2CDAA

Sulfolobus solfataricus glucose dehydrogenase 1 in complex with nadp
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
366
structure length
360
Chain Sequence
b'MKAIIVKPPNAGVQVKDVDEKKLDSYGKIKIRTIYNGICGTDREIVNGKLKGKDFLVLGHEAIGVVEESYHGFSQGDLVMPVNRRGCGICRNCLVGRPDFCETGEFGEAGIHKMDGFMREWWYDDPKYLVKIPKSIEDIGILAQPLADIEKSIEEILEVQKRVPVWTCDDGTLNCRKVLVVGTGPIGVLFTLLFRTYGLEVWMANRREPTEVEQTVIEETKTNYYNSSNGYDKLKDSVGKFDVIIDATGADVNILGNVIPLLGRNGVLGLFGFSTSGSVPLDYKTLQEIVHTNKTIIGLVNGQKPHFQQAVVHLASWKTLYPKAAKMLITKTVSINDEKELLKVLREKEHGEIKIRILWE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUCOSE DEHYDROGENASE
publication title The Structural Basis of Substrate Promiscuity in Glucose Dehydrogenase from the Hyperthermophilic Archaeon Sulfolobus Solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Oxidoreductase
total genus 122
structure length 360
sequence length 366
chains with identical sequence B
ec nomenclature ec 1.1.1.120: Galactose 1-dehydrogenase (NADP(+)).
pdb deposition date 2006-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
A PF16912 Glu_dehyd_C Glucose dehydrogenase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2cdaA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2cdaA01
1XG5A 4HY3A 5CEEA 5K9ZA 3TZKA 4LCEA 3TFQA 4AJ2A 2EGHA 4LVCA 3QQPA 2P9EA 3UCEA 1X14A 1ZIDA 2B5WA 5T6BA 1CQIA 3GK3A 5ENDA 4OYRA 5THQA 2FHSA 1TEHA 1EVIA 3QVXA 3SJ7A 3JYLA 4EZBA 1HZJA 1AGNA 3AFNA 3T4XA 4CLOB 1NTOA 4DBZA 4GMGA 1F14A 1K5HA 5EQDA 1N1EA 2FPIA 5KVSA 1KVSA 4W6ZA 5KKAA 3W8DA 1NPYA 1I24A 2I99A 4Z0TA 2PD3A 4U7WA 4FB5A 1MGOA 1E3WB 1R4NA 3OBBA 4CM1A 2VTEA 2G76A 2UV8A 1LRKA 3FPLA 1PGPA 2AEMA 2PZJA 3GG2A 3FNHA 1HE2A 1PR9A 4L4SA 1ONOA 5TT0A 3V8BA 3KYDB 4DL9A 3QWIA 2JCVA 1DEHA 3QHAA 3MEQA 1U2GA 4I8XA 3PRJA 1DRUA 3LSYA 4PLPA 5TX7A 2DLDA 1W73A 3F1KA 2FY8A 2RBEA 3NTOA 3TF5A 1XQ6A 1AE1A 4R54A 3IUPA 5F5NA 1KEWA 2B35A 2JCYA 2RHCA 4UEJA 4WJZA 5DCYA 3HZZA 4L8VA 5GZ1A 3D4PA 4BKQA 2E49A 4BNIA 3NT4A 1BTOA 8ADHA 1EFLA 4WCFB 4E3ZA 2DBQA 4LK3A 5I9NA 3HJAA 4BGEA 4X54A 3ZDFA 2BELA 3HB4X 4RLSA 4YVFA 1GEEA 3P5SA 4WOKA 3ONDA 1JWBB 1YRLA 3O4RA 3E82A 4HX5A 1XSEA 2EXXA 2I5PO 2Y66A 2A92A 5EPOA 2HUNA 3JSAA 1E7SA 4UUPA 5DOVA 5C7IO 4P4GA 1E6WA 4UUNA 1R4MB 2EERA 1J4AA 2VRBA 2GN9A 3GRKA 2CVZA 1PGQA 3AOGA 1XQ1A 3UKOA 4F6LA 2W98A 4R3NA 5KJEA 3ICPA 3BHMA 4UEKA 4IIVA 3UAGA 3JQAB 4I5GA 3BA1A 4IZHA 3H9UA 4Z3KA 3SBOA 1UAGA 3MJSA 1VL0A 2H9IA 2OGUA 4XRGA 2J8ZA 1Z74A 2OO5A 3LT1A 1U3TA 2Y1OA 2YDYA 4GGPA 4J1SA 1P74A 3JQ7B 3WGTA 3ZGYA 1OFGA 2C7VA 3DOCA 4PVCA 3H65A 4RVHA 2TMGA 3M6IA 1LDMA 1DIBA 3B20A 1U5CA 3EUWA 4JJGA 4YRAA 5A05A 1H0KA 4E30A 2OMEA 5JCXA 1JA9A 2BKAA 1W0CA 5JSFA 5DBIA 5DBGA 1Q7GA 5JO9A 1LJ8A 3NJ8A 4RVUA 5JO0A 3ZV6A 3RWBA 4CJXA 5JDIA 4IJWA 5CAEA 2LDBA 2NQTA 5A1TA 4RF5A 1N9GB 3JYOA 3PPIA 4FQ8A 2X5OA 5G4LA 5ILOA 2H1SA 2J3JA 4K26A 2E4AA 5DZSA 3WIEA 3CZRA 3IKTA 3INGA 3W6UA 3OMLA 1MV8A 3K92A 1PU2A 2YY7A 3DHEA 3UFXA 1BW9A 4D3DA 2AG5A 2OL4A 2WYVA 4DLBA 1EE9A 5B1YA 5KIAA 1G0NA 4W99A 5L4NA 4CM4A 3RKUA 1LLUA 4BNXA 1M2WA 1UH5A 2WSBA 1E1LA 2B4RO 3DOOA 3FRJA 3ZNQA 2ZYDA 1YJQA 2PGJA 3O8QB 1LLQA 3VDQA 1N5DA 5CG1A 4J4HA 1C1DA 3AK4A 2BFMA 3I83A 4DVJA 3GF4A 4RJTA 3FNEA 3QVWA 3WMXA 3MJCA 4ND2A 1C0LA 2WD8A 5CPFA 1PX0A 2GPTA 5JY6A 4D42A 3AUSA 3K2BA 3AI2A 3DWFA 4BNYA 1ZVMA 2POQX 3TSCA 4W7IA 2YV2A 4DIOA 5DP2A 2JFHA 4Q9NA 3RBVA 4IZIA 4AVYA 1KC3A 3OJLA 1EFKA 1H2HA 1EDZA 4R5MA 1DB3A 3DHYA 4CMEA 1GU7A 3PLRA 1KETA 4ND3A 2EJVA 3DAGA 4NQZA 5JXWA 1M6WA 1Q7BA 1HDCA 1MC4A 3MJTA 4NK5A 5TQVA 3WLEA 4YJHB 1LC3A 2NACA 2Y1GA 1E7WA 3VVCA 3LDHA 4MVJH 4D3FA 2YHUA 2QIOA 2IXAA 1R0LA 5KVVA 3RIHA 4L73A 4BNLA 2PKQO 2BFAA 3TQHA 4RF2A 3WMWA 2O7QA 3F4LA 2ZKLA 3T4EA 4WE3A 3N7UA 3ADPA 4IQGA 1LNQA 4FBGA 3DTYA 4UVEA 5DT9A 1G6KA 3NDRA 4CQLA 1VLLA 1YDWA 3MOGA 2HJSA 2FR8A 4E33A 4B7CA 2E6UX 1H94A 4R3WA 5BR7A 1AN9A 4UEOA 4BNHA 4FFOA 3D7LA 2C82A 2ZB4A 3ZH2A 1N7HA 3OICA 1YVEI 1PL8A 5A9RA 4R9RA 2YV1A 3LZ6A 2GNAA 3WTBA 2I6TA 5DULA 4LSWA 1I01A 4DMMA 2RIRA 4QECA 3AOEC 2Y1EA 1E3EA 3NJ4A 2O7SA 1LTHR 2J3IA 3LF2A 3MOIA 3RJ5A 1A7AA 4WGGA 1LU9A 4GKBA 4YA6A 1U28A 2FP4A 1HSOA 4YRBA 1QV7A 1YWGO 1O8CA 4RPJA 4WUVA 1YL7A 5DP1A 2YQ4A 4IBOA 3TL2A 3ZWCA 3HE3A 5I9LA 3RUIA 1W8DA 1R16A 1PQWA 4RPKA 3AW9A 1GQYA 3WDSA 3GRPA 3I9NA 4TRJA 5L45A 2IEDA 2OHXA 4RQUA 4D44A 1IE3A 1CYDA 4D0SA 2FRDA 4I5FA 1B0AA 2WYUA 3D3WA 5T67A 4B4OA 3H2ZA 1I8TA 4J9UE 4KDEA 1DJQA 3HSKA 1ENYA 4UVGA 1PGJA 1PZGA 1YQDA 2JD2A 2OBNA 3KOUA 1YQXA 4OO3A 1EBFA 3OIGA 4PLFA 1X7DA 4ZRMA 1GV1A 1QORA 2NVUA 4FC7A 3DZFA 2HU2A 4JIGA 5FEUA 4BO9A 5ENVA 1T2EA 2OP1A 2CDCA 4D7AA 3ETGA 3UHAA 2FR1A 4B8WA 4QO8A 4XJSA 4K6FA 4RGBA 3VPSA 3DBHA 4QFDA 4MVJD 4BNNA 1QYWA 4XEHA 4YYZA 3AM5A 3OFSA 3QY9A 4NIMA 3SC6A 2W2KB 5CDSA 3WIDA 4ZQEA 2EGGA 4DC1A 1EDOA 2A4KA 2QZ9A 4AL4A 1D7OA 1EMDA 4BUCA 4KQXA 2ZIZA 4UUMA 5F1OA 5JAZA 5MGBA 3AY6A 4GVXA 2A35A 2P5YA 4BO8A 3OQ6A 1ZCJA 2WE7A 4EITA 1T2FA 1ENOA 4NFYA 4NI5A 4PG4A 3K96A 4GGOA 4XB1A 3WWZA 1KYQA 1Z7EA 4BKRA 1NR7A 1MA0A 3A1NA 1K0UA 2WJPA 4FN4A 1A71A 2I67A 1VM6A 5LDGA 1PR3A 1C1XA 5AXBA 3D1LA 2YV3A 4CM8B 3ZWAA 1F0YA 2P91A 4PIVA 7ADHA 4R1NA 4R5HA 4Q3CA 3B70A 1P45A 2NTVA 2Q50A 1YBVA 2ZYAA 3CMMA 3GMSA 5THKA 4I5DA 3JQ8A 3RC2A 3UCFA 4LVUA 3ZHYA 3NT2A 3MZ0A 4Y67A 1EE2A 2GLXA 3JV7A 2ZB7A 1SEPA 4ILKA 1WDLA 2VYND 4NZ9A 1A27A 1T1RA 1KOLA 1QYXA 1DPGA 1T1SA 4Q3DA 5G4KB 5K0ZA 2J3HA 3D5QA 3N58A 2JAHA 1E1MA 3C85A 1P44A 3FNGA 4MJLA 4NPCA 4CMHA 4WLNA 5ADHA 4C7JA 1HEUA 2HK7A 4M89A 4AJLA 3GVCA 4FSHA 3KZVA 5L9AA 1YBMA 3ENNA 4CR7A 3E9NA 2O3JA 5I7VA 3PP8A 1SAYA 2WD7A 4C7KA 1OI7A 5C7OO 3VZSA 4LRSB 5FI5A 5L4SA 4BGUA 3CSDA 3R1IA 1A4UA 2X23A 1WWKA 2GO1A 4TRNA 3I9MA 3ST7A 1NQAO 3BMCB 5BNFA 1PL6A 1DFGA 1VL6A 1WAMA 3DZJA 1JU9A 3GH3A 2PFGA 3EY4A 3ANLA 3PZRA 5JAIA 1KBZA 2Q49A 4GSLA 4OM8A 3L77A 3NEPX 3RSHA 3RUHA 3HG7A 1A9YA 1X0VA 1SBYA 2AEFA 1U8FO 2YDXA 4OQYA 5JMWA 2DT5A 1ZUD1 1NAHA 1JKJA 1T24A 3JQBC 3VTFA 4E2XA 1JTVA 4OHUA 1U3VA 3D5TA 4YAGA 4OSPA 4B4VA 2ZTLA 4DIBA 1D8AA 2DBVO 1V8BA 3PYMA 4FJ1A 3UF0A 3WB9A 4Z0PA 4WCDA 2Y93A 4DGSA 1RJWA 2OFPA 1S6YA 4CLEA 1J5PA 1LC0A 4RZIA 3U0BA 3D64A 1YONA 1Q0LA 1YGYA 3GT0A 4JBHA 1YDEA 1BMDA 1A5ZA 3WLFA 1VPDA 5H81A 3AFMA 1YO6A 3PJGA 1CWUA 3S2FA 1BVUA 4WNIA 2W8ZA 2DM6A 2ZB3A 3KETA 5CPBA 5A3JA 1NYTA 5I8ZA 4KQWA 3Q3CA 1VKNA 3ZV4A 3X2FA 1HE3A 4DRYA 2CD9A 2VUSA 5IN5A 1JAXA 3R3SA 3RC7A 3BMOB 3GG9A 4E2WA 3U3XA 3TOZA 1TB4A 5JE8A 5B4VA 1T2CA 5G0VA 1ZEMA 3G79A 3I9LA 4E5NA 3NUGA 1AXEA 1Y5RA 1ADGA 4P38A 1JAYA 3RU9A 5CDGA 5KJ6A 2EKPA 3U9LA 2W90A 4W4TA 3JQFC 3OEYA 4FCCA 3PQFA 3QWHA 4WOJA 3Q9UA 4FIZA 4WK6A 4RVFA 4EJMA 4YQZA 3W6ZA 1PWZA 3KYBA 3HN7A 4GI2A 3KEOA 4ZQGA 3ZV5A 4YJFA 1RM4A 5F21A 5HS6A 3WWYA 1A7KA 4BO4A 1EBUA 1CRWG 4PLTA 1FDWA 4GX5A 1NPTO 3NGLA 3Q1LA 1NQ5A 4F3YA 2J6IA 3I9JA 4DREA 1V3VA 3DBVO 3ZV3A 8LDHA 2DTDA 1I2ZA 4ONEA 1M75A 1T26A 2I65A 4RF4A 4PRLA 5MDHA 2PR2A 5T8KC 1ZBQA 3D4OA 3JQCA 1TVEA 4AJPA 1WZIA 3AU9A 4BNFA 1PS9A 3DBRA 4YXFA 2Y1DA 1JVBA 4CMGA 1I30A 1GUFA 1CERA 5A06A 1HZZA 4CPDA 3O26A 4BNMA 2G82A 5AXDA 3EMKA 3OJOA 3A4VA 1IHYA 1ZSVA 4Y8VA 3IMFA 2OZPA 2P4HX 4B7XA 4BGIA 2DFDA 4RVGA 2B0JA 3QWAA 3PVZA 1E3IA 3PLNA 2NV6A 2NM0A 1TT5A 1VJ0A 4H7PA 4KDFA 4DLLA 1SB9A 1U9JA 2B36A 3K9QO 4P8RA 4YQYA 3EZYA 4MKZA 3BMQB 4M55A 4XB2A 4B8ZA 2CDAA 4XD2A 4N54A 1O9BA 2NLOA 3TZCA 4MOWA 2CSUA 2AHRA 1I36A 3GA0A 1B16A 1BHSA 4R69A 1E3LA 1XR3A 2W2LD 2BFOA 3PWSA 1IZ9A 1LSJA 3EAGA 4IGEA 5TS3A 1J0XO 1U8XX 1Q2XA 4GX0A 3OH8A 3DBLB 4NFSA 1OMOA 4UVHA 3GY0A 1QKIA 4JCOA 1ZEJA 2HMUA 3S55A 2HKIA 2Y99A 2ZK7A 1WW8A 4NDNE 4DLAA 3ORFA 3ASVA 3DMYA 5FYDA 1R0KA 1NXQA 2Y0DA 3KSDO 3PHIA 3VHRA 1K2WA 3RJ9A 1HDGO 3LT4A 3OQBA 2OUIA 1Q7CA 4J90A 2O3UA 1TLTA 1FXSA 1E77A 1FMCA 1GCOA 4CMJA 2D59A 1BDMA 4PRKA 1DO8A 2O3RA 4J2HA 2PH5A 4XKJA 2IE0A 4ZJUA 4DTIA 3BMNB 4URFA 4XYLA 4WLVA 1D1TA 2HK8A 1DLIA 4IUYA 1O89A 5TLSA 1I2BA 1JW9B 3PXXA 2BHLA 2VUUA 3F47A 4DUPA 1ADBA 4R4JA 2QQ5A 4IDCA 2BI7A 1P0FA 4Y98A 4JN6B 3TRIA 4U0KA 3G17A 3KYCB 3ZW9A 4B7UA 1E5LA 3NKLA 4FFRA 4XQEA 4O0LA 2YQ5A 4EI2A 1HRDA 1HDXA 3IDSA 2B69A 3PQEA 4FC6A 3CPSA 3PJFA 1GAEO 5JFOA 3K31A 4CMAA 2CUKA 1LSUA 1Q1NA 5BNTA 2IZ1A 4K1LA 4YJGA 5CDYA 3PYXA 2WYWA 5T8KA 1BGVA 4MVJI 2RAFA 4IDAA 3F1LA 1NFRA 5KNLA 4I9HA 4B3JA 2CF6A 1Y6JA 3H3JA 1J6UA 4MINA 3S1LA 1PWXA 4CLRB 1A9ZA 1DC6A 3E5MA 3WJ7A 5JDIC 4CQMD 2QW8A 4PCVA 1M66A 2PKQP 2TMDA 4FW8A 2FR0A 2GSDA 2JJYA 3H9GA 2F1KA 2VTDA 3ROQA 2VHVA 2NU8A 3ZN2A 1X0XA 5C3MA 5JYEA 1PJ4A 3KSUA 4RVSA 3I5MA 3IL2A 4OAQA 1WMAA 1Y8RB 3FF4A 5L51A 3ITKA 2UUPA 1ZK2A 3H9JA 2ZYGA 4RPHA 2Q3EA 3ROMA 1U3UA 2R00A 3ABIA 4BS9A 2HMVA 5G0WA 3UVEA 4CL8A 3DO5A 3C7CB 2HK9A 3GHHA 1NASA 1ZK4A 4ZA2A 4B4UA 3COSA 1O0SA 4PLCA 3STHA 4PG8A 3RUEA 2VWGA 4BQRA 4BNJA 1HDRA 3NTQA 5DBFA 1MB4A 1OAAA 5ES3A 4HP8A 4IY1A 1UZLA 4J4BA 3SX2A 2I3AA 3BYZA 1LQTA 1W4ZA 1R66A 1MX3A 1P3DA 1QYCA 3NDIA 4CMEC 4D41A 3WYEA 4CMKA 5HA5A 3AUTA 2X58A 3V1UA 1O6ZA 1B8UA 1RYDA 1GZ3A 2RHRA 4LMPA 1AXGA 4IDFA 3H5AA 3PYLA 3OA2A 4ITUA 4PLZA 3ONEA 4N5LA 1QXSA 1ISGA 4FGSA 2NTNA 1ADFA 3P7MA 4E2YA 2JD0A 4BKPA 2CDBA 3V2GA 1ADCA 2DUUA 4MVJM 3OEWA 4I9NA 1KC1A 3PJEA 4TMFA 3WTCA 4F45A 1HDOA 1NQTA 5BNIA 5BSHA 4J6FA 3D4NA 1JDJA 3VKVA 4IDEA 2QHXA 3E03A 4TZKA 5COQA 4BL5A 4MIOA 2C20A 2IZZA 5L7YA 2YYYA 1B8VA 1H6AA 1R4NB 3FN4A 4PLVA 1VE9A 4GWKA 1F17A 2VT2A 3EVNA 1PJ3A 3PJDA 5CDUA 5JBIA 1U1IA 3HUDA 1PGOA 2O3SA 3B1FA 4CMIA 1E0DA 4FS3A 5CFZA 4DWVA 4CM9A 3VPGA 5IAAA 4BO7A 1CDOA 3JQ6A 6ADHA 3M2TA 1PQPA 3NGXA 4NMHA 1MLDA 3L9WA 5GMOA 4J16A 1NAIA 3OJ0A 3PQDA 4LN1A 4RF3A 2PGDA 3HDJA 5H83A 4B4WA 1R0SA 2H63A 1DLJA 1T2AA 3S8MA 1C0KA 2ZCUA 4WLOA 3L6EA 2QZZA 1XYGA 1PJ2A 4UULA 1TI7A 5I7SA 2E48A 3GMDA 4II3A 3KBOA 1GZ4A 1CJCA 2GZ2A 3OQ1A 4LISA 4NJMA 3LT2A 4R9SA 2Q2WA 5DF1A 2FSVA 4TVBA 1ZXBA 3HDHA 3GEMA 3PK0A 4OKNA 2X5KO 4B3IA 3W4IA 4PFJA 1GR0A 5IXYA 3TFOA 1OOEA 1Z73A 1UXIA 4LGVA 1DIHA 3HFSA 1CEQA 1GUYA 5F3RA 2O2YA 2D2IA 2GN6A 3P2OA 4FOSA 3UH1A 1P1IA 5LDHA 3BIOA 4WEQA 3VH3A 5G0SA 2OOSA 3PGXA 1LBEA 2UYYA 5A03A 4ALLA 2GN8A 1DHRA 1P0CA 4DA9A 2CVQA 2R2GA 1H6CA 1XKQA 1YBAA 4W9NC 3I9KA 3E9QA 1E6EA 4CM6A 1LUAA 2VQ3A 4XA8A 5LCXA 5TJ9A 4XYEA 4AJ4A 2VWQA 3UCXA 5BQFA 3WGGA 3RUAA 1DC3A 3C1TA 4WLFA 4UAGA 4CV2A 3WSVA 3UN1A 4OIMA 4PG5A 3VPFA 3OSUA 5KJCA 2J3KA 1LA2A 3WQQA 2D3TA 2EHDA 1IPEA 1BW9B 3CINA 3FD8A 1XGKA 1I0ZA 3NAQA 3TOXA 4ZQFA 4DYDA 4CM4B 4Z0HO 1UUFA 1PJCA 3E6AA 2V6BA 4JQCA 1NFQA 3RQSA 4U5QA 5AYVA 4CLHA 1GPJA 3I52A 4J0EA 4W82A 2BGMA 2NU9A 4PLYA 4CQMA 2GASA 1IHXA 3QJ5A 4Y6PA 1C1DB 4J1TA 4CV1A 3P2YA 3KHUA 4MVJP 3ZWWA 3AM3A 3H5RA 3G1TA 2PK3A 3OHSX 4UREA 3TL3A 3T7CA 3I4FA 5T5QA 2Y67A 3VVBA 2I66A 4IM7A 3ZWXA 3DEYX 4IMPA 1MXHA 5IDYA 1YJ8A 3LK7A 2PZLA 4AJJA 1NWCA 3H6KA 5U9CA 2AE1A 4CM3A 1WXDA 2EKLA 3GAFA 4H16A 1BSVA 1LRLA 5JDCC 3ZHXA 2C5EA 2O3TA 4U6QA 4DQXA 2X86A 1OC2A 1HYGA 5F5LA 4BMNA 4BOYA 1VKOA 3HNPA 3RU7A 2FN7A 3JQGA 1U7HA 2VZ8A 3I23A 4RV9A 1N1GA 2X5JO 3F4BA 1N8KA 3NTRA 1ZH8A 4MVJE 2BMAA 3RKRA 2P9CA 5IN4A 4R1UA 1FF9A 2WMDA 3BHJA 2C54A 2GD1O 2GRAA 5TC4A 2ZTVA 5IF3A 4O63O 2PH3A 3VZPA 5IZCC 2HMSA 1PJSA 1XA0A 1Y7TA 4OKIA 4U0JA 2NVWA 5CHEA 3EW7A 3H9EO 3U4HA 4FJ0A 4WKGA 2EIHA 4CQLB 5C5IA 1IYZA 1NNUA 2VN8A 4PLHA 4XIJA 1X7GA 3ETDA 1PL7A 2QRKA 3OP4A 4NBTA 2GN4A 5J23A 4J49A 3SXPA 3ZNNA 2X9GA 1EEHA 4NBRA 4ND5A 3KXDA 1DIGA 2YFQA 1E1NA 3GDGA 1IULA 1KVRA 4R41A 4ALJA 5JS6A 4WECA 1ZJYA 3EVTA 3WGQA 1O94A 1KS9A 1B15A 4MP8A 5DNAA 4WPGA 1P33A 3IOYA 1DAOA 3W1VA 1N92A 1GDHA 5L53A 4JBIA 1RKXA 2CF5A 3LC1O 4NNJA 2P2SA 1BXGA 5JAQA 4KTVE 2WTBA 5JC8A 3JD3A 3M1AA 3WFIA 4KOAA 3UXYA 2VHZA 1BG6A 1T2DA 4W9NA 3D3EA 4XX0A 4XDYA 1SCUA 1C0PA 4DYVA 4IIUA 4G81A 2FOIA 3GUYA 2V65A 3D3WB 1UDCA 5U4QA 4ROSA 4R1TA 2W4QA 4BKUA 2DPHA 4GSKA 3U09A 3WYCA 1E6UA 3GZNA 3MJVA 3EGOA 4CV3A 3FNFA 3L07A 3ZWBA 2EWMA 4JX8A 1YOVA 2GZ3A 1VC2A 2HQ1A 3GFBA 2NVUB 2YZ7A 3GHYA 1VJTA 2DBRA 3LT0A 4P4NA 4OH1A 4GQAA 3PEFA 3DOJA 7MDHA 3MTJA 2X0JA 1FJHA 3DBHB 5JCJD 3M1LA 5TJHA 3KO8A 4BIIA 1H6BA 3OETA 1V9LA 3VTZA 3PTZA 5ILGA 1FDVA 3UUWA 3CZMA 4YBZA 1NP3A 1KVUA 1HL3A 5B37A 4F6CA 4WASA 2JHGA 3H4VA 5G2OA 3PHGA 3MJ4A 3R3JA 4JROA 4GX1A 1YE3A 1UZMA 4EDFA 1V3TA 2DTEA 1P1KA 2O3QA 2VWPA 4BB6A 4OOEA 4XQGA 4TWRA 4MDHA 1WZEA 2BLLA 3RROA 3RVDA 2UUOA 1MFPA 1XELA 4RQTA 1ISMA 3EC7A 4B79A 3ON5A 5JDCA 3G49A 3GR6A 3W8FA 3GLQA 1IY8A 1C1XB 4TQGA 1C14A 4AJNA 4CL3A 1YL5A 2JAPA 1YQGA 4YJDA 2B37A 3DAPA 2C07A 4PZCA 5A9SA 4BO3A 5G0UA 2CVOA 1E92A 4XIYA 2EW2A 4TVOA 4WLUA 5FWNA 2O2SA 1H9BA 1HYEA 3FR7A 5HWSA 5KJFA 3EYWA 3RI3A 3ZWPA 3JQ8B 1SB8A 1PZEA 3C1AA 5IZCA 2ZTUA 3AI1A 4EW6A 4H3VA 1PS0A 2HLPA 1DFIA 4J1QA 5ER9A 2PA3A 5L7TA 1GADO 5KCZA 5JYDA 4XQCA 1MUUA 1Z75A 2O23A 3FCOA 5GZ3A 2AW5A 3F5QA 2GF2A 4A5OA 1GEGA 1YXMA 3E9MA 4CLXA 4F46A 3BTSA 1H6DA 3VZRA 4L4RA 3AI3A 4GPD1 4WLEA 3HFGA 1F8GA 2WD7B 4IMRA 1F12A 2X22A 5GZ6A 5BT9A 3PGJA 2B4TO 3PHLA 1UXGA 4XZ3A 1X1TA 2Y0CA 4P22A 3WG9A 4EGFA 2C2YA 4KZPA 1LSSA 3WQSB 3P19A 1ZZEA 5HBRA 1LQUA 1Q0HA 4D0RA 4JP3A 3ZW8A 3OIFA 3I4CA 4IJVA 1QG6A 1QYVA 4MPDA 2C7GA 3Q0EA 4MIEA 3ZU3A 4EUEA 3U5TA 3VAZA 1JQBA 5COBA 3HQ4O 2Y05A 3RCBA 2OP0A 2UAGA 3DXFA 2Q1SA 1X13A 4OL9A 1UDBA 2NWQA 4FD3A 3KEQA 5EJ2A 2C29D 5TT1A 1BRMA 3Q2IA 5T57A 4ZU3A 3KV3O 5FF9A 4NK4A 1PJBA 2C2XA 3KB6A 4E12A 1HDYA 3EK2A 1KVTA 2HCTA 2HDHA 1LDEA 5LC1A 1KERA 5ER6A 1K6XA 1NR1A 1R12A 2PY6A 3BHIA 3AY7A 1O95A 1FK8A 3E5RA 5BSGA 3MCVA 4A7PA 4E5PA 5JC1A 1DXYA 4OGWA 2PNFA 1PJTA 4M86A 4JP2A 4Q3AA 1QSGA 4RVDA 1GQQA 3LYLA 1M6HA 1DRWA 3Q11A 2G17A 1B3BA 4INAA 1Y8QA 2AQKA 4MO2A 2YHIA 4OJNA 2RH4A 1SPXA 3HDYA 4JK3A 3QW2A 4YTEA 5C7LO 3I6QA 5IG2A 4N5MA 3LVFO 3CIFA 4HXYA 3JCZA 1E7MA 2ZATA 2QG4A 1ULUA 3FBGA 1KEVA 4HNGA 4M49A 4TROA 4XGKA 1B8PA 4OQZA 4YDRA 1MG0A 4MVJA 4CM7A 3AUUA 3JQAD 3O38A 3C24A 4WEOA 4HFMA 4QEDA 4E0BA 3JD0A 1LSOA 4RDIA 4GVLA 5U1PA 2JFFA 2NUAA 3WR5A 2QYTA 1HETA 4KMSA 4YJFB 2D4AA 3RC1A 4S3MA 4NU6A 1EUCA 3Q6IA 3KSZO 3DR3A 2AMFA 4D43A 4M8SA 1DFHA 1XWFA 4E21A 1TT7A 4U8GA 2XXJA 4QX6A 4YRDA 3FI9A 4XCVA 2R00C 1E5QA 4I08A 4J0FA 4JBGA 4XQ9A 4AJ1A 3ZU2A 4FFNA 1CF2O 3SVTA 4J43A 4BO2A 1DDOA 1YKFA 2C59A 1DC4A 2AG8A 2GGSA 3PWZA 1ISJA 1LEHA 3Q2KA 2DUWA 4Y6RA 4R68A 3ZHBA 1UDAA 2D8AA 1E3JA 4U6SA 3DBRB 3OJFA 1M76A 1HF3A 3ZHZA 1EZ4A 2IYPA 2ZCVA 4AICA 1L7DA 2CFCA 1WNTA 2I9PA 5DDIP 5TSDA 5JY1A 2X7HA 1I3MA 4WNCA 3RC9A 1UXHA 2BF7A 5JCJA 4BNKA 1SOWA 3ITDA 3PDUA 3AY3A 1ZK0A 1EUZA 4AJIA 3BTVA 2VYNA 1YL6A 4K28A 3WBFA 1HSZA 4L0QA 3ASUA 3IJPA 5JLAA 4ID9A 1QR6A 1TT5B 5EL0A 1HWYA 4CV0A 3QVTA 3VH1A 3JD2A 1LDYA 1YB1A 4HNHA 2ILTA 2O50A 3GAZA 1D3AA 4YAEA 4HUJA 1PS8A 3NV9A 3QP9A 5COAA 4S1VA 1ID1A 3ROPA 5JMPA 3QA9A 2IEBA 3CKYA 3ULKA 1RM3A 1KEUA 3PIDA 4M87A 3FHLA 4IPTA 4AJHA 5A4DA 1LLCA 1VL8A 4ZICA 1E3SA 4DIFA 2YUTA 4BNGA 4HBGA 4IJUA 2CMDA 1OC4A 3KUXA 3B1KA 4L75A 3RFXA 4ZRNA 1PEDA 3HDQA 3LLVA 1HYHA 4LMRA 2NNLD 1K6IA 4CUZA 4BB5A 2Y1CA 4NR0A 4E32A 3CH6A 2BFPA 4JJIA 5IZ4A 1GCUA 4QUKA 4D79A 3HN2A 1NM5A 2PLAA 3T7EA 2PWZA 4ZHSA 3I9OA 3E8XA 1SOVA 4IS3A 1NPDA 4HADA 1O5IA 1EVYA 1C3VA 1LX6A 1GYRA 2HRZA 4E13A 3BXXA 3ZU4A 4PLWA 1B2LA 5K1SA 1SC6A 5BSFA 2H5LA 3L6OO 3PZBA 4LW8A 3ZZNA 3H8VA 2Q46A 3OF2A 4YT4A 5K6AA 2ZJ0A 3QV1A 1QMGA 1EVJA 4E4YA 4QFCA 3F3SA 3IP3A 1I33A 5L40A 1V6AA 4HFJA 5A9TA 4CLOA 4ALIA 4MP6A 3TPCA 2B5VA 1V35A 1UR5A 4IDGA 1ONPA 4HWKA 3QLJA 2VHXA 5GY7A 1DBVO 1JKFA 1I3NA 3V1YA 4UVIA 1E3WA 2QYSA 1PGNA 3UGKA 5ITVA 2EV9A 1BWSA 5C37A 2P68A 4RDHA 3PDJA 3KYDA 2X8LA 4IQ0A 3QVSA 1YS4A 4FFMA 5KVCA 4BGVA 1PJLA 1FDUA 1XCBA 1K89A 1UXKA 3A14A 4R51A 4YJGB 3TJRA 1B7GO 2LDXA 4GBJA 4N18A 4KP7A 5B4TA 4MVJF 4DMLA 4DPLA 1NVGA 5DOZA 3IQDB 2JKVA 4K9DA 2FZEA 3DFZA 4NFHA 1ZSYA 1B26A 1P1FA 1TA4A 4QT0A 4RLHA 1GTMA 1V0JA 4GAEA 1XU9A 3DMTC 2F00A 4JNKA 1UP6A 2PGLA 3BAZA 4WCFA 3A9WA 2P4QA 4A03A 2AA3A 3G1UA 2J5RA 2AEJA 4OXKA 4I1IA 5AOVA 2A94A 1QV6A 3GEGA 1NVMB 3GDOA 2DQ4A 1TXGA 3AWDA 2HMWA 2Y68A 4BV8A 3WXBA 5F1PA 4JXKA 2X0IA 5L4LA 2V7PA 3GGOA 3HB5X 3JYQA 2VT3A 4E31A 1R4MA 1T4BA 3GDFA 3DAFA 2FPPA 4GLLA 1JVSA 3NRCA 5ITWA 4A27A 5EIOA 4QQRA 2GR9A 4DXHA 1YB5A 1L7EA 3JQAA 1VJ1A 3TZHA 1HKUA 2UDPA 2QX7A 5TF4A 3JD1A 1BXKA 1XIVA 3U4IA 4QTZA 1I10A 2XXBA 2JFGA 3FTNA 3JQ7A 1GV0A 3GQVA 2VWHA 1FDSA 4Q3BA 2CZCA 4EEZA 1HLPA 3WSWA 3ZWVA 4NH4A 4A73A 4EUHA 3SLGA 4CLDA 1AUPA 4HFNA 3E48A 3ZNOA 2AQIA 4C4OA 1Z45A 3I3OA 5B12A 4IS2A 4IXWA 4A2CA 2Q2VA 4CR6A 2GDZA 3CEAA 4G2NA 3SLKA 3WGIA 3GNSA 4XR4A 3GVXA 1EUDA 3R0IA 4I5EA 1N9GA 4L74A 1A72A 1NWHA 2W2LA 2PZKA 1N2SA 1UZNA 2DU8A 1DRVA 3EDMA 2X4GA 3QSGA 4FJ2A 4IGFA 3ONFA 3JQ9C 1S7CA 3RUDA 4BHTA 2NTJA 3B6ZA 5DCWA 3SJUA 2IXBA 4BO5A 1Z82A 3WYBA 3UICA 1D1SA 2DVMA 4FOOA 4A10A 2DPGA 3KTDA 2Y1FA 2Z1MA 2VHWA 4FPXA 1ISIA 4J7CA 1NVTA 1WLYA 3O8QA 4BQPA 2NU6A 2V6GA 2OBYA 1SZJG 4Z9YA 5JNLA 3ZNPA 4J3FA 2CY0A 4EJ0A 5IDXA 3WBBA 4O59O 1ZK1A 4XYBA 1I32A 4NU5A 2EP7A 4Q39A 3ROKA 3V1TC 2IODA 2BI8A 2FPGA 3LU1A 1UP4A 1AHIA 4FR5A 2DFVA 3VH2A 4CMIB 4EEXA 1WP4A 2NVBA 4A26A 4FDAA 3WX0A 4KTTE 5IXSA 3F5SA 1AHHA 4JGBA 1ENZA 4RPGA 4KUHA 3L9XA 4HFRA 4YCAA 3L4BC 2Q4BA 2IYOA 4GMFA 4YJHA 3DTTA 4D45A 4K6CA 4Z3DA 3U4CA 1I2CA 4RZHA 5IFLA 2EEZA 3V2HA 1RM5A 4Q3EA 1NHGA 4Y9DA 3QIVA 3DONA 4XRRA 2NQ8A 3DMTA 3VC7A 4J9VA 2I3GA 1MFZA 4AJEA 4TZTA 2AE2A 3CE6A 4NJMB 4BO6A 1D4FA 5AXAA 1Z6ZA 1IUKA 2Q1WA 3GEDA 1I3LA 1ORRA 2O48X 3IIEA 2FWMX 3ZU5A 1WPQA 3U4DA 2Q45A 4BKOA 3W4JA 4QXMA 1VRWA 2EKQA 5KJ1A 2B83A 1BDBA 1HE5A 3K73O 1X7HA 1MC5A 1RWBA 4JLWA 2G1UA 5EINA 1VSUA 1U4SA 3FPCA 2ZJ1A 3IAHA 1GYPA 4ZGWA 2RCYA 5KWEA 1ZMOA 3DZHA 4BO0A 1PJQA 1N7GA 4XJTA 5DN9A 4PG6A 1RYEA 2DKNA 2GERA 3WGYA 1ZW1A 5JW6A 4O5OA 5HM8A 1LDBA 5IDQA 2XOXA 1JN0A 3ZCXA 2SCUA 2Y0EA 4BMSA 2ZB8A 1SO8A 2ZQZA 4YR9A 4TSKA 3BTOA 1XEAA 4KWIA 3S2GA 3WQRA 1P1HA 3EZLA 1QLJA 1DOHA 3VDRA 1H9AA 4G65A 3JTMA 4GLOA 3MWDB 1E7RA 4YT2A 3F46A 2IZ0A 3NT5A 4BMVA 1P1JA 3IJRA 2B4QA 2ZQYA 4IXTA 4NG5A 1QYDA 1M67A 3K2EA 4MVJG 3TWOA 3VH4A 3AUAA 3ZI0A 3PWKA 3K8ZA 1ZO8A 1EVZA 1P77A 4QO7A 4DC0A 4GL4A 1UXJA 3I1JA 3K5PA 2P5UA 1GL3A 3JQ9A 1KIFA 4CMBA 4OSOA 1P31A 4CQMB 2FSSA 5TIIA 5EQFA 4YPOA 1GD1O 3RFTA 3UOGA 4M54A 1I5RA 1UJMA 4AJOA 5AVOA 5I7FA 2Q99A 3JD4A 1U2DA 1KY5A 3I6IA 2VYVD 2W2KA 2D1YA 3C7DB 1HDZA 3AU8A 2BH9A 3LLSA 2VNAA 5T64A 1E1KA 2RH8A 1ZMTA 1WDMA 3GC6A 2D5CA 1LI4A 3VPXA 4MKRA 3X2EA 1GYQA 3PFWO 3U49A 4J4TA 3GVIA 3H2SA 4II2A 4IDDA 2WM3A 1H93A 1MP0A 2JHFA 3NX4A 3WS7A 3JQGB 1QLHA 1HLDA 2G5CA 2V6MA 4CM5A 1XDWA 1OBFO 2UVDA 3PHHA 1X1EA 2BGLA 4O6VA 4RORA 3KVOA 4Z9FA 2AQHA 2BGKA 2XAAA 3L4BA 3OM9A 3QWFA 4CM8A 3ZWOA 4ZQHA 4RCVA 1R15A 5IDWA 2C5AA 3B1JA 1DHTA 1I3KA 2OXIA 1PZHA 3GVPA 4J7UA 2O4CA 4M1QA 4E5YA 2IRWA 3TNLA 1ARZA 3RUCA 2X0RA 3HADA 4NHEA 5CEFA 5JAMA 4OMUA 2PTGA 1JKIA 3RD5A 3L4SO 3NDJA 4UUOA 5G4KA 4ALNA 3DQPA 2PD6A 1LLDA 1P9LA 2Z5LA 3DZKA 4TKMA 5FI3A 4Q3NA 5DCUA 4CMCA 5IJZA 5I9MA 2EJWA 3WNVA 4E5MA 2VHYA 2DTXA 3ZWMA 3C1OA 4DPMA 4ZN6A 1E7YA 1NBOA 2HAEA 1BXGB 2WDZA 3FSRA 4J91A 4MP3A 4ND1A 3FR8A 4Y6SA 4H15A 4D3SA 3GNQA 2PKRA 4EYEA 3BMCA 2VZ9A 3QE3A 4GWGA 3SC4A 3MWEB 3VPHA 2J5KA 5HRUA 1JWAB 4HKTA 3NYWA 3K30A 1BVRA 5H82A 1GZ6A 1DC5A 3D0OA 3MTGA 5A02A 1IZ0A 4YWJA 1Y81A 3GZNB 3G0OA 5EESA 3IC5A 4PVDA 2R6JA 5A3VA 1YOVB 2X9VA 3AJRA 3H5NA 4EUFA 4YT8A 4XGNA 4GX2A 4J2OA 1ENPA 4ZVVA 3IKVA 4NBWA 5F1KA 3WNQA 3FWNA 2GUGA 4PN3A 1F06A 2BRUA 4ALKA 4YAKA 4ZQBA 5HTOA 3C8MA 3RAJA 3WGOA 3W4KA 3GPDG 2PD4A 1VI2A 2ET6A 3EHEA 4RL6A 3WFJA 3KM0A 3IUSA 1WMBA 1ZFNA 1CETA 3AOEA 4L4XA 3AM4A 5CP8A 4EBFA 1DSSG 3RFVA 2H6EA 1HT0A 5EERA 4BV9A 2FMUA 4E6PA 4Z6KA 2BD0A 1R37A 3WOHA 5ICMA 3Q9NA 4LRTB 1U5AA 3WJAA 2JD1A 4D46A 2DAPA 2NSDA 2HRBA 2OORA 3BMOA 4RO0A 2PV7A 2VRCD 1XLTA 4CUKA 3VZQA 1QRRA 1XU7A 5AQ1A 3H9QA 2ZTMA 3C7AA 3HHPA 1SMKA 3RBXA 3L0DA 1ZXLA 3GUCA 3MJEA 1PIWA 3KLPX 2HO5A 3GZ4A 9LDTA 4XYGA 5A9SB 5A5EA 2EW8A 4PZDA 3ZWNA 9LDBA 3E18A 5B4UA 2X9NA 4PLGA 4CUJA 3JQDA 4BNUA 4R01A 4W7HA 5A04A 1IL0A 4XGIA 4CR8A 4HV4A 3PFFA 3DZBA 3BTUA 4RPLA 4PG7A 2JCXA 3L6DA 3INRA 1LDGA 3DZIA 1EK5A 1DIAA 1YH3A 3DHNA 1T25A 1Y9EA 1SNYA 2D0IA 4BNTA 2PZMA 1OZAA 3PHJA 4MKXA 1GY8A 1EK6A 3ZWYA 6LDHA 3CMCO 4TRRA 2A9FA 3TDKA 3HWRA 5G0TA 1R6DA 1NFFA 3GGGA 2VOJA 2GYYA 4YAJA 1F8FA 2CNBA 1Y5MA 4LCJA 3VOSA 5FFFA 4BO1A 3PI7A 1UAYA 4ZD6A 1V3UA 1DAPA 2VOEA 4KWHA 3CTMA 1J49A 2O4UX 5L7WA 3ICCA 2VYVA 1Q0QA 1B3RA 4EJ6A 1PSDA 3QVOA 4P4LA 5ICSA 3GVHA 1CIVA 4UVDA 4IINA 2GCGA 3ADOA 1NHWA 4GKVA 5K6AC 1ONNA 2X1HA 2GZ1A 4ND4A 3A28A 2G0TA 4TKLA 5CDTA 3BMQA 1DJNA 4BNWA 4E2ZA 5L3ZA 2HMTA 1K6JA 1VSVA 1ISFA 3GFGA 5TGDA 2VUTA 4J1NA 3G3EA 5KKCA 2D5AA 2Z95A 3KRTA 4FGWA 1U4OA 1CQJA 4CODB 1JLLA 1W6UA 3GPIA 3DDNA 4YT5A 3OA0A 5BSEA 3LF1A 4E5KA 3F9IA 1U3WA 3DBLA 4N7RA 1ZK3A 4B3HA 3WICA 5TRTA 2FZWA 1ULSA 4OXYA 3QRWA 2WEKA 2X6TA 3W8EA 1H2BA 1MG5A 1Y8QB 2QRLA 2YHIB 3GN2A 1QP8A 2XF8A 1KVQA 1EQ2A 4JJFA 4ALMA 3V2UA 4DQUA 5I8WA 2Q1UA 1ML3A 4NJOA 3O9ZA 4LSMA 2IDZA 3R6DA 4L9RA 1IB6A 1WDKA 3GNTA 3PIIA 3QWBA 2P9GA 4KUGA 2Q4EA 1PQUA 4WCFC 5KTKA 1PTJA 3BMNA 3DB2A 3LQFA 4BNVA 4DPKA 1PZFA 1RPNA 2C0CA 2HSDA 2AQ8A 4CM9D 2YFHA 3E1KA 3GN1A 2QRJA 1H5QA 1K3TA 2YW9A 5HS4A 1GPDG 3CXRA 4GH5A 4YEDA 3V5NA 3JQBA 1YB4A 2I76A 2Q2QA 4AG3A 4PZEA 5JPIA 1HE4A 1LRJA 4R1SA 3TN7A 1LDNA 5TNXA 3KYCA 1SEVA 3CUKA 3K6JA 5AXCA 4Z9XA 1HTBA 3ENKA 2NADA 4IDBA 5I7EA 1ZKMA 2DC1A 3ANMA 3DC2A 3FBTA 1P1RA 1A4IA 4N5NA 2EF1A 4MIYA 1KY4A 2WE8A 3DL2A 4OXNA 5EMHA 4FFLA 3OJEA 1G1AA 1ZSNA 3KLMX 1XHLA 2XPCA 2X0NA 1Z7BA 3RASA 3TZQA 1BXZA 3DZGA 4AFNA 3OIDA 1UP7A 1Y1PA 3H7AA 1LXCA 3C3XA 4CLRA 1ISHA 4G5HA 3DFUA 4YACA 3TZ6A 4BNZA 1IOLA 2AXQA 4PGFA 3RBZA 3S2EA 1U7TA 1GQ2A 1WVGA 4DBVO 3N74A 1ZNQO 2E82A 2WWRA 2Z1NA 4IJKA 1DIRA 3JQFA 4TRMA 2DBZA 4YB8A 3RUFA 4O1MA 2EG9A 3H3FA 4J7XA 3GOHA 3WGHA 3UW3A 1C0IA 1B14A 4NBVA 5CEJA 3S2IA 3IS3A 3JYPA 4NBUA 4ESOA 3SEFA 1MXFA 1GUZA 3OECA 1NX6A 1Y8RA 4OOFA 1GFSA 4QSMA 1L1FA 5KOIA 2VRCA 4XDZA 4A0SA 2VZ0A 4L76A 3F6YA 4FFPA 1RM0A 2YJZA 3IP1A 3VKUA 3WGZA 3LC2O 1T4DA 2JL1A 1EQUA 3M2PA 3FWZA 4YAIA 1X15A 4IQ8A 5A5FA 5L95A 1ZJZA 3INTA 1FDTA 4DQVA 3GGPA 3A06A 1HXHA 4AJKA 2V6FA 3BZUA 3ETEA 3JYNA 3U62A 2E37A 3O03A 1KEPA 2Q1TA 5EN4A 1Y9AA 2NU7A 4XR9A 1NQOA 1E7QA 5CG2A 2VCYA 1G0OA 2HJRA 4BVAA 1IPFA 2VNSA 3JQEA 3FTPA 5KVQA 2EP5A 4R16A 4XWYA 3LC7O 4XYMA 3ANNA 2J5QA 4I9UA 4KUEA
chains in the Genus database with same CATH superfamily
4HY3A 2ZBGA 3VNAA 3AHDA 2B9VA 4LSZA 4YUYA 5CEEA 3E70C 3P45A 4LCEA 1FTWA 2I78A 1X7WB 4JC8A 4TLCA 1TL7C 4KN5A 5FA8A 1YZNA 1JDUA 1U7PA 2WVJA 2BGNA 2EGHA 4G84A 4BX8A 5IULC 3CJQA 1X14A 5I4IA 1URPA 5T6BA 1EG7A 2V9ZA 3K70B 2LTAA 5ENDA 2UZIR 1EVIA 4QNNA 1NMQA 1JT9A 2J6CA 4TMVA 4EZBA 4XFKA 3SM3A 3T4XA 2P1ZA 4Q4AA 4CLOB 1TEVA 4R7ZA 1HGXA 3LCJA 4RUKA 5EQDA 5FBWB 1M0TA 4ZT7A 1FTSA 1N4AA 3W8DA 2B8EA 5B6PA 3THWA 2OCPA 3ZZMA 1I24A 2I99A 4X3PA 3SSOA 3SY8A 1JAIA 3ASZA 4JLPA 4F06A 1AH2A 2QSJA 4G4JA 2VTEA 1ACJA 2G76A 4WQMA 5AHRA 1EXVA 3GDHA 3IUYA 2IZ5A 4OSEA 2QLMA 1P7YA 4AF8A 1NXOA 4A2WA 1DDIA 5TT0A 4M6WB 3KYDB 3GPLA 1M1UA 2JCVA 1U2GA 5G1PA 1KKMA 2IXGA 3PRJA 5DHPA 5F7JA 3RRBA 3KG2A 3E27A 3NTOA 2QD3A 2FSPA 2QLNA 5B64A 4D4GA 3NHWA 2ZIXB 5B3AA 2JGDA 3MIIA 4Q7EA 1P0IA 1KEWA 1MQ9A 2RHCA 3KNZA 1W87A 2JIZD 1ZIYA 3OX3A 3P4XA 1NQVA 2AJBA 1ZN8A 3OQJA 5DCYA 5AP9A 4BWGA 4L7QA 2AF4C 1JZQA 4TUYF 4DBLE 1Y5IA 3B5IA 1WMFA 3D4PA 4OM7A 3U48A 2O59A 3WE7A 4BNIA 4JZKA 2VJLA 2H4JA 5FNVB 3ZDAA 1EFLA 2GDJA 3PQ2A 3KOXA 2VDLB 1IN8A 2EJCA 3G6WA 5I9NA 3ZDFA 1L2TA 3AFOA 4Q4CA 1BVHA 1TCUA 3P5SA 1DWUA 1IY0A 4TTSA 4RJLA 3PA6A 1KZ9A 4DEYA 1YRLA 3AO0B 3E82A 3O4RA 4PCLA 4UMVA 3ND9A 2EXXA 1G16A 1RR6A 1TAQA 2A92A 2FR8C 3GGJA 4GSYA 2OPHA 4INJA 1ZCFA 3L7KA 5FBHA 1W52X 5TVKA 3V8RA 2HUNA 2NUPB 4DA4A 1E7SA 4UUPA 4GZ5A 3CLTC 1R4MB 2EERA 4BFTA 1SH7A 5B36A 4N5HX 1VGRA 2FPPB 3NBQA 4R3UC 5HRAA 4GQIA 1XQ1A 3UKOA 2EBUA 2CL7X 1PWEA 2W98A 4F6LA 4U2BA 4IAOA 3BJZA 3KEGA 1M6NA 1DX4A 1PR4A 2VJQA 5EFOA 4AWBA 2VK4A 3QMWA 3UAGA 4JC0A 4I5GA 2O0HA 1XZFA 1PQ4A 2WZCA 1VL0A 2D06A 2EJBA 2OGUA 5FTLA 2W58A 3GLGE 1G8AA 1Z74A 3FBWA 2DRIA 1U3TA 2YDYA 4OI2A 3ZGYA 5F23A 3L8HA 3DOCA 2AUNA 3U4AA 2BZ0A 3CF0A 3H65A 3DAHA 3PGLA 4BQOA 2QXUA 1J9EA 4BC1A 3LX4A 1DKNA 1WBBA 2XCSB 2WP0A 2X14A 3B20A 1EJBA 4E94A 3VJRA 4AJ9A 1H0KA 3G13A 3HXKA 2QJRA 2JJ8A 3KT6A 1QGZA 5A1JA 2EGUA 2F9LA 4PSCA 2FYTA 2Y2UA 3A70A 4L02A 4HT3B 1JPUA 3PLAE 2PT5A 1OV6A 1LJ8A 1PE0A 1ATZA 4RVUA 3O8RA 3L1UA 3ECCA 2PZ8A 3GL9A 5CAEA 3U44A 1LFAA 1EE1A 1NW8A 3O4JA 5DNYB 4RF5A 2RKWA 2J32A 2I22A 4OUDA 1QBGA 3JYOA 3PPIA 5IXJA 5DGCA 5JNRA 5LZ2A 2X5OA 5ILOA 1DAMA 2E4AA 1GITA 2WVAA 5DZSA 2A1TS 2EAUA 1F8YA 3ZV7A 3EZ2A 2FFRA 5A0TA 4KV7A 1BW9A 2KQUA 2OL4A 2WYVA 3JXEA 4RJ2A 1NVBA 4DE5A 1PVOA 5KIAA 5L4NA 4W99A 5HDQA 1M1XB 1YR1A 3KT3A 1UWVA 2V0NA 2IYFA 1M2WA 1UH5A 2WSBA 3QITA 4OAPA 4IIEA 4X6LA 3W8RA 1PX2A 2ZYDA 2BM1A 3OPYB 1AGRA 3JZFA 4ND8A 3T35A 3ZXUB 1S4MA 3QE0A 1GGHA 4QOSA 1E5TA 2WJ4A 3TLYA 2UUAB 5LKRA 1C1DA 3LCMA 4G37A 4QELA 5JANA 4CKBA 3I83A 4BQFA 3GF4A 4DVJA 3LX6A 1IY1A 1Z15A 5J40A 3WMXA 2P9HA 2E1RA 4Q7JB 4ND2A 5C0OE 3IOEA 2GM5A 1L0BA 2GPTA 2VP0A 4KHZA 2OXRA 4AU1A 5DK4A 2BEJA 2R8XA 2ZUDA 3AI2A 3E81A 4RHTA 1K0FA 1OE0A 2YFYA 3DWFA 4EI7A 2POQX 4DIOA 2VJNA 1F6DA 2QZ4A 2HB6A 3AERA 3RU2A 2VP2A 1XVIA 4ISBA 1JFTA 1H2HA 3CN9A 3FUXA 4IFIA 1DB3A 4Q9AA 4LXGA 4MGHA 4ZO9A 3NBKA 1CULC 4KPUB 3DAGA 3ED5A 4NQZA 4TM8A 4BRWA 3AT1A 1N7IA 2OZKA 3HM2A 3ZLJA 1PKXA 1P2GA 4NYMQ 1U3GA 4UZFA 5JS2A 3PFGA 4HH0A 2QUAA 2YHUA 1HE1C 1RRGA 3UK7A 1F3LA 3DL7A 5KVVA 3RIHA 3THXA 4XLLA 4BBJA 4D02A 2HRCA 3V4OA 3AFGA 4EB8A 4BNDA 2BONA 2J4FA 4OY3A 3IFSA 5AQEA 1D5WA 4ZO8A 1YS9A 1AKVA 3TG2A 3T4EA 3N7UA 3ADPA 4JT8A 5CYOA 4B2PA 3I01A 3LLMA 3FM9A 4IQGA 4Q37A 2XI4A 3RIMA 3DTYA 1W5SA 4UVEA 1G6KA 3NDRA 3SX4A 4CQLA 1VLLA 1K2VN 2HJSA 4YDSA 3VR6A 2E6UX 3QUSA 4DR6B 3E9ZA 1RQGA 1MOSA 2BUCA 4HLUC 1OU0A 4BNHA 1YI0A 2AH5A 2A0WA 1GCIA 1NP7A 3D7LA 3EIHA 1LPBB 3AV0B 3PF9A 1Q91A 3ZH2A 1GZDA 2H57A 3SZOA 3TSZA 4EKEA 3MWLA 5FPKA 3DV2A 2EYQA 1CR0A 1U3FA 1VI5A 3P2EA 2GNAA 1QAMA 2I6TA 3CA8A 3M1IA 4LSWA 1U0OC 3WTBA 5BSWA 3HI6A 4YP1A 3WISA 1Y98A 4HAOA 4K03A 3TDMA 4ZCRA 1E3EA 2IU0A 4QTYA 2O7SA 3PFBA 3N28A 3O8DA 1GPNA 3I61A 5LUAA 1KQPA 3WAJA 2AR7A 2IYNA 1MAVA 4YA6A 2IF0A 1U28A 2D1QA 1CW2B 3A32A 3SS7X 4AB1A 1HSOA 4YAUA 4DR1B 1NUAA 1YWGO 3LGXA 1O95D 3MC1A 4IXMA 4QIHA 5DWDA 2G09A 3Q7QA 4RPJA 1AUOA 1YL7A 5I9TA 4JXXA 2YQ4A 1JFVA 1X70A 1NBHA 1QGYA 1XC7A 2QQGA 4IBOA 4XVHA 4MNTA 4YAWA 2EFDB 2HQOA 2GT1A 4B35A 2H16A 2GM3A 4W5RA 3RUIA 2YXLA 2QTVB 4RPKA 5GONB 2OCIA 3GRPA 4JB2A 1NJFA 2D5LA 1OQAA 2X9LA 3I9NA 2IEDA 2Q5CA 1NZDA 4TRJA 5L45A 1CYDA 5DGHA 2FRDA 2M32A 3MT0A 3D3WA 3GJYA 1UL1X 3H2ZA 1I8TA 3IVCA 5C5EA 3RR2A 1YZVA 2Q27A 2CL6X 2XOKA 1PZGA 3BBPA 1V2HE 4CI0B 1EBFA 1X7DA 4IZOA 4L5IA 3CWCA 2Q2NA 3CRW1 4RACA 3DMHA 1AO3A 3A9UA 1OBCA 4YJ2F 1OTYA 2J48A 3DNPA 4NOMA 1QB7A 4PU0A 4ZQCB 2OG1A 2CDCA 1E79D 3O2SB 4Q03A 4U6NA 5AK3A 3E7DA 5LP6B 1LPOA 4FX5A 3U1TA 3VPSA 1G3QA 2D1RA 4Z5XA 3IDFA 4Q6WA 1XA3A 4JP1A 1QYWA 3DCIA 3ZX4A 2Z8ZA 3K6RA 3AM5A 3P9ZA 1EFPA 2P65A 2W2KB 1XTKA 3IIMA 4WFIA 3VVMA 1KNXA 1CHNA 2CFOA 1C7ZA 3Q5GA 2VSOA 1YU6A 4M0FA 3G0IA 3TZEA 5KS2A 2QZ9A 3QXCA 4HGRA 1D7OA 1EMDA 4YR7A 2ZSHA 2J41A 3K9WA 4AX4A 1ORWA 2XRFA 3AY6A 1VTKA 3H4MA 4GVXA 1H69A 3LLUA 2KE5A 5AVJA 1KL7A 2A35A 2P5YA 4PBRA 3T5MA 5ECWA 4BO8A 3GQBB 5CX4A 3HNOA 4H18A 1ZCJA 2PZGA 2WE7A 3K2QA 5CT9A 3V2IA 1J23A 4ETWA 5ERGB 1OHHA 2YVQA 4XB1A 1CZNA 4ZI7A 1IM8A 2OVBA 3JAKA 4MJ7A 5HNKA 3UB2A 5LSAA 1QFYA 1MQ8B 1A71A 1OKKA 3AWIA 2REXB 1RKQA 5JR3A 5FKJA 3RRMA 1OWNA 4NPAA 4KV9A 4KLNA 1Y37A 5DI3A 4HWSA 1GZ5A 2ISQA 3HEMA 2Q50A 3VDMA 1YBVA 2VH1A 1V4VA 3T54A 3CMMA 3NM6B 5THKA 4XI9A 4K2AA 3JQ8A 4LYGA 2CXTA 3GFRA 4LVUA 2ZEJA 3NT2A 4F8EA 5K45A 1EE2A 2COUA 4GDMA 2JBHA 2DSTA 1WDLA 3HV2A 1A27A 1G5TA 1T1RA 2ORWA 2ZDGA 3LA6A 4QGFA 4XSVA 1QYXA 5D86A 1DPGA 1GRNA 5LL6P 4JD5A 4K6MA 5G4KB 3UT5A 4LAFA 5L8VA 5K0ZA 2P0YA 1BQ4A 3N58A 2XB6A 4BU0A 1X9HA 2QNBA 3GJXC 2JBAA 2NIPA 2HK7A 3PU6A 4IRXA 5T3UA 4AJLA 2XUDA 3GVCA 1EVEA 4BTLA 4FSHA 5IARA 4EY6A 1PWHA 4NU8X 3GLGA 3KZVA 3W34A 2XTMA 1FE8A 1FXWF 5EZ6B 3PNKA 4R9NA 1YBMA 2RI1A 3ENNA 4L9SA 3OY7A 5CIWA 2IQIA 4DLTA 2PQ6A 4GC5A 4ZCMA 4C7KA 2WD7A 1WZCA 2XMRA 1EU1A 1OVGA 3H6GA 3MYYA 3MT9A 1USUA 3D2LA 4MYCA 5FOUA 4XUEA 1BOOA 1MC1A 2H4HA 4LRSB 5FI5A 3U9SA 3WKCA 1VZ2A 4GM0A 5BMVF 3W2HA 1V96A 3CSDA 5KX5F 2LW7A 3WL7A 2VDUE 3ST7A 3BMCB 3LCVB 2DECA 1PL6A 2NUBA 2J3LA 4GECA 4NAHA 1MNAA 2PT9A 2A3NA 1VYUA 4DSOA 4ENPA 3AVVA 1R50A 4BAZA 3C87A 1A9RA 3V4VB 4P58A 3WNCA 5DM60 4JV5B 2UVQA 4MW7A 3L5KA 1T5TA 1PTJC 4BLTA 2C5GA 3BD9A 3SS8A 1YVRA 1A9YA 3BRCA 1X0VA 1QZTA 2A0UA 2XWJI 2XHZA 2ZPAA 2ZYIA 4M7PA 5CW2A 1Y4DE 4Y2TA 3VYVA 1V5FA 1WU8A 4FB4A 3VC1A 2AEFA 3LDAA 7REQA 1U8FO 5AW2A 3W5BA 1F4LA 4MWTA 1L9KA 5ALQA 1G9SA 2UZAA 3R0XA 4O2BA 5K3FA 1VBNA 1JKJA 1W76A 4K0RA 3WLMA 1VCNA 1T1GA 2OEPA 4OHUA 1U3VA 3D5TA 2OLJA 2WM2A 4QYWA 4B82A 3B3FA 5KAPA 1T9GR 4DIBA 2DBVO 1GTL1 2CVHA 4II7A 2C9OA 5AO9A 1TMKA 3QVJA 1W2GA 4FJ1A 4NCIA 5FRDA 4Z0PA 3SE0A 4Q6BA 3UF0A 4X65B 4EG5A 5JSZA 2L18A 1LC0A 2P40A 2R1ZA 4RZIA 5AKIA 4EOGA 1G21B 3ACDA 4F6RB 3KZMA 3GLHE 1LZLA 3C5VA 4JBHA 1BMDA 4NBSA 4Y2GA 2FI1A 4MK4A 4KLZA 1TECE 4JVSB 4A8TA 3L1IA 4TMYA 1CWUA 3U5ZB 3NOVA 4YRSA 4B4DA 2A5DA 4DRXB 5B55A 1EFDN 2TECE 2W8ZA 4RTSA 4TYYA 2DM6A 3R3UA 2VA8A 3KETA 1NYTA 2PXCA 3V80A 3Q3CA 1VKNA 3E9CA 1LW6E 3FMGA 4DRYA 5HYVA 1P19A 3C48A 1UXOA 2RGBA 1H4SA 3ZYZA 4B4UA 4PW0A 4C7XA 1RWOA 3PFCA 3R3ZA 2ZBEA 4RGQA 3WIBA 5JRJA 4I50B 5DSXA 1AXEA 1PLLA 5DYNA 4AKSA 2FRXA 2OKGA 4OK5A 5GAJA 2O9JA 2D2VA 4HMPA 3F74A 3QTLA 4V03A 1T3ZA 1JTEA 4TTVA 5FPPA 5B1SA 3C6MA 4HNAB 1Q20A 1SC3A 2WA1A 4RKQA 2RHHA 4FIZA 4Z4FA 1A50B 3F0TA 5KVAA 3T06B 3QVMA 3VHLB 3KYBA 3HN7A 4GI2A 3KEOA 4ZQGA 3EVBA 4DDKA 3HO6A 1KPIA 1RM4A 4YJFA 1DUVG 1IG3A 1A7KA 1XKLA 4Q1AA 2FG6C 4OHRA 3BSFA 2WHRA 1ZOSA 2X6RA 5D3MA 4EA6A 2GZDA 1V11B 3KVYA 4L3VA 3TE6A 3A1EA 3I9JA 5DX0A 3VYTB 3DBVO 4EVQA 5AH0A 2WU4A 4H1UA 2DTDA 3A6PC 1I2ZA 3ZK9A 1F2TB 4RW0A 1ZL2A 3THSA 5D1NA 4PRLA 5E6SA 5DSTA 1QMPA 2PKWA 1NJ5A 1LLFA 3AVPA 4QASA 4YBRA 3PT5A 4RULA 1SVMA 3WWDA 4MR9A 1G66A 1WZIA 2VCHA 4NYJR 4QQNA 4AJPA 1OIWA 1RZ3A 2WIDA 3ZCTA 3J81k 3DBRA 4O8CA 3LL4A 4O2LA 1UMDB 1FQJA 3AETB 3MIZA 4X6XA 3KR2A 2HWYA 3FDJA 4AP5A 1WQ4A 1HZZA 4FNMA 5ALNA 4KGVA 3ZHQA 4N48A 2G82A 1XCMA 3V9AA 1HNZB 1Y3DE 1UIMA 3TJMA 5TEVA 1JQ3A 2WP8J 1XRJA 3C3EA 1JLKA 2WWHA 4P53A 1ITZA 1RYFA 1V43A 3FOAA 4RVGA 4KC0A 3A9RA 1KEKA 2B0JA 2AJ8A 3QWAA 3HWX1 3R8FA 3PVZA 3LJKA 1DC8A 1K6EA 4FXPA 1E3IA 3PLNA 4MGEA 3AKYA 3BEOA 2NM0A 3LWNA 4P82A 4BXOA 4LWZA 2YWFA 1TT5A 5JMOA 4G5OA 1RJ9A 4LXHA 4AUEA 1U9JA 1P72A 3K3PA 4UAUA 2B36A 5K6RA 4M38A 3GP8A 2BFDB 2XCRB 1JQLB 3RGGA 1P91A 1SIWA 5T41A 4XD2A 3BDVA 4BVJA 2ID9A 4UEQA 1T6YA 1UBLS 1O9BA 4N54A 1Z0KA 1YR7A 2FMIA 3IA2A 4UHKA 3TZCA 1AOXA 2IS2A 4O4HA 3GA0A 1Q44A 4MGZR 4YV1A 1G2QA 2HO4A 4R69A 1X8XA 1XR3A 1Z0UA 2WJWA 3DYIA 4WBXC 1JLLB 4A6DA 3AF5A 1LSJA 3EAGA 4IGEA 1U04A 3HR8A 3KZOA 4BQNA 4CCYB 2FFJA 3H16A 4NFSA 5B58T 5C35A 3QVUA 4QDXA 1QZ3A 1BEEA 4LRWA 3GY0A 4P7FA 1TW2A 5E9WA 1UM8A 1E1QA 3NU1A 3R8CA 4J3NA 3S55A 3C7KA 4LWQA 3EC2A 1AB5A 3EXIB 3LTEA 2V4ZA 2WZBA 4DLAA 3ORFA 1RQ7A 4ZDKA 1DOAA 1VXRA 4DQ0A 1I1HA 1BU5A 3C6BA 1VKRA 2QZPA 3HJBA 3VHRA 1PVVA 2WM8A 4DWOA 1K2WA 4GLJA 2Y71A 2ZS8A 3KJFA 3LT4A 3R2JA 4P80A 4GM1A 3RJ9A 1Q7CA 4A23A 2QL9A 1VHQA 2J0VA 3PNBA 3STUA 1FMCA 1VJDA 4RHEA 3GLFE 4PQFA 2PAAA 3I45A 1BDMA 3QOXA 1A0OA 1G5HA 2OBXA 1DO8A 4FDMA 4C88A 4LC1A 2OO7A 1EK2A 5LB4A 5BWCA 4KR3A 1PVDA 2VJOA 4IIJB 4RDXA 4MV0A 5CCXA 3SSNA 5AI4A 4IUYA 1J0EA 4TUYB 4EPXA 3BM5A 2BHLA 2CJWB 3OLCX 4DUPA 4R4JA 5CBKA 3ZLTA 3OSZA 2JZCA 4GYWA 2H9YA 3DTVB 4HUQA 3UV6A 3GLSA 3TRIA 1OBVA 1TCCA 2DFNA 3AL3A 5JATA 2XD9A 3DVQX 1D8TA 4XQEA 3IJEB 3U7JA 4AQYB 3WA7A 1HRDA 1ZQ9A 3FKJA 4FZVA 2B69A 4L2IB 2CXQA 4G97A 1X77A 3RJZA 3QKRB 1G7CA 3HI4A 5B1IA 2OHIA 3FPSA 4RHFA 2CUKA 1Q1NA 1BA3A 1GFIA 1GR1A 4HYQA 5ULLA 2Q29A 2X76A 3EVGA 1F8XA 1RPZA 2V7VA 2F3RA 4IDAA 4Q3OA 3VYRB 1MHTA 4C0JA 4MV3A 4I9HA 4B3JA 2CF6A 2GAOA 1E9SA 4PZZA 5IH7A 1TIKA 3S1LA 2FN4A 2OYSA 1A9ZA 1DC6A 1F1BA 1NVDA 1WPGA 3E5MA 3VR5A 3WJ7A 1G8PA 2IJGX 1YV9A 3QG1A 2QW8A 1ES9A 3EXEA 4B9AA 3BQMB 1FUEA 3VAYA 1NI5A 3HVHA 4E3WA 4R8MA 4FW8A 4A8JA 4E5NA 1OJ7A 3JARB 1FU4A 2EKDA 5CD9A 3JVEA 2VDVE 1KH3A 2F1KA 1I7LA 2H1WA 4KB5A 2ZUUA 1XQVA 1X0XA 2APJA 2GCOA 3EF1A 5IYZF 3ZN2A 4B71A 4D81A 5JYEA 1NGSA 5K99A 4N0MA 4QFMA 4Z3OA 2VTVA 2XE6A 1X86B 1ZUWA 5JADA 4B09A 3BREA 4QVKA 1Y6RA 4TWIA 2RARA 3HVUA 1WMAA 3LSTA 3FF4A 1KSGA 4CEIA 3MUNA 5DEIA 4JA2A 3ITKA 4CIDA 2GOYA 3VYUB 4E11A 4ZU1X 5KNBH 3FH0A 1KQOA 2IPMA 2WAAA 1C9NA 1M2GA 2ZYGA 3LQ4A 1QVZA 3OU6A 3J81A 4KIGA 4BBAA 5L3SB 1U3UA 3GRUA 1G63A 3EH1A 13PKA 4R8KA 2GN2A 4OL0A 4QBFA 2GZHA 3UIEA 2VPXA 3MERA 5DBOA 1R5BA 3PVCA 3OX4A 1RBYA 3AUKA 5JH7F 4U2KA 3MGAA 2HT1A 2ID4A 4ZA2A 4PLCA 1O0SA 1RI3A 1FNSA 1TM1E 4YJ3F 2PWPA 3STHA 3TAUA 3GLIE 2GAFA 2VWGA 3GLHA 2I8AA 2IYEA 3Q0IA 4UNIA 2B4KA 4EG6A 1WV1A 1ZGJA 2ZRIA 4PYIA 1SCBA 4QGBA 3GXOA 1CUIA 3MJRA 3K4PA 5BQPA 2C1XA 3SX2A 1LQTA 1W4ZA 2G3YA 1JHQA 1QYCA 2DG2A 2HA4A 4CMKA 1L4MA 3EF0A 2X58A 3V1UA 1O6ZA 3IOBA 3MS7A 1MX9A 1Q0TA 1J1IA 3PFKA 2AF3C 3CGGA 2WSYB 2YFKA 1GZ3A 4FMCF 1TVMA 2ZDQA 4LBYA 3KEMA 3W2FA 1OYOA 1U4NA 3ZY4A 2WJ6A 1GFWA 1QLWA 2EP8A 2YMLA 3A3NA 1ABFA 1UKZA 3PYLA 4IDFA 1ZJJA 1TJPB 2JJ1D 2XYHA 3L01A 1GNRA 3OA2A 4PYQA 4N5LA 4ZCLA 4D82A 4K0KB 1FRZA 1ACMA 1IWBB 5E1MA 4E2YA 2HIHA 5JWOA 4E7OA 1QHFA 4IG9A 4QUAA 3REGA 4AM8A 5T7BA 1KGSA 1B2RA 2X7XA 4LTDA 5E1BA 4I9NA 1O94D 1KC1A 1NDQA 4HUTA 3UWKA 3PJEA 3MWJA 5M34A 3AF2A 1E9VA 1ZIPA 3VOTA 3GD7A 3NWPA 2E4YA 2VNIA 3DKRA 3VMMA 3NFYA 4RA6B 3S4YA 3S99A 4TV9F 5JXGA 1CUEA 2ZBRA 3UT6A 4AP6A 2PUVA 2ERYA 2QHXA 3D6UA 5EQTA 1O5TA 4G63A 4MYTA 4IG4A 2YYYA 1B8VA 5C46F 1R4NB 1E3QA 3O8OA 5DN6D 3B48A 3GA7A 4Q66C 4R1OA 3DF9A 3IUNA 4L5CA 4C4YA 3ESRA 2RGAA 3GRFA 1W35A 1WRBA 2FEXA 4HQNA 4Q7LA 3OFNA 4PAWA 5CDUA 3EFOA 3GH1A 4ZGGA 2QTFA 2O3SA 4CMIA 2FPRA 1YKGA 2P1DA 4R2JA 5SZHB 4NJEB 3KL2A 4JJEA 3I92A 5HFJA 1VDZA 3M3DA 4MV6A 3QKWA 4HVLA 4IEEA 2OCBA 4BO7A 3KZKA 3HYSA 1M8KA 3RTDA 4F97A 2YZMA 1SXJD 5IK2D 2HV8A 1P7PA 5C5CA 4ZOLF 3X1KA 4MW1A 1J2JA 1Z25A 4OQEA 4DCSA 4XWAA 1H2FA 3EDRA 1E2EA 2ZWIA 2IP2A 4B4WA 3IQEA 3TQOA 3TG8A 3JRNA 1E6CA 5D2CA 5BUZA 4HLNA 4JY7A 1DLJA 1T2AA 3NFRA 4B43A 1V48A 4KODA 5E0KB 5IJAA 4WLOA 4COKA 4LZOA 4EG1A 3ZVNA 3SQWA 4DV2B 1XYGA 5HIAA 1DG9A 3BB1A 5I7SA 1AMUA 1O4VA 3VKHA 3EVAA 1KP2A 1NXXA 1Q0UA 1Z0AA 2P11A 4NX2A 4EYQA 2M1ZA 1ODKA 1MB3A 3CEMA 1VMEA 3L7AA 4FU0A 4M1WA 5EWJB 3S44A 1LFDB 1T5HX 4LKRA 1HYQA 5FUQA 2FSVA 4H35A 1M83A 4LK2A 1N2BA 1ZXBA 2YS7A 2A7XA 1OXSC 3GEMA 1LF5A 4N12A 1JQEA 4OKNA 4P5PA 4Q1EA 2JAWA 4MDFA 3EAFA 3W4IA 4R31A 3TECE 4MYDA 1CU1A 4QBHA 3KOOA 2VQ6A 3TFOA 2CHFA 1YZUA 1T9HA 2UZ1A 3DMGA 4LGVA 1FL9A 3L0IB 5C8YA 2OXEA 2O2YA 3P2OA 4JB3A 4FOSA 4NCKA 2RB5A 1LGYA 2VJKA 1RWPA 3BCUA 3RW9A 3UH1A 3MAAC 4L27A 4IFTA 3BIOA 1Y7PA 5G0SA 3ROTA 1GPAA 3HKDB 4YJ2B 3UJ9A 3ZHTA 3AFIA 5LOVF 4ZT6A 2Z2XA 4ALLA 3NBUA 1JSCA 2CXOA 2HF8A 4I4NA 4KGZA 2DBYA 2DQZA 3JQPA 4JEMA 4DA9A 5JIBA 5FBLB 3S5UA 3TIGA 3VO2A 2J0UB 3LYHA 1N75A 4FIDA 2ODNA 3MD9A 3HJTA 721PA 1FYVA 3HYCA 3G5UA 3TIIA 3FUWA 3I9KA 4W9NC 3EN0A 1YZFA 1E6EA 3RT9A 1T3HA 2AJCA 5LCXA 5AW7A 2CKMA 4FBMA 4EK9A 1Q1BA 4BCBA 3UCXA 5CCDA 3RUAA 1J99A 2MSKA 4WLFA 4Y9SA 4Q3KA 4OFXA 3L1KA 2XNCA 1VFPA 3WSVA 2QTNA 1AKYA 2YYSA 5C1DA 2DULA 2QTRA 2QJOA 3JYHA 4IXDA 4PG5A 1YQEA 3GLFA 1JJIA 1V4BA 2ECPA 3RAFC 5KJCA 2J3KA 2XQJA 1XCJA 4FS8A 3T8YA 1IPEA 3CINA 4HQ0A 4BVGA 1K68A 1XGKA 2O6LA 4DILA 3BJEA 3NAQA 2JJ2A 1C8BA 2XW6A 4ZQFA 3I1FA 4DYDA 3ROZA 1RZVA 4CM4B 2OGSA 5SY9A 4OK6A 1UUFA 4NCBA 2RI6A 1NFQA 1TAGA 1VBFA 2NYRA 2XODA 3FKSD 4WVLA 1G6HA 5CD1A 2WTUA 3C4JA 1GPJA 4RV4A 3KKKA 4M8NE 2XNDD 4CQMA 3F8WA 3ROGA 2XE4A 1C7EA 3PCXA 4AS3A 3QJ5A 2GEUA 2G08A 3BFVA 4RMGA 4E1VA 2JAOA 3OUTA 3W1WA 2AR0A 2XJ9A 1TZCA 2REBA 1RWNA 2YIJA 3H5RA 1SC4A 3VZDA 4QBKA 4ASUA 4UREA 3AR7A 3G8DA 3THRA 3E22B 3I4FA 2PIDA 4MQ4A 3VHXB 5B5SA 1UPBA 1Z36A 3JU3A 4MICA 5F5XA 3VVBA 5JZVA 5EIXA 2RCNA 3OOWA 5BWLA 1MXHA 4PY2A 1YR9A 2HM7A 1A9XB 3WGNA 4MS3B 1D6JA 3ZE7A 1W581 3GYGA 2NSJA 3BE4A 4B32A 4CM3A 2EBFX 5JDCC 2WHYA 2W42A 4U6QA 1N6KA 1JLMA 1OC2A 1HYGA 2VXOA 1A76A 1D6MA 3GBPA 5F5LA 5JCPA 4M83A 3RU7A 2FN7A 4UFNA 3JQGA 3R7LA 4LV5B 1E98A 4D9IA 1ZH8A 4MVJE 1T9GS 2O8BB 3TQFA 3QPBA 1CNMA 1FFCA 1XMJA 2F3TA 4YPVA 2MMCA 5H59A 3V7YA 5LJIA 2WMDA 3BHJA 3RVOA 2GD1O 2GRAA 1P1BA 5BMVB 4GMDA 4KH0A 1QRSA 5TC4A 4ITRC 4W1SA 1QIEA 2HMSA 2H9AA 3E4CA 1XA0A 2PCLA 3NGMA 4LHEA 5LA6A 4OKIA 3QBJA 4ROTA 4U0JA 3CNBA 3TTWA 3EW7A 4FOLA 3H9EO 4DW8A 4ESHA 4FJ0A 3RYCA 1II8A 4L4ZA 1UC4B 4RK4A 2EIHA 2IWHA 3FYHA 2CNDA 4LVNA 4PLHA 4E03A 1PL7A 3OP4A 2QTMA 2O8FA 2IK8A 3B6KA 4PYJA 2R1TB 1N78A 1EEHA 5BPFA 5DGIA 1ZGHA 2PSJA 1ZNZA 1Y7HA 4IWNA 4NZZA 4ND5A 3E9DA 3H2HA 3KXDA 5CLLA 2A59A 1DIGA 1CS0B 1O03A 4TWZA 3UC9A 2GXSA 4FI3C 1LI7A 2Z4SA 3UMMA 5C1BA 4ALJA 2YXEA 3C1UA 4GMXA 5JS6A 1TX4B 2GRJA 4WXHA 2V74B 3RHFA 1IY2A 4HRXA 5EE9A 5LJLA 5CT6A 1JLSA 4YP7A 3RC8A 4DIEA 1P33A 1IJKA 4C0BA 3OI7A 3G2PA 5DHTA 4U2CA 3GLIA 1IZZA 3EQ2A 1DAEA 1KH1A 4HX2A 4RGYA 3MGGA 5AHWA 3AVWA 3KT0A 4CCSA 1YAHA 3QG5A 4MQUA 4N3CA 1UKCA 5H70A 3M83A 3P4UA 4JL8A 4WKPA 3UTCA 3VTAA 1U1DA 1Q1GA 3HA2A 3E3MA 3TNFA 2W2VA 3KFVA 3W05A 4L9WA 1XL0A 3CV3A 3EA5A 2REQB 3ABRB 3MWEA 4WA8A 4DLUA 4TQAA 1GVHA 4MA4A 1GQOA 2FK7A 3GARA 1C0PA 1JIIA 3FZQA 1KFCB 3B53X 3FTQA 4FGLA 4IIUA 4JU9A 2EFHB 1H2RS 4LF5B 1J0DA 1ETHA 3VV2A 3CUSA 4HL6A 2W4QA 4KWTA 3R77A 1ZNYA 3U7RA 3VU8A 3ZHCA 2FEKA 2I6FA 1G5PA 1E6UA 1K8RA 4DLXA 3FNFA 3L07A 1G19A 1NJSA 2EWMA 3RYHB 3ZWBA 5E4YA 4FYPA 2HQ1A 1O95C 4H59A 4V0KA 1CV2A 3B36A 4L57A 3LT0A 2MHCA 2WUFA 1RLOA 1RWWA 2E55A 3OWXA 3PEFA 7MDHA 5EQJB 1FTNA 1HNNA 3CWZA 1HT2E 2H7YA 3DBHB 1FS6A 3DULA 4D80A 5AD1A 3OCUA 3GCGA 1NR5A 4D9MA 1SKUA 1L7AA 3OETA 5J4HA 3PTZA 2XE7A 3B1YA 4PRYA 4Q9DA 3QXSA 4QWMA 1WIWA 4TMTA 4WOBA 4L8YA 1NP3A 4QYIB 4YBZA 5B37A 2UU9B 2ZUEA 4WASA 5CBPA 1YQTA 3PHGA 4LYJA 4RA9B 3P9XA 4P3KA 2X1VA 2X9QA 4GMKA 1YQUA 1V3TA 3IXQA 2NN3C 1E0AA 4HRVA 3QBEA 3NH6A 1AKTA 2O3QA 1E2HA 2VWPA 4OOEA 4MDHA 2H4WA 2BLLA 3AR5A 3RROA 1MVOA 1C9YA 3AJDA 4YFYA 5FUYA 3RVDA 1JR6A 3L7YA 1ISMA 4UBKA 1C5KA 3ON5A 4Q9LA 2QENA 1UKEA 2QP4A 3EGXB 2EBWA 2A84A 2G6BA 2J33A 4REQB 3MBKA 1RAIA 3W8FA 4M0DA 1H2EA 2DWOA 1C1XB 2KYRA 2ZJ3A 4HEA6 1JXOA 2XGMA 5LD2C 1XWIA 2YVLA 2CLHB 5IBCA 1COWD 5A9SA 4C2BA 2WTAA 4IGAA 2WIGA 4Z51A 1E92A 3HCCA 4GOJA 2Z57A 4IUCS 4LJKA 4WD3A 1FMTA 4A1OA 3JZAA 3FR7A 4DB4A 1ZC3A 4B6OA 1R6TA 4KXFB 3RI3A 3O9MA 4B45A 3H4TA 3UWSA 3LQYA 4FW9A 2H51A 4K9PA 4CDGA 3CNQS 4BE7B 1GLGA 4EW6A 5JARA 1JA0A 2WIBA 2C00A 1OIXA 3GRCA 3PI6A 2CEKA 4INOA 621PA 2P67A 2OBMA 3MPOA 3QEJA 1G2PA 4KQIA 3L8CA 3WJ2A 3F5QA 3C3YA 3LXRA 3RV4A 2HFJA 4UOEA 1QS0A 1UJ4A 3PEWA 1YXMA 1O5OA 2HZBA 4QARA 2OCYC 1JP7A 1D1PA 3BTSA 3GP5A 3LVQE 2OA0A 4D1YA 9ABPA 1WNFA 5JZBA 4HCJA 4U9UA 4IXNA 3AI3A 1XDZA 1MMFB 2PMBA 3ZC3A 4WLEA 1MW9X 4HYTA 4LQDA 1P7VA 2QT1A 4C22A 2X22A 1OLSA 4R2IA 3AM1A 3WB1A 1HX7A 3PGJA 2R7NA 4I1RA 1UBTS 3M33A 5HF9A 3C3KA 1X1TA 3GIDA 3WG9A 4LOKA 4JYPA 2CV0A 1TU4A 2A5LA 3P19A 2QMQA 3K1YA 5LXTA 1ZZEA 4PO8A 1YCHA 1W19A 5GGXA 1ZGCA 3NIGB 1NONA 2A5JA 3C3WA 4LI3X 1ZCZA 4EUEA 1QYVA 3AR4A 2C7GA 3U1VA 4LHYA 3UMGA 2COKA 1JIKA 3O90A 3U5TA 2OFFA 3HVRA 2C5BA 1G7SA 1JQBA 4I2NA 2Y05A 3TTUA 2UAGA 1NJ2A 3DXFA 2EDCA 2Q1SA 4UJ5A 1ECLA 4DY6A 1XJWA 1UDBA 4EI9A 4FD3A 3QA3E 3WADA 2DFTA 1A96A 2BEUA 5HJ7A 5EJ2A 4G0PA 1NW5A 3H8JA 1OH8A 3N3AC 2OCAA 3Q2IA 5T57A 2WHQA 3IEMA 2GYWA 1NUQA 4KVGA 3ETJA 2C2XA 1MB2A 2ZI7A 1HDYA 4RE6A 1JLHA 3U7EB 5B2FA 3STWA 3DWGA 1P5JA 2HCTA 2W6ID 4PX5A 4R2HA 2YHBA 4WXYB 5SYAA 1K6XA 3BHIA 4RE5A 4PR3A 5IRCD 1T8RA 1H8ED 1ESNA 1GSHA 3E5RA 3N7AA 4FZ5A 5BSGA 3NO4A 4RY0A 5FOQA 4MUMA 4ZJYA 1H65A 1Z29A 1KO4A 2R1VB 1UPFA 3E53A 3W78A 4YI5A 4HMQA 2AJTA 1WXXA 1QK3A 1F6WA 1QSGA 2QM7A 1H2AS 2BJVA 2Z6VA 4RVDA 4NXNB 4RNDB 1NM5C 1RWVA 4IQ4A 3Q11A 1KEEA 1RD4A 1JLRA 4GMHA 4BLOA 3RRXA 1UK7A 4KE8A 4MUEA 4P0TA 5L3VA 4L0CA 1VFNA 1JA1A 1JH8A 3LCCA 3SN6A 3WBKA 2R6HA 3I6QA 5IG2A 4GP6A 1Y3IA 2BUBA 1FS4A 3VO8A 3SS9X 1S2MA 3H1EA 4P92A 5D8DA 3IH5A 5JJ5A 3PC4A 2W48A 2XSZA 4Q01A 4E46A 4Q3LA 3ZW7A 3O0DA 5DTMA 4IEIA 4G0QA 1TCBA 2FX5A 1RYHA 1UMCB 1Q2UA 3T3OA 4ZVOA 4OQZA 2VKTA 4JKOA 5SY6A 1E5XA 4MVJA 3UWOA 3JQAD 3P9KA 3R74A 1TFUA 4PC1A 3O38A 1OVMA 4AWAA 4MUYA 1YIOA 4JOBA 4QEDA 4EELA 3N7TA 4RDIA 5U1PA 1IOWA 4DMRA 2NUAA 3ZD9A 3QYAA 1OLUA 5DWVA 1R6XA 2O5EA 2DWQA 3GUHA 4F56A 4KMSA 3AHGA 3K9BA 1EFRD 2NQ2C 3RC1A 4S3MA 2JCBA 1N2ZA 4I66A 2MYNA 5BSMA 1JUDA 3H1FA 3Q6IA 3C41J 3DPIA 1NI3A 3O7WA 5CB4F 4WXPA 1DFHA 1C3XA 1ZMRA 1TT7A 3CXUA 3EZ9A 4RFVA 1HQCA 2A9QA 1JTFA 2X2FA 1O6GA 5IYZB 4KJXA 3ER8A 4XFJA 4MTCA 4F4FA 4RY9A 4AJ1A 4FFNA 1CF2O 1HE8B 3KJEA 1YGPA 1DDOA 1YKFA 4BO2A 3MRXA 2ZIEA 5IAEA 2H8GA 4DSAA 1K92A 1ISJA 3IP7A 1JR3D 1Z8HA 4PSKA 1ZD4A 4DA6A 1HNWB 4R68A 4M1TA 3ZHBA 1E3JA 3G8CA 4RD0A 5E6UB 2GKGA 3SDBA 4F60A 5JT1A 1FNBA 3HMQA 3AFHA 5F9FA 5CVTA 5BN3B 4Q34A 1G8FA 4UTVA 1LJLA 3DLCA 5JH7B 3PFIA 4MARA 1QHNA 1U9IA 2VSQA 4TVSA 3RAEC 4WNCA 2P3SA 1UXHA 2BP7B 2EDAA 2FQ1A 3CZCA 4BNKA 4Z7JA 3T9DA 3RPEA 1E6MA 2HLNA 1EUZA 2WWIA 3U40A 1UBOS 1YL6A 4F3NA 3WBFA 4B47A 1MO3A 1Z0JA 3KUUA 4PM4A 1OX4B 1KRWA 1T34A 2W71A 3D2AA 2XZTA 1G41A 3DDWA 3L1JA 3MB5A 4FNAA 5E0OA 1J00A 1HWYA 1NP6A 1CUGA 2X8BA 2GNOA 2HJWA 3CPJB 3FCYA 3EEIA 4CV0A 4FMCB 2OUKA 2VBGA 4Q7QA 2ACVA 1Q92A 3T9FA 1IN5A 1RFLA 2COEA 4M9UA 4YAEA 3FPAA 4YV7A 3RYTC 1N0WA 2IHJA 3OOEA 2IEBA 3CKYA 3ULKA 3PIDA 5EE1A 4U7FA 3B38A 2PSHA 4DV0B 1NSTA 1INLA 2RBGA 4YRKA 3C8HA 4L50A 3AI7A 1JB1A