3GMSA

Crystal structure of putative nadph:quinone reductase from bacillus thuringiensis
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
331
structure length
331
Chain Sequence
b'SLHGKLIQFHKFGNPKDVLQVEYKNIEPLKDNEVFVRMLVRPINPSDLIPITGAYAHRIPLPNIPGYEGVGIVENVGAFVSRELIGKRVLPLRGEGTWQEYVKTSADFVVPIPDSIDDFTAAQMYINPLTAWVTCTETLNLQRNDVLLVNACGSAIGHLFAQLSQILNFRLIAVTRNNKHTEELLRLGAAYVIDTSTAPLYETVMELTNGIGADAAIDSIGGPDGNELAFSLRPNGHFLTIGLLSGIQVNWAEIVTKAKVHANIFHLRHWNDEVSPYKWQETFRHLIRLVENEQLRFMKVHSTYELADVKAAVDVVQSAEKTKGKVFLTSY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative NADPH:quinone reductase
publication title Structure of putative NADPH:quinone reductase from Bacillus thuringiensis
rcsb
source organism Bacillus thuringiensis
molecule tags Structural genomics, unknown function
total genus 111
structure length 331
sequence length 331
ec nomenclature
pdb deposition date 2009-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3gmsA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3gmsA01
2W2KA 5DCWA 4ZRNA 4D0RA 4DMLA 2JCYA 4PLPA 5LCXA 3F6YA 1X1TA 1ZKMA 2C07A 4B3HA 2RHCA 1TI7A 3LLSA 2QRJA 1ISHA 3WOHA 1HRDA 3HZZA 3KLMX 1KC3A 2GF2A 4IIUA 2HKIA 3FTNA 3ZHZA 3TZQA 4PG8A 3F3SA 3NTRA 4DA9A 3B1KA 3AJRA 1U1IA 3H9GA 1P74A 4EGFA 4BO8A 1RJWA 2Y67A 4OIMA 4MOWA 2QIOA 2FRDA 5AOVA 1UUFA 2QYTA 4WUVA 4BNKA 5COAA 3ZNPA 1P1RA 5IDQA 3H9EO 1Y8QA 3QJ5A 3PXXA 5IJZA 1XA0A 1U2DA 3WGQA 1B8VA 4BUCA 1UZMA 1GYRA 3GF4A 1HDCA 4MVJP 3UOGA 4BNHA 1H93A 2VNAA 1OMOA 3KYBA 1N2SA 4OSPA 1A72A 1X15A 4K28A 4WNIA 3ZWMA 3MJ4A 3INTA 1E7SA 1HEUA 2GR9A 2SCUA 4F45A 2GRAA 4Z0PA 4K9DA 2Y1FA 4Y67A 3MJTA 2GDZA 3JQFA 3IJPA 4KOAA 3PGXA 4IDCA 4DLLA 1C1XB 2LDXA 4R41A 5A9TA 4HY3A 4J2HA 4PG5A 5IDYA 3RJ5A 1GD1O 5COQA 1YGYA 3JQBA 2PTGA 1P77A 3LF1A 5K0ZA 1PJ2A 4LMRA 1ZK2A 1E5LA 2QQ5A 2Q4EA 5TF4A 2X5OA 4LGVA 3OA2A 3DBRA 4XJSA 3WTCA 1Y9EA 5JO9A 1IB6A 1ULSA 1ENZA 1YRLA 3PLRA 3RI3A 2ZQYA 2D5AA 1V0JA 4J91A 1ZSVA 3I9NA 1H0KA 2ZTLA 4LN1A 3SJUA 3VH1A 5ER9A 4XCVA 5B12A 2VUTA 3G17A 1B3BA 2EKPA 4BVAA 3AM3A 2VHZA 1HKUA 2HMVA 4CM8A 4D0SA 3A9WA 3JQ9A 3GAFA 5H83A 1JVBA 1DC3A 1KOLA 1EBUA 2Q2VA 3G79A 3RBZA 1NFFA 2JCVA 1ZMOA 2QG4A 2YY7A 4OL9A 3P19A 4CUJA 3EGOA 3GT0A 2GERA 2DUUA 3DZKA 3MJCA 2C5AA 4GVLA 4JGBA 4R1TA 4MKZA 4CUZA 4Q3AA 1E7RA 2RHRA 3WYBA 1WPQA 1A4UA 1YVEI 1ZK1A 1HDOA 3HDQA 1KC1A 2QW8A 3U4IA 1XQ1A 1EEHA 3ZCXA 5DF1A 1HDRA 1JWAB 5HS6A 5TNXA 2GPTA 1L7DA 1F8FA 1Q2XA 4XYGA 4NPCA 1DC4A 2I99A 4BMVA 3W8FA 1N8KA 4M49A 5BSHA 5JNLA 2AEFA 1EQ2A 4EITA 4CLRB 3RQSA 1LQUA 1NNUA 3IKTA 1YBAA 4RF5A 3ZW9A 5ITVA 1NTOA 1YS4A 3GHHA 5T8KA 2JKVA 4E2XA 1MFZA 3L9WA 3U09A 1NWCA 3BMQB 4EBFA 3DO5A 1VJTA 2CDBA 1AHHA 5A1TA 3PTZA 2CY0A 3D3WA 1YO6A 3ZV4A 1NP3A 2OORA 3I9KA 4E4YA 4WNCA 1GZ4A 1EK6A 3WX0A 1KVRA 1ZBQA 2I67A 4B4OA 1NHGA 4ZICA 5ENVA 1J4AA 3HE3A 3G0OA 2WYVA 4DMMA 1X1EA 3WLFA 4CM7A 4BGEA 3AUAA 3G49A 5DCUA 1ISIA 1EZ4A 1CRWG 2YV3A 2HDHA 3UW3A 4CMIA 2WYUA 4A7PA 5JY6A 2IEDA 1B2LA 9LDTA 4YJFB 4N7RA 1CJCA 3PZBA 4RPJA 4G5HA 4PLGA 1J5PA 3RBXA 3GGOA 4YQZA 4ZQFA 3L4BA 3RC9A 4KWIA 4XR4A 4RLSA 4RF4A 3ROKA 1E3JA 5F1PA 3G3EA 1NBOA 3TL3A 1HDXA 5DBFA 4IXTA 1KIFA 3GK3A 3NDJA 4W6ZA 2TMGA 1IULA 3JQAB 1PL7A 4JBHA 1R0KA 3VOSA 4BIIA 2P5UA 5JS6A 3GMDA 3VZSA 1C3VA 4OXNA 1LA2A 1UXHA 4RPHA 1Y7TA 4D3SA 3GEGA 3VPGA 1E3WB 2B5WA 3JQ6A 3WIEA 3DTTA 3DFZA 3BMCB 3IAHA 1DPGA 2NU9A 5EJ2A 2WTBA 1HSOA 2VUSA 4ALNA 4BO4A 3KTDA 3TZ6A 1OZAA 3I1JA 3GOHA 3TOXA 2GCGA 4YJFA 4KTTE 4EJ6A 4F3YA 3AFNA 1BDMA 2HRZA 3LZ6A 4J49A 1M67A 3ZU2A 4DUPA 5JY1A 4BO7A 1IYZA 3K2EA 5HM8A 5G0SA 1OFGA 4CQMD 1CQIA 3HHPA 3W8EA 2Y1EA 2JFHA 5A9RA 2VZ0A 1E7YA 1ZEMA 3BYZA 3QA9A 5LDGA 2ZB8A 1MX3A 3NGLA 3VPHA 3DBHA 3TZKA 1NR7A 3HDHA 4WLEA 4R16A 1WLYA 4R5MA 5JPIA 3CINA 3STHA 3H5AA 5JFOA 3OQBA 3C7DB 3EZYA 3DAFA 1WW8A 1JN0A 1X14A 3RU7A 4ND2A 4DQUA 4KDFA 5BR7A 4NJMB 3COSA 2PZJA 1T2CA 3E9QA 4N54A 2GSDA 4MO2A 5I7VA 5FI5A 1E3WA 3DOJA 1A7KA 1QYCA 4RVHA 1LSJA 3NYWA 4ALJA 4II2A 2YV1A 4I9UA 1W0CA 1K3TA 3V2UA 4FBGA 1D7OA 4DWVA 2Y0EA 2XOXA 4GGPA 2FOIA 4CLOA 5L45A 1EVYA 4GLLA 4ALKA 2V6FA 4R1UA 5FF9A 4M55A 1U4OA 2NU6A 1VKOA 2IZZA 3IJRA 2P68A 3RKUA 4U6QA 1U7HA 4P8RA 1H9BA 4CR6A 4FFOA 4ALIA 3IL2A 1HL3A 1LBEA 1LDNA 4TMFA 4FW8A 2X58A 5A9SA 2NSDA 1WDKA 3GEDA 5G0VA 1KBZA 3KETA 3RCBA 2B0JA 2ZB3A 1QYDA 4PLYA 1R66A 3PZRA 1WNTA 3AUUA 2NWQA 3I9JA 1YB4A 3GRPA 2ZCVA 5JW6A 1HLPA 3PP8A 4GLOA 3JD3A 1JKJA 2W98A 1KS9A 4PLVA 5HRUA 4INAA 2O3TA 4BS9A 1C0LA 3IP1A 2ZCUA 1QG6A 5ADHA 3IC5A 4IPTA 4JNKA 1ONPA 1X0XA 3L6EA 4MVJH 4B8ZA 5B4VA 4L4RA 2VRCA 2PR2A 2Y68A 4CMHA 4BKUA 4LSWA 3E8XA 4AJHA 1PR9A 4XQGA 2VWHA 1NX6A 2FHSA 2HMWA 3DZJA 4OH1A 2J3IA 1E6EA 4UEJA 3CIFA 2WD7B 4MP8A 1F12A 3B20A 4M86A 3GVIA 3ROMA 1DJNA 3QVSA 3DQPA 4HKTA 4NBRA 3WGIA 4NBTA 5CPBA 2RAFA 4WLUA 2VHVA 5BT9A 2Q2WA 1VLLA 1R37A 2VYND 3DMTA 3KRTA 1A7AA 5KOIA 5CFZA 4FOSA 4BNLA 2AW5A 3G1TA 3FSRA 4JBGA 5I7SA 5IDWA 1I10A 4RPLA 5KJ6A 4FFRA 3E9MA 1I01A 1H5QA 4LRTB 2PD6A 5ENDA 1GCUA 1X7DA 4FJ2A 1T2EA 4YT5A 3PPIA 4PCVA 3E82A 4BO0A 4I5FA 3I83A 3DZGA 4WCFA 1PX0A 4BKRA 4XB2A 4XGKA 1PU2A 1VJ0A 4ROSA 4BL5A 1RPNA 4S3MA 5DNAA 1MG5A 1BGVA 3RC2A 3PJGA 4ZGWA 1O95A 4CL3A 4AG3A 3CE6A 3NT2A 3NT5A 3I6IA 1ISFA 4CV1A 3JYQA 3K9QO 4RDIA 3QHAA 4NI5A 3NUGA 2PZMA 1SEPA 3WNQA 1N7GA 5ICSA 3B1FA 2GZ3A 2AEMA 4GMFA 1T1RA 1LLUA 1WMBA 2Y99A 1PWXA 3VAZA 4CQLA 3CKYA 1Y9AA 3LU1A 4FQ8A 1PTJA 2GUGA 3VC7A 5COBA 2JD2A 1M6WA 4GWKA 4PZDA 4QUKA 4QO8A 2AEJA 4TRJA 4YR9A 2OFPA 2Y05A 3LYLA 1HYHA 2NM0A 1YL7A 2ZB7A 4LRSB 2ZKLA 1I0ZA 1OAAA 3ON5A 5U4QA 4N5MA 2OOSA 5DDIP 4AJKA 3JQ7A 4I5GA 3VH4A 2O3RA 2AMFA 4I1IA 3TF5A 3C7AA 3DL2A 5JAQA 2Q99A 1I3LA 3INGA 4IQ8A 3I9LA 1E77A 2NVWA 4R4JA 4GX5A 3K8ZA 4XR9A 1CF2O 4LCEA 3RSHA 2VT3A 1O5IA 2X5KO 4FD3A 8ADHA 4CQMB 4JLWA 3BAZA 4Y6RA 5B4UA 1ZCJA 4IIVA 1DB3A 4NBWA 4QO7A 2Z95A 3PYMA 1P3DA 1ZO8A 4JP2A 4DPLA 2W4QA 1NQOA 3GMSA 3KYCB 5JC8A 1B16A 3ANMA 4OXKA 4AJOA 4E33A 2J5KA 2DC1A 3QW2A 8LDHA 3WMWA 1LDYA 3O8QA 2GNAA 3DFUA 4LISA 2B69A 4R68A 5AQ1A 4JQCA 1NHWA 1Y81A 4YJGA 3UN1A 4U5QA 3UHAA 1H2BA 3VZPA 2EW8A 4NK4A 4KUGA 3RKRA 1NVTA 3CZMA 3INRA 1FDSA 1KEWA 2X9NA 3OSUA 3ZH2A 4IUYA 4ZVVA 1O94A 3WFIA 3K96A 3X2FA 3CMCO 5CEEA 3UKOA 2NVUA 1C1DB 2LDBA 4G2NA 3ZV5A 1EUCA 4E5MA 1EFKA 3WSWA 5CG2A 3SVTA 2PKRA 3LT0A 4L4XA 4MJLA 4RZHA 1CQJA 4DIBA 4FC6A 1X0VA 3UCFA 2AQKA 3C1AA 2W90A 1CEQA 1DIRA 4II3A 5KNLA 2NNLD 3HJAA 5G4KA 1RKXA 2OBNA 1YDWA 3ICCA 1I36A 1DIGA 2CNBA 3PFWO 3WR5A 4CJXA 4YTEA 4KUEA 4E3ZA 4J1SA 3VHRA 1YOVA 3IIEA 3UH1A 1ML3A 3FR8A 4FB5A 3ZDFA 3E18A 4GBJA 1FF9A 3BIOA 4CL8A 3JYNA 2J5QA 5B1YA 3GRKA 2FY8A 4QTZA 4E21A 3ZI0A 4F6LA 2O7QA 2BF7A 4OGWA 5IAAA 4W9NC 5L7TA 2I9PA 1B14A 3GC6A 3DBLB 2D0IA 4GH5A 2HK7A 5JC1A 1RM4A 1YDEA 4RGBA 4AJIA 2X9GA 2VHXA 2C7GA 4YACA 5KVQA 3AOEC 2GO1A 3KM0A 1IL0A 4URFA 1SCUA 4UUNA 3KYDB 4GL4A 4TRMA 2BI8A 2YV2A 1HDZA 2EG9A 4O59O 4U7WA 3MWDB 7MDHA 4LK3A 1R0LA 1VSVA 2G1UA 1MV8A 1DIBA 1QR6A 2Y1OA 4H7PA 1VSUA 3TZCA 4IS3A 1N7HA 2I66A 4J9UE 1U4SA 4OSOA 2F1KA 4AJ4A 4WLOA 4K6FA 3ANLA 4X54A 1ADFA 1C14A 1IZ9A 1T4BA 3WICA 3AU9A 3QIVA 1L7EA 2BHLA 5B4TA 2DTEA 1TA4A 2R00C 1NQ5A 4PG6A 4R1SA 1UXJA 1Q1NA 4XRGA 3DB2A 4XA8A 5JDCA 3K31A 1J6UA 4YJDA 1E7WA 4M87A 2B83A 4RF2A 5FYDA 1YJQA 2C7VA 2VUUA 3AI3A 2UUOA 3PIIA 4BNUA 4E0BA 4E5PA 3TZHA 2B35A 4XB1A 3U62A 5KVVA 4JJFA 4W4TA 3GGGA 3JD4A 2HLPA 3NEPX 5T5QA 3WLEA 4FDAA 3KYDA 4HX5A 4CV2A 1GU7A 3QWIA 2VYNA 4BV9A 3GA0A 3D7LA 2QYSA 1EE9A 2EKLA 5AVOA 2W2KB 3I4CA 5IZCA 1E6UA 1NVGA 3DZIA 3PHJA 4F6CA 2BGKA 1HETA 4Q9NA 3GN1A 3JTMA 4GX0A 4CMCA 3LT4A 2VCYA 2DPGA 3GR6A 4OQYA 2Z1MA 2NU8A 1H9AA 4TQGA 1XEAA 1KY5A 1QLHA 1UXGA 3ZV6A 5CEJA 3SJ7A 1P1HA 1ENOA 2HSDA 3FPLA 4NQZA 1W73A 1K6XA 2EV9A 3WYEA 3JV7A 1PZHA 4J1QA 1LSOA 1T25A 3W1VA 3WGYA 1LSSA 2C2XA 4XEHA 1EE2A 3UICA 2XXBA 1ZZEA 1PGOA 2BELA 1ZNQO 3LC7O 1Y8QB 5BSFA 2WWRA 1H6CA 3GZNA 3Q3CA 3WGZA 5F5LA 4D3DA 3EVNA 4EUEA 4N18A 1HF3A 4WCDA 4Z3DA 1V35A 1VL0A 4XIYA 5KTKA 3Q2KA 7ADHA 5G2OA 2NV6A 3EDMA 3OICA 4HADA 4J3FA 5CG1A 2O3QA 4KUHA 2UV8A 3V5NA 3HN7A 5JYEA 1SMKA 3H8VA 1PQWA 5IXSA 1XQ6A 3WTBA 2BFOA 3PFFA 1PZFA 2PH5A 3NKLA 4FFNA 2V6MA 3GHYA 3V1TC 1K5HA 4WASA 3GQVA 4HUJA 3WBBA 4J4HA 3AU8A 2WJPA 3QVTA 5F3RA 5L51A 2P4QA 4A27A 1TB4A 1C0PA 4MVJG 1XGKA 2AA3A 3DBRB 4E12A 1LDMA 1TT5A 1J0XO 3WDSA 4HV4A 2CDCA 4GX2A 5TIIA 3GUCA 1PL8A 2CVOA 4YVFA 1Q0HA 2FPPA 5EL0A 1ADBA 1W4ZA 2RIRA 1F14A 3ZWNA 3Q9NA 4ND5A 3FBTA 3F4LA 1T26A 3F1KA 4CM8B 5I9MA 3BZUA 2AQIA 2IYOA 2C2YA 1EVZA 1NFRA 3H65A 4NMHA 4XRRA 3VPFA 4P22A 5EERA 5TC4A 1ARZA 1ZSNA 3IKVA 1BSVA 5JE8A 2OP0A 4L73A 1DAPA 3FBGA 3H5NA 4UVHA 1UP7A 4PZCA 1E3SA 1QSGA 1V3TA 3C1OA 5CAEA 3TOZA 4PGFA 4IGFA 5A4DA 1UAYA 2O2YA 3F1LA 4QSMA 2DAPA 2HMSA 2HRBA 4N5NA 3PHLA 3GVPA 4CM5A 3I5MA 3S1LA 2P91A 4B3IA 5L4SA 5EN4A 4TKLA 1YBMA 3S2GA 3IOYA 2GN8A 3ITKA 2VRCD 4H15A 3RAJA 3TFQA 1VM6A 3S55A 1S6YA 3EYWA 3ZU3A 4RVDA 4NZ9A 4IY1A 4RLHA 1TT7A 3EC7A 1B7GO 3M1AA 3KSDO 3BHMA 3QWAA 5TJ9A 4PFJA 1YE3A 4EZBA 3W8DA 1QXSA 3PJFA 2H6EA 2X7HA 4CMEC 2UAGA 1R0SA 1T4DA 3QY9A 2BI7A 1UH5A 1LRLA 3HDYA 4KP7A 3D3WB 4J2OA 2B37A 4EUHA 2V65A 1GDHA 4IQ0A 4LVCA 5ITWA 3LT1A 4J7UA 2VHWA 4D41A 4XQ9A 5GZ1A 1GYPA 1ZH8A 2PKQP 4BO9A 4TZTA 4DYVA 3LSYA 3NT4A 4Z0HO 3KB6A 2A92A 2BGLA 5L9AA 4JK3A 1PS9A 1V8BA 1YQDA 2G5CA 3M2PA 4CMIB 1NPDA 1GQ2A 1VL6A 2OO5A 3V2GA 4EUFA 4YRBA 4XX0A 3RUHA 1LI4A 1ZJZA 4FSHA 3HFSA 4Z9XA 1DIHA 2DU8A 3WMXA 3F5SA 3TN7A 1I5RA 4GKVA 1IY8A 2RH4A 1MUUA 3C3XA 2DM6A 3OHSX 1ONOA 1NAHA 3FNFA 5TQVA 1U9JA 2PH3A 2DLDA 3PQFA 2IXBA 4E2YA 2B4TO 1XWFA 3CUKA 1ZK4A 1LDEA 2D1YA 4DGSA 4UULA 1D8AA 3GAZA 3OH8A 3UCEA 4QEDA 4RZIA 3N58A 2I3AA 2ZYDA 2E37A 3H3FA 3WBFA 5JCXA 1K2WA 3EAGA 3ZHYA 3QE3A 3RUAA 1BRMA 1RM5A 4DPMA 3NJ8A 4I9HA 3WGTA 4XIJA 4O0LA 4AVYA 3JYOA 4DYDA 3V8BA 5BSGA 4HFNA 1QV6A 5DOZA 4L0QA 4U0KA 1B3RA 4BKOA 1MC4A 3AI2A 3DBVO 1N1GA 3TSCA 1PR3A 5HA5A 3A14A 5KCZA 5IN5A 4CMAA 2Q1UA 3ZWWA 5FI3A 2X0JA 3ASVA 4DPKA 2DTXA 3R6DA 3EUWA 3E03A 3E5RA 2ZTMA 4YBZA 3ORFA 2GN4A 4TRNA 4EI2A 3BA1A 2CMDA 3EMKA 3OJ0A 3MTJA 4BNYA 1X7HA 2OXIA 5HTOA 1KEVA 3P7MA 1ZFNA 3QWHA 2E82A 2A9FA 3ANNA 4G81A 1F0YA 3DBHB 3PVZA 5IFLA 4Y8VA 4R5HA 3EVTA 5EIOA 5T6BA 1R4NA 4ZJUA 3GDOA 3M6IA 5KJEA 4B7UA 3OJEA 1SO8A 1ISMA 1LSUA 2OP1A 3CMMA 3TJRA 5AXCA 5KIAA 3KEOA 4XYMA 1PSDA 4CM1A 4YWJA 5TJHA 4Y6PA 2YW9A 1RM3A 4W82A 3ADOA 4GVXA 3WGOA 2A4KA 2HK9A 4JIGA 2Q1SA 3FRJA 3I9OA 4WOJA 2BD0A 4CPDA 3OQ6A 5CP8A 4BNIA 4CLOB 1XDWA 2FR8A 1F17A 4HNGA 1JTVA 1CDOA 3BTUA 3SX2A 5THQA 1GCOA 4PG4A 5KKCA 4DXHA 3RD5A 2J3HA 3OETA 1WMAA 4YDRA 1DEHA 1H6BA 3LF2A 2AQ8A 1I2BA 1RWBA 4CLXA 3PK0A 3DZHA 3ICPA 5A9SB 4GSKA 5C7IO 4WKGA 2EWMA 5L40A 4LCJA 1Z75A 4Q3DA 3ST7A 3NX4A 1Q7CA 3HNPA 3PI7A 3Q11A 3OFSA 3AWDA 2A94A 3GZ4A 1M76A 4ZRMA 3TQHA 4FOOA 4E2ZA 3QVWA 5A3JA 2PGDA 4OJNA 5JLAA 4NBVA 3RFTA 4YAIA 1F06A 2NACA 4N5LA 3L6OO 2WE7A 1BXGA 5U9CA 4DLAA 1NM5A 3RJ9A 4DREA 3JQGA 4UVGA 3RFXA 1GFSA 4ILKA 4YCAA 3SEFA 2ZYAA 2WEKA 4RL6A 3AY7A 2CSUA 1O6ZA 6LDHA 1E92A 2XF8A 2Q3EA 3ZHXA 3FCOA 3ADPA 1DFIA 4XQEA 3CSDA 5JO0A 3HN2A 4RVSA 3DHYA 3NDIA 4PZEA 3BTOA 1SEVA 2UYYA 3TNLA 4CM4A 4OHUA 4PLHA 4WE3A 5HS4A 5K6AC 3IDSA 4JJIA 4NNJA 1W8DA 4TKMA 4PN3A 9LDBA 2G82A 4H3VA 4M8SA 1GR0A 4FGWA 2PV7A 1LXCA 1EMDA 1T2AA 1Y8RA 1Z45A 3VPXA 1XG5A 1UXIA 1PWZA 4AJPA 4NK5A 3DHNA 5MGBA 3H9UA 3PQDA 1HYGA 3UUWA 3ZWVA 4WCFB 1D3AA 1HE4A 4L9RA 1T1SA 5TLSA 3ONDA 1PJQA 4EW6A 4BNVA 4AJLA 3JD1A 2I65A 3OQ1A 4B4WA 3DR3A 2W2LD 3M1LA 2DBVO 3T7CA 4LSMA 5TT0A 1HE5A 3E5MA 3QRWA 2OGUA 2FSVA 3FWZA 2CDAA 4XD2A 1JKIA 1U5AA 2VN8A 1PJ3A 4BNZA 2O7SA 1MGOA 3RUCA 1PIWA 4PG7A 1LC0A 4C4OA 1U8FO 2P9GA 2D59A 2FSSA 4J7XA 4WEQA 4FFLA 4CQLB 1IZ0A 4QECA 2JFGA 3DOCA 3GNTA 4NG5A 3M2TA 3PDUA 4ID9A 1LU9A 4J1TA 1XSEA 4TVOA 4J1NA 2BKAA 3EK2A 1VJ1A 1P0FA 3TDKA 2DTDA 5JAMA 3FWNA 3ZV3A 1H2HA 4MVJF 5EQDA 4YAJA 1EUZA 1B8UA 1HZJA 3ZNNA 3T4EA 4LW8A 1U28A 1ZEJA 4AFNA 3JQ7B 5U1PA 5KVCA 4ZA2A 2NTVA 3W4JA 1I3KA 2IZ1A 4CLHA 4IDFA 4XYBA 3ZNOA 3GFGA 1I2ZA 1E6WA 4A0SA 3SXPA 2EKQA 2EP5A 3H5RA 1TLTA 1KERA 4P4LA 1ORRA 4FPXA 1YKFA 2AG5A 2R6JA 4TZKA 4YQYA 4D3FA 2O3UA 5T67A 5BNFA 4QX6A 1JQBA 3ENNA 3GUYA 4FR5A 3L77A 4BNNA 1NPTO 3E9NA 3GFBA 4EYEA 1Q0QA 1KVUA 2EW2A 3BMNA 1FK8A 1TEHA 1V3VA 3AM5A 5TRTA 4WLFA 3U0BA 4CR7A 1R16A 4FJ0A 2VT2A 2BLLA 4HP8A 2EGHA 4NIMA 3U3XA 3I3OA 3L07A 2O50A 1GEEA 3O8QB 3C8MA 4RV9A 1N92A 5EQFA 6ADHA 2J6IA 4YJGB 4CMBA 2XXJA 4OM8A 5K9ZA 1V9LA 2E6UX 2FP4A 4Z3KA 3PRJA 4PIVA 1GEGA 4JXKA 1U3UA 1LUAA 5L7WA 5A5EA 3R0IA 1SNYA 4I9NA 2A35A 2O2SA 3V1YA 4NU6A 2PNFA 2POQX 3PYLA 4BNXA 3KO8A 1QYXA 5L95A 1UP4A 1Z6ZA 1GYQA 2GZ2A 2NVUB 4PRLA 4W7HA 1H6AA 1ZXLA 1WDLA 2HJRA 3RFVA 1B26A 4DQVA 2QZZA 1GUYA 4XDYA 1A9ZA 3DAGA 1A71A 5I7EA 3VTZA 2NTJA 3A06A 1ENYA 4ZQEA 4D79A 4C7KA 3IQDB 2JD1A 1LDBA 4I08A 2C29D 1SBYA 5G4KB 2PZKA 3JQEA 4L75A 2HO5A 2VTEA 5A05A 1ZVMA 2ILTA 3E48A 3QVOA 5DZSA 4K6CA 1YOVB 5L53A 2G0TA 1EUDA 2AE2A 4C7JA 4EDFA 5IXYA 1A4IA 1HYEA 3GY0A 4Z9FA 1NVMB 2VZ9A 4BOYA 1XU9A 2VZ8A 4YRAA 4Z6KA 5I9LA 1FJHA 3K2BA 4XWYA 2VOEA 5IZ4A 4PLCA 4AJNA 1KY4A 4A03A 4HFRA 4IZHA 5GY7A 3LK7A 3A28A 3HB4X 4PVDA 3S8MA 3EZLA 2VWPA 1FDTA 1RM0A 2OBYA 2WE8A 3CXRA 3SLGA 5H81A 4EEXA 2JAHA 2JFFA 3GPIA 1Z82A 4MP3A 3F4BA 1IUKA 2C82A 4DQXA 1RYEA 3BMOB 3L9XA 4Y6SA 2DVMA 4TSKA 1PJCA 1SPXA 4RF3A 5KJFA 3K5PA 3F5QA 3JD2A 1KETA 1C0KA 4KQXA 4ND3A 4ZU3A 2EJWA 3WWYA 4NH4A 4JX8A 2DBRA 1XHLA 1ZMTA 1P1FA 2NVBA 3D3EA 1LLQA 1JVSA 2BFMA 3E1KA 4MINA 1ZJYA 4G65A 1WXDA 3F47A 1P33A 3H4VA 3O26A 4UVIA 1O8CA 2YJZA 4IJKA 4D42A 1Y5RA 1LX6A 1AUPA 3K30A 3FTPA 3ENKA 2DUWA 3OEYA 1JA9A 2ET6A 2YFHA 3CPSA 4IJVA 4J43A 4XDZA 2NADA 3AK4A 3Q0EA 3VH2A 1LRJA 4FFMA 5TS3A 4J9VA 4CUKA 4GAEA 1KEPA 2E48A 2Q46A 3FNEA 3GH3A 4I5DA 3JYPA 1FDVA 3SC4A 1WAMA 1ZW1A 4BO1A 3NRCA 1JAYA 2CZCA 2RH8A 4XQCA 1YL6A 3ULKA 4KWHA 5A03A 4RQTA 3BMOA 4HNHA 4BNGA 2WSBA 4XJTA 1LRKA 3P2OA 1DFHA 1I30A 3VH3A 1D1TA 3DDNA 3FI9A 3OECA 4U8GA 4KDEA 3OF2A 5J23A 3ITDA 1LEHA 3NDRA 1Z73A 4AJ1A 1YJ8A 4DL9A 2PGLA 1FXSA 3KEQA 4R3NA 1N9GB 4KZPA 4GSLA 2JL1A 3FF4A 5G0UA 1HDYA 4LMPA 2FMUA 2WD8A 3E6AA 5TGDA 1N5DA 2UDPA 3GNSA 3KZVA 4OMUA 4YJHB 3MTGA 3PWSA 5F1KA 4Z0TA 1EQUA 1CYDA 3ZWPA 3SC6A 1NWHA 1DIAA 4P38A 1KYQA 3WXBA 2W2LA 2QRKA 4GPD1 3N7UA 3DC2A 2Z5LA 1YQXA 3GGPA 4WEOA 1MC5A 4ZD6A 3QWBA 1E1LA 4D43A 3U9LA 5BNTA 1NAIA 3RIHA 3ZW8A 3DONA 2EHDA 3GZNB 1NQAO 2HMUA 4WK6A 3VZQA 4P4GA 3JQ8A 4RORA 3QVXA 1MFPA 4XGNA 4O63O 3FR7A 5C5IA 2ZJ0A 2PWZA 1P1IA 2Y1CA 1QYWA 1PGQA 3KV3O 5ILGA 1PZEA 4R3WA 4MVJE 3KSZO 3JD0A 4CM9A 3EHEA 2Y0DA 2Y1GA 1U5CA 2O3SA 4EJMA 1E5QA 1NR1A 3JQDA 2CD9A 1LLCA 5CDYA 1HTBA 1N9GA 2FN7A 2ZYGA 4PRKA 3AOGA 3RASA 3WGGA 2X4GA 2I76A 3ONEA 4AL4A 2P9CA 3L6DA 4BO3A 4E5NA 3DZBA 5A5FA 5TSDA 2ZTUA 2CUKA 5IG2A 2HK8A 2I5PO 3H9QA 4YJHA 2DFDA 3JQFC 1ZXBA 5L7YA 1AE1A 4KTVE 3OBBA 1JAXA 1TT5B 1CERA 1GADO 1DLIA 2EF1A 4MVJD 4WECA 2DQ4A 1YB5A 1LLDA 5B37A 1HE3A 4W9NA 3JQBC 3ZU4A 3ZWBA 3ETDA 2X0RA 1GZ6A 3FHLA 2PGJA 1AN9A 3HUDA 5DCYA 4D45A 3GPDG 1D4FA 1GV1A 2Q50A 3WJ7A 3AY3A 1IE3A 1CETA 4ZQHA 5G4LA 5CDTA 3PDJA 4IINA 1QLJA 4Q3BA 2TMDA 4U6SA 3AOEA 2DBZA 2Q45A 4IM7A 5T64A 4R54A 2O4CA 3WNVA 3DMYA 3AY6A 4TVBA 3JQ9C 1LDGA 1HSZA 2O3JA 3OIGA 2IE0A 4IMRA 3KLPX 3VKVA 5ILOA 2BFPA 2I6TA 2D3TA 3HSKA 4FGSA 4YYZA 1WVGA 1T2FA 1XCBA 3SLKA 3GVXA 1R12A 4R9SA 1ZK0A 1E3IA 1MXFA 3D4NA 3R3JA 2PKQO 4BO5A 1OC4A 2ZTVA 2FPGA 2Q2QA 3UF0A 5ER6A 3W6ZA 4NFSA 1ONNA 4FC7A 4NFHA 2CVZA 3IMFA 2FPIA 3DZFA 3JQAD 2O4UX 3Q2IA 1G0NA 4CR8A 3WS7A 3OEWA 1VL8A 3HWRA 3QQPA 1QORA 2JD0A 2R00A 4YAKA 1SB9A 5A06A 5KWEA 2Q1WA 4PLZA 1YQGA 2DT5A 2X23A 1DDOA 3W4IA 4CMGA 1I24A 2D4AA 2UUPA 1R4MA 1DHRA 1Y5MA 4Q3NA 4IDEA 2EXXA 4YXFA 4Y98A 4ND4A 4ND1A 1WP4A 4E6PA 4K1LA 2FR0A 3H2ZA 1K6JA 1GPDG 3A1NA 5L4NA 4XYEA 3UAGA 4GGOA 3D1LA 3PYXA 5T8KC 4D7AA 5IDXA 4FN4A 4HWKA 1DJQA 4R01A 2PD3A 1X13A 2NQTA 4UREA 3U5TA 2JHFA 1PQUA 5AYVA 2HJSA 3WQRA 5KJ1A 1BG6A 3UVEA 1WZEA 1AHIA 1U7TA 5EPOA 2UVDA 1BW9A 3CEAA 3CTMA 3AI1A 4HXYA 1E1NA 4LVUA 3ZWCA 4A5OA 1KVSA 3DWFA 3EW7A 2YHIA 4OOFA 2HQ1A 1DOHA 3MCVA 2Y93A 4AJEA 3ROQA 4K26A 4MPDA 1K6IA 4YAGA 1MG0A 4YEDA 1D1SA 1I8TA 1YL5A 3V1UA 5JAIA 5JMWA 4QFDA 5JXWA 3ABIA 4FIZA 3L4BC 1VE9A 1PS8A 1LNQA 4UEKA 1PJSA 1I33A 5A02A 1M66A 3D64A 4XKJA 4E30A 3GLQA 5JCJD 4HBGA 1SB8A 5JDIC 1EK5A 1QKIA 1WWKA 1GL3A 1YWGO 5DULA 1P44A 2WMDA 2NLOA 3DHEA 5CDSA 1A27A 2X5JO 3ASUA 4I8XA 3PHHA 3RBVA 1PL6A 2DPHA 4JN6B 3ETGA 4ZQBA 4EJ0A 1BXZA 3WJAA 1IHXA 4CODB 1PJ4A 1XKQA 3F9IA 4M1QA 3PEFA 5EMHA 3D5QA 5LC1A 3WFJA 2ZQZA 1LQTA 4I5EA 4UUMA 3OM9A 3UXYA 1Z7BA 1G0OA 1HZZA 3IS3A 4H16A 4IDDA 5THKA 2IRWA 3OP4A 4IZIA 3AFMA 2XPCA 4UVEA 3KSUA 5JMPA 3PGJA 3MEQA 4CV3A 1UP6A 5DBGA 4CMKA 1C1XA 1OI7A 3HFGA 1GY8A 3GVHA 1R4NB 3V2HA 1FMCA 5JSFA 3HG7A 2EP7A 2V6BA 2YDXA 4F46A 4UVDA 1I3MA 1B15A 2Y0CA 2ZK7A 1U3WA 2OHXA 3JCZA 1P1KA 4RDHA 3GDFA 4J7CA 5TX7A 4GX1A 1CWUA 4IQGA 4CM3A 2W8ZA 1JDJA 3NGXA 1NYTA 3PHIA 4Q39A 2C20A 2D5CA 4EEZA 1DRVA 3CH6A 5KKAA 2PZLA 2VQ3A 5DP1A 1NXQA 3OJFA 4ONEA 4BO6A 5CDUA 3QP9A 4DBVO 2BH9A 4L4SA 4BHTA 5C7LO 1PGJA 1H94A 1HLDA 1DO8A 1E7MA 3JYLA 3FNHA 1FDWA 2D2IA 3N74A 2X6TA 2R2GA 4PLWA 3IP3A 2PLAA 3H2SA 3BHIA 3OMLA 2YQ5A 4YA6A 3GDGA 3B6ZA 3LC1O 3ONFA 4D44A 2B36A 3WSVA 4GI2A 4YPOA 1MP0A 4XYLA 3A4VA 2GN9A 4PLTA 4L76A 1ULUA 2X0IA 2HCTA 2FZEA 2OMEA 4O1MA 4DRYA 3L0DA 1BTOA 1BXGB 2EEZA 1QV7A 3VTFA 1S7CA 4CMEA 5AXBA 2YQ4A 1LJ8A 4W99A 3KHUA 3RC7A 5A04A 5GZ6A 5BSEA 3JQGB 4CLDA 2YUTA 1PJLA 5CDGA 1EVIA 3D5TA 2P9EA 4MVJA 5JDIA 4CLRA 4RVFA 1RYDA 4BO2A 4MVJI 4OKNA 4E31A 3FD8A 2VHYA 4OOEA 4BNTA 1GUFA 2PFGA 3BMQA 3TRIA 5MDHA 1JU9A 4GWGA 4OQZA 4Z9YA 4CM4B 3GEMA 4XGIA 3HQ4O 3FNGA 4KMSA 3WG9A 3OJOA 3MJVA 5FEUA 1XYGA 1ENPA 3ZWYA 5T57A 5A3VA 4R51A 5I9NA 1L1FA 5L3ZA 1P9LA 2VYVA 1DXYA 4A26A 4R69A 4FCCA 1Y8RB 2QHXA 1DHTA 4NHEA 3VZRA 1E3LA 2AHRA 1U8XX 3PWKA 3LQFA 3GN2A 2X8LA 3MWEB 3VVCA 3DMTC 4TROA 4BNWA 4E13A 2YDYA 2JAPA 3GG9A 3UCXA 1ZSYA 2AXQA 3O03A 3RUFA 3BTSA 3VPSA 1P31A 1G1AA 4RVUA 3F46A 2P2SA 4KQWA 3AUSA 4J0FA 4OAQA 4DLBA 4WCFC 3WQSB 1EVJA 1SZJG 1UZNA 1W6UA 3JQAA 4RQUA 4RPKA 4O5OA 1U3TA 5K1SA 4MKXA 1VPDA 2HMTA 1P1JA 2FWMX 4JBIA 1E1MA 1F8GA 1H6DA 4J6FA 3AM4A 1A9YA 4P4NA 4W7IA 1EBFA 3KBOA 2D8AA 3ROPA 3BMCA 3H3JA 4J0EA 3GG2A 3JQCA 1CIVA 3ZHBA 4FFPA 3OIDA 4DTIA 4NU5A 1ISGA 1Y6JA 3D0OA 1QP8A 1YONA 1BHSA 3ZWXA 2EIHA 3DOOA 3VDRA 1PQPA 4R9RA 3WYCA 1OBFO 2GGSA 3I23A 1E3EA 4GKBA 1SOWA 4BGUA 5EESA 4ZHSA 4HFJA 3UGKA 2GD1O 3C1TA 1SAYA 3PLNA 4UEOA 3D4PA 4A73A 4B8WA 3LLVA 2B5VA 4Q3CA 2Q49A 1YXMA 5ES3A 4IDAA 4IDGA 3BMNB 2Z1NA 3PJEA 2VTDA 1K89A 3PJDA 1VKNA 3PIDA 3DTYA 2X22A 4HFMA 4UAGA 2GYYA 2BMAA 4NJMA 1O89A 4J90A 2X9VA 2ZB4A 2CVQA 2P4HX 4NFYA 3Q6IA 5AXAA 3ZGYA 5G0WA 4CM9D 4M54A 5JCJA 4WLNA 1BMDA 3RWBA 1DRUA 4DIFA 2ZIZA 4OKIA 5KJCA 3HB5X 1M2WA 3W6UA 3OJLA 5LDHA 2JHGA 1JWBB 1T24A 3X2EA 4JP3A 2J8ZA 1DC6A 1Q7BA 1P0CA 2C54A 3TPCA 4AJ2A 4NDNE 4D46A 4RCVA 1BWSA 1MB4A 1AXEA 3U4HA 1E7QA 4DIOA 3B70A 4ZN6A 2PY6A 4B4VA 4OYRA 4TWRA 3B1JA 4WPGA 1GPJA 1PEDA 4B4UA 3CZRA 4IS2A 4BMSA 4BNMA 5L4LA 3HDJA 4CMJA 1XLTA 1MA0A 1GTMA 3DAPA 2H5LA 4M89A 2O23A 5FFFA 2FZWA 1Z74A 1M75A 4R1NA 2PD4A 2VWQA 2GZ1A 1GV0A 1V3UA 1I3NA 1BDBA 4NR0A 2VNSA 5JAZA 2DFVA 3BTVA 5JYDA 1U2GA 4IGEA 3LT2A 4QXMA 2WDZA 1QMGA 2QRLA 4QT0A 5DP2A 3IUSA 1DRWA 2J3JA 4RPGA 1U3VA 2I3GA 2B4RO 2HU2A 4BB6A 4B3JA 1BXKA 1HE2A 3S2IA 5K6AA 1DFGA 1UR5A 2DKNA 1E0DA 1NASA 3O4RA 4RO0A 2VRBA 3PHGA 2WD7A 3RVDA 3LC2O 4TRRA 4IDBA 4WOKA 3ZU5A 3MJEA 2YHUA 1DAOA 2BFAA 3EY4A 1PJBA 1UZLA 2G17A 3O9ZA 4NBUA 4B79A 3MOIA 4MVJM 1Q7GA 2AQHA 2GLXA 2YZ7A 3QWFA 1UXKA 4YT2A 3U49A 3OA0A 4WLVA 3S2EA 3P5SA 3WIDA 2NTNA 5DN9A 4IXWA 1A5ZA 1IHYA 2XAAA 4MIYA 1ZIDA 1HXHA 4YRDA 3P2YA 5DBIA 4PVCA 3SBOA 2WM3A 3NJ4A 3NTQA 2NQ8A 4J4BA 1LTHR 1YB1A 3T4XA 2YFQA 5IN4A 3I52A 1PGPA 1LC3A 2JJYA 1C0IA 4E5KA 1HT0A 3KXDA 3C85A 4WJZA 1DSSG 2EERA 4FJ1A 3WWZA 1IPFA 4YAEA 3NV9A 2G76A 3OIFA 4DC1A 3H7AA 1ZK3A 2QX7A 3QLJA 3WGHA 2BGMA 1JW9B 4WGGA 4L8VA 2Y66A 1NQTA 2IEBA 4JJGA 3VKUA 3WB9A 3H6KA 4IBOA 2B4QA 3DEYX 4UUPA 3K92A 4BKQA 1UAGA 5EINA 2AG8A 2C59A 5JDCC 2QZ9A 4DBZA 3K6JA 3GNQA 5HWSA 1AGNA 3MZ0A 1ADCA 1VC2A 1J49A 3LDHA 5F1OA 2H1SA 3PQEA 2X86A 1IOLA 3NAQA 3TL2A 1XU7A 2AE1A 1E1KA 5I7FA 2F00A 1M6HA 1HDGO 2V7PA 4B7XA 4BGIA 1R15A 4DC0A 2NU7A 3MJSA 4GMGA 1P45A 4BV8A 1T2DA 5HBRA 5DT9A 4FS3A 4L74A 4YT4A 4YT8A 5IZCC 3RUEA 5BQFA 1PS0A 1GZ3A 2HUNA 4CQMA 2IODA 3KOUA 5IF3A 4U0JA 1KVTA 3FN4A 3C24A 4IJWA 2E49A 2X0NA 1UDBA 4ZQGA 1FDUA 3GVCA 1KEUA 3KYCA 1OOEA 2RCYA 4MKRA 3ZN2A 5C3MA 3QSGA 2Q4BA 3JQ8B 4AICA 3R1IA 5I8ZA 1I32A 4UUOA 5H82A 4Q3EA 1X7GA 3RROA 1HWYA 1VRWA 4CLEA 2FR1A 5KVSA 1GQQA 2H63A 2PA3A 4E5YA 2ZJ1A 4YB8A 3RUIA 2JCXA 4OXYA 4MIEA 3I9MA 3RC1A 1PZGA 2V6GA 3ZZNA 2O48X 2CF6A 4RJTA 1MXHA 4ITUA 4ALLA 5FWNA 3BXXA 1DBVO 5G0TA 1BVUA 1B8PA 1WZIA 1TVEA 1QYVA 3BHJA 2EJVA 1R6DA 2RBEA 2DBQA 4JROA 1SC6A 1ISJA 3AUTA 4Y9DA 1C1DA 4CM6A 3D4OA 4J16A 1Q0LA 2BRUA 4BQPA 4MIOA 3ZNQA 3R3SA 5F5NA 5CPFA 2OUIA 4BMNA 1TXGA 3PWZA 1XR3A 1WDMA 4IMPA 2ZATA 4QQRA 4S1VA 2EGGA 3VVBA 4E32A 1O0SA 1PJTA 2PK3A 1V6AA 1JKFA 2J3KA 2IYPA 4CV0A 1VI2A 5CEFA 1UDCA 3WQQA 2CFCA 1AXGA 2GN6A 2C0CA 4PLFA 3IUPA 1JLLA 2IDZA 2NUAA 1DC5A 2H9IA 5C37A 3DBLA 3Q9UA 1YBVA 4XZ3A 2Q1TA 5BNIA 3S2FA 5CHEA 3KVOA 1Z7EA 4BNJA 3W4KA 2C5EA 3DXFA 1YH3A 4ESOA 2P5YA 2YYYA 3QV1A 1O9BA 4A10A 1XELA 3K73O 1G6KA 2VWGA 3MOGA 4J4TA 1UJMA 3LVFO 1EDZA 4QFCA 4B7CA 3VDQA 3TFOA 4BNFA 3RU9A 5ICMA 5F21A 5TT1A 4BGVA 1ADGA 1K0UA 4DVJA 4ALMA 1Y1PA 2J5RA 3C7CB 1EFLA 4A2CA 2IZ0A 1SOVA 4BQRA 1QRRA 1ZUD1 2WYWA 4O6VA 1R4MB 3U4DA 3L4SO 4E2WA 1MLDA 3AW9A 1KVQA 4JCOA 5JBIA 1NPYA 2IXAA 2E4AA 3NTOA 1UDAA 3JSAA 4MP6A 4OO3A 2VYVD 1XIVA 2OL4A 3ETEA 3UFXA 4NJOA 1IPEA 3ZWOA 1GUZA 1ID1A 3HADA 5GZ3A 2VOJA 3I4FA 2OZPA 3KUXA 3RUDA 4AJJA 3Q1LA 1N1EA 1PGNA 2CF5A 1GQYA 2X1HA 2HAEA 1BVRA 1NFQA 1OC2A 2GASA 5DOVA 1GAEO 4MDHA 3U4CA 5C7OO 1DLJA 3FPCA 5AXDA 1I2CA 4GQAA 5I8WA 4BB5A 1BW9B 4IJUA 4BKPA 4RVGA 3H9JA 3ZWAA 1B0AA 2Y1DA 3TWOA 5GMOA 3G1UA 1EDOA 3T7EA 3I6QA 2YHIB 3O38A
chains in the Genus database with same CATH superfamily
2W2KA 2OO5C 4ZRNA 2FSIA 1L5LA 5DLPA 1XAJA 4HWSA 1WXXA 1L4EA 5LCXA 4EF4A 3OCZA 1X1TA 1U4NA 3DVAB 1ZI9A 1W93A 3GT7A 4RVOA 1FP7A 2VT6A 5J2TF 3C48A 3KPJA 1O57A 3BPSA 5EHGA 4M98A 1BHO1 3NW9A 3O8OA 3CGGA 2FPXA 3WOHA 5HQ3B 5K8LA 1G63A 4US2R 4XLTA 3FPJA 2GF2A 4IVPA 2HKIA 1CVIA 3FTNA 1CG6A 4PG8A 3Q8KA 2WR8A 3LFTA 1T1JA 4QUGA 1N4AA 5GGYA 1P74A 2H9YA 2PEYA 2VJMA 2CJXA 3FTCA 5JCOA 2BISA 4BO8A 5JZSA 1RJWA 4OIMA 5SYNA 4W5TA 2Z04A 1BA3A 2FRDA 2QIOA 4JLKA 5LZ7A 2O2EA 4BNKA 4DEVA 1AS3A 4P5DA 2YIVX 1MQ8B 4X6UA 1IBKB 2B99A 3L3BA 4WA8A 2WP0A 4UNNA 3OU6A 1T5BA 2VYCA 2ZJOA 4QGAA 2I4OA 2Z8ZA 3UOGA 2C83A 2M2IA 3KYBA 1N2SA 3T7JA 1X15A 2HY7A 2QQGA 3NPMA 3MJ4A 2Q3DA 2WIDA 3QKTA 2W42A 1HEUA 1DKRA 1DOAA 2GR9A 3QHPA 3VU9A 2SCUA 4E3WA 1XF1A 4F8EA 4DV5B 4OJKA 3D7RA 1AKEA 2VCHA 4K9DA 4WADA 2X1VA 3SR3A 2Y1FA 2ZUTA 3UB4A 3MJTA 3L46A 3P32A 1Z68A 3NKFA 4P1ZA 1AZSC 2UZIR 3PGXA 4KOAA 4MR8A 1BJRE 4DLLA 4C3OB 1M7BA 2LDXA 5FUWA 4DWWA 1EXVA 1QG4A 5JZOA 3HVRA 5KOHA 1PWYE 1K63A 1P9RA 2FUEA 3BJIC 3IE2A 3BGWA 2RGCA 3RJ5A 5C8YF 1PT8A 5BV7A 1XOIA 3E7WA 4RC9A 3CLSD 2PTGA 2J5BA 3V1KA 1DX4A 4ZVMA 5CFLA 4DIUA 1RFLA 1VMDA 2QQ5A 1BQ4A 2X5OA 5CU7A 3DBRA 3PPXA 5AJWA 3OUUA 3WTCA 2E85A 1IB6A 2IP2A 3FUXA 3LJKA 3RI3A 2D5AA 2R44A 4B5KA 1N2ZA 4XVCA 4RTJA 1TZBA 1UBNA 3W77A 3CVUA 3IJEB 4QBKA 4YJ2B 1F2DA 2PX4A 5B12A 3WL7A 1G2OA 4Q24A 2D1SA 4AKIA 1U2QA 2EKPA 1XQWA 1FE8A 3AM3A 2JCBA 2PQ6A 4LJKA 3A9WA 5CT9A 3L0ZA 3UIEA 3SR0A 2JLAA 2P2CA 3WOVA 1DC3A 1NP7A 1DKLA 4Q6BA 5EZQA 3ES9A 2I4IA 5JU6A 1X3SA 4ZOLA 3MTIA 1Y3FE 2J0SA 3G6KA 2A58A 3LHIA 2Q2VA 4GYJA 3EZFA 4ZOEA 3O92A 1OLUB 1ZMOA 2KW5A 2AUNA 4MUHA 4QKQA 3FCXA 1B23P 1Z3CA 3PC8C 4EMBA 3FB1A 3PRYA 2O5RA 4HH0A 3Q7QA 1QNLA 2GZMA 1E4EB 2EFHB 5C1IA 3MJCA 2XA2A 2C0PA 4GVLA 1OWMA 1BS1A 4R1TA 1MORA 1Z5NA 2Y6UA 4HWGA 4UDYX 4RAOA 1WPQA 1SIWA 1I6WA 4XGQA 1ZK1A 2AOVA 4R81A 5H68A 3AF2A 1KC1A 3UYKA 3AIIA 1EEHA 1ZJ6A 2WKQA 2YMMA 2PPVA 5DF1A 3LNTA 1PD1A 1NKVA 5B7PA 3M5PA 1VMEA 1XCLA 1IHDA 4BFUA 3KPUA 4XYGA 4DQLA 2I99A 1P60A 2VL7A 2W2NA 2QNIA 3E9ZA 3H5TA 1TPZA 4RA9B 2WF5A 2QM7A 4HB4A 5F64A 3UMJA 4P7JA 1LQUA 3D6TB 1NNUA 2OV4A 2MWMA 5FQNA 1EAMA 5ITVA 1F2TB 1NTOA 1SCBA 4S1TA 5EXPA 5T8KA 4C21A 4E2XA 1NL3A 3GUZA 3LDAA 1VZ2A 1Q1GA 3D3WA 4UBMA 5FBRB 5L3SA 4G4JA 1M9NA 4X6YA 1GZ4A 1EK6A 2FG7C 3KU1A 1UT6A 4Y6QA 3TW8A 3WX0A 1W8IA 1VRCA 3EFEA 4OX9Y 2Z2XA 5KBYA 4L3VA 4RX1A 4ZICA 1F2VA 3T5GA 3AINA 3K20A 4GMXA 4MI1A 1D04A 4BGEA 2WP8J 3MERA 4UZSA 3LI2A 2PSSA 3AG5A 5DN6A 1YUBA 3CCFA 4OPMA 2R86A 2HLDD 2WYUA 2XLBA 4A7PA 2HIHA 1JAHA 2M6SA 5EC8A 4HWOA 2IEIA 1X7YB 2AX3A 5B7QA 3REFA 2XD4A 3I04M 1CJCA 4MW1A 4UAVA 3Q7PA 2ADMA 1J5PA 4YCBA 5DU2A 3K9GA 2LIVA 3GGOA 3NP9A 4YQZA 2XGGA 1YB7A 3L4BA 1PNQA 3RANA 1YFZA 1Z07A 1E94E 3L7OA 2BZGA 1SHKA 4RF4A 3ROKA 1BMTA 5FUMA 4FNMA 5F1PA 3TXXA 1FSSA 1QH0A 2FEAA 3RRMA 5CK5A 3TL3A 2UVPB 4CMGA 3O7WA 4AX4A 4IXTA 5HF5A 3U40A 1IXYA 1N0HA 5EJMA 3T5DA 2EFCB 3NDJA 4M1KA 4V0QA 1IULA 3A3YA 1PL7A 1U2EA 4JBHA 4WD3A 2HCBA 4MICA 2D13A 3GEPA 1C3VA 4IH4A 1V37A 3VZSA 3D3KA 1SU7A 4A6XA 3HN6A 4DLWA 1LA2A 1U8CB 3I61A 4JA0A 1M2VA 1Y7TA 1N5KA 2OY0A 1V96A 4IRMA 2IKSA 3JSXA 4G23A 4K6OA 5ENZA 3SE7A 1E3WB 2B5WA 3CRQA 2Z4TA 2I8CA 1PKXA 4G84A 4IJQA 5SY9A 3UZUA 4A2QA 1YBFA 4LWPA 4HEHA 1HK7A 4CZ2A 3OJWA 2V7QA 1QCZA 2NU9A 1XD8A 4ZYVA 3B5JA 2QTZA 1OT3A 4HAZA 3ECAA 1ZW6A 1QHGA 4XASA 1WMSA 3TZ6A 4L5IA 4EB6B 1RZVA 3ZZ1A 1DBRA 1R5OA 3FMFA 1OD6A 4YJFA 5T3UA 4ZJYA 4MR9B 3Q87B 4H4EA 4LQDA 4W1RA 3UHFA 3WQHA 1FRQA 4HN9A 2HRZA 1YJXA 2G71A 4HDNB 2PUHA 3M3DA 5JY1A 3K2EA 4BVBA 1OFGA 1QRAA 3RW9A 3WJ2A 2Y1EA 4L4UA 1W1UA 4IXMA 2HC9A 1JPVA 3L93A 3QA9A 3KOZA 1N5MA 4MLCA 4TV9F 3NGLA 3ZWDA 1APBA 1T10A 4CIAA 1INLA 3RRNA 1IXKA 4AY4A 3RSCA 1FSZA 2ODBA 2PVPA 5DPMA 1BJTA 5CVJA 3SHOA 3EZYA 1WW8A 4WOBA 2C4NA 2ZAGA 4ND2A 3AZPA 4DQUA 1CUHA 4RVCA 4BWFB 5CX1B 4P84A 3BT7A 2PZJA 1D1PA 4E70A 3ZK7A 3EGDB 4MS3B 4QG3A 2VHTA 5B7GA 5FTWA 3W9YA 1E9FA 3MGBA 4ALJA 1QYCA 4RVHA 4JLBA 2ZIFA 3NYWA 4R2JA 3VKWA 4YRKA 4ZV4A 2H1OA 1E2BA 5A3RA 2IW1A 2WIBA 1E69A 2GXSA 3GLTA 3HZRA 1PL0A 5FBKA 2VJLA 2Y0EA 3V2UA 4UFPA 1XEXA 3PFKA 1OFUX 4WUTA 2JHPA 4ALKA 4R1UA 5FF9A 2NUBA 1SU4A 1ZQ1A 2VIIA 2X6QA 3UJHA 4A2PA 1YASA 2ZJ7A 1X1CA 1OJLA 3H75A 3V2IA 5IKMA 1UPXA 4EB8A 4EA6A 5AOAA 3V1LA 4FFOA 4R1OA 3TZBA 4EG1A 5BUSA 1XLWA 4WXRA 1HL3A 3QKRB 2IYNA 4Q05A 3EUAA 4QU8A 4QUJA 4TMFA 2NSDA 1W30A 1Z0JA 1JHMA 2XT6A 3OQVA 2ANBA 2YVAA 5DO9A 1TM1E 1SA0B 4G09A 1D2RA 1GG9A 1PR5A 3ZZTA 3D8RA 3MSCA 4MW9A 4G8CA 2Y9MB 2B1JA 1YB4A 2AOTB 3GRPA 3VSAA 2ZRBA 5JW6A 4K8RB 1HLPA 1B6SA 1JKJA 3JAWA 4Q7KA 1DAKA 2GO7A 1C0LA 1MENA 3IP1A 4KQHA 5LQSA 3X1ZA 3N05A 5ESDA 4BP9A 4LDZA 4G0VA 1TK3A 1Z62A 3N2ZB 3OX1A 3DUFA 4HR7A 3I0NA 2IYFA 3DPIA 4IPTA 1WB6A 2WHYA 4MVJH 1WBJB 5EWMA 1OBCA 1L4KA 4HLQB 3PU6A 4TUYA 3ZY6A 3EUFA 1YE5A 1ZCFA 3E4DA 4FBLA 1PR9A 4AJHA 1YR1A 1HTWA 5K8CA 1SKAA 4OH1A 2CJFA 2HMWA 1RWKA 3TRDA 2ZDGA 1F12A 1Q20A 1QHSA 2G8NA 3GVIA 2CL0X 3OURA 4U3JB 3RC8A 5EWLA 3ZYZA 4HKTA 2OGWA 1FFBA 2O59A 4US0R 2VHVA 2BTEA 1EFUA 2XSZD 4RH0A 2CYAA 1CV2A 3VKFA 3F98A 1P4JA 3OCXA 1E6CA 1A9XA 4GPIB 2GAFA 4YCJA 5KOIA 1CC1S 3OPYB 4DMUB 4FOSA 5CFZA 5ED0A 4MITA 3HJBA 1ZD2P 2WZQA 2ERYA 2QZSA 2GEBA 4PTYA 5I7SA 1I10A 2DGDA 1XT6A 4HQLA 2ALJA 4C30A 4B6RA 1H5QA 5CA1B 3OZTA 2QTNA 4YCSA 2R8XA 3FJ1A 5CXUA 3DFKA 2B7LA 4M8NE 1W88A 2YYSA 1CLUA 2R751 3I83A 1UJ6A 5AIBA 3AR5A 3KQWA 1GRCA 3HR7A 3D2AA 1T8YA 3TIIA 3ZS9A 1ABEA 2XTZA 4E46A 2QSUA 1OWOA 4QYIB 1DWQA 2VSXA 1R9JA 3D5EA 3LS2A 5DNAA 2ZRHA 2CLEB 1ZS9A 3RC2A 2J46A 3PJGA 4HBZA 2X5XA 3W8NA 4N3AA 1NT2A 2FJPA 3NT2A 3NT5A 5ALSA 3ZLBA 1Y3DE 4KXLA 3S1SA 1KMNA 4ILEA 4LY3A 4CV1A 1SUDA 1UM8A 2JGIA 4TXNA 2Q9CA 1SM4A 2KB0A 2WJ3A 3IAAA 3MS4A 4NBNA 4PV7A 4P5EA 2FFRA 2JRCA 3WNQA 1OIWA 1N7GA 5ICSA 5IMSA 1SWWA 4N03A 4OXXA 2AEMA 3VAYA 3VI3B 1Z6YA 2Y99A 2P67A 3BWDD 3EQ7A 2QORA 2RHBA 1W0KD 4FMCF 3R3XA 3K53A 4UTOA 1Y9AA 3VOBA 4EVIA 5KKNB 2NP6A 4OJYA 3PDHA 4MNTA 4Q3KA 2CLFB 4MGHA 2AYYA 3VC7A 4RY9A 3WWEA 2OQRA 4JC0A 3PUIA 2R1VA 4PZDA 3S5JA 3COJA 1USGA 2AEJA 4YR9A 1DWUA 4DV2B 2Y05A 2JKYA 1JJ7A 2VQSA 1YL7A 1Z0UA 2PXCA 3NGMA 4GRAA 3WB2A 1I0ZA 1IDN1 4FZ3A 2RAUA 5F3DA 5LYJA 5U4QA 2QVCA 3ISVA 1G3RA 3HCWA 2OOSA 5FDFA 1EJ2A 5DDIP 4CYMA 3FF1A 2O0HA 1PR1A 3VH4A 2P3OA 2ZT7A 5E3JA 3BWYA 4DE5A 4LJ5A 1VJ5A 2QWXA 1FZTA 3K71B 3C7AA 1M6EX 1U7XA 1H4SA 4KO8A 3D8UA 3MA0A 5JAQA 3I6BA 2G08A 4OQPA 3SYTA 2VF8A 1QRTA 3A4TA 3K8ZA 2C2MA 3CZPA 1FFAA 1YDGA 2EJUA 2IQ5A 1E2HA 1S9DA 1O5IA 3LFHA 4C0JA 1ZICA 1J8YF 4FD3A 1ZI8A 3THRA 3K0EA 2BEKA 1RPJA 3DVRX 2QF7A 3BAZA 3HCEA 4KO1S 2YASA 1QS0B 4Y6RA 2PXXA 2VPWA 3BH7A 5KU1A 1J8VA 1XFDA 3L7YA 1P3DA 2K6GA 2V03A 1REQA 3GPCA 4UAUA 4ZZ0A 3K09C 4OUDB 4QATA 2W4QA 3RRYA 3OD5A 5LQUA 3GMSA 3KYCB 3SSAA 4BDSA 2C77A 5JC8A 3G5LA 4EB3A 5JAHA 2C4TA 2DC1A 1PLLA 4EM6A 5EXSA 2WV9A 1RLTA 3I6ZA 3O8QA 2VJQA 4R68A 3C41J 2PMKA 2ZIEA 3AEYA 1Y81A 1UFVA 5GTDA 1UFOA 4XCQA 2EARA 3UN1A 4U5QA 1NJ5A 1R4ZA 3UHAA 1QIGA 4ZVOA 1IHOA 4FILA 4GSYA 4LF4B 4IMJB 3G0CA 1QJCA 3CUTA 4IV8A 2RMKA 1BNCA 2COUA 2ENWA 2NXJA 4KXUA 3INRA 3ZS8A 4CI9A 2AEEA 1F9EA 4FMPA 3L8CA 3NHJA 2GBGA 2Q0SA 2GJ4A 1ESNA 1O94A 4LX0A 3OC0A 3K96A 3DQZA 4KYTA 4MV4A 1B4DA 2JLBA 2Q4TA 4OA5A 3TIVA 5LMNB 1U0JA 1TUBB 1P17A 4RV4A 5CEEA 3F7MA 4G2NA 3ZV5A 5LQCA 1LI5A 1EUCA 5LB2A 4EY6A 4A0QA 1Z5ZA 4PR3A 4MAFA 1X42A 4MDYA 2YVKA 2B9EA 2ON6A 1R6BX 3HP4A 2ZWIA 2J0QA 2O8FA 5KNLA 5M3BA 4R1QA 5DW3A 3HJAA 4WXMA 3SZMA 3E9CA 5E1DA 1YDWA 2EBFX 3CU5A 5C31A 2BR3A 3Q7SA 1DIGA 3PFWO 4CJXA 3GAMA 5F7ZA 3WR5A 4KUEA 3ROTA 4J1SA 3VKHA 2BHRA 1BHQ1 2ZUVA 1RVDA 2SKDA 5LN1A 1C9JA 3K4QA 3PXGA 3BXFA 3DUWA 3G0IA 2BR5A 3U2QA 4BVEA 1KI6B 2CLDX 4JNCA 5GJCA 1WDTA 1P2VA 1X3LA 1OYYA 1QO0D 2FY8A 2J0UA 4MPRA 3LXRA 3PNMA 3K9HA 1TW3A 4OHZA 2ODQA 2EW1A 4GRDA 4G1CA 3TCXB 5BNZA 3KJEA 3DT8A 4JGIA 4E5SA 4MWEA 4BVLA 1QGDA 3P9SA 4RD1A 2D0IA 2FNAA 5H4HA 4WJLA 5LP1A 4GH5A 4U7TB 2VPQA 4AROA 5BVHA 4NEQA 4BFLA 1RM4A 5K4GA 1T4CB 3LPMA 3QUSA 4W9MC 1ZRHA 2C7GA 4YACA 2WNHA 5KVQA 2C42A 2POCA 3EQ6A 1VA5A 1YULA 5C8YB 3ZJTA 1MVNA 1N9KA 3KM0A 1H69A 2WWVD 2JB9A 1SOAA 1NF9A 4UXHA 3T7RA 2RC5A 4UUNA 3X1DA 3HC7A 1FQOA 1RC1A 1VECA 3KYDB 4GL4A 4RFLA 4KQEA 3WK8A 1WXHA 2J6BA 2WVGA 3D7SA 3MW8A 4IIBA 4RS3A 2BR4A 5F5XA 3DXXA 1L7PA 3ND7A 3I5YA 4NKRA 4EL0A 1GFZA 5LMCA 2JG3A 3EVDA 3AG6A 1VSVA 4BX3A 3T5CA 3B38A 1I4WA 5IPFA 1QR6A 3CLVA 3GRFA 1C7FA 2Y1OA 4MW0A 4N6NA 4QLOA 4X97A 3ZX5A 3ESQA 3O1IC 4H1UA 2I66A 5KYWB 4L1KA 5YASA 1RLMA 4QDZA 5C81A 1VYHA 5CB8A 2V0CA 1JR4A 4YREA 2ETVA 1SVSA 3TCKA 3ANLA 3X1MA 5CYOA 4FFBB 3QFRA 1C14A 4PN7A 3TZLA 1IZ9A 1E9VA 1T4BA 2JIQA 3HKBA 4ZVKA 4Q9AA 3WICA 3EF1A 2PVCA 1U9IC 1NW6A 2Z2ZA 2P7IA 5B4TA 2DTEA 5EVJA 5CVTA 1T9DA 3VDXA 4R1SA 1Q1NA 1BIFA 3K31A 1J6UA 1AQJA 1SPBS 3GOQA 4M87A 2H2AA 1U80A 4FYKA 2UUAB 5CYFA 5E3IA 2I7DA 3RS2A 1MGPA 4BNUA 1CW2B 3Q7RA 2ZS7A 2QTLA 1AY0A 2F43B 4O4LB 2XUFA 3TB6A 3U62A 4EGCB 1O97D 1K6EA 4QTXA 3RRBA 3WLEA 2AK3A 2HLPA 4FDAA 1KHHA 3CX6A 5NULA 1CU1A 3JZAA 3QWIA 4HGRA 3E3LA 3GA0A 2IV7A 3NPAA 4DM4A 3BBLA 4P4UA 2R6GA 3CEMA 2QYSA 3HEMA 2WC1A 4JENA 2PLNA 2CC2A 3DZIA 2ZUUA 4F6CA 3O9MA 1Z2PX 3LIIA 1DTSA 1QFYA 1LQ2A 4RE5A 2O0JA 4U02A 4B81A 1C1HA 2VCYA 1W75A 2QY6A 5HE8A 2Z1MA 3EZGA 2NU8A 4TS9A 4TQGA 1T5LA 1XEAA 4PWYA 3LG2A 3W3AD 3B3JA 2A0UA 2PANA 3LA8A 5BRAA 5C35A 5CEJA 2IVZA 3QMPA 1GQFA 2W43A 2PUVA 3GRVA 1VGVA 3WYEA 5LDDC 3GLIA 3JV7A 1GTVA 1YRYE 4J1QA 4TXJA 5CLHA 2G0AA 4FYWA 1Y63A 3P2EA 2F8SA 4XEHA 1TZKA 2PMDA 2OVBA 3IALA 2GH1A 3LSTA 1KE2A 4GZ6A 3WKBA 4AXBA 3E3AA 2W48A 4CKEB 5ISMA 2FZLA 1SXJE 2AYXA 1Y8QB 1K7SN 4Y6LA 4E09A 2WWRA 1H6CA 2PT5A 2RHHA 3EEQA 1VMAA 3FFXA 4ZT2A 5ELLA 3VR2A 4D2IA 4IMIB 1B73A 3WYGA 2W6ZA 4MW5A 1NE7A 2ZBUA 5JCZA 1ACLA 2QRMA 2PZGA 2UYGA 4HWRA 4I4CA 5BSUA 4D92A 4C5CA 4N18A 1A2QA 1JHZA 5IP5A 3QH4A 4WCDA 4MULA 4Z3DA 4XIYA 3HJCA 2E18A 3K1YA 3KSBC 2XYHA 2R8BA 1W5SA 5ALYA 3L7KA 2DR2A 4RXMA 3ER6A 3FSGA 5FL7D 2GDJA 3JZMA 5A4IS 2YXEA 2FWJA 4P80A 4RAQA 4LF5B 1KJWA 5JYEA 4KQ2A 3H8VA 3PRHA 4FYJA 3B6MA 4FYMA 5AWFC 3VZCA 1N3LA 2Q3MA 4BYMA 5FTNA 5AKXA 3DLBA 4BQSA 4DAEA 5T6MA 3PFFA 4X1KA 4YWHA 2PH5A 1V6CA 3I5UA 1CY8A 3IQZA 3ZIDA 4A16A 1SZDA 3KHSA 3V6MA 1LBQA 1S4QA 4WL0A 3AU8A 4J0JA 3E7DA 1FVHA 1UPBA 4LZZA 3PTAA 2J6CA 1U0EA 2PBFA 4A27A 4B47A 5D51S 4MVJG 1XGKA 3DMRA 5AOCA 1J0XO 2DFTA 2OFOA 3SYMA 4BNDB 1YI8A 2CDCA 2R97A 4Q1DA 1EXNA 2CD7A 2CVOA 4REOA 4YVFA 3WSTA 3ANYB 4KNVA 4EO9A 1BFUA 1JSRA 1K8ZB 3F4LA 4JT4A 2BP7B 1IC6A 3WLAA 4CM8B 4RE6A 5I9MA 2AQIA 4DY6A 2BGUA 5ALOA 1VE3A 5EERA 5CW2A 4GWLA 3IKVA 3VR5D 2H5JA 4JOQA 1RBQA 4ABTA 2YMQA 3L0IB 1M1NA 2DHCA 1L3CA 4L73A 1ZN2A 4L85A 4BQEA 4F7WA 1PYGA 5HJ2A 4AG6A 1UP7A 1FTSA 2JIZA 3AR6A 3I1FA 4C14A 1DKMA 2H3HA 1YAHA 2BLNA 1D4AA 2W6ID 1AB5A 4MX8A 4OMDA 1VLQA 1G7TA 1O5TA 1TF7A 4AURA 3AUXA 2YV5A 4MPTA 2WY2D 4ZDIA 4IGFA 3FNIA 1QIFA 4Q4JA 5A6SA 3GRRA 1GGKA 3JATA 2XA1A 1MIOB 3S1LA 1VSBA 3QTBA 1PFUA 4PTZA 4NXMB 4IDHA 2V1XA 4TKLA 1JNYA 4V0KA 5K0LA 1WB9A 1YBMA 2WF7A 4K9OA 3IOYA 3S2GA 3ITKA 3NYQA 2VRCD 4H15A 1IBSA 4J76A 4Q1FA 3S55A 1S6YA 2LXNA 4IIJF 2BYTA 3B85A 4RVDA 4MUMA 4RLHA 5KI6A 1R2QA 1QIIA 4B45A 2HI0A 3L06A 4KO3S 4RHCA 5JV5A 2L19A 3O82A 3M1AA 1ZOPA 3MQ4A 4FB4A 4IFBA 4YP1A 4WV3A 2QPAA 1YE3A 2I0FA 4GLFA 1R6VA 3AHDA 2OV2A 2YIMA 1QXSA 1LPSA 3AR3A 2AC4A 2BHTA 5E2IA 3T1QA 3W8DA 5AW4A 3EH2A 1U3DA 3LWNA 1R0SA 4PNHA 3MD0A 1RRVA 1G20E 1AO3A 1JIIA 1FFGA 1H42A 2CNWD 1V1MB 4JUIA 1USWA 1FYXA 2BEUA 2GXQA 1PJZA 4JA2A 4F4FA 8AT1A 4P0PB 4G97A 3LT1A 4QT4A 2VHWA 3MWKA 3A6GA 1GYPA 1ZH8A 1FNBA 2CKMA 2PKQP 4JKOA 4ME6A 4QE3A 2P2GA 1NT4A 1V5WA 3NT4A 3TRFA 3KT3A 1I13A 2R7MA 5TQ2B 2H08A 2ZRNA 5J1TB 2WBLC 3THYA 2PXHA 2CUNA 3QUCA 4KR6A 2MINB 1NSTA 4JK3A 1DL5A 1G21E 1P6XA 3IOCA 3JRNA 3U1TA 3M2PA 2IZ5A 2QXTA 3R5HA 1Z6QA 2VK2A 4KXVA 3UQZA 2VQDA 4X71A 3VJKA 5DNUA 1XN4A 4HNAB 2RHGB 5AW9A 1LI4A 4DEYA 4B3RB 1YR7A 2FW9A 3NWJA 2BH2A 4ZARA 3OX4A 1ZU4A 3W6PA 1UFRA 3X1KA 1PV1A 3C3XA 1CB0A 2Z2IA 4RDXA 1XPUA 3DOFA 3RRZA 4OP1A 3A2KA 3WWOA 1P9OA 3I73A 2PH3A 1UPUA 2DLDA 1Z7WA 3BH0A 2L0XA 1NN0A 3TDNA 2KM1A 3CUKA 1PLKA 3SYNA 3Q8MA 1LDEA 3GB9A 4I19A 3NFYA 4DGSA 3GRAA 3SC2B 1RYNA 1K3FA 3JZDA 3VV2A 4ZAYA 2P4SA 3OH8A 3A9CA 5JFGA 3UCEA 2QMEA 4LFBB 1XD2A 2I3AA 4PHTA 1IOZA 2BMVA 1WCWA 3GP5A 4TZ0A 1K2WA 3PPVA 3M1YA 1TKBA 1A95A 1ODKA 2EKZA 3HFJA 4UE3S 1BRMA 1CUSA 3ZHYA 4FWTA 4RSGA 1RM5A 1CUZA 2QBYA 1TL7C 4HC4A 1UT8A 3WGTA 5EKXA 4XIJA 3QF4B 2WJHA 5CK4A 2IXDA 4ML3A 1C30B 3AF5A 4FW9A 3KWLA 1IBMB 3K1ZA 1QV6A 4HFNA 5JNSA 3GJQA 3ITNA 2XUZA 4TKZA 4BKOA 1ZCBA 4NBLA 1URPA 3F3KA 4MTCA 2OCAA 2W83A 2XCIA 1ECGA 3IIMA 5IN5A 2Q1UA 3IT0A 3BOSA 2ONYA 1FMTA 5HKLA 3WP1B 2DTXA 1FOEB 4L95C 2ZCJA 1RKBA 2FRXA 2YH2A 3E5RA 1FX1A 1QIJA 2PEZA 1XMPA 1BHJA 3K0FA 1OQAA 2VNHA 4D3XA 4UOZA 1V25A 1ZZGA 1H5NA 5EGSA 4DXAA 5DVZA 5LOVB 1YV9A 3OKPA 2H2WA 3QPAA 3O0DA 2H92A 2H11A 4TRNA 3BK7A 3EC1A 2HT1A 2CMDA 3EMKA 4O2LA 2N3ZA 3IUMA 1X7HA 3MTJA 2YWGA 2OXIA 3TLEA 4BNYA 3QWHA 3Q8WA 2V6JA 3C3EA 4G0OA 4IKPA 1ZJ5A 1XA3A 1NN5A 4G81A 3VU0A 4OBEA 3DBHB 5C8XA 3HBJA 4KBYA 1THTA 1B0UA 1QF9A 3EVTA 4YROA 1TM5E 1ZHHA 3W7BA 5IH7A 5JJBA 3H2IA 3QU4A 1Y4ZA 3BHNA 3M6IA 2FFAA 4PZAA 1IZ7A 4XUCA 9MHTA 4WDRA 2HF2A 3I12A 2E4YA 1FXWF 4M0PA 4B7UA 2XBMA 4E11A 1ISMA 3CMMA 3E05A 5DX8A 5FOXA 1F1BA 5AI9A 4Z7QB 1XTIA 4O4JA 3K2QA 1PSDA 3R3VA 2OCYC 5TJHA 1Q3HA 3E7XA 4W82A 1ILWA 1KAGA 5DH9A 3K0KA 3FUTA 2GUWA 1SD2A 4JOCA 1C50A 2PJZA 3WGOA 2AOUB 2J5XA 2Q1SA 3FRJA 3I9OA 1QGUB 3GJ4A 2A0KA 3OQ6A 4Q47A 3AC0A 1XDWA 2FR8A 2C7PA 3FYUB 4WW0A 1JTVA 2XUAA 4H77A 1CDOA 1WOYA 4ZZ2A 3BTUA 1M0WA 1Z3IX 2HF9A 2QUZA 3U4MA 1GCOA 1M8GA 3LLMA 3M70A 4K6GA 2LVBA 4BP1A 1I0IA 4C4ZA 5LR6A 3OETA 2QAGC 4MUXA 3GIDA 1H6BA 4HDMA 4R8VA 4OLFA 2A5YB 3VPDA 2X8AA 1VBFA 4PYRA 1RWBA 2D3WA 2WHEA 4CLXA 1LTQA 4WY2A 4W5RA 3REQA 3TEJA 3DZHA 3ICPA 1QVWA 4S12A 5C7IO 4W1SA 4WKGA 3BWMA 1L0BA 3UC5A 3QSYA 1Q7CA 4F3NA 4QTTB 4DR6B 3OFSA 3SMVA 2WIAA 3TQHA 4CKXA 3QVWA 1N6HA 2P1ZA 1A8SA 1PKEA 3IUBA 5AVJA 4OJNA 5JLAA 1W87A 1T3TA 4MCJA 1B74A 3R5FA 3A6PC 3ENQA 3B3GA 1EX6A 3S2YA 4LJLA 4RTNA 3DD5A 3FE2A 1BXGA 2CXTA 4JJ6A 4Z4HA 2NYUA 1OLXB 1NRWA 4HRXA 3E1GA 4FUQA 4MRPA 1CY7A 3R8FA 2NP7A 1T6ZA 1J2EA 1P4RA 4O2AF 3CLRC 3AT1A 1BH6A 4TKVA 4RV5A 1GFSA 2AF3C 1I7PA 1ANKA 2XUOA 4ILKA 3HXQA 1GCGA 1V41E 1WUKS 1KS2A 4MVCA 2WEKA 1DMSA 4RL6A 3OF5A 5IVDA 1O6ZA 2UKDA 2ZYUX 2YKGA 3DS8A 4GOXA 2IEZA 3BKXA 4S1NA 2GEFA 1IY1A 2PV0A 4HEA1 3TBKA 3EXIA 4CKBA 1QOZA 2QW0X 4D97A 4RVSA 1R9MA 1U2GC 8OHMA 2O2JA 4U00A 1XZNA 1JSLA 5C8DA 1PFVA 2I2BA 2B8WA 4LHSA 1W36C 5LQRA 5ECGC 5L6LB 4QJ5A 1UBOS 1X19A 1NRJB 1PFYA 1L5KA 3FCAA 3PFNA 4C2UA 1W8DA 3VHXB 5A6SB 3K5IA 4TKMA 1THMA 2JGLA 2NN3C 3IEXA 3CIOA 4FGWA 2R6CA 4U7FA 3ADBA 2CN1A 4XIGS 4EG3A 1Z45A 1T2AA 4KK3A 1XG5A 4BJ6A 5DV9A 1ESMA 3RV3A 1PUIA 4AJPA 3G0BA 5K01A 1QK3A 3IUNA 4IDNA 5EPUA 1JIXA 1G8KA 4EB0A 3QE9Y 2Q9UA 2MMCA 4C7OB 3JQPA 1XZQA 3ZWVA 2H2FA 4UNSA 1J20A 4HRVA 1T1SA 2G9RA 3WGJA 2HYDA 3CWQA 5TLSA 4G1EB 4NESA 4WNYA 3STYA 1GPMA 1RI3A 4LTNA 2FJUA 3C3PA 4R7GA 3OQ1A 5AI6A 4BNVA 1XRMA 3TW0A 1XHEA 3EISA 5C1OA 4E94A 1ORTA 1E63A 2PLRA 4LSMA 1HE5A 1KMCA 3RWOA 1P81A 3FWZA 3R7WB 2CDAA 4ZCMA 4YCLA 1JKIA 1U5AA 1ZM7A 1SELA 3CH7A 3FPGA 1MGOA 4JJKA 2C4UA 4ZI5A 3PF9A 3RUCA 1Z34A 3QX3A 3ONVA 4PG7A 1LC0A 2ILVA 2EU8A 2Y71A 4S24A 4CETA 2NZWA 2Z9DA 3Q6NA 4G85A 1W5BA 4MVXA 4XQ0A 4WEQA 5CXSA 2XMCA 4BAGA 4FFLA 4LVOA 2AWOA 1IZ0A 1HDIA 4FE3A 3HUFA 3GNTA 3M2TA 3PDUA 2ATEA 1I4OA 2GB4A 4GR4A 2VH1A 3RRJA 4ZGBA 3A6HA 5FD8A 2BKAA 1DAIA 4WMLA 4AMGA 2ORED 2BHSA 3Q10A 2D6FA 3EIOA 3ZV3A 5BWCA 1IM5A 3IAM1 1JR3A 2IPXA 1BQ3A 5HNKA 4EW1A 1IM2A 1K66A 3RGGA 4PC6A 2X0DA 2BVNA 4Z7NB 4FKBA 4ROTA 4QXAA 4JXXA 4L4YA 1GDTA 1SXHA 3UXMA 3LO5A 3WK4A 1EFRA 3HY4A 3GELA 1TADA 4JITA 4MB6A 2CXOA 3IKLA 1EA5A 1KY3A 1NA5A 1W5EA 2IUSA 2Z56A 2K2QB 3GFGA 2QJTA 2EP5A 3OD1A 5FI0B 2AJ8A 3SXPA 3V34A 1KEEA 3H5RA 4B3GA 1TLTA 3C6XA 4TS4A 4BX9A 1ORRA 3WDKA 3CM0A 4FPXA 5EMKA 3N2LA 4TYNA 1UBJS 3OY2A 5AKYA 2WWWA 4O4IF 2WIFA 4LJRA 1QV9A 5BV2P 4FR5A 5C0OE 1VMKA 3GROA 3GFBA 2R5NA 4YCCA 2GS9A 3PD1A 2X8BA 5AI0A 3S4YA 2JJMA 1N8SA 4ERXA 3DKKA 3IJ5A 1FK8A 1Z16A 3D3NA 2WWHA 4UOQA 1A9SA 4CR7A 3FPKA 1R16A 2VT2A 1L8XA 1JPNA 3ZE6A 2AV6A 3U17A 4B9EA 5IU6A 4OHCA 4H7HA 3P1JA 4KMOA 1EWTA 1UM9A 2ZI9A 4LEIA 1NXVA 4KRXA 1W1WA 3IHWA 1WB4A 2HXYA 4RQAA 1Y37A 1V9LA 2GLTA 4X1YA 4JLJA 4KO2S 1G3MA 4A0GA 1U3UA 1LGYA 3D2CA 3NP7A 1K4KA 3DR5A 1K97A 3OOSA 4H59A 1DWPA 5J9FA 5A5EA 2EX4A 5E6UB 1S8FA 2A35A 4Y9SA 3V1YA 1VYUA 3PYLA 3VR5H 5LZ4A 1KAOA 1TJPB 5ADUS 3CG4A 1QYXA 2B8JA 4ZIRB 1UP4A 4GECA 1GYQA 3O7MA 4QDTA 1K7YA 3CBGA 1DNPA 2XDWA 4Y1EA 3NMUF 1MW9X 1NMYA 4C0XA 3K6SA 1I7SB 3BF8A 1U94A 4DQVA 2QZZA 4PXYA 1GUYA 1UCFA 4XDYA 3GCGA 2DKFA 2PU7A 3A06A 1FYEA 1ENYA 4ZQEA 4C7KA 3IQDB 3OZVA 4JBNA 3FVQA 2JD1A 1YHZA 1LDBA 4NBSA 5DRTA 4ZCLA 2DJ5A 3RVNA 3X3HA 4DAOA 1SBYA 5K0BA 2VPZA 3B82A 1XMQB 1TYEB 5CNMA 5A05A 3PIRA 4OXQA 1FBNA 3E35A 3A1SA 1EBBA 4J16C 1YOVB 1DCFA 4MYTA 5DK4A 2AE2A 4RJ2A 5DTMA 7REQA 1FXUA 1KWGA 4Z9FA 1T8WA 2A1TS 5TVKA 3BA6A 4G4SO 5HKKA 1XZJA 5IJ0A 1IEQA 1UK9A 3I6MA 3K2BA 4IHAA 4H4CA 5E4JA 3DDCA 2O7NA 4HFRA 5J2UF 4IZHA 4KE7A 4EENA 5JHHB 1NBME 2WFLB 2FN8A 4K9NA 1T1EA 4DB2A 3P8ZA 3U6BA 3BFVA 5LZ9A 3QOXA 3ZE7A 1RM0A 2OBYA 4XIIA 4J0IA 3ERCA 1A7UA 4EEXA 2JAHA 3CW8X 3SNKA 1H2YA 2AL7A 3H11B 4HYEA 1IUKA 1OFHA 1SVWA 2IYVA 2RHLA 2A9OA 3FSEA 4JT9A 4RH3A 4DQXA 1LB1B 2ZRJA 1WUJS 1YZLA 3ORQA 3EFOB 1V43A 1PJCA 2QSJA 2XOEA 1AD2A 4XWWA 1HA3A 2O0KA 1O4WA 2K7ZA 3HO8A 2XMQA 3USZA 3N7AA 1KETA 4B40A 4KQXA 3R7FA 1RAIA 3HCDA 5JQGF 3S2SA 2BSXA 4INPA 4GZLA 3ICQB 4QXQA 2RGEA 4IDQA 4LMBA 1Z63A 2NVBA 1P1FA 3TRJA 4A8JA 4R8MA 1LLQA 3VMFA 3QX7A 4B73A 3Q5GA 2WU4A 4MEAA 1ZJYA 2MYPA 1OPRA 2Q3LA 3SQWA 2APJA 3ETHA 4AUEA 3Q8LA 1J97A 1O8CA 2WAMA 1BWPA 3R41A 3R9XA 3M4XA 4I1SA 1MZVA 1Y5RA 1LX6A 2PX3A 3KXIA 2I2DA 3FTPA 5JSZB 1IZ8A 3DXYA 3SZLA 4OHOA 2YFHA 2AJBA 2FQYA 2IU6A 4IJVA 3VDMA 4D4HA 3BUSA 1LRJA 4UDXX 1Z9BA 3BX1A 4WBNA 2XV1A 1T9HA 2O5VA 3KT8A 3NNDA 3C98A 4KPUA 1A96A 2P8JA 4OHFA 1VE6A 4YRJA 3FNEA 4L0CA 2JLWA 5JLJA 3AX6A 2DHQA 4I5DA 3ZEIA 1GCIA 4R2HA 4FLMA 4DVGA 1FDVA 2CCKA 1F1JA 3ZWQA 5DWQA 3MXTA 4JD5A 1NVUQ 5JJIA 2RH8A 2X42A 5A03A 3I64A 4KWHA 4BNGA 4IIJB 3EA4A 1XVIA 3OVMA 4RENA 5GONB 3VH3A 4HNSA 4AJ9A 2WHPA 3M8KA 1Z0KA 3OECA 4RTOA 1KF0A 1U9ZA 3A7DA 5J23A 3NBAA 1TYBE 2WWYA 1LEHA 1G64A 1Z73A 4AJ1A 3RS7A 4RUKA 3NCTA 3WHKA 1N9GB 5K0SA 1BVHA 1GITA 4GSLA 1Z35A 1BE8A 5G0UA 3BG5A 1HDYA 1OXUA 2PZEA 2FMUA 5FKJA 4TN1A 3MFYA 5M5BA 1UMBB 4URUR 1DUSA 3IE0A 3MTGA 2D7JA 3OLCX 1AKTA 2G5TA 4Z0TA 2XNKA 2AUTA 2C3MA 2V8OA 1EQUA 3LL4A 1QLWA 3AVOA 5L8VA 1SKYB 3N1UA 3P26A 5ALJA 3WXBA 1B8OA 4V3BA 4QU9A 1XMIA 1LF0A 1OTHA 3GGPA 4WEOA 5H1YA 2PS1A 3RSLA 1CUBA 3RIHA 3LVQE 1R0CA 3Q7EA 2EHDA 5A4FS 1CEEA 4Q1EA 2OYSA 2ZRAA 1A9TA 4DV1B 2AZMA 3FMPB 2ZUDA 3FWKA 4P4GA 2FF5A 3RTDA 2PSHA 2XTJA 3NBUA 1ZC4A 2C4HA 1CJTC 5E7IA 2QVLA 2ATIA 5I7OA 4FR0A 1YCDA 4F9GA 1KFCB 2Q6TA 3G9TA 4O2BF 5FNVF 5ALTA 4LJ6A 5HCUA 5ILGA 3CN7A 1PZEA 4QVGA 4F2DA 4V2IA 1RMTA 3MCTA 5CA0F 4MVJE 2QDXA 3KSZO 2IOHA 2C95A 4TX1A 2JJ1D 3EDCA 2A9QA 3EHEA 2X0FA 3WHLA 4CM9A 4YUYA 1U2DC 4I1YA 4KFUA 1U5CA 1QE3A 1P29A 1X80A 2O3SA 3EGCA 1E5QA 4Q1VA 2G40A 3RFUA 3WLJA 4KIUA 1YZ3A 2CD9A 2Q2OA 1KH1A 1HTBA 3FAZA 1ZVVA 3RASA 3AOGA 4AL4A 1E9AA 2P9CA 4BO3A 2I33A 3LY8A 1G19A 1G5IA 2KYRA 1VMIA 2ZTUA 3IEIA 2CEAA