5JXGA 1PS8A 1A82A 1ESDA 1XHEA 2HH9A 2QP4A 3DDOA 1YJCA 2I99A 4U7FA 2PY6A 1A96A 3CRRA 3RLFA 5IEJA 2XNHA 2VJLA 4RD1A 4AZWA 4LG1A 3HBAA 2HHLA 5KUTA 2WQZA 4F12A 4FQ5A 1KY2A 3QUCA 4HDSB 2JAOA 4HUJA 3EGXA 3GHYA 3L6DA 1JYFA 4H4DA 4HLDA 4LTDA 2GEFA 4P3NA 4Z51A 3BB4A 2YYAA 3CX7A 4OBWA 1LKZA 1F2TB 1F2UB 4CKWB 2GH1A 2WIKA 4CKYA 3V8NA 3TL6A 5AVOA 3OHPA 4PVDA 3RRXA 2WSIA 3KWFA 1KYWA 1RW4A 2HIHA 1S01A 2VP5A 2FETA 1B0AA 1N3LA 2IUYA 4RH3A 5A0FA 4JOCA 1DOAA 4I5DA 3CVYA 1UP6A 3GJQA 1G21B 1PWXA 1RR6A 1YI8A 1TZCA 1GSAA 3GJZA 3EIEA 3RHZA 3UBMA 3E5NA 2LIPA 5BR8B 4Y9RA 5LQJA 2Y6UA 2OHIA 4D4HA 2I7XA 1MIOB 4NOJA 3VU9B 2DZDA 3TB4A 3ZG6A 3C1AA 1FRVA 4RGQA 2XQIA 4WEOA 4YCBA 5ELMA 2RGEA 1ZINA 3QUQA 4Z8YA 5KYVA 5J59A 4ARBA 4TMTA 1U7XA 2O54A 1S2OA 1ID1A 4KV7A 4X63A 5JXIA 1LNZA 4XQCA 3HCPA 4GLJA 1U81A 2CXSA 5CBPB 1Q2UA 3I28A 1C1XA 4MJ3A 4V0RA 2QUBA 3A4VA 2XUGA 4R0VA 4D4IA 4D9GA 1PWEA 1YR1A 2R1VA 2JAXA 2OG2A 2PVSA 1KEZA 4GZ3A 4KAXA 3T38A 2HBZA 4ECAA 3VOAA 2DKNA 2OZLB 3ZZ0A 2C3PA 5ESXA 2IV3A 2OLJA 5BNZA 2HYIC 1O96A 4AL4A 7YASA 1ESZA 2WVGA 4ZDWA 3RUFA 4BKPA 5KWSA 4G5HA 1BXRA 1E3DA 1WNTA 3ENKA 5CA0F 4I36A 2VPQA 4L15A 3UAXA 3HXMA 3G79A 1WUJS 5M2QA 5U1PA 4RTOA 2GF0A 4Z99A 4BUZA 2XMZA 4YCNA 3NIDB 1VG0B 1IG0A 1JPVA 3C3CA 3FFWA 3KG2A 4Q93A 5M04A 4Q3LA 2AKYA 3C0KA 1DKLA 3AI2A 2OBLA 3CKMA 3OOHA 1S5PA 5L3QB 3HXKA 2DUWA 1CUIA 2CHEA 4L2IB 3VKGA 5BNIA 1P1FA 3IQEA 3N6VA 2IV7A 1FA9A 1JXOA 1S1CA 1YOVA 4E70A 3QM1A 4KQFA 3WGMA 4H3HB 3TTSA 1QCCA 1XJ0A 4PO9A 3GGSA 1Z4JA 2BELA 4C1NA 1U0LA 2BCEA 4L8GA 1E62A 1NTRA 5C8VA 1SVKA 3U4AA 5JI2E 3D9QX 1MQAA 1BX1A 2FLKA 4Q3CA 4YRAA 5I7AA 2ATXA 1SHZA 4AG5A 4EEKA 2AR7A 4H7FA 2WFMA 1SY7A 3VO1A 3AI7A 2PKXA 3VUFA 3DEHA 1IHXA 4PAGA 1KKMA 3SVZA 2Q99A 1AG9A 2R6FA 2ZIZA 3D3NA 3CZQA 4FKBA 4EL5A 1FU7A 4OYHA 2WG2A 1XPJA 3VHXB 2AMJA 5EZ6B 2HWXA 3D1VA 1KMHB 3HJGA 3ONEA 4BNVA 1FYWA 2FUKA 1BQ4A 3O8LA 4MV8A 3VR5A 3WZ2A 1F4PA 4BN4A 1KOGA 3CJRA 5E6RB 4D0RA 5K0SA 1NP6A 3QIAA 5I5GA 3OG9A 4OJMX 2JHGA 5KJ6A 1HKHA 3V3KA 2QQ5A 4K9QA 3BXXA 3AF6A 1GZ7A 1VBNA 3L0ZA 3O47A 2FHPA 1JA1A 3TBFA 1FDOA 1TU4A 4Q9AA 1JXMA 1YZHA 2E4AA 3C98A 1FB5A 3ZS9A 4YRJA 3QUAA 1YJAA 3NBUA 5FJJA 1KF0A 4OKNA 3R5JA 2G82A 4NENA 1E2EA 3WSVA 3H0CA 1DLJA 1GY8A 3TUIC 5I7RA 4YCSA 4NCIA 4ZVUA 1ZKMA 1YIAA 1S7GA 1DMSA 3KDPA 5EXDA 1C3VA 4C9BA 1XVLA 3CNLA 1F0NA 1FNCA 3FCEA 3M6UA 1ZU4A 5IBPA 1B4DA 1Z6AA 3RC2A 3OFKA 3T3HA 4CU2A 5B2FA 4NXNB 2RHLA 2QL6A 3RVKA 2LDBA 4LNHA 5IAEA 3KJZA 5CT8A 2DQ4A 4U4AA 3V4FA 2BRUA 2Q8NA 3CIFA 3UKDA 1AKRA 1M1NB 2EGHA 2YJ5A 1WUIS 3K0BA 1UODA 4FEYA 3N5KA 5ALMA 2ILVA 3SBXA 1EUZA 3HSKA 2R6AA 1ITZA 2BR4A 2C3OA 5I9LA 4W8GA 2CBGA 4X94A 2IE0A 3HWRA 4C14A 4B44A 2LD4A 4P32A 5JG7A 4PLHA 1NU6A 1RI3A 3D4BA 1ODJA 1F06A 1W1IA 5EIFA 3IUYA 3A2LA 2LNDA 1VCMA 2OAEA 2PPLA 2IHBA 3GLHA 1KH2A 1O8BA 1VPDA 1ZEJA 2DE0X 3SOZA 5LXTA 4DY4A 1T2DA 3GQVA 3RWMB 4DLWA 5JDIA 3ZYZA 2A5JA 2G8NA 1M1ZA 4MQEB 4B3CA 3SF8A 1XNGA 3V8RA 4X62B 2JFOA 3ZS8A 1N8NA 3OTWA 1QZUA 2WSSD 3BH6A 2RAPA 2VRCD 2XB9A 4PF1A 1N9GB 3WWCA 3NKLA 4RKEA 4EATA 3KLBA 3WZMA 2VT2A 3TO5A 3UEOA 1LS1A 3FRJA 4A26A 3Q41A 1J7KA 1YZFA 2RJOA 1NBMD 4MRAA 2JGNA 4AZSA 2PRKA 1ZGZA 5LVAA 1LBEA 1YMQA 3DWIA 3HCFA 3EMKA 5F52A 3DMRA 3GOQA 4JLPA 1UJ5A 2UUOA 1X39A 3KB2A 1OAOC 4E94A 4JENA 1S2NA 4LY6A 2ORYA 4Y6QA 2VH5R 3STXA 3WNDA 3ZE2B 3HSSA 2G5TA 2I3AA 1MPTA 4RANA 2V6BA 4Y7DA 4UDOA 3WP1B 3HLKA 2P69A 3OCZA 4QYMA 4O02B 1TYEB 1XEWY 4IX9A 4P33A 5EWLB 4DLLA 3WWDA 1YE8A 4EKDA 4G89A 4Y2GA 4F8YA 1GTMA 1UL1X 1QFXA 1VECA 4R1PA 1E18A 4V39A 4M3NA 4V1CB 3ZV6A 1X19A 2BE7A 2I1WA 2OV4A 1DQZA 4MTCA 3ERCA 1IK4A 5EJEA 4EYEA 3NJ8A 4EHLA 3ZV4A 4Z7NB 1RHMA 4F6RA 2HCTA 1OAOA 2OD2A 4YJHB 1KNXA 2ISCA 3TM5A 4B1FA 3A4IA 4TS9A 2QX9A 1JDTA 5CITA 2WWWA 1RRFA 4LYYA 4A5OA 4DV7B 2HNBA 2J6IA 2AI1A 2GCNA 4LY3A 2HAEA 4J1NA 4XX0A 2CSXA 2SECE 3D4LA 1DTEA 3VZDA 1FNSA 1A3CA 3JYQA 4NNJA 2GPWA 2X9NA 5DHSA 2V4ZA 5KX5F 4BO2A 2VYFA 2FOXA 3WJAA 1A9TA 1F60A 2FJPA 2FTKE 1JA0A 2BGJA 4ZOCA 1KFCB 4KPUB 3EA0A 3N8HA 1G20E 4WK0B 4A03A 3HCWA 4E09A 5I4CA 2Q29A 1FEZA 2BMAA 2XHZA 2ZYSA 1DAKA 5LZ4A 1WS6A 4A9AA 1YBFA 1ZSNA 2IPAB 2V7VA 1ETHA 2W6PA 5EYPB 5BVHA 2BFEB 5IN4A 1UJNA 4MROA 1AGNA 2F3RA 2R8PA 4MZXA 1ST3A 1JIQA 2J9RA 1JFVA 1QGOA 4WFJA 3WLLA 2N42A 4M0FA 5D5HA 3LXXA 2JFPA 2XZDA 4TVKA 5JWHA 4LJRA 4GZ5A 1FDWA 3BQNB 4KFSA 5H8WA 1VM6A 4XWWA 3Q3JB 2O1XA 4GOJA 3I30X 4RY2A 2R48A 4EEXA 5C3MA 3TGPA 2J6CA 3C7KA 1DIAA 5DE3A 4F56A 4HQOA 3J81A 3DBLA 2PGJA 1A9OA 5BSFA 3MAJA 4QXAA 4CUJA 1L4FA 1ESEA 2FZGA 5DM0A 4PTYA 1U80A 2G25A 2WLTA 3AR9A 1IZZA 1Z5NA 4KQ6A 3W5UA 4BGEA 4O25A 4WLNA 1AQUA 1Q7GA 4MQ6A 5KNCA 2ODAA 1WBJB 4BO9A 3QUTA 3SVTA 1IBCA 5J63A 2I3DA 5B3LA 3QPDA 5I47A 3F6SA 3UJNA 1Y9JA 5JH7F 4A2QA 1YCFA 3HMKA 3A04A 4JGBA 1NUPA 4O2LA 2IELA 3PTLA 5E2IA 2QGNA 4E46A 2P4UA 2VAXA 1NSTA 2ZIFA 3JQBC 3KDSE 4PFKA 4WVLA 4RELA 5CYPA 5EFZA 1JMKC 1JAIA 2BFCB 4ZJZA 2G5GX 4BMVA 2PMFA 5G2OA 3VKVA 5CFOA 1NG9A 2DLCX 4NBTA 2BM1A 2PX5A 1RKVA 3ACBA 2VLIA 3AR8A 1P2SA 3M9XA 3FSGD 3DUFA 3MD9A 1YOBA 2PMDA 4M1TA 3RGWS 1HETA 1MAVA 4D6YA 1JAYA 1OKKD 1ECBA 1SCDA 1SKQA 5ALKA 5FFMA 4D8TA 3IDAA 4AQYB 5DI3A 1XYYA 3Q12A 4D96A 3AOEA 4DEXA 3KZCA 1YO6A 1ZI8A 3KYJB 3GQBB 1T8WA 1UH5A 1ZGBA 2G83A 2GAAA 2OFPA 4I46A 1VA5A 3FDJA 5JYCA 4EB0A 1JZSA 1X14A 3HABA 3JQBA 4Q3NA 1QX4A 3GVCA 4PYNA 5TRTA 2NLOA 3VJLA 1CV2A 2XF2A 3QP9A 3LY7A 3NHKA 5FIUA 1PL8A 1ZXLA 2VBIA 4LBZA 2PX3A 2WJ6A 3DO5A 4YWJA 3TVDA 3H6GA 4CI0B 4LF7B 3K5WA 4BNIA 2C04A 1KGSA 4IIJF 2QN6A 5EVJA 3ZGZA 4Q3BA 1GUYA 1CY1A 4G2NA 4H77A 2FQQA 1Q1EA 4U5XA 3ER8A 2MSNA 1A97A 1ECGA 1M34E 2GJKA 4Z3OA 3L02A 3O91A 4H7IA 1CR0A 1FFAA 3RF6A 1V11B 4DADA 1XA4A 3ZX5A 1WB4A 3PNLA 3D7KA 3SF0A 1QFYA 1PG0A 3DEJA 1RDFA 2G0NA 2IZOA 4NARA 2O5EA 3WIEA 1W1UA 1UZAA 3MMZA 1P7WA 1N75A 3ELDA 4MGEA 3KSBC 4F9FA 1Y5LA 1E1MA 1HOTA 3KJQA 2I6QA 3UWOA 1Y7LA 3CLSC 3QK7A 3A4MA 3M1LA 1PTKA 1ZOLA 1PKXA 1RFGE 2ETVA 3LC2O 4WK4B 4ZOBA 2P1RA 2M6RA 1RJEA 4D25A 4DNPA 2YHBA 2HDWA 3CZ9A 4K8OA 1WHTA 1QQ5A 2BGKA 2Y1GA 3PD0A 3ZCSA 3ETEA 3BN3A 3G0HA 1DWPA 4W5RA 3VUEA 2I8CA 2ACEA 5BYBA 4ENQA 5L8VA 2IITA 4KXLA 1HO3A 1G9SA 1N5DA 3AINA 3FDXA 2QSUA 4HDAA 2H7VA 4PLVA 2IFTA 4Q4JA 3FPJA 5I51A 3KZXA 4WZBE 4D98A 1ATZA 2FHSA 3PCTA 2GHTA 4XGIA 5A9SA 1EVLA 1JR4A 5GZ6A 1TO6A 5IX8A 5FOVA 5KYUB 4BPBA 5EJGA 1XVTA 3DMTC 4UD6A 5KMGA 3FPBA 4D46A 3IUNA 4JELA 3W4IA 1GZSA 3RS7A 4U2DA 1KJZA 3SQMA 1Y48E 3KSUA 5C4MA 1NLYA 3IGFA 2D4HA 3DZKA 5KCZA 4Z4QA 2G63A 4WCFA 2OCAA 1COWD 3OIFA 4FBLA 3RC3A 1SKMA 1L6RA 1OBOA 1SHLA 1Z06A 2LVBA 2PGIA 3M4JA 4JFAA 5LP6C 3DJYA 1QZTA 4M1WA 2VWPA 1WZUA 1U3DA 3R76A 1AQNA 3GNSA 4GE3A 2AQIA 1P39A 1VSVA 3LDAA 5JCZA 2O6LA 2A9FA 4NRDA 1I3MA 4UQPA 4M9XA 2C96A 4IDEA 3BEDA 3URKA 2P6OA 3KOZA 1PG2A 1TKAA 1UFOA 1JQKA 4QUEA 2E9SA 1IUNA 4H27A 4ZJPA 2VP6A 2PLAA 1M1YE 3QV2A 4B3JA 1UIMA 4LI3X 2ENUA 1E6MA 4WE3A 1XX6A 2FRDA 1XDUA 1IU9A 2DEUA 4TXMA 1LV7A 5CIQA 1RSZA 3P9NA 3KZNA 3T6KA 3NHWA 4BX2A 1MBZA 3BWVA 1X74A 1U65A 2D7JA 1KIFA 2FLVA 2GUGA 3LOUA 4D1YA 5BMVF 4OA5A 3QMWA 5LP6A 2C4VA 4JLBA 1NVVR 1EB8A 4O4JB 5FLEX 3VXKA 4MO2A 2YCLA 5AM0A 5EE9A 1KO1A 1SD5A 2VZ0A 4DUGD 2QRUA 4LDPA 4KR7A 2E55A 1JAZA 2JD0A 1N9KA 5D3MA 2OE2A 4C0WA 1ONBA 5G0WA 2H52A 1X70A 2Q4OA 2VHCA 3D4PA 5HFAA 3S2YA 2OXIA 4II2A 1VTKA 2VP9A 3ZY5A 4EO9A 1H23A 5HM6A 4G65A 1P8AA 4UFOA 2A0XA 1RKUA 1T3HA 3LT1A 1U2GC 3O8QB 4LY0A 2QRHA 1GPWB 2V6GA 4YRMA 2QD4A 3HDVA 1DRKA 3HU2A 4M6WB 4EM6A 2ID4A 1DC5A 3BEOA 3LA6A 1N1GA 1E7MA 2HSDA 1YBAA 3BF8A 5ENDA 3ZEIA 2VPXA 1FE8A 1JEYA 2UYYA 1U11A 2W98A 4H7KA 1ZHHA 5JE8A 1KIAA 3PT9A 3R3JA 5JLAA 1K4MA 5TQ0B 2G6BA 2TRSB 2AC7A 1R7RA 4DLNA 1VE7A 3NAMA 3CF6R 5JSYA 4C7OA 1FXUA 2OQ2A 3WLEA 1H4QA 4F92B 3L6RA 4AUNA 3A4NA 1L3IA 1JBEA 5C35A 5DCUA 4YMGA 1FUKA 1FTQA 1SCJA 1KJ8A 2DWCA 3NXSA 3WFJA 3F0TA 1U2GA 4QTTB 1UM9A 3T7JA 1WOMA 1Y1LA 4GP9A 4EDHA 1FUEA 5CCBA 3PHLA 4WFIA 3JR3A 3QKRB 1OQAA 1T6ZA 2PUWA 2Q45A 3AB8A 3DMYA 3IUPA 3CURA 3QTTA 2Z8YA 4S35A 5EJ2A 3THOA 5IPFA 1X1BA 3NFYA 5AJYA 5CHEA 3SZLA 1GDDA 3NYIA 5IAJA 8MHTA 3H3JA 4S12A 4BO7A 2ZG6A 2FEPA 3AL2A 1KOJA 1JHVA 1P2UA 3EWSA 3MEQA 2OFWA 4HXGA 3DTVD 1MX1A 4UUAA 1TKBA 2X41A 3REQB 3IO5A 5FAXA 1SG6A 2HRRA 3RUEA 4YIHA 2PNJA 1L1FA 1E0KA 2GTHA 4ARZB 1A95A 1LQTA 2NQ8A 3KE9A 4EG8A 5BSVA 4NBLA 1Z12A 2AZXA 2PHZA 3WP0A 1NWHA 2I5PO 2QT9A 1WKVA 1OIXA 3LXUX 3AKYA 3QU4A 4NK5A 4Z4IA 3K31A 1TVEA 4UU8A 4BBJA 1XK7A 2RKWA 4I9UA 1GGMA 1X1RA 2XUQA 4NV1A 3MMSA 1JJ7A 4OG2A 4PZPA 1RQLA 4S1WA 4LFBB 4HNQA 4WZBB 4K1LA 3ROKA 4XSHA 1OE0A 2C9BA 1UWCA 2QD5A 4FNGA 5JPDA 4K26A 1P74A 3W2EA 1MAHA 4F7DA 1P7VA 1E63A 1OC4A 2G71A 3EGVA 4RAQA 4AQ7A 4PHGA 2ZJ2A 3QVJA 5G3YA 4QKQA 4FM9A 1EUCA 3B1XA 5K5EA 1MORA 3OM0A 3RHTA 2J5BA 1X7WB 3P97A 1I5RA 1WLSA 2I7CA 4OV6B 3S70A 1ODKA 1JMVA 2O1EA 1PJRA 4CDRA 4EJSC 5FPKA 4LTMA 1YB6A 4JASB 4ZVRA 3PYLA 5AW8A 4O29A 4Y2PA 3WK6A 1DI0A 2XGJA 4JBWA 2BJWA 3DXYA 4IJVA 4UCQA 2HREA 1E2LA 1LGYA 3ZX4A 3P2MA 1CEQA 2MMGA 4UVDA 2R751 3FOAA 3BL5A 2WINI 4G4IA 5JAOA 3D2CA 3SYKA 3AVUA 1CNEA 1EAYA 1NF8A 3EBOA 1KYYA 2MINB 3QE2A 4LCEA 5FULA 1FJGB 5AM5A 1J0BA 1SRQA 1OPRA 1ODCA 1NVXQ 4XGKA 5KB3A 1DG9A 5LUBA 4BFUA 4N3CA 4MRMB 3E22A 4U8HA 1VBKA 4RIEA 2PQ6A 4HXFB 1TOAA 5C5IA 1CEYA 1X7YA 4RKQA 3I8SA 2Y9MB 4K6FA 4EJSA 1SEPA 5K1SA 4XD7D 4YMTA 1J5XA 2FPRA 2IODA 5FA8A 2YWEA 1SO8A 5KJEA 5LMZA 1GN8A 2HPZA 2B1RA 2ZBFA 2J9FB 1E4EB 1AQYA 2IEIA 3CZ4A 2F3UA 3ESAA 4IV0A 4A16A 2P6NA 4DIUA 3HU5A 4J0HA 5A06A 2Y93A 4PCAA 2A30A 3EXEA 4EG3A 4JP3A 4IFBA 3T0FA 3NUGA 3EOAI 3IS3A 2FR8A 4RPJA 2GPJA 4RK0A 1JHMA 1PHRA 3M5PA 4HAWA 1E59A 3S5UA 2VJQA 1OASA 4B0PA 3B9PA 3PC8C 2I9KA 3E53A 3ABRB 5ARCA 2VAMA 1OGYA 1GNVA 4LOJA 4JR1A 3P2YA 5GJCA 4Q7JB 2WPDA 4ZARA 4P2BA 4BNZA 1OTHA 4YRGA 3EXHC 3SXJA 2W2OA 4H60A 3H17A 5H0IA 3ZNNA 4FGKA 1ULTA 4KX3A 1I1QB 4Y0AA 4B3DA 3B1WA 1ZY2A 1DAOA 1SBIA 2IE8A 2YOHA 1CQPA 2EFEB 1AS3A 2YV4A 2NV6A 2YXEA 3AEQB 3ZW8A 4ZHQB 2X8LA 4L3OA 4B32A 3G2QA 3F78A 3GL9A 1YVRA 3UHPA 4OP1A 3MLEA 4NMMA 1OCEA 4CEHA 2XCSB 1MAAA 4U7GA 1PGOA 3BK7A 3HJFA 4ZXFA 4HKTA 2EDAA 4ARSA 4B2IA 1G42A 3JD1A 1DTWA 2VDWB 4MS4A 4OAOA 3DKKA 3SYMA 3WQQA 1KS9A 1SVLA 5JAHA 4QOGA 3VR2D 2OUKA 1ZDMA 4NSNA 3EXHA 3LCVB 1KQPA 4LVNA 3FJYA 1FXWF 4LBVA 2FWMX 5DX8A 2DT8A 1UWLA 3SS7X 3K70C 3AVTA 1WRBA 5DBEX 3BIWA 4JQCA 4JC8A 3IO3A 4HH4A 1VIMA 4O59O 1CUYA 5D1NA 3V8BA 1VLZA 7REQB 3JD3A 2V9CA 4KUHA 5IASA 3GG9A 2FV8A 2RGUA 4HQ0A 1ZNWA 3QEAZ 1O54A 2AMFA 5H02A 3C45A 3ME5A 2I0FA 3IURA 1DKOA 2OG1A 3ZHZA 5K8IA 1JEDA 1M73E 3QBTA 5ALYA 1ZM4A 3DAOA 3WG9A 4AMYA 2W6QA 5GPBA 1ODFA 4DDTA 5K0LA 5G53C 1K5GA 1GPDG 1NF9A 3CB2A 4MUAA 4JXJA 1THMA 3DFMA 4UNQA 3FCUB 4JODA 4XM2A 2R2GA 1D2GA 3NH9A 1BS2A 3OIVA 1IBLB 2IRWA 1NUAA 5ALPA 4MAMA 4OATA 4P84A 2DQZA 3PI7A 3N39C 4MUJA 1OXSC 4WLFA 3H2HA 3OFVA 1R66A 2AN3A 2OR3A 5SZHB 3O4FA 5EOVA 3KQHA 1H5QA 3KUUA 3DWGA 2XB6A 3H11A 2YJ4A 3C3JA 3CH6A 1YC2A 3EIOA 5JYDA 2ZJ1A 3Q3VA 1F7VA 2AJBA 1RRMA 1LBSA 4LRQA 4M2LA 2BKVA 4CMCA 2GVZC 5K6RA 3LDFA 3CPJB 2ZZMA 3C6KA 4R1LA 1G4AE 1VI5A 4XFKA 4KJZA 1X80A 1UMCA 2AOUA 3A1VA 1H2WA 2XHEA 4HS4A 2GQ0A 4YP5A 1GWNA 4NTZA 1BVYF 4ZAFA 4TRNA 4MW2A 3KUKA 3K09C 3BX1A 4RVDA 4BDSA 2C5GA 4L3VA 2QYSA 4N03A 5DMXA 4DQLA 5LD2C 3KR9A 1VJDA 2CC2A 4CU5A 2EVWX 3DE3X 5GVSA 4P4NA 1ZNZA 4KE9A 3NBAA 3T3PB 4F5ZA 4EF6A 4RULA 5EWMB 1W5TA 1TMOA 4J2TA 4NJMA 2WM8A 4W6QA 2DWQA 3SHWA 3VYSB 4D9BA 2MR5A 3UOGA 1PV4A 1I3NA 3TE6A 4K6GA 3R7FA 4B76A 2YJZA 5CVTA 3IV7A 4C4PA 1BA3A 2JD2A 5FI0B 1I30A 1BDHA 3PCXA 2ZXUA 3F7OA 1SUPA 2GBCA 1XAGA 4MUIA 5TPZD 5GGYA 4HVTA 5DP1A 1EHIA 4QODA 2GWRA 4MI1A 4ZGWA 3RHSA 3DHVA 3E9MA 4NCNA 1QB8A 3Q6MA 5FHRA 4JIMA 4FONA 3D02A 4YRDA 3OETA 4YJFA 4I5IA 3KKQA 3N6RA 1YZGA 3K05A 4ZYZA 4Y9DA 3OZUA 1HTWA 4EA8A 1IK6A 2VBCA 5E2BA 2YXBA 5TQ2A 3CCBA 3EVBA 4LFAB 3HV0A 3TX6A 1GQ2A 3MAGA 3R3YA 1ZCAA 1XZDA 2ZB2A 3GW8A 3SHOA 3UMYA 2F1OA 4IEFB 4KLAA 5DV9A 5J4VA 2ZR9A 3B3GA 3BVPA 1TAHA 3HN7A 3RW9A 1BG6A 5IJ0B 3VTAA 4BLPA 5IF9A 1NVKA 4F85A 3MTIA 1MCZA 3QFCA 3FBWA 4R8RA 4E4RA 2BKLA 3QEKA 3VNSA 4DR6B 2BUAA 2UXBB 13PKA 5HTKA 3N28A 3TZEA 4MUXA 1UJ6A 1O95C 4HVLA 3Q10A 2I4OA 1QFJA 2PO5A 2VKQA 2V9PA 2YHIB 3LC0A 4LV5B 3R09A 2R47A 2F3TA 1G8FA 3G49A 4BATA 5BN5A 2QVCA 4TMVA 1ORWA 4EG7A 1FU8A 1NWCA 2JIZA 1ONNA 2YN4A 4L1KA 3VX3A 2B9VA 4UUQA 4YRKA 1PEAA 2YKGA 3CN9A 2A9PA 2QT1A 2CMFA 3NTXA 2XAUA 1TGYA 2XZTA 1RYBA 3U4IA 2J48A 1TRKA 1WZIA 3D6TB 1R64A 2OTCA 4WIAA 5AJVB 2QW0X 4GQBA 1GLGA 4JQZA 2FOLA 2PZ8A 1PJ4A 2WWTA 2ZPUA 1A7JA 1D7OA 4G0VA 4KR6A 4MW9A 5HKBA 2BTQB 4JBNA 3PQ7A 1X38A 4KRGA 2KSQA 1O95A 3IJRA 4B8ZA 3CU5A 2MWMA 1FUYB 2XITA 3HB9A 3LLSA 3LUDA 4GQAA 4XM0A 5K20A 5LOVB 1P4RA 1I14A 3DKPA 4TMYA 2FFAA 2AD5A 2BKXA 2W83A 1YZVA 4GLOA 3O75A 2YWJA 1WNFA 5EXEA 3RUCA 3I5YA 1AK1A 1MIHA 2YW2A 2ZCVA 4Z9FA 1Y6ZA 4DQXA 5JAPA 5EL0A 3UPUA 1G6KA 1WSWA 2ZZKA 4NIMA 1YHYA 4MWEA 3R0XA 4B80A 3BL8A 2WWRA 3GMDA 5F64A 5TR9A 5I48A 4NOLA 4UFPA 4IMPA 1Q0LA 2G4CA 3WMRA 1PT7A 3TL3A 1YS6A 4LBYA 1D03A 2QTTA 3QVXA 4II3A 4XDYA 2IS4A 3PNVA 5ALRA 4AWXA 3RABA 1Q0SA 3ZE1B 2Y0PA 4RD0A 3WQBA 4U2FA 3O82A 2W7TA 2BGGA 4JR2A 1ANKA 3B9BA 2B1JA 1CU1A 1AN9A 3VRHA 1JL3A 1KXJA 1XN4A 3HGTA 5KYGA 1JG7A 4GVXA 2V45A 1EINA 3VV2A 4EYQA 1EFAA 2QROA 4A0FA 1B93A 1EFUA 4TWAA 1NQUA 3B13B 4DJEC 2J3DA 1Z6YA 1XEWX 2Y8EA 2WF9A 3FDIA 4JSYA 1U3GA 4BP9A 4M0DA 4K3UA 4IAOA 2BF7A 5IJWA 3LCJA 1NUHA 1UM8A 1T1IA 1YB7A 3FYHA 4V0KA 3R0JA 1J2UA 3BHNA 621PA 2N0SA 2A0WA 2ZUBA 3UV7A 3ZCXA 3GZJA 3NTUA 4J43A 4J0GA 3B6ZA 4Y2YA 5G1OA 4RVCA 2GKGA 4URFA 3BXZA 3DFKA 4KP7A 5A0TA 2HSEA 5ER6A 1SWVA 5ILOA 1DAHA 3OMWA 4P54A 1DJNA 2YUIA 2VXBA 4LX0A 3AZPA 2ZYUX 1WUYA 3LG2A 3Q8XB 3E5RA 4G6ZA 4XB2A 3ZHUA 4V1CI 2QN7A 3CO0S 5HRCA 2XWSA 3WX0A 4GI3A 1BQ3A 4JP8A 5DGTA 3OT5A 1Q6YA 5B1IA 5L3RA 5FEMA 2PT7A 2A9JA 4XDGA 2XCQA 4BQFA 3RD5A 1J0EA 2ODEA 4ZT3A 2H5IA 1HMPA 2XSZD 2H17A 3ZNQA 2J0QA 3WBKA 2O5RA 5F2EA 4JJ6A 2WT8A 4Y8VA 4S3MA 1GUAA 2RG7A 3FPFA 4WL0A 1LVUA 1D2NA 2I65A 3EFEA 3H9UA 4GP6A 4KXXA 3W6UA 4RW0A 2Q3DA 1NFQA 4WHMA 4BTLA 4HDQB 4G84A 1GILA 1T9DA 2VHTA 3H2YA 4MA0A 2CXHA 2A5LA 2Y1WA 3ZGXA 2D0DA 2VTVA 3LLMA 4MUBA 5DCLA 2H8GA 1JKXA 4JEMA 3ZZ1A 1OU4A 4O2AA 4IEIA 1CHNA 3CF2A 1ZM7A 3D3WB 3QWHA 3V80A 1AKNA 4ALIA 4M9UA 4F5EA 2WSSA 2VRCA 1E1QD 4LCBA 4M9QA 1G8SA 2WNHA 3H16A 3IH5A 5FPPA 4L16A 1ZOOA 1T29A 3N3AC 1T8PA 2Q1UA 3HRIA 3LBYA 4M36A 1TYDE 4PPGA 4U1RA 4ZREA 3UV6A 2EQAA 3V6MA 3BMNA 3PENA 5DK6A 1NBMA 1AZTA 1M2FA 4FXPA 4G1CA 3SNHA 3VX4A 4A0SA 2JEYA 4BMNA 2H29A 2FFHA 1YGYA 5KHAA 1WSAA 2WTBA 2QMEA 1Z0KA 5EGSA 2E82A 1G8JA 2KJQA 3U6BA 1RJ9A 5C18A 2BP7B 5EKTA 3OLQA 3IERA 2X1VA 1BNCA 1RAGA 3ZTWA 2LDXA 3S5JA 4AKTA 3OESA 5G3ZA 1JTFA 4MWZA 2VQ3A 3PQDA 4IF6A 2C03A 3TAXA 1VIAA 3J80A 4ZKEA 2X7JA 3JV7A 1K8ZB 1Y8AA 5CNMA 4BGIA 2XZLA 1ETUA 1QO0D 2QVYX 1MMFB 3D6UA 3LECA 3TTTA 5KYXA 3GIDA 4HNTA 3HGQA 4FFMA 3OQIB 4TXNA 4WKNA 2P6PA 5LWQA 5B1YA 3INRA 3NB0A 2HU2A 1WU7A 3PDWA 3Q8LA 2VOEA 3DAYA 2AK2A 4IPTA 4KCGA 2G06A 4PSDA 1CB0A 1ZMTA 2JGKA 3SIXA 1EFDN 1CJKC 1U0JA 5KYTA 3OIWA 1PK7A 2OWEA 3B1FA 5KHOC 3EEIA 4UNSA 2R5FA 4MB2A 1Z4OA 5FLKA 3W6OA 5AHRA 2C2GA 5C34B 5T7BA 1EJ6A 1N7GA 3G2OA 3JTEA 1SCAA 1OJLA 2KYRA 3EW7A 5EPEA 1RFLA 1MOZA 1QVRA 3OEHA 2CL7X 1FP7A 2O0LA 3IDFA 3LVQE 3KSZO 3PFCA 5FPQA 4EPRA 1WXWA 3E03A 3GLVA 4MUGA 3G7SA 5CX4A 3F6YA 3TOXA 2PUBA 1HI9A 2O8BB 4HLUA 2FH5B 4YHBA 4IDOA 1GG5A 4J1QA 3IULA 3WIOA 2UV8A 4YCMA 5CLJA 1I2BA 2YX1A 2X13A 1E7SA 3ZPXA 4CTMA 4ABTA 4WECA 4HGYA 5YASA 1KEEB 3PJEA 3MWEB 2KBEA 1E99A 3QG1A 4HN2A 4P1ZA 2GKOA 5AKZA 3A37A 2R68A 1ZIOA 4IBOA 4BECA 4DA9A 5IYZA 1CERA 4L4UA 4RWZA 1X2EA 3CR8A 3TEMA 3CZMA 3FNIA 5DNUA 1VOTA 2MR6A 3BIFA 3NTQA 4FWBA 4HDRB 4YO8A 3S2GA 4LDZA 2ZDGA 4AIRA 3ZHTA 2OAP1 3NDRA 5BV2P 4E07A 3KQNA 1YR2A 2ZATA 5FXMA 1BHO1 1K5DA 2JW5A 4G67A 4PC2A 1L3CA 1NAIA 2F48A 2YFYA 3OF2A 2PTHA 1R0RE 1EWRA 5DJ5A 2XZOA 3DFUA 4ZK2A 3KBBA 1NXSA 4DSUA 1QYCA 2RBEA 2AMYA 4RTSA 2QMYA 3E3NA 1JWBB 2GX6A 1Z8HA 4JUDX 1XCGB 5AW9A 3W06A 4UM9B 1VRCA 1OBHA 5I6DA 1U28C 1CUUA 1O03A 2JGLA 4AVYA 3RYHA 4C88A 1JB9A 1FRFS 3RJMA 1A9SA 1FVOA 1XVUA 1QHXA 5BR4A 3LWBA 3NIGB 1E6UA 2JRLA 1XP8A 2VUUA 3FCSB 4D57A 3DE4X 3HEAA 4XR9A 4BC1A 4E2WA 4M38A 2QENA 1YCGA 2WMOB 1GCOA 4EY3A 5HE8A 1K3FA 4H18A 4ME6A 3MBOA 2WTMA 1UC9A 1Z34A 3AXTA 3L9XA 5THQA 3RTGA 4YYEA 2Y1LA 2AXPA 2WT4A 4LQLA 4PANA 3NYRA 2HD4A 1JMYA 3WXMA 1DTSA 1EWVA 3H83A 3NHSA 1UQRA 3MBIA 4JLOA 5DT2A 4REMA 3C16C 1O2DA 5I7EA 1QX3A 1WCIA 3JQ9A 4D8UA 2BFDA 4BQIA 4D0SA 1K9VF 3LIIA 2ZTUA 3LY8A 4KXVA 3UGKA 1KAMA 3LQKA 1P1KA 1X9IA 1P5HA 2C59A 2RCYA 3LV8A 1LNQA 3BK2A 1YF3A 4RVHA 5ALTA 3ZDYB 1Z6QA 3JASA 4L4ZA 4LW8A 1L7OA 3AH8A 2WMDA 1KDOA 1U0FA 1YQDA 3KJGA 2HQBA 1L5YA 4MR9A 1P9NA 2Z2XA 4P86A 3OBIA 3UJ6A 2CLLB 2FEMA 4NY1A 4ETWA 5GJBA 2QUIA 1ULBA 2P2LA 3LVFO 3RQSA 1MOPA 3UJAA 1CP3A 3JALA 3VNAA 4YK7A 3WLIA 1IL0A 3IA7A 4KR0A 4P4SB 5AP9A 1XLWA 4IGKA 2CLFB 2PVCA 4JL8A 1DEXA 2YV3A 3A4LA 3FI0A 4BJ1A 3TPZA 2FSHA 4NPAA 4OI4A 3WLFA 4LJSA 4ZOAA 1YS4A 1JQBA 5LJIA 4BCDA 3SXPA 3ZU2A 3T99A 3TKAA 2IPXA 4P92A 1Y0BA 1JKJB 2PUTA 3A2MA 4GQIA 2VRWA 3NIBA 1YV9A 1W4CA 3W2GA 1C9JA 2Y68A 4TWBA 2BFAA 2AG0A 2O23A 2QMUA 1AOXA 2A0YA 4DTIA 2GEDA 4CNQA 1Y8ZA 1BWRA 3ODGA 4EBFA 3ZI7A 1ZD2P 3AKDA 3LQFA 3OJOA 4QHYA 1AUOA 3TIFA 2PZGA 2XOEA 2XNJA 3MGKA 3M0EA 1B43A 4KVAA 1XZJA 4LNUB 4RK4A 5E2AA 3SKVA 3G2HA 1LPNA 3H4IA 4PG8A 2HADA 2AFIE 4LHSA 1R6DA 5HQ3A 2FA9A 5T67A 4F21A 5KKNB 2UUAB 2J5QA 4MRPA 2PR7A 2QAGB 5DOZA 2NSLA 1ZGJA 3HZOA 1MJNA 1R6TA 2AZ4A 2FMXA 2ZWOA 3BGIA 3EGOA 3IKMB 4O6VA 3E9RA 3WYFA 4NK4A 1NAHA 3OPXA 4TXHA 4ALMA 2W22A 4NATA 1TQ4A 2OKCA 1TXGA 3MRTA 2G9NA 4I3GA 3A27A 2J0UA 4OOEA 5LP1A 1LJ8A 2FCRA 2BHNA 2G3YA 2GD2A 3BXHA 1H2HA 5JYEA 3VR3D 3I9MA 4TRRA 4JLVA 4GXRA 2F67A 3RIMA 1IG3A 1UMKA 4X85A 4YAWA 3AETB 2ZUEA 4B47A 5CIYA 4LF8B 4EQZA 2P2GA 3C41J 1MT3A 4AO7A 2O3RA 1VRWA 2YJTD 3GMIA 2H3EA 3B6MA 4BPRA 3QMVA 4C21A 1COWA 1JU9A 4AYWA 1BVHA 4D3ZA 4DLTA 3UFXA 4I55F 1VG9B 4BNWA 1E1KA 5K6TA 1LSUA 3U7HB 3F7NA 3SSMA 1XFDA 1HMYA 5PNTA 2NT4A 2BDEA 2R97A 3V2GA 4GPD1 4RDXA 2IHTA 3WXBA 1W9MA 3AR6A 3NBXX 2ANCA 4D9NA 3OC6A 2F17A 1DC6A 1VLLA 3O2NA 5CBKA 5I7SA 3GLFE 3CVVA 2YJNA 3L7LA 2NZVG 4WESB 3NORA 1P2VA 1BW9A 2B25A 3AF1A 1GGVA 1G5QA 2HRQA