3GMSA

Crystal structure of putative nadph:quinone reductase from bacillus thuringiensis
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
331
structure length
331
Chain Sequence
SLHGKLIQFHKFGNPKDVLQVEYKNIEPLKDNEVFVRMLVRPINPSDLIPITGAYAHRIPLPNIPGYEGVGIVENVGAFVSRELIGKRVLPLRGEGTWQEYVKTSADFVVPIPDSIDDFTAAQMYINPLTAWVTCTETLNLQRNDVLLVNACGSAIGHLFAQLSQILNFRLIAVTRNNKHTEELLRLGAAYVIDTSTAPLYETVMELTNGIGADAAIDSIGGPDGNELAFSLRPNGHFLTIGLLSGIQVNWAEIVTKAKVHANIFHLRHWNDEVSPYKWQETFRHLIRLVENEQLRFMKVHSTYELADVKAAVDVVQSAEKTKGKVFLTSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of putative NADPH:quinone reductase from Bacillus thuringiensis
rcsb
source organism Bacillus thuringiensis
molecule tags Structural genomics, unknown function
molecule keywords Putative NADPH:quinone reductase
total genus 111
structure length 331
sequence length 331
ec nomenclature
pdb deposition date 2009-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3gmsA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3gmsA01
2GYYA 3WGHA 2X0RA 1IZ0A 4XB2A 4GKVA 2XPCA 2ZQZA 3EZYA 1LLUA 3WNVA 4R01A 5GMOA 3KEQA 1A7KA 4KTVE 2CF5A 2VYVA 3GHYA 2C82A 4EI2A 3FD8A 4PLGA 2DTXA 2VHZA 3RBZA 3TOZA 4ZQHA 3NTQA 4ALLA 1O95A 4YACA 1ENOA 1R6DA 5T67A 4WCFB 2AW5A 2R2GA 3A4VA 3KO8A 4YA6A 5T5QA 1MV8A 3C8MA 4HFNA 1XSEA 2DVMA 2HLPA 3K2EA 1ARZA 4WUVA 5TT0A 3JQEA 1PJ3A 3CZMA 3AI1A 1H6DA 3DMTA 3MJ4A 4J0FA 1SMKA 3PTZA 4CLDA 3JQAA 4TVOA 5L40A 4K9DA 1ZCJA 3WJ7A 5DF1A 3W4IA 3H9GA 1X15A 1YL5A 3FNEA 3RIHA 3EUWA 3AOGA 4BNYA 1KEUA 3TZ6A 4MP8A 4DPLA 3WGIA 2EERA 3E5RA 4YQZA 5I8WA 1HE3A 3DBRA 3NJ4A 3P2OA 3NGLA 1U4SA 4BO0A 4CJXA 2AE1A 5JYDA 5ES3A 3JYQA 1C14A 3PQDA 3VZRA 4L4XA 2FR0A 3H2ZA 3MWEB 4TVBA 2NVWA 3WJAA 1C0IA 1ZUD1 3UF0A 4YR9A 4II3A 2JFFA 3V1YA 3WGOA 4XQEA 4GX2A 3HN7A 2HMTA 4R5MA 4HFMA 1LLQA 1ZNQO 1HYHA 3JQGA 4MIEA 3IJRA 3U5TA 1E6EA 3IC5A 3JQBA 1F17A 4GMFA 5FI5A 4KUHA 1LA2A 1GR0A 1X1TA 2NNLD 1B8PA 2ZYDA 1G0OA 4MIOA 4J1TA 3UGKA 4C7JA 3RASA 1GU7A 1LLCA 4D3FA 4F6CA 3MOGA 2J8ZA 4AJ2A 3HB4X 1YJQA 4MP6A 2C07A 1LDYA 1DFGA 1PQPA 2P4QA 1H0KA 4FJ2A 3U4CA 4BNFA 3PRJA 1E6UA 4W4TA 2C2YA 2GF2A 4PZEA 3GPDG 3GG9A 1ZVMA 1YJ8A 2YZ7A 3E03A 1K89A 3E1KA 4LMPA 2BFMA 2PNFA 4O6VA 2ZKLA 3PLNA 1BXGB 1T2FA 2NQ8A 4YEDA 1DPGA 4ID9A 1PR3A 3QWAA 5CEEA 4R51A 2XXJA 4CR7A 4UEKA 1VC2A 1DFIA 1E1KA 4CM4B 3WGZA 1K0UA 1YB4A 1XCBA 3JD4A 1Z82A 1QYVA 1KBZA 2PV7A 4DIBA 5JMWA 4ZVVA 5BNFA 4Y9DA 5U1PA 4EJ0A 2XXBA 3KOUA 3MEQA 2DAPA 3WTBA 1DIAA 3RWBA 1V35A 5IN5A 4OHUA 1QRRA 1EE2A 2FOIA 1KETA 5I9MA 1CQJA 1U7HA 1I33A 3OIFA 3QLJA 4HXYA 4JJFA 4BGVA 3F1KA 5KKCA 3FTPA 4QSMA 1EVJA 1PGNA 2RH8A 1GZ4A 4LW8A 1DJNA 4QO8A 1MB4A 3KBOA 2PD4A 3GDFA 4FIZA 2B69A 3HG7A 5AXBA 4RJTA 4CMEA 1VL0A 4AJHA 1XIVA 4DPMA 2AQHA 2P5YA 2HSDA 2Q3EA 4CUZA 1A71A 2B0JA 2P9GA 5TJHA 2EF1A 3S55A 3D4PA 3DHEA 5A3VA 1V3UA 1YS4A 2JFHA 2UUOA 3LVFO 3ZNPA 3L77A 3OMLA 3DONA 3F3SA 3DB2A 3PDJA 4QUKA 4BIIA 2FWMX 8ADHA 4LRTB 1QV6A 2OHXA 1Y9AA 2C20A 4IPTA 3LF1A 1UDCA 3DAGA 2FZWA 3CH6A 2OO5A 1H2HA 2ZYAA 3UOGA 1WAMA 2A35A 1UXHA 3BTVA 2DLDA 2PH5A 2VUTA 4FFLA 3NUGA 4TSKA 3D0OA 6ADHA 1A7AA 4L75A 2CVQA 3JYPA 4E12A 3ZI0A 3ADOA 3I9MA 1LUAA 5I7EA 4W7HA 1MFPA 2FPIA 1JAXA 5A02A 1ZIDA 2O48X 4XYBA 4PIVA 3ZHXA 1XDWA 4AICA 2V6MA 4XR4A 4JNKA 1IHYA 2B5VA 3H8VA 3RBVA 1V9LA 1G0NA 1YB1A 1R4NB 4J3FA 4BNVA 3Q2KA 3VPSA 3WGTA 1J49A 5JBIA 3V8BA 4ILKA 1P3DA 4IIVA 3SLKA 4UVIA 1LJ8A 2GN4A 3E9QA 3OJLA 2BGKA 5IJZA 5MGBA 4WECA 1QP8A 4Y98A 5C7IO 1GEGA 4Z3DA 3V1UA 4BUCA 4I5FA 4CMCA 5ILGA 2Q1WA 2W2KA 3ZWBA 4FB5A 1Z7BA 4CPDA 3ITDA 4J2HA 3TZHA 5JY1A 1K3TA 1Y6JA 2XAAA 5AOVA 1P1JA 1LXCA 4S3MA 4NK4A 4IS2A 4ALJA 4WNCA 2C54A 1DHTA 4UUMA 4B7XA 3JCZA 1UZLA 5HRUA 3DAFA 4EITA 1WDKA 2QQ5A 5KTKA 1P74A 1R12A 1PS8A 1YBVA 2O3QA 1KOLA 2NU9A 1K6XA 2I66A 3CSDA 3GDOA 5JE8A 1VSVA 2X5JO 2DUUA 2OP1A 1YQDA 1NQTA 3OEWA 1C0PA 3PIDA 2AEMA 4XGNA 3PIIA 2WTBA 1R4NA 3MTGA 3ROMA 4JJGA 2A94A 2OXIA 1PQWA 1ADBA 1XU7A 2DBZA 5HS4A 3U0BA 1DB3A 3AJRA 1GYQA 4GQAA 3UXYA 3KSUA 2CDAA 4MVJM 3RBXA 1HE4A 4YYZA 3PFFA 4DYVA 4BMVA 4FOOA 3SX2A 4WCFA 4D45A 3LT4A 5KJ6A 5K6AA 1XKQA 2OMEA 2TMDA 3ZNNA 3BMQB 3OP4A 1U8XX 1I8TA 1KVQA 5HTOA 1OBFO 4BO7A 2ZATA 3INTA 1CQIA 3OIDA 5CDYA 2PKQP 4PCVA 3WBFA 2OGUA 3TFQA 1J5PA 1GCOA 5CEJA 3TL3A 1E6WA 1DO8A 5A06A 5ADHA 1BW9B 2EEZA 2WJPA 2QIOA 1BDBA 3C85A 4QX6A 5JC1A 1NFQA 3I9LA 1OC4A 1X7GA 2GSDA 3AOEC 2GZ2A 2VYND 4GAEA 2QYTA 3ZWWA 5G0WA 4AJKA 3VDRA 5FEUA 1NVMB 1AXEA 1N8KA 3CUKA 3AI3A 1DIHA 3AM4A 3H6KA 1YE3A 3RJ9A 5JC8A 3NYWA 1TT7A 3BMCB 2JFGA 1XR3A 1DAOA 5B4TA 3STHA 4N7RA 3AY6A 4PG8A 1ZJZA 4LSWA 3VTFA 1ISJA 2ZB4A 4DMMA 4D0SA 1C1XB 3JQ7B 3BMNB 4NPCA 1NQAO 4K6FA 4W6ZA 4BNWA 2HQ1A 4CMGA 2WDZA 5A9SA 5KJ1A 2X23A 3BHJA 1YQXA 3HDJA 3RVDA 4FBGA 1WDMA 4QTZA 3E6AA 3NDIA 5DCWA 4BB5A 4BKQA 5A9RA 2R00A 1CERA 4I08A 3SC6A 5K0ZA 1F8GA 1R37A 2B36A 2NADA 4ZICA 4LVCA 2I6TA 3GFGA 3QIVA 3QVWA 4BO1A 3IQDB 3ETEA 1W6UA 4IDDA 4A26A 1K2WA 4YQYA 1CRWG 1TLTA 1YB5A 4FR5A 4YVFA 1IPFA 4INAA 4TQGA 4EDFA 2X4GA 3GVIA 4DLAA 5GZ6A 1SO8A 3OF2A 3AFMA 5TF4A 4WK6A 1E3SA 1B14A 3G79A 3I1JA 1XGKA 5THQA 1PGOA 2IRWA 1TI7A 2I3AA 4IMPA 3L9WA 5T8KC 4E2ZA 3U4IA 1GQQA 3DC2A 3QY9A 4YAIA 4E5YA 2O3RA 1W0CA 4NU6A 2NU6A 3GNTA 3K9QO 5IZCA 5TIIA 2AG5A 1P44A 3LT0A 4R3NA 1VRWA 3AUAA 1ADFA 3WMWA 3UFXA 2YFHA 2BFOA 1E7YA 1BVRA 2VCYA 2BFPA 4HNHA 4NI5A 2YYYA 4MKRA 4MVJF 1LSSA 2BHLA 4WOKA 1RYEA 2P9EA 1DIRA 1ZW1A 2ZJ1A 4UVEA 3OQ1A 1EUZA 5JAIA 3D5QA 4A5OA 1UXIA 4JQCA 4J9UE 1SNYA 1LEHA 3BMNA 3RUAA 4CMBA 2I5PO 5GY7A 2EV9A 2OFPA 4LISA 4BMSA 2PGJA 3DBLA 1L7DA 2VNSA 3I9NA 1QYCA 3IMFA 3NEPX 4MVJI 4R4JA 5EERA 3JD1A 5TGDA 1HL3A 1UXGA 3JQAB 3KV3O 3WSWA 4E3ZA 5I9NA 2Q49A 1Y7TA 2QRKA 4Z6KA 3WB9A 1ENPA 3OIGA 2DFVA 5TQVA 4TWRA 4MVJD 3I23A 1I3KA 3GA0A 3OJOA 4CODB 5BNIA 1QYXA 3DBRB 4YWJA 1YONA 1IZ9A 2WSBA 4WLUA 1X7DA 2VZ8A 4LN1A 4XIJA 2UDPA 3K6JA 5KJFA 4Q3BA 2J5RA 1EVIA 5LCXA 2Q4BA 2B4TO 3RUEA 1PGQA 3EMKA 4GBJA 4D3SA 1NBOA 2RBEA 2UV8A 3GMSA 3ABIA 4KDFA 4LSMA 3PGXA 1R0LA 2PZJA 2BI7A 5EINA 1W8DA 4P8RA 1WXDA 4PLZA 3W6UA 4R1SA 1MG0A 3HSKA 3ZU5A 1FDSA 4NR0A 3FNFA 4ZQEA 4FSHA 5IG2A 4IMRA 1N1GA 4J4BA 4ND4A 1ZK3A 2E48A 5KWEA 1U2GA 4AJ4A 1QMGA 3W8DA 4F3YA 4LVUA 4XYMA 2YQ5A 2CNBA 2VWHA 3FSRA 4OL9A 1WP4A 5B12A 3WYBA 2YV3A 3ASVA 2E82A 4JBHA 1EK6A 1LI4A 2I67A 1LSOA 2BFAA 2FPGA 4S1VA 2EGGA 4WKGA 1ZFNA 1U9JA 4J7UA 4MVJA 3K31A 2ZIZA 1NPTO 1U5AA 3KYBA 5FFFA 4CLXA 1ADGA 4TRRA 2EKPA 1R0KA 4OJNA 1TVEA 2JD0A 4I9HA 4GVLA 5EMHA 4EUHA 4CMEC 3JTMA 4YJHA 4OXNA 1F8FA 4XYLA 4IDBA 1U3WA 5HA5A 5L3ZA 7ADHA 5ITWA 4E30A 1A4UA 2J3HA 4L74A 4WCDA 4YAEA 3HHPA 1DLJA 1NQ5A 4BNTA 4TZKA 1LDMA 3PJEA 3GGGA 3L0DA 1QLJA 1SOWA 2Y1GA 1Z74A 4IJWA 4TKMA 4BL5A 4IJKA 4BO9A 3V2UA 3U9LA 3JQAD 1ZMOA 4OKNA 1RM3A 1EQ2A 2E37A 4B8WA 4UREA 3PEFA 1PJCA 3GMDA 4AJJA 3BMQA 3EGOA 4O1MA 4IQGA 1PEDA 2PD3A 3UCFA 4H3VA 2D1YA 4YBZA 4NBWA 2G76A 3SEFA 1I2ZA 3IP3A 3ST7A 4DGSA 1GY8A 2W2LD 3PJDA 4GSLA 4L9RA 3M1AA 5H83A 3H9QA 1ZK4A 1NX6A 4YT4A 4NBRA 3PXXA 5AQ1A 4BQPA 3Q9UA 3W1VA 4OXKA 3U3XA 2VUSA 5LDHA 3BTSA 2PLAA 3OA0A 3BTOA 5JDIA 1UP7A 2Q2QA 4MINA 3WFJA 3KXDA 3RC1A 2BGMA 4IS3A 2WEKA 1JTVA 3INRA 4K26A 2RHRA 5ICSA 2DQ4A 4ZA2A 3DQPA 3CIFA 2RCYA 3GG2A 1U3VA 4GX5A 2GUGA 2IYPA 4CV0A 4RPGA 2VHVA 2X22A 4RO0A 5U9CA 4HKTA 1C1DA 2EJWA 3D7LA 4RLHA 3ZWXA 1CYDA 1F06A 4CMJA 4FFMA 1JKFA 1CJCA 3WMXA 3GF4A 2VHXA 3LC1O 4CLRA 3HJAA 3NGXA 5U4QA 1I10A 1LRKA 4L0QA 2HJRA 1RPNA 1DIBA 3P19A 4YPOA 2PFGA 1RJWA 1HTBA 3PI7A 5KKAA 3DZGA 1QSGA 3CE6A 3LK7A 3KYCB 2BF7A 4DIOA 5BQFA 2O2SA 3C1AA 4XYEA 5JAZA 3ZW9A 4TROA 5JFOA 4JLWA 3OICA 1PZHA 4A0SA 1YL7A 3X2FA 3TSCA 4YJFA 3DR3A 5KIAA 2VUUA 3TZQA 3ZWOA 5ENVA 2NTNA 4CR6A 3FF4A 1DOHA 5EQDA 4R5HA 3I5MA 4ZRNA 3DFUA 1GEEA 4GPD1 4B4UA 4HFJA 3WS7A 1GDHA 4YTEA 4UUNA 4IDAA 3VH1A 1SEPA 3A06A 1UDAA 4BNXA 2V7PA 2W90A 3DMYA 2DT5A 3VC7A 1ORRA 1TEHA 4DQXA 1N1EA 3ZWNA 4E31A 4YAGA 1CDOA 2VYNA 1R66A 1GUYA 3D1LA 3GT0A 3DL2A 4GX0A 2WD7B 2PK3A 5G0VA 4CM3A 2YW9A 2NV6A 1E7WA 2JL1A 4Z0TA 1Y5RA 3LLVA 4IZIA 2X5KO 3KM0A 3R1IA 5ITVA 4YT2A 5JMPA 3SBOA 5I7SA 4I9NA 1FMCA 5T8KA 2AXQA 3JQ8B 3GR6A 3WGGA 4O59O 4RF2A 3L4SO 1EUCA 4PG5A 1KC3A 3S2GA 4RPKA 4YJDA 1DRWA 3C7CB 1NR1A 4J91A 1AE1A 4JGBA 3VH4A 3GUYA 4JIGA 3WWZA 1J6UA 1U1IA 1QLHA 4P4LA 2WMDA 1GPJA 3TQHA 1BVUA 4Z3KA 1FXSA 2H1SA 5K6AC 3A9WA 3GVHA 3K2BA 4FN4A 1R16A 4M55A 3V1TC 1Y8QB 1E3LA 5DCUA 4DQUA 4OAQA 1H6AA 5JDCC 1UAGA 1OAAA 1NNUA 1HEUA 4UEOA 4DMLA 4AL4A 3MJVA 5BT9A 2PZKA 1L1FA 4BO3A 5T6BA 5DBIA 3O8QA 1ZO8A 2I76A 1SZJG 3H5AA 3HQ4O 3W4KA 1KC1A 4CM9A 1EFLA 4OYRA 1FJHA 3EZLA 2JD2A 2RH4A 4DUPA 1Q7BA 3RKRA 1M75A 4QXMA 3NDRA 4Q3AA 1LU9A 4JXKA 1WVGA 5JCXA 1PL8A 4RVUA 4NJOA 1P33A 3FCOA 5DULA 4ALKA 4LMRA 4EUEA 4N5NA 1A27A 4BNMA 3S2IA 3M2PA 3PZBA 2G82A 4BKUA 3DBHA 2GZ1A 3CKYA 1I5RA 1N2SA 3E5MA 4WLOA 4AJLA 3DHNA 4BGIA 4D79A 5COAA 4B7CA 1GUFA 1BW9A 1GYPA 1HDYA 2AHRA 4NJMB 3HNPA 5G4LA 1KIFA 1GADO 3DZJA 3Q2IA 4BO4A 4FJ1A 4RLSA 3B1KA 5BSHA 4BNZA 4NFHA 3FR8A 4PGFA 2C5AA 3RFVA 2F1KA 3HFGA 2PY6A 4U0KA 1DLIA 2NTJA 3LZ6A 3EAGA 1MC4A 3FHLA 2NACA 2W8ZA 4G65A 4HNGA 3NAQA 1ZK2A 1RM0A 4OKIA 2CVZA 3PJFA 4NHEA 3FRJA 2VT2A 4E2WA 3JQ9C 4E5MA 1M6WA 5A9SB 2GN6A 1R0SA 3FBTA 5JDIC 2GCGA 3B1FA 2FR1A 3KHUA 4E32A 2IYOA 2PD6A 2Y0EA 4E33A 2P91A 1YL6A 3OQBA 3CMMA 2EW8A 4DXHA 3ZWMA 3RUHA 1EVZA 5KNLA 3W4JA 2PWZA 2HK8A 3CINA 4Q3EA 4M1QA 4N54A 4DLBA 1T25A 1JN0A 3EHEA 3LC2O 3WOHA 3HWRA 1HLPA 4CLEA 2BGLA 4PLPA 1WMAA 5LC1A 2GD1O 2A4KA 1MXFA 5JLAA 1P0CA 3N74A 2HU2A 4FJ0A 1VJ0A 1EFKA 2HRBA 3ENNA 4ND2A 4CLHA 4CM8B 3VPGA 1CWUA 3PHLA 3FWZA 5L4LA 3V2HA 4ND3A 1U8FO 1IPEA 3K5PA 2QRJA 4UVHA 3WNQA 2X9NA 1XYGA 3DZHA 1NVTA 2DPGA 3C1TA 1NHWA 1VKOA 4FD3A 4W7IA 3ROQA 1X0VA 2PTGA 2QZZA 3U4HA 1LLDA 2YJZA 3F47A 1A72A 4IDFA 4RF4A 2POQX 1U4OA 1AXGA 4HWKA 2VHWA 1YDEA 4J1QA 3TDKA 3RQSA 4W9NA 1DXYA 4RF3A 4ALIA 4J1SA 3EW7A 5BSGA 1VKNA 2V6BA 3KB6A 3VVCA 4TMFA 1WDLA 2HK7A 3FTNA 1RM4A 1K6JA 1Y8RB 1KEWA 3G1TA 3LLSA 2ZYGA 3TZCA 2ILTA 3M6IA 4KWIA 4YAJA 5FI3A 3DHYA 3GH3A 4Q3CA 3D4NA 4TRMA 4WLNA 4C7KA 1D7OA 5C7OO 3PYXA 1HSZA 1P77A 1YWGO 3HB5X 1AUPA 3IOYA 4XWYA 4B4VA 4KMSA 2Q2VA 4XDYA 2VHYA 3ITKA 1OZAA 4KP7A 4PZCA 4GGOA 4MVJP 2Z1MA 4XJSA 5KVQA 1LX6A 3F1LA 2O3TA 3AI2A 1PTJA 3ZU4A 4YJGA 1BHSA 5CAEA 3QSGA 3KYDB 4I9UA 4FC6A 4ALNA 3I3OA 3D3EA 2NTVA 3PHGA 1LC3A 1W4ZA 4PFJA 2B5WA 2YHIA 1MP0A 4Y6PA 1QKIA 1UUFA 3F5QA 4GX1A 2VTDA 4CV3A 1Z7EA 4L76A 5BR7A 1E3IA 2X0IA 1IY8A 3RKUA 4MVJH 3LYLA 1KVSA 3LF2A 1G6KA 4NH4A 4PRKA 3B1JA 3EYWA 2GNAA 3QVOA 3WGYA 2NVUA 1NAIA 2JD1A 5DCYA 4HV4A 3PWKA 4DYDA 1Y8RA 1WMBA 4L4SA 5IAAA 5EESA 3KEOA 3FNHA 5F1KA 2AA3A 3O26A 4CUKA 2X6TA 1DRUA 2B37A 3KETA 3PZRA 1BWSA 1ML3A 3QP9A 3AM5A 4EYEA 1KVUA 1E3JA 3OJFA 2VNAA 3Q11A 5DP2A 3GVPA 1BSVA 4HFRA 4WE3A 3ZV6A 2VT3A 1EEHA 4J4TA 2X5OA 3WFIA 1WZIA 3RD5A 1EVYA 1GL3A 1PR9A 1UDBA 2LDXA 4LK3A 3RUFA 1NWHA 2H9IA 2G5CA 2QZ9A 4EZBA 3CPSA 3P5SA 4YJHB 1GV1A 1ONPA 4OQZA 2GERA 1DIGA 4PG6A 2YY7A 4FDAA 1LSUA 3ANMA 1U5CA 4Q3NA 1RKXA 4WLFA 3Q0EA 3VPHA 1NTOA 1C1DB 1SB8A 2QW8A 1UAYA 5H81A 4NU5A 4Y6RA 4MKZA 1YBMA 1EZ4A 4FPXA 4IGEA 3TNLA 1I3NA 3O8QB 2HO5A 4PLTA 4IXWA 5F1PA 3G0OA 4B8ZA 4G81A 4BGUA 1A5ZA 1E5QA 5COQA 3AY7A 3GN1A 4E0BA 1T2DA 2XF8A 4ZQFA 4C4OA 3F9IA 2W98A 5DBFA 1LRLA 4ZU3A 5JS6A 1X14A 5C37A 5KCZA 1H5QA 1XLTA 4B3HA 1HDCA 5ILOA 3H9EO 3DOJA 3QA9A 1Q1NA 1SBYA 2SCUA 4OSPA 1HDZA 3MTJA 5JPIA 5CFZA 3F5SA 4D0RA 1KVRA 4HX5A 4Z9FA 2Q46A 4D42A 1LC0A 2EG9A 2VRCD 1PJ2A 5I9LA 4ZQBA 3ONDA 3RU7A 1QG6A 1MX3A 1IUKA 3PLRA 1SC6A 2UVDA 4FQ8A 1W73A 4XQGA 4BNKA 2OL4A 4PRLA 3UN1A 4NK5A 4N18A 3IS3A 3L07A 3OA2A 3VKVA 1GV0A 4R41A 1VPDA 4RZHA 3OM9A 4XRGA 1ZSNA 5EIOA 5F3RA 4YT8A 3S2EA 4DL9A 4EEZA 1GD1O 3VTZA 1NPYA 4IIUA 3VZSA 2HJSA 1P0FA 4J2OA 1J0XO 4RZIA 2G1UA 1B15A 3ICCA 4L4RA 1SCUA 2GRAA 3OEYA 4CV1A 2BD0A 3WTCA 3E82A 1H9AA 2ZJ0A 2GR9A 4CM9D 1LDGA 3ANNA 3O03A 2WYUA 1P31A 2FR8A 5TNXA 1E7MA 3C7DB 5COBA 3NDJA 3IKTA 3HZZA 2EP5A 1PJQA 2YQ4A 4J90A 4NBTA 1IHXA 2RAFA 3NJ8A 1X13A 4R16A 3JSAA 4RQTA 1E7QA 4DQVA 1EMDA 4GI2A 1LDBA 1MUUA 7MDHA 1ZMTA 4RVDA 4M54A 2FPPA 4WOJA 3CEAA 3D64A 1T2EA 2ET6A 3DXFA 4XRRA 2X8LA 2FMUA 4CV2A 1HF3A 1EDZA 5I7VA 5F5NA 5MDHA 1OOEA 4WNIA 4FFPA 4ZJUA 4O5OA 2V65A 4BNHA 4MPDA 1ZEMA 4EW6A 1VLLA 4CL8A 4BO8A 4I5EA 1V6AA 4NMHA 5FF9A 5CDSA 3ZNQA 1H6CA 4NDNE 4A10A 1R4MA 2ZB7A 2P2SA 2YV1A 3QE3A 3P7MA 2OP0A 3ONFA 1E3WA 4D3DA 4IQ8A 3MJTA 3X2EA 2YV2A 4RPHA 2O50A 5AYVA 1B16A 1ZXLA 1FK8A 3H4VA 1XQ6A 3GZNA 1E1NA 3NT2A 3PHHA 4NG5A 4CQLB 1PZEA 4FCCA 4FS3A 1NQOA 2HUNA 1VE9A 2DBVO 2NQTA 1QXSA 3I4CA 4GL4A 4ND1A 1Q7CA 5H82A 4E5NA 2Z95A 1E0DA 1NM5A 3ZCXA 3ZWAA 5CDUA 4CQMD 3BHMA 2IZZA 4AJEA 2C0CA 1LQTA 4A73A 4BVAA 3JD0A 4XQCA 3KZVA 4Z9XA 4BS9A 1M76A 2WYWA 1GQYA 3QQPA 2NUAA 4OM8A 2EHDA 3TWOA 3TPCA 3NX4A 4YT5A 3EC7A 2AG8A 3RFXA 3I6IA 5AVOA 1E1LA 3MWDB 1LDEA 4HY3A 1O5IA 1TA4A 5T64A 5A04A 2VYVD 1T4DA 3DZKA 4J0EA 3GN2A 4DIFA 2EWMA 4MVJE 3C7AA 5ENDA 3COSA 2VRBA 3AU8A 3H65A 3EVNA 4TRNA 4O63O 4Q39A 3JQ6A 1DJQA 4MOWA 2OZPA 4GWKA 1EK5A 1T2AA 4RPLA 3M1LA 5GZ1A 1ZK1A 1NXQA 3H5NA 3PYLA 5BSFA 4FC7A 2BRUA 4XJTA 1D3AA 1LSJA 4WEQA 4BNLA 2C29D 5IZ4A 4KTTE 4II2A 3E48A 3TN7A 2EP7A 4E21A 2QHXA 4J7XA 5IDXA 1IL0A 3QVTA 1JW9B 2ZTLA 3AW9A 1ZBQA 4YJFB 1PZFA 3OBBA 5CDGA 3TRIA 3ZH2A 2CDCA 4B3IA 4PLCA 4IJUA 3GEGA 1L7EA 4A27A 4UEJA 3F4BA 4CMAA 4YB8A 2H6EA 3QWBA 4U8GA 4M8SA 4PLFA 2Y68A 2GASA 2Y1DA 1YVEI 4J16A 3DOOA 1B8VA 4DWVA 5JNLA 1GZ3A 1UR5A 2J5QA 4RQUA 4XCVA 1Z75A 4JBIA 2PGLA 1NP3A 4XGIA 3UHAA 1XA0A 3ZV4A 2Q4EA 1P1HA 1Q0LA 4EUFA 3T7EA 2D4AA 2D5CA 2IODA 1LDNA 2WD7A 3B20A 3TF5A 3ASUA 4I8XA 5IDQA 3SJUA 3IP1A 4Y67A 4E2YA 4OOFA 2JCVA 1DC6A 2J3KA 4CLRB 3FPCA 1XQ1A 5DZSA 2E6UX 5F1OA 5DDIP 5A4DA 1NASA 4ZRMA 5B37A 4HBGA 1GQ2A 4U6QA 3JQFA 4GLOA 1D1SA 4PLWA 1CETA 2GPTA 1NR7A 4ZGWA 1B3BA 2D0IA 4H15A 3WR5A 4L73A 3AU9A 4CQMB 1ISMA 5TJ9A 2P5UA 4I1IA 5DOZA 2WYVA 3I9KA 3L9XA 4U6SA 4AJNA 1EBUA 1BDMA 4GWGA 4Y8VA 2Y1OA 4YJGB 1Q0HA 4BO6A 3MOIA 1O6ZA 3RU9A 2IDZA 3DTTA 4XYGA 5GZ3A 9LDBA 1ZXBA 5TT1A 2JAHA 2AE2A 3GRPA 4EJMA 1H94A 1B26A 1HLDA 3K96A 4EJ6A 3VH3A 4DC0A 3H7AA 5L7WA 3GVCA 3Q1LA 3O9ZA 1WLYA 4DREA 4ALMA 1NFRA 3S8MA 1PX0A 1DRVA 3QWFA 3BMOB 2CZCA 1DSSG 2IEBA 3DZIA 4NQZA 3DDNA 1FDUA 2LDBA 3OFSA 4AG3A 2Y93A 2PR2A 4ZQGA 1I3LA 1HDXA 3LT1A 2IE0A 4W9NC 2NVUB 4UVDA 1JVBA 3OJEA 2O3UA 2VZ0A 2AQKA 4QFDA 2HKIA 2A9FA 4ONEA 3HN2A 5DOVA 2CVOA 2YDXA 1WWKA 2YUTA 1EBFA 1XEAA 2X86A 3I52A 4IXTA 3VH2A 1UP6A 2JHFA 2W2KB 1PIWA 3CTMA 3PWZA 1LRJA 4B4OA 1HDGO 5JW6A 1ZSVA 4QEDA 2B83A 1I01A 4UUOA 5IFLA 5IN4A 1P45A 5EL0A 1PJLA 4R54A 3WDSA 4NIMA 3AUUA 1MFZA 5TLSA 4NBUA 3DMTC 4OQYA 4K6CA 3R3SA 4QT0A 3RCBA 1ULSA 2E49A 3KYDA 2Q1SA 1C3VA 3TOXA 1ADCA 3W6ZA 2D3TA 1GZ6A 5CPBA 3PHJA 1OMOA 3AY3A 1JDJA 1Y8QA 2HMUA 2EGHA 1DC4A 1E7SA 3KVOA 4WPGA 4OMUA 5JAMA 2EKQA 2AEJA 4XDZA 4D7AA 1HETA 3FPLA 4WLVA 3ZHBA 3KLMX 2DU8A 2F00A 2VRCA 2O2YA 4Z9YA 3RUDA 4P4GA 4PG7A 2ZK7A 1YXMA 1QR6A 4PLHA 1T1RA 4XB1A 4BKOA 4E13A 1QYDA 3WYCA 3E9NA 4WEOA 1PQUA 5AXCA 2Y66A 1P9LA 3JQBC 4CM7A 2ZB8A 4ESOA 1Y5MA 2HK9A 2PH3A 4NNJA 1MLDA 4R69A 4BNNA 3A14A 3TJRA 2DTDA 4M87A 3RI3A 1E1MA 4ROSA 2HMVA 3D5TA 2Q1TA 4RV9A 1BXGA 3DBVO 2CD9A 1BRMA 1I36A 3H3FA 2EW2A 5HWSA 3JQFC 3A28A 2C7VA 3U49A 2DBRA 4BKPA 4BNUA 4RVSA 1LQUA 3T7CA 3BXXA 1UJMA 1WNTA 3V5NA 2GDZA 2DBQA 1V0JA 4L8VA 4PVDA 3M2TA 1TT5B 2Y1EA 2DKNA 1BMDA 1ZJYA 1Z45A 5TRTA 3ZWYA 2JJYA 2WWRA 2J3JA 1Q7GA 4XX0A 2RIRA 2R00C 5G0UA 4BHTA 1HDRA 4UAGA 3JD2A 4BO5A 5TX7A 1JA9A 3I6QA 5DT9A 1HYEA 1CEQA 5KVSA 1O9BA 2O23A 3D3WB 1O94A 4D43A 4MIYA 1EDOA 3RC9A 3V2GA 5CEFA 1OFGA 4CM5A 2Z1NA 1GYRA 1PL6A 5ER9A 3G17A 1UZNA 2UAGA 1AN9A 5CDTA 1HYGA 4GLLA 4W99A 3GAZA 4JBGA 2OUIA 4EEXA 4R9SA 4BQRA 4PVCA 2J6IA 3FWNA 4YXFA 5C7LO 2E4AA 1ISHA 2Y0CA 1FF9A 2QYSA 5JAQA 4J7CA 4IINA 1NPDA 1MXHA 5G2OA 4FGWA 4W82A 1PJBA 3JQ9A 1PWZA 1HRDA 4G2NA 2X1HA 3H9UA 4IDGA 1U7TA 1M2WA 5KVCA 2B4QA 1ZEJA 1O89A 1PGPA 1YOVA 2CSUA 3OJ0A 3GNQA 5A3JA 4Q9NA 3FBGA 1VI2A 3VVBA 1I2CA 3JYOA 4A03A 3F46A 5CPFA 3WIDA 2ZTMA 5JCJD 3DTYA 3NT4A 2DM6A 5JO0A 3TZKA 2IZ1A 4B4WA 1VJ1A 3EY4A 4KUEA 1JAYA 4PZDA 1FDTA 2J3IA 3ZU2A 4OO3A 4YRDA 2BKAA 2PKRA 3QWHA 5A03A 4AJPA 3L6DA 3PQFA 3KLPX 4DPKA 1OC2A 2G0TA 3L4BA 2NM0A 3QHAA 3ADPA 1JU9A 5F5LA 3HDHA 4KDEA 3PHIA 3C24A 3H3JA 1JWAB 2I9PA 1U2DA 3WWYA 2QX7A 3RUIA 2DPHA 3ZHYA 1PS9A 1H93A 2VWGA 2WM3A 1B0AA 1GAEO 2OORA 4E4YA 3WBBA 3U62A 3FR7A 3DZBA 5KOIA 3JD3A 3ZU3A 1M67A 4Z0PA 5HS6A 4E2XA 2EKLA 1ZKMA 5C3MA 1HE2A 3PGJA 3ZNOA 1TB4A 4PLYA 2X9VA 5TS3A 4YRBA 1YBAA 5L53A 5CG2A 3N7UA 3A1NA 1XELA 4FFOA 1BXKA 1PJTA 2W2LA 4BNIA 4KQWA 3JYLA 3IUSA 3UAGA 4P38A 1UXJA 4TRJA 4R1TA 4XA8A 1P1FA 4RDIA 1I0ZA 4JP3A 5CHEA 5CP8A 4DC1A 9LDTA 5KJEA 4IQ0A 1EE9A 5EJ2A 1T1SA 1EUDA 3LQFA 2UUPA 2D59A 3ZW8A 4IDEA 4M86A 1LNQA 2YHIB 4IY1A 4LCEA 1JKIA 1F12A 2WE8A 3KTDA 1V3TA 4HP8A 4AFNA 3O38A 4I5DA 3DFZA 5G0SA 3ROPA 2J5KA 2TMGA 2W4QA 2DTEA 1PJSA 1ZSYA 2FP4A 4IGFA 4M49A 4D46A 1ISIA 1I30A 2I99A 2X9GA 1PU2A 2ZTVA 3E9MA 4N5MA 5HBRA 1N92A 2Q45A 4MJLA 4WCFC 3MJCA 3IKVA 1C0LA 3GY0A 4OXYA 2ZTUA 3GZNB 4CQLA 3GDGA 4Z0HO 4RGBA 2VZ9A 4FFRA 2Z5LA 3OECA 4CLOA 3H9JA 5A1TA 1DDOA 1S7CA 3I4FA 2X7HA 4A7PA 1O8CA 4OH1A 3ORFA 3AUSA 4RF5A 1E7RA 1S6YA 3GVXA 3BAZA 2NWQA 4BNJA 3K30A 4PLVA 1RYDA 5JXWA 4DBVO 4O0LA 3Q3CA 2Y99A 4JN6B 5K9ZA 5B1YA 4F45A 1WW8A 1HXHA 2PKQO 1ISGA 3ROKA 3T4EA 1MC5A 2GN8A 3SJ7A 4EBFA 4BGEA 1D4FA 4RVGA 2EXXA 3PK0A 5EPOA 4B79A 4BMNA 4R68A 4NBVA 3UCXA 1ZK0A 4MKXA 1HZZA 4P22A 4RCVA 1KEPA 3NTRA 4BV9A 8LDHA 1DC3A 3PVZA 1ENYA 4MVJG 4FW8A 3DO5A 1H2BA 3RSHA 2PA3A 4IJVA 4BO2A 4OSOA 5BNTA 1T4BA 2AQ8A 1MGOA 4E5KA 3TL2A 1K5HA 1PGJA 3RFTA 5FYDA 1I3MA 4IUYA 4WJZA 1HE5A 3WX0A 4BOYA 4AJOA 3PQEA 2C7GA 2O4UX 4OGWA 1RWBA 4OIMA 3L6EA 1NYTA 2NLOA 4I5GA 3OSUA 1JQBA 1PL7A 3WQRA 1WZEA 3GFBA 1Z73A 2HAEA 4CMHA 3QWIA 4YAKA 2BI8A 2P68A 3ON5A 4J1NA 4BB6A 3PFWO 3I9JA 3AFNA 3VPXA 2ZB3A 3RUCA 4R3WA 3IDSA 2JKVA 2FSSA 4CL3A 1WPQA 3EDMA 3QRWA 1BGVA 3ZN2A 3ENKA 4FFNA 2I65A 1P1RA 3KRTA 1G1AA 2IEDA 1PSDA 3G3EA 2PZMA 3I83A 4RVHA 1JLLA 1B7GO 3GGPA 4CMIB 1Y1PA 3UH1A 1BTOA 1N7HA 4JP2A 1XHLA 4RPJA 1IE3A 1ONOA 1XG5A 3SC4A 3WYEA 3U09A 1PWXA 4QO7A 4YDRA 1UH5A 1HT0A 4J4HA 3QJ5A 3SVTA 1B2LA 1PZGA 3WG9A 3WICA 4R9RA 4DRYA 2V6FA 4WASA 2YDYA 1JWBB 4ZHSA 1UXKA 1E3WB 1E77A 1HSOA 3MCVA 5TSDA 3GZ4A 3Q9NA 5IXSA 4M89A 3R6DA 4AJ1A 2IXAA 2GZ3A 1MA0A 2HRZA 4K1LA 4JX8A 1P1KA 5A9TA 4OOEA 3DBLB 3W8EA 3QV1A 2DFDA 4JK3A 1NWCA 3LT2A 1ZH8A 4E5PA 2D2IA 3ZDFA 4CM4A 1V3VA 5L95A 3DBHB 1Q2XA 3DAPA 3OETA 3PWSA 2BH9A 4MP3A 5HM8A 1Q0QA 5B4VA 2CF6A 5ICMA 1P1IA 3UCEA 1M6HA 4QFCA 2VOEA 1KVTA 4IDCA 3EK2A 5IDWA 1H9BA 3VKUA 3ZV3A 2X0NA 5CG1A 3C1OA 5A5EA 4GGPA 3GK3A 5DNAA 3NT5A 1T24A 2BLLA 3GLQA 2VQ3A 4D41A 2ZQYA 4CMIA 1X1EA 2Q50A 2Y67A 4DBZA 4IBOA 3GRKA 3N58A 3JQGB 4H16A 3VOSA 4CR8A 4YRAA 1DHRA 1GCUA 2Y05A 2B35A 5B4UA 4R1NA 2X58A 5L4SA 1YRLA 3JQCA 2DUWA 2CMDA 1R4MB 2C2XA 1VJTA 4RORA 4NFYA 3OHSX 1YKFA 2C59A 2G17A 1NAHA 2YFQA 2HCTA 4ZD6A 3GAFA 3OQ6A 3LSYA 3GNSA 3H5RA 3CXRA 4NZ9A 4GH5A 4U7WA 3BHIA 3VHRA 2HMWA 4CMKA 4RDHA 2A92A 2Q99A 6LDHA 3FN4A 3Q6IA 5AXDA 4FOSA 3JQ8A 1Y9EA 1UP4A 1GTMA 3GGOA 1E92A 3MZ0A 3AOEA 5EN4A 1BG6A 2FSVA 1NVGA 4JROA 5JSFA 1U28A 1D8AA 5BSEA 3F4LA 1T2CA 1I32A 4F46A 1N9GB 2FN7A 3CZRA 1GFSA 1V8BA 4U0JA 2FHSA 5A5FA 3O4RA 1DFHA 1RM5A 3HDQA 2CY0A 5J23A 3ICPA 5I8ZA 2OOSA 1PS0A 5A05A 4U5QA 4MDHA 4XR9A 3MJSA 2YHUA 3WQQA 1BXZA 3UVEA 2AMFA 4G5HA 4KQXA 3PP8A 3QW2A 2FZEA 2GLXA 1CF2O 4K28A 3WSVA 1AHHA 3RJ5A 3GOHA 3KSDO 3BMCA 4DLLA 5I7FA 4AVYA 1HWYA 2JHGA 4GSKA 2OBNA 5L45A 4GVXA 3ZWCA 1Y81A 5JY6A 1JKJA 3IJPA 4JJIA 1IOLA 3ANLA 4J49A 2GGSA 1DBVO 1A9ZA 1UZMA 3NTOA 4H7PA 3S1LA 5JYEA 4JCOA 3JV7A 3LC7O 1SPXA 2XOXA 4CQMA 4XGKA 3QVSA 2DC1A 2GN9A 4DTIA 3BA1A 3K92A 3P2YA 3PDUA 4IM7A 4ND5A 2EIHA 3DOCA 3DWFA 2WE7A 4XEHA 3GPIA 1YDWA 3BZUA 3VZQA 2VTEA 5G4KA 1T26A 2AQIA 3WQSB 4B3JA 4J6FA 5KJCA 4QECA 2VWQA 3D4OA 3GUCA 2QG4A 3KUXA 5JDCA 1N9GA 4LCJA 2BMAA 2H5LA 1NHGA 3K73O 5F21A 1E3EA 2RHCA 3LU1A 3LDHA 1DEHA 2D8AA 3QVXA 2VOJA 1KEVA 4XIYA 2JCXA 3PYMA 3KSZO 2CDBA 3E8XA 3W8FA 4P4NA 3BMOA 3D3WA 4YCAA 1AGNA 5IXYA 1PJ4A 1B3RA 5L51A 1I2BA 1HKUA 1U3TA 2VWPA 3IL2A 1VL8A 2NVBA 3NKLA 1YO6A 4XZ3A 4BKRA 2Y0DA 1E5LA 3WGQA 1DC5A 1F0YA 1B8UA 1DAPA 2ZCVA 4XKJA 4A2CA 4CM1A 5IF3A 1M66A 5T57A 4J9VA 5THKA 3RAJA 4BNGA 2H63A 2I3GA 2OBYA 5DN9A 1AHIA 3KYCA 2NSDA 5LDGA 3SLGA 3VAZA 4QQRA 2D5AA 2JCYA 5IDYA 2O7SA 4TZTA 3BYZA 3NRCA 1SB9A 3VZPA 4J43A 1NFFA 2EJVA 3L6OO 2ZCUA 1KYQA 1N5DA 2Y1FA 3G1UA 4HUJA 4LGVA 5G4KB 3ZZNA 2UYYA 3AK4A 3BIOA 4CM8A 3RROA 4CUJA 4N5LA 1LTHR 3JYNA 1VM6A 4E6PA 2O4CA 3B70A 3WLEA 3GEMA 4UUPA 3ZWVA 1R15A 3JQDA 4EGFA 2C5EA 1X7HA 1IB6A 5IZCC 2R6JA 4KWHA 5L9AA 2HDHA 1CIVA 3MJEA 3S2FA 3PJGA 3ONEA 1XU9A 3FI9A 4XD2A 4Q3DA 1X0XA 4BV8A 3GHHA 5C5IA 1K6IA 1KS9A 1C1XA 1SOVA 3HE3A 3JQ7A 2Y1CA 4KZPA 4LRSB 5KVVA 2O3SA 3OH8A 5FWNA 4F6LA 1KERA 2PGDA 2VN8A 3FNGA 1FDWA 4Y6SA 3ETGA 1U3UA 2P4HX 3RC2A 1ID1A 1OI7A 3GQVA 3GC6A 2IXBA 3ZV5A 1VL6A 3IUPA 4XQ9A 1J4AA 1JVSA 1KY5A 1HZJA 2GO1A 2X0JA 3TFOA 3R3JA 4HADA 4WLEA 3HDYA 1YQGA 3CMCO 1SEVA 1Z6ZA 2QRLA 1F14A 2PZLA 3R0IA 3HADA 3HFSA 3F6YA 3E18A 3I9OA 3B6ZA 3GEDA 3IAHA 4KUGA 1C0KA 2Q2WA 3WLFA 3WXBA 3U4DA 2WD8A 4GMGA 5G0TA 1GPDG 2Q1UA 4MO2A 2AEFA 4URFA 4UULA 5K1SA 1XWFA 5AXAA 1D1TA 1HDOA 3INGA 3ZWPA 3EVTA 3UKOA 1A4IA 4B7UA 1I24A 4KOAA 5JCJA 2CFCA 3AM3A 3G49A 5L4NA 2FRDA 1QYWA 3HUDA 1ONNA 4NFSA 4TKLA 4D44A 3IIEA 5EQFA 3VDQA 5TC4A 2O7QA 2FY8A 1QORA 1SAYA 3VPFA 1VSUA 1H6BA 1TXGA 3UUWA 4DA9A 4PN3A 1FDVA 4ITUA 1ISFA 2CUKA 2HMSA 1IYZA 1N7GA 3UICA 2NU7A 3C3XA 4X54A 1ZZEA 4ZN6A 3DZFA 3ETDA 4UVGA 4AJIA 1O0SA 3L4BC 3RC7A 3WIEA 1ENZA 5L7YA 2V6GA 4FGSA 5DBGA 5L7TA 2P9CA 3ZHZA 4PG4A 3NV9A 4GKBA 4IZHA 5DP1A 1A9YA 3BTUA 3ULKA 3ZGYA 2IZ0A 3AUTA 3AWDA 4DVJA 1YH3A 1EQUA 1YOVB 4CLOB 1IULA 2JAPA 1GUZA 4RL6A 2B4RO 1YGYA 3K8ZA 1KY4A 3PPIA 1ULUA 5JO9A 3H2SA 2O3JA 1QV7A 2BELA 3DEYX 1MG5A 4CM6A 1LBEA 2NU8A 3UW3A 5ER6A 1TT5A 3T4XA 4NJMA 3SXPA 4WGGA 4R1UA 4RVFA
chains in the Genus database with same CATH superfamily
5B2EA 2DSTA 5D6OA 3EH2A 5BYBA 3N70A 2X0RA 4M9XA 4OM7A 4XB2A 2VXBA 4H60A 2Z0MA 4W1SA 5ULLA 3UMSA 1LLUA 1SN7A 1Q0RA 4X66B 4HRVA 1AJEA 1EBBA 2AOUA 3KEQA 1GCAA 5DNUA 4LDNA 3EG9B 4EMBA 3FD8A 1Y9ZA 3GD5A 1NVFA 2QLFA 2YOHA 2QN2A 3M5WA 2HIGA 3RBZA 3JARB 4ZQHA 4ALLA 1O95A 4YACA 4Z4CA 5HVNA 2O8EB 3N2YA 2R2GA 4OPMA 5J4YA 1Q91A 1U81A 1MV8A 3C8MA 4HFNA 5A2QA 2ATCA 2WWWA 4HPXB 3SVTA 1KARA 1SURA 2HLPA 4WXEA 4UD2A 4OX9B 2IUTA 3BK1A 1BFKA 1ZUWA 4IUBS 2O19A 2R6ZA 3LW7A 3MBKA 3KB8A 3PTZA 3R6TA 1SVMA 4U02A 1F5NA 2CLMB 3GJ6A 5KDDA 3HYNA 3B51X 3WJ7A 4G8CA 5DF1A 3WGNA 5ICEA 3W4IA 1I0IA 2HHCA 2MMGA 3H9GA 3AR3A 4X5OA 2YXEA 3WNBA 3A9SA 1QB7A 4AKEA 3HHEA 5AOAA 2PZGA 3AOGA 3REOA 4BNYA 4MP8A 5C8YB 2HHHB 3WV5A 3NJ4A 1V8PA 2AXNA 2DUMA 3LVQE 3P2OA 1A8PA 3ILVA 1U4SA 4CJXA 3QBTA 5TPWA 1E9CA 4JU8A 4NAUA 4XPIB 5JNWA 5JYDA 2FMKA 1U6JA 3H2ZA 3IESA 3WFZA 3WJAA 2MDTA 2HMYB 2Q3JA 1QB8A 2ILVA 3I45A 4G0QA 3B53X 4II3A 4HYEA 4X1IA 5EC8A 3REGA 4YR9A 2B6HA 1UBKS 2YASA 3HN7A 1DWPA 4R5MA 3RTGA 5JJBA 1RHMA 3ASYA 4U39A 4BLSA 4PSAA 3DV9A 3U5TA 4BXOA 1VLHA 2N42A 4Q9LA 3UAXA 4WZAE 5BWLA 2AV6A 4HLUA 4TSFA 2QJWA 4UCQA 3VVMA 1CULC 1B8PA 5H3HA 3KTAB 1ECGA 1L5KA 3OQHA 4O1HA 5M29A 4CU2A 2J8ZA 4EG3A 2CNDA 1KZ9A 1WCV1 3HB4X 2OGSA 3HKCB 5H1YA 3I01A 2ZKIA 1BEZA 1DFGA 1PQPA 3NAMA 4BNFA 2A9KA 4KXQA 2EAUA 3A6JA 4N1AA 2C2YA 2GF2A 2GX6A 1NY5A 3GPDG 3MINB 4RJ2A 1L5HA 5LXTB 4DR7B 1KQNA 4FOTA 3E1KA 1QBGA 2AJDA 2PNFA 4C0HA 4LRQA 4MW0A 4YEDA 4M1TA 1UZUA 1ZA2A 3QKSB 4LWZA 3ZGXA 5MF6A 1LPBB 2G36A 4JVOA 4MUNA 1PR3A 1SUSA 2J4FA 2XXJA 2Q3HA 2H31A 3FAZA 3I39X 3FYDA 5FP0A 1KBQA 5H80A 1YB4A 4CHGA 3KQSA 4QNRA 2WVJA 4FZRA 1WPGA 5TQ0A 3CHYA 3SHOA 4EJ0A 1O5OA 4U7PB 3UWMA 2XXBA 2XQFA 3MEQA 1JSLA 2DAPA 1TAUA 1RXUA 3WTBA 3OY7A 4E1BA 2IA5A 1PYOA 1Z26A 2M1XA 4B87A 5IT4A 5JMTA 1X1BA 3LQKA 3OIFA 2XHEA 4ERNA 2FOLA 2I2AA 3F1KA 1YUMA 3IAEA 1Q7EA 1GPLA 2J08A 2JBAA 5KU7A 4DB4A 1T36A 3KQKA 1L0BA 5KYYB 2C9DA 3CVUA 3VR1A 4LVNA 2RH8A 4PZLA 3PSAA 1PV2A 4LW8A 4MA0A 3ES9A 4QDUA 4IHKA 3CYFA 4FIZA 2OE2A 3RG2A 3F5DA 1T8SA 3HG7A 3IBYA 3KXPA 2Y92A 1UBCA 2ICAA 2XITA 5CVVA 1GL6A 2AQHA 3T5MA 4CUZA 3FB1A 2P9GA 2UU9B 3NXSA 5JQGF 1RLJA 3OZDA 4Y2XA 1NXSA 3CZAA 1H22A 1F0KA 5DMXA 3B48A 1G3UA 4WDQA 3DHEA 3K0BA 2W6JD 3I1YA 1J0DA 1Y1KE 1XTBA 1V3UA 1YS4A 3LVFO 3P9CA 4FE4A 1JSXA 3L77A 4PYIA 3UAZA 3UMBA 4AKGA 2ZVDA 4GKKB 3F3SA 1EFCA 3PXBA 4DANA 1NLMA 1X1CA 1KYXA 2FWMX 3FAKA 4ZT2A 1Q3TA 1MF7A 1P4GA 4LTNA 4EZIA 4J0QA 5LP1A 4Q4JA 1UDCA 3PUZA 4P31A 1S89A 3CH6A 1H2HA 2ZYAA 4C30A 5BWCA 3T4PA 1YU6A 3D2AA 4FHZA 4RHFA 2YNMD 3OF5A 3GCWA 2ZWAA 2BRUC 3K72B 4NH0A 4BLTA 3ISJA 4AS3A 3H2HA 3D0OA 3HKDB 1A7AA 4HSEA 4I50B 1JSCA 4KEAA 3G0BA 1SCNE 1K5PA 2FLKA 4P58A 1Z4QA 2FPIA 2ZRIA 3V4LA 1SOMA 3TI9A 2PLFA 1ZIDA 3QHQA 4Y2YA 1YF3A 1TJ5A 3BZWA 3IVCA 1B4DA 2MR6A 1X8XA 3CWZA 3FSGA 2CC2A 4D9JA 4P9NA 4XR4A 3BSWA 1IHYA 2B5VA 2J87A 3GJXC 1IHUA 4IIEA 1KJQA 4QASA 4W7SA 4M38A 5HDQA 3D8RA 1RJ9B 1EFAA 4KQIA 4OBEA 3B60A 1G8HA 1TRHA 1YZTA 4M22A 4MLDA 4MRRA 5ALGA 1MA3A 2F4NA 3WGTA 1MOPA 6REQA 3FPEA 1DAHA 5E6UA 1V8FA 3C7TA 4ZU1X 1WIWA 2D1TA 2QD3A 3DO8A 1A69A 1RHQA 1GRRA 1E2MA 2XDQB 3GXBA 5LVAA 3TLGB 1OBHA 2RGGA 2XQKA 5ALTA 4YP6A 4B43A 3WLSA 3BIXA 1XDGA 3S1AA 1FA9A 1J8DA 4LQ4A 2A0WA 5ALDA 2HNBA 2DBYA 3E9QA 1JB9A 2XNCA 3KJXA 4ZDIA 5IJZA 1Z68A 1QP8A 1CVRA 1P2BA 1W5SA 2LWIA 2FG7C 2RH9B 1QO0A 2Q3BA 2WWHA 4Y98A 1M1ZA 3A70A 4JR0A 2Y6VA 4WI1A 4I5FA 4CMCA 5FD8A 1TEVA 1JR3E 4QBHA 4JR1A 3R7WA 1M73E 4AIIA 2E4UA 2A3RA 3QGMA 5K3FA 5CVUA 5JY1A 4U9HS 1ZCFA 3CEJA 5FJJA 1SR8A 1P1JA 3ZE6A 1Z6XA 5CCEA 1UC4B 2YW2A 4NK4A 1NU8A 4PQEA 4C7MA 1K66A 2BBOA 1DHTA 1CS0A 2PUBA 4FGUA 3FYTA 1V11B 2GNOA 3JCZA 3MPOA 3OM0A 2GZSA 4KNWA 1CYEA 3WNDA 4ZQCB 3RAFC 1WDKA 2J6CA 2ZR0A 2H65A 4IF4A 1FTNA 2C03A 4MYUA 3HVIA 3STWA 1RYBA 4JX9A 5C4MA 2W93A 3SEQA 2ZIFA 3NWEA 2QLLA 5I5GA 1C9MA 2D5IA 5DX0A 1SIUA 2AZTA 4B2LA 1FS6A 2I33A 1HLFA 2PSSA 1FFXA 3TUJC 3U4GA 4B1FA 4URVR 4M8NE 2OP1A 5AUNB 4F1JA 1X77A 1LTKA 1P9OA 4BN5A 1ISPA 1U1DA 2X77A 3RT9A 1GU0A 2A94A 2P9JA 3UJAA 2X9QA 2OXIA 2PQ0A 3MRVA 1KJ9A 4MUGA 1KP9A 1RI4A 5HS4A 2VPQA 4JEMA 3U0BA 3MUFA 1DB3A 4DCSA 5I7OA 1XN1A 2PO7A 4GQAA 1H4VB 4MVJM 4QYMA 3UXYA 1XZ8A 1HE4A 1KZYC 1CU1A 2VK2A 4RKFA 3UK1A 3W5BA 4F6RA 1T34A 3SX2A 4D45A 1CCWA 3UHFA 1XKQA 3NHZA 1PT7A 2MU1A 3V8QA 1DBWA 1OLSB 3OP4A 4R8KA 4TGLA 3IMGA 3CUYA 5C31A 3WKAA 4TLBA 1KVQA 4N39A 1OBFO 4TTSA 1QCDA 2JBHA 2VHUA 4A2QA 1PFGA 2J9ZB 3R5HA 4RC9A 4ZARA 3ER6A 1M2HA 4UHJA 1CQIA 1C4XA 5CDYA 3O6VA 4PCVA 2ZUFA 2PBFA 2W43A 3TFQA 1ATIA 4TXNA 5KEIA 4HTAA 3UO8B 1PYDA 1CQZA 3IJEB 5I4IA 4IDPA 3WL5A 4Q7QA 1K75A 3ZD8A 3PQ6A 5AK5A 1BDBA 3C85A 4OU4A 4QX6A 3SS7X 3F5MA 3A6KA 1X7GA 4QVKA 2GSDA 1QHHA 3BWDD 3IH5A 2YUIA 1VGRA 3AL2A 3AHEA 3GFSA 1PR2A 2VTKA 3ABZA 2HYDA 3BKXA 2BT4A 4NMMA 4PR0A 3VX4A 3ZWWA 4AJKA 2IY8A 2JFUA 4N6OA 1BKYA 1N8KA 5CXXA 4N4AA 3UJ9A 2M6SA 1UK8A 3AM4A 3H6KA 4X84A 2BZ1A 4WOBA 2WSIA 4N47A 1NIPA 1C3XA 1J9GA 1KOFA 1W59A 2VJMB 2WFLA 5AI5A 4YQFA 1XR3A 3EARA 3CKKA 5DGIA 5B4TA 3EXHA 3JAKB 4YP1A 1JB1A 1QZUA 2FETA 4EX7A 3PFBA 2P2ZA 1G18A 4XASA 2QNRA 3KTAA 4MKIA 1P5HA 2HQ1A 5KJ1A 2W42A 4GE0A 3CGWA 3G9ZA 3QYFA 1YQXA 3HDJA 5DM2A 1GO2A 2GXUA 3ASZA 4O4HF 3A32A 4FBGA 5FORA 4ES6A 4ZJPA 3E6AA 3NDIA 1T1JA 2E85A 3FOFC 2AN1A 2R00A 5IUKC 2OAGA 3UT6A 1OTYA 2VNKA 2IEYA 1R37A 4RLQA 1A8HA 3DV2A 3IEIA 4ZCLA 3KWLA 3L6UA 3QNWA 4UDYX 1N2EA 3C1UA 3R5KA 3V4OA 2WJGA 1ZUNA 2I6TA 4LWQA 1PJ8A 1N2JA 2GJ9A 5TXGA 2ST1A 2QN1A 3V80A 4MLZA 5JNVA 1W6UA 3H2IA 3V7YA 4A23A 4RK6A 1UC5B 4YQYA 1C7QA 4L57A 1MEOA 4MYCA 4YVFA 2QEQA 4JGGA 1ZISA 3I4LA 1E5DA 3N2GB 4XPZA 1KXJA 2Z1DA 1SQFA 3UBMA 4J0IA 2QUKA 1AIPA 3OF2A 5TF4A 4WK6A 1EWVA 3LV8A 3OU6A 4KXWA 1X92A 4YK7A 3U17A 3T3DA 3CF4G 5CB8A 2OESA 2A3NA 4N3AA 4E2ZA 2ZSAA 3U4IA 1GQQA 5K0GA 2O3RA 4JUCA 3C45A 2NU6A 4X7BA 3K9QO 4BQOA 2IHNA 1JS1X 5CVCA 3EPLA 5TIIA 4JUBA 5DBHX 4JIMA 5JU6A 4R3NA 2PKXA 5EJGA 3WMWA 4PINA 2X1VA 4GE3A 1IAQA 4NI5A 1T6NA 1DCMA 5IPFA 2Y2UA 5EWMA 1NT4A 2OCIA 3HMQA 4JLOA 1TAHA 3R5SA 5BMOA 1NW9B 2O2HA 1UXIA 1I5EA 4WKPA 1W75A 1GG2A 2HWXA 4U2DA 1T5BA 3V9PA 4YDSA 3H2KA 1T8YA 1WTAA 3AVPA 3EJWA 1KI7A 4Q6BA 1P9NA 2I5PO 4PXSA 4RZXA 4XJXA 1US8B 2ZITA 2EV9A 1GGHA 1H2AS 1L7QA 1ORWA 2OFPA 2V9PA 3E4DA 3GCGA 1GPH1 3ZW7A 5GIPE 5A0TA 4GYYA 1VCMA 4MVJI 4R4JA 4ZPXA 4R0MA 2A9PA 5TGDA 3SHVA 1JR2A 1FSPA 1HL3A 2GSWA 3KV3O 4E3ZA 5I9NA 3HXOA 1TCCA 2Q49A 1RRPA 2X3YA 4I55A 4GPZA 4LRUA 4ZVMA 1A76A 1VKJA 3WB9A 5JCPA 3RDPA 2FPLA 3ONWA 4MVJD 4J8PA 1BOOA 5KTOA 1QG0A 1VBKA 2AR9A 2H7CA 4JBLA 3LGXA 4BX9A 2JW5A 2XYRA 1C9EA 5J9FA 1FRFS 2UDPA 5KJFA 1D9XA 4R1PA 4BLUA 2J5RA 5JRDS 2M6RA 3U7QB 1FFGA 4UNQA 2AFRA 3S0JA 3TLBA 2Q4BA 4C6TB 2FWPA 3WIUA 3QF7A 4RMGA 2COKA 4EGAA 2WD9A 4GBJA 4G9BA 1NBOA 2UV8A 3MMZA 2JHPA 3HR7A 1Y9JA 3E22B 4KDFA 4LSMA 2W6NA 3DA8A 5ITSA 2XQVA 1R0LA 3PGXA 2H3EA 1W76A 3IURA 4RE5A 7MHTA 2MSEB 2F8TA 3HNOA 1XA4A 1MAWA 3P0HA 1W8DA 4NMWA 1WXDA 1YBFA 2AN5A 2D7JA 4RD0A 1QRTA 2YXPX 2WNHA 1FDSA 3G0DA 3RKSA 4MSUA 3LYAA 3VSAA 1VDMA 4I6GA 1ETUA 1YQTA 5IG2A 1VIMA 2WU3A 3W0LB 2QW0X 4K9OA 1ZD3A 2W70A 2AFHB 2E48A 4OUDB 1U2GA 4AJ4A 1QMGA 3W8DA 4C7XA 4GI5A 4XYMA 1VKHA 4JSTA 2H4WA 4MAMA 2WHPB 2YWJA 2PMCA 3ZXUB 4L5JA 1NNLA 3A1VA 1MAHA 2A9VA 2YV3A 3WYBA 1XQYA 3N53A 4JBHA 4PHTA 1R6UA 1LSOA 2BFAA 4NOLA 4FEYA 2FPGA 5I6DA 2XCSB 4F8YA 1KIMA 2WUGA 5K8LA 1ZFNA 2JGMA 3M33A 4DFDA 1OAKA 4ZOLF 1SC1A 2R7MA 3RTEA 3R7NA 4O4JB 4DC9A 4X20A 1KZGB 1R5NA 1R0KA 2AVNA 2EKPA 3P5BA 3PQ8A 1J0CA 2CNWD 4I9HA 4GVLA 4M0PA 4MW2A 5JSUA 5EMHA 5CD1A 1FS5A 4ZO9A 4DLNA 4P4SB 3WLHA 3TD2A 1MX1A 4IDBA 2AB0A 3WDLA 4W8HA 1CQXA 1U3WA 3FB4A 4WY5A 5HA5A 7ADHA 2B4KA 3NHRA 3OVMA 5ERXA 5J47A 3B7GA 2OK7A 5ITWA 4E30A 1VCHA 3FTFA 4G5YA 5BWMA 1CT9A 2V7QD 3HHPA 4Q1EA 4WK2B 4MI9A 5FAKA 5HQ3B 4ZCTA 1E58A 4TZKA 2FDCA 1F2TB 1GT6A 2QRHA 2YX1A 3OZWA 5KI6A 3ZY2A 1QLJA 1L2TA 4F12A 2VKQA 3N0VA 3QF4A 2FZKA 1Z74A 2FEAA 2ZSFA 1QK5A 4FYWA 4IJKA 4BO9A 2Z3VA 4LVOA 1ZMOA 4QD3A 5HZHA 5EUMA 3KZOA 5CUQA 5IWCA 2WU0A 4E5SA 2WWIA 3NBXX 4B8WA 2HWUA 1R4ZA 4CT5A 3KX2A 1FRZA 4OI4A 4AJJA 5KQSA 3U26A 2Q5JA 3DOEA 4ZVRA 4IQGA 2HQRA 1PEDA 2WP0A 3UCFA 2D1YA 3EWAA 1I0LA 3BFXA 1T4CB 5DX1A 5BSRA 1E89A 2GBGA 3GZJA 4NBWA 3SEFA 3ST7A 4DGSA 3BGOS 5EJ8A 2GBCA 2GHQA 4GSLA 4L9RA 3CWQA 3ISTA 4NF2A 1NRJB 4DCTA 5KYWB 3J80A 3H9QA 1IUNA 1BU8A 4O29A 1U2PA 2X4LA 3KQQA 4YT4A 1KHHA 2B92A 4Q9KA 3PXXA 1RYMA 4B3DA 4CG1A 5AQ1A 4OHRA 2QTRA 4MWOA 2XUDA 1XE3A 4AP5A 1JDSA 2WU4A 4LG1A 3DW1X 3W5JA 4RV5A 4X62B 1OXVA 1WCXA 3LUCA 1RBQA 1M2EA 3M9XA 3NWOA 4DJ5X 1YA6A 3A6FA 2Q2QA 5LQNA 2HX1A 3WFJA 1WHTA 1F0NA 4YJ3A 2VNHA 3H2BA 1XZKA 1WOYA 3TTYA 4BX0A 1V16A 4K26A 2WWVD 1EGVB 2I4LA 2Q8PA 2ZT8A 2F8LA 3TLAA 3QFTA 3M1IA 4XUDA 4WSOA 5C8XA 5A4AA 4QBFA 5BUCA 2X22A 1JIJA 2VH2A 4RO0A 5ECYA 5CU7A 2WOJA 2VJAA 1C30A 2RC6A 4QOSA 2IGTA 1QYRA 2YVKA 4KFTA 3ZWXA 1F06A 2FJ0A 1Y3FE 1CJCA 1VLVA 4FFMA 3GF4A 4LJ5A 4NECA 2VHXA 5F7OA 5ISMA 4PO9A 3HJAA 2H2AA 2XE8A 2JI9A 4Z1MD 1M8PA 2HJRA 3BXGA 2PFGA 1T9DA 1RJWA 2XKKA 4ENTA 4RMNA 3LDGA 4MUJA 1QSGA 5DI3B 1SA0B 3IUYA 3DL0A 1VSTA 3ADBA 3WAJA 4Z53A 2QE6A 4UZEA 4TT8A 2BF7A 5BQFA 1U63A 1KAGA 2FP3A 2N1MA 2C8JA 4XYEA 1AMOA 3ZLJA 2WAMA 1R8XA 4D56A 1HURA 2HPHA 3EVZA 3WIBA 5JNRA 4JLWA 1L7MA 3OICA 3FYUB 5LMNB 3ENWA 3G88A 1YL7A 2C4HA 2Y76A 3C14C 3TSCA 1FUEA 3SHQA 4BEWA 2VUUA 3L1JA 2ZXEA 1JTFA 2FWNA 1IQPA 3BCUA 3EY9A 3AVWA 4ZALA 1IJFA 2PWBA 1DOHA 2YZNA 4RANA 4OJMX 1Q17A 1R9GA 4ZRNA 1GM5A 1B6SA 5GPBA 2NSHA 4U2CA 4ENRA 3D6HA 3ZY4A 4Q1VA 3WS7A 3I6MA 2PX3A 4MB0A 4IOJA 4IDAA 3VH1A 3G9UA 5TMDA 1OXMA 1UDAA 2HB6A 3B78A 4C03A 3VC7A 2CLKB 1ORRA 4CCAA 4HVCA 4K0KB 1N1EA 3ZWNA 4Y2QA 4YAGA 4RMJA 3KFVA 2C97A 2VYNA 1R66A 1FP7A 4RSMA 5GIOE 3D1LA 4GX0A 3DL2A 2ZWMA 2WD7B 2WJVA 4PBTA 2GAAA 3JVVA 4FMDF 2J9GA 4GSYA 1AKYA 5DTIA 5G0VA 3UAOA 2RHHA 4CM3A 1JQ3A 2GCPA 2OKGA 1Y6ZA 4NEQA 2TYSB 2CUNA 2NAFA 4Z0TA 2AZ4A 2O2IA 2X41A 1Y5RA 4DLZA 4TL9A 2WNSA 1JG1A 1VBFA 4NY1A 4ZAXA 4Q5IA 3LBFA 2X5KO 4FGJA 3MYYA 2I6SA 1PHPA 3JRNA 4J07A 5FTMA 1II8A 2IDJA 4C08A 1WSWA 2BMEA 3HZOA 3JQ8B 1JHAA 3AESB 3ONNA 3B8HA 4UATA 2FPXA 5AI9A 3U40A 4ZYXA 3U7JA 3RJMA 1GNVA 4O59O 4RF2A 1KAMA 1HNWB 1XYYA 4AG5A 4KRXA 1OFIA 3F73A 3DS8A 3S2GA 4YJDA 5TQJA 4FONA 1JEYB 2G25A 4EH1A 4J91A 3ESZA 5EXEA 3V8EA 4JIGA 1CR6A 3LBIA 1U1IA 4OY3A 4DRXB 1U8AA 2XF2A 4MWZA 2PUHA 6GPBA 1Z3CA 3GGDA 2H1SA 5K6AC 3QEMA 3E0QA 1PVVA 3IALA 4KGZA 4M55A 2HSZA 5AKXA 5FR1A 5AW9A 2WKPA 2Q21A 2YMPA 3WL7A 5K2MA 4JNCA 5JMOA 4OAQA 2G09A 1SULA 1UAGA 2A0YA 2L18A 5LOVF 4D0LB 4WJKB 4QM6A 1QF6A 5LD2B 1U7WA 3WL4A 1TE2A 3OWHA 4ZOLA 4ARVA 2GK3A 1SQ5A 2O20A 5IEJA 5CGQB 3W1EA 2VP9A 3I8SA 4AT1A 1RXWA 4G41A 1Z6AA 4K9MA 2NT4A 1L7AA 4AL4A 4CGYA 3MJVA 4DDHA 4OD0A 4O3FA 5HFJA 5KX5A 4BO3A 2VPXA 2H7VA 1VCIA 2OYCA 3VR6H 1G4UR 3DXXA 1ZO8A 4ZCPA 1AF7A 1SZJG 4YNBA 1QO0D 1TVKB 1U9ZA 4QYIB 3W4KA 4AU1A 4EO9A 2VJLA 2BH2A 4DR4B 3FPGA 5DN6D 3EOZA 4JLPA 2JD2A 2RH4A 1FXWF 1JAIA 1Q7BA 3DLPX 1EX7A 5CMLA 2VC2B 1M75A 2HLHA 4QXMA 3NDRA 4Q3AA 1HUQA 1T6XA 4JKIA 4F04A 3QU5A 4NJOA 5LXTA 2VDNB 5H4HA 1U9YA 1QDEA 4RFVA 1A9OA 4KXUA 1N34B 1R0XA 3BXEA 4OI1A 1N0WA 4F86A 1A27A 3BB3A 1U1GA 3M2PA 3PZBA 4E51A 2G82A 3DBHA 3OIUA 4A0HA 2BE9A 5HQJA 4AJLA 3MTIA 1SD2A 2OG1A 3CLKA 1X19A 4X20B 5COAA 3VGJA 4YV2A 1WABA 2P11A 3NTLA 2GA8A 1BW9A 1HDYA 2CJYA 3PQ2A 5HRAA 4MB6A 2GKOA 4QHSA 2EHJA 3Q2IA 4YAOA 1QBKC 2FPWA 1K06A 4FJ1A 1P7YA 1EP3B 3AL3A 1Q12A 1X2BA 2WR8A 4QXRA 1N33B 1G20B 1RWNA 3UK2A 5FLXA 4JQYA 1XAHA 4DIDA 1RWVA 3N07A 2NUAB 2QUZA 2GD6A 3FR8A 5IBRA 1T4GA 2VPYA 4ER0A 2HW8A 1QE3A 5IJAA 4P5DA 3ZK9A 1UWCA 2NTJA 3AZPA 4YMLA 2QAJA 2A1TS 4MQMA 3RNLA 4W5JA 3OTWA 4P08A 2AI2A 1ZK2A 2H00A 5F3DA 4M9CA 3VR3A 1ZNXA 5J43A 2PGAA 3AUYA 1TJPB 2ZWOA 3FRJA 3JQ9C 3PXDA 3WZLA 4E5MA 3KVVA 4EKIA 5KNBD 5A9SB 3QIAA 1ZH6A 2VJYA 2HT6A 1GT91 4TLLB 2ADMA 1UADA 1CUGA 3B1FA 3DAOA 3RIGA 2IYOA 1XZAA 4TQUS 2PD6A 3ZC3A 5CH8A 4E33A 1T0BA 1YL6A 1Z56C 3CMMA 2H4JA 3RVPA 4EG4A 1J1IA 3WISA 3OQVA 5KNLA 5F51A 1N2CA 1Z6QA 3CINA 1WR8A 4D80A 4W5NA 3E53A 4DLBA 5IJ0B 1T25A 4DEVA 3LC2O 3G7SA 4PAMA 3WOHA 1J00A 4CLEA 3M6XA 3KTFA 2CLEB 4PRZA 1PK8A 3NYRA 4ND7A 5LQJA 2GD1O 2C8LA 1Y7PA 3ZHSA 5CYGA 1A5BB 1U0EA 2A4KA 2ZBUA 1P8JA 4P3PA 1VJ0A 2F9LA 2HRBA 3ENNA 2IEAA 4PTZA 4PSDA 5H68A 3PL5A 4AZ3A 4CLHA 1E1DA 3VPGA 1CWUA 3DCJA 5ALOA 3FWZA 1K6EA 4LXUA 2X0DA 4C3ZA 3MRXA 1Q0TA 4UW9A 4KXFB 4G5GA 4PNEA 5KNBH 1CG6A 2BFEB 4JBWA 2X9NA 1XYGA 2Q4TA 5J5VA 5KWSA 2FEPA 1KYWA 2DPGA 1M5RA 3SMVA 4OIFA 5ETJA 1BMTA 4HDCA 3Q87B 2OLKA 4W7IA 1U8YA 1KFBB 1X0VA 4XWGA 4A6EA 4B80A 2GARA 1JZSA 2K2WA 4HH3C 2A9RA 2P6PA 1A72A 4IDFA 3RAGA 2POQX 3CVVA 5U4XA 1KO7A 3DYVA 1R5JA 3M4ZA 3JAWB 5CVTA 5ADWA 1ZMXA 2AFHA 3TDKA 3MUOA 2ZWPA 1XMSA 4RF3A 4UKDA 1HQKA 1XPJA 1K3FA 2QTVA 4LYAA 2ISSD 1VKNA 3VVCA 1D2NA 3VXKA 4TMFA 3D2LA 3U4QB 1AH2A 1CUDA 1GPUA 4UCWA 1SFRA 3TZCA 2CSXA 2ZYGA 4M1ZA 3M6IA 4YAJA 5IC6A 1E18A 2KW5A 4NBSA 4Q3CA 3PPYA 1IUPA 1Y80A 4WLNA 4C7KA 2HGSA 3PYXA 3QKSA 5JARA 2TS1A 2FUG1 4XWOA 3AVYA 1BKSB 1Q92A 4RTSA 1AUPA 3VR5A 2O06A 5ALFA 1TYEB 1XWIA 4RD4A 2BHNA 2Q2VA 4OATA 3ITKA 3NEAA 2FNAA 1W2HA 3PSHA 3HZHA 4PZCA 4XM0A 4GGOA 2MIIA 5B30A 5KREA 3E2IA 4C6SA 2OO5C 1JR4A 4IW3B 4K03A 4B48A 2FQQA 1LX6A 1A5AB 5JHHB 3AI2A 3HCCA 2G6BA 1KJ8A 3AEUA 1IZZA 4YJGA 3J7AC 4HEHA 1F2UB 2HA3A 4MW6A 1GTZA 2VHJA 4I9UA 4JI6B 4FC6A 3K9FC 2X8WA 4LF8B 1MTOA 1ZIOA 3M4YA 5LA6B 1QK3A 2EBUA 2VP2A 4RQAA 4RDXA 3EFBA 1OF1A 1OI3A 5B1IA 3FVTA 1Z4PX 1MP0A 2YHIA 3DFKA 3PKZA 4Y6PA 3NLLA 3PA6A 3EIHA 1MPXA 4FQ7A 3OZAA 4II7A 4CV3A 1TQDA 3CM0A 2P9TA 1L8AA 4QTUB 3SEAA 1GLNA 5BR7A 1QYIA 3HY3A 4WKCA 4S04A 1HMPA 2B1JA 2X0IA 1M2FA 4TTIA 2CFRA 1IY8A 5EWJA 4QOEA 5DHRA 2WAOA 4HF7A 4MVJH 4GL2A 4UBLA 3ZZUA 4EHDA 1CK4A 1KVSA 4BMXA 3I58A 3KWFA 3EYWA 3P2MA 4GM4A 3RVKA 3QVOA 3WGYA 2NVUA 4DJFC 2ECQA 3TAXA 2V7WA 1K98A 4DIEA 4HV4A 3P9SA 1C1YA 4G4JA 3B6EA 2DWUA 3S28A 1GFWA 3KEOA 4GBED 5LWHA 5F1KA 1P1CA 1X8JA 3RR2A 1I3CA 4URWR 3RSOA 2X6TA 3IO3A 2B37A 3G13A 3PVCA 2BMVA 5ALSA 4QUIA 3VPDA 4BP3A 1RRFA 2XB9A 2IUYA 3MHTA 1E3JA 1XD9A 1E5VA 1NG1A 1EA7A 2ID9A 3L82B 3OJFA 2TMYA 4IVRA 3GVPA 3RG8A 4HFRA 4R6XA 3WMEA 1U8TA 1YV9A 2DPYA 1DKNA 1T2UA 4L3VA 3SKVA 3ZV6A 3ZJ5A 1THZA 4J4TA 5JH7A 1SK9A 2Q6VA 2X5OA 3K1TA 1WZIA 3RD5A 4RD2A 5AW5A 3WFIA 4BFWA 3N05A 1RKUA 4HI0E 4KZKA 2R1VB 4XLTA 4XTCS 5HF9A 1QHYA 1UDBA 1IONA 5JUWA 1SUWA 1V39A 3PGLA 3RUFA 4EZBA 1KRHA 2G5CA 2R8PA 3M6VA 3EEYA 3CPSA 2P1ZA 3P5SA 2W11A 1GV1A 3OKPA 5P8WA 5DISB 3RVLA 2GERA 2RSLA 3EWSA 4PICA 3AR9A 3I76A 4JYCA 1QHHB 4FDAA 5CVEA 1LSUA 5C9ZA 4QBGB 1V4VA 4RTRA 1G4AE 1XZLA 1A5TA 1Q1GA 2WRZA 4CN8A 2O8CB 1I94B 4G89A 1U2GC 3Q0EA 4X8OA 2IYUA 1CUFA 3PEYA 1XCOA 1EFRD 1OB2A 1UAYA 3ZOKA 2FK7A 4JI4B 2YXLA 2J5XA 1IU9A 1ODCA 4Y6RA 4JC5A 2WSMA 4IHJF 4GQIA 3QJGA 4M0EA 5M5BA 3AMVA 3RU3A 1K4KA 3HUFA 3IVAA 4G1UC 3AERB 3ZD9A 5CD9A 2V1UA 1U2DC 4KE6A 4PLTA 1CLEA 2YTZA 2YWXA 4GO1A 3WGJA 3KR9A 5I7AA 4NXMB 1E5QA 1P91A 1E5XA 3V3TA 2YR0A 3DDHA 3I30X 3AY7A 4Y7CA 3SJBA 3GN1A 3G2IA 3ANXA 4KGDA 1DQZA 4ZU6X 1SUAA 2XF8A 3OTGA 4JUFA 1QRAA 1RMTA 2HQOA 3SS8A 3HY6A 4C4OA 1LRLA 5LB4A 4BCDA 3RTDA 3SVLA 4LTMA 1GKYA 3L4JA 4ZOQI 1IFXA 2HA7A 1YA4A 2OFXA 1XLTA 5KCZA 1EHYA 5F52A 1XJ5A 3AF3A 3AKEA 3QBEA 4CCYA 1E64A 1N2ZA 5M7EA 3RTAA 4LBYA 4YRJA 3AXSA 3HR4A 5BYKA 1M8FA 4C05A 1VJDA 3UA4A 3O84A 5ALUA 3U13A 5KNDA 1SBYA 4MDYA 4YIKA 5KB3A 1J07A 5JPIA 4BX8A 5CFZA 3HSYA 4MW4A 2IZ7A 3H8SA 5LKAA 2WWTA 4MQEB 5B3JC 2V7QA 3P2JA 3OE5A 1PJ2A 3CB2A 2ZDQA 1JI3A 3A4LA 3DFIA 4HAWA 3ONDA 1LPAB 4Q21A 1QG6A 4YN3A 4KMOA 2UVDA 1W73A 1W93A 1D1QA 3NNDA 4REQB 1L5ZA 4MRPA 1PRYA 1JE0A 2X6RA 1NOIA 1MPTA 2W22A 4LJYA 3WP1B 3L05A 3W2TA 1E0AA 1VIDA 2BGRA 3L07A 3OA2A 2XUGA 3AF1A 1JR3A 3I42A 5AW4A 2OC4A 4B7ZA 2EFHB 1OIXA 2FRXA 1ZSNA 3IR5A 2ISCA 3OM9A 4LJ7A 2IYLD 1T15A 5EIOA 4XEUA 5F3RA 3S2EA 3T95A 1MNQA 1NPYA 3F8WA 5EJFA 5C4IA 5I51A 4XCQA 2IW3A 3JZDA 1W0JA 2VQEB 1DBPA 1P0FA 4DUZB 1J0XO 2BKXA 2G1UA 3OCJA 4FFDA 3H4IA 4RW0A 3UBTA 3GLGA 1PNTA 4OAPA 3WLTA 3M83A 3LUHA 1OXBB 1RVDA 4OGFA 2GESA 3UPUA 3D31A 2ZJ0A 4L6CA 2GR9A 4BFVA 2HL6A 2Q6TA 1EUCB 2HTFA 2WYUA 4TVKA 4UM9D 4B74A 1USWA 3KYJB 1E7MA 3C7DB 3IKTA 1EX6A 3NDJA 4F71A 3WE7A 3HZZA 2EP5A 4AUEA 4R7GA 3LDAA 2XYVA 3NJ8A 3VUEA 4K8RB 2G63A 1WSBA 4JJ8A 1FFHA 4R16A 4AMVA 2INGX 3U19A 4DQVA 1KZ6A 1Q21A 5DVZA 1IBSA 2P65A 7MDHA 4KITB 1IIRA 3DCNA 4RVDA 2OZVA 2QN7A 3QEMB 5EHGA 2FPPA 3IBTA 1T2EA 4IOLA 1RRMA 1NW3A 1SK8A 1GRQA 2ERXA 5D8DA 5EGNA 3UJCA 4HNRA 4LA4A 3CH4B 4N8DA 4X1KA 3EVDA 1OLOA 1IJBA 2HLDD 2JFOA 3KFLA 3MTAA 1REQB 3T12A 5F5NA 1OOEA 3OEHA 2B34A 4FFPA 2RI1A 5AW1A 1MD9A 4PNZA 3FZEA 1VLLA 5CIWA 3DD1A 4JJEA 4CL8A 2XUJA 5LP6B 3BH7A 2PYZA 3AQIA 4V0RA 3O7MA 1KYTA 1OGIA 2ECFA 4AZ0A 3EXHC 5IVDA 1B0ZA 1R4MA 2HN9A 1IOWA 3FHOA 4PPNA 2YV1A 4GYJA 2WI8A 1M1NB 1VCOA 3H5VA 3P7MA 4KFSA 4P3XA 4WXPA 3G0HA 4TV9B 2C58A 4UXIA 1RDFA 4EG1A 1IATA 2O50A 3MLAA 5AYVA 1ZJ4A 3U4QA 2OGTA 3ZD7A 1F9EA 3B82A 1FK8A 3H4VA 1XQ6A 3GZNA 2JCSA 3NT2A 4CQLB 3GLFE 1TYZA 4LJ4A 1TU0A 3OLCX 2O1SA 3TNYA 3D0QA 3NEYA 4OREX 1VE9A 2PT7A 2Y4OA 4BE4A 1NU6A 4DADA 2G3YA 1YC5A 1G8JA 1C4KA 2DULA 4ND1A 3KQVA 3KYIB 4E5NA 4Y0AA 2C9ZA 1ISRA 3SAJA 2WUEA 1A9XB 1F60A 3C48A 3ZWAA 2PUVA 3BHMA 3E3NA 2J32A 4MPRA 5AHKA 5DK4A 4DNOA 3K8QA 3QFHA 1LQTA 3BRQA 3HSSA 3ND9A 4EMUA 4NV1A 3R76A 3T9CA 4H7JA 1QGDA 5YASA 1QU3A 4FYYA 2WYWA 3NKFA 1PSWA 2K2QB 4ZDJA 5LA6A 1ULBA 2H0AA 2XR1A 4AKIA 2WOOA 2EHDA 2R5FA 3LIIA 3A9RA 3Q7TA 2Z8YA 1JXQA 3WO0A 5EE3A 3PR3A 2YZMA 1NW6A 2AG8A 3I6IA 2VZLA 3HB7A 3HRHA 3BREA 4RQBA 3UB3A 4AMUA 3MWDB 1UJCA 4HY3A 3H6HA 5AP9A 4M53A 2E18A 5JCOC 1XNJA 1FFYA 1LK5A 4HX2A 4J0EA 4PYQA 2PVSA 4UUBA 4MVJE 5ENDA 3TSOA 5F1YA 1AQLA 1Z5VA 2EG5A 3MTQA 1A97A 3E9YA 1US8A 4TRNA 1JLRA 2X8BA 3HH8A 1Z4OA 2A58A 2Y0PA 3KSMA 4Q39A 1LBHA 2H4ZA 5A5VA 1ZU5A 2OZPA 5ALLA 1T2AA 4XDHA 1RZUA 2KPOA 4G0ZA 4B76A 4CTJA 4OB6A 1JJIA 3MJDA 3ZWDA 1SBIA 1ZK1A 4RAOA 4DCNA 5BSFA 5FX2A 1DS6A 2ZSHA 1D3AA 4DT1B 1WF6A 4WEQA 4BNLA 3IQFA 1S3IA 2RFLA 2ZTSA 1XEWX 4RCYA 5K0LA 5IZ4A 3O74A 2VK1A 1A9TA 1AGYA 2PJUA 2UZ1A 3I2YX 3L5KA 4PF1A 5CW2A 2HO4A 1RT9A 3DEJA 3TN7A 3LUAA 4EAQA 5FFNA 4RABA 3QVTA 3ZI4A 1MB9A 3FYUC 3OBBA 5CDGA 1NDUA 3WQHA 3K5HA 4ATNA 4YRGA 4RX1A 1MMFB 1SQ6A 2CDCA 1OKKA 2JKZA 5ADUS 3GEGA 2IITA 3AR6A 2LCQA 5A7HA 1M34A 2D2VA 3N8NA 4QUBA 1FLAA 2FW8A 4IP0A 4DYHA 1CY4A 5HR5A 5JD5A 3MB5A 3UAYA 4PAWA 2QRQA 3CNEA 3DKVA 4GUDA 2X9LA 1P4AA 3SY8A 5HM6A 2VXCA 1RKVA 4M8SA 1GHTA 2V4UA 2GASA 2HDOA 4BLOA 4DWVA 3I05A 4RXMA 3RRZA 2KLHA 3INYA 1XA0A 5AM5A 3B6KA 3WLRA 2IELA 2WVHA 4BWVA 4GHWA 2XRMA 1P1HA 3QEJA 4U7GA 2PBRA 3WYGA 2EZ4A 2HJHA 2MSKA 3S99A 3B20A 2IODA 2AN9A 2ZUDA 3TF5A 1QTRA 3HVUA 1E0SA 3B13B 2WB4A 3B8EA 2QG9A 4Y67A 5EXTA 3HTXA 2I6QA 3IE0A 4TKVA 4LV8B 3AF6A 2FN9A 2JLRA 3NEJA 1MW8X 3QXJA 4P86A 4LOAA 5H5JA 5JBNA 3IT0A 1HQCA 1TMYA 2E6UX 4YPFA 3ZHTA 4DV5B 4I66A 1MIOB 4TMVA 1WETA 2AFHE 5HG0A 2QYOA 2F7SA 3NWPA 4TMYA 2JHCA 3JQFA 3DZDA 3KLNA 4GLOA 4U6QA 4CIAA 1ODKA 3LUPA 2WWFA 3NALA 2FVYA 3L0OA 3CN7A 2FEWB 4H15A 4TLDA 5I4BA 2RHOA 4Q47A 2RI0A 2YJ5A 5CNIA 6CHYA 4AF8A 2FSVC 1L4MA 2WM9B 4HWOA 1ISMA 4HQOA 2D3WA 4OB8A 5DOZA 4H7HA 3CZPA 1VMAA 1EBUA 4GWGA 1E63A 4NENA 4B73A 4OHYA 4Y8VA 2Y1OA 3AEUB 4UHCA 4YJGB 4WKOA 1LWNA 1V9SA 3IHTA 1Z2AA 2P4EA 3DDZX 4UXHA 3RU9A 4JLMA 2IDZA 4RD1A 1N9KA 3M81A 4XYGA 5GZ3A 2FHPA 3K9WA 3Q4GA 1G21A 5TT1A 4XFDA 2VKTA 2QGNA 3PGA1