2CDAA

Sulfolobus solfataricus glucose dehydrogenase 1 in complex with nadp
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
366
structure length
360
Chain Sequence
MKAIIVKPPNAGVQVKDVDEKKLDSYGKIKIRTIYNGICGTDREIVNGKLKGKDFLVLGHEAIGVVEESYHGFSQGDLVMPVNRRGCGICRNCLVGRPDFCETGEFGEAGIHKMDGFMREWWYDDPKYLVKIPKSIEDIGILAQPLADIEKSIEEILEVQKRVPVWTCDDGTLNCRKVLVVGTGPIGVLFTLLFRTYGLEVWMANRREPTEVEQTVIEETKTNYYNSSNGYDKLKDSVGKFDVIIDATGADVNILGNVIPLLGRNGVLGLFGFSTSGSVPLDYKTLQEIVHTNKTIIGLVNGQKPHFQQAVVHLASWKTLYPKAAKMLITKTVSINDEKELLKVLREKEHGEIKIRILWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUCOSE DEHYDROGENASE
publication title The Structural Basis of Substrate Promiscuity in Glucose Dehydrogenase from the Hyperthermophilic Archaeon Sulfolobus Solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Oxidoreductase
total genus 122
structure length 360
sequence length 366
chains with identical sequence B
ec nomenclature ec 1.1.1.120: Galactose 1-dehydrogenase (NADP(+)).
pdb deposition date 2006-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
A PF16912 Glu_dehyd_C Glucose dehydrogenase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2cdaA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2cdaA01
4L4RA 3Q2IA 1GL3A 3WGOA 3I6IA 5DF1A 3UW3A 4AJ2A 4L75A 1MGOA 2O7SA 4N54A 4Q3EA 1I33A 1NAIA 2ET6A 4KMSA 3Q9NA 4EDFA 5C7OO 4KUHA 1LLDA 4FGWA 1K2WA 1T1SA 4J1TA 4NBRA 4A2CA 2GN4A 1WZIA 1FK8A 1EMDA 3EGOA 4DPLA 1K5HA 4GMGA 2BI8A 5EERA 4J3FA 2D3TA 2WM3A 4IIVA 5TGDA 5B12A 5KJCA 4E2ZA 3KVOA 4GWGA 3OQ6A 4GX2A 1XG5A 3SC4A 4WE3A 1E3SA 4RVDA 2NNLD 3PWZA 1YS4A 3QHAA 4YTEA 4AJKA 1P1IA 4LRTB 1NR1A 3VH1A 1PJ4A 5KJFA 3SX2A 2VRCA 3GVXA 5EQDA 3GGPA 1ZSYA 1G6KA 1E1NA 1E3WB 3INGA 1GYRA 2H6EA 1Y1PA 1LJ8A 2FMUA 3C7AA 3C7DB 2H1SA 4DIFA 1EVJA 1MP0A 2VWQA 3WFJA 4ND2A 1XQ6A 3GUYA 5C3MA 1HYHA 4J90A 5IZCC 4YAEA 1GYPA 4FGSA 2D59A 4R3WA 4YDRA 4FN4A 5AVOA 3JQ8B 4XA8A 3ANLA 4F45A 1VJ1A 4GMFA 3E6AA 1H6CA 1UZLA 3WR5A 2VOEA 5G0TA 2VWPA 1SAYA 5AXCA 1WDMA 1YH3A 1DLJA 1I36A 1CIVA 5L7YA 4AJEA 3EYWA 4MKXA 1RYDA 2X9VA 3LYLA 4JIGA 3HFSA 5IXSA 4GKVA 4S3MA 1TT5A 3GEDA 3AK4A 1HDYA 1OC4A 4JBIA 2C5EA 4I8XA 4CL3A 4UEOA 1LRKA 1DO8A 2HO5A 5I9MA 4B4WA 1RM5A 1FDTA 4BB6A 2PKQO 1C14A 1NVMB 2NUAA 1X7HA 2ZCVA 3CZMA 2DFVA 1J4AA 3PYMA 2W8ZA 5U9CA 4P4GA 3GNSA 2Q3EA 2WE8A 2NVUA 4EW6A 1HETA 2PV7A 1ADBA 2UAGA 5I7SA 4MVJM 4ZRNA 3KV3O 2O2SA 1DIAA 3DZGA 4NDNE 1DC6A 2V65A 2PGLA 4M8SA 2BD0A 1JKIA 1GUFA 2VWHA 1A9YA 2PZJA 4RV9A 3TFQA 3Q6IA 2J8ZA 2QQ5A 3PZBA 1ADFA 4MP6A 4R69A 4BV8A 1A4IA 2O3UA 4H16A 4UREA 2X4GA 3ONEA 3IMFA 4XCVA 1XU9A 3ROPA 2C07A 1CETA 5K1SA 4WNIA 3RBZA 4O1MA 2HMWA 4UUOA 5JAZA 4OIMA 1VRWA 1ZK4A 3I9KA 1I2BA 1TA4A 4HNGA 3UXYA 2ZKLA 2AA3A 1KYQA 2YW9A 3QP9A 4AJNA 3I3OA 5CPBA 2QX7A 2PZLA 4CM8B 1P33A 3W6UA 3H2ZA 5H81A 1X1TA 1JLLA 2Q49A 1R4MB 1SCUA 4E32A 1Y6JA 2YYYA 1B7GO 2ZTUA 2PKQP 3GVHA 1B14A 4NQZA 4RVSA 1MUUA 3BMNB 3KZVA 2ZB8A 4BMSA 2ZYAA 4BKUA 1UXKA 1E92A 3WSWA 2NU6A 4CQMA 3BMQA 4KZPA 4Y6SA 4CODB 1SEVA 4ZQEA 2VRBA 3WWYA 1ZEJA 3DEYX 3WQSB 4Q3AA 1NFRA 2I3AA 2WJPA 3Q11A 3B1FA 2VTDA 2XF8A 3NKLA 4ZQHA 4CLOB 3OJFA 2BRUA 5AQ1A 5CEEA 3ZWOA 1BRMA 4J6FA 5JFOA 1WPQA 5A02A 5CDTA 1ENOA 4A0SA 2I6TA 2IYOA 1U2GA 5T5QA 1H6AA 2Q50A 3F3SA 1OOEA 3JQFA 1RYEA 4E12A 5TT1A 3BAZA 1UR5A 4NFHA 5F5NA 4KTVE 1DJNA 3WS7A 4MVJE 1W73A 1SMKA 1GZ6A 5JBIA 3PHLA 3A4VA 4PG4A 1O94A 4B4OA 1N9GA 5T6BA 3WBBA 1PQWA 2HRBA 5K6AA 4FB5A 2JFFA 3GVCA 1IB6A 1LDNA 3D3WB 3OQBA 4XGKA 5DT9A 3V2UA 5KVQA 2YHIB 3ZZNA 4JJGA 4FOOA 3OFSA 4MVJI 2AEJA 3MJSA 5JMPA 1WAMA 4PLYA 2I99A 5G4KB 2X5JO 1UAYA 2QIOA 2JFHA 3IP3A 4RVHA 4CMCA 1UAGA 2C59A 5J23A 5KKAA 1CQJA 1YONA 2I65A 2YQ4A 4KTTE 2W90A 4LSWA 3M2PA 3EK2A 1U3UA 5JO9A 4GI2A 2V7PA 4MVJF 3GZ4A 1JKFA 2EEZA 1HEUA 3RKUA 3D5QA 4GLLA 5I7EA 4J16A 2BI7A 3BTOA 3UVEA 3UCFA 2PWZA 3H3FA 2IYPA 2Y1CA 1FMCA 3WGYA 2W2KA 1N7HA 2ZB7A 2JHFA 3GC6A 4YBZA 5KIAA 4FOSA 4DQVA 4U8GA 3HN2A 1O8CA 3HDHA 4MKZA 5AXAA 3NYWA 4RPLA 2RAFA 3GHHA 5TIIA 2X0JA 2P9EA 4TVOA 3RFVA 2VYVA 4BO2A 1ZNQO 1BW9B 3VVCA 3BTVA 2VUTA 4I08A 3O8QB 3RBXA 1XCBA 4PLWA 3H6KA 1XQ1A 3WJ7A 2OBYA 2C5AA 4OXNA 2EW8A 5LDGA 2J5QA 4S1VA 5L45A 5JS6A 2FN7A 4Y9DA 1F8FA 4QUKA 3NJ4A 5ITVA 5JAIA 4IJWA 3ZWPA 1U7HA 4P8RA 1CDOA 4W9NC 2QRJA 3B70A 2Z95A 1KOLA 3OETA 3VPHA 5IJZA 5I7VA 4B7CA 1A7KA 1C1XB 1GUZA 3MEQA 1JA9A 5BSGA 5KKCA 3ROMA 3JD4A 1Y5MA 1PL8A 4Q9NA 2DUWA 4AJIA 4OKIA 5TT0A 1DAOA 4GVXA 4GL4A 2YDYA 2X7HA 4ONEA 1B8PA 3ETGA 2YHUA 4J7UA 4RGBA 1SPXA 4W7IA 3WFIA 1CF2O 4L4XA 3D64A 4Q3CA 1LDGA 5FEUA 1AXEA 3I9OA 1KERA 2WD8A 3U09A 1ZBQA 4D46A 3DHNA 4ID9A 4ZQBA 1PR3A 4CMIA 2PZKA 4A7PA 4LISA 4CM1A 3FI9A 1U2DA 4I9NA 3MWEB 2HK8A 4BO1A 4AJOA 4PG5A 1HF3A 1YKFA 3V2HA 2P91A 1PR9A 2Y1GA 1GADO 3NT5A 3JD0A 3D5TA 3PRJA 3BMOB 5JNLA 3HFGA 4YYZA 5AXDA 4RDHA 1LU9A 2J3HA 1HLPA 1T26A 5F1PA 1D1SA 2V6BA 2BGMA 4BUCA 1GD1O 1IOLA 4CQLA 1GCUA 4XQCA 2OP0A 3GN1A 1TLTA 3G17A 3DR3A 2GZ2A 3AUSA 3N58A 5JXWA 3CH6A 3LT0A 3Q0EA 3KUXA 3U0BA 1R4NB 4BO9A 5KCZA 2TMDA 4DBZA 1W8DA 5L4LA 3TSCA 4K6FA 3E9NA 3UCXA 5HBRA 1E1KA 3COSA 1IYZA 5JE8A 4O59O 1ISJA 4EGFA 3HADA 1M67A 1TVEA 2Y05A 1PS9A 3RUCA 1PGOA 4I1IA 3T7CA 3I23A 2JCYA 3NTQA 4B4VA 2AEFA 3EUWA 5FI5A 1AGNA 4ND4A 3N74A 4LN1A 3WGIA 4KQWA 3KLPX 2AEMA 3GDGA 4DMLA 3AWDA 3EC7A 5CHEA 1L7DA 1IPFA 1DAPA 2BFAA 3PLNA 2NQTA 1AHIA 1E0DA 2VHVA 2NTVA 1KVSA 3KB6A 1NQAO 3CPSA 1U28A 1VJ0A 2GPTA 2IZZA 3CZRA 3WICA 1PJQA 1FXSA 1JVBA 4DYVA 1KVTA 1I3MA 4I9HA 3OHSX 1OAAA 4D41A 5L4SA 3GHYA 2VWGA 4PLZA 1G0OA 3BMCA 5IDYA 4BNIA 1U9JA 1T2CA 3L9XA 1K3TA 1EE2A 1PGQA 4FSHA 5JCJD 3L07A 2RH4A 3WMXA 4YJHB 1BDMA 3G0OA 3PIDA 2IXBA 1EVIA 1UDCA 2DTDA 4HY3A 3K5PA 1P0FA 4XYMA 3TZCA 1FDVA 1U8FO 2FSSA 3ZWCA 1LLUA 4YACA 2ZK7A 4MVJG 1NYTA 1DPGA 1SOWA 1YL7A 2YQ5A 3DL2A 3R0IA 4J1SA 3CINA 4YXFA 4K9DA 1YOVA 2QRLA 5T8KC 3ZNPA 2JL1A 1OC2A 3LC1O 4B3HA 4OJNA 4L0QA 3FN4A 2C7VA 3DZKA 3TN7A 7ADHA 1AE1A 1FDUA 3W8EA 3FBGA 4WASA 1O5IA 2JAHA 4GSKA 2UV8A 3EMKA 2YZ7A 2PFGA 1GQYA 3VKUA 9LDBA 1BWSA 1M66A 4QTZA 1LSSA 4IGFA 3RVDA 2BLLA 3WB9A 3QWBA 5ADHA 5TLSA 4AJJA 4XIYA 2Y66A 3SLGA 1T25A 3GPIA 2AG5A 3MCVA 3GT0A 3PHIA 2C82A 4R1TA 3TRIA 5JO0A 1O9BA 2A94A 2EG9A 4IS3A 2O3QA 3F5QA 3I9JA 2HJSA 4CMGA 4R3NA 4D43A 2IZ1A 3VAZA 3KO8A 4NU5A 4PZDA 4ALNA 4Z9YA 3I4FA 3U5TA 4MIEA 1KVUA 5IN5A 2VHYA 2EHDA 4DREA 4E2WA 5JAMA 4URFA 1A7AA 1HDGO 4WEQA 5CG2A 4WJZA 1Z6ZA 1GZ3A 1LQUA 4PRLA 3ZHZA 3UKOA 2CD9A 1VJTA 1A4UA 3U3XA 1RM0A 4D44A 4EBFA 2CZCA 3WGHA 1R66A 4RVGA 4R41A 1DDOA 1YBAA 1Y9AA 4RVUA 1YJ8A 1ZVMA 3O38A 1OBFO 1QG6A 3ADPA 4FQ8A 4B3JA 1J6UA 5JCXA 3D4NA 5HS6A 2OZPA 4NPCA 4MVJA 2HAEA 3OIGA 3T4EA 4QFCA 2W4QA 4DLBA 3TWOA 4GGOA 4E6PA 4NZ9A 4RJTA 5H82A 3AFNA 3GRKA 1PSDA 5BSFA 2HK7A 2ZQYA 1YWGO 2NVWA 3MJCA 1UP4A 4OO3A 1P9LA 4YB8A 1DFGA 3IP1A 3LLSA 2G1UA 4FS3A 3JQGB 1JAXA 3CSDA 3X2FA 4YJGB 1E77A 3H9GA 1R15A 3OP4A 5DZSA 1MXHA 5DULA 2X58A 4R1SA 4Y6RA 3ZWYA 5AXBA 4L76A 4A5OA 3U62A 4B8ZA 1AXGA 1KY5A 3H5NA 2DU8A 3JQ9A 1UXHA 4Y6PA 1DC4A 5LDHA 4LRSB 1H2BA 4JJIA 2DPGA 4HXYA 3PLRA 1JW9B 4Z9FA 2O7QA 3LT4A 1PIWA 2EW2A 2EERA 3RC9A 1X7DA 1DSSG 2ZJ0A 3BYZA 1IULA 2YDXA 1MV8A 3DWFA 3RUDA 1E5LA 1NX6A 1QV6A 5ENVA 3S2IA 3C24A 3QWAA 1ZEMA 2HJRA 1M6HA 1E3WA 3ZWBA 1R6DA 4TWRA 2DM6A 5ES3A 4BO6A 4KP7A 1ADCA 3DAFA 3DMTA 4MPDA 4N18A 2O50A 1PU2A 1IHXA 3SJUA 3Q3CA 1XYGA 4TROA 2QG4A 1I24A 2FZEA 2CFCA 2ZIZA 2VNSA 3DAPA 3DBHB 3FWZA 3K2BA 3KSUA 4RPJA 5L95A 3IC5A 2OGUA 4NFSA 4XDYA 1EVYA 3DOCA 3JQ8A 4HWKA 1NASA 3DFUA 1NPTO 2E49A 8ADHA 4CL8A 1PTJA 5I7FA 2YUTA 4E30A 3W8DA 4BNNA 1WWKA 3EDMA 3AY3A 3ZU4A 3OH8A 1UP6A 4Y98A 3PIIA 3WTCA 4NBTA 3FPLA 2AMFA 1PQUA 1JWAB 3UGKA 2AHRA 2YFQA 4A10A 3CMMA 3C1OA 1GU7A 3C1TA 3PDUA 2NV6A 4BKRA 3ZWMA 1XIVA 2EGHA 3WWZA 3K9QO 4DLAA 3DC2A 2B5WA 2HUNA 3EZLA 4IY1A 4P38A 1QP8A 4F3YA 3RASA 2CUKA 4XYEA 5A05A 3UN1A 1QLJA 3ZU2A 4BNTA 2R6JA 2X5OA 3E1KA 4DWVA 4IDCA 1XR3A 1OI7A 5BSEA 1QXSA 3F1LA 3KHUA 1U7TA 4XD2A 4BVAA 3E9MA 4BNLA 5EPOA 4WLVA 1ID1A 2JD1A 4Z0PA 3GK3A 3K96A 3LLVA 3OM9A 2VHXA 5B4VA 5G0SA 1QR6A 4RPHA 4MIYA 1XEAA 4IZIA 3ZHYA 4ALIA 4WCFB 3ASUA 1ULUA 3PYXA 1EBFA 2O2YA 3OMLA 4N7RA 4PLGA 2C2YA 4TVBA 1U3WA 1ZK1A 3FHLA 3ZWAA 1N8KA 1ENPA 3ZW8A 4OOEA 1DBVO 3W6ZA 1RPNA 4NNJA 4XX0A 3PJGA 2HQ1A 3JQFC 2EKPA 1EDOA 4JNKA 3H5AA 3RJ5A 3ROKA 1EBUA 2WD7B 4WOKA 1EVZA 4B4UA 4KOAA 3H9EO 1D4FA 3ITDA 4CM8A 4BMNA 1IUKA 1QKIA 3KOUA 3QVWA 3SJ7A 3WLEA 1K6XA 2Q46A 3M6IA 1JN0A 1R4MA 4EUFA 5K6AC 2NVBA 2OOSA 3F4LA 5A04A 1DOHA 5A1TA 3PGJA 4IBOA 4FJ1A 4UEKA 1GR0A 1E6WA 3NX4A 2VRCD 2AQIA 3BMNA 5A03A 2Q1WA 1PZFA 1PZHA 1TEHA 3VHRA 4E33A 2HKIA 1N2SA 2Q1SA 3KM0A 3DB2A 1E6UA 2XXJA 5KVVA 4Q3DA 2WSBA 4IDFA 4MINA 1EEHA 1X0XA 2AW5A 1HE2A 3VZSA 1H5QA 3L0DA 4GWKA 3RD5A 2E37A 4LMPA 3WDSA 1ML3A 4CLOA 4ZA2A 1HLDA 4BL5A 4BGEA 2CY0A 3M1AA 3MOIA 2X23A 4HKTA 4ROSA 3S2GA 1U5CA 4FR5A 3KEOA 1FJHA 1GTMA 2B4TO 5T67A 3RKRA 3CKYA 4J4BA 1UZMA 1UDAA 4XGIA 3WQQA 1J5PA 1SOVA 4YVFA 5U4QA 2DBQA 1DC5A 1EUZA 1N1EA 4J43A 4UULA 5LCXA 3IJPA 1MG0A 4MOWA 1R12A 4XQEA 2WYVA 3JCZA 3DBRA 2XOXA 2XAAA 4WK6A 3AUTA 3B6ZA 2CSUA 3JTMA 4KWHA 4BQPA 3DZFA 5I9NA 2NU8A 1I30A 3D3WA 3P5SA 4CR6A 5BNTA 1N7GA 2PLAA 2UVDA 1C0IA 3H2SA 2YHIA 1Y8QB 3JSAA 3OEYA 4WECA 4PVCA 5CPFA 4L73A 1B3RA 2JD0A 5G4KA 1Y9EA 4XYLA 3WGQA 5G0WA 3AI3A 3EVNA 2ILTA 2EV9A 4ZQGA 4E13A 1DFIA 1LX6A 3ZH2A 3GN2A 4Z0HO 1PL7A 3VTZA 1DEHA 1M2WA 2AE1A 3RC1A 3A9WA 3AU8A 2D4AA 2Y0DA 4BNKA 2IE0A 5BR7A 3C3XA 2EXXA 2VHZA 4FFRA 1CRWG 3RROA 3ORFA 4G81A 2J6IA 3D1LA 1PJCA 4N5LA 1LDYA 3KETA 5A5FA 2W98A 3GR6A 3K2EA 4KQXA 1ZH8A 4BGUA 2NTJA 3ZN2A 2WDZA 3PYLA 4PVDA 4FBGA 4TRJA 1G0NA 1KEUA 1VSUA 3BXXA 4CUKA 4EYEA 4GAEA 5KVSA 4TMFA 3GDFA 4CLHA 6LDHA 1W6UA 3DTYA 3GH3A 1QV7A 3E5RA 4PGFA 5B1YA 3H7AA 1JAYA 1EFKA 4YA6A 5IG2A 4BHTA 4RL6A 4HNHA 3ZW9A 1BW9A 2E6UX 2UUPA 4RZHA 1E3EA 1NQTA 3O8QA 3ZCXA 1F14A 3RSHA 2BELA 1X7GA 3V2GA 5C37A 4DC0A 5A9SB 1BXZA 1P1RA 3KTDA 1V3VA 1OZAA 5DBIA 1NHWA 4CQMD 1P31A 3E82A 1DJQA 4FPXA 4F6LA 3I9LA 2BFOA 1I8TA 1ZUD1 2NWQA 3D4OA 1B8UA 1PWZA 1GCOA 4M55A 2VUSA 2OBNA 1AHHA 1C1XA 2EJWA 4NMHA 2JJYA 4IJKA 1Q7BA 3U4DA 1PEDA 4JBHA 4MDHA 1LDMA 3ULKA 4G5HA 2VNAA 2I67A 2PD4A 2WWRA 2QYSA 1O6ZA 2EKQA 4QO7A 5F5LA 2FR1A 3DOOA 4ALMA 4D79A 2JAPA 3K30A 4NR0A 2Z5LA 5BNIA 2R2GA 5A4DA 1HE3A 3MZ0A 1NQOA 2ZTVA 3K8ZA 4M49A 4OMUA 1L1FA 4BKQA 3FSRA 5IDQA 3WQRA 4E5MA 5A9TA 3ZWVA 3UHAA 3P2YA 3JYNA 4P22A 3L6DA 1IHYA 3FTPA 4XRGA 3BMOA 1HYEA 3IQDB 3OIFA 3R3JA 3TOXA 2CVOA 2O3SA 4YEDA 4BNWA 3HSKA 3HWRA 4UAGA 4XYGA 4O5OA 3WOHA 3QY9A 3JQ7B 5JYDA 4JJFA 1LLQA 2WMDA 5F1OA 3WGZA 5GZ1A 4ALKA 3FNEA 1YB1A 2GERA 1PGPA 4JXKA 1R4NA 3B1JA 3GG9A 5TNXA 1YBMA 1E7MA 4YQZA 1UXGA 4ALLA 1LC3A 1VM6A 1EQUA 2J5RA 3AM4A 2B36A 1OFGA 2AQ8A 3LF2A 5LC1A 3W4KA 3R6DA 1EUDA 3V1TC 3ZWNA 4A73A 2ZB3A 4D42A 4WLUA 4INAA 5TF4A 5KJ6A 2DKNA 1FDSA 5DBFA 5MGBA 3LDHA 1LLCA 3HB5X 1CQIA 4QECA 1T2FA 2X6TA 3VDQA 1V3UA 1Q0QA 1IL0A 1Z7BA 1WVGA 2E48A 3K92A 3FNHA 2P5YA 3OA0A 3GMSA 1NPYA 4GBJA 2YFHA 2FOIA 3ZDFA 2NLOA 3MJVA 4CUJA 4CM9D 3GAZA 3FR8A 1CERA 1I3NA 1R0KA 3HHPA 1GZ4A 1EFLA 2A4KA 3QVSA 4YJFB 3L6OO 1YO6A 3WIEA 3ZI0A 1ORRA 2CVQA 1I10A 2HSDA 1Z74A 4QT0A 4Z0TA 1ULSA 3JD3A 4CMAA 2VT3A 4OH1A 3PPIA 3SBOA 5L53A 4YJHA 4OHUA 5JC8A 4ZHSA 3RU7A 2CDCA 3E8XA 1B15A 3EW7A 2J3KA 1K0UA 2JFGA 4RZIA 1VL0A 1PQPA 4L9RA 3S8MA 3A06A 3W1VA 2D2IA 4PZEA 2Q4BA 4EITA 1SBYA 3ZV4A 2O3JA 4D45A 1DHTA 1U8XX 1YB5A 4IDDA 3OJOA 3QE3A 5JPIA 2RBEA 5BSHA 3SEFA 1XA0A 1ZO8A 2EGGA 1H94A 1T2DA 4NU6A 1ISHA 2I66A 1B0AA 4MJLA 3WSVA 1Q0HA 4YQYA 1GV1A 3TF5A 4FC7A 4R54A 4RDIA 1ISMA 4BO5A 4PG8A 3O9ZA 4H7PA 1GDHA 2Z1NA 2VTEA 4NI5A 4B3IA 1JU9A 3QRWA 1OMOA 3LC7O 5GMOA 4CLDA 2SCUA 5L40A 1T4BA 2Q2VA 2F00A 3L4SO 1LDBA 4P4LA 5TX7A 4K6CA 4BO0A 1B26A 3K73O 1VKOA 4R1NA 1VE9A 4HUJA 1X13A 4H15A 2D5CA 3BHMA 3AI1A 1ENYA 1QSGA 1S6YA 1O89A 3GPDG 5COBA 2GRAA 4HX5A 1HTBA 1LTHR 3V1YA 4PLCA 3BTSA 3PVZA 4BV9A 3JQ9C 4RQUA 1ZK2A 2FPGA 4XR4A 3F46A 1HZZA 1GQ2A 1WZEA 4NBVA 5F21A 1TT7A 1UJMA 2X9GA 2UUOA 1TXGA 3DXFA 1HSOA 1NR7A 1R16A 5IDWA 2IODA 3GGOA 2POQX 1MB4A 4D0RA 5L7TA 4J7XA 4BNVA 1V0JA 3DOJA 3DBLB 3L77A 3ETEA 4Z3KA 1RJWA 5GZ3A 5AOVA 1C0PA 4CM3A 3I9NA 1K6JA 3ANMA 3KYCB 1HE4A 3EZYA 3GRPA 1ONPA 2Y68A 1X0VA 3KYDB 1YQGA 3FD8A 3VPXA 3DMTC 4OSOA 3I83A 4GGPA 3TFOA 2O4UX 2XPCA 1K6IA 1F06A 3JQGA 1VC2A 2VYND 2HU2A 2Y0CA 3GY0A 3INTA 3QLJA 4J49A 4ILKA 4YJGA 4AG3A 4JROA 3TPCA 3K6JA 4RF3A 3C7CB 2Y1FA 1BVRA 4N5NA 1YQDA 1T2AA 2OORA 1DRVA 2NQ8A 4AJHA 3QWFA 1GEGA 4AICA 4E3ZA 1MC5A 4EEXA 4DPKA 1KVRA 3NV9A 4TKMA 2GGSA 4DIOA 2PD3A 3JV7A 1HKUA 4JCOA 4NFYA 3JQDA 4P4NA 2HMTA 5IAAA 1NWHA 4IDAA 3QSGA 4IMPA 4DVJA 3GDOA 3MTJA 1K89A 3GLQA 2B4RO 2CDAA 3PQFA 5KTKA 4E2YA 3IS3A 1LEHA 3IL2A 4NHEA 5ITWA 4DQUA 2JCXA 5COQA 2GUGA 3ONDA 4BNYA 1ZKMA 4IMRA 1IZ0A 3I9MA 2PNFA 4O63O 5JLAA 2B83A 4R1UA 5KJEA 2J3IA 4OM8A 1I2ZA 3CIFA 2O23A 3LK7A 1WW8A 2Y1EA 3QW2A 4K26A 5B37A 3TL3A 3DBHA 1EE9A 1P1HA 3E5MA 1N1GA 2DBRA 4AJ4A 3QVXA 4KWIA 1Y8RB 2AE2A 2W2LD 5FF9A 2NTNA 4PLFA 5TS3A 1ZXBA 4WPGA 4BGVA 2HMUA 2AXQA 3UUWA 1PL6A 4ND1A 1NM5A 1PWXA 1BGVA 4MP3A 1U3VA 1HSZA 4NJMB 2J3JA 1DIBA 2JCVA 4IINA 1E3JA 5U1PA 4J1NA 3EAGA 1JVSA 4MIOA 3ZGYA 4BNGA 4XB1A 4K1LA 1E7QA 3H9JA 4A27A 3M1LA 2PZMA 4BS9A 1C0LA 4UUMA 2IZ0A 4ALJA 3FTNA 1DHRA 2ZQZA 4OYRA 2A92A 5B4UA 4RLHA 4XB2A 5G0VA 2D1YA 1M6WA 4J0FA 2FSVA 2I5PO 2DPHA 5IF3A 4IDBA 4FFNA 4FJ0A 3JYPA 3IUSA 4NH4A 5KOIA 4MVJD 3JD1A 5HM8A 1ISIA 1D8AA 5A3JA 4BO3A 1J0XO 1WNTA 2C29D 1DIHA 3KEQA 5KWEA 3JQAD 2C20A 2ZJ1A 2I3GA 3TZQA 2ZYGA 5KVCA 3C1AA 1U1IA 3ASVA 3ETDA 4XKJA 2BGLA 4IJVA 3OF2A 3JQBC 5HTOA 1Y5RA 3B20A 1QYVA 1PZEA 3GVPA 2GN6A 1A71A 3PQEA 4WCFA 1KBZA 3AW9A 1O0SA 1YJQA 1J49A 3VPFA 3DQPA 3I6QA 1AUPA 5L7WA 1LQTA 5IXYA 1I2CA 4J9UE 3DONA 1VLLA 2WD7A 3GFGA 1PJTA 4R5HA 4CM7A 3JYLA 1F12A 3O03A 4DA9A 3NUGA 2PR2A 1ZK3A 1N92A 4PRKA 1HDZA 3VZPA 5TC4A 3WNVA 2HDHA 4A03A 2C0CA 4IUYA 1BXGB 4B7XA 1SB9A 2X5KO 4E5PA 1ZMOA 3AJRA 1BVUA 1GV0A 2VQ3A 4OQZA 4AJ1A 3ZNQA 5JW6A 1LUAA 3DAGA 4OL9A 5C5IA 3MJTA 2UYYA 3DZIA 3WIDA 4BO7A 3EY4A 3QVOA 1KVQA 3PWSA 1NQ5A 1DLIA 2NACA 3JQCA 5JDIC 2G76A 1CJCA 4QEDA 2C54A 2DLDA 3T7EA 4OXYA 3ANNA 3HG7A 3AM5A 4WLFA 3RQSA 5EJ2A 2PKRA 2GYYA 4YT4A 4E31A 1N5DA 2Y99A 2QRKA 3TZ6A 3QQPA 1PJ3A 1FF9A 3HDYA 3NRCA 5HWSA 4JP2A 4YAGA 4E4YA 3V5NA 2Y93A 1PJSA 3U4IA 2FP4A 1NP3A 1QYCA 4CV1A 2OHXA 1H93A 1P1JA 1NNUA 3VTFA 1B2LA 4M54A 3W4JA 2BH9A 3DZJA 1PGJA 4RCVA 1VL6A 1MA0A 3KSDO 3LF1A 4EI2A 2GSDA 5IDXA 5DBGA 3E9QA 2OP1A 3NDIA 3LT2A 2IEDA 4W4TA 4ITUA 4UEJA 4I5GA 4U6SA 1SNYA 2NU7A 2GF2A 4J91A 3KRTA 4AFNA 4XJSA 1Y8QA 2CF5A 1YBVA 3GA0A 4BNFA 5A3VA 3CXRA 3MJ4A 1Q7CA 2DBZA 4KDEA 1XSEA 1V35A 4FJ2A 2ZTMA 3H3JA 5JDCA 2OL4A 4BNMA 4BIIA 4BKPA 2P9CA 4IQGA 3TJRA 1HXHA 2GLXA 2NU9A 3UCEA 4BO8A 3A14A 5HRUA 1I3KA 3INRA 4II2A 3UF0A 4I9UA 2RIRA 3GFBA 1ISGA 4XWYA 3GEMA 2HMVA 4FCCA 4WLNA 3GUCA 4DYDA 1ZW1A 4WNCA 1ZCJA 4CPDA 1PS0A 1R37A 4QSMA 2GZ3A 1A27A 1H2HA 1QYDA 3UFXA 3NEPX 1NVGA 1ZJZA 2P4QA 5ER6A 2BKAA 3DZHA 3HE3A 2RHRA 4WLOA 2R00C 1B3BA 2AG8A 1PJBA 3WNQA 4BNHA 3PJDA 4J9VA 2BMAA 1TB4A 3NDJA 3H65A 1ZXLA 3QIVA 3ICPA 4CLRB 3TNLA 1EDZA 5CAEA 3IDSA 5A9SA 1U4OA 1SB8A 2IEBA 3AI2A 1MLDA 1Q0LA 4D3DA 4YAJA 4PIVA 3CE6A 4CV2A 2FR8A 4EJ0A 1IZ9A 4N5MA 2E4AA 4GPD1 4RF4A 1RKXA 4OAQA 1GEEA 5EN4A 1ZJYA 4HFNA 5K9ZA 1PX0A 5DP1A 1BDBA 2NADA 1CYDA 3PXXA 3ZV5A 3L6EA 2YV3A 4EEZA 1NAHA 2VT2A 3WTBA 4A26A 3D0OA 1LA2A 3S2EA 4LCEA 5GY7A 3RUIA 4DTIA 4CM4B 3E03A 2PA3A 2VZ8A 4E5KA 4KUEA 3JQAB 3AOGA 5C7LO 3IAHA 3T4XA 1UP7A 3LSYA 1WXDA 2AQKA 5JYEA 1UDBA 1V9LA 3ST7A 2HMSA 3GZNB 4WKGA 4YAIA 4CR8A 3JQBA 5THKA 5JMWA 3C85A 2DBVO 5L4NA 4UUPA 3SLKA 2X0RA 3RUEA 3F1KA 4ZVVA 3RWBA 2ZYDA 2PTGA 4NK4A 3STHA 4IZHA 4CV3A 2V6FA 4B7UA 4RF5A 1A9ZA 3IOYA 2VHWA 4ZQFA 2O3TA 3S1LA 4YWJA 2B4QA 2OUIA 3OECA 3WYEA 1IE3A 1EK5A 1SEPA 4J4TA 4XYBA 5KNLA 4U7WA 4R68A 3OA2A 2CMDA 1PZGA 3K31A 3PP8A 4IDEA 4CJXA 4D3SA 5CG1A 3JQ7A 5JY6A 3GEGA 3IJRA 3PQDA 3RJ9A 1KIFA 4JQCA 3WYCA 2C7GA 2D8AA 4FFPA 1MX3A 4RF2A 1QYXA 4LCJA 3F47A 5TSDA 1V6AA 1ADGA 3U9LA 1IPEA 2QW8A 2NSDA 2FPPA 3ZU3A 5JDIA 3DHEA 5COAA 4RQTA 3GQVA 3GGGA 3FNFA 3KBOA 1FDWA 4RVFA 1M76A 1LSJA 4Z9XA 3TZHA 3PI7A 4PLPA 2P68A 1WLYA 3ABIA 4HADA 3MWDB 2OO5A 5TRTA 4RO0A 2PK3A 4UVGA 1C1DB 3DFZA 2JHGA 4WLEA 2H9IA 5G0UA 2DAPA 3LU1A 1VL8A 3F5SA 3AY6A 3G3EA 1X15A 4C7KA 3FWNA 3PK0A 1E1LA 1LDEA 3FPCA 4HFMA 2PGJA 5F1KA 3FF4A 2D5AA 3RBVA 3TQHA 1U4SA 4IS2A 1I5RA 1YVEI 4OQYA 4YJFA 1EUCA 3ZWXA 1T1RA 2EP5A 2V6GA 1RM3A 2Y67A 2FHSA 1ARZA 4FW8A 3H8VA 2P4HX 4ZN6A 1YXMA 5HS4A 1V8BA 4I5FA 1ONOA 2IRWA 3NJ8A 2F1KA 5FYDA 4DUPA 3GVIA 4W82A 4R4JA 5I9LA 3LQFA 1H0KA 4LW8A 4UUNA 1LI4A 5TJ9A 1L7EA 1KS9A 1E6EA 5ICSA 4CMEA 5IZ4A 4UVIA 1ZSVA 3RC2A 1DXYA 3Q1LA 1VSVA 2PD6A 1ZK0A 4OKNA 3S55A 2DC1A 1NBOA 5DOVA 3UOGA 4ND5A 4NG5A 4PG7A 4PLHA 1LRJA 1PGNA 2DVMA 2YV2A 3WG9A 3C8MA 4XEHA 1HZJA 4YPOA 4BNJA 2D0IA 3WBFA 3AUUA 3LVFO 1VI2A 3NT2A 1QORA 5EESA 1QMGA 4EJ6A 3AOEA 4MVJP 3S2FA 2VZ0A 4OOFA 2JD2A 1H6DA 2AQHA 4JBGA 1C3VA 1MFPA 1A5ZA 1E7RA 3ADOA 3HN7A 3NTRA 4C4OA 1LNQA 4XJTA 3RIHA 2R00A 4FD3A 5T64A 4D7AA 3PDJA 1PJLA 1KC3A 4DIBA 3EVTA 1DRWA 1H9BA 3WGGA 2ZATA 4ZD6A 3RAJA 3HUDA 4WEOA 5FWNA 5CFZA 4OSPA 4JK3A 2Y1OA 5DDIP 2DQ4A 2B69A 3RCBA 2YJZA 4DBVO 1BSVA 5A5EA 1UZNA 1WMBA 2O4CA 2CVZA 3ZV3A 2GN9A 3NT4A 4TRRA 2X22A 2Y0EA 4NJOA 1NTOA 2CF6A 3AFMA 1JQBA 2DT5A 3TL2A 2G17A 2XXBA 2G82A 1Z45A 3PTZA 4R16A 3RUAA 1LBEA 6ADHA 4M87A 4EJMA 1Q1NA 4W99A 4J4HA 4CMHA 3BZUA 2X0IA 3SC6A 4TZTA 1NFQA 3OJLA 5DOZA 1Q2XA 4RPKA 3DBLA 2GZ1A 2X1HA 1QYWA 1MXFA 2VN8A 2J5KA 2FPIA 3KYCA 4HV4A 3DBRB 3UAGA 2GDZA 1ZFNA 1DRUA 3H9QA 1KEVA 4DC1A 3KYDA 1F17A 1XELA 3SVTA 4CMBA 4BQRA 1W0CA 1GPDG 1KEPA 2QHXA 4WGGA 2VUUA 1X1EA 2H5LA 3JD2A 1E7WA 1JTVA 5DCUA 3V8BA 3AY7A 2VYVD 3ZNOA 3GNTA 4TSKA 4WCDA 3WX0A 2VZ9A 2HLPA 3I4CA 5EINA 1UXJA 4RLSA 3TZKA 3P19A 1TT5B 4L4SA 4DGSA 2BGKA 4W6ZA 3CEAA 4HBGA 3WGTA 3O26A 1EZ4A 2VOJA 3PFFA 4IIUA 1DIGA 3P2OA 4ZGWA 4CV0A 5BQFA 1HT0A 4J0EA 2Q1UA 2EJVA 5G4LA 1KY4A 3TOZA 2A9FA 3I52A 4TRNA 4R01A 3O4RA 1QLHA 3GMDA 2NVUB 4DRYA 5THQA 2IDZA 3G1TA 4GLOA 4TKLA 5IN4A 3ICCA 1I0ZA 2E82A 4PFJA 5IZCA 5JSFA 2DTXA 4YT8A 1E7SA 4BKOA 5F3RA 3L9WA 5BT9A 4PCVA 2O3RA 3VH4A 5L51A 5EMHA 4HFJA 5DCWA 3LZ6A 3NDRA 1RM4A 4JP3A 3A1NA 1Y8RA 3RUHA 1G1AA 1P0CA 4FFOA 4H3VA 2GR9A 5TJHA 4CM9A 4U5QA 3VH3A 3VDRA 3I5MA 4ZJUA 4CMJA 4I5EA 1RWBA 3E18A 1A72A 4B8WA 4WCFC 3VPGA 3KSZO 1YQXA 4B79A 4YRBA 1GQQA 1Z75A 3QA9A 3OIDA 4GSLA 3GOHA 1HE5A 4NJMA 4XGNA 3LC2O 3VZQA 3ZHXA 1WDLA 2BFMA 2CDBA 1YDEA 2FRDA 4JX8A 4E5YA 1JWBB 1KEWA 4II3A 3FRJA 1XU7A 5EL0A 3U4CA 4Q3BA 1BXKA 4UVDA 1GY8A 3OBBA 4GX1A 5L9AA 3BHJA 8LDHA 1Z73A 2X8LA 2I76A 1T4DA 4IQ0A 3UH1A 4YJDA 4CQMB 4E21A 3BMQB 3RC7A 2EWMA 1KETA 1YL6A 4L74A 1ONNA 4O0LA 3HZZA 4U0KA 2OXIA 5EIOA 1MG5A 1I01A 3D7LA 4U6QA 1P44A 3L4BC 1P1KA 3PZRA 4J2HA 4TQGA 5CDSA 2PY6A 5CDYA 4PLVA 3H5RA 2Z1MA 3F9IA 2I9PA 4BNZA 3NGXA 4LK3A 4BGIA 4YRAA 4Y8VA 2GN8A 3DZBA 3ZV6A 2HK9A 3QV1A 4KUGA 2X0NA 2FWMX 2Q45A 3B1KA 4JN6B 4AJPA 3HJAA 4XRRA 3JYOA 2FR0A 4WOJA 2GO1A 4XQ9A 1N9GB 4CLXA 2NM0A 1GYQA 1GPJA 2OFPA 4FIZA 1R0LA 3RFTA 4XQGA 4YT2A 3G49A 1XDWA 4RPGA 3OSUA 1BXGA 3FNGA 1HDCA 4JLWA 2QYTA 4G65A 1CEQA 4QQRA 4Q39A 1O95A 4LVUA 3RFXA 3AM3A 2G0TA 3EHEA 2Y1DA 4I5DA 1XHLA 4AVYA 4TRMA 3U4HA 2GD1O 1CWUA 3HB4X 3AU9A 4QX6A 3NGLA 3DMYA 1P74A 2WEKA 5AYVA 1BG6A 5JDCC 3ROQA 2WYWA 3F6YA 3E48A 3G79A 3DHYA 2B0JA 4KDFA 2DFDA 4ZICA 5DN9A 3W4IA 1HDXA 3BHIA 2PH3A 5CDGA 2BFPA 2W2KB 3R3SA 4OXKA 4GQAA 4DXHA 2EF1A 3ON5A 3GG2A 1E7YA 5CP8A 4Z6KA 3IKTA 1JKJA 5CEJA 4CR7A 2VYNA 3CMCO 3M2TA 2WYUA 3IIEA 2GNAA 4Q3NA 4PG6A 2YV1A 1U5AA 5DP2A 1ISFA 1I32A 4K28A 3SXPA 2ZTLA 3MTGA 4IXTA 4NBWA 4NIMA 4PN3A 3DTTA 5GZ6A 1BHSA 4HP8A 1HRDA 3LT1A 1LSOA 1NVTA 2V6MA 1NXQA 4NK5A 3Q9UA 4IJUA 3ITKA 2X9NA 2VCYA 5JCJA 1DIRA 1EQ2A 3DDNA 4NBUA 3VOSA 4PLTA 4CM6A 5T57A 3PEFA 5CDUA 5FI3A 5BNFA 9LDTA 2Q4EA 3ENKA 2Q2QA 2B35A 4R51A 2UDPA 4DMMA 1MFZA 1IY8A 2FZWA 1DFHA 1T24A 2PH5A 3CTMA 4OGWA 3ZWWA 3H9UA 2A35A 2P2SA 4CMKA 4CMIB 4GKBA 3PJFA 5MDHA 4GX5A 3MJEA 4IM7A 3VZRA 3QVTA 1ZZEA 2IXAA 4ESOA 2DTEA 3ZHBA 4Z3DA 1HL3A 2W2LA 4G2NA 3FBTA 2QZZA 1C0KA 1P77A 4LSMA 4R5MA 5ER9A 3WYBA 1LXCA 4WUVA 2GASA 3WJAA 3PWKA 3RU9A 1LSUA 4W9NA 1I3LA 4CLRA 2EIHA 3P7MA 4J2OA 4CQLB 2PGDA 4BNUA 4LGVA 4Y67A 1HYGA 1WMAA 1W4ZA 4CM5A 4BOYA 1E3IA 5JAQA 4FC6A 4X54A 1YE3A 4U0JA 3X2EA 2P5UA 5G2OA 3PFWO 4BB5A 4W7HA 4J7CA 4BNXA 3DBVO 1P45A 3TDKA 4F6CA 3IKVA 1HWYA 2GCGA 4M86A 4AL4A 1UH5A 5ICMA 2C2XA 3GAFA 4BMVA 3FCOA 1YB4A 4IXWA 3ZNNA 1Z82A 4XR9A 4CM4A 3NAQA 3BTUA 3VC7A 4DLLA 2EP7A 1YL5A 1E1MA 2X86A 4EUHA 3QWIA 3JQAA 4YT5A 3WXBA 4E5NA 1HDOA 3KXDA 1DC3A 4DPMA 3U49A 3GNQA 3NTOA 1XLTA 4CUZA 5DNAA 3L4BA 3GZNA 3Q2KA 1M75A 1NHGA 1YDWA 1YGYA 1E5QA 4DL9A 1XGKA 4DQXA 5A06A 2RCYA 2JKVA 3IUPA 4FDAA 4E2XA 3BA1A 2BF7A 3VH2A 2QZ9A 4JGBA 2RH8A 3OQ1A 1XWFA 1JDJA 4XDZA 3I1JA 4LMRA 1Y7TA 5TQVA 3OJEA 4D3FA 4M89A 4F46A 5EQFA 1GUYA 4EZBA 5HA5A 3BMCB 3ONFA 3GF4A 2EKLA 1H6BA 2HRZA 4YCAA 3VVBA 2DUUA 4GVLA 1ZSNA 2TMGA 1E3LA 5FFFA 5JY1A 3WMWA 1SZJG 3ENNA 1GAEO 3R1IA 1F0YA 1EK6A 1WP4A 2LDXA 1NWCA 3RUFA 3KLMX 4BO4A 5I8ZA 1NPDA 4L8VA 2WTBA 3VPSA 4ZRMA 1UUFA 1V3TA 2O48X 3VKVA 2BHLA 1SC6A 3OICA 1ENZA 3F4BA 5C7IO 3UICA 2B5VA 4MVJH 3HDQA 2Q99A 1TI7A 1MC4A 3MOGA 4TZKA 4UVHA 5KJ1A 5DCYA 4CMEC 1YOVB 4RORA 3A28A 3H4VA 4LVCA 4ND3A 1S7CA 4CLEA 3PHJA 2Q1TA 2H63A 4HFRA 5L3ZA 1VKNA 1Q7GA 3HQ4O 3D4PA 5CEFA 1H9AA 7MDHA 4MKRA 5K0ZA 1C1DA 3KYBA 4IGEA 2OMEA 3QJ5A 5JC1A 4XIJA 2HCTA 3BIOA 1X14A 3JQEA 4XZ3A 4GX0A 4C7JA 4YRDA 3G1UA 3AOEC 3W8FA 1PJ2A 1ZIDA 3WLFA 4QO8A 3QWHA 1LC0A 5B4TA 3FR7A 4J1QA 4O6VA 4ZU3A 4AJLA 4R9SA 3ZU5A 1Y81A 4QXMA 4YR9A 5I8WA 5ILGA 1Z7EA 3CUKA 1P3DA 2RHCA 3V1UA 2B37A 2FY8A 3OJ0A 1BTOA 2G5CA 1PS8A 2ZB4A 1XKQA 3HNPA 4IDGA 1YRLA 3RI3A 1AN9A 4GH5A 1U3TA 1T2EA 1QRRA 4EUEA 1D1TA 2P9GA 5T8KA 4E0BA 3OEWA 5A9RA 1R0SA 3HDJA 3JQ6A 4PZCA 1GFSA 3PHHA 5IFLA 1ZMTA 1B16A 2YY7A 4R9RA 2LDBA 4MO2A 1D7OA 4UVEA 3N7UA 1NFFA 1BMDA 3DO5A 1UXIA 5H83A 2WE7A 1WDKA 5ILOA 3PGXA 1B8VA 3PHGA 3PJEA 1SO8A 4FFMA 4IPTA 1LRLA 1DB3A 1VPDA 2Q2WA 2ZCUA 5ENDA 1F8GA 4D0SA 3AUAA 3D3EA 1P1FA 3JYQA 4MP8A 4IQ8A 4YAKA 1HDRA 4M1QA 4QFDA 1D3AA 2CNBA 4FFLA 1KC1A
chains in the Genus database with same CATH superfamily
3C5HA 3Q2IA 3C3PA 1V6CA 3FHJA 3W7VA 1AKNA 4V38A 1K7FB 3WYNA 2H00A 3I6IA 1C1YA 4M0PA 3UW3A 4KBFA 4L75A 2CDNA 4DZZA 3L79A 2FCAA 3MN1A 3OX4A 3HUTA 1RXYA 1O94C 4AD8A 1JMKC 4CEIB 5TPWB 1NAIA 4EG1A 2PSDA 3EGEA 3SS8A 3EQZA 3BSYA 1IN1A 4KMSA 1XWWA 3VR5A 5IBCA 1Q95A 3IUNA 3R5KA 4IKEA 1LLDA 4FGWA 4CFZA 1J2RA 3WB2A 5JSHA 1K2WA 3EVAA 3GLGA 3GUHA 1XZQA 2C5SA 4NBRA 5HKLA 2JEZA 3CPJB 4Q9KA 4ON9A 4HS4A 1MAVA 3BULA 3OTWA 4LRUA 3CVVA 2HWXA 5F76A 2EZ4A 2P7IA 4GM4A 3T61A 3KQSA 4BP3A 1E89A 2NNWB 3OQ6A 4L95C 4OM7A 3SC4A 1XKXA 4OYHA 5K8CA 2QGZA 5DISB 2CJWB 2HPAA 3D6MA 3UATA 2NT4A 2PXCA 3THWB 3I8OA 4Z49A 3QHAA 3FMVA 5EXSA 4BXOA 2ZZMA 4TM8A 1VYUA 1P4HA 3MRXA 3VH1A 4C2UA 2BE9A 1VCHA 3GVXA 5KWVA 1ORHA 5HXAA 4HVLA 1E1NA 1RRFA 1QJ4A 5EKDA 2FEOA 5BYJA 1XZCA 4XTRA 3KOMA 3DEHA 5AHRA 4Y3UA 3SOZA 2VWQA 2PSEA 4ND2A 3GUYA 1MR3F 1HYHA 3L1KA 1II0A 4YAEA 3F4KA 1GYPA 3KWLA 4I9FA 4II7A 4TV8A 5BO5A 4OHZA 2KW5A 3D81A 3REQA 4R3WA 4LF6B 4E5UA 4FN4A 5K8VA 5AVOA 2ADMA 2LIPA 3CWZA 4R0NA 1P2BA 3EZNA 3ANLA 3MWFA 5A62A 2OK8A 1CC1S 3THYA 2H5IA 3I2JA 3U7EB 4Z51A 4H7HA 4RU1A 1XXLA 3GRYA 2F55A 2YXEA 1SOUA 3D8UA 4FE3A 2VWPA 1Z5PA 3L18A 4ZT6A 4M1KA 2O14A 2YHBA 2JBAB 1GR1A 3QG1A 4Q4HB 4ZI7F 1DLJA 1I36A 5JZMA 2EGUA 1PHPA 1JTFA 3F3KA 2GPJA 1ZUNA 1IM5A 1E4EB 3SR0A 5LIPA 4KQEA 4Q9LA 2G9RA 2PZAA 3QF7A 1Q44A 1TT5A 3GEDA 3AK4A 1B43A 5JVDA 2X76A 2C5EA 1D6SA 4C4SA 5F3WB 4UEOA 2GZAA 4I55A 4N0DA 2QDXA 1GSHA 1WB4A 5AO9A 1KIMA 4XX1A 2PKQO 3AIMA 2C8JA 3D1JA 4QASA 3T1QA 3UY4A 3ME5A 4Q1AA 2DSTA 2ZCVA 3CZMA 1J4AA 4L1KA 5ALJA 4KDCA 4D6XA 4EZEA 2XCUA 4P4GA 4C7MA 5CRIA 1JNXX 1Z0JA 3GNSA 1NUQA 3BB3A 3RDPA 5G3YA 3UB4A 4B3BA 3BDIA 2NVUA 2CWWA 3AWIA 4EW6A 1VOTA 3Q0IA 2KS6A 4FR2A 1ZA1A 4MVJM 4ZRNA 2O2SA 5G53C 1YUBA 3Q8LA 2FPSA 2V65A 4NHOA 2X1LA 4CGYA 3TQCA 1SK9A 3NHZA 3QI2A 3N0TA 1TZJA 2BKEA 2XR1A 3ZTWA 1SU8A 2E85A 4RHFA 2VWHA 2W8BA 3OZ7A 4GR9A 5DSTA 3B1VA 3DVLA 2PZJA 4RV9A 2HHJA 3GT4A 4GW3A 3MFYA 4K46A 3TFQA 5BV7A 3LKDA 5EUBA 1OBHA 2FUEA 4HMOA 2R8YA 1K27A 1V5IA 3RFUA 1ODTC 2MSLA 4TUYA 3DLHA 1ZN9A 5JQGA 3OZAA 4RYLA 1XU9A 2MDTA 3HCEA 4QNMA 2WPDD 2ZB2A 1CETA 1W29A 2VP2A 2RAPA 3NIBA 4JOCA 4O8CA 2X3YA 4O1MA 2HMWA 1NVVR 3L7KA 5BN5B 3PGMA 4UUOA 3OUTA 1T3GA 4LJYA 3QX3A 1VRWA 5J1TB 3I9KA 2DWQA 1ZQ1A 2ZKLA 2YW9A 4PGHA 4XSGA 4EA6A 3I3OA 1EXNA 5CXUA 2OZVA 3ORRA 2QX7A 4JVLA 4NVRA 1WZUA 2HR1A 3KKQA 1SU6A 4AXXA 1MVOA 1MF7A 2H08A 2RK4A 3H2ZA 5H81A 4AKHA 2JRLA 2Q49A 4MMXB 2JGKA 1SCUA 3MINB 1QP0A 3THXB 4TN1A 4E32A 5CA1A 4KSCA 2V3VA 2ZTUA 2PKQP 3GVHA 5BN3B 1B14A 2BFDB 2CBGA 2Y4NA 3HZHA 3HYLA 1DQSA 4RVSA 4ZMBA 3ZBQA 1MUUA 2QRZA 1YFLA 2ZB8A 3R7SA 4BMSA 2ZYAA 4BKUA 1N5IA 1E92A 2XWPA 1JJIA 5IWAB 1DRJA 3AL3A 3NCHA 4CQMA 5K4GA 2O8DB 4DV7B 1ESZA 1OZ0A 3AHFA 4X93A 4I3GA 5D84A 3LY5A 4OU5A 1B8OA 2WJPA 2G1JA 3KKKA 5HOEA 3T3IA 2VTDA 3IPXA 1EB8A 1GGKA 4ZQHA 3OJFA 2QJRA 4NAHA 4X20B 3ZWOA 2VF2A 1BRMA 3UMYA 2AJ8A 5JFOA 1GPKA 1J2TA 3VSAA 1WSWA 2GETA 5BVHB 1ENOA 1PI3A 2ZBPA 1U2GA 2P9TA 3L1JA 3D2AA 3F3SA 4HMPA 1RYEA 2UVQA 4IIXA 4ZOEA 5ALZA 4LZNA 5TT1A 1AMNA 3BAZA 2PYIA 3QKSA 1EGQA 4NFHA 4KTVE 4I14A 3WS7A 5AHOA 1KAQA 1W73A 3KKEA 3W3AH 3ZK7A 1GZ6A 1N2CB 4Y7DA 5JBIA 2WBLC 1JILA 2GBLA 4PYQA 2GJKA 3A4VA 1M6EX 3PEWA 1PZNA 1TCCA 2PGIA 1R0WA 3QFFA 3O2NA 5A6SB 4BN5A 2JFFA 3GJ4A 1IB6A 1E2KA 3D3WB 5DT9A 2G28A 4BGDA 2H5EA 4LTMA 4HNUA 2BFEA 2YHIB 3KKOA 2I03A 1JZTA 4D96A 1KO8A 1GG5A 1W0KD 3UXHA 5JXWA 1Q7TA 3MJSA 4MV0A 4RANA 5CDHA 5JISA 3UJHA 4PLYA 5G4KB 4W5NA 2BZ1A 4L5YA 3S7ZA 2NZ2A 3IP3A 1FQOA 2QSUA 4RKWA 1Z29A 2C59A 4KU4A 1RS0A 3GBVA 4UJ3A 5F7ZA 5BRNA 2QAGA 1CQJA 2I65A 1DBPA 2GCOA 1SFRA 4GOKA 4Z1MA 5BURA 4TT3A 1A8QA 4EIWA 3CBQA 3QX9A 2MWMA 4FP9A 2IYYA 3I72A 4FNOA 4QDKA 2YIDA 4R1PA 3AINA 5T4EA 4D99A 4BMDA 4YPVA 2V7PA 3D2LA 4DV1B 1K1EA 4PICA 1X80B 3RKUA 2ZAGA 2RGGA 3ZDZB 3BBPA 3BTOA 1OT5A 3EH2A 2AXNA 3NBKA 3KKMA 1Q11A 4MUEA 2FZGA 5TGTA 4ZTUB 3I45A 3TJMA 5LQDA 2HNBA 5I51A 2XVZA 4MRPA 2Y1CA 1EH5A 5E4JA 1OWMA 4GXQA 1T2NA 4B2YA 1Y3IA 5KQLA 2JHFA 2ZYWX 3HBMA 2QGNA 2BKUA 4DQVA 3B3FA 3OT5A 1XZIA 2FDRA 3G2OA 2AOVA 2CXUA 3COWA 1EFVA 3LQRA 3N8HA 3NYWA 4RKFA 4RPLA 3RSOA 4OPMA 1MD9A 2GPYA 2H7YA 1XWIA 4PSDA 2P9EA 4CKZA 3MMXA 3RFVA 1OA1A 1E2LA 3VVCA 2GHTA 2HIMA 4DHWA 3O8QB 1PR2A 3RSZA 4EX7A 1NXPA 1TYEB 5JI3E 2AW3A 4HN2A 4KPUA 2EJBA 2OBYA 3AP2A 3E4CA 4RS3A 3T3PB 2AR0A 1V1RB 4OXNA 3IOCA 3ANSA 2J5QA 3M7IA 3JASA 2FN7A 1DO2A 1MABB 3NJ4A 4QSHA 4ARCA 1KAHA 2PX0A 4E7OA 1L5VA 3B70A 4POAA 3K6RA 1P0IA 3DO8A 1KI3A 1U0GA 4K9SA 5I7VA 2OBFA 3MCWA 1ILWA 2ZDHA 1GUZA 1RHMA 3MEQA 1GM5A 1JG6A 1JA9A 5KKCA 3NBXX 3JD4A 1KDYA 1L1QA 3ROMA 4DCJA 2DUWA 3K9LA 5EJ6A 1U1GA 4MRMA 1JIQA 4C7OA 1OFHA 4W7IA 2YHUA 4UATA 2XUFA 3IAFA 5JS2A 4I4TA 4EYKA 3P2IA 1IY1A 1CF2O 2JIZA 4C07A 4YIHA 3BH0A 4LRWA 3ABSB 4NWIA 4Q3CA 1B74A 2WAOA 4EHJA 2VJCA 4BDTA 1BH2A 1Y6QA 4N1AA 5HF5A 3BD8A 4ZQBA 4XSVA 4YP0A 1P29A 3VR0A 4GYWA 2PZKA 3CHYA 4CHTA 2OZLA 3O7MA 1MJ5A 3D8HA 2IHUA 3DA8A 3HPRA 4I9NA 3U37A 1D2GA 3VO2A 3NHPA 1OPXA 4Q21A 4AY6A 3HVUA 3R41A 4PG5A 5CBPA 1ZI6A 1LY1A 3PE3A 2LKCA 3R7WB 5DWQA 1E20A 1XK6A 3D5TA 4C5AA 3BMOB 1ETHA 2QZJA 2HEIA 5E6UB 1WKCA 2B78A 1GTSA 1T6NA 4JQOA 1KTVA 4TTIA 6CHYA 3KV1A 4G1VA 2JHCA 5AXDA 3G7UA 4QUAA 3S1SA 4JI4B 3LNCA 3ZDBA 2J3HA 1HLPA 1UJ5A 3IP6A 4CRWB 1EINA 3D54D 1V4NA 5DI9A 2BGMA 3LCJA 3LIIA 1IOLA 3WK4A 3OZIA 4BUCA 1N1DA 4ZMRA 1MC8A 2XCRB 3DXYA 5LYJF 3AR9A 4WV3A 4XWAA 2XUOA 4ALLA 1U2TA 1E9AA 3DR3A 2FI1A 3AUSA 3D6HA 3CKLA 3N58A 4P4SA 3CH6A 4PC6A 3Q0EA 2C57A 3HDVA 3M3DA 1R4NB 1RZRA 2AH5A 2GT1A 2P8JA 1RWKA 3EVZA 4IDNA 2F3TA 4EA9A 4ZOLB 2GD0A 3Q40A 1WSBA 5DN6A 3X1JA 4J0DA 4I3FA 4RFSA 1UEIA 3B9RA 3CIOA 5I47A 3UMSA 3A1DA 4TYNA 5DYTA 1M67A 2C4KA 3QYFA 1TVEA 2XB4A 1B93A 1TUGA 1UMBA 1WDTA 5KQSA 1DNPA 2PPLA 5H0IA 3M9WA 3TLYA 4DM4A 3HHEA 3AF3A 5FI5A 3A3PA 1I7SB 3LBNA 2FU5C 1I80A 3N74A 4FCVA 5C1OA 1QHIA 2A86A 4KQWA 3KLPX 3Q3VA 5GJVC 4HDSA 4O4JB 3GDGA 5HIAA 1AF7A 1IPFA 1HQDA 4IV5A 2WW8A 2BFAA 4QUHA 4RHUA 4ZU6X 2NQTA 1FFXB 3PGA1 2OE2A 1E96A 3V4PB 2B8EA 1NC3A 4FX5A 1V5WA 4ZO9A 3E81A 1OXBB 5F7XA 3CPSA 2IZZA 1NOKA 1QVWA 3DLTA 4BZZA 4A2PA 3C16C 3L1IA 2C5LA 1Y34E 1KVTA 2AN3A 1E2FA 3ND9A 5LP6B 4RE5A 2H1LA 1EI9A 2WM2A 3EIWA 2M6RA 2VRWA 1UBOS 2FFBA 2OFXA 3LPAA 4KGZA 4BNIA 4HSEA 1U9JA 5FWXB 3RYIB 1T2CA 3L9XA 1IATA 1K3TA 2ERCA 1EE2A 2F3SA 4B3CA 1Q83A 1QOPB 1O54A 3CGGA 1KJZA 5CITA 1U8UA 2TS1A 1NXTA 4ZAXA 3WMXA 2JFPA 1BDMA 3G0OA 3PIDA 3EDCA 2QRMA 1EFPA 4M3NA 1QVZA 1UDCA 1VJDA 5FOSA 2AOWA 4HY3A 1A8UA 3UUEA 4L8FA 1G9TA 4KQIA 4Q4AB 4TV9A 1M72A 3LX5A 2XWSA 3SQOA 5BW8A 2BTQA 1AMUA 6AT1A 5BRJA 2YIJA 1X7XB 4YACA 3JY6A 1NBWB 2YV5A 4EGAA 4P0QB 1DP4A 1SOWA 1YL7A 2HZBA 4IX1A 4J1SA 1T2UA 2CYBA 3RWOA 1KSJA 4YXFA 2GLTA 4YCNA 3H42B 2DH6A 1JXAA 4I6EA 3DT9A 2XTMA 4B3HA 3FN4A 2C7VA 3TN7A 3MLBA 1FCJA 4ZT2A 2QRUA 1EA5A 1GPWB 2ZSUA 3EAQA 4RZ3A 1O5IA 2JAHA 2VA9A 2ZSEA 4GSKA 4RHTA 3GDWA 2YZ7A 2PFGA 4G0PA 1KP3A 2FW6A 3KQLA 1A2OA 1XZNA 2F8MA 1SKAA 3IV9A 4E1AA 3VZBA 2G88A 2CLCX 4BQIA 5TLSA 2GK6A 1CJMA 2C5HA 2Y66A 5D85A 4BJ5A 4BMOB 3MCVA 3QJYA 1NONA 1ORIA 1KQGA 3Q87B 2C82A 3E9RA 4K6HA 4OFXA 5JO0A 1O9BA 5G1NA 4IH1A 4PU0A 2O3QA 2XWJI 1BE6A 4PQEA 4EQ6A 1VYHA 3BX1A 3OPNA 5FX2A 5ALKA 2IYSA 3B51X 3VNQA 4CMGA 4R3NA 2QR2A 4CT0A 4D43A 2G9VA 2FLKA 2Y1XA 4MGKR 4NU5A 4G4IA 3DFKA 3WNBA 2C42A 5JNSA 3KVRA 5KYXB 4MIEA 1KVUA 4JJKA 2NP6A 3K9BA 2YXDA 3EUAA 5ALGA 3OU7A 1DUSA 1JG1A 1PFVA 4CG1A 5IAJA 5CVJA 3L0CA 5JAMA 3NNNA 2QSJA 3LNTA 2I1WA 4R83A 5WRFA 2IYAA 4NBNA 4BCBA 1Z6ZA 1LQUA 1SR8A 2A4MA 2P79A 5IK2A 3SE7A 3KT6A 3ZWKA 1N1MA 1RM0A 3WGHA 3EEIA 1ACMA 1SCKA 2FAXA 3P9PA 4TWBA 5F9HA 1NRWA 1XO1A 4EELA 5GJBA 1KKMA 1XRMA 1KRWA 3O38A 1OBFO 3ADPA 4ACAA 3LPDA 3QVUA 3D4NA 3L02A 4MUJA 1UM9A 1V4VA 2B30A 3CCCA 2JLAA 2HAEA 3OIGA 4LZAA 4MVJA 1T9GR 2W4QA 4QFCA 1KJIA 3ZOZA 4DLBA 1FMTA 2VYFA 3A7EA 2QM0A 4EHLA 4RJTA 2C2KA 3K0KA 3GRKA 5H82A 2J7PD 2VL7A 4MIKA 5DLEA 2YRWA 1JTEA 2PSSA 4TLBA 3HO6A 8GPBA 4YNBA 3RHFA 4TLLB 1YC5A 2ZQYA 4HEJA 2FZKA 3JAKA 2IS4A 1HFEL 1M8JA 1QHYA 4RMHA 1UP4A 1NNI1 3CXUA 1U7DA 4LZWA 4MYDA 2HBQA 2RSLA 1JSLA 1XQWA 2IFTA 4WJKB 2HNKA 2O8EB 4Q9AA 3RYTC 5HKOA 5BSMA 1ISPA 4D5GA 2XYVA 5DZSA 1MXHA 2OCXA 1M6VA 1T5LA 2ZYHA 3MUFA 3HP7A 4A5OA 4B31A 4Z99A 1T9CA 1J33A 5CT6A 4YYEA 4AZTA 5DBEX 2LRHA 5B7QA 2GBCA 3MHTA 2DU8A 1IN4A 1SZCA 1GKUB 2PRIA 2MCFA 1PUXA 5C46F 2QN8A 4QGSA 4IX9A 3FFXA 3O4GA 2WTMA 3V8EA 1GCIA 1H2BA 4EBBA 4QBHA 2DUJA 3EMDA 4W8HA 1DI0A 3ZXXA 4ZYTA 2Q1XA 3GA5A 1T3TA 3QX7A 2ID4A 2UYGA 1PIWA 4RUKA 3KJFA 3SKXA 2D3WA 2EERA 2G9ZA 4FFSA 1GUBA 1VCIA 3TQOA 4AS1A 1HT3A 2WFLA 2VXYA 5AW9A 3AT1A 3PG5A 4Q4CA 2VJPA 3TTUA 1MV8A 3F8SA 3RUDA 1IJBA 1QV6A 4DJDC 1J22A 4NS1A 2AUTA 4A36A 3S2IA 4HH3C 2WAXA 3LBYA 1PG2A 2HJRA 3PSHA 1NLMA 1YT5A 4JVOA 4LOIA 3V80A 3ZWBA 1MTZA 4TWRA 2V0NA 5CXXA 3K0EA 2ODBA 2VATA 3KOYA 1MZVA 2DM6A 3Q7EA 2AT1A 4MPDA 4EKDA 5K7SA 3C3WA 3QPWA 1L5QA 1IHXA 3JR3A 1XYGA 2FZEA 4YFYA 1UOPA 1SC4A 3DAPA 4IUBS 4AIRA 1BMFD 2ANBA 2VHQA 4NFSA 3UV6A 3AFHA 3DOCA 4GDMA 1NASA 3BGSA 4YMGA 3DFUA 2Z8XA 4BNDA 1JAZA 2PUGA 2A1IA 4V03A 2AOUA 4IIJB 3BDAA 1N77A 3OZTA 1CUUA 4GYKA 1E98A 3FOWA 3GWGA 4NCHA 1LF0A 2R60A 3EDMA 1LF5A 3OWXA 4LJ7A 4M0MA 3COYA 4UZFA 3WGMA 4OLAA 3OH8A 1R6UA 3PIIA 4NBTA 2EFEB 3OCCA 3DW1X 5FTMA 1ELOA 5EXPA 4UUQA 3IRVA 1YRHA 1GU7A 2A1UA 1AGPA 1W75A 4BKRA 1NYQA 2CBXA 2V4ZA 3G8AA 3QPAA 1M0SA 4EUKA 1R8JA 4UU0A 4MQ4A 3C1UA 3DC2A 2HUNA 3JR7A 4P38A 4V0MA 5J2UF 2BEWA 1QP8A 4REQB 1JPJA 4F3YA 4YV1A 5ALVA 3IRUA 1O2DA 4D4JA 2IU3A 2ZRFA 2R6JA 3V33A 1YDFA 3D5EA 5HMMA 1Q14A 4C0KA 3FCEA 1U7TA 4EB6A 5LJIA 4BVAA 2XH8A 2IY7A 4BNLA 5KWSA 4DMFA 2VK8A 1ID1A 3KAPA 3PD1A 4L4YA 1FNSA 2GEUA 5LLDA 2X1MA 2R8XA 3BGVA 3CW2A 4X1IA 3TRHA 3KUUA 5T4BA 1QR6A 2HSZA 1TEVA 3OPMA 5BT8A 4B6QA 1TFUA 1N33B 4HOYA 4ER6A 1CULC 1BROA 2ILVA 4PLGA 2GN0A 1V5FA 2KPOA 2C2YA 1JSZA 3IUJA 3WLRA 4KXWA 3E27A 3ZWAA 2NP7A 5CB4F 4FGUA 3DUFA 5A2QA 2WJIA 4MWCA 3RS2A 2Q2NA 3DWGA 4LNUB 1U2GC 2UZAA 4KI7A 3THRA 2IS6A 3DL7A 3ZJ5A 1L7OA 1WRBA 3WL8A 4NMXB 2UZ1A 3VGPA 2WM8A 4U2FA 3N2KA 2P3SA 3RJ5A 3ROKA 3V1MA 3KVNA 1XMPA 2HRRA 2WD7B 4OA8A 5J47A 2R65A 1PT6A 2H4WA 1GGVA 1T0PA 4CM8A 1D4FA 5LXTF 4GEGA 2DT8A 1YAJA 1QKIA 2GTIA 5AJXA 1REQA 3UNXA 3JX9A 4KPGA 4BMXA 1YS2X 1K6XA 2Q46A 3M6IA 4EUFA 3KJHA 2V9ZA 3RR2A 2NVBA 3OG9A 1E5DA 1WQ1R 2O5EA 1DOHA 3L7JA 3PGJA 4X5OA 5A1TA 5E95A 1QGED 3NXKA 1TM5E 4EQZA 3P52A 3UPTA 5A03A 1V26A 3BMNA 4OF4A 3X1YA 4CKEA 1P8JA 1PZFA 1PZHA 4Q34A 1N9KA 2IBMA 1ICIA 3N8DA 3NNDA 3D4LA 1TF2A 5IMBA 4E33A 3VU9B 4MW0A 2X1VA 2EYUA 5I4IA 1E6UA 4PZYA 5IH3A 4IDFA 4MINA 3KJEA 1EEHA 1B1AA 2Y6UA 4K9NA 4WFIA 2WAYA 1EM8A 1H5QA 2ZAMA 4GWKA 2QAGC 2E37A 3WDSA 2P2GA 3SR4A 4ZA2A 1QKJA 3N8IA 2MMGA 3OQPA 2CY0A 3S2GA 2X23A 1GRCA 4QUIA 2P9BA 1N9ZA 4FR5A 4LYHA 4C88A 1RYZA 2GBGA 3AUYA 3EEQA 3KEOA 3RAPR 4LSGA 1GTMA 2B4TO 4ND8A 3CKYA 2IHVA 3QKIA 1APBA 4GPEA 1VPEA 2XVAA 4D0NA 1UDAA 2BONA 2W6QA 3FNQA 5U4QA 2BZGA 1NSYA 1K7SN 1KI7A 2CHVA 2DBQA 3IT1A 1EUZA 1P7CA 4J43A 1E4VA 1QZUA 3ONVA 2LCFA 2JJ2A 3HCCA 3KE9A 3O4IA 4WZBB 1VDZA 1FFCA 3NWBA 4F4FA 3KZCA 5TVGA 3NC4A 2XOXA 2XAAA 4CKWB 4D4MA 5LP6C 2DQKA 4LV6A 1NGSA 2ZSIA 4MUFA 3L6UA 3TBFA 2O7VA 3WWCA 4BQPA 3PDIA 4MUIA 4OJQA 4PCLA 2NU8A 4CR6A 4TWZA 2A1TR 4FFWA 4H7EA 3H2SA 1NRXA 1G5HA 3FLEA 4HDCA 5DSXA 2B1RA 3OEYA 2RI6A 4QYIA 1SIUA 2C4TA 3C6XA 4PVCA 5FBHA 4AUMA 4EGQA 4BX3A 5K01A 1SC9A 4BQFA 3FYHA 1YR6A 3WGQA 5KQPA 4KKVA 3C3BA 1ATZA 2FXVA 4PG8A 1DBRA 1QIHA 2ILTA 2Q3DA 2VHEA 1QZ3A 3QEKA 4ZQGA 2ZRHA 3N3BC 3T7KA 3ZQ6A 1CJBA 3EPLA 3ZH2A 1NY6A 3GN2A 1GCAA 1EHIA 3VTZA 2AE1A 4MMYB 3PCXA 2OB1A 3AU8A 3LYHA 1UC9A 1SGWA 2D4AA 2NXCA 3UJ8A 4TMTA 2Y6VA 2Z4TA 3W5CA 3QUAA 1T4CA 4KBYA 3C3XA 2EXXA 3R0ZA 4TMZA 3RAEC 1MH1A 3RROA 3OMWA 5CYOA 4PX5A 3WL6A 5A4FS 2LR0A 1U0JA 2J6IA 1PJCA 2R44A 3CUEF 2HX1A 4FYMA 3SX0A 1LDYA 4DW8A 2PGOA 5A5FA 2W98A 2Q8PA 4EHDA 3GR6A 3WSTA 3ZN2A 2WDZA 4Q37A 1KEZA 3H1TA 4TRJA 1Z6TA 5FLYA 2VAXA 2I6FA 1RI3A 3OD1A 4BU0A 2H4XA 4GAEA 4TMFA 1ADYA 5DT2A 4CUKA 5L3VA 7MHTA 4QYXA 5K0EA 4CLHA 6LDHA 3ZJYA 2XE7A 4EY8A 2PWBA 3FTCA 3QFRA 1W6UA 2RH5A 3DTYA 3EWSA 3L06A 4PGFA 3U0VA 4YA6A 1V2HE 3ZK8A 4O2RA 1GUAA 3NGMA 4GBED 3ZQ4A 2E6UX 2WB4A 2GMWA 4RZHA 2NXWA 3DT6A 5FADA 1X7GA 5A9SB 3B78A 2I8AA 3B1ZA 3AVUA 1JHPA 3EXFA 3PE6A 1V3VA 4K6GA 4C2TA 3T15A 3LOQA 3SQMA 1P31A 4OCZA 1DJQA 2I6GA 3GRZA 5JTUA 1Z13A 4WI1A 1XLWA 4E07A 1IRIA 1ZOOA 3DVRX 1I8TA 4D1YA 4F9EA 1DJOA 2RGDA 4HYYA 3UAVA 1UK6A 3NO4A 1GCOA 4M55A 1KYVA 3TTSA 2QRQA 2VUSA 1FB5A 2BFWA 1I4EB 2Q9UA 3LOPA 3TMYA 3OIWA 2EJWA 2Y92A 3CUSA 3DM9B 3P2MA 4NMHA 2X3UA 4KN8A 1U90A 1L5ZA 2O2EA 3HBFA 4QRDA 1H4QA 1Y9ZA 1PEDA 1N5JA 1XF1A 1LDMA 4JBHA 4MDHA 2OTCA 5B1SA 3SC2B 3ULKA 5LB2A 5TB5A 3ODPA 4DEXA 2RK3A 5I45A 1JEYA 5F5LA 2NGRA 1WEKA 3DOOA 4D79A 1JQDA 1RABA 2JAPA 4NR0A 2X9QA 3Q5GA 2R2GA 3L1VA 4W6QA 4TQ9A 2ZTVA 3H9BA 3IGFA 4OMUA 4M7RA 5FPSA 1DQYA 3WQRA 1UDWA 2QSYA 2AX4A 1QQAA 2Q7OE 3O1LA 3GNLA 1G5PA 3UHAA 4ARVA 5CFQA 5LPNA 1XMJA 3CVXA 2CFIA 1LZLA 3GCZA 3P2YA 4B6SA 3FTPA 4QOIA 1RBYA 2VBIA 1NUSA 3IQDB 5IBRA 3UV7A 3OIFA 3R3JA 4XVHA 2B9EA 1Q92A 2ZIUB 2REQB 5JD3A 2PEYA 3LY7A 3VUEA 2I29A 2SNIE 1CUBA 5E7JA 3RVLA 1ZHOA 1NBAA 3RVKA 5EP1A 5I5GA 5AP9A 5DTJA 1Y8ZA 4QPPA 3B5IA 4JWTA 1Z6PA 4M2LA 3PL5A 1UPAA 3E70C 4F06A 5IW8A 1QH8A 2BBTA 1A9SA 1UT5A 1VHTA 1DG3A 2VEOA 3F90A 4AP6A 5M5BA 5J3JA 3GLVA 1XXHA 1WV1A 3A70A 3O3MB 2G36A 5TNXA 1UAAA 4E94A 4CT5A 3FSGA 4PF1A 2GKOA 1PUJA 2BFBB 4OY3A 3AM4A 5GONA 1TVMA 2PO7A 4QLOA 2NYUA 4ZCLA 3ROTA 4PIMA 4A73A 1IAQA 5BQPA 3SBXA 3V1TC 1NVXQ 5CMLA 3SKYA 3ZWNA 3ZGVA 5BMOA 5HUQA 2IV3A 1KFKB 1YE5A 5KJ6A 1W4RA 1HE1C 2IH4A 3GJQA 2WJ6A 4YMSA 3R7DA 1LLCA 4JL8A 4J8PA 4L50A 3K09A 3RSSA 2HLDD 4KB5A 4BY9E 1T2FA 1AUQA 3UHJA 1V3UA 3LCVB 4WJLA 4OEHA 4P86A 1Q0QA 3QYPA 3QKRB 1JWLA 3MMPA 3M6UA 3EZ9A 3OE7A 3FNHA 2Z2YA 3WNCA 4RSMA 2PS1A 3N86A 2PU5A 2AD1A 4UNIA 2PG3A 1Y9DA 2NLOA 4KQKA 3ZDFA 2G40A 4CM9D 3FR8A 3RTGA 1JG4A 5K3CA 721PA 5A4KA 2ZRDA 1BN6A 2O5VA 1Z4OA 1EFLA 4YJFB 3L6OO 4AMBA 4IQ4A 1YZ3A 2CLSA 1FDRA 4NULA 1RLJA 2CVQA 1I10A 4N9QA 2V8OA 4XIGS 4KACA 3G8BA 4CKCA 2VT3A 3B3QA 1F3OA 2A7XA 3F8TA 2QTAA 3FYUB 3MCUA 4ZTBA 3D0RA 5L53A 3E9DA 1SG0A 2F4VB 4YJHA 1MIOB 1US8B 1W88A 3R5HA 1Z4LA 1P61B 1PN3A 4LY3A 1Y6GA 5CB6A 1IMJA 2A33A 3DL0A 4ZVOA 1WZNA 3EIUA 4GOMD 4LHVA 3VVMA 1T8SA 4RM3A 2FSVC 2JFGA 1A8SA 3LZCA 5LA6B 4DV3B 2C2WA 2JGLA 1E66A 3AFGA 2D2IA 1NP7A 3VBEA 2Y0BA 3FPFA 4FE7A 3CYFA 1SBYA 4PCAA 1R6TA 3RRXA 1ZPDA 1DHTA 1YB5A 3LCRA 1U7PA 1AZWA 4GL2A 1E1QD 1NVDA 3ZLTA 2C9OA 3SEFA 4B6PA 1XA0A 1D1PA 5DYIA 1U7OA 1N3LA 4G4JA 1VGQA 1U8CB 3DKPA 4RMJA 1NJGA 2JH9A 1B0AA 1WY7A 4KWEA 4MJLA 5LN1A 3MYRA 1KI6A 1Q0HA 1Q3HA 4CIDA 3TF5A 2O7RA 1NJSA 1YIAA 2AN9A 1ISMA 4EKIA 3E1SA 3RSGA 1IHDA 2CMGA 4CU5A 4MB6A 1C50A 2X2OA 4X71A 1RAFA 1JU9A 5FBWB 3I6BA 2PSFA 2YC2C 5GMOA 3IVCA 1S3FA 1W7AA 2LV8A 1O96A 3ZDXB 2F00A 5FA8A 1LDBA 3F6CA 3OE5A 5TX7A 1XA3A 1V96A 4A82A 4V3CA 3ODGA 4OQQA 1U0FA 2QR5A 3AG5A 4PWYA 4D3XA 3U4MA 2GPAA 3H83A 1F7VA 1WOYA 2G0NA 1DAKA 3V3TA 1ZM7A 1X13A 2GCEA 4KW7A 4NEHB 3UBMA 1Z2EA 4I1SA 1MAAA 1QSGA 1U9IC 1USKA 4G1MB 1O89A 3A31A 4TMKA 3LX4A 4HX5A 1OBOA 4OXQA 3AF6A 1PD1A 4PLCA 3ORSA 1Q22A 2XAUA 3BQMB 4NYIQ 3D6FA 3T3DA 1B0PA 2Z6VA 3BCRA 3KIPA 4G4SO 3V4FA 3LPNA 3UO8B 1YSCA 2ZAOA 2NSHA 3MXTA 3W3ZB 1WPRA 3Q3IA 1GQ2A 3DS8A 5BSWA 1C41A 2PUWA 3NHSA 4ENPA 1FQJA 2I8LA 3T7JA 1UJMA 1TLLA 1NZDA 3TSOA 2X9GA 2UUOA 1TXGA 2NTYC 3C87A 2HXYA 3ETNA 5IDWA 2D5LA 3GGOA 3V4SA 2ZUBA 1R0RE 1NMXA 1TGVA 1KJYA 5KDLA 4M9ZA 4GMKA 1V0JA 5TVKA 2PZFA 3C8HA 4Z3KA 1WBDA 3K53A 4K3VA 1K3UB 1P72A 4LJLA 4UQLA 3I9NA 1K6JA 5ED0A 3UMMA 2FSPA 3GRPA 5HIIA 3G0BA 4K8RB 4FOLA 1ONPA 3ND8A 1XZDA 1L2TA 5BUZA 2AG1A 5K99A 5F33A 2G07A 3F97A 3FD8A 2OLEA 1PBTA 4EPTA 4RHYA 1EGVB 1CS4C 3S8YA 1W25A 1Z5ZA 3INTA 4GZMA 3EBPA 4YJGA 2YUIA 4JROA 1KL7A 1D0IA 1ZD2P 4JB3A 5J4VA 1G7RA 3DMDA 5CR9A 2AKEA 4UBKA 2R8OA 1YNSA 5LQNA 1MB9A 4KXMA 2F62A 2Z3VA 3KOZA 2ZTHA 3R9IA 4YXWD 2QQ0A 1KK2A 2NOAA 2ZRQA 2F9FA 1QIFA 4JU8A 3AB8A 4OFZA 1JYFA 1M34B 3AETA 4CW7A 2RH9B 1KPHA 2FN3A 4DIOA 1FL9A 1SVKA 4OMCA 3JQDA 5AM4A 3B1WA 4MW1A 2HMTA 1M8PA 4P4NA 4IDAA 3LUDA 3RFCA 5JCOC 3HYNA 4XDGA 2P6RA 3GDOA 2PXAA 2EL7A 2G71A 3GLQA 5JYBA 1WIWA 2WYHA 3AV0B 4G4SP 3PGVA 1H2FA 5EVCA 4ZT5A 3W2GA 2JAOA 3IL2A 5BPHA 3G0CA 1IZYA 4R2IA 4CFYA 2W42A 4HDNB 4I4IA 2IHBA 3G5LA 2FMFA 4G4GA 1YGPA 1FS6A 1FUYB 1NXWA 1YFKA 5F9MA 5DB4A 2JLWA 1FRZA 4D02A 4POOA 3TW0A 2GUGA 2Z2IA 3ONDA 5EUMA 4BX0A 3I9MA 4Y0VA 1NDQA 2PNFA 1QC5B 3IDZA 2B83A 3JARB 4O63O 1QGOA 4R1UA 5KJEA 2J3IA 3K72B 5GOTA 1NKVA 3ER6A 4OM8A 2UZ3A 3RIYA 2B8JA 3CIFA 4A1FA 3LSTA 2XVYA 3PX3A 4M1YA 3DBHA 1KZGB 1YJBA 2W43A 5AJTA 1DARA 3E5MA 4NYIR 3WL5A 1ILEA 2VA8A 4FHEA 3UT5B 3Q3EA 2AE2A 2OD7A 4KMRA 3PGKA 2VZEA 1F2DA 4YRLA 4DKJA 2FFAA 4AKGA 3UKJA 2BM8A 1CV2A 2BGRA 3LPMA 4KQ1A 3PX2A 4HEHA 1NM5A 4UHHA 5TPZD 3UUWA 4C0XA 1G7SA 4EHBA 5IABA 5P8WA 1BEEA 1S8FA 1T3LA 4KPEC 4N8DA 3MTEA 4MP3A 1U3VA 4HNRA 5U1PA 1LLFA 3RVQA 4DDMA 1U0OC 5EAIA 3ZGYA 1H4TA 4O2BB 2GBIA 3AQ4A 4K1LA 1E7QA 1ZGZA 2YN2A 1O0BA 4MGIR 4BS9A 2V9PA 4ZALA 1CY6A 4UUMA 1NI4B 2IZ0A 2Q0XA 2VXCA 3FTNA 4IEEA 3QLTA 4F1KA 5IAOA 1TF7A 5JYCA 3TIVA 4Q6WA 5B4UA 2PXHA 3NHUA 4ISBA 4XB2A 4EJSA 2D1YA 4WDRA 1M6WA 5EJMA 1BVYF 4WACA 4NH4A 4FFNA 1W87A 5F9FA 2C7PA 5ADVA 3A11A 2VSOA 5A3JA 2RGNC 1J0XO 2C29D 4Y1FA 1X8LA 2ADOA 3F0TA 2XGGA 3L7MA 1MW8X 2QUJA 2C20A 1UIMA 2ZJ1A 3BJMA 3JQAD 3OTQA 3QEOA 3R24A 1FP7A 3TZQA 3LTNC 2FLWA 4WESA 2BDUA 2IP2A 4GS5A 4OB8A 4XKJA 4P1ZA 4RH1A 1IC6A 3NVDA 3UH0A 5D3MB 5HTOA 1YOBA 4HAVA 4RBNA 5CIWA 1QYVA 4MHTA 3GVPA 1A71A 2F43A 2WB2A 1JBKA 2V5VA 5SY9A 3T3EA 4ER5A 1OPRA 3GI1A 4F4UA 2XYQA 5B3LA 2ZJ4A 2YZ2A 3GBPA 3DQPA 3JVDA 2A5YB 1M33A 2X4LA 2XTNA 2HIHA 4R8VA 4DDTA 3SWWA 1TVKA 1ST3A 5L7WA 1IEVA 1ZG3A 1CU1A 2FWBA 5JJLA 3RVNA 1YZLA 2ZTSA 1L4HA 2QRPA 3OFKA 3IXLA 1VLLA 2JGNA 2CNKA 2DPMA 3IT3A 4LDQA 5HGJA 4R5HA 2PGXA 5BOSB 1Q3TA 4YMHA 3OLZA 3W5HA 1ZK3A 1K66A 1N92A 4PRKA 5TC4A 2HDHA 1R00A 2C0CA 3CLKA 3OPYB 4B1FA 1T29A 1SB9A 1E2MA 2ZI7A 2KX7A 2VJLA 4M6WA 3V8PA 3SG0A 1GV0A 4DV2B 3DVAB 2VK1A 3ZNQA 3IBSA 2AJBA 3EMVA 5JW6A 3DAGA 4IJ5A 5JPDA 1K6EA 1Z4IA 4FHFA 3B52X 2LP4Y 2CZQA 3GCWA 3DZIA 3MJTA 1V6SA 1L5OA 3WIDA 4REOA 4Q12A 4H6XA 3SIXA 1NQ5A 5AW2A 4ZCQA 4F86A 2WTUA 1INLA 3HEMA 4JLDA 1ZVQA 4ZYZA 4OX9Y 4P83A 3GMIA 2YCLA 4G0NA 1CR0A 4UKDA 4EA7A 1L5HB 1V3QE 4B48A 5J1SB 2WQ6A 2IOFK 3B53X 3BVPA 3RQSA 2QG6A 4JFRA 4ZMSA 1UODA 5EJ2A 4YT4A 2DR0A 3TZ6A 3SNKA 2CXHA 4LFBB 5LQUA 3HDYA 1C7IA 3WGKA 3HL4A 4DCOA 1SQ0A 5FBQB 4ZYWA 5E9AA 5C4IA 4RA6B 1KRXA 2YJNA 2Z83A 4MYUA 1TZCA 1T91A 3QQ5A 5EIWA 4YRPA 3CBGA 3CO0S 2ORVA 2OHXA 1NJ6A 4IIFA 5AVQA 1H93A 1NKSA 1P1JA 5FTKA 3AONB 1RAAA 1E2JA 1B2LA 3HBLA 3MELA 3MD0A 4GP6A 4IICA 3IP5A 2IYZA 1NBMD 3MMSA 1D5CA 1VL6A 4EI2A 3LF1A 3NI2A 4GO1A 1NI5A 3ZY3A 2DG2A 1X38A 2OP1A 1QRAA 2A5GA 2IEDA 3IIMA 4PPNA 4W4TA 3UG7A 2VKQA 4O4HF 4MB0A 3SIWA 4ZOBA 3TO5A 1F2UA 1QCDA 5REQA 1UXOA 1L4YA 3V46A 2KQUA 1Y8QA 2HU7A 2HQOA 2O1SA 5FBKA 3GA0A 3KE8A 4F8EA 1AKQA 2HXSA 5K8LA 4UNQA 2AZMA 2FEWB 3CXRA 1Q7CA 3EGWA 3UT0A 3BIXA 3K5WA 3ZIDA 2YWJA 4LHXA 1ZVKA 1LI5A 2PS3A 1MDBA 2ZTMA 1JR3E 2NXEA 5JDCA 2JI6A 1RACA 2P2YA 2VPYA 1RKQA 2EF0A 2Z58A 4BKPA 2OEPA 4JXXA 3S7TA 3B1YA 4ABTA 1IQUA 2CL6X 4DEVA 4S12A 5JUWA 4IQGA 1HXHA 1DAIA 5JROA 2GLXA 4LHSA