2CDAA

Sulfolobus solfataricus glucose dehydrogenase 1 in complex with nadp
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
366
structure length
360
Chain Sequence
MKAIIVKPPNAGVQVKDVDEKKLDSYGKIKIRTIYNGICGTDREIVNGKLKGKDFLVLGHEAIGVVEESYHGFSQGDLVMPVNRRGCGICRNCLVGRPDFCETGEFGEAGIHKMDGFMREWWYDDPKYLVKIPKSIEDIGILAQPLADIEKSIEEILEVQKRVPVWTCDDGTLNCRKVLVVGTGPIGVLFTLLFRTYGLEVWMANRREPTEVEQTVIEETKTNYYNSSNGYDKLKDSVGKFDVIIDATGADVNILGNVIPLLGRNGVLGLFGFSTSGSVPLDYKTLQEIVHTNKTIIGLVNGQKPHFQQAVVHLASWKTLYPKAAKMLITKTVSINDEKELLKVLREKEHGEIKIRILWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords GLUCOSE DEHYDROGENASE
publication title The Structural Basis of Substrate Promiscuity in Glucose Dehydrogenase from the Hyperthermophilic Archaeon Sulfolobus Solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 122
structure length 360
sequence length 366
chains with identical sequence B
ec nomenclature ec 1.1.1.120: Galactose 1-dehydrogenase (NADP(+)).
pdb deposition date 2006-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
A PF16912 Glu_dehyd_C Glucose dehydrogenase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2cdaA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2cdaA01
5CP8A 1U5CA 5C37A 3ZWXA 1LRJA 1PGQA 2A4KA 3WYBA 1IPEA 1H5QA 4GWGA 4A7PA 1QXSA 1NPDA 1YQXA 2AXQA 2PR2A 1ZMTA 5L45A 1JWBB 2YV1A 3DMYA 3KM0A 1KEWA 5EQFA 1ADGA 1U5AA 4CMAA 1YH3A 3IUSA 1SMKA 2GN4A 3KB6A 4GKBA 2VRBA 4ID9A 3VDRA 3JD0A 3KSZO 3HDQA 1QSGA 1DO8A 4B7XA 3QWAA 5T5QA 3RKUA 1B16A 2DBVO 4YJGB 3A4VA 3WG9A 4R51A 3RFTA 1O8CA 3VAZA 4UUPA 4W99A 1VL6A 2V7PA 1N9GA 3D64A 4DQVA 3UGKA 4Y6PA 2G17A 3ENNA 4NZ9A 1Y8QB 1ADBA 1KVRA 3CMMA 4TSKA 3WICA 2X5KO 5HS4A 4BL5A 3IDSA 2WMDA 3ZWVA 2X7HA 2W2LD 2CY0A 5GZ3A 2G5CA 1E7WA 5A9RA 5TS3A 4ND5A 1DFIA 2UYYA 4TKLA 1GQYA 3UFXA 3HWRA 3OBBA 1BW9B 3KSDO 4JJGA 4AL4A 4QFCA 5I7EA 3GUCA 2V6BA 5L7TA 1LX6A 3V1TC 1NHWA 1E6EA 1O89A 3O9ZA 3WGTA 1YB5A 4G81A 3L4BC 3WB9A 3JTMA 5BSFA 3NJ4A 3UN1A 4FIZA 2VWHA 4YCAA 1PSDA 5G0SA 3HDYA 2NNLD 1QMGA 1W73A 2OFPA 2VHWA 3DZJA 4R3NA 2YFHA 4BO4A 3I1JA 3JV7A 1GCUA 4IGEA 4DA9A 3OH8A 4A5OA 2Q2QA 2YW9A 3VPXA 4DIFA 4E31A 3GT0A 3Q6IA 4NDNE 3KZVA 4Q3CA 4YJDA 3FPLA 4NFHA 1D4FA 1YL6A 2X0NA 1BHSA 5T8KA 5KJFA 3ST7A 4PLHA 4OMUA 3FNEA 4EW6A 3JD4A 2X86A 2BD0A 3SJ7A 5LDGA 3W4JA 1E5LA 1LXCA 5U4QA 3FWZA 3PQFA 1JQBA 4QT0A 2DTEA 3OJFA 2J5KA 3ZCXA 1BGVA 3MJVA 4LN1A 2D59A 2P9EA 2EKPA 1IULA 5C7OO 4D0RA 3GN2A 4PLGA 1X1TA 2FOIA 4YAGA 1E3SA 2JJYA 3H9UA 2X0JA 2D1YA 4KMSA 5EN4A 3NT5A 4PG6A 2Y93A 4UVIA 3RU9A 3SLKA 3ZNOA 4UVGA 3W8FA 1EEHA 4A2CA 4F46A 4CR8A 4XYBA 2HUNA 3V2HA 2JKVA 2O3JA 2D3TA 1MXHA 3NV9A 3I9JA 5JMPA 4AJEA 5ENDA 4XDYA 3DBRA 3JCZA 3L6DA 1EE9A 1C1DA 3JQDA 3LF1A 3E18A 4Z0HO 2OBNA 1BVRA 1I36A 4Q3BA 5L95A 2HJSA 5JY1A 1E3LA 1XQ1A 4GLLA 4F3YA 5A3VA 1SAYA 3WBBA 5C7LO 5IG2A 3PLRA 4IQ8A 3JQ7A 4HFNA 4OL9A 2X23A 2PD3A 2AEJA 1Z6ZA 2ZATA 2ZB8A 1AN9A 3F9IA 1XQ6A 4RF5A 3ADOA 1E92A 1D3AA 1CDOA 2ET6A 3NTQA 4ZVVA 4IJWA 4BO5A 3FPCA 3L0DA 3PJFA 4IDGA 1HDYA 2OBYA 2FP4A 1QV7A 1T26A 4GKVA 2BGKA 4UEOA 5BNTA 4IGFA 4R1TA 2XXBA 3HJAA 3OIFA 4CM4B 1HDZA 3BYZA 1PR9A 3GG2A 2IODA 2VCYA 3DZIA 4YJGA 1LLDA 4BO0A 5AQ1A 1U1IA 1U3VA 4PRLA 2DBZA 1P0FA 5I9NA 1I2CA 2WE8A 3LVFO 2NWQA 2VHXA 2P9GA 1PQPA 3ONDA 2A35A 2C54A 1CEQA 5KKAA 4BB5A 4GX0A 1DFGA 1WVGA 1Z7EA 2IYPA 3QP9A 4HADA 4J9UE 1C0KA 3GNTA 4AICA 3DQPA 4NBVA 3DDNA 4JN6B 3H6KA 1I3KA 4CR6A 2HKIA 1U4SA 1UR5A 1F0YA 4OKIA 3WYCA 1BW9A 1X0VA 1LSJA 4BHTA 1ZZEA 4CMKA 4BKRA 4EYEA 4PZCA 3SXPA 1DJQA 1MLDA 2P9CA 4CQMD 3U09A 2GCGA 5F5LA 1ZMOA 4H16A 1UXIA 1KETA 1D1TA 1G1AA 1E7YA 2J3IA 3KUXA 1XDWA 3F4BA 3B70A 5KKCA 4PZDA 3RUFA 1EVJA 4YVFA 3C7AA 4GX2A 4UUMA 1I3LA 2CMDA 2X6TA 1N1EA 2QX7A 1A9YA 2VTEA 3KYDA 3KO8A 2OL4A 4Z9YA 3ANLA 3OF2A 5ER9A 4J1NA 4LK3A 4RCVA 5H82A 3DZKA 6LDHA 1YB4A 1WZEA 1JW9B 3EAGA 4OAQA 5JAQA 1K6IA 1SOVA 2BKAA 2D0IA 3ZV5A 2XOXA 4IZIA 2JD2A 1YJQA 3ZHXA 5A5FA 3TOZA 3MOIA 3G49A 4RQTA 2O2YA 2EWMA 3ZNPA 2CVQA 3K9QO 3G3EA 3DHEA 1KC1A 1VL0A 4GGOA 1R4MB 3AU9A 1NNUA 5AXAA 3OETA 4PLCA 4PGFA 1EFKA 4PLTA 4CMBA 4OHUA 1O6ZA 4IDFA 4RQUA 4KQXA 4BQRA 4WEQA 3JYNA 2PZJA 3NGXA 4WJZA 1RM0A 3IP3A 4O6VA 1BWSA 1KY5A 1QYVA 1MV8A 3GY0A 3WQQA 1PL8A 1I33A 4J16A 1YBMA 1B26A 2FR1A 3GQVA 1UXGA 5B4TA 4N7RA 5CHEA 3UW3A 1NXQA 5IZ4A 1UXKA 4OOFA 3FI9A 4AJ4A 3AUTA 1QYCA 4XR9A 4CLEA 5B4UA 4L74A 1HE5A 1YVEI 5L4SA 4NBUA 3D5TA 1Z82A 4A27A 4QSMA 2BFAA 1LNQA 2GZ3A 5JMWA 1HT0A 5JDCC 3OIDA 4XQGA 4IPTA 5TX7A 1PGNA 2O7SA 4CM8B 1TEHA 1JLLA 1U2GA 3UF0A 1ZNQO 4OIMA 4DREA 3JD3A 4EEZA 1KYQA 4NR0A 4TRMA 3MWDB 1N2SA 5CDGA 4WLOA 4YT2A 3PVZA 3VPGA 1UXJA 1HZJA 2W4QA 4RF3A 1U2DA 5EL0A 2PH3A 1KY4A 3CZRA 3NTOA 3RUAA 3COSA 3DOCA 4H3VA 4WPGA 4FFRA 4LISA 4XGIA 3HN7A 1L1FA 1ONNA 4OJNA 3QRWA 1LSOA 3BHJA 4J1SA 1MUUA 5EPOA 5C5IA 4XYGA 1P1RA 4NPCA 1NFFA 1OBFO 2EJVA 1GYRA 3OSUA 3U4CA 3WX0A 1DLIA 2QRJA 1ISMA 3IJRA 3DZBA 4GH5A 4HY3A 1M75A 4YJHA 3ZW9A 1XCBA 1TB4A 3H8VA 2HU2A 4BS9A 1I0ZA 4CM9D 1M76A 1LDNA 1P0CA 1SEPA 1HLDA 4AJJA 2ZTVA 3GN1A 2UV8A 5TGDA 5FEUA 3TL2A 2X1HA 2DLDA 1SBYA 4GVLA 1NVMB 3ROKA 2Q45A 1KVQA 3O38A 4AJ1A 2Y68A 4NG5A 3MJTA 2D4AA 5LCXA 3T7CA 3F4LA 2GR9A 3KOUA 3Q2KA 4MVJE 2VRCA 4MJLA 4PLVA 1ULSA 4QTZA 3S2EA 4R54A 1K5HA 3ICPA 4CMEC 2DPHA 1TXGA 4XRGA 4EUHA 5JE8A 2PLAA 4DGSA 4FJ1A 1YQDA 4MVJF 5IDWA 1ZVMA 3OECA 4XYLA 1XR3A 1WZIA 4D42A 4YB8A 3D7LA 4LW8A 4N5NA 4TMFA 4BMNA 2RIRA 5BSHA 4RO0A 3C24A 3S8MA 4TVOA 3HDJA 2ZIZA 1Y5MA 1VKOA 5B4VA 3L4SO 2EIHA 3KLMX 4R01A 3TZCA 3TFOA 4MKXA 4M49A 5IN4A 3G1UA 4WE3A 4UVDA 1ADFA 1P1HA 2FZEA 1SEVA 3ROMA 1OZAA 1BG6A 3I4CA 5I7SA 3BMNB 3JQFC 5T57A 2X5OA 4DXHA 2BFMA 4Q3AA 2HMWA 1R4MA 1FMCA 4U0JA 2AE2A 1ULUA 3E03A 2E49A 1SOWA 4B3JA 5A05A 2CD9A 1QR6A 1ZO8A 1W0CA 2RAFA 1XHLA 3OA0A 5JAZA 2NACA 1ZSYA 2HMVA 1P44A 2UDPA 4R69A 4BV9A 4GX5A 4Z9XA 1T2AA 4KUEA 3ABIA 3HHPA 1LUAA 3UHAA 2IZ1A 1R0SA 2RH4A 5K0ZA 1PJ4A 3R1IA 2FY8A 3NTRA 4YBZA 1PJBA 3VPFA 1TT5B 4GMFA 3WGHA 2VQ3A 4D7AA 3OQBA 1X14A 3PIIA 4B4OA 1V3UA 4K6FA 3M1AA 3VPHA 2O2SA 1PJSA 5DOVA 3ZWYA 1XIVA 4OGWA 2VT2A 3FD8A 3AY7A 2PGDA 2QQ5A 4E2WA 4J2HA 3WIDA 4CM8A 4C7JA 5I7FA 4OQYA 1ZSVA 3Q9UA 3PJEA 3PP8A 4NHEA 5JS6A 3DB2A 4G5HA 4P4LA 1XLTA 4RVUA 4IJVA 3UAGA 3GLQA 1GQ2A 1PIWA 1ENZA 2IRWA 4OKNA 5K9ZA 3C85A 4YAEA 4L76A 3NDRA 2NSDA 4WLUA 1KOLA 2BHLA 1NQOA 1XSEA 3DL2A 5EJ2A 2C7GA 2Y1FA 4D41A 1G0OA 1QYDA 2I76A 4UUNA 3H5NA 3UOGA 3AJRA 1EVIA 1H6CA 1NR7A 1W4ZA 1I3MA 3B20A 2AQKA 3JQEA 1HYHA 3H65A 3EW7A 3IOYA 1NFRA 4O5OA 4CL8A 3SJUA 3G0OA 4E21A 2EERA 3U62A 3TOXA 2X8LA 3AI1A 2NVWA 3QQPA 5IDXA 1MXFA 3ULKA 2OP1A 4RV9A 3FTPA 2CVOA 3GRKA 2ZTMA 3JQ9C 4CLXA 1N5DA 1EVYA 2B37A 2C5EA 2IE0A 4TZKA 4J7UA 2WE7A 1MC5A 3INGA 4GQAA 1DIAA 5HTOA 2Y1GA 2BGMA 4P38A 3AOEC 4W7HA 2W8ZA 3OJ0A 4YAIA 2B0JA 5F3RA 5KNLA 3GFBA 1ISJA 3CUKA 2WD7B 3VKVA 5L51A 4Y8VA 1ZW1A 3VZSA 2NVBA 3PI7A 4FJ0A 2DC1A 4E0BA 1MGOA 1Y1PA 5CDSA 2E48A 3D3WA 1UJMA 5TT1A 2NU9A 2Q1WA 3R0IA 4J3FA 4GPD1 1GUFA 4YXFA 5IDYA 3ETEA 1P33A 3VZPA 4FSHA 4RF4A 5FI5A 1I10A 4OXKA 4IBOA 3M2PA 1N7GA 2QZ9A 3D0OA 4L0QA 1H94A 1HKUA 1A5ZA 3GF4A 3RU7A 3BMNA 2FRDA 2JAPA 2DAPA 3FBGA 3LK7A 3GR6A 1JDJA 3DAFA 3MWEB 5TSDA 3AM3A 3CXRA 3MTJA 3OA2A 5BNIA 3DAPA 1QKIA 5CG2A 3NYWA 3K6JA 4CPDA 1WXDA 5CPFA 3GOHA 3EZLA 4OH1A 5FFFA 1HYGA 5IZCA 4NI5A 1H0KA 1VSVA 1ZJZA 4ND4A 1S7CA 5EQDA 4W9NC 1N1GA 3QWIA 1K3TA 3BMQB 2AG5A 4Y6RA 1TT5A 4Y98A 1YQGA 3ANNA 1MX3A 3SBOA 2YQ5A 3KETA 2BI8A 3GEMA 4FDAA 1R37A 2IZZA 4QO8A 3DO5A 2J3KA 4I8XA 4K1LA 1GPJA 4CUZA 1FXSA 3DMTC 5EESA 3W6ZA 2EJWA 3HE3A 1M2WA 1NASA 3R3SA 4HNGA 5IAAA 4RLHA 3RUIA 2WD8A 5TLSA 4J7XA 3JYQA 1EQ2A 1JA9A 2A9FA 1QYXA 2ZK7A 3ETGA 3KHUA 1IPFA 4XGNA 1ZUD1 4BKOA 2Y1OA 3T4XA 1JKJA 4XD2A 3BTOA 4R5HA 1FJHA 2QZZA 2VWGA 4JBHA 3H4VA 5G2OA 2YQ4A 4GWKA 1DIRA 1T2EA 2XXJA 5JLAA 3TF5A 1U7TA 1P31A 4M54A 4XIYA 1FDSA 4XGKA 1RYDA 3WWZA 2VZ8A 1KBZA 1IOLA 5K6AA 3JQGB 4XWYA 4ZQEA 4U0KA 4Z0PA 1I2BA 1CF2O 1GV0A 1P1KA 3ZZNA 5JYDA 1GL3A 4DMMA 1TT7A 2PZLA 2Y1DA 3LC2O 2GZ2A 2X4GA 1Q1NA 1RM3A 3IIEA 3KRTA 4YWJA 5G0VA 3VKUA 4JGBA 1BRMA 2O7QA 2PGLA 5U9CA 2FPPA 4RVHA 5G0TA 4JROA 4LGVA 4CR7A 1O94A 4U8GA 1YS4A 1JU9A 1R66A 1NHGA 4E5NA 1XU9A 3WFIA 4HWKA 2DQ4A 2D5CA 1NPTO 1NBOA 2UAGA 4ZQGA 4MDHA 1PEDA 1V35A 3MJSA 3RAJA 5I8WA 3GEGA 1GADO 4J0FA 3GPIA 1A72A 3PYXA 1NFQA 1X7GA 3I9KA 4N54A 2ZQYA 2AQIA 3DBHB 4NJOA 5DBIA 3WYEA 3N7UA 4RPJA 2YJZA 4DBVO 2GRAA 4BGVA 4DL9A 3C1OA 4KQWA 1Z74A 4HFMA 4RL6A 1MG0A 3ONFA 5GZ6A 2F00A 3DBLB 4ND3A 3HB5X 4XDZA 3STHA 2GLXA 3I4FA 4Z0TA 4EUEA 1X13A 3HADA 3PIDA 1Y9AA 3O26A 4RVGA 4GI2A 5HBRA 2WD7A 4GSLA 4BGEA 1A7AA 1KS9A 3W6UA 5KVCA 3MJEA 1QG6A 2Y0CA 4CJXA 2RBEA 1LSUA 1RM4A 4IM7A 3JYPA 1Z7BA 1PS0A 4A10A 3BMOB 4LSMA 4NJMB 3JQAB 2C59A 4AJPA 1NWCA 1LQTA 1N92A 1PJTA 3E9MA 2NQ8A 1EUDA 2BRUA 5BSGA 2P91A 1BMDA 2AQ8A 5TJHA 1E77A 2B4QA 1BSVA 4WCFA 3F6YA 4PIVA 4TRNA 5A06A 1AHHA 5MGBA 1E3EA 4FFOA 3JD2A 5DT9A 4QX6A 4ALKA 1M6HA 1I24A 4MINA 4RORA 5FF9A 3PHIA 1HDCA 1P3DA 1V0JA 2GO1A 1WDKA 3VOSA 1VSUA 4CUKA 3ZHZA 3AUAA 3H2SA 1QLHA 4XIJA 5A4DA 3IAHA 3VTFA 1V9LA 1ISGA 1VE9A 4KUHA 1HDGO 3H5AA 3QIVA 1OAAA 2Y99A 3L77A 4EI2A 1KEVA 3QWBA 2H9IA 3BMQA 4GLOA 3K30A 2HAEA 2OOSA 3S2IA 2HK7A 3HZZA 5ILOA 4IDEA 3WSVA 3L6OO 2F1KA 4WLFA 1MA0A 3C7DB 3I5MA 3PHGA 2EHDA 5G4KA 4D3FA 3BMCB 4K9DA 3B1FA 2BELA 3QSGA 3RC9A 1H6AA 5DCYA 3B6ZA 4BNNA 4IIUA 3F47A 2J8ZA 1PGOA 4GMGA 2O50A 1PL7A 3EGOA 4RPKA 2PNFA 1BDMA 1C1XB 3PQDA 3QY9A 2D2IA 4I9NA 1D7OA 4RJTA 2I3GA 4FCCA 4HUJA 4JJFA 2ILTA 2VYNA 3S2FA 2VUTA 3GDGA 5KVQA 4P4GA 2FZWA 1PQUA 3H5RA 3D4OA 1HDRA 3JYOA 1KEPA 3NDIA 3W4KA 5JCJD 3WBFA 1E7MA 4GAEA 3Q2IA 4BMSA 2QYSA 3EUWA 1I5RA 1AUPA 4YEDA 4RDHA 2B83A 2GN6A 1YBVA 4D45A 2C29D 2NU7A 2Q2VA 3WGQA 3WTBA 1D1SA 3AK4A 1XELA 3ZWWA 4IDCA 4TRJA 3DONA 1RYEA 5CDUA 3I6IA 1YDWA 2JHGA 1WNTA 3L4BA 1B15A 2J5RA 3ZWCA 3GHHA 1QP8A 5C7IO 3DAGA 3RI3A 3DHYA 2CDBA 1CIVA 1F06A 4BO8A 2W90A 1XU7A 4YPOA 1X7DA 3V8BA 1E1LA 1E7QA 4WOKA 3H3FA 1PJ3A 3GPDG 2G0TA 1BDBA 2ZCVA 1LDYA 1YL5A 3DBHA 1YE3A 3GAFA 4FGSA 4MP6A 4J1QA 2CUKA 4FFMA 3ZWNA 1Y8QA 5ES3A 1QLJA 1U8FO 5BQFA 3TRIA 1KEUA 1J49A 1OC4A 3ZV6A 3RVDA 4A03A 3QLJA 4QECA 2PZKA 3BTUA 2IXAA 5A9SB 8ADHA 2P5UA 2PD4A 1D8AA 5H81A 3K5PA 4EBFA 5KCZA 2X5JO 1E5QA 5GZ1A 3PWZA 5IF3A 1EDZA 2FR8A 3LT0A 3VZRA 4ZD6A 1E3WB 4DPLA 3WTCA 3GGGA 4U7WA 3RCBA 4UREA 3RBZA 1ARZA 1EK6A 5A04A 3AFMA 4NJMA 4NK4A 1ZFNA 5JC1A 1K2WA 3NEPX 1LRLA 4ALJA 4KWIA 2O3TA 2WM3A 4MIYA 2VTDA 5DP1A 1LSSA 3ORFA 3OJOA 3S1LA 3GH3A 1UH5A 5JO0A 3PYLA 4ITUA 1VRWA 3QWFA 3AUUA 4BB6A 3TWOA 1ZBQA 1B14A 4BGUA 2BFOA 4JBGA 3U4DA 3PHJA 2I65A 5DCUA 4AJKA 5F21A 4TVBA 4NQZA 3WGOA 4BO2A 4J90A 1E1NA 3ASVA 4Z3DA 3D3EA 4CV2A 3OQ6A 3GNSA 3VH1A 2X58A 2PGJA 2JD0A 5TT0A 4ALNA 4S1VA 2JCYA 3NT2A 4BO7A 1VL8A 4R9SA 4B3IA 3K73O 3AU8A 2W2KB 3W8EA 3ZI0A 1DRUA 1JWAB 2GDZA 2DM6A 2Q1SA 1ENOA 4PLYA 1GU7A 4DLAA 5BSEA 5IJZA 1HSOA 3ENKA 4IMPA 4N5MA 4MO2A 3ITDA 1ISFA 1NAIA 3FHLA 1P1JA 4DPMA 2VN8A 1VJ1A 3E9NA 1U8XX 1Z73A 3E48A 3IC5A 3P2YA 4IDDA 3BMCA 3RC1A 1B3RA 3CPSA 3H9JA 4L9RA 3QV1A 4URFA 4EEXA 5L40A 4M87A 2D5AA 2AEMA 3KEQA 4EUFA 2XF8A 1OFGA 4H15A 4O59O 1FDTA 3JQBC 3E5RA 1B3BA 1C1XA 1KVSA 1P45A 1GUZA 2YDYA 3FCOA 3GZ4A 1XYGA 4KZPA 1DIGA 4FGWA 1EMDA 3G17A 5CFZA 3GGOA 4M89A 4QO7A 4Z3KA 3AI3A 4D79A 3C8MA 4R1SA 2CVZA 2JCXA 3QHAA 3MJ4A 2NV6A 1SO8A 3ON5A 3QE3A 5TC4A 5KIAA 5EMHA 3WOHA 4CLHA 5I7VA 4YT4A 1A27A 2CZCA 2PK3A 1HTBA 2DPGA 3GA0A 1FK8A 4ZICA 3DC2A 3TDKA 1DAPA 4BO9A 5HWSA 2ZTUA 1MFPA 4UVHA 4KDFA 1WDLA 4OXYA 4ZRMA 3RFVA 4ZQHA 2J3HA 1Y81A 2BFPA 3EHEA 4HXYA 5A03A 5U1PA 1LC3A 1K6XA 4MIOA 4CM4A 3KBOA 2BLLA 2WEKA 4YRAA 4UULA 4XB1A 5TJ9A 1DC4A 2B5WA 1B8VA 1DOHA 4LCEA 4EJMA 5HM8A 1YL7A 2YZ7A 1U9JA 1GY8A 1UDCA 5TF4A 4II2A 3CTMA 3VC7A 5KJ6A 1NQAO 3GZNB 3H9QA 3PXXA 3DTTA 4YYZA 3P7MA 1HDOA 3VHRA 3VH2A 3ANMA 1T1RA 4CQMB 4J9VA 3WSWA 4RPGA 4PFJA 4WECA 4MVJA 1Y9EA 2C82A 1Q2XA 2IEDA 5GY7A 1JVSA 2QIOA 1J6UA 2GASA 2PWZA 4WK6A 4ILKA 2WWRA 3ADPA 3V2UA 5A9SA 5JDIC 3DEYX 2ZYGA 3GVXA 1P77A 4ALMA 1U3UA 2G82A 4WUVA 2OMEA 3TPCA 1DIBA 3A1NA 1E3WA 1NM5A 1P1FA 2ZTLA 1E1MA 2YY7A 2VHZA 5G4LA 4B7CA 4GSKA 4WCDA 3MTGA 4FFPA 1GD1O 4XYEA 4NU5A 4YQZA 2PKQP 1GV1A 1DFHA 5F1KA 4YTEA 4OXNA 2DUUA 5A5EA 1ZIDA 3D4NA 3JQ6A 4RDIA 1BXGB 3PLNA 3WGZA 1F12A 3L9XA 3F3SA 4DLBA 3V1UA 5JAIA 1ZK3A 2VWQA 3UCFA 1SPXA 7ADHA 4WGGA 5COBA 3VH4A 3WXBA 1JKIA 2JFGA 1MC4A 3GDFA 3DZHA 3TZ6A 3ZWOA 1YOVB 4FW8A 3HB4X 3ICCA 4Y6SA 3WMXA 1Y8RB 1SB8A 2UUOA 4HBGA 2YHIB 2Q3EA 5CDTA 2VNSA 4RF2A 4O63O 4FC6A 4WLVA 2CSUA 2R00C 5JDCA 1UP4A 2Z1NA 2W2KA 1LEHA 3AOGA 4AJ2A 4BKUA 3F5QA 2YV3A 4W7IA 1DAOA 3OMLA 3HQ4O 2C07A 1J5PA 2X0IA 1CQIA 3VVCA 2IEBA 1J0XO 3ZU5A 4AJOA 1UP6A 3PK0A 1EBFA 5C3MA 1ML3A 4MP8A 1PR3A 4ZA2A 5AYVA 5L3ZA 2OXIA 4NBWA 4CMIB 5TRTA 4DQUA 1VJ0A 1PJQA 3N58A 5ENVA 3TL3A 3INRA 4CMJA 2CDCA 4FPXA 2EW2A 2OGUA 5I9MA 1NVTA 4J6FA 5AXCA 5A3JA 4LSWA 3ASUA 4XZ3A 3U9LA 2YV2A 3GAZA 4GBJA 1HZZA 3RUDA 3W4IA 1X1EA 3E5MA 1ZK1A 3OJLA 4P22A 1YO6A 4R1UA 3T7EA 2DVMA 3S55A 2JCVA 2P5YA 9LDTA 3EZYA 3QVTA 1WW8A 3EDMA 2AHRA 2R2GA 3I3OA 3RUHA 5KJ1A 1C0IA 3JQ8B 4TKMA 1DIHA 2EGHA 4G65A 4DMLA 1U3WA 1NYTA 5TNXA 3X2FA 4UVEA 4MKRA 4TRRA 1HE3A 2DU8A 2PY6A 5DDIP 4PZEA 5A02A 1OMOA 1DSSG 1U3TA 3TSCA 3AW9A 1C0LA 4KWHA 1Z75A 4ZRNA 1YXMA 2ZB4A 4QQRA 5JO9A 3IP1A 3UUWA 3EMKA 4I9UA 1T2DA 1LDGA 4Q39A 4HKTA 2BF7A 4JNKA 2DTDA 3V1YA 4CMEA 3GZNA 4PCVA 2HRBA 1UZMA 3MJCA 3OJEA 3PJGA 4I9HA 3ZU3A 4CQMA 3PFWO 1DRVA 3OM9A 4RZIA 3CKYA 2C2XA 2E6UX 4J4HA 4JJIA 3ZU4A 4C7KA 4PVDA 4U6QA 5MDHA 1EBUA 4J7CA 1V3VA 4CLRB 4FR5A 4B4UA 2GGSA 4CV1A 2I99A 4W4TA 5T67A 5IZCC 5HA5A 3DTYA 1ZEMA 1RJWA 4WKGA 4XQCA 5K1SA 5B12A 4FN4A 3TFQA 1GYPA 4YA6A 5HRUA 3IKTA 3KYBA 4JP3A 2FWMX 1WP4A 3JQFA 4EDFA 1GAEO 1XG5A 2EF1A 2J6IA 2B69A 2J5QA 2IDZA 3ROPA 4CMGA 1ZEJA 2VYND 1Y5RA 4JIGA 4PVCA 2R6JA 1O0SA 1P9LA 5KVSA 3RD5A 1T2FA 3K2BA 1K89A 1H9AA 1BXGA 4RPHA 1I30A 4YRBA 4XJTA 2YDXA 3AY3A 2JD1A 1L7DA 4U5QA 3PTZA 2O4UX 3GDOA 2Q50A 3BZUA 5JYEA 1N9GB 3H9GA 3NUGA 1JVBA 1Y8RA 1YGYA 2FN7A 1IZ9A 3E1KA 1Z45A 2Q49A 2YHIA 3IMFA 4WEOA 1H6DA 1GZ4A 1IL0A 1BXKA 3K8ZA 3GVPA 4CM1A 3I9NA 4D0SA 2E4AA 3A14A 1NR1A 4YT8A 1HL3A 4PG8A 1GCOA 1HSZA 2I67A 2WYUA 3PFFA 4FS3A 1B0AA 5DN9A 4CV0A 4EZBA 2A94A 2EW8A 2AE1A 3EVTA 1O5IA 2QHXA 1E1KA 1ONPA 4TQGA 1Q0LA 4R1NA 3K2EA 3I83A 4YQYA 2HK8A 1BVUA 2HMUA 1PS9A 2ZJ1A 2FR0A 3H2ZA 3P19A 5THKA 3D1LA 4CMIA 3RUCA 2E37A 2GYYA 5F1OA 1LQUA 1C0PA 1QYWA 4MIEA 1IHYA 4E32A 1R0LA 5AXBA 3JSAA 2OORA 2O3QA 3DBVO 3FNFA 1CETA 3EC7A 2WJPA 4I5GA 3WQSB 2NUAA 3GVIA 4DLLA 2ZYDA 4YDRA 2Q1TA 4O0LA 1PQWA 3RBVA 4BNKA 4UEJA 1EZ4A 1Q7GA 1WAMA 2NU6A 3O4RA 1NP3A 2SCUA 2CNBA 3DFUA 3FN4A 4MPDA 2JL1A 3GMSA 4BNXA 4IIVA 3X2EA 3D5QA 3EYWA 4S3MA 4MOWA 4UAGA 4BNIA 3WWYA 4OSPA 1ONOA 2PFGA 1XGKA 2OP0A 3D4PA 6ADHA 5CEJA 2VZ9A 1HF3A 4IXWA 4BUCA 4BNYA 1FDVA 3ZWAA 1UAGA 4NFYA 2LDXA 3JQ9A 1KERA 1LA2A 3HG7A 4P8RA 2HCTA 3HUDA 3FRJA 4L4SA 3W1VA 4IS3A 4D46A 3UICA 5JAMA 3ZH2A 3A06A 2HLPA 3T4EA 3AOEA 4E6PA 3PPIA 4PRKA 4BNFA 3LT2A 1DRWA 4HX5A 4UUOA 1RWBA 4PLFA 4CM5A 1DDOA 1M67A 4E3ZA 1DJNA 1VM6A 1YONA 1E7RA 3DBRB 2Y1CA 4J91A 1C1DB 4RLSA 2OO5A 1GYQA 1JAXA 4EJ6A 3WLFA 2PKQO 3WJ7A 3UH1A 1QRRA 2WTBA 4YT5A 1DLJA 2TMDA 4CLRA 2HQ1A 2D8AA 2XPCA 1EK5A 1YWGO 3N74A 5T8KC 1EUZA 3JYLA 1R16A 1R15A 4IJUA 1LBEA 4GVXA 4B7UA 1EDOA 4GX1A 1LLQA 5G0UA 1G6KA 4C4OA 2JFHA 1NWHA 1SZJG 4IZHA 3WGYA 3UCXA 4D44A 3E6AA 4M86A 3K92A 5FYDA 2NLOA 2C2YA 4ZU3A 3ZWPA 1ZK4A 1H6BA 3HN2A 1UXHA 3V5NA 1MB4A 4FD3A 1W6UA 3BXXA 3LU1A 5DZSA 1JTVA 1Y6JA 3P5SA 3LC7O 3UVEA 4MVJM 4MKZA 5TIIA 3LC1O 4JCOA 4W9NA 3ZW8A 1JAYA 4E5KA 3TZKA 1LDEA 4IQGA 4WASA 2H63A 4IDAA 1P74A 3RQSA 1YKFA 5GMOA 1A9ZA 3R6DA 3WR5A 1HLPA 3GEDA 2O3UA 2RHRA 1GZ3A 3WNQA 4R4JA 4IQ0A 3DMTA 3JD1A 4I5EA 1GEEA 1UZLA 1K6JA 2NADA 2YUTA 2AQHA 4QEDA 4XB2A 1GUYA 4XR4A 1WPQA 2QYTA 4NK5A 2EV9A 4Q9NA 4FFNA 3AM5A 2ZB3A 4LCJA 4MVJD 3HFSA 2V6MA 1R4NB 1P1IA 1YRLA 4DC0A 2Y1EA 4CQLB 5G0WA 3IL2A 2IZ0A 1ZCJA 2P4HX 2Q2WA 5COQA 5B37A 3ZGYA 1OI7A 2NTVA 2X9NA 1QV6A 1YB1A 1SB9A 2C7VA 3I9OA 4PLPA 3QVSA 5H83A 1PGJA 2JAHA 1LU9A 1TLTA 1ZJYA 3KYDB 2VT3A 3LF2A 3KV3O 3K31A 1R6DA 3OICA 2C20A 4FFLA 3I23A 2X9GA 3TNLA 2Y66A 3SC4A 1CERA 2CFCA 1MP0A 3Q11A 4EGFA 4NBTA 1NQ5A 3OFSA 5AOVA 4AVYA 5CEFA 1XKQA 5KTKA 3C7CB 4LVCA 2AMFA 1E3IA 2VRCD 1O9BA 3NDJA 5FI3A 4JX8A 4Y67A 4I1IA 2V65A 4OSOA 1VI2A 4RZHA 2EKQA 3EY4A 1M66A 2P68A 3NT4A 4XRRA 3WNVA 1GQQA 3PDUA 3BHIA 4BIIA 1E0DA 1MG5A 3AY6A 3KXDA 4BV8A 3ZDFA 1PWXA 3HFGA 1AGNA 1WMBA 4DYDA 1HETA 3PRJA 1SC6A 3JQGA 4HNHA 4E2ZA 1UDBA 1X15A 5IFLA 1HWYA 4J4TA 5DCWA 1IB6A 2J3JA 1DB3A 1F8GA 1ORRA 1UZNA 3GHYA 5DBFA 3WS7A 3FTNA 4FJ2A 4B8WA 4K6CA 2YYYA 4KP7A 3RFXA 4KDEA 4J43A 5ILGA 3RJ5A 1VPDA 3IS3A 2Q4EA 4AG3A 3RC2A 7MDHA 1T24A 3PGJA 3VZQA 1T4BA 1CRWG 4R9RA 4CUJA 4IXTA 4NIMA 4WNCA 1ENPA 3PDJA 3GVHA 4B4VA 3QVXA 4M1QA 3RC7A 5JBIA 1ZH8A 2H1SA 3ZNQA 3GMDA 3TZHA 1PGPA 3ZV3A 5EINA 1RKXA 1UDAA 4FBGA 4CLOB 4HFRA 1UP7A 2ZQZA 2HDHA 3DBLA 3PEFA 4F6LA 4ZQFA 2FMUA 2Z95A 3NRCA 2WSBA 3A9WA 2GERA 3GC6A 3TQHA 4FOSA 4K26A 1N8KA 4ZQBA 5THQA 3FNGA 3CINA 3RSHA 3TZQA 1B2LA 1FF9A 4CMCA 3IKVA 4PG4A 2EP5A 1Q0HA 4E30A 4E5MA 3U3XA 1TVEA 2VUUA 3H7AA 4CL3A 4Q3DA 4M8SA 3MEQA 4XQ9A 4F6CA 4DPKA 1ID1A 1EUCA 3BMOA 3CE6A 3JQAA 3B1KA 5KOIA 2HMTA 3RBXA 1FDWA 1EVZA 1PL6A 3BA1A 4BO3A 4ALLA 1LLCA 2Y05A 4DQXA 4B3HA 2FHSA 3PYMA 4KTVE 4NNJA 4YJHB 3DOOA 4LMPA 1NX6A 1Q7BA 3QVWA 4QFDA 4CODB 3DZGA 4TROA 1DPGA 2GZ1A 3NX4A 1CJCA 3GK3A 2ZB7A 2AA3A 5JXWA 2XAAA 4OM8A 4OO3A 2EG9A 4BNMA 3U5TA 1DXYA 1R4NA 3AM4A 5ER6A 4DVJA 2GNAA 1HXHA 2VOJA 3TN7A 3WGGA 4YAKA 5CPBA 4CQLA 1IE3A 4LRTB 4R5MA 3I52A 3QA9A 1ADCA 4G2NA 4PN3A 4MVJP 1DBVO 2B5VA 4FOOA 4HP8A 1C3VA 3LLVA 3SX2A 3IUPA 2V6GA 1GFSA 3PZRA 2ZKLA 3Q9NA 4J4BA 3F1KA 1CWUA 2NTJA 1F17A 1OC2A 4E5PA 3ZV4A 3M2TA 1HDXA 1T1SA 4I5FA 5HS6A 1ISHA 2VYVA 3PWKA 2HSDA 3CSDA 1HE2A 3VVBA 5IXYA 2LDBA 1X7HA 1SNYA 3VH3A 1WLYA 3DXFA 1HRDA 3OP4A 3QWHA 3LYLA 3U4IA 3ITKA 3AI2A 4I08A 1PZFA 4WLEA 2GN8A 3ZU2A 2OHXA 1NVGA 3LSYA 2BGLA 2OZPA 2JHFA 3CZMA 4NFSA 1LDBA 1PZEA 5DNAA 1ZK0A 4BNUA 1BXZA 2PKRA 3G79A 4LRSB 5IDQA 4IDBA 1O95A 4ND2A 1U4OA 2H6EA 3A28A 1PJCA 2BI7A 3FR7A 3ZHYA 1W8DA 3RWBA 4R16A 2I9PA 2EP7A 1N7HA 3M6IA 3VTZA 1EFLA 1LC0A 1LJ8A 2GD1O 4E5YA 4XEHA 2W2LA 4Q3EA 4K28A 5I8ZA 2NU8A 4W82A 3GGPA 4DYVA 4J1TA 2TMGA 5DBGA 1PJ2A 4HV4A 5F1PA 4BNZA 2WYVA 1FDUA 4MVJI 5J23A 1WMAA 5L9AA 1GDHA 3PGXA 4W6ZA 3H9EO 1X0XA 3INTA 3WLEA 1PZHA 3DHNA 4OQZA 4TZTA 5DULA 3QJ5A 1GTMA 3OQ1A 5A9TA 1YDEA 2FSVA 1Q0QA 1XEAA 1SCUA 4GL4A 4YJFB 2CF6A 5DF1A 4BNJA 4R68A 2ZCUA 3Q0EA 4O1MA 2CDAA 1PWZA 3BHMA 4Z9FA 4CLOA 5LC1A 1GEGA 4DC1A 1J4AA 2Q99A 3UCEA 3ETDA 4ZGWA 5JSFA 3LQFA 3WJAA 3L07A 1OOEA 4DIOA 1CYDA 1B7GO 5ADHA 1VLLA 3L6EA 1ZXBA 2PA3A 4KTTE 4BNLA 3FSRA 2NM0A 2V6FA 1AHIA 2JFFA 3PQEA 4KUGA 4CLDA 2EEZA 4EJ0A 3LDHA 1T4DA 2PH5A 2Q4BA 1E3JA 3O8QB 1VKNA 2Q46A 1F14A 2GPTA 1AXEA 1JN0A 3GVCA 5JFOA 2O48X 4DBZA 4UEKA 3JQBA 2C5AA 3KVOA 3EK2A 2OUIA 1ZK2A 2DT5A 3FWNA 2H5LA 1IY8A 1GZ6A 5KJEA 3OEYA 4BQPA 1VC2A 2EKLA 5DOZA 3W8DA 3FF4A 3CEAA 4RVFA 3I9MA 5CAEA 5AVOA 2IXBA 2C0CA 1ZKMA 1EQUA 3Q3CA 4BOYA 5JNLA 5JY6A 5JW6A 5BNFA 5KJCA 4L75A 4PLWA 3VDQA 1E6WA 1I2ZA 2BMAA 3R3JA 5BR7A 2B4TO 2DFVA 3DFZA 1K0UA 1Q7CA 2VZ0A 1WDMA 4BKPA 3DZFA 2UVDA 1IZ0A 1I01A 4IINA 1PU2A 5L7WA 4YRDA 2GSDA 3I9LA 3WMWA 4BMVA 2HRZA 3RROA 1V8BA 3O03A 5JCJA 1AXGA 1H2BA 1B8UA 2ZYAA 1XA0A 4ONEA 3NKLA 3UXYA 4BNGA 2AG8A 3PHHA 4XJSA 4NBRA 3D3WB 4MVJG 1ENYA 4NH4A 3HNPA 2VWPA 2AW5A 3HSKA 5COAA 3FBTA 1YBAA 1PZGA 1V3TA 3E9QA 2B4RO 4JLWA 2FPGA 4YACA 1PX0A 4A0SA 4ZJUA 3GUYA 3GFGA 3VPSA 4XA8A 4LVUA 5JPIA 3RJ9A 4ZHSA 1QORA 4NMHA 3F1LA 2YHUA 4OOEA 3NGLA 4OYRA 1LLUA 2NVUB 4Q3NA 5TQVA 4AJNA 3WGIA 2UUPA 1E6UA 3IQDB 5BT9A 3C1TA 2IYOA 3TJRA 3ZHBA 5B1YA 2Z1MA 3DOJA 3E82A 4FQ8A 4RVSA 4E33A 5JDIA 4MP3A 5KWEA 4BVAA 3K96A 1Y7TA 3LT1A 2G1UA 1DHTA 1TA4A 2O3RA 5ICSA 4WLNA 2I3AA 4JBIA 3GRPA 5CG1A 2I66A 1RM5A 2DBQA 3ONEA 5CEEA 3KYCB 1T25A 3SVTA 1R0KA 3LLSA 1A7KA 4TWRA 2CF5A 2EGGA 3PHLA 3ZWBA 4NU6A 3KEOA 1H93A 3CMCO 3F5SA 2Y67A 1F8FA 5JC8A 4FC7A 5AXDA 2RH8A 5JCXA 4JP2A 2DTXA 4D43A 2DUWA 4E4YA 3QVOA 1IUKA 4M55A 3DWFA 3HDHA 1V6AA 3MZ0A 4ROSA 1PJLA 2E82A 5L7YA 4BNVA 2HO5A 1ISIA 4KOAA 2DFDA 4WOJA 4YJFA 4ZN6A 1WWKA 1A71A 2DKNA 2GUGA 3ROQA 5A1TA 1C14A 4GGPA 4R41A 3KLPX 2G76A 4CM3A 4QUKA 4DIBA 3M1LA 3U49A 4B8ZA 4Z6KA 4XCVA 3PJDA 2R00A 3FR8A 1U7HA 3RIHA 2B35A 3RKRA 4P4NA 3PWSA 4IJKA 3WFJA 2PD6A 4LMRA 1CQJA 4H7PA 1E7SA 3BTVA 1KVUA 4L4RA 1PS8A 2P4QA 2A92A 1AE1A 1LDMA 2QRLA 4IMRA 4INAA 4PG5A 2O4CA 3AWDA 1LI4A 2FPIA 3H3JA 4HFJA 1TI7A 4J49A 4X54A 2QW8A 4L4XA 1B8PA 1H2HA 3O8QA 4JK3A 4I5DA 1IYZA 2Q1UA 1PTJA 3P2OA 3ZN2A 4A73A 1U28A 1L7EA 1HYEA 2POQX 1HEUA 2RHCA 4PG7A 3ZWMA 2HJRA 4N5LA 1RPNA 4RGBA 5EERA 1LTHR 4B4WA 4DTIA 2FSSA 4IUYA 4XKJA 3Q1LA 1DEHA 4B79A 2Y0DA 4ND1A 3IJPA 4RVDA 4XQEA 1NPYA 4ALIA 2GN9A 1YOVA 3OEWA 3NJ8A 4CM7A 2YFQA 5L4LA 3RUEA 4RPLA 4MVJH 3I6QA 1DC6A 2I5PO 2PZMA 1S6YA 2WYWA 3WQRA 4BNTA 3UKOA 3BAZA 3KSUA 3U0BA 4R3WA 4AJIA 2QG4A 4YAJA 3ZNNA 1GR0A 4J2OA 2ZJ0A 4A26A 5F5NA 4BNWA 4E2YA 3B1JA 1ZXLA 3SEFA 3F46A 5L4NA 5K6AC 4E12A 2QRKA 3U4HA 3V2GA 3E8XA 4L8VA 4BO6A 2VOEA 5IXSA 1I8TA 4J0EA 4AFNA 1M6WA 9LDBA 2O3SA 2WDZA 1BTOA 1EE2A 3SLGA 1I32A 1T2CA 3GNQA 3C3XA 4DRYA 1UUFA 2VHYA 4CM6A 2P2SA 4FB5A 3JQCA 3AUSA 3S2GA 2VNAA 3LZ6A 4L73A 5T64A 4AJHA 4E13A 1JKFA 4F45A 1DHRA 1KC3A 4WCFB 1ZSNA 1IHXA 3GG9A 1G0NA 4D3SA 1KVTA 1GPDG 5T6BA 2EXXA 2VUSA 3CH6A 1HE4A 2X22A 5IN5A 5L53A 3EVNA 1VJTA 5ICMA 4YR9A 5LDHA 1DC3A 2NVUA 4JQCA 2HK9A 1LRKA 3FNHA 4XYMA 2B36A 2VHVA 3BIOA 3JQAD 3MCVA 4D3DA 2BH9A 4JXKA 3JQ8A 1NTOA 2PV7A 3NAQA 1H9BA 4IY1A 4BGIA 4BKQA 2RCYA 3AFNA 3KYCA 3CIFA 5DP2A 2AEFA 1UAYA 2Z5LA 5ITVA 4EITA 3OIGA 3L9WA 2PTGA 3DR3A 2DBRA 4U6SA 3WIEA 4XX0A 5I9LA 4WNIA 2I6TA 2NTNA 4DWVA 4II3A 5G4KB 3MOGA 3SC6A 4CM9A 4N18A 3WDSA 1NAHA 4Y9DA 4AJLA 1KIFA 4CV3A 4WCFC 4CMHA 5CDYA 3RASA 3OHSX 1I3NA 2O23A 4ESOA 2X9VA 4PLZA 1NQTA 3LT4A 5ITWA 5KVVA 3C1AA 2W98A 2Y0EA 5FWNA 4QXMA 4E2XA 1XWFA 2X0RA 2HMSA 2GF2A 1YJ8A 4DUPA 4BO1A 1DC5A 3G1TA 3JQ7B 3KTDA 1MFZA 1A4IA 2VYVD 3PZBA 1A4UA 1R12A 8LDHA 3QW2A 4IS2A 3BTSA 5EIOA 2NQTA 4BNHA
chains in the Genus database with same CATH superfamily
3LTNC 3CPJB 4MRMB 3GUUA 5F33A 4FWIB 1PGQA 1AIPA 4K9MA 4EX7A 1H5QA 1NF3A 2FP4B 4GWGA 2ZVDA 4S2UA 3WJ1A 1NPDA 2PQ0A 3OY2A 4R71A 1ZRHA 2QI9C 5LP1A 3FMIA 3A6GA 5J1SB 2DYKA 2HJWA 1JWBB 2PSDA 2PKYX 2YV1A 1Q84A 3KM0A 3WYFA 1U5AA 2GEDA 5IASA 1YH3A 1PR4A 3AVYA 2GA9A 4ID9A 3SX0A 4D6PA 4Z49A 3JD0A 3KSZO 2FWJA 3LV8A 4KX5A 5F2NA 1DMRA 2BJWA 4U2CA 3RKUA 3FMOB 2GH1A 1Z8FA 2Q9BA 3RBAA 3OTIA 2WSSD 4LCBA 4R51A 1KQGA 2I6UA 4W99A 2VAPA 1I13A 4IV0A 2TMKA 4HSGA 2NUTA 1SXJE 3AKZA 3DDCA 4QZVA 2PSJA 3A1VA 1J0CA 5TXGA 5ISMA 2G17A 3ENNA 3U7FB 4HLUC 3HMQA 4MJ7A 3T3GA 3ZVKA 5HS4A 1HE8B 2H08A 4X41A 2VDLB 3ZWVA 2X7HA 5GZ3A 1PD1A 2CY0A 2ODAA 3IHKA 4IV8A 2JKYA 4KBFA 2ATEA 4G01B 4TSFD 3LVQE 5F51A 2B2NA 5CFQA 1DFIA 4PINA 2YXDA 4ZQCB 2OXRA 3R7WB 3SZUA 4DUYB 1GQYA 3UFXA 1VCIA 3GCDA 3NHBA 2IYTA 4OU4A 1YASA 4HYQA 1LJLA 2OENG 1IH8A 2V6BA 1WE2A 2OCBA 3GJ6A 5AJUA 3VHLB 4QWMA 5L7TA 4RTPA 1NHWA 3O9ZA 4INJA 5E6UA 3DKVA 4OHRA 2ANCA 3Q8WA 4JVSB 3C3PA 3JTMA 4GI3A 5KYTA 4Z2YA 4BX8A 1B93A 4UU8A 3AB3A 5G0SA 3LP5A 2XYVA 3HDYA 4G8BA 4L27A 2XUZA 5JRDS 10MHA 1ECBA 1PSZA 1QS0A 1W73A 3CRZA 3LKDA 3CLSD 2IV3A 3UATA 3UT6A 1C4XA 1TQHA 4DV2B 1N5LA 2ZTSA 3OI7A 3RAPR 3SIWA 3LCRA 2HR1A 2QUIA 3T7KA 3TLKA 1QAOA 1ECFA 2I7DA 4LZOA 3U9SA 1QVRA 2BDUA 2Q5JA 2QG6A 2WHQA 4LY3A 3UUGA 1YU6A 4BRUA 1IBKB 3LLMA 1BFUA 1FYFA 4EW2A 5M34A 4XDHA 4E31A 2JLZA 4NDNE 5D3QA 1D4FA 3JSXA 2AFVA 3WMGA 1L2TA 1FSGA 3ST7A 3K0KA 3DUWA 3R0QA 3IBSA 3TRJA 1L5HA 3W4JA 1U0NA 2BD0A 3KAPA 1IWBB 4DR1B 2AKAB 3IQZA 3FWZA 2QT9A 2R8OA 4ZCIA 1WY5A 2DTEA 3W7BA 5AM1A 2G28A 3IULA 2UVQA 1FP7A 2P9EA 3GAAA 3DV2A 1E2LA 1IULA 2P2DA 2AI2A 2CHFA 3PNQA 2WLTA 4HQ6A 4KJXA 5HCUA 4N47A 5F2EA 1Z06A 2HDNB 1UZAA 2HK6A 1X1TA 4D2IA 3KQLA 4EX6A 4EPXA 2WMYA 4L8LA 4EY4A 4TQUS 2JJYA 4MQ5A 3H9UA 5EKDA 2D1YA 3RU9A 3RRFA 4YV2A 1QRAA 2WIJA 1MIHA 1MOSA 2Y93A 1ZCZA 4HRAA 3VISA 1EEHA 3ZNOA 2ZJ7A 4NCHA 5L3SB 4XYBA 1BX3A 1AA6A 5FOVA 2HUNA 5FLYA 2IHNA 1Q6ZA 2OZLB 2W8BA 4GOJA 4Q02A 1FUKA 2ZYUX 3RNLA 3UJ9A 6Q21A 3I9JA 3KJFA 4AJEA 2M2IA 2Z58A 3DBRA 4X24A 2WC1A 4XDYA 1P2TA 7REQA 5EVJA 2OUKA 521PA 1C1DA 4U2BA 4QFMA 3PA8A 4AY2A 2ODNA 5L95A 4IIEA 5F78A 4PPGA 1J97A 1XZIA 3QE4A 1RBMA 3G5MA 5ERYA 4MUIA 4F3YA 5EFOA 1GA1A 1GPAA 1ZM7A 3CLVA 2PX3A 1SAYA 1AQUA 2JI7A 4N3GA 4NU0A 1MO2A 5A3VA 3WBBA 4EFKA 1NV9A 1DC7A 2ZRMA 3JQ7A 1JH8A 1U7ZA 2V4ZA 2ZYHA 4OL9A 4OK6A 1L5VA 1UK6A 2AEJA 3AR5A 5JJLA 3O2SB 3VYWA 2NYUA 5A6SB 3ADOA 5JSZA 1OGIA 4UATA 6CHYA 1XRMA 2R97A 4LXTA 3FVTA 3E2IA 3SVZA 3NYRA 4MRMA 2ET6A 4ZVVA 4IJWA 1GAJA 3PNBA 5ADUS 4IDGA 2FP4A 2PJUA 4AKSA 4AC9A 3G8AA 4GKVA 2A7XA 2AK2A 2NYAA 3C3EA 2VDJA 5CBKA 2IU0A 4IGFA 1JILA 2ATXA 2WB4A 4ARZA 1TX4B 4UM9B 2D06A 4G0ZA 1JHOA 1ZR4A 4R1TA 2FRXA 3ESYA 4B6JA 4CM4B 4QGAA 4H18A 2J0SA 1RZRA 1FBTA 1KDPA 3K0HA 5I7UA 1VE7A 4KQ6A 3RTEA 4DCTA 4MW4A 1A1SA 4PX3A 5F23A 1RKBA 2VPTA 3GFQA 5AVXA 4WKCA 1PR2A 3DZCA 4MCIA 4RIFA 5DX8A 1P0FA 4A23A 5I9NA 3NWBA 2I3BA 2ZOSA 2NWQA 3OIWA 2VHXA 2P9GA 3U4GA 3ZQ4A 4HNRA 1AMUA 3N2YA 1G6Q1 1ZD5A 3WP0A 1WVGA 3EDOA 3QP9A 5AKHA 4J9UE 1U8ZA 3VV2A 4C22A 3DQPA 1UDXA 2GF9A 4JN6B 1Y1KE 3H6KA 3EW9A 3RYTC 4Q16A 2HKIA 1UR5A 5I5EA 3R7WA 1O0BA 2VJPA 4GI1A 3ND7A 3WYCA 1DQSA 1LSJA 3KTFA 2ZTHA 1XJCA 4I8IA 1ZZEA 4NBLA 5EUQB 4YONB 3S81A 3OFNA 4BFLA 1GRRA 2B5OA 2HXGA 2P9QA 4M83A 5JATA 4GM0A 2WIKA 3CB4A 1OROA 4WN3A 4DLVA 1JHAA 1MLDA 1Z4MA 2CD7A 3U09A 2WFMA 1WD5A 3LHKA 3G7UA 3HVJA 1US8B 3HYCA 3L02A 3AHIA 1Y7PA 1ZMOA 3NBYC 2CXQA 3N5KA 1G1AA 2FNAA 2WRZA 1YULA 5AIAA 5IVHA 2OAEA 2MOKA 4W1RA 2Q28A 4Z54A 4IVQA 3BBLA 3C7AA 4GX2A 1O08A 4ISCA 1RAIA 5K6RA 2X6TA 1O6BA 5M7EA 3KJGA 5EKSA 3ZY2A 4HGNA 1A9YA 4ER5A 2VTEA 3ZVLA 4CL2A 2WQ7A 2VF8A 3N5CA 1KAHA 4I1OA 2DFNA 4C08A 2CGEA 4M8IA 3TR0A 3OLWA 3UNXA 4J1NA 4RS3A 2VSNA 2I71A 4LK3A 1CF9A 5H82A 6LDHA 2Q5QA 2X1LA 3B5JA 3RJZA 2NX2A 5KZMB 4FYWA 1YVUA 4I36A 1SOVA 3WQBA 2V8OA 4LC9A 2D2VA 4FYXA 4LYAA 4ZC1A 1YDGA 3MJRA 1L0BA 2XOXA 3FNBA 1N4AA 2JD2A 2H4FA 2H11A 2XV1A 4G4SO 1JJFA 1M33A 5A5FA 1YJXA 2OQ2A 2PAAA 1Z34A 3MOIA 3TQCA 1Q17A 3ZLTA 1ECPA 3OT5A 221PA 3AG6A 3EVCA 3P26A 3PDCA 1Z0DA 1CQIB 4DA6A 4F9TA 1NM5C 5EJEA 3OZXA 1RWMA 4W1SA 2CVQA 1EFUA 2RMKA 3Q7EA 4HAWA 4KJZA 4NECA 3TI7A 4D82A 1NY6A 4EVQA 1OPRA 3SYNA 4WMLA 4YN3A 3OETA 4O2BB 1DJLA 3BM5A 5EJIA 3VKWA 2BGUA 1YA6A 4MB6A 2MU1A 4CMBA 1KTVA 1N2BA 3U1TA 4LTNA 2E3JA 2JBAB 5L3SA 4BQRA 4LDJA 1XZJA 3KSRA 4WEQA 3JYNA 1FQWA 4D9JA 2OZLA 5JSKA 3NGXA 1VRVA 2PU7A 3IP3A 3K6KA 4AUMA 4KVAA 3B1ZA 1QYVA 3UMRA 1GQOA 2AOUA 1MC8A 4XSVA 5DM0A 3UMSA 2AF4C 2AR7A 2BUAA 4J16A 2X9LA 3WQQA 4AURA 4YQFA 1A4RA 1HO3A 3D9QX 3OCJA 1KSGA 2VJBA 5HKBA 1VB5A 5BW4A 1NBHA 3KG2A 3JWEA 3HR7A 2IEIA 4ZCQA 5IZ4A 1UXKA 4GBMA 3FI9A 4FDLA 1H8HA 5HK8A 4AJ4A 4XR9A 3NBAA 3LX5A 5JNWA 1YVEI 5L4SA 2QRVB 1A97A 1OTHA 4NBUA 1JMVA 1KY3A 1Z82A 4A27A 4QSMA 2BFAA 4CQJA 2X6RA 2FOLA 3QBVA 3WDLA 1H9CA 3NR2A 5A6SA 5TX7A 1X1RA 4NULA 1U8UA 4EUSA 1TEHA 1U2GA 4OIMA 2GCNA 1SC1A 3SY8A 4DREA 1FJGB 2TRSB 4QULA 2D74A 3AXTA 5KTNA 4M3NA 1ULBA 1OASA 4TRMA 5C18A 1ZESA 3IO3A 4MV3A 1Y6ZA 2Z2KA 3RG8A 4HBZA 5HIKA 5F98A 4B17A 1YJBA 1QIMA 1N2IA 2GZSA 3C41J 1S2GA 1V71A 3QUAA 4RCZA 2PWAA 4QHTA 1IXRC 2XYQA 4MRVA 5EL0A 1MQAA 2M32A 3G5AA 3COSA 5ARBA 4R2HA 3ITEA 4WPGA 2OV2A 3C6BA 4FFRA 5JWRA 2W0SA 1ONNA 3GCWA 2ATIA 4OLJA 4A0HA 4G0VA 1LSOA 2WZBA 4UDOA 1QVAA 1J9ZA 5FBRB 4XSHA 3OZWA 3IIJA 4XYGA 5FT9A 1K7YA 3SE0A 2V97A 2XNDA 1HZZC 1XLWA 3WLOA 2W2VA 2BFCA 1Z2NX 1ZOLA 2EJVA 2PZBA 3FMPB 3ZKWB 1FFHA 4E14A 5KNBA 3U44B 3OSUA 3ICEA 3F8SA 3W1EA 4B09A 1DLIA 2QMYA 4EGSA 2W6MA 1ISMA 2GLTA 3EF0A 5FRDA 2JZCA 3MLAA 1M75A 4YJHA 5J5AA 3ZW9A 2ZJBA 3WL5A 3H8VA 3C4JA 3UHFA 4EOGA 4HYEA 1J7KA 1M76A 3M8KA 5FOSA 2PPLA 1G21E 5F2KA 5I4IA 4RTJA 2ZTVA 3GN1A 1T1JA 2UV8A 5K3BA 1HOXA 2CNKA 4KMRA 5JQWA 4NV1A 1PG2A 5E3JA 2NT4A 1ZM2A 2QN2A 1ZN2A 4LYYA 2B8TA 1L7OA 4RY8A 5LIPA 1Q3TA 1Z15A 1THGA 3G0BA 1SBYA 4IMJB 1US8A 2CK3D 5LQAA 2P3SA 4RYLA 4UBKA 4MPRA 1KVQA 3O3NB 3O38A 3A6FA 3W6NA 3U4MA 3MJTA 3T7CA 3F4LA 4FCVA 4LWZA 3U40A 1S96A 5EJ6A 2GR9A 3LP8A 1SA0A 3A9UA 1E1RA 2IU6A 2VRCA 3E15A 1R6BX 1WHSB 3IYLW 3UC9A 3S2EA 1SUPA 1V1JA 4R54A 4ANFA 4E08A 3OZFA 3TYXA 2DPHA 3F5DA 2R60A 1YFJA 3LUGA 2BLNA 4BGDA 1PRYA 2KMLA 1OX6A 3MAAC 4MVJF 3UMBA 4RD2A 4K9OA 1RSZA 1WZIA 1E5DA 1EWKA 1T0IA 1T0PA 1YR2A 2DF8A 3FPAA 4PTYA 4YB8A 1RIIA 5GVRA 4N5NA 2CL0X 2WAAA 4TMFA 4BMNA 1JIQA 2BEWA 4RO0A 1PNQA 3RJTA 4AKTA 3IVMA 1M34E 1EYZA 2IE8A 4FYHA 3UGJA 1QH1B 1JKXA 4DM7A 1NVKA 3L4SO 1NBMA 2DPYA 3KLMX 5CURA 4N49A 1A2OA 4C6SA 5IN4A 4ZVLA 1Z8HA 1G38A 3JZIA 1CCWA 4GU5A 4Q01A 1W96A 3TIGA 4CIYA 5BYJA 5AUOB 3LYAA 4Z4GA 3FRHA 1G2IA 5CGZA 5C1PA 4Q3AA 5FPYA 2HMWA 4MMYB 5CCDA 4Q1EA 3AKCA 4U0JA 1ULUA 3E03A 4XX1A 3FVQA 2ASVA 4O2BA 3O0DA 5A05A 2QN9A 1SD2A 1VL2A 1CQPA 4C30A 4UOEA 5IC6A 1T8YA 2HBRA 3EQ7A 1QR6A 1UBMS 3I64A 2JBAA 1I1HA 4UBIA 1XHLA 4DNQA 1DG1G 4DANA 1QH8B 1ZSYA 2HMVA 1TQ4A 3QBJA 4GWLA 4Q4AB 4R69A 4Z9XA 3L4KA 3LW7A 3GLFA 1UBFA 1F38A 2VHEA 4LJ9A 1Z6AA 2XNCA 3C43A 4UCFA 4F4HA 3VPFA 3WGHA 1TT5B 2VQ3A 4YJ2B 1UKVY 1ZNZA 3OQBA 3JZAA 2DWCA 3IRUA 3PIIA 3P0EA 5FP0A 3REOA 1E6LA 3UIEA 4B4OA 2BTOA 3M1AA 4US1R 1UOOA 4C6TA 1NW4A 2WILA 5DOVA 4LTMA 5AJZA 3SLRA 3WBKA 3AZPA 3EY9A 3PTAA 3AY7A 3KVVA 1YBHA 2CJPA 2PGDA 2QQ5A 4E2WA 2I3ZA 2ID7A 2ARKA 1SM4A 5I7FA 1O03A 2I2BA 3JATB 1VG0B 1ZSVA 3Q9UA 3BXOA 4RKQA 1E3TA 2NZVG 1NN3A 2V55B 4NHEA 3TPFA 4P4LA 2ZXEA 1L1EA 5JS6A 3M89A 2B82A 3ND9A 3D4IA 3AEYA 1PIWA 1LLFA 3B6JA 2QAGC 4QPCA 3SIPA 3DLIA 1V25A 2JATA 3C85A 2H8GA 1FFWA 1NL3A 2ZSAA 3D7KA 3H87A 3HJCA 4YAEA 5JSQA 1VHDA 3PLAE 1SKYE 1KOLA 2BHLA 4TMYA 5FB3A 3W05A 2AXNA 1I6MA 1CIPA 1M2JA 2C7GA 5G3ZA 2M6SA 1UPFA 1H2RS 4D41A 1CUYA 1F8UA 5DHFA 4R6WA 3U19A 1TZBA 5J59A 1M2VB 1XEWX 3AUXA 3TD2A 1C3XA 1T9DA 2ZJOA 3OPYB 2P8JA 3PR3A 4PPFA 3ZKWA 3L7NA 3DVSX 2BGGA 3U44A 2D2EA 3AJ9A 3ETLA 1H4TA 1T1GA 1TMYA 3TUIC 3H65A 1W88B 1BD3A 1NFRA 1U1FA 2FWBA 2QQGA 2FPPB 1K8XB 2P4UA 3CY6A 3FOWA 4O5OA 1XZHA 2R65A 3FDZA 4UBNA 3V8VA 4AF7A 1G2PA 1JPNA 3KQQA 3AI1A 4WADA 3K9FC 4JT4A 3EPLA 5SY9A 3T9DA 3PGA1 1MXFA 1R0YA 4Q48A 1NMSA 1E9SA 1TJ5A 3VSBA 1WVIA 2O8VA 2QX6A 3HHEA 2DSTA 1YJ5A 3U0VA 4N3CA 1GLNA 4G9GA 2ZTMA 3JQ9C 1EVYA 3PPWA 4N5IX 4FDUA 2EG5A 4G5RA 4PYNA 3D8TA 1AHPA 1KARA 1ZVVA 2GXUA 1HQYE 1HNXB 1AG9A 4O2AF 1QCCA 4GQAA 5EKUA 1VIMA 4YWHA 1GTVA 3ID6C 5CNJA 5DX1A 2BGMA 3GWZA 2GPYA 1WRBA 3AOEC 3FUWA 1WHSA 1EDBA 2W8ZA 3FFXA 5JD3A 3DL0A 4TLBA 4YAIA 1WB4A 2QVLA 1ISJA 1DOAA 5JISA 3VKVA 4B81A 5IEBA 5L51A 4Y8VA 2XUIA 4KPEC 2NVBA 5LMUB 3LBHA 1HOTA 3GFPA 3M9LA 2QN6A 5BO5A 5LUBA 3EXAA 1M7HA 3RU2A 1U9IA 1UJMA 1PQYA 2O1WA 1SUDA 2Q1WA 5TT1A 1XROA 4YXFA 1EUDB 1VIAA 2C7PA 2ZWIA 1QH1A 1W35A 3DO6A 1CY2A 2NAFA 4OXKA 4JVMA 4PR3A 3SYKA 4EHKA 3F78A 3KKNA 4XQ0A 1H94A 2ZR0A 4Y1GA 4WZAB 2FRDA 1ZCFA 4FKMA 3N59A 5HFJA 1YD7A 3H04A 1DAFA 3SNKA 3ZJ4A 2O5VA 4RIEA 1M1XB 1HEIA 1DT5A 3MWEB 2AZDA 1V1MB 3LYUA 3MTJA 2OESA 2VKQA 3IUEA 1KI4A 3VC2A 3DAPA 4BUZA 4ARBA 2ZVJA 5AVVA 5LQNA 1KPIA 1QH8A 4JJ7A 1P3JA 4PYOA 1Q74A 2A1UB 4RAOA 4G67A 4NI5A 3Q87B 1H0KA 2MSWA 4Q4AA 3TTYA 4GE0A 3V48A 2ACEA 1ZJZA 4ND4A 1S7CA 5EQDA 3O1HB 3P9RA 4W9NC 2ONJA 1MT0A 1N1GA 4JEHA 1K3TA 4KK3A 4NDAA 1CT9A 3BMQB 1TT5A 4PGHA 1XNGA 1OWNA 3P97A 5HKKA 3OFND 5T41A 4EABA 2XUDA 1NW9B 3RGWS 1BIFA 4ETMA 1PFWA 2ONYA 1R37A 3FUXA 3HSYA 2IS2A 1N6PA 1C7ZA 3CLTD 3X1KA 4KXQA 1LBSA 4MGHA 4Q4HB 1AUVA 2V6JA 2V54A 4CUZA 4U7JA 2CYAA 2LP4Y 1P4SA 1SCDA 3STTA 3B1VA 1M2WA 1QF9A 4BMXA 3JATA 5FI1B 4W5QA 1DAHA 5A7HA 4R3UC 1SUAA 4RH3A 1SXGA 2R6DA 1EQ2A 3OEED 4MUHA 5K0LA 3I5XA 1QYXA 2ZK7A 3B2EA 1UCFA 3IB3A 3KHUA 1ZUD1 2AX4A 3Q5DA 1LK7A 2BEKA 4BKOA 3M1YA 1XQ9A 3M3HA 1DXOA 1R5JA 2VEOA 4CFSA 4BN5A 2JAOA 4JBHA 1G4HA 1GNSA 4E22A 5I01A 1MC1A 1P4AA 5E2AA 2RGCA 4RHTA 1U7TA 2VTBB 2PL5A 2ORED 1U0RA 4IOJA 4XIYA 4XGKA 5HZMA 3RLIA 4E70A 4XWYA 1SHTX 4NAHA 4ZQEA 2BTQB 2EL9A 1TO1E 1M2VA 3KOZA 2HPAA 1I2BA 4DCPA 4QUJA 1TT7A 1QIDA 2HJVA 2X4GA 3KRTA 2YN2A 2DQYA 5G0VA 3M1IA 4L1KA 2B4YA 1K5GA 1PBNA 3VTKA 4K5QA 4HPJB 1U1EA 2FW0A 2DT8A 2GN0A 2PM8A 2RHDA 2W2OA 4L3WA 5KJEA 1SY7A 5U9CA 3EPHA 2FPPA 5G0TA 2QX9A 1ZA1A 1O94A 3A36A 2YYSA 3C98A 1JU9A 2QM3A 1K66A 3CEMA 2YIVX 5IJWA 4MGIR 5JADA 5LP6F 3AR2A 5BW6B 4QATA 1NPTO 4N4AA 4P82A 1VECA 2ZDQA 3QE0A 3UWOA 4P3YA 4TPKA 1E9RA 1V35A 1VHLA 5D87A 4YBRA 3SAJA 3PYXA 1YR6A 2FTKE 1NFQA 1LCIA 1X7GA 3LGAA 2J0UB 1EFCA 1NTRA 2P3LA 3BWBA 3WADA 2VNHA 3WYEA 1QOQB 1SK8A 2JHAA 4DBVO 2GRAA 2KHZA 4BRSA 5LPNA 1QTNA 2F43B 2OK8A 4B74A 4F93B 3GLGE 1Z5WA 3QE9Y 4DQ0A 4UFNA 3F8WA 1MG0A 3ONFA 2H1HA 1H8HD 2F00A 2KBEA 3FYUB 3DBLB 1JT2A 3HB5X 3MWJA 1MORA 2CXPA 2C57A 2WF8A 2GLXA 4HN2A 4MV8A 2COEA 2RGXA 3CZPA 5TPZA 3I4FA 5KUTA 2G0NA 4MKGA 4L57A 4EUEA 1ZJ6A 1X13A 1EJBA 1JQKA 1PG0A 1QVZA 1Y9AA 4FMCF 3IT3A 4Q82A 2ZU6A 3CJQA 5CRIA 3S7TA 4GSLA 2YFYA 4BQIA 2HCFA 3T6KA 4GICA 4YHHB 5KVCA 1QG6A 4U7GA 5B3JA 4Q93A 1NDQA 4LZLA 3AL0C 5I9BA 1B8OA 3BMOB 3JQAB 2JIZA 1RHQA 2C59A 2GYUA 2YJ3A 1LQTA 3PE3A 1V9CA 2CUZA 2NQ8A 1EUDA 2ZIAA 3E9MA 3N9IA 5EP2A 4JGIA 4OVKA 3SXJA 2Y6VA 2B21A 1Q2UA 2B4QA 4ZO4A 3O8BA 4TTRA 6NULA 4X00A 1PQ4A 3QFFA 2XMCA 1CP2A 5HM6A 3ED1A 1V7ZA 4D8YA 1BXRB 1CS4C 3JD2A 4QX6A 4S12A 1X9IA 4Z9BA 3ZHSA 4ZVOA 3U80A 4EG5A 4MWDA 5BW5A 2ZAGA 1W46A 3B36A 4HVCA 1Y63A 3I0NA 1XXHE 4LFBB 2D6FA 4BQOA 3MWEA 4P86A 3OPXA 3PHIA 2PX0A 1KOJA 1NOJA 1O4VA 3Q7PA 2J1LA 1V1MA 3PUIA 3QU4A 3HMKA 2H1OA 4MAFA 5CU7A 3VOSA 5I5GA 5KNBD 3ZHZA 1WL8A 2HQOA 4EKGA 1T0HB 2ZYTX 3H2SA 4LJ8A 4XIJA 1NI4B 5A4DA 1DBWA 1G3RA 2A1UA 1TC1A 2OAQ1 2ZEJA 1UKZA 1YR7A 4PO9A 4JLSA 1RI5A 2FH5B 1RBYA 2YYAA 4XH9B 1N36B 1DJPA 2I29A 1HK7A 1UINA 1VE9A 4UAJA 3DGEC 2CV1A 1OAAA 1RWVA 4BVLA 4G0PA 3R5TA 4AUEA 1KEVA 1EZZA 3QWBA 3BMQA 1WU8A 1S2MA 1DXQA 3K30A 5H80A 4GI7A 2HK7A 1KFCB 2C99A 2JLAA 1WZNA 1UPAA 2K6GA 2MYUA 2VF7A 3HZZA 3LY5A 3ONNA 5AHWA 4IDEA 5FKJA 3IDZA 5D51S 5EWJB 5ADWA 3OZGA 1P1CA 3O4GA 3I5MA 3ZD9A 1R3UA 4JR1A 1QDLB 3BMCB 4K9DA 4JJ4A 3B1FA 2IHVA 4HJRA 5DTRA 3QSGA 4YQYA 4Z4EA 5DCYA 1LVUA 3B6ZA 1PR6A 3JRXA 3KB2A 1RC1A 3NBXX 1PUXA 1QH0A 1UF9A 3NUZA 5ENZA 5K51A 4RTSA 1P18A 2PO5A 1F2UB 3U7HB 1U0EA 2ASEA 2EJTA 4MS4B 4ZRDA 2QU8A 3EGOA 1OR8A 2KLHA 2PNFA 2Z3ZA 1BN6A 5KB3A 1E1RD 3QY9A 3UK7A 2D2IA 3SG0A 1D7OA 1QTIA 2I3GA 4RJTA 4FCCA 1E2BA 1OH7A 4KNYA 4DSUA 2CUNA 2VHUA 2VUTA 3EPKA 3GDGA 2WSIA 3CRRA 3Q4GA 4UFOA 4D9EA 3WB0A 4Q66C 5JCJD 3TTTA 1A3CA 3WBFA 4FNGA 3ABQB 4GAEA 4RWZA 2E55A 3AVWA 4Q1BA 4P9NA 1I5RA 4YEDA 2OGZA 1C81A 2B83A 2VTBA 4LBZA 1CS0B 1WUKS 4DGQA 1C8KA 1IK4A 1YBVA 2RFLA 1EM8B 2FPKA 3ICVA 4IX9A 1DBPA 2IJGX 2J5XA 4C2AA 2JLBA 1NBMD 2Q2VA 3NZEA 1J2YA 3WTBA 4BBPA 1D1SA 3N0RA 1XELA 4IDCA 1RYEA 3BK2A 3C8UA 4UBOA 3SM9A 3I6IA 4FLMA 1XNJA 1YDWA 2JI6A 1E2DA 1OI3A 1WNTA 2WJZB 1BS1A 2QI9F 4ESHA 1QP8A 5JRZA 1K92A 3RVLA 5C7IO 4MR7B 3RI3A 3KT8A 3A3YA 1OZ0A 4Y6GB 3LD9A 4BO8A 3QM1A 1OIVA 1L4GA 1NJ2A 2W90A 1F60A 2IUEA 4X8OA 1P62B 5EMNA 4CCYB 3ZCVA 3MXTA 3GLGB 1T3ZA 4ZO9A 2PZ8A 4QYWA 3H3FA 5TARA 2AI1A 2D0OB 3EODA 4RFLA 5AHKA 3S0JA 5LMCA 3PXGA 2ZCVA 2J0UA 4PYMA 4A91A 2R62A 1Z39A 4ZP1A 5LZ8A 1YE3A 2HWXA 2NW6A 3FUUA 4FGSA 2GETA 3AYZB 5E0KB 3I6YA 3VBCA 5A71A 1NG9A 2CUKA 1TF5A 3F6PA 2P30A 2F43A 7GPBA 3USES 4M9SA 1IHDA 4N7MA 1QLJA 2QPLA 4JT9A 2WUWE 5DYTA 3B7PA 4OHCA 3ZV6A 4A03A 3FYUA 1FDIA 4HXGA 3QLJA 4BB9A 3V80A 3BTUA 4YO7A 8ADHA 2C58A 2D7DA 2FAXA 3LPCA 4JKOA 3M9WA 4EBFA 1K98A 4K03A 4JQZA 1WXWA 1E5QA 1H2ZA 1OWMA 1V8PA 3N2LA 3C8ZA 5DYIA 4IHKA 4JFAA 3T61A 4OJQA 4DPLA 4NZYA 4FEYA 3KK0A 3EDYA 2RHMA 3GJRA 4NCKA 4U7WA 4LF6B 4UREA 2YKGA 2IU4A 1D7AA 1ARZA 2EFJA 1EK6A 3DMRA 3Q9SA 1BCRB 2C4TA 4NK4A 2H3EA 4CTMA 5LU9A 4LJRA 2FSUA 4JMPA 5LBTA 4OM7A 1K2WA 1LRLA 4HAYA 4IQ4A 2ZRDA 2C7BA 4WQMA 5CVEA 5DP1A 5FBKA 2C9DA 2QSJA 1PK8A 3DR5A 4B6PA 3ILVA 3FFTA 3H5WA 3FPBA 1ZBQA 4H31A 1BXRA 2GLUA 5HUHA 2VR1A 1GAWA 3DWGA 2G9QA 1XRSB 1CJSA 2BFOA 3DLAA 4RJJA 3E0XA 2ZBDA 4PNPA 5F21A 5KO2A 1HT2E 1KDTA 2ZXFA 4JUDX 1JDTA 3WGOA 3VI4B 1E1NA 4B4DA 3F7TA 4X6YA 4CV2A 1XTTA 4D8VA 3VKHA 3WGJA 2TMYA 2FPSA 3D0QA 4M0CA 1NJ5A 1P0IA 4U39A 3ZLVA 3DE2X 4E7PA 4ZYYA 4ALNA 4ETWA 2JCYA 1NI4A 3O6VA 4G89A 5AVYA 1UJBA 1M8FA 1KXZA 4R9SA 1G64A 1W581 4B3IA 4KN9S 1Q91A 4A0FA 2F48A 1JQDA 2YR0A 3CLSC 4DV6B 3KKMA 4LVNA 3OQOA 2UZ0A 3RTCA 1DRUA 3S2ZA 4F2PA 1G6HA 1JYEA 1GU7A 1WHTB 4UUQA 3L1HA 5IJZA 3KR1A 4TLLB 4EPYA 3HC7A 1E9VA 2XMPA 4J3JA 3I32A 3FHLA 1QZUA 4MO2A 1ZGZA 4O4JF 3DQQA 3IUJA 1YIAA 4XTCS 3VR2A 3MCTA 4XI9A 1VJ1A 5EWJA 3IUQA 3LFUA 2GJ8A 1U8XX 1M2GA 5K8UA 3P2YA 4J03A 3BMCA 2IYFA 3RC1A 3L8EA 1R0BA 3ROEA 2JK0A 4IXNA 1TEZA 821PA 4QELA 3WLNA 1JIJA 4JY7A 3RRXA 3V4RA 1F2UA 1QAMA 3G7NA 5DGCA 3TLXA 1ZJJA 1R8SA 5LNK6 1M6NA 1KVSA 2OV4A 2JFBA 1GUZA 2HDWA 3R3UA 3Q85A 3G5LA 5FTNA 4QEZA 2WP0A 3BGSA 1NZFA 1PYGA 3SKXA 4I2NA 3BB3A 5KKNB 2QDXA 2B1JA 2XZOA 5EXSA 4UHFA 4TYNA 1ZN7A 3UG6A 4Z3KA 4BWVA 1K7EB 1QFYA 3AI3A 3C8MA 3EZ6A 4LHWA 4RTRA 2JCXA 3F6RA 1A04A 4IZ6A 5L4NA 1J06A 3MJ4A 3PVSA 3BZWA 3QE3A 1M1YB 3K5WA 4CLHA 1CS0A 4UXHA 4FSDA 1A27A 2EQBA 1RBZA 1EM8A 2RB4A 3QLVC 4MEAA 4RJLA 2VK4A 4AZ0B 2PYDA 3GA0A 2VPPA 1W5SA 1FK8A 4ZICA 1ZISA 4IR7A 4BO9A 5HWSA 2WVJA 2ZTUA 4AROA 2C9MA 1MFPA 1KP9A 3PUJA 1DCMA 1URPA 5EXDA 5LQRA 4TTQA 1AU9A 1XFDA 4LMBA 3W9UA 1GCGA 3BXEA 4L8FA 4KRFA 1D09A 3R3XA 1Y81A 4RENA 4YLEA 4YS6A 3FDXA 4Y9TA 4KACA 3EHEA 4MR7A 4TV9F 3E5NA 1LNSA 5U1PA 1GRQA 2EKZA 3Q3JB 2ROQA 4LYHA 4XASA 2WEKA 4BJ1A 3BPSA 4UULA 4CCYA 1B8VA 5K1ZA 3WGLA 4EJMA 1X7ZB 3GLGA 1FRFS 1Z2PX 1WOYA 4HNQA 4M7PA 2YOFA 5TF4A 3CTMA 3VC7A 1KBQA 2DQZA 3MMNA 1UEJA 2IPOA 5ALKA 2I4IA 1MH9A 3VHRA 3VH2A 5FUMA 1FTWA 2XWBF 3IBYA 3PNKA 4QBGB 4CQMB 2VT6A 1DQYA 4J9VA 2X0DA 1R9GA 2A6PA 1J8YF 3HXPA 4L07A 1FJ2A 1JEQB 1FNSA 2C82A 4L3VA 1TJ3A 3A1FA 2ZPAA 4UQPA 5HKKD 4Q3KA 3EOAI 3EIEA 2MJLA 3DFFA 3G8BA 2GASA 2PWZA 2FX3A 1HQKA 2WWRA 3V2UA 4NCXA 5JDIC 1Q77A 2DR0A 3S5UA 4MWTA 4F84A 2ZT7A 2C2ZA 3A1CA 3CW9A 1G2OA 1DQZA 3EGIA 1BFKA 4RUKA 3ZXUB 4BNDB 2ZS9A 3QA3E 4A5SA 4L6CA 3SVLA 3VGPA 1E1MA 3I30X 3HLKA 3ILSA 1TOAA 5ECWA 4PQRA 3LDAA 1JG7A 4B7CA 1Y34E 2CJWB 3JYHA 3WK6A 4F2WA 4FFPA 5K0GA 1Y4UA 1UMBB 4YQZA 5C34B 3IP9A 4LHEA 2HRDA 2C7RA 1GZSA 3N0VA 3WK5A 2GPBA 4QPDA 2V3CC 2CV0A 2FCAA 4D9MA 4CTNA 2Z98A 3K0CA 4H1HA 1BXGB 3WGZA 3CU5A 1F12A 1JPVA 2W37A 3L9XA 1CUGA 4OHZA 4DLBA 4Z7NB 1OSNA 2ID9A 2KSQA 2NN3C 2R11A 3NLLA 4GXRA 1SPXA 2QMEA 3OX1A 2GRUA 5COBA 2RK4A 3WXBA 7ADHA 1IK6A 5JWOA 5KSYA 1JKIA 2JFGA 1MC4A 4MW2A 3SBEA 2BGWA 4A92A 2NZ8A 3C6ZA 1ORIA 2XRMA 1QIIA 2FUCA 2CEAA 4Y6SA 1N8NA 3WMXA 3OZAA 1GZUA 1Y8RB 1SB8A 3CUUA 1WUIS 2HLNA 4EI7A 2VNSA 2ZRCA 3VRHA 2H4YA 1FTGA 3PFBA 4RF2A 4FGLA 4QHSA 2WU3A 3A8TA 3K35A 2R00C 5JDCA 4BKUA 2H3HA 1DE0A 3HFJA 3M6WA 2F9FA 2WA2A 4W7IA 1DAOA 1O94D 3HQ4O 4GZMA 13PKA 5EZSA 4YUWA 2CFOA 1JHMA 2JFNA 2W2QA 5BSUA 4AJOA 2CVHA 2N46A 5TMDA 4BECA 4X1OA 4IICA 3ENZA 1CE8B 4WACA 3ORHA 4BVFA 5CIYA 5AYVA 5I7RA 5DCLA 1GKIA 3KWJA 5E9WA 3KNZA 4CMIB 3VM6A 3TW0A 1G63A 4URYR 3PKIA 1QHEA 1QPBA 3JQPA 4ND6A 4NG4A 4AMGA 1RQ2A 4K6KA 1MENA 2GEVA 4QXPA 1PVOA 3INRA 2QSUA 4ENSA 1EK1A 5D3ZA 3AV0B 4LYJA 3SN6A 2CDCA 1DP4A 4G9EA 4X65B 2HA6A 1NVTA 4J6FA 1GNPA 3KVRA 2EX1A 4OQDA 5TPZD 1UK9A 2AK3A 2ISQA 1HTTA 4XZ3A 3U9LA 4JT2A 3WISA 3WLPA 1FLAA 1KDZA 4PSKA 4BKMA 4ZOLF 3RUDA 5EZ5A 3W3AH 2NU6B 4C29A 5DSZA 4S1OA 1CKEA 1ZK1A 3OJLA 5EE5B 1HNWB 1CUIA 4Z4HA 2QB5A 5HJ5A 2JCVA 2GPSA 1MEJA 2FK7A 2P5YA 3BKWA 3H4IA 3IQEA 4G0NA 2OCIA 3PQ5A 1NONA 3IIKA 3QVTA 4OL0A 4ZVUA 3OQIB 2JIZD 1M1YA 3L7OA 3LI2A 5KJ1A 1PV4A 1Y1QA 3QV2A 4AZ0A 4D0GA 4G65A 1CR0A 4DMLA 1GSAA 1NYTA 4TZ6A 2Z6QA 3FMFA 3IVAA 2ZUBA 5K09A 3AH8A 1ZN8A 1U1DA 2JGMA 4IXMA 1DT3A 4TRRA 4BLWA 1HE3A 1SRRA 4N8DA 4S35A 2AN4A 3WVNA 3S99A 5A02A 2JIOA 1DSSG 1IUPA 2RGWA 3H97A 1NOKA 4QQRA 3G59A 3WK4A 3IP1A 3A6KA 3NJRA 3P96A 1P6XA 1X7ZA 2QW0X 3LBFA 3QX9A 4INZA 4AP6A 4ZDJA 4GPZA 1LDGA 1FJXA 2WHYA 1USWA 3UEOA 1VL5A 2NSYA 4OAPA 4DSOA 1AT1A 3OE7A 3CONA 4CMEA 3FVRA 4M2LA 1UBRS 2HRBA 2W2XA 4HRXA 4L15A 4RKWA 4DCUA 5CJ2A 1VLVA 3OJEA 1RXEA 4I9HA 4OSEA 3ZU3A 4CQMA 2WUGA 2UYQA 1Q11A 1TVKB 1RAEA 3IX7A 4URVR 5EZYB 5BNZA 2AXEA 2C2XA 1DCKA 1KYZA 2GD6A 3U31A 1I4DD 4KREA 3GRZA 4OYHA 1QPGA 3UV3A 4COKA 1FVXA 2DX7A 5MDHA 4J7CA 1V3VA 1OWLA 4K3UA 2EVWX 4FR5A 2YWJA 2GGSA 3BK7A 2GM4A 2Q5LA 3KQPA 2A0WA 5IZCC 3T7AA 3DTYA 1RJWA 4WKGA 3STWA 5K1SA 3BEOA 1S89A 2FZCA 3IKTA 4YA6A 5J2TF 2GPWA 4JP3A 4GEKA 4JLNA 1VZ2A 2NO4A 3JQFA 4JI5B 4D8WA 1XG5A 2EF1A 1FRQA 4XJVA 2B69A 4TTPA 4GL2A 4F85A 1CUZA 1VSBA 2M1ZA 2WIAA 3MJFA 2REOA 4KYIB 4KQMA 2R7KA 4R7TA 1UMBA 1RI1A 1ML4A 1KR2A 2FPUA 4XUDA 4DCCA 3MGCA 2WKQA 1O0SA 1JDSA 3A32A 4EELA 1T2FA 4M99A 2OYRA 3UAVA 5KOHB 4DZZA 1N2OA 1H9AA 4H4CA 4G3XA 4TSRA 3TBFA 1BXGA 4RPHA 1G3QA 5D84A 2R87A 4K2HA 3IJEB 1CZNA 4MVCA 1MEOA 1T1EA 4N76A 3W8RA 4U5QA 3PTZA 5D6OA 3C97A 1RHUA 2O4UX 3DHVA 4C78A 5JYEA 3QVUA 3O90A 1N9GB 4X3OA 3NUGA 2XIJA 3GLIE 4LQ4A 1RLJA 1Y8RA 2FN7A 1E2GA 1IZ9A 2WWFA 1Z45A 3E1KA 3FGOA 3R5JA 4RELA 1NLZA 1W6RA 1H6DA 3AX6A 1IL0A 3QG1A 2XCIA 4B43A 3K8ZA 1A9XB 5F4ZA 5BUSA 4LX0A 4D0SA 4YT8A 1NR1A 1RXCA 1K8YB 1OFUX 4PG8A 1IQPA 2BJVA 1T13A 3ZDBA 1GDDA 1LVHA 2MSEB 4REOA 4XFDA 4O1IA 4GQIA 1K3UB 5DNVA 4CV0A 1ODFA 2QPAA 1SWWA 4JYPA 5M04A 1O5IA 3GLHE 3N8GA 4QPJC 3DTVB 2ERYA 1CE8A 1FSSA 4YQEA 3WLMA 1CQXA 4MARA 2ZJ1A 4EDHA 4CMIA 3OKFA 2E37A 3IUMA 3SYRA 3H1EA 1GQSA 3FUVA 4EPTA 2FZKA 2PFSA 3ZD8A 2HF8A 4YP9