2CDAA

Sulfolobus solfataricus glucose dehydrogenase 1 in complex with nadp
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
366
structure length
360
Chain Sequence
MKAIIVKPPNAGVQVKDVDEKKLDSYGKIKIRTIYNGICGTDREIVNGKLKGKDFLVLGHEAIGVVEESYHGFSQGDLVMPVNRRGCGICRNCLVGRPDFCETGEFGEAGIHKMDGFMREWWYDDPKYLVKIPKSIEDIGILAQPLADIEKSIEEILEVQKRVPVWTCDDGTLNCRKVLVVGTGPIGVLFTLLFRTYGLEVWMANRREPTEVEQTVIEETKTNYYNSSNGYDKLKDSVGKFDVIIDATGADVNILGNVIPLLGRNGVLGLFGFSTSGSVPLDYKTLQEIVHTNKTIIGLVNGQKPHFQQAVVHLASWKTLYPKAAKMLITKTVSINDEKELLKVLREKEHGEIKIRILWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUCOSE DEHYDROGENASE
publication title The Structural Basis of Substrate Promiscuity in Glucose Dehydrogenase from the Hyperthermophilic Archaeon Sulfolobus Solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Oxidoreductase
total genus 122
structure length 360
sequence length 366
chains with identical sequence B
ec nomenclature ec 1.1.1.120: Galactose 1-dehydrogenase (NADP(+)).
pdb deposition date 2006-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
A PF16912 Glu_dehyd_C Glucose dehydrogenase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2cdaA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2cdaA01
4RPJA 3NRCA 1MXHA 2VN8A 1PQPA 2WDZA 3PRJA 4DGSA 1ISFA 2PZMA 1I3NA 5EIOA 2H63A 4E2WA 2YUTA 3S2EA 4CM7A 2Q50A 1MGOA 1T4BA 3GZNA 3KTDA 3GEMA 4B79A 2JL1A 4HFMA 4MVJG 4IIUA 4Q3CA 1HXHA 1WP4A 1GYRA 9LDTA 3ZV4A 3WNQA 1IE3A 4CV3A 4BNFA 5CDSA 4DBVO 1OMOA 4FJ0A 1Y6JA 5TF4A 4B7CA 1JVBA 5IF3A 1C14A 3U4HA 3FTPA 2EEZA 1DJNA 2CVQA 4I9HA 3K30A 2CY0A 5L7YA 3EK2A 4B4WA 1E3SA 3O26A 1C3VA 5IAAA 1ZUD1 1ISHA 2HK7A 2YV3A 1IHXA 2CZCA 5CHEA 4RF4A 4CM3A 3LT4A 2JAHA 1HSOA 3KSUA 2HLPA 3BMNB 4KZPA 4RF3A 4EW6A 2IEBA 2O4UX 2X0JA 4J9VA 3V8BA 5F1PA 1O94A 1O5IA 3WLFA 4OXYA 4TROA 3V1TC 1VJ1A 4CPDA 1YQXA 5ITVA 1EDOA 2DVMA 1U3TA 1YXMA 3WGIA 5CG2A 4INAA 1GUFA 1PGJA 3DBHB 3P19A 1Z75A 3M2TA 4L0QA 2JHGA 5A05A 3ZWMA 2J8ZA 4CR6A 1E77A 4MVJI 1BW9A 5C5IA 3ZCXA 3RSHA 4YT2A 2P9CA 1ULUA 3CINA 4EI2A 2IYOA 5JNLA 3WGHA 4TRJA 1UXIA 2FR0A 2WE8A 4J1TA 4TMFA 4YRDA 1GDHA 5KJ6A 4J0FA 1LLCA 3GGOA 4UEOA 2NTNA 3HE3A 2FSSA 3OIFA 4IJVA 4CMKA 5A1TA 1NFFA 5TJ9A 4J91A 3EC7A 3G1TA 5IXSA 4MPDA 3VC7A 2GNAA 4UUMA 3MOGA 3IAHA 5T8KA 4GBJA 3ZWCA 4ZJUA 2PKQP 3UVEA 5DT9A 5HBRA 4MVJA 1LDGA 1Y7TA 4BO3A 4JIGA 5T8KC 5BSEA 4IBOA 4CM5A 3A9WA 3TZQA 1MUUA 4ND2A 4I1IA 4YYZA 4YRBA 1AN9A 2O3QA 1D8AA 4QTZA 4E3ZA 2O3RA 3DBLA 4Q3BA 4XGKA 3DZBA 3WQQA 1B26A 3ZHBA 4E2XA 1GEGA 2Y0DA 4IIVA 1V8BA 3ROQA 1H93A 1FDWA 1GYQA 2R00C 3DXFA 1BDMA 1OC4A 1LA2A 1ORRA 1T1RA 2B35A 2BGLA 1RM0A 4IQGA 2ZB4A 1XU9A 2VHYA 5T64A 3ZNQA 3PP8A 4DVJA 1OOEA 3ZNOA 4CMJA 3WQRA 3I5MA 1R37A 1TEHA 1VJ0A 3H2SA 1UDAA 1XQ6A 4LMRA 1OC2A 4ZA2A 5G4KA 4XCVA 2OORA 2AE2A 3QY9A 2C82A 2NADA 3FNFA 4M1QA 1AXEA 2EHDA 3QWBA 2EP7A 1GL3A 4ND5A 4PLCA 4FFNA 1ADFA 4CMGA 2GN9A 3GFGA 3P2OA 5LDGA 1WDLA 3EY4A 5I7SA 2O2SA 4J4HA 4R1TA 4Y9DA 2VOEA 5TC4A 4YXFA 4CLRA 3D64A 2HQ1A 1U4SA 4W82A 2VOJA 3DQPA 4EJMA 2PWZA 1PJ4A 3ZN2A 1UXHA 2H9IA 3GVXA 2X22A 3GVHA 4XR9A 2VUUA 4IDGA 3ZI0A 2AQHA 2NVWA 4E5KA 2RHCA 4DLLA 2HJRA 2HRZA 3OFSA 4BNIA 2PLAA 4L74A 4B4UA 2C5EA 1MX3A 3PGXA 4OOFA 4DPLA 4B7UA 3BMCA 5FYDA 3AY6A 1FJHA 3IQDB 4Q39A 5DULA 4ZU3A 1SO8A 4AG3A 5G2OA 4YA6A 3JQDA 5KNLA 2JCYA 1TXGA 4YT5A 4E30A 4N5LA 1H94A 2Y93A 1LU9A 3WBBA 1HDRA 1YL5A 5GZ1A 3U5TA 3IIEA 4C7KA 3VPFA 1JAXA 3K2BA 2YV1A 4TQGA 1KEPA 4W4TA 4M55A 3AFNA 4P22A 2HUNA 4RPKA 1GQYA 3ZU5A 3OIGA 2LDBA 4FQ8A 5IDXA 3GGGA 5A9TA 4W9NA 4BNWA 2CDCA 4ZQFA 2IXBA 4N5MA 5F1KA 5CEFA 4W9NC 1E7QA 3FBGA 1ZJZA 4LISA 1ZCJA 2EJWA 4J16A 4NPCA 1LLUA 4Z9XA 3WR5A 5DCUA 3LC7O 3QE3A 4BO9A 4OQYA 5GMOA 1EZ4A 4Q3NA 4WLFA 3WGYA 4XZ3A 1XR3A 3R3JA 1DAPA 4UUPA 1ZEMA 4YACA 1A71A 3DO5A 3VDQA 1MA0A 4P4NA 1NQ5A 2XAAA 4AJPA 3PYXA 4A0SA 3FWZA 4ZGWA 5L3ZA 1T2FA 1X7HA 5IDWA 2POQX 2LDXA 4EDFA 2OGUA 3JD0A 3NDJA 2B37A 3PPIA 4WLUA 4BOYA 3VH2A 5AXAA 5JY1A 1VL8A 4B7XA 2WD7A 5IJZA 4WLNA 4UVDA 1ONOA 3WGQA 5DBGA 3TFOA 2X1HA 3F1LA 3IS3A 1I0ZA 1KEWA 2I5PO 3PWKA 4CLOB 1KERA 1RYEA 4GLOA 1B8VA 3GVCA 1BXZA 4Q3DA 2DBZA 2W90A 3F6YA 1VKNA 4EUHA 1E6WA 4YJFA 3EGOA 1QP8A 2B4RO 2NUAA 2DT5A 3IC5A 3RBVA 5CPBA 3UUWA 3L6DA 4FPXA 1DC4A 3DHEA 3QVWA 4QECA 3GRPA 4UAGA 1I3MA 3ZV5A 1ENOA 1HEUA 1R0KA 1ZK2A 2EV9A 1I8TA 3I6QA 4NBRA 4Y67A 3U4DA 4G81A 2YV2A 3N74A 5CG1A 1OAAA 2Y1GA 1L1FA 3NEPX 2CFCA 5IZ4A 5EINA 4CMIB 3WX0A 1I3KA 3H9JA 1GZ6A 2BI8A 2HK8A 2QW8A 3F4BA 4D43A 1SAYA 1B14A 2YYYA 3DAPA 4FCCA 4DTIA 2NU9A 4CMBA 4FD3A 4PN3A 3W6ZA 3PEFA 2YQ4A 4IDAA 3TZCA 1Y81A 3KYDA 3INTA 1E3WB 4FOOA 1FK8A 3D3WA 1NQAO 4PVDA 2ZQYA 4WK6A 1Q7BA 3SEFA 2VT3A 3NT4A 1WWKA 3WWYA 4ZQGA 2ZTVA 3O8QA 4FC6A 4MJLA 3U0BA 2PGLA 2YFHA 1H6DA 3GDFA 2H6EA 3UHAA 4PG6A 5I9MA 4ALLA 4OOEA 1SBYA 1U5AA 1X1TA 5BSHA 1XELA 4HKTA 1ZIDA 2R6JA 1UDCA 3QQPA 3JQAA 5C7LO 2YHIA 4QO8A 1TB4A 1T1SA 2D5AA 3KYCA 7ADHA 3SJUA 1HDXA 4ZHSA 3UW3A 1T24A 1PR3A 5K0ZA 1ZNQO 4BNMA 3OMLA 3VH3A 8LDHA 3CPSA 4B3IA 1E5QA 3JQGB 3PI7A 3JD2A 2BHLA 1I01A 4YQZA 4CQMD 2ZK7A 5K9ZA 2C0CA 1V9LA 4NNJA 3OH8A 4XRGA 4XYLA 4ILKA 3G17A 4JLWA 1J6UA 1PJSA 2DBQA 3JYQA 3E5MA 1M67A 4IMRA 4J4BA 4E4YA 3TOZA 1HDZA 3VZPA 4R68A 3V1YA 4IS2A 3LDHA 5IN4A 2W2LD 4D3SA 1WLYA 4NH4A 1JDJA 1F17A 2B69A 4L4RA 4QSMA 1LDMA 1NXQA 4JNKA 4OQZA 1JU9A 4NJMA 4RVSA 2FN7A 3SVTA 4PZCA 3C7DB 1D1SA 4F6LA 1QYXA 2OOSA 3GEDA 3NT5A 4FN4A 3SC6A 1YVEI 4S1VA 2YZ7A 4BKRA 1B16A 3PZBA 1P33A 3QLJA 5L40A 5KVQA 1I30A 2UV8A 4IGFA 3AUSA 4WLOA 4WASA 1WAMA 3U4CA 1NYTA 4I5DA 1J0XO 5BNIA 1O8CA 5DNAA 3FF4A 4RCVA 2BRUA 4J43A 4QUKA 5B37A 5JDIA 4WNCA 4R5MA 3NV9A 4BNYA 3GVIA 2NQ8A 3I4CA 4Z9YA 4D0SA 5JDIC 3L4BA 3ZV6A 2X0IA 1GU7A 3FR7A 3SXPA 3L4BC 4IUYA 4TRMA 4KP7A 2AG5A 4Z0HO 3FHLA 4BMSA 4K6CA 1BRMA 1T2CA 4N5NA 4DIFA 2EF1A 3JSAA 5L4LA 1U8FO 2PD6A 2W4QA 5JPIA 1I3LA 3ETGA 1P3DA 2HMUA 1HE4A 1GZ4A 4U8GA 4G65A 4A27A 3OJOA 4FB5A 5KJCA 2EKQA 1N7GA 1P0FA 1VSVA 1BW9B 2EW8A 4IPTA 4WCFA 4EGFA 1R66A 4H3VA 1XYGA 4R9RA 3IUSA 3BHJA 2I9PA 1I33A 4WCFC 3WICA 2PGJA 4WCDA 2V6MA 4R69A 4CMHA 2AEJA 2PH3A 1NPDA 1DO8A 4CQLA 4AL4A 5KWEA 2NTVA 5TS3A 4UUOA 1R0LA 3I3OA 3H5AA 1E6EA 4KTTE 4FFLA 5JDCA 2DM6A 4ZQBA 3G49A 1GR0A 2ZQZA 5JMPA 4JP3A 1EQUA 1SOWA 5IFLA 3KUXA 5ES3A 2DTDA 3BHIA 2I76A 3OJFA 5JDCC 1QG6A 2JD1A 1UJMA 2WJPA 3WG9A 5JAZA 3I6IA 3JYOA 1ZO8A 1E7WA 4JJIA 3FD8A 2GO1A 2AEFA 1IZ9A 4H15A 3SJ7A 4UEJA 1HE3A 3MJ4A 3WOHA 2TMGA 4PLGA 1KVSA 5ICMA 1Q1NA 3DBLB 2WSBA 1YDEA 3FNGA 3RVDA 3WNVA 1FF9A 3KBOA 4BNHA 2QX7A 4ZVVA 4NJOA 4BQPA 4EITA 5HTOA 3C7AA 1NVTA 2HCTA 4ZN6A 4JQCA 1GV0A 3RUCA 4BHTA 2IXAA 1BGVA 4MVJE 4E5PA 3QVOA 5TIIA 3AUAA 1V3VA 4PCVA 1QKIA 4IGEA 1JVSA 1ZK4A 4M86A 4IDCA 2BD0A 2JFGA 4KDFA 1PJCA 3AI1A 4W99A 5HS4A 4E12A 5F21A 5G4KB 4DRYA 3PHIA 1P44A 3F1KA 1EUZA 3X2FA 3U09A 3TF5A 3C85A 2EWMA 3JD3A 3L4SO 1EE9A 4BGIA 1X13A 5A4DA 1VPDA 3AM3A 2FR1A 3GVPA 3WSWA 4WLEA 3UCEA 5JCXA 5JYEA 4CLRB 4NI5A 2F00A 1H2BA 1YB5A 4QFDA 3AK4A 1EE2A 3L07A 4BKUA 5LDHA 3T7CA 3HJAA 4GX0A 1YQGA 1E3JA 2VUSA 1SC6A 3VAZA 4BNVA 3INRA 2VRBA 4XYBA 1DIHA 2NU7A 2XXBA 3TPCA 1PS8A 4K1LA 3GC6A 1JQBA 5HM8A 1DC6A 3FWNA 1AGNA 1WMBA 3BMCB 1S6YA 5B12A 1NFQA 4I5EA 4RORA 4YAJA 1MG0A 1TI7A 1VL6A 4BQRA 3BHMA 4NDNE 4CM8A 4D44A 3GUYA 3AI2A 1HT0A 2FPPA 4CL8A 3SLKA 1GV1A 1QYDA 5ADHA 1XIVA 3JQ7B 3HB4X 3ZU3A 5TGDA 4HBGA 1JWAB 3NDIA 4PLWA 3KSZO 2VWHA 3KV3O 3NTRA 4IDEA 1FMCA 2P9EA 1N92A 1XWFA 2Q1TA 4GGOA 2RHRA 4J6FA 4O63O 3KETA 3UCXA 4YJHA 1CJCA 2C2YA 4D3FA 1CYDA 1O89A 1E7MA 3S2IA 2ZB3A 4XGNA 3GZ4A 1HTBA 2C7GA 2JCXA 3GHHA 3ZHYA 2DPGA 3C3XA 1DOHA 3HZZA 2JFFA 3ZWVA 1LC3A 4NBUA 1DB3A 2GSDA 2J3JA 1PJ3A 3JTMA 3RFTA 3ZW9A 4XD2A 4NU5A 3H9QA 4ALJA 4UREA 4D46A 4A10A 3QWIA 3DMTA 2FP4A 3AM4A 1JA9A 4OYRA 5FWNA 3WGGA 4BNUA 1IL0A 2GZ1A 3F3SA 3DMTC 1T25A 1D4FA 2WYVA 3SC4A 1K5HA 1V0JA 4A2CA 4BVAA 3ZWXA 3ROMA 3HDJA 1DPGA 5DBIA 4J90A 3OIDA 1C1XA 1I5RA 4HNGA 5H83A 3RUFA 2CF5A 3VH4A 2WD7B 3W1VA 1U28A 4NK5A 1PGNA 2E48A 3ICPA 3HFGA 3AI3A 1PJ2A 5JCJA 2CDAA 4D79A 1UXGA 2GERA 3FCOA 3O03A 4HWKA 4ROSA 2PNFA 3WLEA 4A5OA 4P38A 4QX6A 3ITDA 5L51A 3QJ5A 1V3TA 3BA1A 3E5RA 3K73O 5MGBA 2VCYA 3RUIA 3DBVO 4J1QA 2OP1A 4IZHA 4DC1A 4XDZA 4YJFB 4RDHA 2JAPA 4A26A 1UH5A 2EW2A 3HN7A 1NNUA 1U7HA 2E4AA 5HA5A 3AM5A 1H6CA 3QA9A 4B8ZA 3MZ0A 3K8ZA 4JXKA 1B15A 4JJFA 1PWXA 2EJVA 4MVJP 3DAGA 3H8VA 4M8SA 2HMVA 4ND3A 4NBWA 3TL2A 5CEEA 1A5ZA 1DIGA 9LDBA 1KYQA 4YDRA 5IDQA 2O3SA 1ZXLA 1UXKA 3OHSX 2DAPA 3L6EA 3Q9NA 3NJ8A 5ICSA 3OSUA 2DLDA 2G1UA 2YDYA 3PJGA 2R2GA 3ANLA 3VKUA 5TT0A 1XU7A 3GLQA 3VPSA 4NFSA 3RC1A 1QR6A 3VZRA 4AFNA 3FNHA 3L6OO 4IDFA 1HRDA 2PK3A 3KYDB 3W4IA 2XPCA 3W4KA 4PLTA 4FGSA 1GCOA 3ZW8A 3PJFA 1X14A 4XB2A 1EQ2A 3O8QB 4WLVA 3BIOA 4L76A 2JKVA 4FGWA 4IXTA 2D1YA 4JBGA 1I32A 2YHIB 3TZHA 2PA3A 4RPHA 3HDHA 1Q7CA 3LYLA 1WNTA 3EVTA 3TL3A 4GPD1 3DHNA 4KDEA 1YKFA 4RVGA 2CD9A 2X6TA 4FR5A 1A4IA 3GFBA 4IJKA 3QVTA 3RC7A 4E33A 1HDYA 1SNYA 1GZ3A 5JO9A 1ONNA 3WIEA 1RPNA 4FBGA 4JCOA 5F5LA 4WPGA 3TQHA 4F45A 5B1YA 4J1SA 3JQAD 4R16A 1M2WA 1IPFA 3M6IA 4O5OA 5C7IO 5A9SB 2W2KA 4QQRA 4PLYA 5BSFA 4R54A 1XCBA 1CRWG 1P45A 1Y1PA 2YDXA 2XF8A 3BAZA 2Y1DA 2HK9A 2IZZA 4JN6B 4TZTA 1JKFA 3E6AA 1FDTA 1K3TA 3FPLA 1ZSYA 3KYBA 3EZYA 4NJMB 2FRDA 4FFRA 3QWFA 4OL9A 4DBZA 2E82A 3ABIA 1ZZEA 4ZRNA 3VHRA 3ROPA 5DP2A 5JFOA 1ONPA 4U5QA 4IJWA 5KJEA 1BWSA 2R00A 2X5OA 1HF3A 3I52A 1WXDA 2PKQO 4DIOA 4DXHA 3E03A 4Q3AA 4YR9A 1BDBA 3H4VA 4BO6A 1PJQA 4XRRA 2FY8A 4PZDA 1YJQA 4CMCA 2FOIA 2BFAA 3BTUA 4R3NA 4UVIA 1YBMA 1TVEA 4QEDA 1R0SA 2EG9A 3NGXA 5C3MA 1EK5A 4PIVA 4GKBA 1ISMA 3PHLA 1P9LA 4RF2A 3EUWA 4YAGA 3K92A 3N7UA 3NTQA 1FXSA 4IDDA 3RD5A 1FDSA 3BYZA 2X9GA 1I2CA 4FDAA 3A1NA 4JROA 1PQUA 5TRTA 4DQXA 5HRUA 3KO8A 3RUAA 3H5RA 1UP4A 1ZK1A 1HKUA 3QWAA 4TSKA 2PFGA 3BMQB 3F5SA 3KEQA 4KWIA 4NIMA 1GFSA 3U9LA 1BTOA 4WCFB 5ILGA 1LQTA 4NBTA 4D45A 1NVMB 3QVSA 3DHYA 4QFCA 3RCBA 2UYYA 3F47A 4ALNA 3O38A 1GADO 1CEQA 3C8MA 3QRWA 3FNEA 5K1SA 3A14A 4NR0A 3EHEA 4GLLA 5T5QA 1YGYA 1F12A 2O7SA 2ZB8A 3ANNA 1PZFA 3GNTA 5COQA 3D1LA 3K96A 4HX5A 2OL4A 1GTMA 3KVOA 1KEVA 5JAIA 1K6JA 2C29D 3MJVA 2HMWA 1IUKA 2D5CA 4GMFA 3JYLA 5AXDA 2A94A 4EEXA 3RC9A 3ASVA 3ADOA 2DC1A 2GN4A 2VNAA 3AU9A 2HKIA 4CM1A 3TN7A 4IZIA 2WM3A 3GNSA 4L9RA 3AUTA 4GH5A 1QYCA 1HZJA 4D0RA 3WFJA 4BGVA 1A27A 1GPDG 2V65A 3QVXA 5L95A 2FR8A 1ISIA 3L9XA 3RC2A 2X8LA 4XEHA 1IHYA 2OO5A 4O0LA 1VRWA 1I36A 1N8KA 1R4NB 4OXKA 1I2ZA 3MJEA 5TQVA 3HN2A 5I7EA 5JLAA 4Z3KA 1BXGB 3NX4A 3DMYA 3V1UA 4BS9A 3PXXA 4FFOA 3PQFA 2GUGA 1HYEA 1O6ZA 3WGOA 1U5CA 1C0LA 3ICCA 1Q0QA 1U8XX 3D4PA 1K2WA 5EMHA 4R4JA 2NVUA 2JCVA 1DHRA 1PQWA 3OA0A 1UXJA 1U9JA 3OECA 1YO6A 2UUPA 4J7UA 4OKNA 4EEZA 4RGBA 5FFFA 1DC3A 1SOVA 2BI7A 4XQCA 3VTFA 2Z5LA 4CR8A 1ZBQA 1MC4A 3NDRA 4B4VA 3AWDA 3GT0A 3RQSA 1C1DA 4DYDA 3QP9A 4A73A 4UVHA 5A04A 1LC0A 3IKTA 4FJ2A 4G5HA 6ADHA 3WYEA 2AHRA 1Z7BA 3CH6A 3AY7A 3PDJA 3JQEA 1JAYA 1PIWA 4R1NA 5CDGA 3WFIA 5L7TA 1T4DA 1W73A 4ALMA 1X15A 1N1EA 3PQDA 3UXYA 2E49A 5ER6A 1N1GA 5DZSA 3K5PA 4BNTA 1HLPA 3T7EA 2OZPA 4BNNA 4GMGA 1HYGA 1T2AA 1UZNA 5T67A 1DEHA 1W8DA 1X0XA 3Q11A 3C1TA 5EN4A 2UAGA 3VKVA 4JBIA 3I4FA 2V6GA 2HU2A 4CLEA 2QYTA 1TLTA 4TVBA 3U49A 1YL7A 5KTKA 1J5PA 2WTBA 1U7TA 2BH9A 1D1TA 4I9NA 2CUKA 7MDHA 3K6JA 1M76A 2NACA 4HXYA 5J23A 1NPTO 3BZUA 3QV1A 4BMNA 3L0DA 1PL6A 1U3WA 4H16A 4YT4A 2JD0A 1V6AA 1KVRA 2VWPA 2YJZA 4Q9NA 1G0NA 3R3SA 4M89A 4DA9A 2Z1NA 1ZEJA 4KMSA 1PX0A 4OSOA 4I5FA 3ETDA 1IYZA 2A92A 3JQ8B 3IUPA 4J0EA 1ISGA 1KOLA 3WS7A 5FI3A 1EBUA 2X9VA 1P1HA 1KC1A 3EVNA 3H9UA 3OBBA 1PSDA 3OA2A 3DONA 4PZEA 2AW5A 1H2HA 1XSEA 2NQTA 4YBZA 1H9AA 4CQMB 3O9ZA 1C1XB 3I9KA 3WDSA 4K9DA 1R16A 2CVOA 2QRJA 1HWYA 4M54A 5CPFA 4MVJM 4E13A 5H82A 1Y8RB 1JWBB 4QXMA 2RH8A 1XKQA 4MIYA 3QWHA 3OJEA 3S2GA 5KJFA 4BNXA 4LK3A 1ADGA 4B3HA 4P4LA 3ZU2A 1B3RA 2D3TA 3BMNA 4MO2A 2ZJ0A 3F5QA 4MVJF 1LDYA 4NG5A 4XQ9A 2H5LA 1J4AA 1F8FA 2GZ2A 4GI2A 2AA3A 4MP3A 1HYHA 2OFPA 3PZRA 4ND4A 4AJ2A 5ILOA 2P68A 1VJTA 1QLJA 2EKLA 3MJTA 3B1KA 3GRKA 2J6IA 4RV9A 5TLSA 2EGHA 4DMLA 3RROA 4N54A 3GZNB 3H6KA 5JCJD 1B8UA 5A02A 2H1SA 3MJSA 4FIZA 4JBHA 2I66A 3CTMA 1ZW1A 5L4NA 1AHHA 2AQIA 5GY7A 2RBEA 4CJXA 3JQBA 4LSMA 2Q1SA 2I3AA 4NZ9A 4GX1A 4TRNA 5JO0A 3I1JA 3HWRA 3RUDA 5B4VA 5KKCA 3JQBC 2G76A 3GY0A 2I65A 3G1UA 3M1AA 4OHUA 1ISJA 3DZJA 5DCYA 4CUJA 2Q1UA 1B8PA 4RVUA 1HSZA 1YB4A 2BKAA 5F3RA 1M75A 1Y5RA 4O6VA 1E7RA 1PZHA 4GL4A 1ZKMA 2A4KA 1JW9B 3ZWNA 5CEJA 4II3A 4LMPA 4GVLA 1WPQA 1YRLA 3GGPA 4TKLA 3S2FA 3C1OA 1QRRA 1LXCA 3PHJA 1I24A 3PTZA 1DFGA 3G79A 4Y6PA 4E5MA 4URFA 1MP0A 3B20A 4AJJA 5I9LA 2PZLA 2NNLD 3ZWWA 4DMMA 3GNQA 4RQUA 1KS9A 2HMTA 4NBVA 1N2SA 2P9GA 4IJUA 3ULKA 4YAKA 2ZCVA 5KJ1A 1VM6A 4YWJA 4OJNA 4R5HA 3RKUA 1WDKA 4LRTB 2BMAA 4EUFA 1KY4A 4RJTA 3RU9A 4EBFA 1Z82A 4DC0A 3AOEA 5L9AA 3B1JA 3VOSA 1MB4A 2BGKA 2GN6A 2ZIZA 4GX2A 4PVCA 3EAGA 2P5YA 3AOEC 4BO5A 1NFRA 4RL6A 4PG5A 2Y67A 3BTVA 4OKIA 3ZH2A 3PHHA 4Y8VA 1PWZA 4GKVA 3RJ9A 4DUPA 2NM0A 3U62A 2DBRA 1DFHA 2RIRA 4H7PA 1EVJA 3ONEA 2W2KB 3PQEA 3B1FA 3PLNA 2QRKA 3TOXA 3LF2A 1HZZA 4W7HA 1YB1A 1WW8A 3DZIA 3NJ4A 4BB5A 3K31A 5JYDA 4PLZA 1UAGA 5ENVA 3DWFA 5CAEA 1YDWA 1ML3A 5COAA 4HADA 3OQBA 1Z6ZA 3U4IA 1ZSNA 2PTGA 2VYND 3LSYA 3RKRA 4KQWA 5I8ZA 4RO0A 2F1KA 4R1SA 4Y6SA 2OXIA 1L7EA 4BKPA 4BO0A 2C54A 3KXDA 3UKOA 2AQKA 2P4HX 2ET6A 4L8VA 3E1KA 3EYWA 1F06A 3IJPA 2B4QA 3I9LA 2J3KA 4OMUA 2AG8A 2G82A 1DBVO 4TRRA 1H0KA 1R4MA 2DTEA 3RWBA 1A72A 3NGLA 1NR1A 1HE2A 3WGZA 1Q7GA 3CMCO 4FSHA 3VH1A 1LBEA 2EP5A 3KZVA 4ITUA 4IXWA 1HL3A 2QRLA 4YJGA 4PFJA 2OBNA 4A03A 3GMSA 3JQ9C 4QT0A 3RFXA 5JE8A 4AJ4A 4RPGA 4AJ1A 4DL9A 4BO8A 5C37A 2X0NA 1DIRA 1ID1A 3ROKA 1PJTA 4P4GA 4TZKA 1WVGA 3A06A 3HUDA 1XLTA 4LCEA 1EK6A 5AQ1A 2BGMA 4MKXA 3DZGA 3CE6A 1I2BA 4A7PA 3LLVA 3OETA 4UULA 2VWQA 3GDOA 4II2A 2IYPA 4L75A 1HE5A 1NP3A 4MDHA 4UEKA 2FSVA 3TDKA 1UAYA 1UUFA 4ZRMA 3WWZA 4HP8A 5JC1A 1DFIA 3TWOA 1N7HA 2VTEA 4CMAA 3VVCA 5JXWA 4E0BA 3WQSB 1HDOA 4J7XA 2D0IA 1O95A 1RWBA 3D5QA 2ZTUA 2P4QA 3L9WA 1KEUA 1E1LA 4DPKA 3MOIA 1XQ1A 3ON5A 5IDYA 4RPLA 3IP1A 3EDMA 4B3JA 1JLLA 3E8XA 3IDSA 2NSDA 2ILTA 4NHEA 2PKRA 4ND1A 3ZNNA 4MKZA 3E18A 1OI7A 2VYVD 1ENYA 3OJLA 2Y05A 5U9CA 5DOVA 3WJAA 1GAEO 3ENKA 1MFPA 1LJ8A 5L45A 1KC3A 2ZTMA 5G0VA 4P8RA 3PWSA 1LRKA 1R15A 4CL3A 4GWKA 2VHXA 3GEGA 1N9GA 3NT2A 2VQ3A 4LSWA 1XA0A 3H3JA 1B2LA 2RH4A 1E3IA 2DQ4A 2O3UA 1EMDA 4RZIA 4TWRA 4Y98A 3HNPA 1NAIA 1LDEA 1PU2A 5C7OO 2VRCA 3MTJA 4O1MA 1N5DA 1NASA 1SEVA 4XQGA 2NVUB 1MXFA 4J4TA 5TSDA 1EBFA 1DAOA 3ZNPA 3UGKA 1G0OA 1LEHA 4I08A 4RQTA 3QIVA 3ZGYA 2PZJA 3GG9A 1GCUA 3O4RA 4GWGA 1ENPA 1QMGA 2QIOA 2GRAA 4U0JA 1E6UA 2XXJA 3MTGA 3UICA 5B4TA 3OJ0A 4DPMA 4HY3A 4CV1A 1JKJA 1U3UA 2GD1O 3HSKA 3M2PA 5BT9A 2VUTA 5EESA 3PYLA 3P2YA 1C0PA 1XEAA 1Y5MA 2UDPA 5EPOA 1HDCA 1PTJA 4GVXA 1E3WA 3STHA 1EVZA 4NQZA 4Z6KA 1LLQA 5DOZA 3I9JA 1X1EA 1Y9EA 2VHVA 3H5NA 3TZ6A 1U3VA 1H9BA 3BMOA 3IJRA 5KVCA 3E9NA 2P91A 4GQAA 3ZHZA 1W0CA 2PGDA 4FFMA 4EZBA 2OUIA 4UVEA 1B0AA 1G1AA 3DZHA 1S7CA 3ORFA 2ZJ1A 3W6UA 4B8WA 4XYGA 1PS0A 2FZWA 1F8GA 1A9ZA 1C0KA 2ZATA 1BG6A 1J49A 1PEDA 2Q49A 5DN9A 5ER9A 4YCAA 2X58A 2BFMA 4WE3A 2VHWA 5CDUA 3QSGA 1LSJA 1Y8QA 3TNLA 2Y1EA 5JAMA 1CETA 3PGJA 4GAEA 1TA4A 1LSSA 1KIFA 2GF2A 1E5LA 5LC1A 2QQ5A 1AUPA 1ADCA 1DRVA 2YQ5A 4Y6RA 5DF1A 5EQDA 4KUHA 3ZWYA 4AICA 1IULA 3MJCA 4U6QA 5I9NA 3BTOA 4EYEA 3DBRA 4BB6A 4DLBA 2GASA 1ULSA 3IP3A 2Y1FA 1PL7A 4ID9A 5THQA 1WMAA 3DTYA 3DFUA 3F9IA 5H81A 3UAGA 2XOXA 1DLJA 2G5CA 2UUOA 1F0YA 1M6HA 1TT5A 2DUUA 2FPIA 3D3WB 3Q9UA 4PLFA 1A7AA 4S3MA 1DJQA 4YQYA 3TJRA 3VPHA 5THKA 1T2EA 2O48X 3PHGA 1QV7A 1P1JA 2PH5A 2VZ9A 1E3LA 1HETA 1P77A 4ZQEA 3JQAB 4MIOA 1EFLA 4WOJA 4NMHA 3L77A 1EDZA 1RKXA 1HDGO 3OICA 3KYCB 3OQ6A 4AJIA 4OXNA 4KUGA 1AHIA 1P1IA 5F1OA 3JD1A 4JP2A 1MG5A 2JD2A 1ZXBA 4AJLA 3GN2A 3K2EA 4W7IA 1SEPA 3AOGA 4JX8A 3T4EA 4CMEA 1H5QA 2E37A 2GGSA 4GGPA 3U3XA 3MWDB 5ENDA 1U2DA 2YW9A 2I99A 4EJ6A 4CMEC 3AU8A 1P31A 5BNTA 4BO1A 2GLXA 1O9BA 2J5KA 2Q2VA 1LQUA 2Q46A 2VYNA 1UP7A 3A4VA 2VZ8A 3LLSA 3RUEA 3W8DA 1QLHA 2DFDA 5CDYA 5TT1A 3DAFA 2WYUA 4D7AA 2B36A 4L4SA 3GK3A 2NVBA 1JN0A 2P2SA 6LDHA 4JK3A 5AXCA 3HB5X 1GD1O 1RM4A 2X5JO 3DB2A 3DOJA 3HG7A 3D3EA 5ITWA 3PWZA 2QYSA 3F46A 1ZSVA 4BO2A 2HSDA 2AXQA 2GPTA 2SCUA 3PDUA 4CM4A 4NK4A 5BR7A 2RAFA 1D3AA 1DRUA 1R6DA 4E5NA 3H65A 4K28A 2DTXA 2D59A 1EFKA 4BGUA 3GMDA 4CM9D 2GR9A 2X7HA 5IZCA 2J3HA 5CP8A 4AJNA 1R12A 4MINA 3ITKA 1NWHA 3AY3A 4WUVA 2AE1A 2HJSA 1EVYA 1VL0A 5IZCC 1LDNA 4I5GA 4JGBA 4ALKA 5BSGA 4HUJA 4IY1A 3LQFA 2IE0A 2VWGA 2ZTLA 4R01A 1XG5A 3H2ZA 3V5NA 4BNGA 3RU7A 2NU6A 4Z0TA 2D4AA 3HHPA 1FDVA 4IMPA 2OBYA 2WE7A 4XQEA 3GAFA 4J3FA 2HDHA 3WTBA 3X2EA 3NUGA 4BNZA 1QYWA 4W6ZA 2B5WA 2O3TA 1YONA 3RASA 3PJDA 4GSKA 4CUKA 2C59A 5I7FA 4EJ0A 1LTHR 4R51A 4WJZA 3GPDG 1T26A 1A4UA 1U4OA 2HRBA 1A7KA 3PIIA 1F14A 4OGWA 3UFXA 1D7OA 4OO3A 2V6BA 5KVSA 3LC1O 5BNFA 5A5FA 2Y0CA 1CQJA 1U1IA 5L7WA 3KM0A 2IZ1A 2Q1WA 4FC7A 1XGKA 1NWCA 4RLSA 2DKNA 3CSDA 5GZ3A 2CSUA 1IY8A 1XDWA 4YJDA 5A06A 3ST7A 1NQTA 2A9FA 3H9EO 4CQLB 4M87A 2CDBA 3GUCA 4WGGA 4FOSA 4R1UA 5I8WA 1M66A 1NBOA 5EQFA 4MKRA 1WZIA 4RVHA 1Y9AA 2VYVA 1DXYA 3IOYA 3EW7A 2V7PA 3QW2A 3V2UA 5GZ6A 2Y66A 4C7JA 1GYPA 4YAIA 3KLMX 1VI2A 4HFNA 4FFPA 4KOAA 3PYMA 2QG4A 1DLIA 4LGVA 4OM8A 4BNJA 3WYCA 4CR7A 2E6UX 2QZ9A 3P7MA 1KVTA 4J2OA 4GX5A 1Z73A 1T2DA 2Q99A 4PLPA 2BFPA 4WECA 1ZK0A 2O2YA 3BXXA 3W8EA 5A5EA 4R9SA 1DIAA 4DYVA 2Q4BA 1ZMTA 2CVZA 1PJBA 2IDZA 3OM9A 4RLHA 3T4XA 4Z0PA 1R4MB 4E31A 2A35A 2Y0EA 4LRSB 2UVDA 3UN1A 4J9UE 2AEMA 3RUHA 4WEQA 8ADHA 1LSUA 1UZLA 3JQ7A 1DIBA 3AUUA 3KLPX 3WSVA 1NAHA 2B0JA 4YJGB 4LCJA 1VKOA 3R0IA 3M1LA 4IQ0A 4PG8A 3EZLA 2I6TA 4N7RA 1PGOA 3PJEA 2ZYAA 1P1KA 4LVUA 5FF9A 3VPGA 2Q2WA 3GN1A 4OAQA 1SPXA 1DC5A 3CEAA 3JCZA 4XB1A 5LCXA 1BSVA 5IXYA 1OZAA 4IDBA 5JMWA 3LT0A 5IG2A 3WB9A 1PZEA 4AJOA 2ZKLA 3G3EA 3OP4A 3D5TA 1CQIA 5G0WA 2WEKA 3QHAA 2I3GA 3LVFO 2X9NA 4PGFA 4DIBA 3UCFA 1X7DA 4C4OA 3ANMA 5KOIA 1QORA 4IQ8A 3K9QO 2YFQA 2J5QA 4HFRA 5KVVA 4WEOA 2C20A 3VVBA 1PZGA 3VZQA 3DEYX 3DOOA 3FI9A 3Q6IA 1W4ZA 3RFVA 4XR4A 3C7CB 4YEDA 4L73A 5A9RA 5JS6A 3ENNA 3E9QA 1CF2O 3BTSA 1K6IA 3H7AA 1YBVA 2J3IA 1BVRA 1DRWA 4NFYA 3RAJA 4CM8B 3LT2A 1LNQA 4BNLA 3WBFA 1YOVA 3GQVA 4BKQA 2NV6A 1KVQA 3I83A 1KBZA 3VZSA 3WXBA 1YBAA 2FMUA 3NKLA 4HNHA 4PG4A 1ARZA 3AFMA 2OMEA 1OBFO 2CF6A 3CIFA 4G2NA 4K6FA 3DDNA 5MDHA 1PGQA 4BO7A 2GDZA 2W8ZA 4YJHB 5A3VA 2O4CA 1PR9A 1WDMA 4D41A 3H9GA 1GQ2A 5KIAA 3ZU4A 3EMKA 5AYVA 1N9GB 4R41A 4XJTA 2B83A 2Q4EA 5TX7A 3E9MA 4ALIA 2ZB7A 3FSRA 2G0TA 1UDBA 2BLLA 5T57A 3RJ5A 2GCGA 4BGEA 2Y1OA 3ZDFA 3ZWAA 4IM7A 4Q3EA 4TVOA 3GOHA 2B4TO 4LVCA 2V6FA 3CZRA 2WD8A 3OEYA 3B70A 2O7QA 4DQVA 5AVOA 3PFWO 4CUZA 1M6WA 2EGGA 2FHSA 4RZHA 1MC5A 2WWRA 3UH1A 1P1FA 2PR2A 3FN4A 4L4XA 2VRCD 4FJ1A 4WNIA 1YJ8A 3G0OA 1LX6A 1E1NA 4I8XA 1IB6A 4JJGA 5JY6A 3PK0A 1NQOA 3BMOB 4KUEA 2CNBA 4BO4A 1H6AA 3DZKA 4M49A 1QYVA 3PIDA 1MLDA 1VLLA 2FZEA 4AJHA 4YRAA 1E7SA 1SB9A 3DL2A 4ONEA 3KHUA 1LUAA 2GZ3A 1B7GO 3TZKA 4F3YA 2OP0A 2FPGA 1ZMOA 4PRKA 3RBXA 1ZK3A 3DZFA 4FS3A 4CM9A 3DBHA 2CMDA 5JC8A 1EEHA 1ADBA 3OEWA 4U7WA 4CLHA 1LRJA 3FRJA 5AXBA 1DDOA 3V2GA 1RYDA 1B3BA 1Y8QB 4DLAA 1KVUA 4YTEA 2ZYGA 4DWVA 1VC2A 2FWMX 1ZH8A 3D4NA 4EUEA 1QSGA 5EL0A 3RBZA 5G4LA 4CM6A 2X5KO 5KKAA 3GA0A 3TSCA 1SMKA 1V35A 5DP1A 1E0DA 5A9SA 1JKIA 2AQ8A 2VZ0A 2X0RA 4RVDA 4U0KA 3DBRB 1NTOA 4MP8A 3UOGA 2Q45A 2G17A 2IEDA 1U2GA 2C07A 5JAQA 4PLVA 3FTNA 2JFHA 2QHXA 1DHTA 4KTVE 1TT7A 2D8AA 1LRLA 1TT5B 4MP6A 4RVFA 3CMMA 1P0CA 1LDBA 1C0IA 3Q1LA 4E5YA 1BXKA 3H3FA 3CZMA 4RF5A 3B6ZA 1DSSG 3PVZA 2Y1CA 3JQCA 1CIVA 1EVIA 3SX2A 4BV9A 5JW6A 1ENZA 1LI4A 1UR5A 2C2XA 3I9OA 4ZQHA 4DREA 4YT8A 5A03A 4UUNA 4E2ZA 1A9YA 3WIDA 1RJWA 2C5AA 2GN8A 3WGTA 3E48A 3D7LA 3ZZNA 2IZ0A 5KCZA 3HDYA 3DTTA 4J7CA 3Q2IA 5CFZA 1HLDA 2ZCUA 3RIHA 1W6UA 2O3JA 5G0UA 1XHLA 5DDIP 1E1KA 2NWQA 3DR3A 3DFZA 3UF0A 1ZFNA 3GAZA 1K89A 1PGPA 1IPEA 1BVUA 4BL5A 4Z3DA 3ONFA 3JYPA 4FW8A 4OIMA 3HDQA 3CXRA 3HADA 2RCYA 5EERA 4E6PA 1Q0HA 3BMQA 3WTCA 4E21A 2VHZA 2BELA 3HFSA 4ZICA 2X23A 4KQXA 2IODA 4Z9FA 2O50A 4BUCA 3ZV3A 3MCVA 3LZ6A 3PLRA 4J1NA 1NM5A 4MOWA 2ZYDA 4XYEA 4CM4B 2EKPA 4J2HA 3WMXA 3MWEB 2QZZA 5I7VA 2O23A 3AW9A 3S55A 3W4JA 4XKJA 3I23A 1SZJG 4X54A 3NYWA 4BMVA 4CV2A 3GR6A 1P1RA 1X0VA 1UP6A 1YS4A 4MVJH 2X86A 3LF1A 4IINA 2EXXA 3VTZA 5CDTA 3F4LA 5T6BA 3N58A 1NVGA 1GQQA 4LW8A 4E2YA 3MEQA 5U1PA 4XIYA 1KETA 4PLHA 3GDGA 3DC2A 1H6BA 2DBVO 4HFJA 2P5UA 4QO7A 1VSUA 1BMDA 5HWSA 3JQ9A 4AVYA 2C7VA 3V2HA 2EIHA 2WMDA 1CWUA 3LC2O 4NFHA 3AJRA 3JD4A 2JHFA 1YWGO 1NR7A 1GEEA 1R4NA 4TKMA 4ZD6A 4AJKA 1QXSA 4MVJD 3W8FA 3ADPA 1PS9A 1BXGA 3LK7A 1ZVMA 3ZHXA 5DCWA 1Q0LA 3GH3A 3JQFA 1WZEA 4CV0A 4F46A 3KSDO 1NPYA 1NHWA 3I9MA 3C1AA 2D2IA 4F6CA 1K0UA 4XX0A 3JQFC 1IOLA 3ASUA 4YAEA 3R6DA 2PZKA 3R1IA 5TNXA 3VPXA 1UZMA 2YY7A 5TJHA 2TMDA 4I9UA 1L7DA 3GPIA 3NTOA 5HS6A 2AMFA 4OSPA 3CUKA 2DPHA 1CDOA 4R3WA 2WYWA 1O0SA 5F5NA 1NHGA 5FI5A 3KRTA 2DU8A 3D0OA 4U6SA 5FEUA 1GUYA 4XJSA 1Z7EA 2IRWA 3ZWOA 4BIIA 4D3DA 5AOVA 4GSLA 3KOUA 3ETEA 3LU1A 5K6AA 4E32A 3OQ1A 3P5SA 1OFGA 1SCUA 5K6AC 3D4OA 1V3UA 2Y68A 3I9NA 3RI3A 2NU8A 3E82A 1GUZA 3VDRA 5A3JA 3Q3CA 3Q0EA 1GPJA 2Q2QA 2Q3EA 3GF4A 3JV7A 2BF7A 4YVFA 4CLOA 4LN1A 1KY5A 1P74A 2OHXA 1ZJYA 4BNKA 1MV8A 2GYYA 1PL8A 2PD3A 2EERA 2I67A 4CODB 3WYBA 3TFQA 3WJ7A 1LSOA 5COBA 5BQFA 1BHSA 1Q2XA 1YE3A 3S8MA 1MFZA 4YPOA 2VTDA 4RDIA 1E1MA 3JQ6A 3PFFA 3IMFA 4XWYA 1K6XA 3FR8A 3ZWBA 3OF2A 1GY8A 2B5VA 3KB6A 4NU6A 2VT2A 3ZWPA 3SBOA 1FDUA 3IKVA 1IZ0A 1I10A 4PRLA 1Z45A 5G0SA 4WOKA 5B4UA 3LT1A 2X4GA 4B4OA 4CMIA 4ESOA 1AE1A 4CLDA 4HV4A 3NAQA 3Q2KA 2HO5A 3DOCA 3INGA 1E3EA 4IS3A 1G6KA 1C1DB 4N18A 4XDYA 4BV8A 3CKYA 3ONDA 5IN5A 5L53A 1RM3A 4DQUA 3JYNA 5U4QA 2HMSA 1E92A 2W98A 3COSA 3HQ4O 5G0TA 1RM5A 2PY6A 4XYMA 2NTJA 4D42A 2YHUA 3SLGA 1YH3A 1X7GA 3JQ8A 4OH1A 2DFVA 4PG7A 1EUCA 2Z95A 4BKOA 5DBFA 1CERA 4O59O 2VNSA 4UVGA 2BFOA 4XGIA 4J49A 4XIJA 3FPCA 5JSFA 3A28A 2JJYA 5EJ2A 4MIEA 2PV7A 1VE9A 4CQMA 2DUWA 2PD4A 3GG2A 4K26A 1QV6A 3FBTA 3IL2A 2HAEA 3S1LA 3GHYA 4XA8A 1Y8RA 3WMWA 3KEOA 1E7YA 1YOVB 4KWHA 1YQDA 1AXGA 4YB8A 1Z74A 3C24A 4WKGA 2Y99A 4CLXA 1EUDA 2Z1MA 5JBIA 1PJLA 5L4SA 2J5RA 1LLDA 1NX6A 1JTVA 3TRIA 2NLOA 1YL6A 2W2LA 1SB8A 4AJEA 3JQGA
chains in the Genus database with same CATH superfamily
4GDMA 1EJ0A 1YDHA 1ESMA 3CNQS 3GOQA 1GG9A 3NRCA 3QLUC 1PQPA 4NP6A 3M4JA 4TV9F 2WDZA 5E6SB 1L4NA 2BEWB 4YUXA 5KNDH 3PRJA 1NUSA 4W63A 3BGDA 3KIPA 3QUCA 1I80A 4O4JB 4DGSA 5EIOA 1Y7LA 3NDBB 4KFTA 4N5IX 2V96A 2YUTA 3WL8A 2ZXEA 4CM7A 4A3SA 1GPAA 1MGOA 2VR1A 4I66A 5LJIA 3M9WA 4LYGA 4IHAA 1NBIA 3RYTC 4BLOA 1Y6GA 1VIVA 1WP4A 2XYVA 2FLWA 2I6FA 3KJEA 4XASA 5CVVA 4R71A 5JCZA 3W5SA 3HH8A 4M9QA 2VG8A 5JSYA 4DBVO 1OMOA 2D74A 3ZVLA 3G2IA 2ZR8A 3M6AA 4KBGA 4B7CA 1KQFA 3EBPA 3QLVC 4QEZA 2IITA 3G59A 3M3PA 4FLEA 2BSXA 2VP4A 3U4HA 3HCWA 5IF3A 4CIXA 4D4GA 2EEZA 2MOKA 4XGQA 3U4GA 4E4RA 3OZWA 2CVQA 4EUNA 2YUIA 1FBNA 3KKEA 4G4GA 4JLUA 1WV0A 3K8OE 5DK6A 4ZALA 5KNDD 2OLKA 2WLSA 2RHTA 4LPKA 1ZD9A 2WKQA 3H86A 3D8BA 4X1KB 3ZBPA 1YZTA 3D9QX 2X5XA 3AEQB 4AUKA 4DABA 1X74A 3SE7A 2O8DA 4D9GA 3NYIA 1IXYA 1ESNA 4TYMA 2CZCA 1U0RA 2D06A 3FROA 5J2UF 4G5YA 3I0ZA 2FWNA 1Z4JA 3KZ1E 1OF1A 3I42A 1EFVA 2W6ZA 4JLJA 2GOYA 2ST1A 3SY8A 2HDOA 4W8OA 4ESEA 1FTQA 4J9VA 3R24A 2G83A 3QPBA 3WLFA 1VMKA 3R75A 1NBMA 2C0PA 2CUNA 4HVTA 4NOLA 5HHTA 5JADA 1ZN7A 2Q41A 4YRGA 1JL3A 2ATXA 4INAA 2RHOA 5EWMB 2BGRA 3SDZA 3P19A 1E79D 3FPKA 4J3NA 2DWCA 5DGHA 1GHTA 3ZCXA 2P9CA 3ILYA 3LUDA 1ULUA 4EI2A 1QJ4A 5JNLA 3JVIA 5I4BA 3WGHA 4X8MA 4DIUA 2NUTB 4H31A 10MHA 3R9KA 4XVCA 1UXIA 1WB6A 2PGIA 2ZI3A 4CIWA 3T1VA 2VSXA 4L8LA 4D1YA 2J0UA 1OFHA 4BZXA 1LLCA 3G0HA 1WR8A 1Q6YA 2WVHA 3OZEA 4J1TC 3CISA 3W7AA 2XHZA 3ORHA 4R7TA 1XVAA 1NFFA 1Z3IX 3AW8A 3ILXA 1X94A 4DJ5X 1AURA 2FN9A 4MPDA 1OBVA 3GJ3A 4UUMA 5CU7A 5J40A 1KBOA 3UATA 1GA4A 1MC8A 1QOZA 1EP3B 2HMAA 2XZDA 3DP9A 1YR7A 2PMBA 1HEYA 1RWXA 4H6WA 4BO3A 2AZXA 4JIGA 5T8KC 3PFKA 1VJCA 2E18A 1SUPA 2AFIB 3A9WA 3THWB 1VMAA 5EPEA 3TZQA 4JJKA 1BX1A 5LZ8A 4HVCA 4EG6A 2O19A 1L5RA 2PYIA 4N8DA 2WFZA 2F8LA 3K0FB 1BXRA 4KR9A 3VTKA 5C8VA 5F64A 3N3AC 4E3ZA 4LJ5A 5HRAA 2V1UA 1GRCA 2D00A 2NO9A 2V97A 3PFHA 1VLJA 2HNKA 2YFKA 3I09A 1NY5A 5AHOA 3KWJA 3STUA 3RK1A 3EIEA 1RFGE 5CIYA 2FE1A 1KZ4A 3ROQA 1H93A 4M1MA 3DXFA 2NP7A 1BDMA 1LK0A 1OC4A 2GM5A 3K05A 2EX1A 4Q00A 3WL7A 2JF0A 2AZMA 4J0JA 1CF4A 1OLSA 1OOEA 4POAA 2GARA 3WQRA 3RREA 3C5CA 3I1FA 1FW6A 1H2AS 1O6GA 2CHUA 2HU7A 3REOA 3AKZA 1UJCA 3LHIA 2PMFA 2EWVA 1G1MA 4ZA2A 1OC2A 1U4NA 1YK0A 3EGIA 4C0XA 3K1YA 3C8UA 1UFOA 2Z4SA 4EG8A 5B6PA 3EZNA 5CH8A 1K66A 2BFBB 1RLUA 2C82A 1GZUA 1ZGBA 2NADA 2OC9A 3ECCA 1R6UA 3B6IA 4PO1A 2EHDA 3TUZC 3L7IA 2JIMA 3OEED 2OORC 3PC2A 5BQXA 5IJ9B 2RB4A 5KKNB 1QS0A 1K5DA 2IX3A 1Q1BA 1I4LD 4MUYA 2C4WA 3VNSA 1ADFA 2XBMA 3GFGA 3P2OA 3E81A 5ADVA 2O2SA 1A8UA 1B00A 3KJQA 4QYMA 1I9GA 5B1DA 3PBKA 3HHEA 4MJ7A 3NAZA 4F5ZA 4YMGA 4JKOA 5KTMA 3RIXA 4IKOA 1OI3A 4NEGA 2VF4X 3HZHA 3GVHA 3O8OB 2F8TA 2DP4E 4XR9A 3V1MA 4HTFA 3NTUA 3CH4B 2JFZA 2ZBEA 2NVWA 5FL7D 5DTIA 3WLRA 1GNLA 1OW3B 1BVHA 1Y5NA 2VPZA 1Z2OX 2WM8A 4L74A 5TQ0B 3HXPA 2HSWA 5PGMA 1V8ZA 4MVCA 2W6ID 3NM6B 3D6NB 1WCXA 3GFTA 3AY6A 3UV3A 1A82A 3VU1A 1TCAA 3W8RA 1G8JA 2ZJ4A 2ZXFA 5LZ2A 1Y3AA 2OCKA 1ETHA 3B6EA 4L6IA 5A3SA 4LK2A 3WGJA 5A4IS 5KNLA 2JCYA 2GFHA 3LA8A 4QG7A 4DRXB 4N5LA 1Q44A 4DG5A 3LIIA 4DHEA 4HO1X 1PQYA 2A4MA 3C48A 1YL5A 3UMGA 5AUNB 3STWA 1G7SA 1MIOA 1PSZA 2ODWA 3FHCB 3IIEA 3W06A 4Q3OA 4B6EA 4C4XA 3G23A 2ZSJA 4ENUA 2YV1A 1AK2A 1KEPA 4MRMB 5HUQA 3AFNA 1UKAA 1ZS9A 3UWPA 4P22A 4BQSA 2HUNA 4CF3A 5BOSA 3OIGA 3W5JA 2NG1A 2YWHA 4FQ8A 3FWKA 4QFMA 4D6XA 3GGGA 3FUXA 3I04M 4HS9A 5IDXA 3VKHA 1RPAA 2AD5A 2HYDA 3E1GA 3FUVA 2CDCA 4R9NA 3WL5A 3GA7A 4DIDA 5K99A 1W35A 4YGXB 3I6MA 1Z0SA 4GEGA 5KTYA 4OBBA 1EPUA 3B51X 3A27A 3K9LA 3OF5A 3RODA 4MCAA 3PUHA 4YRNA 4EW3A 2RK6A 2C42A 1ZYUA 3WR5A 1FYEA 3MLEA 4J16C 1AHNA 5LYJF 3W2FA 1NR5A 3LC7O 4C07A 4YJ2A 3ZVMA 4F3RA 4R2KA 4CCYB 3L8FA 4FZ3A 3Q8WA 3QU2A 3H16A 4DNXA 3H42B 2FEPA 4ZI7A 2DMRA 4ND6A 4FSDA 1KYXA 1Z06A 1ZEMA 3GFOA 3S4YA 2XWPA 2J67A 1EDDA 2ZUEA 3SOZA 1T9GS 3EQZA 1G3RA 3PYXA 4LRUA 4A0SA 1BX3A 2WYIA 3FWZA 4DJAA 3NMUF 3U3KA 4OB8A 3O3NB 1RFLA 2XUHA 4CF6A 4YRRA 5K45A 1TO6A 2H48A 1T2FA 3N7AA 4MQUA 5EXSA 5L3ZA 5AVSA 3P9KA 4EDFA 3JD0A 2R1TA 2B37A 5TEWA 4BOYA 2JVKA 3NIFB 1RWMA 2GVZC 4C7OB 2WD7A 4MGYR 3C4VA 1CE8B 3I9V6 2QBYA 4MKGA 4UVDA 2GKOA 1V2HE 5LSAA 2C2WA 3WGQA 2OG2A 2KSQA 5DBGA 2GQ0A 1CT9A 3ZDZB 2HSEA 2V7UA 1YRWA 1S4QA 3WRYA 5CB0A 5JECA 2OAGA 3F1LA 2YJTD 5KSPA 1ZHHA 2ORYA 2W48A 1ECPA 5A0VA 2J6CA 3QENA 3IEKA 3O7MA 1FNNA 3V9PA 1YRHA 4RTMA 2B2CA 4G4JA 4HEA1 1VKNA 3HXOA 5DTRA 4EUHA 3D3QA 1X9IA 4ND8A 1QQ5A 1Z5WA 4YJFA 4EY3A 3EGOA 3DTVA 1QP8A 3GRUA 3AEKB 1T6XA 2NUAA 2ZRMA 3LFUA 4DWWA 2J4DA 5KSOA 1HNWB 3DDHA 4FPXA 4RH0A 2A3RA 1VE6A 3PD0A 3H8WA 3DHEA 3QVWA 3GRPA 4UAGA 1I3MA 1ZM2A 1KXJA 1R0KA 1ZK2A 2J7PD 2EV9A 2FJ0A 3O4VA 2VVTA 2RARA 1XCGB 2V4MA 4NBRA 3O94A 2EARA 4B6SA 2MYNA 1F3OA 2QTHA 4G4SP 1UM9B 5ED0A 2JLXA 4ZTUB 2BMWA 5C8ZA 2JK0A 3ZGZA 4NULA 1OAAA 3F3MA 2Y1GA 4Z1MA 2QQFA 5IZ4A 4CMIB 2HCFA 2UZ0A 1I3KA 3WX0A 4F4JA 2QW8A 2BI8A 2R47A 4YRSA 4I55B 1Z4IA 2XCQA 4D43A 4F38A 1SAYA 1U0GA 3DAPA 1C7IA 2PSFA 1D09A 3VMFA 1XMSA 5EXTA 1NI4A 4AQYB 4E08A 1FTWA 1TRKA 5JS2A 5SYNA 3W6ZA 4IDAA 2YQ4A 3EZ7A 1TEZA 2A9RA 2GAOA 2NIPA 4FOOA 3CF0A 1Z9BA 4J0KA 1NQAO 4PVDA 3BUSA 2C3OA 1Q7BA 1R3DA 1ZAKA 2VT3A 3A4LA 5C1PA 2WA2A 3MMZA 1E89A 3VJKA 4ZQGA 4HDQB 2ZTVA 2IPLA 5BMVF 1KO1A 5IPFA 2PGLA 4H27A 2H6EA 4DB2A 4GZMA 4HBZA 2XX3A 5U4XA 3S28A 2Z5FA 4BQNA 1NX9A 4IKPA 2O1EA 2OCBA 4U2EA 1UDCA 3QQPA 2AN3A 3PPXA 4B46A 2ODAA 5E4YA 4QO8A 1SULA 1T1SA 1NJSA 3WYDA 2VPWA 3SXUB 3X1WA 4AP5A 3F6RA 4G1UC 4JEUA 2XRFA 1RKVA 4MV6A 1KU0A 4F84A 4CIYA 2ZP1A 3RYHB 1HDXA 2ZWIA 1JHPA 4Q48A 3SOPA 1IRXA 4IQ4A 4LBYA 5EHNA 3YASA 4FKBA 4ZHSA 4LX8A 1XLUA 2CXTA 1WSDA 4L5IA 4TWIA 2FMTA 4ZDWA 4BZZA 1ZNQO 1IK6A 3D6TB 2OEPA 3OMLA 2VJAA 5JSZB 1VHTA 8LDHA 2HLNA 4KIGA 4B3IA 4O0MA 4PXAA 1I01A 4US2R 4YQZA 5GV7A 2C61A 4NAVA 3HDTA 3AESA 5FORA 5C4MA 2ZK7A 1OGJA 3TK1A 1V9LA 4NNJA 3VR6A 3W78A 3CZPA 4AO8A 4LJYA 4C76A 3OQOA 3OH8A 3E1SA 1EB9A 1Z07A 3PDHA 4RLQA 4XM0A 4XRGA 3NALA 2RB5A 2DBQA 1F6DA 2DFKB 1VJGA 1M67A 2HU8A 1NNI1 4FXOA 3NWEA 3TUJC 1QGYA 4IMRA 3ZCUA 3FIJA 4J4BA 4NWIA 5ALVA 2GK7A 5BQ3A 5SYAA 4R68A 1S7GA 5EMJA 3N07A 4BE9A 5BV0A 4QEKA 4D3SA 4AKHA 1FFXA 2UZ3A 3M6WA 3HO6A 1JDJA 1WX1A 4EJSC 4BZQA 4HT3B 1NXQA 2PGOA 1A8IA 1NDQA 4OQZA 1RKBA 1RRFA 3B2QA 4DLVA 1VGRA 1KA9H 3DPSA 3OQMA 4PZCA 3NNDA 3KJIA 4PPGA 4DMCA 4F6LA 4C2AA 2Z2YA 3OWOA 4FN4A 5FR2A 1GNTA 1CY1A 1KMNA 2XEDA 4BKRA 1U02A 4LQ4A 5L40A 2WNSA 1X1BA 3U4CA 5JAUA 5BNIA 3RADC 4I5DA 2RK4A 3G2JA 2BRUA 2A0FA 3HDGA 1KK3A 2PO5A 1F0PA 2QWXA 4MI3A 4XPIA 5K0NA 3V1KA 3NTLA 4DCGA 4EF5A 4EHAA 5IKXA 1UAAA 3NV9A 2BPOA 3DKPA 4PTZA 5CVTA 1CV2A 2REXB 3I4CA 3GQBB 3NRBA 5E2AA 4ZT4A 3L4BA 3DNMA 4MRAA 2G28A 2X0IA 5NLLA 1DMSA 5AK3A 2PUFA 3TQSA 2R8RA 5KOHA 2OHGA 4KP7A 4Z0HO 3JASB 4FEYA 3ZGVA 1P6XA 4C01A 1J5EB 1LBTA 4BMSA 5LKAA 4DIFA 2SECE 4CTOA 2V9CA 3ETLA 5JPIA 3VNRA 2X42A 4D3ZA 1IEWA 4MQLA 1P3DA 2HMUA 5FWAA 2AXPA 4JC4A 1KOGA 1TQ4A 2QT1A 4HOYA 3T1OA 4QLAA 1JBKA 3OJOA 4FB5A 5C8DA 5L3QB 4JLVA 4AKGA 2ZVPX 5E1BA 4PYIA 4RMNA 1N7GA 3HB7A 1BW9B 3MELA 2ZULA 4OUDB 2AN4A 6REQB 1LI7A 3SFZA 4DDWA 4K0KB 4R9RA 4EKDA 5GADl 4OCZA 1I33A 1QF9A 4WCFC 2B8JA 4AM8A 2BTEA 4OXXA 4RJKA 4QU8A 3DTNA 2FCAA 4H7FA 5LD2B 5ECGC 1VHLA 2OC4A 4CMHA 4UNIA 5LUBA 2AEJA 1DO8A 4JBNA 1KQ3A 3T12A 4DJTA 4EA9A 4OU5A 3VSEA 1WB9A 3KVVA 4UUOA 4X91A 3H5AA 2BR3A 1Y8CA 4FFLA 4KPFC 3PD7A 3IPCA 3G49A 2OCIA 2ZQZA 1KAHA 3HBNA 5EXPA 1GM5A 2HSGA 2YICA 4JP3A 3UKDA 2G0NA 4FNOA 5DYIA 3KUXA 1LFAA 3IVXA 3GJ7A 1XKLA 2LKDA 3O4JA 3WG9A 4QM7A 3IQGX 5JRJA 3I6IA 4EVIA 4BFTA 4GD3Q 4C1NA 2J9YB 3L3BA 3N0RA 1KSJA 3TBKA 1T5HX 2CFIA 2GO1A 4XXHA 3I01A 3IMEA 4HB2A 4OI4A 3D2CA 3V3TA 3WDKA 1E2IA 1FEZA 1NF3A 3DEHA 1NQWA 1PBTA 4RIHA 2WSBA 3JAMA 1YDEA 4HXFB 2OXTA 4PRYA 1FF9A 3I8XA 5ALPA 2QX7A 4OMDA 4BQPA 5AUOB 1G42A 1NVTA 2HCTA 1NW6A 5ECWA 1L7MA 3KVYA 3L0CA 5AT1A 3RUCA 4BHTA 4YLYA 1QU2A 3SDBA 3LRPA 4E5PA 4MVJE 3QVOA 1G5FA 3HU5A 4PCVA 1V3VA 4Q1EA 1ZK4A 3SD7A 4IDCA 5G40A 1CQJB 4QYIA 1YIOA 1P17A 1G16A 3H0CA 3T3DA 4TYYA 3AI1A 5AI8A 3BHNA 3VC2A 3QEJA 3A1FA 2AZTA 1LX7A 4E12A 3MG9A 5F21A 3EXHB 4U6NA 1SA0A 1EUZA 3U09A 1ONBA 3DMNA 2Q8PA 2NNWB 2GAFA 2X4IA 2WPDA 1C50A 3RAFC 2C78A 2W6JA 4BGIA 4R31A 1SIUA 4R8KA 5A4DA 2REBA 1SUEA 3WSWA 2YIVX 1JI0A 4WLEA 2DFPA 3UCEA 5JCXA 1XNQB 5JAOA 4NI5A 4BU0A 2AJLI 3M70A 1GFIA 2G7ZA 4QFDA 1EE2A 3L07A 1RSZA 3EPKA 4JEIA 1VZ3A 4I1YA 2F55A 4NDAA 4GSYA 2PU7A 3HJAA 5F23A 2IY9A 1Y7PA 4S2EA 1D8TA 2ZFUA 2RAUA 3H1AA 3SZGA 2QTCA 2VRBA 1PBNA 1A9XB 2A67A 3HDVA 3RKSA 2Q9BA 1DIHA 1E2GA 4L28A 2XXBA 3WRWA 3JRWA 3GT4A 2VJBA 2H8GA 2ZRDA 3BXFA 2F1IA 5D5PA 4ZQIA 1AGNA 1IZ7A 2P6OA 2CV1A 4QU0A 1TMGE 1CUHA 1MT3A 4FI3C 4LJKA 4N0EA 4A82A 5B12A 5K05A 5LJLA 3WHPA 2QUKA 4I5EA 4ZOEA 2XE4A 1GCAA 3SBXA 1XNRB 2QSJA 2GK4A 3KJHA 1RAGA 5GJCA 3BHMA 1N2EA 3GUYA 4JI5B 3V46A 4C7BA 4D44A 4EHBA 1CKEA 1E5TA 1NT2A 1VJRA 1YJXA 1QYDA 2JI9A 3ED5A 1XIVA 3ETNA 3IMKA 3JQ7B 4GYYA 4QUEA 3HB4X 3ZU3A 4AZ0A 4HBGA 1JWAB 1U63A 3KAPA 1EVKA 3EWAA 4DN6A 3KSZO 1W6RA 4J76A 2QAIA 2O6HA 3KV3O 5C0OE 4G56A 4KHZA 1ECBA 3IIKA 3KOWA 3PFBA 1W36C 3HL4A 3RC8A 4FKMA 1XWFA 2Q1TA 4J6FA 4KAXA 5J4VA 2OBMA 3I58A 1XN4A 2XNHA 3QFRA 4Q15A 3UCXA 4DKXA 2LCFA 4BRSA 4D3FA 2C58A 1CYDA 4EFKA 2C00A 4OHRA 3ZTTA 1XF1A 2ZB3A 2ZIXA 3NC1C 4Y2SA 5DBHX 4WUTA 4XGNA 4ZVMA 3GHHA 1UC5B 2V54A 3HB1A 5CGQB 2DPGA 3VBCA 3MWKA 3DWIA 3ZWVA 3U7JA 4D9MA 5H4GA 2LKCA 2GPYA 3V7UA 1PJ3A 3DMFA 3ZW9A 4D9EA 3TKLA 3GCWA 1GGJA 1FVOA 1OZ0A 1FP4A 4IDQA 4ALJA 3C4QA 3DLTA 4UREA 4D46A 4A10A 2VBFA 3CN7A 3W90A 4D82A 2WJHA 1NUTA 1XZIA 3U80A 3TLMA 1DG1G 2HWUA 1M7BA 1JA9A 3EXG2 1OVGA 5FWNA 4BNUA 4V0QA 1QP4A 3ES9A 5IJXA 1JLMA 1P2FA 3SC4A 5BNWA 1K5HA 3QA3E 5AW3A 1L5GB 5D5QA 1S8FA 2JI7A 1HR0B 2Q27A 1C1XA 1B74A 4GEKA 3CRNA 2RJOA 2QA5A 3QF7A 3REQB 3W1VA 4NK5A 1Q20A 2P77A 4KE6A 5JH7F 1L4YA 3R0JA 1BOFA 2VK2A 4JLNA 4IIFA 4XJVA 3WE7A 4EY6A 4D79A 2C7PA 2CJWB 1AA9A 1UXGA 2XNCA 1JV2B 4G63A 4RYDA 4ROSA 1U6JA 4E03A 4FDVA 4KZKA 4P38A 1E6KA 1QK5A 4ZIRB 2VP5A 4L7VA 4PBRA 3RS0A 1MD9A 3QJ5A 1FJGB 3CO5A 3FDJA 2VCYA 2XMQA 1QGED 3DBVO 1XMJA 3H1FA 4J1QA 3V7YA 2CHVA 2OP1A 3IAUA 4IZHA 4XDZA 2FSFA 4RDHA 3VAAA 4DC1A 1UH5A 2VDJA 3HN7A 3O21A 1PYOA 2PPLA 5JLJA 3O8NA 4B71A 4JHLA 3NC0C 4XX1A 2QMUA 4F5YA 2Q3LA 4S0XA 5JJKA 1TNDA 1X1RA 2E4AA 2FSHA 2R8PA 4IRMA 1DQNA 1U7PA 1O57A 2ZU6A 4ZGBA 2OYRA 4G86A 4ZO6A 1P4SA 2FF7A 4IYJA 1I4DD 1H4QA 4JXKA 2XTJA 1B15A 4O29A 5FPTA 4EJ2A 1PWXA 2EYUA 3H8VA 2MWMA 3VKWA 3TL2A 3W2EA 4FEAA 4NBWA 1A98A 4TT3A 4Z7NB 2COEA 2V98A 1SJ9A 3R3ZA 2KLBA 3M3DA 3QKIA 1A5ZA 1UM8A 4OHZA 3GLHA 3TEFA 4C06A 2PJRA 4G5RA 4YDRA 1TPZA 4KYTA 4CG2A 3L1UA 2UZ1A 2DAPA 2JLRA 2ZS8A 1NT4A 1S8NA 3GJ5A 3BCHA 3H11A 3Q9NA 4QOJA 4JYAB 3BFVA 2YDYA 4B2YA 3ANLA 1C80A 4XUCA 3V8VA 1UT8A 4MUEA 4TT8A 4KXNA 2XDYA 1Z33A 3N70A 4R8VA 4WK0B 3VZRA 1OXMA 3FNHA 5D01A 2ZUWA 1JP7A 3KYDB 3W4IA 4KRFA 2VDWA 3KLOA 5B53A 1XEWY 3FHJA 4A23A 5EHZA 4HUQB 5JJIA 2FN3A 4PLTA 1RXVA 3ZW8A 3I0MA 2CN1A 1NI5A 2C5SA 5HGJA 3ESZA 1B93A 5ITZA 1EQ2A 4EKNB 4WLVA 2JIBA 4BBZA 3BIOA 4PR3A 1W2WB 5FT9A 4F2DA 4JVSB 5A7HA 2X2OA 2QD2A 5DNUA 9ATCA 3FDIA 3DGEC 5LQMA 4JA2A 3AVUA 1RYYA 2H2DA 1ILWA 4JBGA 2YHIB 1ZHFA 3TZHA 4HNUA 1H3EA 5SY6A 4F8YA 5HKOA 5KMGB 2FTKE 3CRMA 3E5HA 5AJWA 4N65A 2VT7A 3LL7A 4UMDA 4GPD1 1N2GA 1W59A 2BLNA 3CSUA 3DHNA 4RVGA 4JXZA 5DMHA 3GFBA 2PANA 3T54A 1W47A 2O07A 5BSMA 4E33A 1E2PA 1HDYA 1XUOA 1XMOB 3UY4A 1GZ3A 2C4VA 4YWHA 1H2XA 3C3PA 2XDAA 4NYMR 5JO9A 4L85A 4KIFA 1DBIA 3KU1A 2XXAA 1DX4A 3JX9A 3TQHA 3I5UA 4IQFA 1NVEA 1O5OA 1L7BA 5B1YA 3CGGA 3PQ7A 1PDVA 2P3OA 1IPFA 5LN1A 1YS2X 2HH9A 4O5OA 5C7IO 2Z6AA 5I7OA 2W2KA 4QQRA 3UGTA 3GRRA 2JLWA 2MSEB 3C3WA 4R54A 3F4KA 5FTMA 4IJQA 4O2BF 4ZVOA 4BNDA 2YDXA 5DN6D 1L9XA 4LGYA 2XF8A 1GAJA 3BAZA 4XOUA 2Y1DA 2K5UA 2ZBPA 2QP9X 4X66B 4JN6B 3VI3B 3PPVA 3EF3A 3T1NA 3BQNB 1PD1A 3NQ41 1JKFA 3E6AA 4TZTA 5AJUA 2B30A 3QNUA 1USIA 1K3TA 2X15A 3QXCA 1ZSYA 5EUMA 3O8BA 4UDXX 1IBKB 3T3EA 3VFDA 1V7QA 3GP3A 1PT8A 4CQNA 1W96A 4UM5A 3MWEA 4FDTA 3TD2A 4JP1A 1NN3A 5FJJA 4UOEA 1F51E 3ROPA 5JFOA 1N8SA 1FRQA 2XGJA 4FFWA 1CTQA 2ZYWX 2QDXA 4KXQA 3G6KA 5D8DA 1FLNA 1N3LA 1S01A 2MSCB 2R00A 1HF3A 2IZ7A 2X5OA 3HVIA 1Z6PA 2BFDB 3I52A 4AIIA 3ZQJA 3J81k 2JLZA 3AHCA 1N3BA 1A3CA 4PTLA 5TB5A 4D0GA 1BDBA 3CPJB 3H4VA 4YR9A 3PRYA 1KMIY 2FY8A 5K3FA 3T35A 4HYQA 5IMSA 4TTPA 4HNAA 3TW8A 3KL4A 1P3Y1 3X0DA 4AP6A 1E4VA 1YJQA 1O08A 2FFHA 4UVIA 4R3NA 3FCEA 4X84A 5ESXA 1OLUB 3R7FA 2YBDA 1YBMA 2OHFA 5JV5A 4JYMA 2EG9A 3F8WA 3O9MA 4NMXB 1VL1A 3UYLA 1N2JA 2QAGA 4HQOA 4RF2A 2IYZA 1D4AA 2GZMA 2IYNA 4YAGA 2D7JA 3JWHA 5BV2P 1XX6A 3N7UA 1FXSA 1U7DA 3BYZA 2C5GA 1G41A 1Q92A 2C1EA 4WH0A 1KRXA 1PQUA 2JFOA 1PR6A 3KO8A 3O0TA 1M7HA 2ADFA 1XQ9A 5IC6A 3LWNA 3N8NA 5BWMA 2QI9F 5HSGA 1U81A 3QWAA 2PBLA 3F5FA 3F5SA 4IUCS 4KWIA 1I2DA 1L5SA 1O96A 1EA5A 1POWA 1WW3A 1BTOA 3C39A 5ILGA 1LQTA 1RMQA 3QVSA 2AVDA 3DHYA 5K3EA 2ISQA 1JEYB 2ZUCA 1GU0A 3AVQA 3SJCA 3ZKWB 1KBQA 3LFTA 4CI0B 1EYZA 4ZAWA 1OQAA 2IUSA 3T5TA 1CULC 3EGDB 2ZYSA 2NQ2C 4UQLA 2IV7A 3RT9A 3MTDA 3R3HA 2BF4A 4N39A 5T5QA 5C9ZA 2SNIE 2PGAA 3GNTA 3KDAA 3HK2A 5COQA 3I1YA 3K96A 4HX5A 3GCZA 2OL4A 4QGGA 1KEVA 4LQLA 1VYUA 2WZQA 2HMWA 5EMKA 2D5CA 4MA5A 4GMFA 5KQPA 4JLKA 1JZQA 4FEGA 2A94A 4RY2A 1Y98A 3RC9A 2G4CA 1MVNA 4DT1A 2HKIA 4YI5A 3CEMA 2ERCA 4IZIA 3U9TA 2WM3A 4C0SA 1Y80A 5DYNA 1ZUHA 4CGZA 2BUBA 4D0RA 4ZEWA 3WFJA 3DVAA 4G0MA 3U7IA 3DDZX 4NE2A 5I4IA 5JD6A 4P0QB 2V65A 2I8CA 1E4OA 3L7KA 1J2UA 3UEOA 2KW5A 2OFWA 3RC2A 1F1JA 5FPPA 3BZWA 3ZV7A 1UBUS 5CX4A 3OZBA 3D7MA 1IHYA 1BMFA 1B4DA 2IUTA 2M32A 2OO5A 1ECFA 1CUAA 1VRWA 1I36A 1N8KA 2GNOA 3DMRA 1X87A 3IJEB 4OXKA 1U1EA 1S02A 3MJEA 4IIYA 4WXRA 3HN2A 1UBLS 3TKYA 4IGKA 3FYUA 5JLAA 4Z3KA 3ME5A 3DMYA 4FYXA 3C41J 3PXXA 4FFOA 2JLCA 3MRSA 1MOQA 4BYMA 2WKWA 2I2AA 1J2EA 4JJ6A 3WGOA 1U5CA 3ICCA 4WA7A 2W0SA 1P2UA 3JR7A 2NVUA 1URPA 3THXB 4C43A 2AKEA 3UENA 1G8MA 2XOKA 4TTIA 4X1YB 2AOUB 4R8MA 3U44A 3FCCA 1E5DA 1CFJA 4ZVNA 1YO6A 4CKCB 2FA9A 1XAJA 4M2LA 5CA0F 3G9ZA 4RGBA 4B73A 2OESA 2FUEA 1Q3TA 1SOVA 2BI7A 3OUTA 4MKHA 2JW5A 4Q01A 3VTFA 3A1UA 5H8WA 5DXJA 2ICAA 1ZU4A 3SC2B 1AQIA 3OSZA 1C1DA 3KOZA 5BN4B 4F1KA 5KZMB 4FJ2A 3A6EA 4G23A 4GPZA 4ZI2A 4B9AA 3WYEA 3OZXA 5J4HA 2AHRA 4WKOA 2W4MA 1O0BA 2VK1A 2PLRA 3AY7A 3CH6A 5EIHA 1P5JA 3PR2B 2XGSA 4RQAA 1G7RA 1NSFA 1X7XA 3IMCA 4MWZA 4BJHB 5B58T 4C3VA 1A96A 2V59A 5BWBA 3D6HA 1NJ8A 1VPEA 4URXR 1N1EA 2Q1YA 5H1YA 2YN4A 1QUFA 2QPAA 3KDPA 4LZPA 3B7WA 4QELA 4C08A 2HBZA 5E4FA 2AZDA 2P2LA 3ZW7A 2WM9B 1N1GA 4RA9B 1TVKA 1LVGA 1YC5A 2FE4A 5CFNA 1NW4A 2P4EA 4Q66C 3GFPA 3SKXA 4PZPA 4EG3A 3K5PA 5FLEX 3O0DA 3SKYA 3T7EA 4BLVA 5JYCA 4MQEB 5GWXA 2ZKIA 2DY1A 5T67A 4OXQA 3RFFA 4N0QA 3ZVRA 3Q11A 5DNDA 3OPXA 1XTPA 2ZRPA 4RJIA 3LXMA 1CJSA 2F43A 1XK6A 4FWBA 4UCWA 4CLEA 4DV7B 3WIBA 3W5DA 3A2MA 3EFOA 2HJGA 4M9CA 3LW8A 2WTBA 1QCCA 1U7TA 4FMPA 3W5UA 1D1TA 1FFCA 3QKRA 4JR0A 3RSQA 2PL1A 3SCZA 3L0IB 2YYSA 2BJWA 4FX5A 5FNVA 1F4PA 4L3VA 2IK8A 4Q5IA 4GU5A 1P0MA 2HW8A 1T2VA 1XOIA 3ISTA 4PC7A 3QV1A 1I7DA 1DAEA 1QPGA 4OEHA 2XUJA 3G7SA 1VMIA 4G0VA 3RARA 2WTMA 4YT4A 1GG2A 2XUAA 4U7JA 3EHDA 2A1TR 2YJZA 5FOUA 3VJRA 1P61B 2EEPA 5IARA 1G0NA 3R3SA 4GG1A 4M89A 4DA9A 5IH7A 1ZEJA 3RS2A 1VI5A 2XUOA 1AUXA 1ULHA 1WPRA 3OZRA 4G4SO 4I5FA 2XNKA 1XLVA 4MWTA 2A92A 3JQ8B 3W2IA 3ER9A 2F9MA 4OVKA 5FI3A 4ES6A 3QGMA 1KXZA 3H9UA 4K05A 2F1RA 1WUKS 2C8JA 2HA7A 1JT9A 1KQNA 3OBBA 1THGA 2QX4A 1PAUA 2ROQA 2JH3A 3USCS 2NQTA 5BYKA 1J5XA 2Z8YM 5DWDA 4BFXA 3ZHVA 4CQMB 1J23A 1P91A 3O9ZA 1A2OA 1FXWA 2P6UA 3I9KA 1SVNA 2QRJA 4K9DA 4RY0A 5CPFA 4ZHQA 3BPSA 2C2KA 4MVJM 1JWBB 5EJEA 3O2QB 1P4AA 4MYSA 3ZZ1A 3ZXXA 2GJ4A 2PXXA 3QWHA 1MHTA 4LK3A 5AVWA 5L3SB 3HBFA 3BGOS 4MKFA 5EQTA 4ASUA 3B2NA 2AV6A 1B3RA 1TYCA 1XZMA 4TKUB 4D8YA 2GM9A 5K0BA 2YINC 4O4HF 4UBOA 2A14A 2Q07A 4AZ3A 5JVDF 3F6SA 3L6BA 3FCUB 4GI2A 1U0LA 2ACWA 1JB9A 3UT6A 1GTG1 4QPPA 4RFSB 1E0KA 2OFPA 4Y2RA 3TIFA 4R8RA 4H1TA 1NJ2A 1UBOS 5UKDA 5ILOA 2RBKA 3QITA 3QUAA 5AW5A 4LDJA 3MJTA 4JHXA 1NBWB 3EA0A 5EJMA 3HEMA 2VHTA 3MIIA 7YASA 2FPWA 4KVFA 2I1VB 4L2IA 5JCJD 2ZUTA 1MB3A 2WOOA 3PUIA 2FMFA 1FYVA 2RGXA 4O2AB 2H1SA 4UTXA 4G8CA 1MH9A 4W6QA 4MAAA 1RLTA 5L4NA 1EZ1A 3QPUA 2AQIA 1L5YA 1JPVA 3QEOA 4CJXA 3CJTA 3GJ0A 2I3AA 2Q0QA 4QNRA 3ZDRA 1RR6A 5K7SA 4ZU6X 3RVBA 4AZSA 3QPWA 5FOQA 5JO0A 1UMKA 5GP1A 1Z2CA 4Q9JA 2FGJA 2HHJA 3DBOB 5CK5A 2PUGA 1VBMA 2XMPA 3BE6A 3GY0A 1TD9A 3ZY3A 1ZP6A 1NOJA 3S0JA 5BR1A 3L6CA 3I2YX 5DCYA 1KEEA 2LXNA 1FFEA 1ITZA 3GLGA 1E6CA 2IUFA 4HS4A 3K71B 1GN9A 1HM5A 1M75A 4O6VA 3PTLA 1YHYA 3LUAA 1XQWA 2G0AA 1JSZA 3UT0A 1JW9B 1V4BA 3ZBUA 2IHNA 2CFOA 2P2NA 3ZWNA 4QD3A 5CEJA 1ZD5A 2OZLA 3E3AA 4G24A 5KINB 2XRZA 3GMTA 1SUDA 1YRLA 1EFVB 4HQ6A 4TKLA 3S2FA 3IA7A 4TV9A 3UZUA 4EMBA 1I24A 1WETA 1DFGA 3G79A 4URFA 3EC2A 3OLYA 1NTRA 8GPBA 1GTVA 1NC3A 5I9LA 2IKQA 1XEXB 4HAZA 3GNQA 2C83A 1C1HA 3ZZTA 5JS1A 4I3FA 4NBVA 3TIGA 3ULKA 4A8JB 1AV6A 3K8YA 3RNOA 1VM6A 1PW5A 4UE6A 1KP2A 5TVGA 4NKRA 4DEXA 4EP1A 3RKUA 4MAMA 5P8WA 2JZCA 2UVPA 2P79A 2WJIA 2Z04A 4LXQA 3RU9A 1JFVA 3ZD7A 3KSBC 5IABA 4OQNA 4P0TA 3AF1A 2VK8A 2BGKA 1L1RA 4M7RA 5E1DA 3GLFB 1NJ5A 4BWYA 3U60B 2ZE6A 2ZWAA 4DR7B 3V6MA 1LBIA 4DJDC 4EHHA 1JTEA 3UMBA 1XZAA 1I4OA 4GMKA 3ZH2A 3CF4G 2J08A 2ARKA 3IILA 2NXWA 3PHHA 1VHDA 5DYWA 4D98A 4M8NE 2XTNA 4MPTA 2QN7A 3FSGA 5AK5A 1USVA 1XDSA 4ZT2A 3VU9A 3Q10A 2WG1A 4LDPA 3JVVA 3OUZA 3TOXA 1UZUA 3N2YA 3WBJA 1I2MA 2YWBA 2EFEB 3GLFE 2H8KA 3KHKA 2JGDA 4R0VA 1OYOA 3IIMA 4FGUA 1QIEA 1WW8A 4FFDA 5J2UA 5ULLA 1XHEA 5KQLA 2QN6A 1UAGA 5ENVA 3B1YA 3BC1A 1Z5NA 3NWJA 1K7EB 2QN3A 4TQAA 2IY8A 2PTHA 1MW8X 3OQBA 2QEQA 3NH9A 4RHYA 2LR0A 1P7YA 1EX7A 1T34A 1JS1X 3NOXA 1XPJA 1UFRA 4WV3A 3VYRB 4Y6SA 3VSBA 5BT8A 1NF2A 5FKJA 2ET6A 3E1KA 3FKJA 4K40A 5A2GA 1LPOA 2JJQA 4K2AA 2WSMA 1DWPA 3LTEA 2ZSKA 5KNCH 2FKAA 2WWFA 4V3CA 3IJ5A 2WABA 4KSBA 3EVEA 3AEUA 1NR1A 1OLSB 4NZOA 1ONSA 2FUNB 2H16A 1PD0A 4UUBA 4AZ3B 4DLSA 1IC6A 1LBEA 2EP5A 3KE8A 1DBQA 2BMEA 5ADHA 2VS1A 4IXWA 1HL3A 1WG8A 5FXMA 3S40A 2OBNA 5DHUA 4AO7A 4BX8A 4DUGD 2JATA 2BEVA 2MTBA 1FVXA 2MR5A 2QSYA 3KZXA 3KEMA 2QY9A 5JE8A 2I3DA 4PNPA 4AJ4A 5BURA 5KYXA 1H23A 4BO8A 2ZBRA 4MHOA 1W29A 4EOGA 3SJBA 1V1RB 2X0NA 3WB0A 3CUYA 2CE2X 1AB5A 1DIRA 4WBNA 2ALJA 1PJTA 2I7TA 4P4GA 2O8CA 1DRKA 4RZQA 1OR8A 3ER8A 1CNFA 1WVGA 2HHLA 3HUDA 1XLTA 5E7JA 3HY6A 4JJZA 5KNCD 1W4RA 2BGMA 5KTPA 3DMGA 1Q15A 3DNPA 1H2YA 2QX9A 3DZGA 4HATA 4MYDA 1N0UA 4ZJPA 5EKSA 4NTZA 4NU0A 4GKKB 4J07A 4AQ7A 4TYWA 3A4TA 3GT7A 1NUUA 1Y3HA 3AF5A 1RHMA 4HTFB 4IOLA 3GJ6A 4K9NA 2B7LA 2GZSA 4LDAA 1W5FA 3AC0A 4MDHA 2H59A 2EJCA 2WIBA 4BFUA 4XSVA 1UUFA 1NVVQ 4DLNA 2WIGA 4W1PA 5AKZA 3RC3A 3SR4A 1IN4A 5JC1A 3EC1A 4OHVA 4CMAA 2XUDA 1G4HA 3QXHA 5IYZB 5DM4A 4E0BA 2A5FA 2IXDA 1HDOA 3HC7A 4NU8X 5AKJA 3NO4A 3TCNA 2BISA 3L9WA 3ORYA 2WHYA 2PT6A 2Y1KA 5K0SA 1KEUA 4IOMA 1LF0A 1V1JA 2ECPA 2WTAA 2XB9A 3FDXA 5DTMA 3CNBA 1FFGA 5SZJA 1FX0A 3NASA 4B3JA 1JLLA 3TSYA 2RGAA 5CCEA 3Q3IA 1X2BA 4XWWA 4BPBA 1WQ3A 2Q6VA 5JI3E 4F0JA 2PKRA 1DWOA 3GD5A 2BGJA 4D99A 2PQMA 4E07A 5E1MA 3BB3A 3OQIB 2FKNA 4XVHA 5BOSB 4NY1A 2QYHA 1YQ9A 3NXKA 1BN6A 3P4UA 1X1AA 4L16A 5ENZA 2AKYA 1TUEA 2Y05A 1ZNZA 3K9GA 1OZFA 1MFPA 2V1XA 3HWSA 4JAVC 5CA1F 5L45A 4DCCA 2NAPA 5BPFA 3S8YA 1QVRA 3GEGA 1WXXA 1QYRA 2R25B 2Y2UA 4ZYXA 1RI1A 1XA0A 1GPYA 1VBNA 3CEJA 3H3JA 3DNFA 1E3IA 2DQ4A 1EMDA 3LGXA 3UB2A 4RZIA 1KYWA 1YA4A