3GMSA

Crystal structure of putative nadph:quinone reductase from bacillus thuringiensis
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
331
structure length
331
Chain Sequence
SLHGKLIQFHKFGNPKDVLQVEYKNIEPLKDNEVFVRMLVRPINPSDLIPITGAYAHRIPLPNIPGYEGVGIVENVGAFVSRELIGKRVLPLRGEGTWQEYVKTSADFVVPIPDSIDDFTAAQMYINPLTAWVTCTETLNLQRNDVLLVNACGSAIGHLFAQLSQILNFRLIAVTRNNKHTEELLRLGAAYVIDTSTAPLYETVMELTNGIGADAAIDSIGGPDGNELAFSLRPNGHFLTIGLLSGIQVNWAEIVTKAKVHANIFHLRHWNDEVSPYKWQETFRHLIRLVENEQLRFMKVHSTYELADVKAAVDVVQSAEKTKGKVFLTSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative NADPH:quinone reductase
publication title Structure of putative NADPH:quinone reductase from Bacillus thuringiensis
rcsb
source organism Bacillus thuringiensis
molecule tags Structural genomics, unknown function
total genus 111
structure length 331
sequence length 331
ec nomenclature
pdb deposition date 2009-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3gmsA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3gmsA01
1PZFA 2PZMA 5C7IO 1ZK2A 1MGOA 3DC2A 3HE3A 5B4VA 3DOCA 1Z7EA 2OP0A 5J23A 2NVUA 5JY6A 5L4NA 4GSKA 1X7GA 4AL4A 1ZNQO 1B3RA 1WPQA 1UAGA 2W98A 4U8GA 3BMQB 3WYBA 4DYDA 1R4MB 2X5OA 5JO0A 2WD7B 3GQVA 3PJEA 2NQ8A 4PRLA 4AJHA 2YY7A 2PK3A 4RQTA 3VHRA 2FZWA 4ZJUA 3GFGA 2I67A 3DO5A 3WIDA 2GO1A 4OMUA 4NJOA 1DC4A 5KJ1A 1X7DA 3GR6A 3ENNA 1UXIA 3LSYA 3LT4A 1ADBA 3H2SA 5DP1A 1GPJA 5CG1A 3H7AA 2ET6A 3KHUA 2O50A 2VYVA 4ZN6A 4H7PA 1GFSA 3WDSA 4FC6A 5CPFA 5DOVA 1DFGA 1KOLA 2DT5A 5IDXA 3RI3A 1Z74A 3NJ8A 4E5NA 1PU2A 1JAXA 1A5ZA 1A7AA 2B4QA 2X22A 1AGNA 3F3SA 4O63O 3OA2A 4R9SA 1P1FA 4XYBA 5DZSA 5AXCA 1A4UA 4B4OA 5A9TA 2Z1MA 2VCYA 3TOZA 1T26A 2Z95A 1OC4A 4WOKA 1QYCA 2YHUA 4UEJA 1GQ2A 2PA3A 4WEOA 5FFFA 1Z6ZA 1LDEA 4YQYA 2E4AA 1ZJZA 3QVWA 1EVZA 4GMGA 1GEEA 1A27A 5DP2A 4IGFA 1HKUA 3EUWA 5DBFA 2GN4A 3PHJA 4YJFA 5L53A 5IN4A 4CUKA 5F5LA 1PGQA 4CM9A 3GEMA 3KBOA 4OQZA 3VAZA 1JWBB 3V1TC 4PLPA 2Q45A 3VDQA 1JLLA 3L6OO 1TB4A 4L4RA 4OSPA 4PGFA 1E1KA 3UCEA 1JN0A 3X2FA 2BGMA 3CE6A 1EUCA 3DZHA 3PXXA 3FR8A 3WTBA 1LSOA 3D0OA 1N9GA 4J7XA 4UEOA 5F21A 2RH4A 5B4UA 1V0JA 3K9QO 4NK4A 1HT0A 4N18A 4FW8A 4J1SA 4PLTA 4AJ4A 1B2LA 2NU8A 1Z75A 4BNJA 1O0SA 4QECA 1UUFA 1Z73A 2PD3A 1V8BA 4UULA 2IE0A 1DJQA 9LDBA 1IHYA 3SJ7A 4WCFA 5FEUA 3PDJA 2H6EA 3KYCA 1CJCA 1GZ6A 2EEZA 3JYOA 2J6IA 3F47A 1E7MA 1I2BA 2XXJA 4J9VA 4U6QA 4AJOA 2B69A 2C2YA 2X0JA 1UDAA 1U4OA 2GR9A 1KVSA 4F6CA 3JQ8A 4O1MA 3ZI0A 4IZHA 2ZTMA 4PCVA 3ZW8A 4II3A 2CDBA 3PIDA 2GZ1A 3DMYA 1GUYA 2I99A 3DBLB 3HDQA 3VH4A 4CQLB 3OEWA 1GYQA 3AOGA 4TWRA 5EERA 3WMWA 4E2YA 1O6ZA 4B79A 3Q9UA 1U5AA 3MJTA 3PWSA 4R01A 3GMDA 5DN9A 3ZU2A 2BI7A 1NR7A 1PEDA 4YWJA 1IOLA 2IXBA 5B4TA 4UUMA 4R3NA 3ZWXA 4GVLA 2YV1A 1P9LA 3GOHA 4KP7A 3P19A 2CY0A 5A05A 1MP0A 3JQBC 1BHSA 4ZGWA 1WXDA 3GVHA 1J6UA 2EP7A 3JYNA 2Q2VA 1T2FA 2PH5A 4C4OA 3AUUA 3W8FA 1OBFO 3GPDG 1GZ3A 4HFNA 3C1OA 1LNQA 2P9GA 1YS4A 1QV6A 1WZEA 2PZJA 5BSFA 4EUFA 5KVQA 4CM9D 4WLNA 3IAHA 4W4TA 4TRNA 4J1QA 3AW9A 3ZN2A 4O6VA 1WP4A 1UDCA 1PJBA 3GNSA 2J8ZA 3RUFA 1LSUA 2HJRA 2O2YA 2ZB3A 3JQFC 2E6UX 3EGOA 1ID1A 2UYYA 2YUTA 2PKQP 1MC4A 3GGGA 5JC8A 2D0IA 1E7SA 4KOAA 2HQ1A 4DC1A 3Q2KA 3DBVO 3K2EA 2C20A 1O9BA 2ZK7A 1ULSA 5G4KB 1D4FA 3NTRA 1BXKA 4PG5A 5CEEA 1P0CA 2AA3A 2ZTVA 5COBA 2NNLD 1E3WB 1SB8A 3ROKA 4PIVA 1J0XO 5ER9A 4PRKA 3DB2A 4NH4A 4XRRA 2NACA 4EJ6A 2JL1A 3BMOA 4BGUA 1VRWA 5IXSA 1YWGO 1P77A 4NBUA 4IY1A 4CR6A 1YONA 1R4NB 1TA4A 3M1AA 4INAA 1QLHA 3ZV3A 2UAGA 5L40A 1G0OA 3G1TA 4HNGA 3PI7A 5B12A 2O3JA 3ICPA 1PQPA 4CODB 3JQ7A 3U49A 1PR9A 1C1XA 1QYWA 3JQDA 1U2DA 4E31A 1B14A 4NU6A 3F46A 1NAHA 5A03A 3ZGYA 3OJFA 5JNLA 2PFGA 1HETA 5CFZA 2G5CA 3OFSA 3Q1LA 4C7KA 3PGJA 1NVMB 2DTDA 2VUTA 4L73A 4B3HA 1O5IA 1E6UA 3EYWA 4BO6A 4PLFA 1Y5MA 4GWKA 3JQCA 3F1KA 4CQMB 1EVJA 1P3DA 3P2OA 4XD2A 4E4YA 1IULA 1V3UA 3C85A 3D3EA 4I8XA 3VH1A 3E82A 2X4GA 3ZV5A 1OZAA 3I9JA 2RAFA 4IM7A 4H16A 4JLWA 3TSCA 1CEQA 2I65A 1GQQA 1EE2A 1EVIA 1MA0A 3OQ1A 4YT5A 2BD0A 5AXAA 3FHLA 2A9FA 4JK3A 5JDIA 2IDZA 1NWHA 1XEAA 1NQOA 3OIGA 5JBIA 3BHMA 1YRLA 1XQ6A 1PX0A 4IMRA 1F06A 3FD8A 1LQUA 4LK3A 4KTVE 4Y6PA 2B4TO 3JD2A 4HWKA 2FSSA 3JQAB 1K6XA 1KC1A 2PD4A 2VTDA 3VTFA 1KC3A 3WIEA 2HSDA 2BH9A 1ZO8A 2Q2QA 1DRVA 4GWGA 4WLEA 4ZRMA 3S2IA 3BMNA 4BGEA 3O9ZA 2VOEA 3RVDA 1YBVA 4FD3A 4OSOA 3WOHA 4XB2A 1ONOA 4KDEA 4J49A 2J3HA 4GQAA 1L1FA 2LDBA 3ZWMA 3IL2A 3I6IA 1N8KA 3HB5X 5KTKA 3GUCA 4KUHA 4EUEA 2HAEA 4QSMA 2HUNA 1LBEA 1YDEA 3A1NA 4BNHA 2OBNA 4YRDA 5JAQA 3BTVA 2BLLA 3AM4A 1DIGA 4XIYA 4B3IA 2FZEA 1LQTA 4GMFA 4LRSB 3GFBA 1E6EA 1J49A 3IOYA 4IDEA 2FPGA 4YT8A 2HMVA 2FWMX 1ZVMA 4JP2A 5B37A 2AXQA 4IDGA 4KUGA 4BO7A 4LISA 1YL6A 3AU8A 4WOJA 5C37A 3IS3A 1SOVA 3RAJA 4RVDA 3RUHA 5CDTA 2A35A 2VOJA 5TGDA 4J90A 2YQ5A 4LW8A 3AI1A 5L9AA 4BO4A 1S7CA 1VKNA 3JQFA 5AXBA 3BHJA 4RVFA 2D59A 3GG9A 2DUWA 3M2PA 4CMJA 1CDOA 1B7GO 1QLJA 1GV1A 1MFZA 3SXPA 3GN2A 1EK5A 2JAPA 3H3FA 2W90A 2EHDA 1V3TA 2X0IA 4MIYA 2VHWA 4BO1A 3UCXA 1I8TA 1F14A 2O48X 4FCCA 3DTYA 1P1HA 3I5MA 2C5EA 3RC9A 4J0FA 2Q50A 4IDCA 1RM5A 1JVSA 3R1IA 3ZU4A 4E5YA 2UV8A 4QO7A 3WFJA 3DDNA 1H9AA 3OMLA 3IQDB 1LTHR 4D41A 2ZYDA 3BMQA 2DFVA 4BMNA 1T2DA 4RPHA 2EXXA 3G0OA 3G17A 4OL9A 1WLYA 2WYUA 4YDRA 1R37A 3FNGA 3SEFA 4MVJI 2FPIA 1NVTA 1O94A 3E18A 4YQZA 3RIHA 3W8EA 3PYMA 5BSHA 1BVUA 1Z82A 1FK8A 1XSEA 4M89A 1JTVA 5HS6A 4RVUA 1HRDA 2OORA 4EUHA 4BQRA 2GNAA 2PTGA 1GYRA 3OETA 2XF8A 4L74A 4OM8A 3W6ZA 4L8VA 4WEQA 4R3WA 4NJMA 2Y67A 2C07A 3KO8A 3DTTA 3GA0A 3KVOA 4L76A 1HWYA 2C2XA 1DIHA 1NPYA 5JYEA 3KM0A 4DXHA 2YW9A 1I36A 1IY8A 2W2LA 3PHLA 4J3FA 1Q0QA 1GYPA 4IJKA 4FQ8A 3GDOA 4RF4A 2VRBA 4CJXA 1UP6A 4WK6A 4M87A 2AMFA 4DIFA 3O03A 4I9NA 4NQZA 2CUKA 3TOXA 2B36A 2Y05A 2D1YA 5T67A 1VSVA 1XLTA 4DUPA 4JP3A 3HZZA 3M1LA 5IZCA 3VH2A 1U3VA 3RBZA 1QYVA 2C29D 2CZCA 3CMCO 4CV3A 1QKIA 4GLOA 2Y1EA 1TLTA 3LU1A 3RFVA 3RU9A 4CLOA 1T4DA 1D8AA 4WECA 2QRJA 3V2HA 1H2BA 4QT0A 2YV3A 1P74A 5JMWA 4R69A 2VRCD 3WX0A 3W6UA 3AJRA 4JJGA 3PZBA 3CH6A 3DHYA 3A06A 3E5MA 5JSFA 2OO5A 1PZHA 3EZLA 4N5NA 2FMUA 3ZWPA 1ENZA 1NP3A 3GZNB 4BIIA 1O8CA 1I3MA 2Y0EA 3H9UA 3W4IA 4YEDA 3ADOA 5IDWA 2H5LA 4A26A 3TRIA 2GN8A 4DIBA 1VJ1A 3AY6A 4P38A 4M8SA 4IDFA 1I30A 4FR5A 2Y93A 2V6GA 3OQ6A 3AUTA 4XQ9A 2Q2WA 3E48A 2WWRA 4DREA 1YL5A 1B3BA 3E9NA 3GUYA 3UH1A 3RU7A 3RUAA 4CR7A 2DBQA 2ZCUA 5A04A 5I7VA 2JCXA 4RPLA 4UVIA 3GRPA 1UZNA 1DAPA 1HEUA 1S6YA 1XKQA 3QW2A 4M55A 3Q3CA 3R3JA 1NVGA 3KYDB 4B4UA 4GH5A 5IDQA 3V8BA 1E7QA 5DCUA 4CMIA 4MKRA 3GVXA 4W9NA 5TS3A 4AICA 1FDUA 1GCUA 3VZQA 4D0RA 2J3KA 3WR5A 1NXQA 4UUOA 4XYEA 4LCJA 1E7WA 1RM0A 1DC3A 1EUZA 4IJUA 2J5RA 1SEVA 4CM3A 1UXKA 4I5EA 5ICMA 1WZIA 3RBVA 4CUJA 4BKOA 3QWHA 4FFNA 4UVEA 5BT9A 3VVBA 1SB9A 4CMAA 4E13A 1ZSNA 1YKFA 4ZVVA 1IL0A 1XHLA 1LA2A 4UVHA 4Y98A 1FF9A 1RKXA 1TT5A 4CM8B 2CVZA 1YOVB 4I9UA 3DFUA 4WUVA 3TPCA 2X9VA 1RYDA 4FFOA 3WTCA 1E1LA 4WGGA 4ZQFA 4XZ3A 3EVNA 3OQBA 4CMCA 1ML3A 1E5QA 3L4SO 2DKNA 2ZCVA 4G65A 4BNVA 4TKMA 1BVRA 2I66A 2AW5A 7ADHA 1H6CA 2VT3A 1J5PA 2W2KB 2W8ZA 3ZWYA 5DULA 2NV6A 4NR0A 2G17A 1P1IA 5G0UA 2QIOA 4AJJA 1E3EA 1X0VA 5EESA 4NPCA 3I3OA 1VL0A 3JQ6A 2FN7A 1VJTA 3K2BA 4KWHA 3LC7O 1MC5A 1QYDA 4G5HA 5BQFA 4XWYA 5TC4A 1DIBA 1XR3A 4W7HA 3S2FA 2QYTA 3K31A 2EKQA 4BNFA 3C3XA 3DAGA 1SOWA 5JAZA 3FSRA 4FOSA 1O89A 1HE5A 1I01A 1JVBA 2GZ3A 3BZUA 3U0BA 3WXBA 4YT4A 5KOIA 2RHCA 3AM3A 1U9JA 2G1UA 2DUUA 2OXIA 3VKUA 5G4KA 3D5QA 1RJWA 3DR3A 4BNTA 4DA9A 1ADGA 3K8ZA 3TZHA 4U0JA 1E3WA 1Q2XA 4XR9A 5L3ZA 4WASA 1Z7BA 5COQA 3UF0A 1HDRA 3TZCA 3MJSA 3CEAA 4S3MA 4PLWA 3KYBA 4ND1A 2V6BA 1NQAO 4HX5A 4MVJH 1PGPA 2VHXA 4EEZA 1A9ZA 4BMSA 4E33A 2BI8A 1YO6A 1GCOA 1ZXLA 3DHEA 3HG7A 5G4LA 4BNWA 5A9SA 3G49A 2I5PO 5KCZA 3PLRA 4IDBA 3E1KA 1R0LA 3WNVA 3GDFA 1EQ2A 2GRAA 2Q99A 4IQGA 4OKIA 4Z9FA 3ANMA 4IS3A 4N5MA 3ETGA 3TFQA 1A72A 3ZU3A 3DZJA 2VWGA 3BIOA 3PZRA 4YAEA 1YXMA 4NHEA 5I7FA 7MDHA 1XA0A 2AQIA 4DWVA 1PJTA 4MPDA 4PZCA 4ND3A 4LCEA 3PYLA 3ZWWA 3LC2O 1VL6A 5JAIA 4I08A 1HZJA 4L75A 1ULUA 4YRAA 2FP4A 4R5HA 5TJ9A 5TT1A 3ZU5A 3D3WA 5L4LA 3I83A 1U4SA 2EGGA 2HRBA 4R4JA 3WGGA 4CR8A 2BHLA 3ZHXA 3OJOA 4CQMA 4DPMA 4M49A 4FJ2A 4LN1A 3AUSA 3C1TA 3RCBA 1IPEA 3D4PA 2NADA 3DBHB 4R1TA 3KLPX 1UXGA 2HK7A 2HK8A 1LDYA 1I2ZA 5JFOA 4E12A 2OL4A 4L4XA 4A5OA 4OHUA 2Y1FA 1GV0A 2QX7A 1I3KA 3K73O 4BB6A 3VTZA 2CDAA 5DDIP 4HFJA 4RCVA 2ZATA 4R1UA 2EKPA 2Y1OA 3L0DA 4DIOA 2I3AA 5ENVA 2GN6A 1JW9B 2FSVA 1ONNA 3WQRA 1ZEMA 1JDJA 4Y6SA 5F1KA 1ZK4A 3LLSA 4ZQBA 3MTGA 2EW8A 1WAMA 1EDOA 3CINA 4JJFA 5CDGA 5CDYA 1AE1A 4BGIA 3ZDFA 1IHXA 1BW9B 1MLDA 4YRBA 1A9YA 4TMFA 3C24A 4FN4A 1XU7A 1WWKA 1DO8A 4XJTA 3RUIA 4I5DA 4CLRB 2B0JA 1Y6JA 3FWZA 4YBZA 5I9LA 1HDOA 1PL7A 1GPDG 2FR8A 4Q3AA 6LDHA 1JKJA 3COSA 4DQXA 3F6YA 5EL0A 2IEBA 4FFPA 4Q3BA 4K28A 1LDBA 5EN4A 2HMTA 2WDZA 3HADA 3AFMA 1OMOA 3W8DA 3IC5A 1IPFA 5KVCA 3O8QA 2NM0A 2AE1A 3QHAA 3RASA 1YB5A 4EGFA 1C0IA 2ZB8A 5I8ZA 1JKIA 1HSZA 3JD1A 2O3SA 2PR2A 1EBFA 4E6PA 1LI4A 1DLIA 1MFPA 1VC2A 4YAGA 3Q0EA 2EJWA 4QX6A 5EMHA 4PVCA 4TRRA 2GASA 4PLGA 4Z6KA 2IZ0A 2WE8A 1HDGO 1Y5RA 2CNBA 4E2ZA 1U7TA 4IS2A 1I10A 2E49A 1HDZA 5DOZA 1ZK1A 1G1AA 4U7WA 4HV4A 4NFYA 5GZ6A 3UAGA 4XGNA 4B4WA 5L4SA 1PWXA 1M66A 4DMLA 1QXSA 4WLUA 1GTMA 3GK3A 3S2GA 4LRTB 4P4LA 3QLJA 5IN5A 4J9UE 4DYVA 1YQGA 2VYVD 1ZJYA 1U3UA 5K6AC 1N2SA 2Q1SA 2PKQO 2VT2A 2EWMA 2A4KA 3B70A 3WB9A 4BOYA 1GY8A 1E3IA 1E3LA 2WMDA 1XCBA 5EQDA 3PPIA 1UZLA 1DHRA 1G0NA 1B26A 1WMAA 1L7EA 3MCVA 4Y6RA 4Q9NA 1I0ZA 3V5NA 5BNIA 1QR6A 4KUEA 1MB4A 3GRKA 5LC1A 5ILGA 1RM4A 4CM4B 4GX1A 4IBOA 3PJGA 4FJ1A 2EIHA 4DPLA 2P68A 5ICSA 1T2AA 2VWQA 3EHEA 1HZZA 1YBAA 1A4IA 4GGOA 1D7OA 4L9RA 4OYRA 1W6UA 2D5AA 3H4VA 3Q11A 1K6JA 2JCYA 1DFHA 1DRWA 1GQYA 2GD1O 3CKYA 2D5CA 2PZKA 3I9OA 4LMPA 3U09A 3GC6A 1LDGA 4PLCA 2FY8A 1VPDA 3H5AA 5A9RA 4FIZA 1PS0A 1DAOA 5HS4A 5IZ4A 1NR1A 1LLCA 4BO5A 2VUUA 5MGBA 1EVYA 1C1DB 4DQVA 4D79A 4P4NA 1AUPA 3G1UA 3LT2A 2FR0A 5COAA 4RPGA 2DTXA 3PHHA 2CVOA 1M6WA 2NU6A 4CMBA 5H81A 2VHZA 2OGUA 3RBXA 1PQUA 4F6LA 2QW8A 3NAQA 1MG0A 2P5UA 3X2EA 1LC0A 3DAPA 2WEKA 1M75A 2VTEA 5ENDA 3UOGA 4MVJA 1I2CA 4B3JA 1Y8QB 3E8XA 3B1FA 5ITVA 2B83A 3HUDA 4IZIA 4DC0A 4AJKA 3C8MA 1N1EA 1PJSA 3MWDB 4JCOA 3PP8A 3HQ4O 4D46A 2DAPA 1W73A 1O95A 4OXKA 4BNYA 3SBOA 4ND4A 1OI7A 4K6CA 1YVEI 4NG5A 1KEWA 1KERA 1N92A 4XYLA 3GZNA 1XG5A 4H15A 1PIWA 2R00C 3QVXA 9LDTA 1D3AA 1ZIDA 5ITWA 4ALMA 4E5PA 4MDHA 3OJLA 4J2OA 3QVSA 4MVJF 1YJQA 4OOEA 1Q0LA 3RFTA 4MJLA 1V6AA 3T7EA 5A02A 4BO0A 3PFFA 3WS7A 4HBGA 4DMMA 1UP4A 2CF5A 5EQFA 3QIVA 1Q0HA 2OOSA 5GY7A 4BV9A 1M67A 2AQ8A 3HHPA 4XJSA 3WWYA 2C82A 4Y8VA 3ZNOA 1UDBA 3OICA 2YFQA 3BTUA 4JJIA 3U62A 4N7RA 3BMCA 1DIAA 4A10A 3HDHA 3ZWNA 1Y8RA 4U6SA 3KYDA 4ZU3A 1XELA 4A7PA 1ZZEA 2O3RA 2EF1A 3DMTC 3ON5A 3PWKA 4TRJA 5JDCC 1MXHA 3GNTA 1HF3A 1W8DA 3JD0A 1ISJA 3WBFA 4TSKA 3I4CA 3JYLA 5THKA 1VKOA 4I5GA 4FFMA 1KVTA 2NVUB 3BAZA 4XGKA 2O3QA 2P2SA 3FBGA 3EAGA 4ZQGA 4BB5A 4XIJA 1LRLA 1ONPA 4JX8A 1K89A 3ASUA 1YDWA 2V7PA 1B8VA 1XYGA 3EC7A 5AQ1A 3UXYA 5JW6A 3FPCA 3I23A 4W99A 4YXFA 4GSLA 4BNXA 4D7AA 3H2ZA 3FBTA 4ID9A 3LQFA 2Q46A 4CMKA 5JO9A 2CVQA 3QWBA 3NDRA 3F9IA 4FSHA 2J3JA 1YOVA 2V65A 2GF2A 1P0FA 1NYTA 4JIGA 2PV7A 4Z0TA 1PJ2A 4CLEA 5JCXA 5K6AA 2Y1GA 4EDFA 3IKTA 4WLVA 5G2OA 2I76A 4ND5A 1TT7A 3W4KA 3EW7A 5LDGA 3EDMA 2RCYA 5TNXA 5DCWA 3VPHA 3PVZA 4RVSA 3ZZNA 3MZ0A 1KS9A 2YHIB 4OGWA 1MUUA 3G79A 1KIFA 3OJ0A 4KDFA 1BDBA 4YJDA 3H6KA 5T6BA 4BVAA 1BXGA 3A4VA 2VQ3A 1PSDA 4U0KA 4LVCA 2B5VA 1EQUA 2IRWA 3JQBA 4ALLA 4L0QA 4CL3A 5KJCA 4PZEA 3NYWA 3DBRB 1HTBA 2JAHA 3WICA 1NFFA 4XQEA 4YJGA 3K5PA 5EIOA 3D4NA 4BS9A 1LUAA 4JXKA 5GMOA 2P9EA 1SMKA 1ZMOA 1FDWA 1NQTA 2BGKA 2ZYGA 3L07A 2QG4A 3WLFA 5JE8A 1EK6A 4PZDA 2DVMA 1ZH8A 1UP7A 4YJFB 1PGJA 2X5KO 3AWDA 3W4JA 2XOXA 4CUZA 3NRCA 4JBGA 4XGIA 1PJ4A 3STHA 3KSUA 5KWEA 5HBRA 3F5SA 3KRTA 4LSMA 4OAQA 2DLDA 3N74A 2EGHA 4J4BA 4UREA 2HLPA 3MWEB 4FJ0A 2V6MA 1DRUA 4MVJE 4RF3A 1BSVA 1XDWA 1X14A 3L6DA 5IG2A 3HDYA 1N9GB 2GUGA 4B7CA 3L4BC 4IINA 3ZWAA 3TFOA 1HE3A 3RKRA 1NX6A 2TMGA 4E2XA 2VNAA 4BKQA 4DLAA 1Y9AA 3QSGA 4MP3A 3UW3A 4D3FA 1KYQA 4ND2A 1Q7BA 3VPXA 1KBZA 1B0AA 4BNLA 4HUJA 3KYCB 5TT0A 3KOUA 2FOIA 3VC7A 4OXYA 4NDNE 2O3UA 4LSWA 3RFXA 2R00A 3WQQA 1HXHA 4DVJA 1SC6A 3RC1A 1R4MA 3DONA 4HKTA 3SC4A 3D64A 2WD7A 2DBZA 5G0TA 5C7LO 2NTVA 3IP1A 1ZUD1 3JQ8B 1LDMA 4O5OA 3AY7A 4I9HA 2POQX 1UXHA 1A7KA 1BDMA 1LLUA 1SZJG 5I9MA 2VZ8A 2PGJA 3KEQA 5L7TA 2V6FA 3V1YA 3RJ5A 4IJVA 1SO8A 3DZBA 4XQGA 4ALKA 4BMVA 4IDDA 1JKFA 5DF1A 4XX0A 3CZMA 2DBRA 3WBBA 3WQSB 3UICA 4AJEA 1Q1NA 2BGLA 4A2CA 4NU5A 1E7YA 5HWSA 4OOFA 1KY4A 5CDUA 2O23A 3DMTA 4J43A 3PQEA 5JDCA 3FI9A 3E9QA 1NM5A 4RJTA 1E1MA 2YDYA 4IDAA 4L4SA 4D45A 3FF4A 3MEQA 1YQDA 2QZZA 5KVVA 1C0KA 3H9QA 1E77A 3ZWVA 2O3TA 2JD0A 3H9GA 1YGYA 2AEFA 4MVJG 1VE9A 2GCGA 3ZWOA 3UCFA 1FMCA 1U8FO 4JN6B 5TRTA 2O7SA 1BW9A 3B1JA 1H0KA 4GKBA 4HADA 4R5MA 5LDHA 1QSGA 1ZK0A 3PIIA 5F1PA 5THQA 3RC7A 4OIMA 1I5RA 2JHFA 4XYMA 1P1KA 2AQKA 2GLXA 1GAEO 2XPCA 3HFSA 3U5TA 1T1SA 2JFGA 3VDRA 3TJRA 1ZBQA 3HWRA 2NVBA 3VOSA 1MG5A 1WDKA 4J0EA 5IF3A 4LVUA 3AOEC 5FWNA 1KVRA 3GVIA 1ZSYA 1RWBA 1KEPA 3ZW9A 4DL9A 1CQIA 4Q3DA 2VUSA 3DQPA 3TZ6A 2P5YA 4AG3A 2BKAA 3ZWCA 3HN7A 2AE2A 4NI5A 4BNNA 2PH3A 4UUPA 3I9KA 2GYYA 3FR7A 1HDXA 3RUCA 3K6JA 3PK0A 2EP5A 3NDIA 3WNQA 4FB5A 3GLQA 2J5QA 3QP9A 3ETDA 2IYOA 3RKUA 3E03A 1ZKMA 4HFRA 4YYZA 2C59A 2Q3EA 2NVWA 1MXFA 5B1YA 5L95A 3JQ7B 4G2NA 3B20A 2EW2A 2Y99A 3L77A 4Z0PA 4ZHSA 5K9ZA 1C1XB 3PQFA 2AQHA 1VLLA 3DBLA 2NQTA 4MVJP 1DC6A 2X5JO 4P4GA 2NTJA 4R1NA 3MJCA 4QEDA 4W6ZA 4CQLA 4D43A 1FDSA 3W1VA 4YA6A 3N7UA 3ANLA 4DBVO 1AHHA 2W2LD 4TZKA 2H63A 3IUSA 5F5NA 4FBGA 3JQGB 2ZQZA 2HK9A 3WGYA 3NGXA 4ZQEA 3GEDA 4AJ1A 1ENPA 4Z0HO 5A06A 1UAYA 4CMEC 1R12A 2QRLA 4S1VA 5DBIA 2Y0DA 3VZRA 3A28A 4NBRA 4YJHB 3TL2A 4XQCA 4AJPA 4OO3A 2B4RO 2GERA 2IXAA 4WPGA 2PZLA 4BO9A 2W4QA 3WGZA 1P45A 2VZ9A 2DPGA 1DPGA 2ZYAA 3DZFA 5JCJA 2VZ0A 4R41A 1B16A 1ENYA 2E48A 1OFGA 2BELA 4RDHA 5TLSA 3T4EA 3KZVA 3MJEA 4RLSA 4BNIA 5DBGA 2X1HA 3NTQA 3QRWA 4PLVA 4YAJA 4FS3A 3AK4A 2BRUA 4MKZA 4KQXA 1FXSA 1IE3A 4TRMA 4IUYA 4F3YA 2VHYA 3L9XA 1SEPA 2HCTA 1PWZA 3I9NA 1N7GA 3NT2A 4R1SA 3GHHA 1IZ0A 4IXWA 3UGKA 4CM7A 4OKNA 3NX4A 3E6AA 3ZH2A 4WLFA 1Z45A 3ST7A 2O7QA 5GZ1A 4ITUA 3GY0A 3DZIA 3KSDO 1PJQA 3TNLA 1YBMA 4N5LA 4BGVA 1R0KA 3CXRA 3RROA 1I24A 1P33A 1SPXA 3KB6A 3R6DA 5DT9A 3BTSA 5DCYA 1E92A 3V2UA 3ASVA 3D5TA 2I3GA 4QXMA 2G82A 3TN7A 4NK5A 3E5RA 1R15A 3TQHA 1K5HA 3ONEA 3SX2A 4CL8A 1ENOA 4EZBA 5CEJA 4F46A 5JXWA 2DM6A 2Q4BA 1I3NA 4WCDA 2Y66A 1R4NA 2WE7A 1BG6A 4U5QA 4CV2A 4GL4A 1X7HA 4RZIA 4NFSA 3GPIA 3IP3A 4NFHA 4YCAA 5JAMA 1LLDA 2GSDA 2HMSA 4E5KA 4J2HA 2JHGA 5CDSA 4TVBA 3DWFA 4Q3NA 2P91A 3LK7A 3ORFA 2J3IA 5TF4A 4MP8A 5L45A 2AEJA 4PG6A 3JSAA 3RWBA 4EJMA 4E0BA 3IMFA 2C7GA 3LZ6A 4RORA 3H3JA 1GD1O 4M54A 1E3JA 4KWIA 2WYWA 4X54A 3LT1A 2DFDA 2X0RA 1GADO 5T5QA 2E82A 3GN1A 2GDZA 4RVHA 4E3ZA 4KMSA 2A94A 3NJ4A 3K96A 5FF9A 3VZSA 3ZCXA 4PN3A 1E7RA 5AOVA 4BNZA 4CMHA 1ZCJA 1FDVA 3F4LA 3N58A 5A4DA 3DEYX 5CP8A 5KVSA 4QO8A 4YB8A 5H83A 1DFIA 1PGOA 5AYVA 1N5DA 5JCJD 3OBBA 2EJVA 4MIEA 2FHSA 5BNTA 1TEHA 3QWAA 2ZTLA 5IXYA 3K92A 2D3TA 3WSVA 3U4IA 1PJCA 2XXBA 3R3SA 4GPD1 3QWIA 1C0LA 5A5EA 4R16A 3D1LA 1OOEA 4BNUA 4P8RA 3KEOA 3FRJA 3UUWA 4BO8A 3ITKA 3JQAA 2DTEA 2O4CA 3KLMX 4NJMB 4J1NA 5L51A 4E32A 5JC1A 4M1QA 1X1EA 4G81A 2G76A 2QZ9A 4WJZA 3WYCA 4CV1A 3HSKA 3PLNA 4JQCA 1A71A 2YHIA 2D2IA 1IB6A 4AJNA 3D7LA 3H8VA 4UEKA 5HRUA 1V3VA 3KXDA 4MINA 3MTJA 3GGOA 5BR7A 2GZ2A 4JBHA 3ZNNA 2C7VA 5G0WA 4GX0A 3FNFA 2X0NA 4W7IA 4ZICA 4CMEA 4K6FA 1GU7A 3DBRA 5F1OA 2ZKLA 3JV7A 3BA1A 2Y68A 3FTNA 3ROMA 4BL5A 1GUFA 4FGSA 4YTEA 3OP4A 4CLXA 4EI2A 3GZ4A 4ONEA 1QORA 4OJNA 4DPKA 3RSHA 4YR9A 3OM9A 3RQSA 4J1TA 4PG4A 4CLOB 3ONFA 4RLHA 5T64A 3Q2IA 4WLOA 1EFLA 2A92A 1WDLA 1NQ5A 5JLAA 1D1TA 1GR0A 3IJRA 2P4HX 1QP8A 3JCZA 3JD4A 4ZD6A 1Y9EA 5C3MA 3EY4A 2WSBA 3VH3A 5TQVA 1LLQA 4J6FA 4A0SA 4WNCA 2ZJ1A 4EEXA 4C7JA 1U5CA 4J4HA 3SVTA 4LMRA 4FFRA 2CF6A 1KETA 1XIVA 1PJ3A 2JFFA 3I52A 4Y67A 1E3SA 1W0CA 4Q3CA 1UH5A 3LYLA 1KEUA 1QRRA 3H5NA 4CQMD 2BF7A 1ISFA 1MV8A 2ZIZA 5I8WA 2VN8A 3AI3A 4DTIA 3K30A 1F17A 4IQ0A 4YAKA 3HB4X 3UN1A 3ADPA 1QMGA 3C7DB 3FCOA 2VHVA 1EE9A 4MO2A 3S8MA 1GL3A 1R16A 3ULKA 3WGHA 3ENKA 3LLVA 1DBVO 3BXXA 1DIRA 1X0XA 3DFZA 4CMIB 3OHSX 1UR5A 3ZWBA 1CYDA 1XQ1A 4HP8A 5JDIC 2Y0CA 1BXZA 5EPOA 3ZV6A 5F3RA 2OUIA 2X8LA 4N54A 1K2WA 1DLJA 3JQAD 1NPDA 4F45A 2OFPA 3AUAA 4BNKA 1B8UA 2DU8A 4CMGA 4NMHA 1AHIA 3KTDA 1NHWA 1I33A 1PJLA 4GBJA 1YQXA 4YVFA 3GNQA 3INTA 2NU7A 1H5QA 2WTBA 3GVCA 3IJPA 1DOHA 1FDTA 5KJFA 4ESOA 4RF5A 3FNHA 1NNUA 4P22A 5L7YA 1DB3A 2FR1A 4A27A 5U1PA 1CWUA 2IODA 4ALJA 2H1SA 2WM3A 4H3VA 5CG2A 1TT5B 3IKVA 4YAIA 4PLYA 4KZPA 3NEPX 1DXYA 1H93A 2BFMA 1PTJA 1WNTA 3CTMA 4KTTE 3DOJA 3U4DA 2BFPA 1BGVA 3RUDA 1GDHA 2Y1CA 4RL6A 4BUCA 1D1SA 1Y81A 4TQGA 3L9WA 4XKJA 4E30A 3GH3A 1R6DA 2YZ7A 1EMDA 2HMWA 3U3XA 2ZJ0A 3OSUA 3OIDA 4PG8A 2B37A 5KKAA 1YB1A 2BMAA 1EBUA 4OH1A 3PQDA 2YFHA 1TVEA 4I1IA 3LF2A 4K1LA 4GLLA 1NPTO 5T57A 1LEHA 3RJ9A 3ABIA 5BNFA 2X9NA 1ISIA 3WSWA 1NBOA 2Q1UA 4NIMA 3QY9A 3WJ7A 1N1GA 3PJFA 2I9PA 1LU9A 3FTPA 4IIUA 3F4BA 1XGKA 3WMXA 4BKRA 2NTNA 5U9CA 4NBTA 3PDUA 3RD5A 3VZPA 3BTOA 1LX6A 1CF2O 1T4BA 5I7SA 1K3TA 2NWQA 3KUXA 4K9DA 3DOOA 3M6IA 3EZYA 1ORRA 2H9IA 2JKVA 3GMSA 1X1TA 4IPTA 1LRKA 3SLKA 4EITA 3O38A 4Z3KA 1ZXBA 4WE3A 2Z5LA 2UUPA 4J16A 3CIFA 1RM3A 1ARZA 2PKRA 4DLBA 1LXCA 2TMDA 3O4RA 1ADCA 3PRJA 4QFCA 4R68A 5CEFA 4Z3DA 2DC1A 1M76A 4EBFA 4TKLA 1U1IA 2OMEA 2EG9A 4MKXA 4RO0A 5CPBA 5A9SB 1H6DA 2X7HA 1LSSA 1X13A 3MJ4A 1NFRA 4WNIA 3GG2A 2Q4EA 1CERA 4BKUA 3U4CA 2P9CA 3WG9A 3WGOA 1M2WA 3WLEA 3UVEA 1WMBA 1T1RA 1VJ0A 1DSSG 2BFAA 1E5LA 3FWNA 5AXDA 2ZB7A 2OBYA 3IUPA 5U4QA 1K6IA 1GZ4A 3L6EA 4NZ9A 4D42A 5JPIA 3V2GA 4D3SA 1KVUA 3WJAA 2O2SA 1OC2A 4PG7A 3DHNA 2VWPA 1E0DA 1C0PA 2CSUA 4PVDA 2AHRA 4XDZA 5H82A 2CD9A 5EJ2A 3O26A 1IZ9A 2FPPA 3D3WB 5TX7A 1UZMA 4AFNA 1CIVA 3JQGA 4PLHA 5I7EA 5AVOA 3PGXA 1H94A 1K0UA 5BSGA 1WDMA 4CM8A 5TIIA 1BMDA 3P7MA 2X86A 1BTOA 3OEYA 4OXNA 1J4AA 2RHRA 3AFNA 4YPOA 5IZCC 4ALIA 5C5IA 1AN9A 3ICCA 2JD2A 3BHIA 3LT0A 3ZNQA 2DQ4A 4YJHA 1WW8A 1YL7A 1XU9A 1EDZA 1P1RA 3B1KA 3TL3A 3JYQA 3GAFA 3T4XA 4MVJD 3TDKA 1JWAB 4XYGA 5KIAA 1HE4A 1ADFA 2W2KA 3HNPA 4R54A 3MJVA 3QA9A 4HXYA 2GN9A 2CDCA 1QG6A 1CETA 2RH8A 3OECA 2EKLA 2NUAA 3GEGA 3SLGA 5G0SA 3GHYA 3JQ9C 3GVPA 1BRMA 3QQPA 4PFJA 3M2TA 1ISGA 3NGLA 2IZ1A 1YB4A 4XA8A 1ZK3A 1IUKA 3S55A 1HYEA 4GX5A 1T2CA 3ROQA 3HN2A 2X6TA 3HJAA 3I1JA 4DLLA 3NTOA 1F12A 1LC3A 1SCUA 2YDXA 3AU9A 4AJLA 5G0VA 5KKCA 2CMDA 2C54A 2OP1A 4B8ZA 5TJHA 2D4AA 4B7XA 5JY1A 2JCVA 2VYNA 2HDHA 3CUKA 3VKVA 3CPSA 4ILKA 1YJ8A 3TZKA 4IQ8A 2HJSA 2QQ5A 1EFKA 4W82A 4RDIA 4GVXA 5IDYA 5JYDA 2OZPA 3R0IA 5JS6A 5L7WA 1UJMA 3Q9NA 3GAZA 4MOWA 1N7HA 2HO5A 4BV8A 2YQ4A 1B15A 3A14A 3O8QB 3QJ5A 3FNEA 3TF5A 4QQRA 1YH3A 3WGIA 4JROA 5FYDA 5A3VA 2HU2A 2R2GA 3PHIA 4NBWA 2GGSA 4II2A 4WKGA 4W9NC 2JD1A 1E6WA 4D44A 4M86A 2J5KA 4UAGA 4B7UA 2VNSA 1JU9A 3P2YA 3IIEA 3ROPA 1HYGA 4PLZA 2NLOA 3F5QA 2I6TA 4URFA 4FGWA 4RPKA 2O4UX 2VRCA 4WCFB 4CPDA 3SJUA 3GGPA 1Y7TA 4D3DA 1KY5A 1CRWG 1W4ZA 2IZZA 3NT4A 3OA0A 4HFMA 3ZHBA 3QVOA 2EERA 3S2EA 2X58A 3IDSA 5DNAA 3U9LA 4A03A 4Y9DA 2PGLA 3PTZA 2OHXA 1DJNA 4JNKA 3WFIA 1ZFNA 1JAYA 5KNLA 4MIOA 1G6KA 1E1NA 3DZGA 4LGVA 4RVGA 3ZNPA 3AI2A 2AG5A 1EEHA 3GT0A 3RUEA 2ZB4A 2NU9A 3NUGA 3T7CA 5ILOA 3EMKA 3INRA 1VM6A 2IEDA 5K0ZA 1HE2A 3DBHA 4TVOA 6ADHA 1PS9A 4CLDA 1I3LA 4RGBA 4AVYA 1R66A 3C7CB 3F1LA 1Q7GA 2UVDA 4EW6A 3BYZA 4BHTA 5LCXA 5ER6A 1P1JA 4ZA2A 3H65A 1PS8A 4TROA 5K1SA 4RQUA 1KVQA 3SC6A 1PGNA 3JYPA 3WYEA 1YE3A 4AJIA 1XWFA 4CM5A 1PL8A 3U4HA 3DZKA 4UVGA 2X9GA 1Q7CA 2PY6A 3LDHA 1V35A 2ILTA 3A9WA 2DPHA 2PD6A 3H5RA 5A1TA 8LDHA 5HM8A 1P31A 1X15A 5TSDA 4AJ2A 3RC2A 4A73A 2VYND 3QWFA 1U3TA 1NASA 5A5FA 4CLRA 2GPTA 1QV7A 4XRGA 3TZQA 5A3JA 3KETA 4RF2A 3WGTA 4DGSA 1BWSA 1VI2A 3VPSA 3PWZA 5BSEA 2D8AA 3ZV4A 5FI3A 1LRJA 2LDXA 4NBVA 3INGA 1PQWA 1VL8A 3QE3A 4FDAA 1DC5A 4JBIA 3H9EO 5EINA 3NDJA 5T8KC 1NFQA 2JJYA 2DBVO 2WJPA 2YV2A 3ITDA 3UFXA 3UHAA 3JD3A 4B4VA 2BFOA 3ZHYA 4XR4A 4BQPA 1SBYA 3OIFA 2Z1NA 2R6JA 4R51A 4EJ0A 3LF1A 2RIRA 4CV0A 2IYPA 2WYVA 1VSUA 3JTMA 4XB1A 1WVGA 3ZHZA 3I9LA 3DAFA 4GX2A 4BNMA 1SNYA 3EVTA 1HDCA 1H9BA 2E37A 2PGDA 3JQ9A 4CLHA 1U28A 4NNJA 2UUOA 3GDGA 4EYEA 1OAAA 3MOGA 1R0SA 1PL6A 5CAEA 2YJZA 4IXTA 4DBZA 5C7OO 4J91A 1AXEA 1TI7A 5KJEA 1HLDA 4O59O 3BMOB 3ETEA 1L7DA 4TZTA 4BO3A 5IJZA 4MVJM 1FJHA 4KQWA 3PEFA 1C3VA 3G3EA 4XEHA 3UKOA 5JMPA 1NHGA 1PZGA 4BNGA 3PJDA 3FN4A 3AY3A 5FI5A 4OQYA 2Q49A 4E21A 1H6AA 2Q1WA 1H2HA 3NKLA 1LSJA 3E9MA 1B8PA 3KSZO 2PLAA 3H9JA 3PYXA 5KJ6A 4ROSA 2C0CA 4ZRNA 1F0YA 1RPNA 1UXJA 1JA9A 3KV3O 4Q3EA 1CQJA 3BMCB 3OH8A 1T2EA 1Y8RB 1EUDA 2ZTUA 4ZQHA 4E2WA 3OJEA 1PR3A 3L4BA 1F8GA 1GEGA 5ES3A 4CM4A 1JQBA 5CHEA 2PNFA 3OF2A 4GKVA 5IAAA 4FPXA 4UVDA 1T25A 3VPGA 5HA5A 2G0TA 1DEHA 1U7HA 1ZW1A 4IGEA 4Z9XA 1ZMTA 3CZRA 1TXGA 4RZHA 3AM5A 1AXGA 2QHXA 2Q1TA 2SCUA 1U2GA 5GZ3A 3QVTA 5IFLA 2HMUA 2X23A 4QFDA 5ADHA 3P5SA 3PFWO 4B8WA 4DQUA 2CFCA 4J4TA 4BO2A 4E5MA 2FRDA 3QV1A 1U3WA 4FC7A 4Q39A 1Y1PA 1C14A 2UDPA 3DXFA 2AEMA 2B5WA 1C1DA 4YACA 1P44A 1HYHA 3JQEA 3I4FA 4BKPA 4J7CA 4GI2A 3LC1O 3GF4A 1RYEA 1MX3A 3CMMA 2VWHA 1HDYA 3BMNB 4IIVA 1HSOA 1ISMA 4HY3A 3CSDA 4J7UA 1NTOA 1SAYA 3WGQA 4RPJA 4UUNA 4CM6A 1BXGB 3MOIA 1PZEA 5MDHA 4HNHA 3I9MA 1NWCA 4ALNA 4FOOA 1Y8QA 3WWZA 2JFHA 4R9RA 3D4OA 4Z9YA 1F8FA 3ONDA 2EV9A 2PWZA 1ZEJA 2F1KA 3S1LA 4FFLA 1V9LA 1DDOA 1QYXA 4IJWA 4WCFC 4YJGB 4MP6A 4QTZA 2YYYA 4XCVA 3ANNA 3HFGA 2Y1DA 4K26A 1H6BA 2F00A 2NSDA 2P4QA 1LDNA 3C1AA 2B35A 1ISHA 4IMPA 4RV9A 5I9NA 4XDYA 3PHGA 3Q6IA 4I5FA 2RBEA 1GUZA 3VVCA 2ZQYA 2C5AA 1HLPA 4YT2A 2HKIA 3C7AA 3NT5A 4QUKA 2HRZA 3TWOA 1EZ4A 3V1UA 1NAIA 2QYSA 5HTOA 2XAAA 4GAEA 3HDJA 1T24A 3B6ZA 5T8KA 3VPFA 3DL2A 1LJ8A 2QRKA 3EK2A 1DHTA 4CM1A 3FPLA 2AG8A 3AOEA 3NV9A 3I6QA 1M6HA 4JGBA 4O0LA 1ZSVA 4DRYA 1U8XX 1HL3A 4D0SA 1KEVA 8ADHA 4GGPA 1IYZA 3LVFO 1I32A 2WD8A
chains in the Genus database with same CATH superfamily
1GNQA 3EVDA 1WXFA 5C7IO 1ZK2A 1JVNA 1KIMA 4OFXA 1X7ZB 1MGOA 4S2UA 3CLVA 3NVDA 1YS9A 1L4MA 2OP0A 4I50F 2NVUA 4QUGA 5J23A 3W5JA 1LW6E 1VKZA 4AL4A 4ER5A 4S04A 3BD6A 1UAGA 2XJ9A 2JBWA 3VYRB 3AJ8A 2OD9A 3CVXA 1VCHA 3BMQB 4U8GA 1XYVA 4QPDA 1GRVA 2FW7A 2X5OA 3WLNA 1XDBA 2G9NA 2V54A 2B1RA 5SICE 5DNVA 3GQVA 3CSUA 5ISMA 2MSEB 3LUDA 4QU9A 3LFHA 4XE5A 1YMUA 3DR5A 4YJ3B 1ORTA 3WQBA 3VKHA 2YY7A 1H2YA 2PK3A 2XGGA 2FZWA 1JH8A 2GKSA 5F2EA 1W4AA 3GRFA 4BX8A 3WWOA 1X77A 5I8PA 5J4HA 4JYPA 4NJOA 3LWNA 1Y0BA 1T9CA 3G5AA 3GR6A 4O0MA 1CQWA 4AC9A 1F8YA 3S40A 3LSYA 1GPJA 1AGRA 4X85A 4XX0B 2FEAA 5IH7A 1HGXA 2ALJA 2QZSA 3G7NA 1PR6A 3AXSA 1VLMA 3AR8A 2PAFA 3KCQA 1GWNA 5K0BA 1D2MA 4S1NA 2PSJA 4PTLA 3TZEA 2DT5A 1EHCA 3SC3A 4BVGA 1ODSA 1G5IA 3I76A 3OCUA 3T9AA 3WB2A 3UPTA 5A4KA 2O2GA 2VXCA 1A5ZA 3VR4D 1UC4B 2X22A 1T3TA 4DXAA 1Z88A 3PUHA 4MYCA 4QEZA 4E14A 4PN7A 3KQHA 1ZI8A 2ZYSA 4H1UA 4UHBA 4LV5B 1WHTA 5AO9A 5EPUA 1J97A 1FCJA 1IHOA 2O8DA 1R0WA 5DZSA 4IICA 1WHSB 5DCLA 2OXEA 1MGPA 2C2BA 1H4VB 3TLAA 4YFVA 1Y1SA 3K9HA 2Z1MA 3L7LA 2VCYA 3OTGA 4PZPA 2J4CA 3CR7A 4G2TA 5DM1A 1T26A 3LKDA 1OC4A 5BN3A 1QYCA 2YHUA 5HF5A 1C3JA 1Z6ZA 2G72A 1R6VA 1N2BA 1LDEA 4BJ6A 3HXOA 1F2VA 1ZJZA 1G8GA 3M6UA 2DWUA 5DP2A 2W9XA 3E5NA 2GPAA 2R1UA 3CZ5A 3AI7A 1QO0A 4CUKA 1A69A 4H4CA 5LLTA 3HKEB 2CK3D 3EWSA 4H6WA 4ITRC 1JQJC 3V1TC 2Q45A 3L40A 1TB4A 1FRVA 1GU1A 2H3HA 1RWPA 1L5FA 4I2NA 2PXXA 2HH9A 1PNRA 4PGFA 4WZBB 2WJWA 4P53A 4CCAA 2OCGA 2BGMA 4V1CA 3DZHA 1EUCA 4K9KA 3FR8A 3THWB 4ND8B 2F9MA 2Q0HA 3LCCA 1XMXA 1EFPA 2A9QA 2RH4A 2ATCA 1E1QA 1V7ZA 2HWYA 4D92A 3A9SA 4FW8A 4AJ4A 2RDMA 2BZ0A 1GAWA 3QMVA 4BYGA 3K0FB 4AS1A 2WF5A 2ZAMA 1DJQA 4X61A 2XOKA 4YY3B 3E3AA 4X8MA 2CHEA 3PDJA 1C81A 3O92A 1TLLA 2JLVA 1GZ6A 2WF7A 2EEZA 1NBEA 2J6IA 1KXJA 1FJGB 4HGZA 4J9VA 1DVRA 1WZCA 4X1YA 2B69A 3ZIAA 2X0JA 5FNZA 1K9VF 1U4OA 3RS2A 1GPUA 3HGMA 2JIZD 1S9HA 3G2OA 3GDHA 3HC7A 4ZAFA 1KVSA 4F6CA 3JQ8A 2GBCA 3ZI0A 2WOOA 2HNBA 3C3PA 2F1IA 2YUIA 4J2TA 1YHZA 4R1QA 4EMSA 1SXQA 1T8RA 2AJLI 2I99A 3HDQA 4DV1B 2AFIA 3KQKA 2G9ZA 2R1TB 3VH4A 4NG4A 5EERA 4TWRA 3EG5A 2IEIA 4B79A 3Q9UA 4ZRDA 4C6SA 4Z7OB 3WNDA 4AURA 2AJ8A 3OE7D 1BN6A 3JWGA 1NR7A 4KDCA 3EX7C 2YASA 4QWWA 5DWQA 1OIVA 1KDOA 2XT9A 1UQRA 4FOTA 1P6QA 3CF0A 5B4TA 2NP7A 4MQFB 3F96A 2NUPB 1GSAA 1SCJA 1MA3A 4XD7A 2Z3VA 4IKEA 3TVYA 1NRWA 4JB2A 3A26A 3GOHA 3TTWA 3VSBA 2P9YA 2YMMA 1MAVA 1MP0A 2BFCA 4XXHA 1G21A 4X7RA 5D51S 3M1YA 1RP7A 1XN4A 1B0ZA 4M9XA 5FR2A 4U2DA 3SI7A 3WK9A 4A2PA 5IHXA 4KIUA 1NQXA 3B3FA 1U7DA 1YDGA 1P18A 1PVVA 2Q2VA 1BN7A 3M5WA 4C4OA 3AUUA 1I1OA 3L7CA 1IQ0A 1J8MF 5TVGA 4FS8A 4YV7A 3Q8KA 4Q4LA 1EZ1A 1VSQA 3ZQKA 4D9HA 3WMEA 1LNQA 1U8TA 1ACJA 1V96A 1OFUX 1QV6A 1EP2B 1YS4A 1OGJA 2O1EA 4JP8A 2QAGB 3IXLA 2VJQA 2W6MA 3WL3A 5BSWA 1YTUA 4JR2A 1OTYA 4CM9D 1U0BB 4W5WA 1LK0A 2O05A 3A9CA 2W2VA 3AW9A 3A36A 1CUCA 2H0RA 5G41A 2J8ZA 1LSUA 3O47A 1W7AA 4L8LA 1M1YE 4D4LA 1Y6ZA 4G0NA 3UOWA 4KQ9A 4TKVA 3TQFA 3IAS6 1ID1A 2M98A 2IF2A 3NBKA 1ZRNA 1ZMXA 2J87A 2OAP1 1E6MA 2WUGA 2YUTA 3EFEA 4CEIB 2D0IA 4IIHA 3OF3A 1ZIPA 3Q2KA 3T95A 1FX0B 4ZU1X 1PLJA 2UYGA 1R0XA 3W3ZB 4DRXA 4RKYA 1FU4A 2H4HA 1N75A 4YYEA 3HJRA 3I01A 3NTRA 1P1CA 4NNPA 2V4MA 2ZTVA 2GFHA 4TWAA 4EJSA 2R6DA 2FUG6 3WDKA 4EO4A 3MCAA 3Q3IA 4FYHA 1RZVA 4PIVA 3K9NA 4ARIA 4O4LF 1BOOA 2WHRA 1E2GA 4QICA 4XRRA 4DY4A 2NYAA 3WA7A 4MMXB 3ADCA 5IXSA 3GRCA 1I4DD 4NBUA 3V4FA 1JF8A 1RHRA 5C8ZA 4MEAA 4ZJZA 4R8MA 1ZAYA 4J0JA 1ZA2A 3BFXA 1BE0A 3D6HA 4EY8A 3QBEA 2H4YA 1XZEA 2ZI4A 3MW8A 5L40A 1O94C 3KQVA 4LY9A 2HM7A 1XZNA 4HQKA 2JJ1D 1AZTA 3ECAA 3LL4A 3PI7A 3Q3GE 3DUWA 4Q37A 5AH0A 5B12A 1KGSA 1PQPA 1VIAA 2UUAB 3JQ7A 1K4MA 4IHKA 4K46A 3D0QA 2AOVA 1TPZA 1JR6A 4TYWA 1U2DA 3F7MA 3LXMA 1RSZA 1ZGCA 4YLEA 4NBKA 1Y89A 2XE8A 4DADA 1CVIA 1MABB 4C20A 5CFZA 3Q1LA 1FP6A 4C7KA 4FHCA 1N9KA 4N0DA 5KOJA 3JSXA 1NVMB 3PGJA 4I6JA 1WEKA 2DF8A 1QZXA 1KAHA 1O5IA 4IJ6A 4C7OB 3I2YX 3DL7A 2IX3A 2KW5A 1ZVKA 4K9OA 1SY7A 2NUTB 3HDVA 5JSZA 3ZJUA 1R0RE 2VPXA 1E5DA 1P3DA 3G02A 5TPZA 4E4YA 2HHAA 3WLLA 1IULA 3K70B 1AH2A 2ZZMA 1EM6A 1SBHA 3E82A 3DT9A 1EGQA 1R2QA 2OCKA 1HNWB 2YFYA 2WSLA 1KFEB 3LA6A 5AR1A 4JLWA 3PA8A 4DANA 2B2CA 3ORYA 5ALLA 1DT3A 4KVGA 5A3SA 5KU7A 2V1UA 1GQQA 1PDVA 4AZ0A 4IGIA 1EE2A 3IA2A 2N1BA 4TLLB 5AXAA 3C3DA 3CJQA 3V9AA 2A9FA 5JDIA 5DHFA 2JJ2A 3T7TA 1FXWA 5KZMB 1L8XA 1KEKA 3BHMA 2H2AA 2YCBA 1BS2A 1QBGA 1XQ6A 4RKEA 1H1LB 1C3LA 1LQUA 4TLCA 3REQA 3W78A 1T8YA 1E61A 4MS3A 2YV4A 1XO1A 1QRUA 5KINB 1KC1A 4MRSA 2VDVE 3MBKA 2VTDA 3R3VA 4M3NA 1KC3A 3WIEA 2OO5C 2BH9A 3C74A 1ONSA 1DRVA 4ZXFA 3UB4A 5AM0A 4BGEA 2VOEA 3AF4A 4PSVA 5IXJA 1ULZA 5MN6A 3ILHA 1IWBB 1UC9A 3G6KA 4I66A 4XB2A 2DPLA 2HWXA 2L18A 2ZJZA 4DR1B 3IBTA 1R9JA 3IP6A 2B6HA 4Y2QA 2M6KA 3WWPA 1TQDA 2G1PA 4D9IA 4AI6A 3I6IA 4FGJA 1CJKC 1Z6TA 4K6GA 4ZYTA 4PYOA 1BVHA 4FU0A 5KTKA 4KUHA 1RJ9B 1RZ3A 1N7IA 2RHTA 4D4IA 1GT91 3OZIA 4HEHA 2HUNA 4XIFA 1TU0A 1U8ZA 1ORWA 4LF7B 3F6BX 3M6LA 1Z6QA 2IIBA 2BLLA 1U65A 4WKNA 4YX9A 3R3XA 1VJGA 3VNVA 3AB7A 2YXLA 1CR6A 4BEWA 2CMFA 4TTJA 4C1NA 4EMBA 2XSZD 4LRSB 3GFBA 3IOYA 1GL7A 2FPGA 2HMVA 2HHJA 5LA6F 3R9XB 1NYLA 3ZE0B 4DLKA 2IOHA 4IDGA 1FVHA 1XV5A 3AU8A 2IW3A 3GCXA 2ZUTA 3DOUA 1TQ6A 2JS7A 1QIMA 3DHWC 3D5EA 3A6GA 4ZT6A 4A8TA 2YWBA 1TOAA 2YZNA 3R6TA 1DZ3A 2PKYX 4HLUC 5CDTA 4CETA 1D2GA 3MWLA 5DFAA 4MI9A 2HIMA 3KJZA 4M60A 3SXJA 3V7YA 4N7BA 1XT6A 3NALA 2GSWA 1GXSB 2YJ6A 5HG0A 4BO4A 1VKNA 3LUKA 3RWMB 1YFJA 4Y2YA 4OQ4A 1GPLA 1S3GA 3BHJA 4XM0A 2MINA 3MRVA 5GM2A 2EJUA 1XZLA 2A5DA 4H4DA 4BCCA 2QRUA 1AGPA 1E59A 3QIAA 3CXUA 1GGVA 2J48A 2WVJA 3EXFB 1MFZA 3CH7A 3SXPA 4ENWA 2CE7A 5LN1A 3GN2A 1GL6A 4KXVA 4X93A 3ETLA 3DE6X 3UCXA 3OY7A 1M9NA 4MITA 1AQUA 1WETA 2GCIA 2O48X 2ZZKA 4NL4H 3VDXA 1U8CB 4WKPA 4DM3A 2ODEA 2RKBA 5JATA 5KAMA 2Q50A 4IDCA 3WLTA 1RM5A 1JVSA 3R1IA 3E15A 4QO7A 3RR2A 3D8HA 1R1DA 3AKYA 2WPNA 1M6EX 3DDNA 3C16C 3OMLA 1LTHR 2ZYDA 3BMQA 1Q83A 1P0PA 1VRVA 3SZOA 4KRFA 2AZDA 2EXXA 1IOWA 4F2WA 1JE0A 1JLRA 3U6KA 1CZUA 3L79A 3FNGA 1NVTA 2BF4A 2ZR9A 4JA2A 1Z82A 1TMOA 4M89A 3MT8A 4BLVA 4UCQA 1JTVA 4DA7A 2Z83A 1H4SA 2AT1A 1HRDA 1M33A 3EVFA 5DSTA 4ZAGA 1I6MA 5GONA 1ZVQA 1FL9A 4CT5A 4D9MA 2PTGA 1GYRA 4Z4IA 1WQ1R 3OFKA 1NSYA 4R3WA 4XAQA 3BH7A 3PNQA 3O8DA 3GA0A 4JLSA 4PAWA 4D5EA 4LG1A 4G97A 3VPDA 5JYEA 2C2ZA 3OWHA 4DXHA 1B1AA 1R8XA 1CY6A 4HNTA 1PSWA 4MLCA 2RHJA 4FDMA 2C77A 4KKVA 3A2NA 4J3FA 3S4YA 1HFEL 1Q0QA 3WO0A 4RF4A 4FQ8A 1OBOA 3K9BA 1HL7A 4DNOA 4CTMA 5AW1A 1EFRA 1CS4C 2AMFA 4YRQA 3HB9A 4FOLA 2XKAA 4IVPA 1JI3A 4LGYA 1NC3A 2CL5A 2L0XA 4ZOLB 1BMTA 5T67A 1CNFA 3EZGA 3OKAA 3Q15C 4KXXA 4QBHA 3ZVMA 1WHSA 4MQEA 3CWQA 4P80A 2IEYA 4PYNA 2PUDA 1MPXA 1QYVA 3QPAA 1OBHA 3PUVA 4RTMA 2D54A 3VPAA 4Q1FA 5FPKA 4KG7A 1QH1B 1F20A 3DB1A 5FJIA 3V8PA 1TM5E 4CV3A 2R6CA 2JB9A 3PD7A 4FINA 2VXBA 1DBPA 3H2JA 5EJFA 2Y27A 3RFVA 1SXJA 1T4DA 3A32A 1NUTA 5AVQA 5CNIA 2BSQA 2WYHA 4EVIA 2Q3HA 2YV3A 3HGTA 2BFWA 4R69A 1TCAA 2VRCD 5CLGA 4BWVA 1U1EA 2PX5A 4JEMA 3AJRA 3OUTA 3VDNB 4EELA 2J6BA 2DWQA 1QQ7A 4JJGA 2JFXA 3ER8A 3HKEA 1QTQA 1WW2A 3E5MA 2NZVG 4LTMA 2DWOA 2OQRA 2PRYA 1USKA 1PZHA 1E8NA 1IEWA 3MJRA 3JARB 3GEHA 4H7KA 3ER9A 2IYAA 5FI0B 2PGOA 4PV7A 4OLAA 3ZBTA 2PQMA 3KLNA 3MQFA 3QI2A 2Y0EA 3H9UA 5H59A 3UV7A 1FC0A 4S35A 1R00A 4K3VA 4ARUA 4CKEB 3DMGA 4ZGBA 3PC6A 4LKOA 4WT7A 3PGMA 3TRIA 2VO1A 4UNIA 2HDNB 1E94E 2BR3A 2GRUA 4K2AA 2QUHA 1VJCA 3GELA 2OC9A 2Y76A 4M8SA 4QDKA 2BUCA 5AM1A 1SCAA 3RFCA 2Y93A 3OQ6A 3HEMA 3MMNA 1T6BY 4LDRA 3K0FA 1IHPA 4MMYB 1T3SA 4W8HA 2V6JA 2KBFA 4UBIA 2Q28A 1B3BA 3E9NA 3P8ZA 4JLMA 3KOMA 3UH1A 4CKBB 1ETHA 2DBQA 3VAAA 5A04A 4TLBA 1MJGA 2JCXA 4RPLA 4UVIA 4DJDC 3GRPA 2OFFA 2WG1A 5JXHA 3GGSA 4YREA 4AJ9A 3QW2A 2FNAA 4OHBA 4ZU6X 4B40A 1VMEA 1TZCA 4PRYA 4HS9A 3KYDB 2QTVA 3OPXA 5AUQA 3SE7A 4V24A 1U2PA 3V8BA 3SSOA 3BERA 1V8DA 4Y6QA 3WZLA 4GZ6A 2VAWA 3ET5A 3GVXA 4MRNA 1RXSA 5CBPB 3GJTA 5HSGA 1S89A 1GCUA 4CEJA 1B74A 1O77A 3VZQA 4D0RA 2J3KA 4TTSA 1TC2A 3AF1A 1YZTA 2FWNA 3P0FA 4OQFA 1C7EA 4W5HA 1AD2A 1E7WA 2JHPA 2GFQA 2F8LA 2R1TA 1A97A 2EOAA 5DBEX 4CM3A 1DMSA 2ODAA 2OB1A 2W43A 4R1LA 2OCDA 3VOBA 5H4GA 1UXKA 1NV9A 5C34B 4ENUA 3WJ2A 2QJWA 3CNEA 2GM3A 3RNOA 3QH4A 3E2PA 3EH2A 4OEHA 4FFNA 5BT9A 1Y1RA 3VVBA 4EAQA 1QBKC 2Q9UA 5JVDF 4L4YA 1ZSNA 1YKFA 4ZVVA 1YZUA 3V42A 1JSZA 1M7GA 4ZO4A 4AKEA 2JK0A 1LA2A 4MW5A 4LJ9A 5G1PA 1YQWA 4C4ZA 1RHQA 5C2JB 3V1LA 2CVZA 4ARVA 1FYFA 3F4KA 3TPCA 3G8BA 1P7ZA 1SN7A 4FFOA 2HLDD 4V2UA 1E63A 4BLTA 4ZQFA 4MYSA 4CMCA 2OGTA 3N87A 1ML3A 2F3PA 4RM2A 3KZMA 2O8EB 3L4SO 5CA0F 4KREA 2CXSA 3GGCA 2DETA 5JAHA 2EARA 4QOHA 3VJKA 4BE9A 3Q6MA 1KFCB 2SKDA 1O96B 1G6HA 2W2KB 3I0MA 4XWAA 5DULA 2BZGA 2ZDGA 3KD3A 4GYKA 5MF6A 1CS0A 1KXZA 3IFSA 3ND5A 4EG5A 5EXPA 1P1IA 2OXTA 2X0DA 4ZVUA 4NYJQ 5E1BA 4TSFD 2R8YA 4PHGA 1B8OA 1H2RS 3F78A 3W3AA 4JASB 3SHVA 3EG9A 2VPPA 2AIRA 4ZCLA 2V59A 1Y8ZA 3UIEA 3EAQA 3RANA 1T5IA 3FIUA 3U9SA 4G5HA 1KAOA 2A0FA 4RGYA 4QRHA 4IEFB 5TC4A 3DKPA 1AHPA 1F0NA 2R8EA 4I0WB 2DX7A 3S2FA 1JG3A 2WNHA 2Y1WA 2QYTA 3AERB 3K31A 5ELXA 4X63A 4CEIA 3PRKE 4M9UA 2P4SA 5EP1A 2AOXA 1FBTA 4C0JA 2R6R1 1FX0A 1HE5A 3VPBA 2XRZA 3BZUA 2BEJA 2Q1YA 4QDZA 5DT2A 4EB3A 1U9JA 3A7EA 3BIWA 2GK4A 2CJPA 3AIKA 4LY0A 1FFSA 1ZM7A 4FUQA 5E8JA 4H7HA 3IT0A 3FOEC 1T0PA 1FBNA 1PZMA 3K8ZA 2GD2A 1SU4A 2PAAA 2I8LA 1Q2XA 1PHPA 3IRVA 1QHEA 5L3ZA 4WASA 5COQA 3RJMA 4OREX 3TMKA 1DQYA 1L9KA 1QOPB 3UF0A 4A0RA 4DMGA 1TZJA 3CEAA 4S3MA 1WSAA 3CX8A 5EFOA 3W7VA 4YLYA 2V6BA 1XTBA 4EEZA 2VHXA 4B6GA 4GBMA 4HUQB 5A3QA 2XMSA 4N82A 1GTVA 3PB3A 1A9ZA 3UWKA 2V5AA 4UHFA 3KZKA 4E33A 2BI8A 3COPA 3GWGA 4IFBA 2CLHB 1YO6A 1ZXLA 3HG7A 2FPMA 1JECA 3PLRA 3LNTA 3Q9LA 821PA 2E4ZA 1R0LA 1U7UA 2J0EA 4IQGA 4OFWA 4TV8F 5B2FA 3ANMA 4N5MA 4LNHA 3TFQA 1VA4A 3LGSA 1KO5A 2IP4A 1ZOPA 4WNYA 3BIOA 4YAEA 4A0HA 1YXMA 1AK1A 3OLQA 1MHPA 2ZRKA 4URXR 4Q4JB 4BC0A 4D1YA 4RTOA 1XA0A 2RC6A 2P2ZA 4PIPA 3ZWWA 2NO0A 1N1DA 4CKZA 2D1TA 3CWZA 1VL6A 2ZWOA 4H7JA 4MRRA 3N0TA 4MWBA 5LZ7A 5BMVB 1UIMA 5BSTA 3VC1A 4BZQA 4CG3A 5I7WA 3PNSA 2JRLA 4WK2B 4YRAA 5EYPB 3EPKA 4WKBA 3C3CA 3DAHA 3RGGA 3D3WA 5E1MA 1BKDR 1XWIA 2C2WA 3I83A 3QE0A 4AZVA 5JCOC 2EGGA 4WN9B 5DNCA 3O8RA 1M34E 8GPBA 2V98A 2GAOA 3HUEA 3C8UA 3EEOA 4WQMA 2ASVA 1KY3A 4PGAA 3JVEA 1QCCA 3RCBA 4B75A 2IU4A 1FZTA 2D3WA 1NI4B 3SJCA 1XDZA 4R1TA 3KLPX 2ZYTX 3U16A 3K9FC 2HK8A 1LDYA 4IIJF 1EGVB 4KNVA 3R7NA 5JFOA 2PX0A 5HQ3B 4E12A 3VU1A 5LPNA 5AVSA 4A5OA 1PR4A 4OHMA 4P36A 3FSEA 1TAGA 2M2IA 3R23A 2JGLA 3O82A 1X70A 5KDDA 3VTZA 3KQUA 1ABBA 2BCEA 1JQ5A 3N6XA 3WA6A 1K75A 5ENVA 5JCPA 1JW9B 5K3FB 3X3HA 2R6HA 5EZYA 4Z2YA 4QJ3A 1IBLB 1CJSA 3IPLA 4D6YA 1U6JA 1QVWA 4GPTA 4YCDA 1N6NA 3AEQB 3OURA 3U39A 1WAMA 3CINA 4KU4A 5C46F 1F4PA 1GILA 5CDYA 5DMHA 4CN9A 2C9YA 4RMNA 1GKIA 1MLDA 4NCIA 2PPLA 2RKOA 4TMFA 2PKWA 2I6QA 4DJ5X 5H4HA 2BMJA 2ENUA 4UNPA 5D3ZA 3RUIA 1DO8A 1HNXB 1WQ4A 2B0JA 1Y6JA 3HL0A 3QX8A 3V4SA 3SQMA 4EPXA 1JFTA 3FWZA 3JAWA 1QS0B 3KR0A 5I9LA 1W0JD 1Q1EA 2PS3A 7MHTA 2VDPB 1HK7A 4OJQA 1XEXB 2CNLA 2OKCA 1JKJA 1HNNA 1RJ9A 4WA8A 9ABPA 1RVV1 4GE0A 2VL7A 3KAPA 5JS1A 4Q4AA 2HL6A 1X2EA 2QUJA 5CGQB 2HMTA 1JHOA 2KQUA 2WDZA 4UFOA 1UJBA 4DLNA 3DMDA 1GPMA 3ND9A 4RY9A 1JPJA 1UJCA 3EF3A 4MHSA 2CXQA 3K1YA 3O8QA 1TF7A 1Y9JA 2GCNA 2X4IA 3EGEA 5ERGB 2WT9A 3ZS8A 2IBTA 1C0IA 4IXDA 4EHLA 3ES9A 3JD1A 1XF9A 4D3XA 2O3SA 2PR2A 4TXMA 5IJ9A 1YR6A 4X00A 5HZKA 3INNA 3M5DA 4UPVA 4GM1A 4UPEA 3OPYB 2FF7A 1GTSA 3WE7A 3KKLA 1DAKA 4NSNA 4TRRA 4URHA 1VLHA 4BFCA 2WE8A 3VHQA 3W2FA 3LG2A 4EYKA 3LBFA 2WDPA 4IS2A 2E49A 2VJMA 4DSUA 1DJOA 1D04A 2FPXA 1KYIA 1ZK1A 3LPMA 1G1AA 2ZS8A 3NG1A 4JJ4A 4M8LA 1NIJA 1OYVA 4NFYA 4U7WA 3T7RA 1YKSA 4V39A 1PWXA 3NC1C 3ZCQA 2F3QA 3EXFA 4I3HA 5K0TA 2D2VA 4LRTB 1ZMBA 3L1IA 5L3SB 3OT1B 5JXIA 1P81A 1P7VA 4MAAA 3O3CA 2XCLA 3DLTA 2CMGA 3COVA 3IEPA 3EXAA 3VYVA 4HDSA 2AG1A 4DR5B 3HM2A 3KAKA 4A8JB 3L0PA 1JLSA 3C41J 1CTQA 5TMDA 2Q1SA 1DAIA 1H9CA 2A4KA 3B70A 1U1GA 4BOYA 1XYYA 3OT5A 2WMDA 3BWCA 3KR2A 4WWHA 1DKNA 3IHWA 4TGLA 4ZZ1A 3SYRA 1ZM4A 1NVBA 3DPUA 1SVUA 1B26A 4ZTZB 5BNIA 4Q9NA 1CU1A 1QR6A 2OCXA 1BCRB 4Z8XA 1S2MA 3FJ1A 3FW1A 3MS2A 1SG0A 2BKLA 4GX1A 4IBOA 5TB5A 3REGA 3RODA 2EIHA 3ZLUA 1T2AA 2VWQA 4G1CA 1K7FB 2VSOA 1HZZA 1K1EA 1RJEA 3MPUA 4AX4A 3SEZA 2EWVA 4BX0A 4QM6A 1WMEA 1URPA 4FUTA 3AR3A 4OYRA 1SQGA 4MRVA 4WKCA 3QX9A 4Q4DA 3H4VA 4CG1A 3O83A 4B3SB 3OT4A 1XVUA 1OX5A 2SCUB 2R8XA 3LY5A 2RD2A 2EFGA 2BEKA 2GQ0A 1RXCA 1Z4KA 2PZKA 3IOBA 5FPYA 3I9OA 3L8CA 3SZLA 2GLUA 3U09A 3OG9A 3EBPA 1JDVA 3GZJA 4P82A 5DNWA 2GX6A 4FIZA 1PS0A 1E3QA 5HS4A 4LK2A 2ROQA 2VUUA 1D0IA 1GRRA 4LHEA 5JD4A 2AJDA 4PCLA 1MOSA 3TD2A 4MA5A 5K4HA 3JS5A 3GUZA 2QN1A 3GA5A 4ZOLA 1Y8CA 2PMBA 3RYCB 1ZH6A 3K0AA 3MUEA 3OQMA 5TS2A 4L9WA 1UZUA 3K35A 1ZX1A 4EFLA 2NU6A 4D8XA 2OFWA 2HX1A 4CMBA 2Q6TA 5H81A 1JEYB 1WEHA 3GPBA 2WIJA 5KX5F 4I4TB 4QG3A 3H9CA 3JQRA 5F2OA 1PT5A 1MG0A 1V2GA 1WW3A 3DMHA 3NAQA 1E1QD 1EINA 1VYUA 1X9HA 2RK4A 2ZPTX 4X1IB 3THSA 1M74A 2WEKA 2IPXA 3IP5A 4O4HB 5A5DA 1M6VB 1OE0A 2B2XA 2HHCA 2FFQA 3AEXA 3F0TA 4I55F 3UOGA 4JJZA 1K5DA 2MYPA 2UYQA 3IVXA 4LF6B 1Y8QB 4NNOA 3SYKA 4IGAA 4YMUA 2B83A 4IZIA 2HZ7A 2H2HA 3C8MA 4KQEA 4AJKA 4J07A 1IMJA 2WJYA 3GJ5A 3PP8A 4QSHA 5CNMA 4D46A 3MA0A 1TM3E 2QW1A 2XYRA 4OXKA 4BNYA 1T0IA 1OI7A 2CC2A 1Z0ZA 2EX0A 3GJRA 4EA6A 1OVMA 2FEWB 1N92A 2W4MA 4H15A 2R00C 1F9EA 3HBFA 3EQ8A 9LDTA 5AJXA 4HVAA 1N6OA 4CKEA 4O4IF 5ITWA 3GFVA 4ALMA 1U3CA 2XTJA 3OJLA 4J2OA 3BCSA 4MW6A 3EGXB 1D4OA 3R5XA 4AS3A 4MJLA 4BO0A 4CL0A 4ILEA 4XPIB 5AJWA 4Z2AA 3WS7A 4HBGA 4MKIA 2A57A 3NM6B 4FYYA 5IBRA 5EQFA 3TLZA 2ZBUA 3GXBA 1TJ4A 1SC9A 5GY7A 4CKBA 4BV9A 2VPTA 1M67A 2AQ8A 2H7XA 1AKYA 3E4DA 4G4JA 2FXVA 3WWYA 1SVOA 4Y8VA 1UDBA 2I4IA 1IG0A 3JQQA 4JJIA 4UCFA 4LBVA 1KH1A 3RTCA 2H52A 3BMCA 1DIAA 3HR4A 4H1TA 4BXOB 1NRXA 3L7OA 4X8HA 2DERA 2FKAA 3KYDA 4JI6B 2PA0A 4BQIA 1PYGA 2BHTA 2FG5A 2ZRIA 3PWKA 3C3KA 4M36A 4JUIA 3JD0A 4MQLA 1ISJA 3HDGA 1S4QA 1GIAA 2LZ0A 4WK4B 3WBFA 5D1HA 3JYLA 5CBPA 3PF8A 1U31A 4LDQA 2TYSB 2FW6A 2GCOB 3P0IA 3P0HA 4Y3UA 2Z04A 4L9AA 4B7ZA 1QG4A 4KLRA 4M8IA 4MCHA 4PQFA 3FBGA 4BFZA 1NUUA 3EAGA 3BK1A 1US8A 3BXHA 2VCHA 1ONPA 4JX8A 3UBMA 2R86A 2V7PA 4CKWA 1QGDA 2O06A 3W9BA 3ETCA 4MUNA 2D2EA 3FPCA 5K8VA 4YXFA 1HM5A 4V0LA 2XGSA 3DJYA 4B73A 4NPHA 3IPYA 3W9SA 2IPLA 4AD8A 4IW3B 4NENA 2GEBA 5J9FA 2XUFA 2IIVA 3OZGA 3WMGA 3L4KA 3OTHA 1U0EA 2IP2A 5FWXA 1NA5A 1J39A 3D3KA 2Y0BA 1L4GA 1VG9B 1NYTA 5JCXA 4D25A 3FDFA 5K6AA 1JA1A 5IFKA 2JFWA 4PZAA 4PS1A 3EW7A 1KQGA 4CFZA 3UK7A 5FLKA 4C3UA 2XF2A 3C0KA 2RCYA 5C51B 4YHBA 2NNWB 5DCWA 1XAGA 2G80A 1OLXA 4MK4A 4CIDA 2PUFA 4RVSA 4HL6A 3ZZNA 5ICGA 1A3CA 2WWHA 2BP7B 1GQOA 2CYAA 3K6SB 3OJ0A 1KIFA 1O96A 3LECA 1BDBA 4GRDA 4KO2S 4EOGA 1E60A 4LE1A 3MWYW 2VQ3A 1PSDA 2V0NA 2HWKA 3I1IA 3TMAA 1SCQA 4MPTA 4LVCA 1XCPA 2QYHA 3IODA 4RE5A 2B5VA 5BN4B 5FT9A 3TQSA 1U28C 2AHOA 2IRWA 2OZLB 4R9UC 5HYVA 5KJCA 1ORVA 1AGXA 4PZEA 5IAKA 2FZCA 2B9VA 2OY0A 3DBRB 5IVIA 1G8FA 1D4ZA 2VP4A 1NFFA 1DJPA 1TYBE 5BYKA 4YJGA 1HR0B 4JY7A 3IURA 2XQFA 1G8MA 3P20A 4JXKA 2PQ6A 1R6TA 2R60A 1G9XA 2JI4A 4G09A 4NV1A 3QXJA 1Z4OA 5CGZA 3UMSA 2ZBGA 3K0SA 3HVUA 2B61A 2P2GA 1EK6A 1Y48E 2M32A 3GOQA 5FIUA 1Y3IA 2DVMA 3UW1A 4YJFB 2GCPA 4B74A 3KXPA 5D6OA 5K2MA 5EIEA 3NRCA 4Q16A 2Q4OA 3TTTA 1U04A 3LUPA 1Z0FA 1WOYA 1UINA 1PJ4A 1V7PC 2XW6A 5KWEA 4KWTA 3F5SA 3KRTA 4UOZA 3ROEA 3OOSA 4EKNB 3BWXA 1C9YA 2EGHA 3O8BA 1DZIA 4ERXA 3CRVA 5CM8B 1TF5A 4LHYA 1K6EA 1SVLA 1T4GA 1XTIA 5ESDA 1NRIA 1ZN7A 1UBGA 1JYFA 4FXOA 4O1IA 1X1AA 4JI7B 1UJ2A 2HB6A 3UGTA 2GEUA 2H85A 4TV9B 1KI8A 3WAGA 4UE6A 4IINA 3P9SA 2WNIA 3ISTA 1DG9A 3PPVA 4KPUA 2VFAA 1DCMA 4YALA 1PAUA 2NU8B 1Y9AA 1O0BA 3B3JA 3I72A 3L8MA 1RLJA 4L6CA 4O2RA 1TKCA 4C2AA 1KYTA 1U2ZA 1L5WA 1QB7A 1KYQA 3M6WA 4RPIA 2JKZA 1JPVA 1G20E 1KBZA 1OROA 3NHKA 3PNYA 3LGXA 2LRHA 1C9DB 2EKBA 4RNDB 1CE8B 3KOUA 5FBZA 1Z5ZA 4IHJA 4L50A 4OXYA 2O3UA 1GG8A 1TM7E 1DXOA 2WM8A 3N9IA 4LSWA 3NHSA 4O4JF 3SBDA 1SC6A 2JJ2D 1FNNA 2J4FA 2Y2UA 3DVAB 4MDFA 1A7UA 1FIUA 2I2CA 1BO6A 1BS9A 3EEBA 3HBAA 3IP1A 1XZDA 4WNAB 1CNMA 1EWKA 2HZBA 4FZ3A 4NZYA 4LJLA 4P98A 5ENZA 3T7IA 2JI7A 3TCNA 3CV3A 3VBEA 3IQHX 4I9HA 2POQX 1EGAA 5AJZA 4DT1B 1ECJA 1LJLA 4M7RA 2Q8NA 1QUFA 1MRZA 1DC8A 1J24A 1SZJG 3OLCX 1U6IA 3EEYA 2BT4A 3F7NA 3CH4B 3EMVA 3MTIA 3VUFA 4C5BA 4F4DA 4PS0A 2JH8A 4HF7A 1R8QA 1SO8A 3DZBA 3HRKA 5CJPA 4EX6A 3DLHA 5DF1A 2GN0A 1Q0RA 4G1BA 3CZMA 3RAPR 1EWRA 2QMYA 4C4SA 13PKA 4AJEA 1CK4A 2RHLA 3TMYA 3F6CA 4KQKA 4NU5A 3R7BA 4A2CA 1E7YA 1F5SA 4RTPA 3EXEB 3OQJA 4GBED 3GJ7A 2AZTA 5CDUA 4ER3A 4FR2A 1CY7A 1UQTA 4ECEA 2FFRA 3PQEA 2QJOA 3FI9A 2X4LA 4QA9A 1NM5A 4QYIB 4A36A 3GRAA 1E1MA 1OU4A 1K8XB 2XNCA 1QCDA 1E2DA 4YJ3F 4BTVA 2QZZA 3Q10A 1KO8A 2R8BA 4RGQA 4LTDA 5KNBH 4I6GA 5JRZA 3SVZA 3D2CA 2E1RA 1LS6A 2JD0A 3KDPA 2AFHE 4HSGA 4NAUA 3ZPXA 1VBKA 1ZBDA 3E05A 3MUNA 3QYJA 4UHCA 2XRMA 1IATA 2CW5A 1FMCA 2XKJE 1Z13A 4JN6B 3UCFA 3TJMA 2O7SA 3B1JA 1H0KA 4R5MA 3ER6A 2C42A 1ZK0A 5LDHA 3FGNA 1P6UA 4LRXA 1KY2A 3JWJA 3R7WA 1UT5A 1VPTA 1OH6A 2ZSFA 2H1VA 5THQA 3DVRX 5J4YA 3RC7A 4FKMA 1S01A 3DYVA 2QDKA 2FPSA 4I1YA 3PQ4A 3B2EA 2BHRA 4JBNA 2QW0X 1P1KA 4QQ8A 2HXYA 4G5GA 3ZS9A 1OXMA 3TFWA 4V1CI 1XEXA 1IJEA 2I7CA 2REQB 2ZT6A 3HFSA 1T1SA 5FD8A 5JWHA 1XU4A 3AHCA 2VDNB 3BH0A 4OB8A 4W63A 5BUSA 2JVKA 2QLMA 5K0GA 4EKGA 1REQA 3FROA 3KPVA 3VOSA 3GAMA 4Q1EA 2QT9A 1WUKS 3BD7A 1IAVA 3G7UA 1XE3A 1JG4A 4LVUA 3U3KA 4BN5A 4PC3A 3SQXA 2V9PA 4UJ5A 4BQQA 2PX3A 2RHOA 1RWBA 2ZI6A 2CCGA 2OENG 3RS5A 4F4FA 3K09A 2VDWB 3FYCA 3ZW9A 2R11A 4DL9A 4FK8A 4JUCA 1ISPA 2H3EA 2B25A 3NWOA 4H7EA 5B1DA 1ATZA 1J0BA 2D2XA 1QZTA 1N5KA 2Z2IA 3DQPA 3TZ6A 1IFXA 4CIXA 5BSVA 2QVXX 3K1TA 1H85A 3EXIA 4CT4B 3IELA 5F9HA 2XUDA 3IQZA 3Q0TA 4IR7A 2ZT8A 3G59A 2QM8A 5F52A 3UEOA 3D3NA 4YIHA 5AK5A 3ZY6A 2VH2A 1VIDA 3A9VA 5EVJA 1GGNA 2GLTA 5A4JA 4YCNA 5D87A 1HDXA 4F9GA 3AFGA 2CFIA 2DHEA 3KXIA 3K6JA 3OFNA 3PK0A 3I01M 2XCTB 1JXOA 4I3FA 2EP5A 3HA7A 3NDIA 1NE2A 1E0KA 4UNQA 1Y7HA 3WNQA 2EGUA 3QP9A 1NXPA 4NDAA 5CITA 2JDID 2ENWA 1W5BA 5CW2A 4GQIA 3RKUA 5IW8A 1EX6A 1WF6A 2Z56A 1PNOA 3OCWA 4LY3A 2UZAA 3C6ZA 2DP4E 4PPYA 2BBWA 4BC1A 3LYHA 2NX2A 5B1YA 2X0KA 3VR3A 4LYJA 3GUUA 5L3SA 3B20A 2QRQA 3VNUA 3OY2A 2EW2A 2Q5QA 2VJPA 2WW8A 4PQRA 4ZHSA 2PMCA 2QX8A 4N3BA 5K9ZA 1C1XB 1RXEA 3PQFA 2AQHA 3CZCA 5TVKA 4YMLA 4KLCA 4HTAA 2NTJA 3KHSA 3VDMA 1NNSA 3HZRA 4D43A 4GNRA 2W8BA 1C41A 4OJYA 3UANA 3LIIA 1ZR2A 3B2NA 3K4HA 1AHHA 3RRNA 1A9PA 2B8TA 3DEKA 4L6IA 3E58A 2GPWA 4QOGA 2FPPB 3SOPA 4BBPA 4FBGA 3C3AA 5EOVA 1GITA 2HK9A 4D9NA 1R0ZA 5DBOA 3PNBA 5TEWA 4HWTA 2FLVA 4ZQEA 1ECPA 2I1QA 2PCJA 4AF6A 4BECA 5KWSA 1YV9A 1I6LA 3PC7A 4AJ1A 4Z0HO 3AFHA 5HGXA 1UAYA 3O8OA 1XD9A 1R6BX 1R12A 4CMEC 2QRLA 5B7QA 2J0SA 1WXQA 4Y2XA 3UBTA 3EZXA 1NJ6A 4PBRA 3WBKA 3VZRA 3L92A 2GM4A 1GLNA 1QU3A 3VPCA 1BQEA 1P5JA 5EJIA 3T12A 2E85A 2CXHA 4AJPA 4OO3A 2A5FA 4YRTA 3T4PA 4A91A 2JATA 4OX9B 5JU6A 4H7FA 1D6JA 3OIUA 4L28A 4PCUA 4BO9A 4J1TC 3UNXA 4EYOA 2GKOA 3HKCA 2W4QA 3SSAA 4YMSA 2EFDB 4AF8A 4C01A 4DV6B 3O4IA 4G5SA 1OXSC 2VZ0A 5HF8A 4RH0A 1B16A 1ENYA 2GXQA 1OFGA 1G4HA 3L8GA 5DHSA 2XZOA 4REOA 1O1YA 3HA3A 4RV4A 4KQXA 3AKDA 3BH6A 3H17A 5SYMA 2VQDA 5AW0A 4EEKA 2DFLA 3HVRA 3WGNA 2B1IA 1YIAA 1JEYA 2J9FB 3KAQA 4F72A 3NT2A 2WTAA 3QTBA 3DWIA 1P5ZB 3PR3A 4M9CA 2IPOA 3NDBB 1XMSA 5ALJA 4XASA 2ZRAA 1XLUA 1M6VA 4TKZA 4BEBA 3QNUA 3G5TA 3H5WA 4QYMA 4DM7A 3KX2A 1YBMA 4MW4A 3DOEA 1R0KA 1C5KA 3W1EA 2WJ3A 1I24A 1QKJA 3J81k