5ENVA

Yeast alcohol dehydrogenase with bound coenzyme
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
347
structure length
347
Chain Sequence
SIPETQKGVIFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCELGNESNCPHADLSGYTHDGSFQQYATADAVQAAHIPQGTDLAQVAPILCAGITVYKALKSANLMAGHWVAISGAAGGLGSLAVQYAKAMGYRVLGIDGGEGKEELFRSIGGEVFIDFTKEKDIVGAVLKATDGGAHGVINVSVSEAAIEASTRYVRANGTTVLVGMPAGAKCCSDVFNQVVKSISIVGSYVGNRADTREALDFFARGLVKSPIKVVGLSTLPEIYEKMEKGQIVGRYVVDTSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Alcohol dehydrogenase 1
publication title Mechanistic implications from structures of yeast alcohol dehydrogenase complexed with coenzyme and an alcohol.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
total genus 110
structure length 347
sequence length 347
chains with identical sequence B
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2015-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5envA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 5envA01
1ZCJA 1C14A 2JL1A 1D3AA 4RQTA 2VHXA 2GN8A 2P5YA 4BVAA 2Y68A 4OOEA 4IM7A 4YTEA 4II3A 3TJRA 1IY8A 3KLMX 4YJHB 5ICSA 4F45A 2ZCVA 1K2WA 4UVHA 4K1LA 2DLDA 3MEQA 4DIFA 3LLSA 2X0RA 1PGOA 4PRLA 1QLHA 3HB5X 2FWMX 2C07A 1KC1A 3BMOA 4L8VA 1TT7A 4IZIA 4JJIA 4RF3A 1AXGA 1FDUA 1JKFA 4XD2A 4XIYA 5K0ZA 2YHIB 2DUWA 5LC1A 3EHEA 1JKIA 4HFMA 5KOIA 5IZ4A 4AJLA 1RWBA 3RAJA 4LN1A 3RC2A 4CR6A 3DZGA 4Z3KA 5ES3A 2BHLA 3EK2A 4NBRA 5ENVA 4Z9XA 5C3MA 1YOVA 4C7JA 1GPJA 2GGSA 3PIIA 3JQ9C 4RO0A 2Q2QA 1GEGA 4YB8A 3H3FA 4JK3A 4XX0A 3MJCA 5KIAA 1E7WA 3NJ4A 4R9RA 4F46A 3TPCA 5IDWA 3PWZA 3O26A 3TFQA 3TZ6A 2VNAA 3NT2A 4IJVA 3S2EA 3BAZA 3Q6IA 1GZ6A 3GVIA 3NGLA 4MIYA 2WDZA 1VJ1A 3F4LA 4ALKA 4BB6A 5BNTA 4MOWA 1YJQA 3RROA 2VHWA 3IQDB 3P7MA 4ND3A 4XQCA 4CM9A 4EJ0A 4YRBA 3JQBC 2GD1O 5CDSA 4DBZA 4G5HA 2BI7A 3RBZA 3PQEA 4RQUA 4ZJUA 4BKUA 1NVMB 2AEJA 3W4IA 2EJVA 2NUAA 1DHRA 1ENYA 3GRPA 5B37A 1EBUA 1Q0QA 3RFVA 3M1AA 1UDAA 3RWBA 3EZLA 4LVUA 3FNFA 3GA0A 4FC7A 1BDBA 1GV1A 1WLYA 3VZRA 4R3WA 4CMAA 3EW7A 2OP0A 1DJNA 1UP7A 3TDKA 1MFZA 2RHCA 3WYCA 4YVFA 4A26A 2A94A 4XJSA 3T7EA 4E13A 2DBVO 2DC1A 3O38A 3FTNA 2Q1UA 3HADA 1X7DA 2BGLA 5JAZA 4IMPA 1H5QA 3K30A 3D5TA 3KEOA 1C0KA 1EEHA 1ULSA 2XAAA 3F6YA 3QWFA 4RORA 3WYEA 4B7XA 1T2FA 2P91A 1AXEA 3CIFA 1N1GA 3BTVA 1K6IA 3H2SA 4OQYA 2IDZA 1Q7CA 3H65A 2O4UX 2G76A 4BQPA 5JFOA 3PP8A 4HFNA 1UDBA 4MVJP 5L7WA 6LDHA 3ANNA 3VPSA 2J3IA 4ALNA 9LDBA 1DOHA 3IOYA 5COBA 4R1SA 4XGIA 2EKQA 3AUSA 4CM6A 4BHTA 4EJ6A 5C5IA 4AJKA 3PGXA 3ABIA 4LSWA 1SEVA 4UULA 1F06A 4B3IA 4TROA 3C7CB 1QORA 3QV1A 1ONOA 1R66A 3ZDFA 3AM5A 1V3TA 3I6QA 4KQXA 3ZNPA 4IJWA 3JQ7A 2NACA 3BMOB 1LSUA 3FR7A 1D1SA 2VYVA 3U4IA 4LCEA 1SB9A 5TQVA 2AXQA 3AUAA 1OFGA 2V6BA 1YS4A 1GZ4A 4DLLA 2BMAA 2IEDA 1HWYA 2VHVA 1ID1A 4E5PA 1M76A 4AJHA 1Z7BA 3E9NA 3DXFA 1YOVB 1BWSA 2VHZA 4DBVO 5IZCA 3SX2A 2B36A 2VTDA 2Y1FA 1A7AA 2BFPA 4BKPA 1YQDA 5CDUA 1B26A 3GVCA 1K89A 1B16A 2B35A 4YDRA 3BTOA 1TVEA 2JFHA 3SXPA 4MP8A 2PH3A 1MLDA 2FN7A 5A4DA 3AOEC 4GKVA 3NRCA 4BNHA 4WOKA 4XKJA 4N5NA 2NNLD 1NHGA 3RU9A 4TRMA 2LDXA 1UXJA 3LC1O 2HUNA 4CLXA 2E37A 1E3LA 3WXBA 2X23A 2Z95A 2IZ1A 3HDHA 3DTTA 3VH2A 5KWEA 2B5VA 3D7LA 3I9KA 1UJMA 1PGJA 2E82A 4NQZA 3EZYA 5A03A 3JYLA 1BMDA 4AJEA 2I3AA 4CMBA 1LDYA 2ZYDA 3DB2A 3K5PA 5DP2A 1ZEJA 1R0KA 2I76A 3KOUA 3GAFA 1X0XA 4TQGA 4A0SA 4BKQA 1XLTA 1PIWA 2EKPA 2FP4A 1PS0A 4M49A 3LF2A 4P38A 3I3OA 1I2BA 4XYGA 3L6DA 2NTJA 4E5NA 3RC1A 3ZU3A 2VT2A 1BRMA 1B14A 1PR3A 5L53A 4U6QA 5TT0A 5ICMA 1BTOA 3PI7A 2XXJA 5A3VA 4D43A 3GHYA 1KETA 2VT3A 3VZSA 1L7EA 5TS3A 4I08A 4XGKA 4C4OA 3H7AA 1NQOA 1P31A 1NNUA 5EERA 4YJDA 3V2UA 1SC6A 1N5DA 1SPXA 4JXKA 3WTCA 3GMDA 4ILKA 3TOZA 4O5OA 1SCUA 3QVTA 4RZHA 1VKNA 1NBOA 4WECA 3RUEA 4CQMD 2DTEA 1ZSYA 3UF0A 1T2DA 5IN4A 2BELA 1ZUD1 4HFJA 4E2ZA 1PS8A 2B4TO 2GLXA 3PDJA 4JBHA 4FPXA 1YONA 2X8LA 3M2TA 3VHRA 1JN0A 3GPIA 1R4NA 4GWGA 3I23A 2EIHA 3JQDA 3PTZA 4JROA 4D46A 4OYRA 3IC5A 2Q3EA 3WGGA 2HO5A 4CMJA 2Q99A 3RQSA 2PNFA 4QT0A 1UXHA 2CMDA 3MWDB 2GUGA 2CFCA 5TRTA 1I0ZA 2C2XA 2FSSA 5A9TA 3FF4A 1QMGA 1EQ2A 3JQ7B 4IDBA 3JTMA 5ITVA 1NHWA 2PGLA 3F9IA 4L73A 4NZ9A 3H9QA 1S6YA 5I9MA 3FBGA 2HRZA 4CMHA 4WCFA 3P2OA 5TGDA 1E7RA 4YCAA 3STHA 3DDNA 1NTOA 4YJGA 3RCBA 4FBGA 3PZBA 2J6IA 4PGFA 1QP8A 2AEMA 3JYOA 1HLPA 4NFYA 4GX1A 1C0IA 4BNMA 4DREA 4TZTA 4OIMA 3ZV6A 2PH5A 4DTIA 3KUXA 4XJTA 4OO3A 3ZHYA 3LT0A 2ZQZA 4GI2A 4MIEA 5BSHA 1R4MB 3NUGA 4LGVA 4PVDA 3ZV5A 4MO2A 4XQEA 5JE8A 1ZSNA 1H6BA 3DZKA 4AJ1A 3TL2A 4RV9A 3E9QA 2J5QA 4BL5A 5L7YA 3OEWA 2YFQA 1WAMA 4PLVA 1A7KA 2NU7A 1E92A 5THKA 1GEEA 2TMGA 2NU8A 2RH8A 1YJ8A 3CEAA 1DC6A 1LDBA 4R68A 4CLEA 5JS6A 4K9DA 1B2LA 1ORRA 2GO1A 1KS9A 3OQ6A 4B7UA 1YXMA 2YDXA 3ZWBA 3QWHA 1LEHA 5EQFA 1DBVO 3ITDA 4DA9A 4TRNA 2VN8A 3RC9A 4D79A 2IE0A 4MVJD 4NNJA 4HADA 5JMWA 5U4QA 1TEHA 2FPIA 3TZQA 1LJ8A 1K6XA 3HN2A 4IIUA 3VZQA 2PFGA 4XB2A 1NM5A 1X1EA 4AJJA 2PZMA 3ETGA 5KKCA 2AMFA 2Y66A 3KSZO 3AWDA 3C8MA 3VZPA 5JO0A 5ENDA 4Q3DA 1LSSA 2PKQP 3OF2A 1QYVA 2X0JA 1B8PA 4CM5A 1ENPA 4RVFA 3A14A 3GDGA 3AY7A 3WIDA 1GYPA 3E5MA 3IIEA 5DF1A 3RU7A 3DAGA 2C5EA 4ESOA 1MG0A 2IXAA 2ZIZA 1I3LA 5K1SA 2D59A 1NPYA 3HWRA 1NYTA 5DDIP 4WOJA 4R1UA 1PGPA 2HK7A 2IZ0A 2CDAA 4B3JA 5KVSA 2D0IA 2TMDA 3LVFO 4ND1A 2OP1A 4XYEA 4XZ3A 4YT8A 3O8QA 1V35A 1GV0A 4O0LA 4DPMA 1A27A 1HE4A 3ENNA 1U3WA 2UUOA 4E2WA 4YXFA 3JV7A 4QUKA 2JCYA 4PVCA 4BIIA 5GZ1A 5FI5A 4G2NA 4J7CA 1ZJYA 1R4NB 1Y9AA 4OXNA 4R5MA 5JDCA 4XQGA 5EQDA 1MG5A 3GUYA 4Q39A 1VRWA 3AI1A 3RSHA 2P5UA 1K3TA 4TZKA 4JP3A 1HLDA 3AW9A 2VRBA 3JQAD 1JLLA 2ZQYA 2ZTMA 3JQ9A 2BRUA 1HDGO 2FR8A 3NTRA 1MFPA 4UEOA 4DXHA 4YQZA 2ZTVA 1DHTA 4A2CA 1I2ZA 4WCFB 4PG5A 4XB1A 2V7PA 4NBTA 3WFIA 2Z5LA 4YR9A 2B0JA 4OSPA 4YJGB 3ZCXA 3PFWO 2ZKLA 4AL4A 3C1OA 1ISHA 4B79A 4CPDA 1E3IA 5DCUA 2DPHA 5L7TA 2G17A 3G17A 1GUFA 4ZICA 1YKFA 4FJ2A 4CMKA 5L4SA 5AXDA 4FSHA 4BB5A 2VZ9A 3KYCA 3PYXA 4FC6A 3CMCO 1AGNA 4IJKA 3LQFA 3DZIA 2AQ8A 8ADHA 5DCYA 3ST7A 3KEQA 5COQA 2YW9A 4Z6KA 3H9UA 4J7XA 3GPDG 4QXMA 4CR8A 5KNLA 4DIOA 3O03A 5CHEA 4RVSA 3WG9A 1HDCA 2JAHA 4Y6PA 4RPLA 3FHLA 3KO8A 1ONNA 4KUHA 4YWJA 4CLDA 1EFLA 2NTVA 5ER9A 2CY0A 2JHGA 4XA8A 2VUSA 3KVOA 1H6CA 3I9MA 4JN6B 3OJFA 4J4HA 1X14A 4HXYA 3DMTC 1CEQA 3QA9A 1HSZA 5CDTA 1NQ5A 1WVGA 5JLAA 4ROSA 1SBYA 1U3UA 5KJ1A 4EYEA 3LK7A 4J0FA 3VPHA 3SVTA 1PTJA 2J3HA 5JDIC 4AG3A 1SEPA 2VZ0A 4E21A 1YB4A 4IDDA 3OA2A 2XOXA 4A03A 1PZGA 1ZMTA 3VH4A 3IP3A 1Y8QA 1H6AA 2YUTA 4BO9A 1OI7A 4BNJA 4UVIA 3EUWA 2ZCUA 4KWIA 2VWHA 4R3NA 3W8DA 4RPKA 1TLTA 1U4SA 5DBIA 2AA3A 3G79A 2YV2A 3WLFA 3QVWA 3JQ8A 4W9NA 4BUCA 2B37A 3IJPA 3VPGA 1DIHA 3PVZA 5DOVA 1BVUA 3DFZA 2QIOA 4MJLA 2PLAA 4CR7A 1ZVMA 1Z45A 3HDQA 3K2EA 4ZRMA 1DIRA 3AM3A 3ITKA 3PXXA 1FF9A 3AI3A 3UAGA 1CQJA 1VKOA 4A73A 1Y9EA 2QW8A 4AJNA 2O2YA 2JD0A 5K6AC 2SCUA 4R41A 1I5RA 2BFMA 1GZ3A 4Z9YA 1MGOA 3RBVA 4RF5A 3O8QB 4GX2A 2WYUA 5AYVA 4A27A 1ZKMA 4UUNA 2IXBA 5BNFA 3DBVO 3EGOA 5F1KA 3OA0A 3WGOA 4L74A 3QVOA 5B1YA 3JQGA 5LCXA 2HJSA 1L7DA 3E18A 4RVGA 1P3DA 2AG8A 4YAGA 1LSJA 3QP9A 3GQVA 4WJZA 3LC2O 3QSGA 1EDOA 4HWKA 3UH1A 1O95A 3BXXA 3ETEA 4MPDA 2WJPA 1IL0A 1U7HA 2Z1MA 4E0BA 3V1YA 1EUDA 3EDMA 1J0XO 2ZB4A 3BHJA 5FYDA 1O5IA 4N18A 1KERA 4PG4A 3WLEA 4LRTB 2W8ZA 3H5AA 1KY5A 1YQXA 3HB4X 5EPOA 2NADA 3F3SA 3M6IA 4OAQA 3NTOA 1U2GA 3W1VA 4R1NA 1DDOA 1E1LA 3A1NA 4CMGA 1IPEA 4OL9A 1X13A 4Z0PA 4BNNA 4GKBA 4XIJA 1UUFA 2OMEA 4E5KA 1DSSG 5CDGA 2GN4A 3C7DB 4M1QA 1P1RA 4ID9A 5JAMA 5TX7A 2IRWA 5IF3A 1L1FA 4CJXA 2CDBA 3SJUA 4BNZA 1WMAA 4U0JA 4UEJA 1LQUA 3UGKA 3DQPA 4ONEA 5IAAA 2O2SA 3OMLA 4FN4A 4R16A 1OZAA 3F46A 3GOHA 1BDMA 3AFNA 4IIVA 4A10A 4EZBA 1Y5RA 2Q45A 3KYCB 3TZKA 5DBFA 3MWEB 3U4DA 4J0EA 4H3VA 1UZNA 1LRLA 2HMUA 3FD8A 2FPPA 3V1TC 4CLHA 2QYTA 1ZZEA 4XYBA 5ILGA 1VL6A 1QR6A 4IPTA 4J1TA 2WD8A 3WJAA 1DO8A 4GBJA 1BXGA 2P9CA 5KKAA 4NHEA 1DAOA 2EP7A 1QYDA 1R0SA 2QQ5A 2VOJA 1PJ4A 4CLOA 4W7IA 3WSWA 3JCZA 1HZZA 2G5CA 4QO8A 3TL3A 3CSDA 1N1EA 1QV6A 8LDHA 1QRRA 2POQX 3D4PA 1P9LA 2I66A 4DQUA 2VWPA 1UP4A 1R12A 2I6TA 2VTEA 3I5MA 4CM3A 1W4ZA 2CDCA 4EW6A 1LU9A 2D5CA 1YGYA 2B4RO 3I6IA 3DR3A 1DFGA 2VUUA 2VUTA 5A05A 3PFFA 4CM9D 4CV0A 3GVXA 3N74A 4FOSA 3H6KA 3LT2A 2DBZA 4CLRA 4FOOA 3OJEA 3UXYA 1KVSA 5FEUA 2FZEA 4J7UA 3DHYA 2XPCA 1Y8QB 2BGMA 4RPGA 2YV3A 1GUYA 3I52A 1PQPA 4UUPA 3H2ZA 3HHPA 3WMWA 3WX0A 4BNFA 5LDHA 1GYQA 3DHNA 3UCEA 3NEPX 3WIEA 4BV8A 1GL3A 3JQ8B 4EUEA 1YWGO 2AE1A 1EE2A 1WDLA 2FOIA 4KDFA 4BO3A 1IOLA 1ULUA 3E9MA 4NJMA 4BGEA 4ND4A 1NR1A 3FNEA 1G0NA 1TXGA 4GLOA 3GEGA 3D4NA 5IJZA 5JYEA 3Q2KA 4GVXA 1WDMA 2DBQA 4CODB 2O23A 2VZ8A 2ZB7A 5JC1A 3NGXA 1BSVA 2YJZA 4CMIB 3CE6A 3UOGA 1A72A 1CETA 3TSCA 4MIOA 4DGSA 1EUCA 3TZCA 1I33A 4OSOA 4ZQHA 1HT0A 1EQUA 3ZWOA 2W98A 1BGVA 4BO1A 3JQGB 2EXXA 2WD7A 1YB5A 3KLPX 1QV7A 3CZMA 2Q50A 3VKUA 4PLZA 1NPDA 2ET6A 4X54A 5AXBA 2X5JO 1F8FA 2O4CA 4RF2A 4JNKA 4CM1A 2NU9A 5EN4A 5A02A 1DJQA 1XKQA 3LZ6A 2P2SA 4HFRA 3OIGA 3GVPA 1FDSA 1LRKA 3QHAA 2Q4BA 1PGQA 4XGNA 2C59A 1Q2XA 4E5MA 2BF7A 5CAEA 1MX3A 4J2HA 4I5DA 4KZPA 2P4QA 1GCUA 2DUUA 1JVSA 4JBGA 3RUAA 2NTNA 3TF5A 3WGZA 1FXSA 3GFGA 1ISMA 3HFSA 4XQ9A 2GZ2A 2ZYAA 3BA1A 5TJ9A 4QX6A 3D64A 3O9ZA 3FCOA 2HQ1A 2DU8A 3R6DA 1O9BA 4XYLA 2GZ3A 5T8KA 5FF9A 1TB4A 2O7QA 3BMQA 3WWYA 1K5HA 1EVJA 3U0BA 3ZNOA 4ALJA 1PQWA 1HDZA 5L4LA 2D1YA 2VYVD 4RGBA 2VCYA 1UZMA 4OOFA 2GN6A 4EGFA 2V65A 1Y7TA 4OKIA 3WNQA 2NVWA 3QWIA 3DFUA 3AUUA 4PCVA 2EKLA 4IDGA 3ZWXA 5JW6A 4CQLA 2H9IA 5JSFA 4RF4A 4HNHA 1BXGB 4NFSA 3DHEA 1GTMA 5C7IO 1K6JA 3SBOA 2X0IA 3TWOA 1MV8A 1YQGA 4ALMA 1KYQA 2O3JA 4CLOB 1CQIA 1N9GA 1M2WA 3TN7A 4J1QA 1U3TA 5G0VA 1BHSA 1VC2A 3GG2A 3JQFC 4W4TA 5C37A 3ANMA 5KJFA 1E5QA 4I9NA 5A9SA 4Y9DA 4L4RA 4N54A 1X1TA 2B4QA 2EP5A 2AHRA 2OHXA 3GAZA 4KQWA 4EUHA 4NI5A 4Q3BA 1GQQA 2Y1CA 4RCVA 1C0PA 1E3SA 4Q3NA 4NPCA 4WE3A 1PX0A 4CLRB 2XXBA 1VE9A 3PPIA 4CMEC 3A28A 4NU5A 1XGKA 2O3QA 3WNVA 5T6BA 1NX6A 3NYWA 4H16A 2BH9A 3UN1A 3GZNA 4AFNA 3ICPA 3ZU5A 1XYGA 1P44A 3V8BA 4NIMA 1LXCA 4KDEA 4E2YA 2E49A 1GADO 4XR4A 4NJMB 2Q2VA 2Y1EA 1NWCA 4W6ZA 3D5QA 1VJ0A 2HCTA 1I2CA 3EVTA 1UP6A 3Q9NA 4GLLA 2HMWA 2PGDA 4WEOA 2Q49A 3NAQA 4LRSB 5G0WA 2WEKA 4JIGA 1E6WA 3BMCB 1RPNA 2O48X 4XDYA 1ADCA 4DMLA 1P1KA 5A5EA 4XDZA 1I30A 5L40A 4GX5A 3MOIA 4Y6SA 1ISGA 2AQIA 1DLJA 2Q1SA 2WD7B 1PSDA 3PHLA 1E1KA 3G49A 4DC0A 3OHSX 2A9FA 4L0QA 3W6ZA 3OIFA 1QLJA 4IBOA 4FJ1A 3PJDA 1LDMA 5HBRA 3UHAA 3DEYX 4INAA 3EYWA 2HMSA 1R4MA 2YZ7A 3JYNA 2HU2A 5BQFA 2EW2A 3DO5A 4BOYA 4BQRA 1LNQA 3DZFA 3GEDA 3PHJA 1O89A 4PLGA 5I7FA 1UDCA 2EWMA 3L4BA 1LUAA 1G0OA 1HF3A 1TI7A 3PDUA 4ZQBA 5AQ1A 3DZBA 4XWYA 3UVEA 4DMMA 4U0KA 2NLOA 3RUHA 5THQA 3FRJA 2WM3A 1UAYA 3MCVA 1IHYA 3QWAA 4OXYA 1H9BA 3ZHZA 2FRDA 3BMQB 4R01A 3INGA 1ZSVA 2C29D 2GDZA 2V6FA 1FDVA 5B4TA 1X15A 1BXKA 2YQ5A 4BKOA 2EGHA 4N7RA 4IQ0A 5T64A 1KY4A 5ILOA 3K92A 1PR9A 2X58A 3GGGA 2HMTA 4WLVA 4OH1A 5IN5A 2HK9A 3FPCA 1HSOA 5G4LA 4CQLB 3QVXA 4JBIA 2JFFA 4BV9A 3LU1A 2FPGA 4NFHA 5IDXA 3IKTA 1F8GA 2PZLA 5L51A 4OHUA 4B7CA 1R16A 3GNSA 3GT0A 1N9GB 3Q0EA 2JHFA 1CWUA 4H7PA 3V5NA 2UYYA 2BI8A 2ILTA 1T24A 2R00C 4MKRA 5A9SB 2DKNA 1CERA 1Y81A 3H4VA 4BKRA 3OQBA 2X9NA 4YT4A 4AJOA 5A1TA 3N58A 2DFVA 2AG5A 5ITWA 3RD5A 4IXTA 4RJTA 3OP4A 1DRWA 4FGWA 2GSDA 2X5OA 3PLRA 3ZU4A 3GC6A 5F5LA 5JY6A 4DQVA 1XDWA 1WMBA 3GZNB 5K6AA 3INTA 4S3MA 1ZO8A 1QSGA 2Z1NA 2Q46A 3QLJA 1ZH8A 3PHHA 1EE9A 4YACA 2X9VA 4WLNA 3WFJA 3FNGA 3GY0A 5BR7A 3GVHA 5L9AA 4KOAA 3UCXA 2W90A 5TT1A 1HL3A 2GZ1A 3ZW9A 1AN9A 3JYQA 5CG2A 1SOWA 1HZJA 1B15A 2DBRA 1LC3A 4WCDA 4ND2A 1H0KA 2JFGA 4UREA 4I9UA 4J9VA 4PG7A 3WTBA 3FWNA 1XWFA 4PLCA 1DAPA 2QX7A 4BGUA 4FCCA 1KEPA 3B6ZA 4CM4A 1JWBB 1MA0A 2JCXA 2HJRA 4WLOA 1FK8A 3BMNA 1PZFA 3KZVA 3WMXA 3WYBA 4CL8A 4K6CA 1NQTA 2GN9A 3FI9A 3RC7A 3ZHBA 3PWKA 3GR6A 4WK6A 4IS3A 5I9NA 3H3JA 4RVUA 3KRTA 5L3ZA 4QSMA 1UAGA 3A06A 5IXYA 4KTVE 3ZGYA 5CG1A 1DC3A 4AJIA 1YBAA 3H9EO 4TRJA 3MJ4A 3DAFA 2B5WA 1DLIA 4GVLA 5F21A 1T4DA 7ADHA 5FI3A 1O0SA 4M86A 5DBGA 3VPXA 4GGOA 4AVYA 2CF6A 3C1AA 3UICA 1J4AA 1NR7A 2O50A 5JCJA 2C7GA 4BO5A 1UXKA 3OETA 3ADOA 1DIAA 4IJUA 4PLFA 4CV3A 5GZ3A 1YL5A 1V3VA 4PG8A 2B83A 1MB4A 4TWRA 2D8AA 3PRJA 5B4VA 1HDXA 1VPDA 4GPD1 1D7OA 3E82A 4PZDA 2ZB3A 1V9LA 4RVHA 4ZD6A 1N8KA 1BW9A 2W2KA 4QFCA 1WNTA 3OJOA 3AM4A 4RL6A 4M55A 3PJEA 4MINA 4EITA 3IKVA 1HETA 3DOCA 4HKTA 4OJNA 5L95A 4EJMA 2O3RA 5AOVA 1R0LA 3X2EA 1T2EA 3ZNNA 4R9SA 5IDQA 1D4FA 4D41A 4LISA 3I9LA 3QY9A 3I4CA 4B4WA 4JLWA 3H9JA 5CEEA 2JAPA 5HTOA 4PN3A 3G1UA 1DFHA 2I67A 3W8FA 2PKQO 2RBEA 3DBHA 4J91A 5A06A 3ROQA 3CINA 5B4UA 3PHGA 2NWQA 1IZ0A 1A9YA 1TT5A 1IE3A 3VDRA 1HYHA 2C5AA 3H9GA 1U8FO 1H6DA 2EGGA 4I5EA 3VVCA 5IFLA 1PL6A 2IEBA 2AW5A 5JPIA 3K96A 3T4EA 4BO4A 2GYYA 1MC5A 3F4BA 3IL2A 4YEDA 3MOGA 3CPSA 4M87A 4YAEA 3X2FA 1I32A 1C3VA 2VWQA 4M89A 3OJLA 2HKIA 4Y98A 3ADPA 3GGOA 1EFKA 2ZK7A 1YDEA 3ROPA 4XR9A 3F47A 2HAEA 2QRLA 3OECA 2FZWA 2PWZA 2PY6A 5GMOA 5JYDA 1NAIA 1I36A 4FD3A 1LLUA 3Q11A 4RZIA 3T7CA 3W4KA 4BO6A 4YT2A 4D44A 1E7SA 2YQ4A 3E5RA 4Z0TA 3RFXA 3P19A 5IZCC 5U9CA 3FPLA 4Z3DA 1Z82A 3AK4A 3DC2A 3JQEA 4PLTA 3DTYA 3JQBA 4GSLA 1YVEI 4LMPA 1P0FA 3GDOA 4NBVA 1LX6A 5CPBA 4CM4B 5L45A 4AJPA 1A71A 2IYPA 1KBZA 1YH3A 2C0CA 3IUPA 3PGJA 2A4KA 3AI2A 5TIIA 3BMNB 3VPFA 3RUIA 5IXSA 4M54A 2HSDA 3UCFA 2CVOA 4O6VA 4BNUA 3DBLA 5ADHA 3HQ4O 1H2BA 3H8VA 3JD2A 4MVJM 1DB3A 4BO0A 1E3EA 1VSUA 2Q4EA 3B1KA 1ZK3A 2E4AA 4PRKA 4QECA 5EJ2A 2O3SA 2VRCA 3IS3A 3D4OA 1ZK4A 2ZATA 3MTJA 2O3TA 2PA3A 2HK8A 4FFLA 5I7SA 1W6UA 3OFSA 5I7EA 2CVQA 3U4HA 4EBFA 4MKXA 2F00A 5JO9A 4ZN6A 1DRUA 3IP1A 4I5FA 4I1IA 1WPQA 4GMFA 3BHMA 5EINA 1N2SA 3K73O 3WGQA 2JKVA 3DZJA 1F12A 4N5MA 4GMGA 4YYZA 3VVBA 4OKNA 4WGGA 1V3UA 3GEMA 3L9WA 4MDHA 2A92A 3D3WA 3MZ0A 3PQDA 2ZTLA 4N5LA 1J5PA 2NQ8A 4CV2A 1XHLA 1V6AA 1LLCA 1BW9B 2W2KB 3CUKA 2UV8A 3KYDA 5KVCA 3QE3A 4BGVA 2Y0EA 1PJ3A 3OM9A 5TJHA 1E3WA 3SC6A 3GNQA 2RIRA 1K0UA 5TNXA 4BMNA 3ZWPA 2ZTUA 4LK3A 3HDYA 2F1KA 5C7LO 4RPJA 4DLBA 4KUGA 3QWBA 4YA6A 1NFFA 4CMIA 5H83A 2WMDA 3VTFA 1PL7A 1SO8A 3HNPA 3NT5A 4Y8VA 3E6AA 4DQXA 3KM0A 1PJ2A 3GH3A 2EERA 2J5KA 1GPDG 1CRWG 3PLNA 1NVTA 2V6GA 3DBHB 2FR0A 4FGSA 3OBBA 4E3ZA 3U62A 1EZ4A 2JCVA 4YT5A 1I3MA 1TT5B 2YY7A 3PYLA 3Q2IA 1PS9A 1OOEA 5HWSA 1Z75A 3EMKA 1U2DA 1N92A 2PGJA 4BNVA 4FFPA 3OQ1A 4J9UE 4R5HA 4O59O 5KJEA 2W4QA 3F5SA 4IQGA 1AHIA 3I83A 3DBRA 1RM0A 4FQ8A 3TNLA 2I5PO 3ENKA 1YO6A 5HS6A 5KJ6A 1BG6A 3GG9A 3QRWA 4WCFC 2PV7A 3KETA 5EMHA 3WB9A 4DC1A 1JVBA 4WLUA 1Q7GA 5I7VA 2CF5A 3AOEA 4D0SA 1N7HA 4F3YA 2VYNA 1NP3A 2PD4A 2NQTA 1PU2A 2P4HX 1OC2A 4I8XA 3GGPA 5T67A 3ZWWA 4DLAA 1ZFNA 1JTVA 1VL8A 3M1LA 4HNGA 4D0RA 3OICA 3COSA 4GL4A 4MVJG 3NT4A 1OAAA 1IB6A 1C1DA 4RLHA 5EIOA 3DONA 4Y67A 2OUIA 4J2OA 2C2YA 1ISFA 4NBWA 2YFHA 1Q7BA 1PJBA 1YL6A 5G0SA 1Y1PA 2Y1GA 2Y93A 1Q0HA 3IAHA 4XCVA 4CUZA 3ZWNA 4ITUA 4EEXA 4W99A 2DVMA 4J1SA 2ZJ0A 4MVJI 2GASA 3DBLB 3GN1A 1NQAO 1LRJA 3ROKA 3AFMA 1JAXA 4UUMA 2Q1WA 3JD3A 3Q3CA 1NPTO 3BZUA 2Y1DA 4K28A 1LC0A 3GMSA 1P1FA 2A35A 3GLQA 4B8WA 2GERA 1P1IA 2G0TA 2QYSA 5CEJA 3C7AA 3K31A 3KHUA 2Y99A 4ZVVA 4ALIA 7MDHA 1VJTA 1LI4A 2WE8A 3IUSA 5AXCA 4I9HA 4LSMA 4A7PA 3L77A 3WGTA 4ZQFA 1ML3A 3S2GA 2QZ9A 1GAEO 1ONPA 1O94A 2ZYGA 1GYRA 4E5YA 4BNTA 1ZMOA 3RKRA 1GQYA 2FHSA 4Q3AA 5JBIA 2Q1TA 5AVOA 3TFOA 3WS7A 2VHYA 4FFMA 1Z7EA 3FTPA 3D3WB 1D8AA 2BGKA 3IJRA 4R4JA 4BO8A 2DFDA 1C0LA 3QIVA 4NR0A 3SC4A 2NV6A 3U9LA 3KYDB 5F1OA 5FWNA 4IUYA 1E3WB 1HE2A 4HBGA 1ZK0A 4H15A 4JJFA 3ZW8A 2LDBA 1DXYA 2OBYA 3LT4A 4PZCA 2PR2A 2HDHA 3S1LA 4LMRA 2DPGA 4FFOA 4GAEA 3BMCA 1HXHA 1QG6A 1XQ6A 1HKUA 3AY3A 4UVDA 3ONFA 2EHDA 1M66A 1P77A 3KV3O 2PZKA 1U9JA 3K6JA 2P68A 4MVJH 4IDEA 5G4KA 2D3TA 3GUCA 3L0DA 5F3RA 4B4OA 5DZSA 2GNAA 2PKRA 4YAKA 1XR3A 4HP8A 2NVUA 5JDCC 3VH3A 1I3NA 2DAPA 1RYEA 5I8WA 4D3DA 3ZV4A 3WQSB 3U49A 4A5OA 3WBBA 2W2LA 4NK4A 3DBRB 5KVQA 5DNAA 3RUDA 4B8ZA 4I5GA 3RIHA 1E77A 3WGIA 1UZLA 3HZZA 1ENOA 4M8SA 5FFFA 4MP3A 2BFOA 2EF1A 3W6UA 3LT1A 3QW2A 1H93A 3JD0A 3MJTA 3BIOA 3HJAA 3TRIA 4FDAA 3OJ0A 1PL8A 4ZA2A 3PWSA 3SJ7A 3LF1A 4EDFA 4JQCA 2GCGA 4MP6A 4TVBA 1HDYA 4J16A 4HX5A 4IZHA 1NASA 1GFSA 2OOSA 3OEYA 1C1DB 2WTBA 3ONDA 5COAA 1WWKA 3P2YA 4DVJA 1T2AA 5U1PA 4JX8A 3V2HA 4OQZA 1AHHA 2P9GA 3ANLA 3OH8A 3R1IA 1Y5MA 3L4SO 1RM3A 3WGYA 3LLVA 1T1SA 1SAYA 1QXSA 4GH5A 4K26A 2Q2WA 3GZ4A 1EK5A 3C24A 1T2CA 1NWHA 1ENZA 5MGBA 4BNLA 1KVUA 1XELA 3KYBA 3O4RA 1X7GA 1U8XX 1AE1A 1PJSA 4U6SA 1HRDA 1NFRA 1XCBA 2PK3A 2YHUA 4QO7A 2OZPA 3ONEA 3B1FA 1LQTA 2PD6A 3NJ8A 1GQ2A 4PLWA 4P4NA 4TMFA 2UAGA 4TKLA 2VNSA 2I65A 2EEZA 1DFIA 1ZNQO 1IUKA 5BSFA 1UXGA 2D2IA 1VI2A 4NH4A 1TA4A 5TSDA 3EVNA 1QYWA 4FS3A 3RJ5A 1KIFA 2BKAA 4B3HA 3GRKA 1ZIDA 1CIVA 3OIDA 3PK0A 1KVTA 4YRDA 4W9NC 4UUOA 4BNXA 4BNGA 1LTHR 3VH1A 1H9AA 3JYPA 2E48A 4J4BA 3WOHA 2IODA 3BTUA 1DRVA 1WDKA 2CNBA 3M2PA 1E7QA 1MXHA 1WZIA 3E48A 4BO2A 5I9LA 3K2BA 9LDTA 1JQBA 3D0OA 4DIBA 5BSEA 5JXWA 3QJ5A 1UR5A 2V6MA 3EC7A 4BNYA 4FB5A 1B3BA 1H2HA 5BSGA 1RKXA 4QQRA 4IQ8A 3SLGA 1I3KA 3NDIA 5H81A 5G4KB 3L07A 3RFTA 3NKLA 3LSYA 4CMCA 1W8DA 4FFNA 2GPTA 3MJSA 3FSRA 4E4YA 1EBFA 5JMPA 3K9QO 2NVUB 3RBXA 3LC7O 4DL9A 4B4VA 4QTZA 3ETDA 4GQAA 1DIGA 2HMVA 1M6HA 5KTKA 3L6EA 1QYXA 4KP7A 1F0YA 1ADFA 1W73A 3I9JA 2FR1A 4DPKA 1KEWA 4J6FA 1JAYA 1YBVA 2RHRA 4GGPA 1EDZA 1HDRA 4RVDA 1E0DA 1MXFA 1JA9A 2O3UA 3A9WA 3NDJA 2B69A 4P22A 4R69A 5GY7A 4J90A 1IZ9A 3DWFA 1ZBQA 3W4JA 1WP4A 3HG7A 1A5ZA 4XYMA 5CDYA 3ZWVA 1EK6A 3G1TA 1DIBA 2X6TA 2J3JA 1PWZA 1WW8A 3MJEA 1V8BA 3P5SA 5G0TA 3VC7A 1E1MA 3L6OO 5DT9A 3A4VA 3ZWMA 1NAHA 5CEFA 1B7GO 4UVGA 3RASA 1W0CA 5JY1A 3ZWYA 2CUKA 4FW8A 1NXQA 4L9RA 6ADHA 3WJ7A 4D42A 2UDPA 2CVZA 3DAPA 3DMTA 3U4CA 4E2XA 2EG9A 4NU6A 4TRRA 4ZRNA 2H63A 4OM8A 3KSUA 5JDIA 3GFBA 4L76A 4ND5A 5DN9A 1ZEMA 2QHXA 3TZHA 2E6UX 3U09A 4BNWA 1IHXA 3TQHA 3DZHA 1MP0A 1I10A 4L75A 4Q9NA 1E5LA 5MDHA 2I9PA 2NM0A 4YBZA 4BO7A 4LCJA 3HFGA 5IG2A 1Y8RA 5LDGA 2CZCA 4PG6A 3QVSA 3MTGA 4AICA 3GN2A 4BMVA 1G6KA 4FFRA 2Y0CA 3HE3A 1CJCA 1KEVA 1XSEA 4D7AA 3F5QA 4J49A 3E03A 3F1KA 4PZEA 4PLHA 4BNKA 1U5CA 4FR5A 4PIVA 2AQHA 4U5QA 3TOXA 1Z6ZA 4OMUA 1PJQA 4EI2A 3GDFA 3RVDA 2R2GA 1YRLA 5CP8A 2DM6A 1U7TA 5DOZA 4J1NA 5JCJD 4DRYA 3CMMA 3ZV3A 1UXIA 1VM6A 4IGEA 3GHHA 1E6EA 3AOGA 1EVYA 3I1JA 4F6LA 1KVQA 4YQYA 3C85A 1FDTA 1Y6JA 2VOEA 1PJLA 1SOVA 2H6EA 1N7GA 4D3SA 2FMUA 4KUEA 3T4XA 5CPFA 3N7UA 4NDNE 1FMCA 5GZ6A 3IDSA 1SB8A 1O8CA 3KB6A 1X0VA 1XU7A 2RCYA 4GX0A 4OGWA 1P0CA 2X9GA 4Z9FA 3JQ6A 3IMFA 1HTBA 1I01A 3C1TA 2VWGA 3F1LA 1A4UA 1KOLA 2CD9A 1Z74A 2FY8A 2AEFA 1PEDA 4U7WA 4PLYA 4EEZA 1PZEA 2Y1OA 3UFXA 5TC4A 2NU6A 1P1HA 2DQ4A 1A4IA 1PJCA 2HRBA 4L4SA 4Z0HO 3WQRA 4P8RA 5HS4A 3GF4A 2X1HA 3L9XA 2X86A 1NFQA 3AJRA 1ZXBA 2QRKA 3ORFA 1U3VA 1YB1A 5HRUA 4NG5A 1QKIA 1GU7A 2OORA 3GK3A 5F5NA 4BMSA 5JC8A 1VL0A 1DEHA 1SMKA 2EW8A 3G0OA 1FJHA 1KC3A 3KBOA 1ARZA 5TLSA 1YBMA 4LW8A 3JQCA 3PJFA 3I9NA 1OBFO 2X7HA 1WZEA 3PIDA 1VLLA 4U8GA 1T1RA 1RJWA 5T8KC 1E3JA 3D3EA 4L4XA 4BGIA 4CQMA 1G1AA 1EVZA 4CUJA 4E33A 5KCZA 1OC4A 1ADGA 5A9RA 1LA2A 2I3GA 3KXDA 4ZGWA 5KJCA 4IGFA 3FNHA 2J5RA 3UKOA 3VOSA 1CF2O 2JD1A 3NV9A 5KVVA 1PWXA 1WXDA 1XA0A 5T57A 3S55A 2PD3A 2ZB8A 1R6DA 3ON5A 4QFDA 2GF2A 4TSKA 3UUWA 3FBTA 2JJYA 4IY1A 3WGHA 3CXRA 4E30A 3AU8A 4Q3CA 2G1UA 2X5KO 1CYDA 1OMOA 2R6JA 3BTSA 4UEKA 4IDCA 5G2OA 1JW9B 4R54A 4WLEA 3GNTA 1QYCA 5F1PA 3R0IA 1HDOA 1HE5A 1Z73A 1M75A 1P45A 2G82A 1Y8RB 1MUUA 5BNIA 2HLPA 3VKVA 4J43A 1RM4A 2ZJ1A 1D1TA 1P33A 1DC4A 4DYDA 2X0NA 1Q0LA 1T4BA 5A5FA 3DMYA 4WUVA 3FN4A 2UUPA 2VRCD 3VAZA 2EJWA 4C7KA 1JKJA 4WKGA 2X4GA 3E1KA 5A3JA 3BYZA 4R51A 4YPOA 3VDQA 4GSKA 3H5RA 1XU9A 1LDEA 1IULA 2VQ3A 4Y6RA 3ZWCA 4QEDA 3ZU2A 4E6PA 5J23A 3AU9A 5H82A 3NTQA 3JD4A 1UH5A 5T5QA 1J6UA 3SEFA 1BVRA 2J8ZA 4PLPA 3U5TA 1A9ZA 4ZQGA 2X22A 4D3FA 4DPLA 2QZZA 3HN7A 1LLQA 3HSKA 3MJVA 1PZHA 5AXAA 3I4FA 1LBEA 4AJ4A 5DCWA 4MVJA 5B12A 1BXZA 3V1UA 4URFA 3CKYA 3B70A 3OSUA 3Q1LA 3ZWAA 3VTZA 4YRAA 2NSDA 3FWZA 4HV4A 2D4AA 4PFJA 1T25A 1O6ZA 3S8MA 1ZW1A 1I8TA 3PJGA 4IS2A 4WNCA 2D5AA 4EUFA 4IMRA 1MC4A 1J49A 1LLDA 1XEAA 3HUDA 4W7HA 1F17A 2NVBA 4RPHA 4ZQEA 3L4BC 1LDNA 2YV1A 3D1LA 4ZHSA 1E7MA 1C1XA 1EMDA 2UVDA 3I9OA 3RKUA 4LVCA 4CM8A 4J4TA 3ROMA 3WBFA 3ZNQA 1B3RA 4XRGA 1LSOA 4DYVA 2OO5A 2AQKA 2YDYA 3CH6A 1E1NA 1GCOA 2OL4A 4IDAA 2C82A 4MVJF 5DP1A 3PEFA 4CQMB 4G65A 5JAQA 4BS9A 3JSAA 2Y67A 4WLFA 3ZH2A 2H1SA 4JCOA 4CL3A 4YAIA 5HA5A 3V2GA 3WWZA 1ISIA 3RI3A 3JQFA 1PGNA 3WICA 1XG5A 2DTXA 4JJGA 2PTGA 1V0JA 4YJFA 4D45A 4RDIA 2VYND 1Q1NA 1ZK2A 4OXKA 3AY6A 3HDJA 1SZJG 2PZJA 2IYOA 3C3XA 3CZRA 2FSVA 2RAFA 3JQAA 3W8EA 4CMEA 4GWKA 2BFAA 2OGUA 1PQUA 2H5LA 1JU9A 1KVRA 1ZK1A 2XF8A 3KSDO 1DC5A 1RYDA 3PYMA 4B4UA 2OXIA 1GDHA 1U28A 2EV9A 1ISJA 4YJHA 3EAGA 1T26A 1CDOA 5JAIA 1F14A 3WQQA 1AUPA 2C20A 1E6UA 2GRAA 3FR8A 3JD1A 1HYEA 1GY8A 2CSUA 1P74A 4HY3A 2GR9A 4NK5A 3RJ9A 3R3JA 3RUFA 3DOOA 1B0AA 2YYYA 3LDHA 3DL2A 1ZJZA 3EY4A 3ICCA 3WDSA 2YHIA 1HEUA 1R37A 5IDYA 3WR5A 3UW3A 1IYZA 2P9EA 4E31A 2WWRA 3ZN2A 5DULA 3E8XA 1RM5A 5JCXA 1XQ1A 2C54A 1H94A 4FJ0A 1GD1O 3INRA 3Q9UA 4NBUA 1KEUA 2QRJA 5L4NA 2DTDA 2BLLA 1PJTA 4WEQA 4XEHA 4NJOA 4CM7A 1ADBA 3B1JA 1JDJA 5I8ZA 1E7YA 3WSVA 1B8VA 4IDFA 4Q3EA 2OFPA 1M6WA 3BHIA 2IZZA 3ASUA 5C7OO 3ASVA 4TKMA 4IXWA 1I24A 1P1JA 4II2A 4WPGA 3NDRA 3ZI0A 1ZXLA 1M67A 1YDWA 2WYVA 4CUKA 4DUPA 1HYGA 2J3KA 1YE3A 5K9ZA 3SLKA 4MKZA 3PQFA 3PZRA 5A04A 4XRRA 3LYLA 4HUJA 3PHIA 4G81A 1NVGA 1XIVA 2WSBA 3NX4A 4O1MA 4NMHA 3CTMA 1U4OA 1HE3A 3ULKA 3B20A 2JD2A 4S1VA 2O7SA 3G3EA 3KTDA 4IINA 1EVIA 4ZU3A 4JP2A 5CFZA 5HM8A 3R3SA 3DOJA 1C1XB 4MVJE 1EUZA 1FDWA 4YAJA 3S2FA 1LDGA 3ZHXA 4CM8B 4KTTE 5G0UA 2I99A 1DPGA 2RH4A 2DT5A 3AUTA 4KWHA 4P4GA 4UVEA 5TF4A 4DWVA 1IPFA 4E32A 2W2LD 4CV1A 3QQPA 1X7HA 4RDHA 4RLSA 4K6FA 4FIZA 1B8UA 1U5AA 5BT9A 3K8ZA 5EL0A 1GR0A 3U3XA 4AJ2A 2WE7A 4O63O 4R1TA 2WYWA 4E12A 5ER6A 3RUCA 2AE2A 1SNYA 4ALLA 4W82A 2C7VA 4YJFB 1YL7A 3S2IA 2R00A 4UAGA 2QG4A 4TVOA 3ZZNA 1U1IA 4KMSA 4WNIA 5JNLA 2Y0DA 2Y05A 3H5NA 2BD0A 1VSVA 1R15A 2OBNA 4JGBA 4WASA 4F6CA 5EESA 4J3FA 4BNIA 3JQAB 1S7CA 1JWAB 1GUZA 4P4LA
chains in the Genus database with same CATH superfamily
3DVLA 3IAS1 4HPJB 2JL1A 1D3AA 4IG4A 3AETA 3KTFA 2P5YA 4P33A 5DI3A 5SZIA 1X74A 2IWHA 4BVAA 5AJVB 2CDNA 4YTEA 4BVKA 4MRVA 1ZUHA 1Z5UA 2F48A 2Z98A 4YJHB 2NUPB 4WZ6A 5ICSA 1BQEA 3N39C 2X40A 4PYQA 1E79A 4ZMSA 4JZYA 5D5HA 3MEQA 3E5HA 1JDTA 2JLQA 4BVFA 5J5CA 2X0RA 1IZ8A 4N0MA 4AN1A 4JBWA 5ADUS 3HB5X 2WHXA 3NOQA 1QRUA 1JHDA 4JI2B 1XMXA 4QTYA 1YZGA 1BE0A 2PYIA 1YNOA 2VDWB 1KPIA 2YJ3A 3GLUA 1JA0A 3CWZA 4RF3A 1JKFA 3H42B 3HPQA 5K0NA 4D82A 5BVGB 2CLCX 1JNYA 5K0ZA 2YHIB 2DUWA 3I04A 4V0RA 4FMCB 5KOIA 4FYVA 4A8HA 4BAGA 1RI2A 1RWBA 5KYYA 3DDUA 3SZOA 1T2NA 2BHLA 1YK0A 2JH8A 2VH1A 3GJ0A 2JFYA 4Z9XA 3N76A 1BGXT 2V7WA 1X19A 1JR3E 4C7JA 3EEFA 5C3MA 1GDTA 1F20A 1G21A 2GGSA 2XJ9A 4E3WA 5CT6A 4RO0A 3NEYA 1YR2A 2AMYA 3A9TA 3C8HA 3O7MA 1A5BB 2GBLC 3ZTYA 1PT8A 1RABA 1TM3E 1E7WA 3AF2A 3OQIA 2WJJA 1KSHA 3BG5A 3SBEA 3HXOA 1CQWA 2HA4A 3FHCB 3COYA 4X1YA 4QPCA 3TFQA 3VC2A 4BUZA 3SF8A 3S2EA 3BAZA 1AQIA 5JANA 1UFKA 3K16A 4MIYA 1OLUB 2WDZA 2E4XA 1AK2A 4Z1OA 1VJ1A 3F4LA 3DGEC 3EGDA 2GHTA 4XJXA 2G70A 5LIRA 1RQ2A 2VHWA 4JI0B 1KJQA 3IUJA 1XMOB 4RSRA 2RGYA 4EJ0A 3WKAA 1XXHA 2Q9UA 1EJ6A 4C22A 4MA0A 1NQWA 4LI3X 5EXSA 1NVMB 4GU5A 2IYLD 4I8IA 2VYCA 3W4IA 1FTYA 1SGWA 3C3CA 1KZ7B 1L4NA 1ENYA 3FH0A 2VJYA 3RFVA 1UDAA 2A0WA 2JIDA 1E2LA 4KQJA 1GG5A 5CXSA 2O05A 1EB8A 4LVUA 1Y6RA 3GA0A 4LNUA 5BRNA 2H7XA 1GV1A 4AD8A 4B3XA 4C2AA 2H4FA 3KKOA 4OFWA 3VHXB 4J6EA 5ILQA 1DJNA 2ACKA 3F9CA 4RJJA 3V8PA 1NDHA 3AUJB 4F4CA 1UP7A 2CEKA 1Z6QA 2W2XA 1MFZA 3WYCA 1YTLA 4RKRA 4YVFA 4QT4A 4FNGA 5KNCH 1UBSB 2VSFA 4QQKA 3VKHA 1XKLA 3T1QA 4ZALA 2XZPA 3JARB 4XUCA 1NA5A 4INPA 2CUZA 3W5UA 3OFND 1MTOA 4WK4B 1NVEA 2ZIAA 3C5WP 2XV1A 4BZPA 2Q1UA 3HADA 1X7DA 4OLHA 4DLYA 4F5EA 5JAZA 4PSAA 2PGIA 3K30A 4TQAA 1QH1A 3CO5A 1KYXA 2Q27A 4QBKA 5HMMA 2ZWAA 4B84A 1OIXA 1C0KA 1XTBA 4RX1A 1WQ4A 2XAAA 4RORA 5ALDA 2LPMA 4F4IA 4HNVA 2BBWA 3CIFA 3NGMA 2PR7A 3F49S 2QVGA 2IDZA 2IYVA 4ZZ2A 4NC9A 3WQHA 4Y1FA 2O4UX 2G76A 4BQPA 4QIHA 2IW1A 2UZIR 2XT0A 1GA6A 1UBFA 3S7ZA 1CF9A 4MVJP 5L7WA 3LC0A 3CRVA 1MGPA 5E4TA 5EUCA 2F8LA 2BUBA 1C7EA 2VXOA 3ITNA 2J30A 3N7TA 3O4IA 1DOHA 2NQ2C 4K87A 3C8ZA 2AJDA 4FXPA 1DOAA 2PG3A 1JQEA 3P20A 4Q9KA 4FMBB 4RNCA 2D06A 4DLVA 3R5TA 4XGIA 2XYHA 5AKKA 3SZLA 1KK0A 4NP6A 4CM6A 2ZRDA 2O2CA 5CLGA 1CVIA 2ALJA 3ABIA 4LSWA 3K35A 1PV4A 2BSQA 1YHYA 2WLTA 1WV0A 1FP2A 3CJRA 4FYKA 1HFEL 1UMDB 2WG0A 3C45A 3EJ6A 3RBAA 3COJA 1N4DA 1CLEA 2J46A 5DH9A 1EH5A 3ZBUA 1KQ3A 3E35A 3ZDFA 2X9QA 1NW7A 4IJWA 4JI1B 2VP3A 4TLMB 4X1OA 5F33A 2XYGA 1XQYA 3IBTA 4TYPA 3ZHSA 1SIOA 3BMOB 3EIOA 3OPNA 1LSUA 1MA3A 1D1SA 4TKVB 1USIA 2VYVA 3R7WB 4LCEA 5DLDA 4G0QA 4R1PA 4EG1A 3B3JA 3B38A 4ZCMA 1Q3KA 2QAJA 1OFGA 3AUAA 5I5EA 5LLDA 1ZVVA 1Z6PA 2Q0HA 2IEDA 1JALA 2Q8PA 1U7OA 3DDOA 1HWYA 1OZGA 4EW3A 2YNMC 4E88A 3W79A 5TR9A 1Z7BA 5JZ9A 1YOVB 2A57A 3SX2A 4NESA 4UE6A 4ZYTA 5AJZA 1WPGA 2Y1FA 2ZS9A 1C9EA 2BFPA 1G9XA 1ZS9A 1ZU4A 3QUBA 1YQDA 4AWBA 2FXVA 1HEIA 1K89A 1ZHOA 2B35A 2QJFA 2WWHA 3BDVA 3BTOA 1CP3A 4R9NA 3SXPA 2AOVA 2PMKA 1MLDA 1DTWB 2FN7A 2DLCX 2YS6A 4GKVA 3AEKB 4BQQA 4DCCA 2O5EA 2F1JA 3RU9A 1T3GA 3TM4A 3P2IA 1NG9A 2ZBVA 1L9KA 2R7MA 3LC1O 3MTAA 2JLYA 3NU1A 2SICE 1M0EA 4BC1A 2X23A 4WXRA 1CY1A 3ZR4B 2Z95A 2MINA 2QTVA 5I51A 4FM9A 3RS9A 1UAAA 1KZ1A 2ONZA 2PT7A 1E2JA 4UNPA 1E1RD 4XAQA 2G40A 3Q3HA 5KMGB 1Z8NA 3FW1A 3LUGA 1AKNA 2VDMB 4W5JA 4ZO9A 2R5NA 1DUIA 2IGTA 4NDAA 1UJMA 4GVPA 1PGJA 3OM1A 1D2GA 1AZTA 5A03A 4L8LA 3PC3A 3ZVKA 1E6CA 2EL9A 1RXSA 4PC3A 2I3AA 2QLNA 4GLJA 1LDYA 3M7IA 3IBCA 4UMFA 1KOJA 2C4MA 3EVDA 3O0TA 1R0KA 3BL6A 3KOUA 3LVRE 5KVAA 4RA9B 1NVWQ 4IEEA 3GAFA 3QVGA 3ROXA 1SVKA 5LZ7A 1QIFA 3FFAA 1PUIA 4ISCA 1PIWA 1RTTA 2EKPA 2FP4A 1I6LA 4YMWA 2WQ6A 3NR2A 1F1BA 5ALFA 5EIXA 2G25A 5IU6A 2X4IA 1WCXA 5EKSA 2AOUA 3RC1A 3TEMA 2XXAB 1XCMA 1M54A 1Z7WA 4R1OA 5LN1A 5L53A 4KAXA 3WHKA 1DQNA 4S35A 4FX2A 3QXSA 1Z2CA 4IXDA 4D9IA 4KXUA 2OLKA 4OSEA 3U7HB 4XUEA 3PI7A 2NO7A 3L1HA 1KFBB 5JJCA 3OZBA 4GF5A 3R44A 3LQKA 1MB3A 1FPQA 3OTGA 1O94C 3DT8A 1SUCA 2I4IA 3QH4A 1ZUNB 2ZETA 1T8WA 4BVBA 1P31A 4I1VA 4YJDA 1SPXA 2FEMA 1A8SA 1GDDA 2D1FA 3PUKA 4HNAA 4O5OA 4AY4A 1SCUA 4DFDA 1MN6A 3HR4A 3MNFA 3RUEA 1U9IA 5IN4A 3UF0A 4DR6B 1KHTA 2HL6A 2OPBA 2BELA 2WKSA 3RJMA 421PA 3DMHA 1O5OA 4E2ZA 1VOTA 3IIJA 3M6XA 3PDJA 4FDVA 3GLVA 3OPYA 4FPXA 3M2TA 3KKKA 3GPIA 3AKDA 1R4NA 1XXLA 5K51A 3V33A 3MD0A 3JQDA 3QXJA 1U3GA 4JROA 4D46A 3IC5A 4Q4DA 5IKMA 1CBUA 2YTZA 4CMJA 3AHCA 4QT0A 1VKZA 2Z08A 3QIAA 1CUSA 5TARA 4TT8A 2XMGA 4TWBA 2FFQA 4PPGA 3KEMA 3NP9A 2JGFA 3DE5X 3QPVA 4D98A 3SHVA 1QMGA 2QTLA 5FJJA 3SC3A 4NJEB 1ZISA 2AZXA 2IEYA 4I4TF 3SEZA 3KC2A 3TXXA 1I4TD 4ZZIA 3I8XA 3IOEA 2HRZA 5I9MA 3WMEA 1M3SA 1E7RA 2BCEA 2QJRA 5TGDA 3HYLA 3G8AA 3LO8A 4QOSA 4XWAA 1JIIA 4IF6A 4RK1A 2VBIA 4F12A 5BSKA 3VR6D 3V4VB 5CB8A 1ILWA 2J6IA 3EEYA 1RZVA 4Q19A 1HLPA 4YRNA 1IUOA 2XWJI 3KYJB 4KKXB 4KXFB 4TZTA 4H1VA 3C5HA 3ZV6A 4EA7A 1YJAA 3LUFA 4HLUC 4IFIA 2AD5A 2KQUA 2PH5A 4MGZR 4O1IA 4PR3A 4DTIA 1OY1A 3R77A 3FZGA 3DD5A 1R3UA 3SLRA 3LT0A 2ZQZA 4OHWA 4RD3A 5K5EA 4E22A 3ZV5A 2BMEA 3HS3A 3ND5A 3JTEA 3CLUC 3R6LA 4HDRA 1SKQA 3UJ7A 2C78A 4MKHA 3F8WA 3TL2A 2FEAA 4EVIA 4LDQA 4JI8B 2F8SA 4XGRA 2IVFA 5FLYA 2NYUA 4WJLA 2NX2A 2YFQA 4JI3B 4FKZA 1R6BX 1CY4A 4A8JC 3P52A 2EP8A 2NU8A 1TKCA 3D6MA 2IPOA 2V7QD 3C3BA 4EWLA 1OKKD 5BSWA 4CLEA 3QGMA 4L02A 1ELOA 4C0QC 2VHTA 4FK8A 3HJHA 5B1SA 5C4IA 4MUIA 3SYRA 5JS6A 2AUTA 4B7UA 4IR7A 4CCAA 4BVGA 3QWHA 5EQFA 5KQGA 1JJVA 2RK4A 4C0SA 4P3YA 2VYQA 2PS9A 2PCLA 3PX3A 4TRNA 1N5JA 2EFJA 4EG8A 4KMMA 5L3QB 3RC9A 1E94E 3QW4B 3ZQUA 4AS2A 4NNJA 4I4NA 2J0UA 4KHPB 1TEHA 3TZQA 1E1DA 4OBXA 1LY1A 2H54A 3FGOA 2ZRBA 1M5UA 1XTSA 2OGWA 4V39A 5JVDF 1NM5A 1X1EA 4S1TA 2HMYB 1ZICA 3ETGA 3OAAA 2FPXA 2QRPA 4QXOA 3DTNA 5KKCA 1P18A 1K97A 2Y66A 1U6IA 2ZLBA 2JASA 1OYWA 1TC2A 3CF0A 4ZVOA 4Y18A 2NPFA 2I8CA 4A6PA 2PO7A 2ZBQA 5E3IA 2HRDA 4LPKA 1Z3CA 4RVFA 3VKWA 3GDGA 4G0MA 4NMLA 1GYPA 2AR7A 4J0HA 5IK2A 1M5TA 1THGA 2YWHA 2VH2A 3QELB 3VTKA 1MG0A 2IXAA 4ESOA 4DG9A 1G8AA 1EXNA 2KBEA 1A77A 3D8NA 3KPVA 4I4TB 3DE3X 2DKFA 5EP4A 4K5QA 1NYTA 1IG0A 4GC5A 4R1UA 4F06A 1WB4A 2A6PA 4PXAA 3SEAA 4AI6A 2D0IA 1GPLA 1P5ZB 2P8SA 4ND1A 2OP1A 4YT8A 5BSVA 4TSRA 4O0LA 4WTOA 1U0TA 3IDFA 3NDPA 3X1WA 2VPPA 2H1FA 5C52B 1HE4A 3A1TA 3UC5A 4E2WA 2XCOA 2VSOA 4KR7A 3JV7A 4D26A 1TYZA 2OM6A 3X1ZA 2XHZA 3A4MA 3ECCA 3K5WA 5FI5A 2G88A 2ZRMA 4G2NA 1IN5A 1HR0B 1DAFA 2BSAA 3WKCA 2MMGA 3L41A 1XVVA 2A5GA 3BD8A 5F12A 4WY2A 3HB0A 1W85B 1V5GA 4UBJA 1O87A 2I54A 3NHKA 3TCKA 4PAGA 4PN7A 1VE6A 1A9OA 1PR6A 2CXXA 2IHBA 1M7BA 2JGIA 4JP3A 5LWHA 2VRBA 3PR2B 4RADA 3NUZA 3OCZA 4UEOA 1S9DA 2HXSA 4JLNA 4A2CA 4QVGA 1I2ZA 2BEUA 3IIKA 1A2QA 4AN4A 3TBHA 3FMOB 5IUJC 3DWEX 3W34A 4D74A 4FP9A 3ZCXA 3PFWO 4LQDA 5KC9A 5EEGA 1G8GA 3ZKWB 4MCJA 3C87A 1ZW6A 4WKNA 5DE3A 2V4UA 4B79A 3VNVA 3TQFA 4MNTA 2NOAA 4CPDA 1E3IA 1RZ3A 2DPHA 3A6FA 1NULA 5DCUA 3G17A 1GUFA 4QNRA 4ZQIA 5AVWA 1GL6A 4CMKA 2NN3C 5ICFA 7ABPA 4FYWA 3BJMA 4BJ5A 2VUIB 2P5SA 4N0QA 5HCUA 1LX7A 2VC2B 2JGDB 3ZJYA 3DOFA 1LK0A 4KKVA 4ZI5A 3THWA 2VZ9A 3L79A 1SCIA 5LXTA 3FYUC 1AGNA 3KE9A 5JVDB 4BN5A 3VHLB 2X4DA 3AUYA 1E2EA 2ZI9A 2AQ8A 1JDPA 2ZRLA 3LQFA 5AW3A 1N7JA 8ADHA 4ZIRB 1WKCA 1XNRB 1W1UA 1PFGA 1IN1A 3SQDA 3GPDG 4RK4A 1XWWA 4GM4A 1N2OA 4ND6A 3VU0A 3OCWA 1H65A 5E6SB 1KFEB 1RRFA 1JXQA 2PZ8A 2VFAA 3AF5A 3G2HA 1MHTA 3AL0C 5JQWA 3A25A 2HT6A 3KO8A 4S1OA 3G2KA 3M6FA 2Z5VA 2GSWA 3KQYA 1YK1A 4ZARA 5FJIA 3SS8A 1GR1A 2GPAA 1G20B 3NBAA 4HZGA 4XA8A 4D0LB 2QAIA 5EJGA 1AGPA 2VUSA 2RARA 5CFOA 1H6CA 4MPPA 4I8DA 5ITSA 2IY7A 3PGVA 5GIPE 3CXUA 2WJ4A 3DMTC 3PXEA 4D56A 3QA9A 5FA6A 1QHGA 1USVA 1MRSA 5KJ1A 4ROSA 2DHRA 4EYEA 3LK7A 4JVOA 4UW9A 1PTJA 3EH1A 4G86A 1U4NA 4RFSA 1KO7A 2WRZA 4N0DA 3OT1A 1YB4A 3G9UA 3PGMA 3OA2A 1L7AA 2H51A 2VSNA 4PAWA 1CHDA 2G6BA 3VH4A 1QX4A 3WBJA 1A8IA 4JHXA 4N76A 1OI7A 4UVIA 4R3NA 5FQOA 3V34A 4HEA1 4IWNA 2ZRJA 1K7CA 4DMCA 5F7XA 2P11A 5JXHA 1I7QB 1G20E 1JWLA 2YV2A 4J2TA 5FPTA 2HB6A 3DEIA 4GXRA 1L8XA 1RXCA 3JQ8A 2QNRA 4BUCA 3SIXA 1PYGA 1WUIS 3IJPA 4A0QA 5JS1A 3H13A 2MYPA 1Z6YA 2G1JA 1FP6A 2PLAA 3DAHA 3DFMA 3NBFA 3IIIA 4LGYA 4CR7A 1P61B 3IVMA 2VJLA 2FEPA 5HE8A 1Z45A 4QJ3A 2B9VA 1JPUA 1US8A 3MERA 3T5GA 4BMDA 5J1SB 3ITKA 2NSHA 3THXB 2CJWB 4A73A 4I55A 3RJZA 3DV0B 4LOLA 2W2OA 3FCSB 2O2YA 2JD0A 3L1VA 3KPWA 5K6AC 1ZKDA 3K6SB 1KMNA 2C9OA 1MB9A 4TL6A 2OHVA 2HDNB 4LZOA 5AYVA 3P27A 3BB4A 2IXBA 1SC1A 1ZYUA 2ZS8A 3GV0A 2YIMA 2BSXA 1Q1AA 1AD2A 2Q5LA 5B1YA 1B6TA 1Q1QA 3MCTA 4B7ZA 1KTIA 3WGNA 1ZGBA 2F2TA 3QP9A 4D9NA 5K7SA 2FMKA 2GEUA 1E20A 3LC2O 4WJZA 3E7DA 4HWKA 4NG4A 1ATZA 2MSNA 2VXCA 3TMAA 2GD0A 3BXXA 3ETEA 2ZAMA 3IPRA 3BFKA 1NJFA 3R7LA 3UWOA 5KREA 1EUDA 5F3WB 4KL8S 5CGQB 4ZVPA 2J5BA 2ZB4A 1V5EA 3THYA 3GEBA 2WZQA 4MB0A 2BR4A 1PDVA 3BSSA 1GFWA 3H5AA 3OFJA 4N3GA 5EPOA 2GLUA 3UT5A 5CXQA 1KQGA 3HB1A 3CJTA 4OAQA 1JLLB 4RY2A 3VZCA 2IUSA 4MJ7A 4CMGA 1DDOA 1XQWA 5AK6A 4RIEA 1I9GA 4YCLA 1I4DD 1JILA 1ZI6A 4G07A 4L5CA 4JVLA 3LY8A 4Z0PA 3UXHA 2J3QA 4BNNA 4BGDA 2GN1A 3O83A 3Q3GE 1JE1A 3LWNA 1MC1A 1CUYA 1TZCA 1V2HE 4M1QA 3TW0A 2FDCA 3EVCA 2FX2A 3K15A 3P2KA 4ZOBA 2LWIA 4HDAA 2G72A 5IF3A 1RAFA 2R11A 1HQYE 2I2BA 5AW2A 4BNZA 4UBOA 3SJUA 1O0CA 4U0JA 1JQ3A 3HCEA 2ZSUA 4PHTA 3UGKA 4EY4A 1I4EB 1RI4A 3OMLA 5HTKA 1OZAA 1KXZA 3F46A 1BDMA 3MINA 4CWAA 2XGJA 3KQSA 2Q45A 3P9PA 5KNBD 1JP7A 4J0EA 1YRAA 2Y71A 3FZQA 3ZBQA 4NYJR 3P4UA 1JLHA 3V1TC 1NBMA 1MX1A 1ZZEA 1IEXA 4A6XA 1Z4KA 2PX8A 3MB8A 1VL6A 4IPTA 4MWTA 2RAPA 3WJAA 3QK7A 1N2JA 1POWA 3GRCA 3N2GB 3FFTA 4YP6A 4C4RA 5B2FA 2QQ5A 1R0SA 4CLOA 3RIMA 4Q4HA 3SD7A 1YDHA 5IAGA 4FCVA 3MHPA 4YROA 1N1EA 1QRRA 4C06A 3N2EA 4NCBA 4QG7A 1KZ9A 2YOGA 5GJBA 3MSXA 1R12A 1NNEA 2GYUA 5EWLA 3SJCA 4EW6A 4QLBA 2BFCB 2D5CA 2WP8J 3K0FA 1C4OA 1XWIA 3I6IA 3DR3A 4G5OA 4JA2A 2VUTA 3T1HB 4ON9A 3UOAB 3GVXA 4HRXA 2GCNA 4CLRA 2O8CB 4U2CA 3DEJA 1E2MA 2XPCA 4EY3A 4CTJA 3WLOA 1J1IA 3H0KA 2YV3A 5EP3A 2IHTA 2MSCB 3I52A 3GFQA 3WX0A 4FWTA 3HJNA 5CB6A 4OI0A 2HJVA 4BV8A 1HG1A 2E89A 3IXMA 1GL3A 5ALSA 3BK1A 3CA8A 4RMJA 1YWGO 5ERXA 1WDLA 2E4YA 4ZXPA 2AEEA 2F3QA 1TM1E 1JHOA 3HCCA 1B43A 1PQ4A 2PV0A 2QSZA 1AKVA 3QEBZ 3AMVA 1M1YB 4INOA 5JXJA 1R1DA 2BTEA 1FP4A 1GARA 2XD9A 5SY4A 3GEGA 5CA0A 5IJZA 3Q2KA 3EBPA 1WDMA 1EDBA 3NHSA 2WIGA 1QFJA 4LF5B 2ZB7A 1Y9DA 3UWPA 3JWHA 1BSVA 2SCUB 5CJPA 1WZCA 4GMXA 5DASA 2CEAA 5ELMA 1JDBB 1A72A 1CETA 1LV7A 2OAGA 4ZJPA 3VR2A 3IAUA 5LMUB 1I3OA 3O8OA 3DA8A 4MIOA 4NOKA 3AJDA 1EUCA 1F51E 3BRQA 3I6MA 3MD9A 3H8JA 5CHYA 2RG7A 4ZCQA 2BZSA 1P3Y1 3CUYA 3WGJA 1F6DA 3I2FA 5WRFA 3H8WA 3CZMA 2D2XA 4M22A 4PLZA 1MX9A 1NPDA 2RHMA 2XI4A 4OLFA 1GUBA 5HJ7A 1M1YE 1HY3A 1TMYA 2O4CA 3B2EA 4XPIA 1A9XB 3ESCA 4JNKA 4PFKA 2NU9A 5ALZA 3DOIA 2XUQA 1T6BY 3EFOA 1DJQA 1RXEA 3LZ6A 2P2SA 4BUJA 4JOSA 3OIGA 1GVNB 1PGQA 3ETJA 2C59A 2QORA 4LIPD 4HEJA 1R10A 1EYZA 3VAYA 3W2GA 3V1MA 3SYTA 3BBLA 4DQKA 4KAJA 1QHEA 3MT8A 3FCCA 4ZO8A 1T3LA 1CNFA 3TBKA 3B8EA 3TVDA 4JR0A 1MKYA 5KTRA 1ZC4A 2ZIXB 121PA 3ZD8A 3MMNA 1Z4IA 2FH5B 3GFGA 4ZOQI 2JFZA 3KDSE 4MCHA 5GV7A 4BQFA 3AFHA 1U7PA 3D7MA 3BA1A 2D1SA 2MCFA 3W5CA 5CW1A 3RT9A 1AV6A 5A71A 1EX6A 3IEXA 3K9FC 4UPDA 5HFNA 2HQ1A 5KDOA 3F4KA 4KH0A 4B87A 1U3FA 3I5AA 4O4JA 2GN2A 5B30A 3FG9A 4L2IA 1FYEA 1K5HA 1LJUA 1EVJA 2OQRA 4MAFA 4A8JA 4EKEA 1FFXB 2ZE5A 2E5FA 2IBMA 2HZBA 4XVUA 3PU6A 1FQWA 4IKOA 4FVTA 4OOFA 3QKUA 2A9PA 1BOOA 4HDNA 2V65A 4EGFA 3CWQA 3BFVA 5HDQA 3RS3A 4OKIA 3QWIA 1EDEA 2FPPB 3ORRA 3WL4A 1IAVA 1S2GA 3EVFA 4L9WA 3PC4A 4IDGA 4OK3A 1IIBA 2C8KA 4OGGA 4WA7A 5JSFA 1VIYA 3V7UA 2CXUA 1XTZA 2YWEA 4M0CA 1VLVA 1BXGB 1XI2A 3KCNA 1XX6A 1YB7A 2B34A 5HBGA 1K6JA 3SBOA 4RSMA 1XN4A 2CCGA 2YFKA 3LLCA 4ALMA 2ZTSA 1GQSA 2KW5A 2GTPA 1CQIA 1C3EA 3TRJA 1M2WA 1SD2A 4R2KA 3TN7A 2ZAIA 5DK6A 1VC2A 3DO8A 4W4TA 2GXAA 1FMFA 5C37A 4DSZA 5FH9A 2FOLA 5L3SB 4D6XA 3AHEA 5HRUA 4L4RA 1PVDA 3L82B 4N54A 5AQEA 6REQA 3CKMA 3KYIB 3HR7A 1J9ZA 3B3QA 1TEXA 3GX1A 3BCHA 2OXEA 2Y1CA 5C1OA 3GI1A 1C0PA 1O9HA 4NPCA 4WE3A 3KQTA 1ZBDA 1H2XA 3CRNA 2GFIA 1WU7A 4LOKA 2BKXA 3QX7A 4CMEC 5A3RA 2CYBA 1QP4A 4NZYA 2IYUA 3R0QA 3PHCA 2GZMA 2O3QA 1PN3A 1UQRA 3MMZA 4IVQA 3NYWA 3HP4A 2ORIA 3FPJA 3GZNA 1XP8A 3T7TA 3UN1A 4B2PA 1TM4E 1OZHA 1E2BA 3V8BA 4YIKA 4L15A 5JCZA 5I7RA 3NWJA 2NW6A 2E49A 2XUGA 2F43B 1GADO 3DUFB 4KDEA 4QBFA 4F4FA 3F90A 3IHKA 4M9UA 3EBOA 4WIAA 9ABPA 3E9CA 1W59A 2UKDA 4EKGA 3QTTA 1GRQA 5K4GA 2HMWA 2PGDA 4WEOA 2Q49A 2GZAA 2G67A 4M88A 4JBLA 4H0CA 5D3KA 2VXBA 3IHLA 3N75A 4GXQA 5D00A 1L5HB 1G8PA 2VTKA 5C35A 1PNRA 3BMCB 4C3ZA 1ADCA 3ENVA 3CISA 3E9RA 3R23A 5AHXA 4DMLA 3WWDA 1V25A 1JFTA 2HHJA 1I30A 3MS4A 5L40A 2KJQA 3RSSA 2OAEA 1PNVA 3RAEC 2PL9A 3TUIC 2WD7B 3JASA 1M0WA 1E1KA 3ODPA 1XPRA 3G49A 3PUYA 5J59A 2PX6A 4UU7A 4AXBA 3P94A 3DEYX 4Z7QB 2Z6UA 5ITZA 5BQFA 2YZ7A 2HOQA 3MGCA 2WU8A 3RV3A 3ZZTA 1MB2A 4OFXA 5FI1B 2H9YA 1ZD2P 2HD4A 5EZ5A 1I14A 4BB0A 2OLEA 5J43A 5KQMA 3HI4A 3SHWA 3C5VA 3FPGA 3I5UA 1P6UA 5CAEB 3DL0A 1PNOA 4BX0A 5EJEA 2M32A 2QGNA 1J00A 3VAAA 1FRFS 1O89A 1T6NA 3PHJA 4HSEA 5CXUA 5IT9A 2P1ZA 5EMNA 2ZSFA 2GH1A 5FBLB 3ZLUA 3QE4A 1X7ZB 2FK7A 4MYSA 1JXOA 3LW8A 3IR6A 4OQ4A 3FYUA 3E0QA 3I64A 1WCIB 4U0KA 2CT8A 4OJKA 2QAGB 5CJJA 4IJ5A 3EWNA 1VBKA 1L7BA 4U5XA 3MCVA 3REQA 5L45A 2O8DA 3W6PA 3HCFA 1NC1A 3K5HA 3U9TA 1JI3A 2OBXA 4OXYA 1IQRA 2IP1A 4MGEA 4TMZA 4UMVA 1I94B 3KJNA 2FRDA 4R01A 4PCLA 3OX3A 4P58A 2Y92A 4ZAGA 1X7WB 1CUUA 1FNMA 1ZSVA 3IVGA 5A0TA 1COZA 4HQ0A 2WWGA 4TLDA 3LUDA 4OHVA 1Y3DE 4N7RA 2B6NA 4PTLA 4N5IX 2ODPA 1KY4A 3LKVA 5CB0A 3RNOA 1TVKA 1ZN7A 1J1UA 3DEHA 1IWOA 3IP6A 1ZAYA 4OHRA 3RAFC 1T0IA 4H59A 2XB4A 4AUEA 1VCIA 1C9MA 2FPGA 4NFHA 4C0KA 3KQKA 2WM9B 1E4EA 3T1OA 3X43A 5IDXA 4UPEA 1G6HA 2UZ1A 4A82A 4UAUA 4OHUA 5IM4F 3DE2X 4B7CA 3S81A 2EZ9A 2H7CA 4U2EA 4KGVA 4L0CA 2JHFA 1ZGCA 4LC9A 5E9QA 5TB5A 4H7PA 3V5NA 2UYYA 2BI8A 3HBNA 3HCWA 3RODA 1B8OA 2ILTA 4ARAA 3OOYA 5A9SB 5IULC 3HABA 4KMRA 5AK5A 1NN0A 1JUDA 1GCAA 1Y81A 3TXAA 2X9NA 3GJRA 4HMQA 4D3ZA 1HC7A 4EEKA 4YT4A 3IHTA 4AJOA 5MGNA 3N58A 2WZCA 3LY7A 1A9QA 1BEEA 4JUIA 1U9CA 3CVUA 5AKZA 3KPYA 5LKAA 4RJTA 3W9SA 4BAUA 4F72A 1DRWA 4JXXA 3LDGA 5FOWA 4AYXA 1E69A 4DEYA 5IJ0B 2F7SA 3LHIA 1N78A 2BHSA 1VLHA 2CKMA 3CX3A 3IAXA 3GC6A 4XWGA 4GYYA 1RYHA 5K6AA 1W49A 3INTA 2JBWA 2O6HA 3OIYA 4S3MA 3WLAA 2AFIB 1E18A 2B5OA 2I7XA 3MWKA 3PPVA 4OTZA 1ZO8A 2XQIA 2GCOA 3NWOA 2Z8ZA 4FGUA 1Z38A 2HA7A 4Y9UA 1ZH8A 4BVLA 4F4DA 2B78A 3CUTA 3ZHOA 1N1MA 4HUQA 4YUYA 4EHHA 1YS1X 2CLMB 4W1QA 4IMIB 2FFHA 3GVHA 5L9AA 5ALLA 1QZ3A 2TS1A 1Q7EA 4BEBA 4PZUA 2GZ1A 3STYA 5CA1F 3IVXA 1AN9A 4PBSA 4XCQA 5CG2A 4DUYB 1ULHA 2IBSA 4Q4JB 1SOWA 4BC0A 2PEYA 5JADA 2C0PA 3G9TA 3PEYA 1LC3A 1L5LA 3PXUA 1YU6A 3R40A 3V6MA 1Y82A 4YV2A 2AGVA 2FUNB 1FUUA 4PG7A 2CB9A 4BLUA 1VYTA 3GLIB 3EDYA 2WG2A 2WP0A 3VO2A 1DAPA 2FPSA 2GJ4A 5FPHA 4FCCA 1O97D 4BFYA 3B6ZA 3WB2A 2ASEA 3NFRA 1JWBB 1KOFA 3AR8A 2GXSA 4FMPA 1NU6A 1SH7A 4LWPA 1D2NA 1Y48E 2CHFA 2HJRA 2IWRA 3RFFA 3PFCA 1FK8A 3WYBA 3WMXA 4CL8A 2XB8A 5GINE 1VDMA 3EB9A 1ZIYA 2GN9A 3SC2A 621PA 1X1SA 2CD7A 2O5VA 2Z2JA 3OEHD 3PFGA 4HYQA 4NE9A 4WK6A 4IQ4A 5E7JA 5BQPA 3KTOA 4RVUA 4DT1A 3KRTA 4Z2AA 1CS0B 1AB6A 4PZ0A 3TTXA 2WSMA 3G59A 4KTVE 5CG1A 3EF0A 2MTBA 4LNAA 4C30A 5DM1A 4OGFA 1JDZA 4AB1A 2HWKA 3FCEA 1YBAA 3GLIE 4LV8B 3ISVA 3O82A 4NCAA 1EWVA 1VBNA 4KRGA 1GTL1 1W4BA 4MB2A 4DV2B 3DPIA 3SYNA 1DLIA 1Z12A 4KCGA 2JLXA 1MV5A 3THOA 4A0HA 3O90A 3HYCA 1GZSA 4IJMA 2QTFA 3R6TA 1YDGA 1LS6A 1KDOA 2G04A 3KVYA 3DM5A 3R76A 1NR7A 2ZZKA 3ZXUB 4ED9A 1RC1A 5IEBA 1OA1A 5ALIA 3VDMA 1W87A 3JPYA 3WL8A 1Z35A 4QATA 2E4WA 2ZSEA 2OPHA 4JMLA 4BN4A 3OU2A 1J9EA 3ADOA 4E46A 3D6TB 4ARZB 5GZ3A 2RH9B 1R6TA 1YL5A 3QG1A 4PG8A 2RGEA 5AKXA 2JK1A 5FWYA 1NBEA 1H3EA 2ATVA 1MB4A 2D8AA 1P7PA 4E6EA 2FPMA 3E3LA 1D7OA 3C4JA 3Q3JB 1Z2NX 2JARA 3KT3A 3EIHA 1JBKA 1COWA 1R6VA 1U02A 2W2KA 4KLZA 4PZAA 1WNTA 2P2DA 3GPCA 2UUBB 4M55A 2O8NA 1KP2A 1U2EA 3NTUA 2AHOA 2LZ0A 4AC9A 4EITA 1SHTX 3AYXB 4EBBA 5C7YA 1JEOA 4EGQA 2BI4A 5L95A 4EJMA 4O0MA 2FSUA 1K1EA 2VYFA 1T2EA 4R9SA 4KE6A 4D8XA 4F6RB 2CFOA 4LISA 5DM60 2CFRA 3I9LA 3QY9A 3I4CA 4PSUA 4ZXFA 3ZZ0A 4B4WA 5JS8A 1XMJA 4D96A 3IQEA 2IYQA 2JAPA 5CEEA 4ZREA 4LYAA 4Y6QA 3W8FA 2HGSA 2PKQO 4H1HA 3N5CA 3Q8LA 1F6WA 5AOBA 2C5GA 2AJTA 1XTQA 3WLLA 1XQ9A 5KTTA 3EPRA 1A9YA 3PDWA 1VSBA 4FEEA 4JC4A 1HYHA 3OWHA 1RQGA 1Y5LA 1N2ZA 3PGKA 1AS2A 2FGKA 3B85A 4IGKA 4LXGA 2QPOA 4ARBA 1H6DA 3ZHTA 4DGQA 1Z07A 1C7RA 1V7ZA 3ZDQA 1C3LA 4BO4A 4YEDA 1IB0A 2MT9A 2W6JA 3SX0A 4ROTA 5J4LA 2B8EA 4EFLA 2H31A 4YAEA 3X2FA 3GLFA 1Q0RA 2FZGA 1I32A 2G09A 2H4HA 4LYYA 1NJ2A 4R0VA 3OY7A 3BFXA 2HKIA 4OI4A 4Y98A 5JHHB 1WHTA 3F8TA 2LE0A 1XLVA 1YDEA 3BBPA 3SKYA 1GSHA 1EGHA 1V6CA 1UWKA 5GMOA 3IOBA 1YMQA 1NAIA 1I36A 4NCHA 3ZQ4A 3EXIA 3W3AA 1ZJJA 4AF8A 4DM4A 5JRDS 3IT0A 2J09A 3CG4A 3DBOB 4YT2A 4D44A 2ONKA 2YQ4A 3KL4A 3BWCA 3P19A 3RIGA 3NVMB 3O2SB 4QRIA 3EWAA 4Z3DA 2HMAA 2QY9A 1VQ1A 3JQEA 4JC5A 1VG9B 1JMVA 3JQBA 4M0MA 1I2MA 3L8GA 4GSLA 4LMPA 4LRXA 1HT1E 2VJMB 1K88A 1ZVQA 1CU1A 3BGVA 3HJBA 3ESAA 1LX6A 2VTVA 3THSA 2FK8A 2DWOA 4CHGA 2OR3A 3QEMA 2CBGA 4CM4B 3ES9A 1YH3A 3KHTA 5JG7A 2I91A 2WV9A 4RLQA 3HO1A 2CCJA 2GI4A 4AO8A 3L0PA 1T2UA 1V47A 1PX2A 3IVRA 3TDMA 3NYIA 2BDEA 3P0EA 5IJWA 2JBHA 1WY7A 4HMPA 5D6OA 1ZM4A 1K63A 1OQAA 2A1IA 1Z5PA 2ECFA 3JAKB 1QHHB 4RXUA 5REQB 5HSGA 3FWPA 2QXUA 4QNNA 1E3EA 3B1KA 3T1TA 2YXDA 5DXFA 3T3MB 4PRKA 4ZKDA 2ERYA 2QLMA 4X93A 4AKHA 4V0LA 2O3SA 4BMCA 2H5JA 2KMLA 3D4OA 4MUFA 3BRSA 4B80A 2COKA 2H5EA 3KQPA 3T3NA 2A58A 3ICEA 2Z1DA 1W6UA 2CVQA 1OH8A 3W5BA 5JO9A 1KYZA 3AINA 3VBCA 1FX0B 2VDRB 3IP1A 1NG1A 5CLLA 5E4FA 1A69A 2VDVE 4GMFA 1JFVA 3BHMA 1RLUA 1UKBA 3ECAA 4XUGB 3K73O 3V9AA 3SIPA 1OBOA 4IIBA 1Q2UA 4N5MA 3DZJA 3AHDA 4BDTA 1Y7IA 4B76A 5GV8A 4YYZA 5K8TA 4TTSA 1WXGA 4O4LA 5BW4A 1CY7A 1DJOA 1H69A 1KJZA 2OC9A 2VP5A 2XTJA 1Q1GA 3NV7A 4JIMA 4WXMA 2A92A 1XN1A 2VT7A 3D3WA 4UUQA 2QLJA 3UMFA 1J5PA 4CV2A 4UC0A 3GYBA 3WO1A 4B6SA 4HTAA 4MARA 2WF7A 1Q7TA 3IUEA 5KVCA 5KQSA 1ZJ6A 4EKDA 1A8QA 1WMFA 5FL3A 1VKHA 3ESRA 3Q8MA 1I6WA 1CEEA 3R41A 3BS4A 1J2YA 1K0UA 2OZEA 3DCIA 4NSNA 4PGHA 4UHCA 4Q9JA 2F1OA 4F3TA 4BMNA 4QOIA 3ZWPA 5ALYA 3GJXC 2JJQA 4IH4A 1K7EB 3HDYA 4PYJA 4RPJA 4F85A 5IPFA 2I2FA 3WWOA 2WB2A 3EGCA 4CMIA 1NKSA 2B3TA 1XEXA 2WMDA 5E2AA 1SO8A 3HNPA 1R0RE 3UWDA 1G5PA 4DQXA 5FI0B 4JSRA 3KM0A 1K08A 1PJ2A 3R2JA 4L7VA 1GPDG 1D6MA 5TY0A 2X5XA 1NVTA 3DBHB 2P69A 5ALGA 4RA6B 2FR0A 3RHSA 4EGSA 2EJCA 1YFZA 1WCWA 2PWYA 3KJXA 3OBBA 3TTTA 4DJ5X 1EZ4A 4N0PA 3C3YA 4LHZA 1WSDA 4YRKA 5SV2A 4OQEA 4OXXA 1UJ2A 2YWCA 1J8YF 1S02A 2GBPA 3PQ5A 4QE3A 2F1IA 3MN1A 3VDNB 1WRBA 3QUCA 4HNRA 2PGJA 2WJZB 2O8VA 4FFPA 1Z06A 4J9UE 4TKZA 4TVKA 5KJEA 3W78A 4YMUA 3QHPA 5HIMA 4EATA 4G0VA 3UB4A 1KMHA 2Y9PB 3B9QA 1AHIA 2FP3A 3F5SA 3P26A 1QGDA 3OZSA 1AQUA 4HRAA 4PPFA 1JEYB 4BZXA 2HIGA 3ENKA 3GFFA 2O57A 2DSNA 4URWR 5HS6A 2XMZA 3W5VA 8OHMA 5LZ9A 1RAAA 1ZCZA 5EMHA 3RRYA 3TIVA 4DC1A 2P0YA 1Q0UA 1BHJA 2DKOA 4M7OA 4WLUA 4L16A 4IIJA 4D0SA 1KY2A 4F3YA 3ISJA 5LQUA 4YCCA 3NHYA 1UOEA 4DLKA 4X8LA 2WUDA 4BU0A 5T67A 5F9FA 1RZRA 3M1LA 2FRVA 2GNPA 3KTAA 5ALKA 2QXTA 3JATB 3N2IA 4KXLA 4KXQA 3NT4A 1O58A 1OAAA 2ZRCA 3L04A 5JEEA 1QAQA 4U8HA 4M9XA 5F98A 2A9JA 3FAZA 2OORC 5EIOA 4OP3A 4X94A 3WGLA 3L7KA 3ELDA 5BMVF 3BH7A 1RXUA 1IBMB 1P0MA 5NULA 4CHTA 2J07A 2X8BA 5HCNA 4MHTA 2DB3A 4ZPXA 1R5OA 1S96A 2Q62A 1NUSA 3FUWA 4XFKA 3V4FA 3UPTA