2CDAA

Sulfolobus solfataricus glucose dehydrogenase 1 in complex with nadp
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
366
structure length
360
Chain Sequence
MKAIIVKPPNAGVQVKDVDEKKLDSYGKIKIRTIYNGICGTDREIVNGKLKGKDFLVLGHEAIGVVEESYHGFSQGDLVMPVNRRGCGICRNCLVGRPDFCETGEFGEAGIHKMDGFMREWWYDDPKYLVKIPKSIEDIGILAQPLADIEKSIEEILEVQKRVPVWTCDDGTLNCRKVLVVGTGPIGVLFTLLFRTYGLEVWMANRREPTEVEQTVIEETKTNYYNSSNGYDKLKDSVGKFDVIIDATGADVNILGNVIPLLGRNGVLGLFGFSTSGSVPLDYKTLQEIVHTNKTIIGLVNGQKPHFQQAVVHLASWKTLYPKAAKMLITKTVSINDEKELLKVLREKEHGEIKIRILWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structural Basis of Substrate Promiscuity in Glucose Dehydrogenase from the Hyperthermophilic Archaeon Sulfolobus Solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Oxidoreductase
molecule keywords GLUCOSE DEHYDROGENASE
total genus 122
structure length 360
sequence length 366
chains with identical sequence B
ec nomenclature ec 1.1.1.120: Galactose 1-dehydrogenase (NADP(+)).
pdb deposition date 2006-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
A PF16912 Glu_dehyd_C Glucose dehydrogenase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2cdaA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2cdaA01
5KKAA 3ON5A 4JJGA 3RC7A 1YL5A 5JCXA 2FPIA 5U4QA 3SLKA 3FN4A 5GY7A 5FWNA 3F4LA 4M87A 3JTMA 3OIFA 3QY9A 1MUUA 1WMAA 2PKQP 4E5NA 3GNSA 1LDEA 3WNQA 4WE3A 2G0TA 3KLMX 2JFHA 1FDWA 3PJGA 4UUMA 4Z9XA 4UEJA 1E3JA 1HETA 4KWIA 1VPDA 2JKVA 4DBVO 1JKIA 2QG4A 3LT2A 3F5QA 3L9WA 4DLLA 3I23A 1EZ4A 9LDBA 2RCYA 3V1TC 5ITWA 3PRJA 5BSEA 3GC6A 1B3RA 2BLLA 4JLWA 2E48A 2WE8A 3WDSA 5I7SA 1SOVA 2V6GA 3OJEA 3AW9A 4RVFA 3GZNB 2DPHA 1N1GA 1A5ZA 1P1HA 2R00C 2RHRA 5DCUA 2B4RO 2Y99A 4ALMA 4CMEA 2YV2A 4MKRA 4JNKA 3I1JA 1E3WA 2TMGA 1DBVO 4GGOA 3GVXA 4KZPA 6ADHA 3HN2A 4ZQGA 7ADHA 4QECA 4B7CA 3F9IA 2IDZA 3LT0A 1YH3A 1ISIA 2ZIZA 3AM4A 3I3OA 4ALNA 2O3JA 3F1LA 4OGWA 2Y1GA 1E1MA 2YV3A 3SC6A 4CQLB 3GDFA 4MP3A 1OAAA 3MJ4A 1BG6A 5AVOA 4JXKA 3T4XA 1I2CA 4NFSA 5U9CA 1G1AA 3AFMA 4KQXA 4PLGA 4TKMA 2B5WA 4E5MA 3DBVO 1LQTA 1QYDA 3GNQA 4JN6B 1XGKA 1YDEA 1I3KA 1L7DA 1N1EA 1RYDA 1J0XO 1U3VA 1XQ6A 2W2KB 5I8ZA 5H83A 1K5HA 2SCUA 1DLIA 2XXJA 4RV9A 1YJQA 3DDNA 1DB3A 1GCOA 4HWKA 1IHXA 3QWBA 1K3TA 3T7EA 4L4RA 3UW3A 3CXRA 4R5MA 2UUOA 2ZTUA 1RKXA 3MOGA 1MFZA 3V5NA 1HYGA 3IJRA 3ETGA 1E6WA 4ZQBA 2EP7A 3H9EO 3K2BA 4HNHA 2VT3A 3LK7A 1FDSA 1XIVA 4CMAA 1QLHA 4O63O 3RKUA 1DIBA 3G1TA 4F45A 1ONPA 5B4TA 4FC6A 4BNHA 3DZJA 1AE1A 3K31A 5LCXA 3MWDB 1OC2A 4J4BA 4NJMA 1PJTA 1GTMA 2C2XA 3GRKA 2RHCA 2P68A 3H2ZA 4N5NA 4II3A 4AJEA 4F6LA 5BR7A 2O4CA 4HFMA 1C0PA 4R54A 1H6BA 3SC4A 1BSVA 1JLLA 2GPTA 3WX0A 4DPKA 2NVBA 3RUEA 1R16A 3JD2A 2H1SA 2AQIA 3G49A 3BHIA 4J16A 2EP5A 3DO5A 4RO0A 1E6UA 1PEDA 5L9AA 1PJ2A 3I6QA 2O2SA 5CDGA 4O5OA 4M1QA 4UAGA 1ISMA 3K9QO 3RD5A 4RL6A 1BHSA 1QP8A 2HKIA 1UP7A 1P3DA 1B26A 1R15A 4CMIB 2PZLA 1YS4A 2QQ5A 1CERA 1X0VA 4M49A 4CM4B 1NX6A 3LC7O 4R3NA 4W99A 2PV7A 4II2A 4K9DA 4NNJA 1ZSYA 4DMMA 3TZHA 1BXGA 5JS6A 1MB4A 3C7AA 4FJ1A 4L8VA 1J6UA 2LDBA 2NNLD 4D3FA 1LXCA 4KUHA 4DRYA 2C20A 3NDJA 1VE9A 2GGSA 4LCJA 5CDSA 4U6SA 1NQ5A 4A2CA 3R1IA 3DMTC 1DPGA 2P5YA 4YCAA 1U8FO 2NVUB 2V7PA 3PLNA 2EKPA 4PZCA 1HDGO 3R0IA 3D3EA 4DREA 4PN3A 3DQPA 4PIVA 4DBZA 3ZN2A 3L0DA 4AJLA 3U3XA 1ORRA 1LRLA 1ZZEA 3H2SA 3E9NA 4RPGA 4I9NA 4XRRA 2YUTA 3W1VA 3NTOA 3F46A 2W2LD 3AUTA 2PD3A 2I76A 5KVSA 3FNEA 5KOIA 4RORA 4M86A 3T7CA 3O4RA 1HYEA 4BKUA 3H7AA 3KSZO 3FF4A 1EFKA 5EIOA 3RBVA 3BMNB 1ULSA 3DAGA 3JQ9C 3NT4A 1CQIA 4QFDA 1B2LA 5IDWA 4MVJG 3FR7A 3JQ6A 3KLPX 1ENPA 1PGOA 4LW8A 1AHHA 2GR9A 2J3HA 4GI2A 4JGBA 4OQZA 3RUCA 3D4OA 5ILGA 4GGPA 2FR8A 1O95A 4QO8A 5JDIC 2VHYA 2Q45A 3GDGA 3GMSA 2Y0CA 1NPYA 2IODA 4G5HA 4RDIA 2P9CA 2A92A 4L74A 4BMSA 2HRZA 1VRWA 4GWGA 1BXZA 2QHXA 2GN6A 2VUUA 1PQPA 1GADO 1T24A 2GZ3A 1UZNA 3PDJA 1N92A 2BKAA 4OQYA 2D3TA 4WLFA 5JAQA 5CPFA 1GUFA 1IPEA 2FSSA 5IZCA 2G5CA 1MXHA 4A73A 4CL3A 2WEKA 5B12A 4K1LA 3X2EA 1C0IA 1ZMOA 3VH4A 4CR7A 4DPMA 3DFZA 4ND2A 1KS9A 3OQ1A 4M8SA 4GBJA 4PLPA 4P4GA 5JY1A 2DM6A 5ES3A 4XYLA 3HFSA 4Z6KA 5KJEA 5T8KA 5JCJD 4RF2A 3H5RA 3L6OO 4PG7A 3DBRA 1YGYA 1K6JA 1AGNA 1NFRA 3TZ6A 1PL6A 1H6DA 3JQFC 1PGPA 4DC0A 5CFZA 6LDHA 3HHPA 4B3JA 4R69A 1FDUA 4K6CA 4LRTB 4PVCA 3BTSA 4R9SA 5T6BA 2X6TA 1WAMA 3G0OA 1S7CA 4U6QA 1C1DA 5FEUA 4XQGA 3ZZNA 1H94A 1DFIA 3IUSA 5KVCA 2B4QA 3INRA 4FFNA 5I7FA 2O50A 3AY7A 3SX2A 3ADPA 4WOKA 4FD3A 3WIEA 2OZPA 3Q0EA 2GZ1A 1ID1A 1ULUA 1RM5A 2XF8A 4TZTA 3ROMA 2NTNA 5IXYA 1GZ6A 4LVUA 4F6CA 3QP9A 2Y1CA 4KTVE 4E2XA 5EESA 5IAAA 1W0CA 3RUHA 4RVSA 5I7EA 3CKYA 1AHIA 5THKA 1DC6A 3AI3A 5EERA 2GO1A 3RI3A 5TT1A 2NUAA 3BZUA 5L4SA 1NPTO 3I9NA 1X1EA 2X58A 4IDBA 4JROA 4CLDA 2JHGA 1KERA 2GYYA 5KJCA 4YPOA 4J9VA 1F06A 1UP6A 2FHSA 2XAAA 2PR2A 4R9RA 4FQ8A 1WZEA 3PHHA 2JCXA 2OBNA 3Q3CA 4L73A 4URFA 2D5AA 4IQGA 1RYEA 3EHEA 2C7GA 3RUIA 3VDRA 3CTMA 3W4IA 3WICA 4BO6A 2EW8A 4GKBA 2IEDA 3GUCA 4RDHA 1YQGA 3ZV5A 1KETA 3PJFA 1JQBA 5A9SB 3H6KA 3Q2KA 3ZH2A 3TSCA 1HLDA 3W8DA 3ONFA 4RVDA 1Q0LA 1X7GA 2X5JO 2QW8A 3DZHA 3HDYA 3IQDB 2AEFA 3IIEA 3DC2A 3PHIA 3B1FA 4QSMA 3RIHA 2ZJ0A 3C85A 5BNIA 3NEPX 4JP2A 4NZ9A 5DN9A 4ALLA 4C7KA 1ZK2A 2CUKA 3AWDA 1GZ3A 1SO8A 3HNPA 4EEXA 1HRDA 1IYZA 4MIEA 5IF3A 5L51A 3U4DA 2E4AA 1R4MB 4HNGA 1PQWA 1HDZA 5I8WA 4BB5A 4IMRA 2Y1EA 5DOZA 4XEHA 4HFNA 2PH5A 3FI9A 4FFPA 3KB6A 5G2OA 4BNYA 4OHUA 2UVDA 2DVMA 2DBVO 2VUSA 4CLEA 3WGOA 5DBFA 4DGSA 5DULA 4DWVA 4XB2A 4IQ0A 4NK4A 4NU6A 4CMBA 3BMQA 4U8GA 1DEHA 3RC2A 2ZTVA 3I9KA 4MJLA 2A4KA 4BNFA 2W90A 3F4BA 4NMHA 2UUPA 4B7UA 4CMGA 4E21A 3GOHA 4F3YA 1GEEA 1PL8A 4ZA2A 3HDJA 3IP3A 4NIMA 2BFAA 2P4QA 1IUKA 4J0FA 2C59A 4J43A 4YJGB 4IJKA 1GYRA 1GZ4A 2NVWA 3CSDA 3JQ7A 4EJ0A 4PFJA 5JDCC 4B4UA 4YT5A 4E5PA 1HE3A 3RCBA 3D3WB 4DYDA 1MXFA 1XSEA 2FPPA 1KEPA 1GQ2A 2YYYA 5C37A 1UZMA 1E3EA 2IRWA 2OP0A 4L9RA 1XQ1A 4GX2A 3TRIA 2O3QA 1KVUA 2X0NA 4Q3NA 1TA4A 2VNAA 3AOEC 1C3VA 3ZWPA 2X5KO 4CMEC 4HADA 3ROPA 3FNFA 2B36A 2VHXA 3KVOA 3WFJA 1A9YA 1DC3A 3IP1A 1YOVB 4PLFA 3OP4A 2H6EA 1RWBA 5BNFA 4AJ2A 3GA0A 3V2UA 4IDFA 1P45A 3DTYA 3PGXA 4G65A 1GR0A 4YWJA 3QW2A 4BO0A 1H2BA 2J6IA 2PK3A 5TT0A 3NT2A 4UUNA 3AI2A 5IJZA 2O48X 2ZYGA 5AYVA 5CDYA 4Z0TA 1U3TA 4CLOB 4AJNA 4BO1A 2ZB4A 3DOOA 5HRUA 1EUCA 2JJYA 3CEAA 2EXXA 1NYTA 3NV9A 1PZFA 3VZSA 2VCYA 4GQAA 2NQTA 1I0ZA 3BMOA 1R6DA 4UVDA 3VOSA 4BVAA 4MVJF 1HE2A 2X9GA 4R1UA 5EJ2A 4XJSA 4K28A 4XCVA 1GCUA 1U7HA 4CQLA 3AOEA 1QV6A 1T4DA 1GQYA 4GLLA 5K9ZA 4W7HA 1VL6A 5MDHA 1M67A 5KVQA 1Y9EA 1HT0A 1EBFA 3C1TA 3AU9A 1UXJA 3MZ0A 1MC5A 3VC7A 1QORA 4BKPA 4AJPA 1ZEMA 1IL0A 1Q1NA 3QWIA 3JCZA 4BQRA 2QRJA 1U9JA 2GASA 4HXYA 2UAGA 3H8VA 4J6FA 4MVJD 5A02A 3GDOA 5C7IO 4FW8A 4TWRA 1MA0A 1Z82A 1H2HA 1X14A 3MJVA 4G2NA 4TROA 4CQMB 2ZTMA 2CSUA 1KIFA 3VH3A 1W73A 3WR5A 4JP3A 2Q2QA 1A9ZA 3RWBA 2PNFA 3ZU2A 5LDHA 1SEPA 1PR9A 1EQUA 2Q3EA 4IGEA 5K1SA 3WBFA 2PZMA 2I5PO 4KOAA 1G6KA 2BF7A 4EJ6A 2ET6A 5KJ1A 2C54A 4PZEA 4D45A 4GMGA 4PRKA 3RSHA 2WD7B 3U5TA 4YRBA 3A4VA 4XIJA 3QSGA 4IDEA 3GT0A 4JCOA 1LBEA 1P1IA 3L07A 4D3DA 4CV2A 4IJUA 3QVOA 3H3JA 2HO5A 2HSDA 3UAGA 5DCYA 3FCOA 4WK6A 4P22A 2OL4A 1BDMA 4L76A 1HF3A 4GSLA 2VZ8A 2ZCVA 3AUAA 4N54A 1SB9A 1LSJA 1E6EA 4JX8A 5AXCA 1IY8A 4XDYA 4L4XA 2X5OA 1ENOA 2YQ4A 3VZPA 2CF5A 1SBYA 2AG5A 1BVRA 3JQ8A 4YAJA 1NFFA 3FPCA 3VPFA 4ND5A 1RJWA 2Q99A 2O3RA 2CVOA 2Y67A 4NI5A 3VPHA 4RQUA 3A9WA 3ZWWA 3P19A 5TSDA 3ASUA 3ANMA 2PZJA 2PD4A 4W9NC 5JDCA 2AE2A 1I01A 3H65A 2DFDA 4EUHA 3K73O 1PZEA 4MVJM 1NVTA 4PG6A 1Z7EA 1ZCJA 4J7UA 4NFYA 1B3BA 1W6UA 2C7VA 4YJFB 3U4IA 1PGQA 4BKRA 3EMKA 3W4KA 4I5EA 3OEYA 4L0QA 3HZZA 1ZK4A 1PS9A 4CLRB 4HY3A 3E1KA 2B83A 5ER6A 3ZHYA 5JO0A 1MP0A 1UAYA 4TSKA 4OMUA 3UUWA 3W8EA 1HE5A 1T2EA 1I5RA 1Z73A 2F1KA 1PGJA 2O7SA 4CQMD 4GMFA 3V2GA 4UVHA 1SC6A 1KC1A 1B8VA 3BTUA 3C24A 3IMFA 3JD4A 3VPGA 5JC8A 3MJCA 4OJNA 4BKQA 4MIYA 3LLSA 4W9NA 1ADBA 2DT5A 3JQAA 4PLCA 1T2CA 4KWHA 3RBXA 4J90A 3BHJA 4R1TA 4AJIA 1LLDA 4IS2A 4A03A 3LZ6A 1NHWA 3CH6A 3FTPA 5KNLA 2HRBA 3WNVA 2Q50A 2I99A 3RU7A 1TEHA 2B5VA 1IZ9A 5JNLA 3AUSA 5G4KA 4G81A 2AA3A 2YV1A 4WCFC 1LSOA 1ZO8A 2Y66A 1U7TA 1ZSNA 1EDOA 1XLTA 4RPLA 4N7RA 4RGBA 2AQKA 1VSVA 4IPTA 4YQZA 1Q0HA 3GGOA 4OIMA 2VTDA 3OFSA 3ZW9A 4UEOA 3ZCXA 4J7XA 2BELA 5T5QA 3E5MA 3QVWA 4HV4A 1QSGA 2Q1SA 4ID9A 1YQDA 1FMCA 4BS9A 1RM0A 1H6CA 3DXFA 4Z3DA 1LDGA 4Y6SA 2EF1A 3HB4X 2YW9A 1NXQA 4A7PA 1ML3A 1EE2A 1WP4A 4B4VA 3AY6A 1HDXA 2GDZA 2JL1A 4AJ4A 4P8RA 4BV8A 3O38A 4Z0PA 4CMKA 4Y8VA 1DOHA 1OZAA 3F3SA 3FTNA 2FY8A 3MCVA 3PYLA 5K6AC 5DT9A 4XZ3A 2PH3A 5BSHA 4WJZA 1UXHA 4IIUA 1FK8A 1EMDA 3BYZA 4FFRA 3E8XA 2LDXA 3RUDA 4ZD6A 3WYBA 3NGXA 1HDOA 2HQ1A 3OJ0A 3GPIA 4BQPA 1VSUA 5T64A 3M6IA 4RJTA 4GPD1 4K26A 3GUYA 3KBOA 4KP7A 4E5YA 4EI2A 4UUPA 3KRTA 5CEJA 2OGUA 2VOJA 1NWCA 5HM8A 1E3IA 5L4LA 2EJVA 4E0BA 1U2GA 1YO6A 1A7KA 1GV1A 3FR8A 4R68A 4JQCA 4BOYA 4YR9A 1Q0QA 1MLDA 4AJOA 4D3SA 1HXHA 3KXDA 4YJHB 3GY0A 3P2OA 1P1KA 4I5FA 3CMMA 2O3TA 1GUYA 3ZU3A 5EMHA 3ZWXA 4OKIA 5G0VA 3MTJA 1EK6A 3O8QB 3UOGA 1BXGB 4TQGA 4R01A 1GU7A 1SZJG 3WG9A 3WJAA 3Q9UA 1SCUA 4I08A 5A3JA 1Y8QA 1RM4A 1CYDA 4J0EA 4L4SA 5IDXA 2JD2A 2DTEA 4AJKA 2RAFA 1KBZA 3DEYX 4WNIA 2V65A 2TMDA 4BNMA 1PU2A 3E03A 2UYYA 2Z95A 1PSDA 2HK9A 4XD2A 1DSSG 1WZIA 4Z3KA 2J3IA 2OHXA 1NR1A 4ESOA 3R3SA 4PRLA 2ZJ1A 1HE4A 4UVEA 4ROSA 1DFGA 1LLCA 3PQDA 2JFGA 4ZQHA 3DBHB 1BDBA 1VL8A 2C5EA 3VVCA 1U2DA 4KDEA 4B4WA 4GSKA 4D44A 4M54A 4R1NA 3TFOA 1XU7A 2EKLA 3ZWVA 4I5DA 1LDBA 1DC4A 5MGBA 3PGJA 3ANLA 5IG2A 2VWPA 3S8MA 3WLEA 1HDRA 2J3JA 4RPJA 3I4FA 4Q3AA 4XR9A 2VHVA 2DQ4A 1DAOA 1P1FA 1J5PA 3OIDA 4CM5A 4D79A 5A9SA 4CUZA 2VYVD 3ZGYA 4EITA 3ETDA 5JFOA 2DUUA 2R2GA 3TF5A 1D3AA 1FF9A 2VWQA 3JSAA 1EFLA 3AJRA 1P74A 4EBFA 2WE7A 3CE6A 3ZWMA 4OL9A 2NU7A 3CINA 1JU9A 2UDPA 2YHUA 1A27A 1JAXA 4ZGWA 1H6AA 1PGNA 1ZMTA 2I3AA 5EPOA 1T2FA 5TQVA 3RC9A 2IE0A 1E77A 4GKVA 1R4MA 3JYNA 1F14A 2IYOA 1H5QA 1LDNA 2PWZA 3U0BA 4E2ZA 2PGLA 1YBMA 3ZV3A 2VRCD 4Z0HO 3JD3A 3ANNA 1Y8RB 1SPXA 4X54A 3A28A 3KHUA 1PL7A 2QYSA 3GAFA 1ZSVA 1P77A 1PX0A 5CP8A 2BMAA 1UXIA 4CMCA 4LMPA 3UHAA 2OOSA 4EUEA 4UEKA 3F47A 3JD0A 1ZIDA 1A7AA 3TQHA 4E13A 5A4DA 2Y93A 1BWSA 5DP2A 4R1SA 1EBUA 4UULA 2JAHA 1C1DB 2D0IA 3JQCA 2ZQYA 3EK2A 1E1LA 1V6AA 4E2WA 4XYGA 2VZ9A 1HDYA 1P1JA 3DHYA 3VTFA 4IY1A 1X0XA 1A72A 1NFQA 2NADA 1X7HA 4BNKA 4DL9A 1SMKA 2VYND 3BHMA 4O6VA 1ONNA 4CM9A 1GV0A 1JN0A 1WXDA 1UXGA 1WWKA 4CM1A 2FP4A 2X7HA 3LYLA 5HWSA 3RUAA 5C7OO 4U7WA 4PLWA 4TVBA 5L95A 1K6IA 2ZYAA 3BTVA 3ENKA 4HFRA 1Y7TA 4NBUA 5KTKA 2CMDA 3QVXA 3ZWNA 3OECA 2GUGA 2HMUA 4WNCA 4N5MA 1YVEI 4DTIA 5IN4A 2C07A 5TIIA 4DQUA 1BXKA 2WDZA 4NU5A 4PG8A 3ZNQA 2QRLA 3A1NA 4QXMA 2V6FA 4HUJA 1I10A 2X0IA 3JYPA 3F1KA 1W4ZA 5JBIA 3I4CA 3TZKA 1C1XA 4BIIA 1UXKA 2Q46A 5EL0A 3AI1A 5F21A 2VQ3A 5G0SA 4DQVA 3OQ6A 1E5QA 1KY4A 2P4HX 4IBOA 3ZHZA 4TRNA 1V0JA 1R0SA 1C0LA 3OA0A 3ETEA 1E1KA 3G79A 3O26A 4WLUA 3WXBA 3BMQB 4NG5A 3GNTA 4YEDA 3MJEA 2Z5LA 5B4VA 5CG2A 2I3GA 3RQSA 4W82A 4AL4A 5CDUA 3V8BA 4UREA 2B4TO 3VKUA 4Q3DA 2Y1FA 3G17A 2XXBA 2Z1NA 5BNTA 2W4QA 5EQFA 1Z74A 5JW6A 4JBGA 2E82A 1JVSA 3WMXA 1V9LA 1NR7A 3EYWA 5K0ZA 1EVYA 2RH8A 1TLTA 2AMFA 2VRCA 2WWRA 4BNXA 1WMBA 3VH1A 4YJGA 1LU9A 2VHWA 4S3MA 4WCFB 3NKLA 4DIOA 1O9BA 2ZB7A 3PQEA 3NUGA 1V8BA 3EY4A 3WTBA 1PR3A 3I52A 2VNSA 1P33A 1DIHA 2PTGA 3WQSB 3NRCA 3LLVA 5A9RA 2FZEA 1PJCA 3GH3A 4OM8A 1DO8A 4ZVVA 2CDAA 4XGKA 3RJ9A 3H9QA 4C4OA 4YT8A 2Q2VA 4CM8B 3Q6IA 4DA9A 4N18A 3CPSA 5DP1A 2NQ8A 3IOYA 3PTZA 1O89A 1XELA 4Q3EA 4HBGA 1XU9A 4BGEA 2PY6A 3I83A 3WSVA 1P1RA 1OC4A 3O9ZA 4ND4A 3V2HA 5K6AA 1T2AA 3OJLA 4B7XA 4CR8A 4LCEA 4J1NA 2JAPA 3NDIA 2NU8A 2IXBA 3JQ7B 3STHA 4BMVA 2OORA 3PYXA 1E0DA 2PGDA 2WYWA 1DXYA 3K2EA 3AM3A 3NYWA 1JVBA 1TXGA 4OO3A 2IZ0A 3PK0A 5ILOA 1HZZA 2HMSA 2VYNA 4Q9NA 4XX0A 2V6BA 3TOXA 4JK3A 3PDUA 3D4PA 2X22A 5TF4A 4WOJA 1Z75A 2QZ9A 5EQDA 5IDYA 3I9MA 4E6PA 2HMTA 2VN8A 3ZDFA 1ISGA 1U3UA 5CHEA 4KMSA 4YYZA 2D4AA 3LDHA 3GN2A 1MGOA 2CDCA 2FSVA 3LC1O 1UJMA 4FOSA 2OXIA 3VAZA 3NX4A 1EUZA 1E7YA 4MVJH 2J3KA 4YJDA 4F46A 1DHTA 4ALIA 4IQ8A 3D64A 3K92A 1D1TA 3QVTA 4Y9DA 3AFNA 4CJXA 1TT5A 4YAEA 4MIOA 4BL5A 1LDYA 1W8DA 3QLJA 1D4FA 3ZNPA 1AUPA 3UKOA 3TNLA 1X15A 3EVNA 5DF1A 4OKNA 4BNGA 1K89A 2FN7A 2NACA 3WQQA 3U09A 3EC7A 3ADOA 1LLQA 4Y98A 3ZU5A 1DDOA 2RH4A 5FYDA 1NQTA 3AOGA 5H82A 4MKXA 1XHLA 4BMNA 4CV0A 4LVCA 4RF4A 1M6HA 5ITVA 2HK7A 4GWKA 8LDHA 1UR5A 4PZDA 4Q3BA 5FFFA 4NFHA 4Y67A 3UGKA 5ICSA 5AOVA 1ADGA 1NM5A 3HB5X 1N9GA 5T8KC 1S6YA 4OXYA 1B15A 1CIVA 1UAGA 2HMVA 3DBLB 1K2WA 4AFNA 5IXSA 3D3WA 1NNUA 3S2GA 3NDRA 1E7WA 1FDVA 1ISHA 5GMOA 4BO4A 2Q1UA 3UXYA 4RF5A 1ZXBA 3MWEB 3K30A 4FJ2A 4PGFA 1LDMA 4MVJP 1GL3A 2XPCA 4YRDA 3C8MA 4ZRNA 3D5QA 4XQEA 4XYMA 2H9IA 3KSUA 1R0LA 1BW9B 1RM3A 3GHHA 3GZ4A 1YJ8A 3GK3A 1O0SA 5F5LA 1QG6A 5BSGA 4IMPA 4ZJUA 4BNUA 1GDHA 4FBGA 1HZJA 2NSDA 4YBZA 3H4VA 4WLNA 1E7SA 2O23A 4H3VA 2NV6A 2X8LA 4NDNE 2J5KA 3DMTA 2C5AA 4BO2A 4I9UA 3ZV6A 1F12A 1U1IA 3PEFA 2E37A 5IDQA 1I33A 4TVOA 1H0KA 3H5AA 4R3WA 3PPIA 3QHAA 4WASA 3H9GA 2G1UA 4RF3A 1UDCA 5G4LA 3DBLA 4GVXA 3WLFA 2HJSA 3CUKA 3GHYA 1GEGA 3LC2O 4DQXA 3FWZA 2DKNA 4J1QA 2YZ7A 3GVCA 2DLDA 3OBBA 4ITUA 3HQ4O 4AJHA 4CM6A 3LT1A 1GQQA 2GF2A 2C2YA 1Y1PA 4NBTA 4CV3A 3GF4A 4D41A 3QJ5A 3S2EA 4B8ZA 2DUWA 3LVFO 4QO7A 1NPDA 5J23A 3LSYA 4GX1A 3QWFA 1CDOA 3C1AA 3FBGA 3GVIA 4Q3CA 4AVYA 3NAQA 5KWEA 2VT2A 4B8WA 2CVZA 5G0TA 5A05A 4LISA 3PJEA 3VPXA 1T25A 1PQUA 4IJWA 1U8XX 3DZGA 3DL2A 3PWKA 5ADHA 3RU9A 3WS7A 4W7IA 4NK5A 5JYDA 3RROA 4Z9YA 1Y8QB 3SLGA 1Y5MA 3WSWA 1ZVMA 1OBFO 3EGOA 4J4TA 4CM4A 5G0WA 2CZCA 2WYVA 3N7UA 3WBBA 4OH1A 5EINA 3VKVA 2DFVA 5I9MA 2GNAA 5A5FA 1M2WA 4JJFA 5JCJA 1E7MA 3JV7A 3GMDA 3VDQA 3RKRA 3ZNOA 2Q4BA 3FRJA 5L45A 3PIDA 3CZMA 1P0FA 2UV8A 4JBHA 5L7YA 2ZK7A 1Q2XA 1C0KA 3LQFA 3DWFA 4LGVA 1GYQA 2GRAA 3BIOA 1WVGA 3L6DA 2XOXA 1I3LA 2NU6A 4OSOA 1GFSA 4W4TA 3ROQA 4U5QA 1TVEA 3CIFA 1PJ4A 3K5PA 1QYCA 1R4NA 2WTBA 2WM3A 3KYCA 4FB5A 3SJUA 4NBRA 4DIBA 1KEWA 3WGQA 2YJZA 2AQ8A 4LN1A 4WLEA 2EJWA 1T1RA 3I9LA 3QWHA 4J1SA 2C82A 3CMCO 4ND3A 3M1LA 3E6AA 1Y81A 4NJMB 1T1SA 4CM3A 5IZCC 3BTOA 1GYPA 3KZVA 4DC1A 3GVPA 2GZ2A 3WMWA 3WWYA 4BNZA 2GCGA 4ILKA 3Q2IA 2ZTLA 4IDAA 4WCDA 2BGMA 3E9MA 1E7QA 1HTBA 3H5NA 3O8QA 3S2FA 4BO5A 4CUJA 1I36A 4EUFA 5L4NA 1KYQA 2DC1A 3PHGA 3WGTA 2BI7A 2EGGA 3NGLA 2VHZA 4P38A 3NJ8A 4W6ZA 4CMJA 2Q4EA 4FGWA 4RQTA 4ZICA 2P9GA 1C14A 4MVJA 3PQFA 3TPCA 2GN8A 5COAA 1LNQA 4LMRA 4CM9D 2HDHA 4H16A 5BSFA 3Q11A 4TRRA 1Y6JA 2EG9A 2ZATA 3PXXA 4YQYA 5THQA 4S1VA 2Y0DA 3VTZA 3GG9A 4E30A 3EAGA 1E3SA 1J49A 3HFGA 4RLHA 5TJ9A 4BNVA 1LLUA 4RVHA 1KVRA 3G1UA 1DJQA 2DBQA 4LSWA 4KTTE 5TGDA 1O94A 4RPHA 5C3MA 3GFGA 3C7DB 1Q7CA 5ENDA 1AXEA 1L7EA 5F1PA 3E48A 2G17A 2X1HA 3GQVA 4IDDA 3GEMA 1YBAA 1ZJZA 1DRUA 2CDBA 3WGYA 2YFQA 3VZQA 2HJRA 3D7LA 1I2ZA 3DBRB 4AJJA 1H9BA 1JKFA 1WPQA 4JBIA 5G4KB 3L4BA 4NPCA 1HKUA 1R0KA 3GG2A 1GUZA 2W98A 3IC5A 5A5EA 3PYMA 3GFBA 2HLPA 4E31A 4XQCA 3ZWCA 2PD6A 1TB4A 2OMEA 3TZCA 4WECA 1F8FA 2O3SA 3VH2A 3GPDG 1EVIA 5A3VA 5AQ1A 2VTEA 4FN4A 5JMWA 3UCEA 1EUDA 1Z6ZA 4J9UE 2WSBA 1DAPA 3WQRA 2VWGA 4H15A 3N58A 2EERA 2Y1DA 5GZ3A 3S55A 1CETA 4XGNA 1SEVA 2VYVA 3HJAA 2I67A 4YDRA 1FDTA 3KEQA 3OHSX 5IFLA 2YDYA 2NVUA 4WKGA 4J7CA 3WGHA 5COQA 4M55A 3JQFA 3HG7A 1GPDG 4OYRA 2JD0A 2I65A 3FD8A 5TRTA 4D46A 1KEUA 2IZZA 2VOEA 3EUWA 1ZH8A 4FFLA 4E5KA 5B37A 4Q39A 3V1YA 5JAMA 1E7RA 3G3EA 3RFVA 4NR0A 1QYXA 1OI7A 4RVUA 3MEQA 1EE9A 2JCYA 3ORFA 5GZ1A 3WYCA 4BO8A 1VKNA 3GN1A 3GGPA 3P7MA 3SBOA 4IZIA 2BFMA 4IDCA 9LDTA 2GD1O 2V6MA 1KC3A 4DVJA 3W8FA 4RCVA 4MDHA 3BXXA 4IXWA 5I7VA 4QQRA 1E92A 4FGSA 5KJ6A 3ROKA 3JYQA 4DLBA 3AUUA 1HDCA 3OSUA 5DDIP 2FMUA 1QYVA 4MO2A 1KVSA 4IM7A 1ZNQO 3ENNA 3JQDA 3BAZA 1EVZA 1GY8A 2CVQA 4E12A 4YT2A 4XDZA 5BT9A 5F5NA 1U5CA 1KVTA 4J3FA 3SEFA 3JQEA 3MJTA 3QA9A 5ICMA 1JAYA 2I9PA 3DZBA 3L77A 5KVVA 1TT7A 3DHNA 3B70A 3ULKA 1H93A 1LRJA 1NBOA 3C7CB 4YACA 1QR6A 1LJ8A 4BGUA 3B1KA 1PS0A 2BD0A 4DPLA 4MP6A 4EGFA 2Q2WA 1LI4A 4FOOA 1MFPA 3OQBA 5JC1A 2O2YA 1JWAB 2IXAA 1YBVA 1BVUA 1PJBA 1BGVA 3INGA 4FCCA 1YE3A 1B14A 3S2IA 3GRPA 5TC4A 4XIYA 5A9TA 3WYEA 4R41A 1YB5A 1I8TA 4J49A 5EN4A 4BGVA 3IUPA 1M6WA 5I9NA 3C1OA 3ZHBA 1BMDA 2ILTA 2GN4A 3U9LA 4YB8A 3DOCA 1HSOA 2E6UX 1B0AA 2JHFA 2YHIA 3PWZA 1R37A 3PI7A 1EEHA 3FNGA 5F1OA 4ZU3A 3QIVA 3ONDA 3QQPA 4EW6A 3DMYA 3MJSA 1WW8A 1X13A 3H9UA 1OMOA 2O4UX 1DJNA 1YRLA 3RFTA 4PLYA 5CPBA 2F00A 5AXBA 4DYVA 5JSFA 5F1KA 2E49A 3VZRA 1LUAA 2OP1A 4XRGA 1FXSA 2YQ5A 4BKOA 5L7WA 3P2YA 1I3MA 2CD9A 3UCXA 2HUNA 3EDMA 3OICA 2O7QA 3ZV4A 4TKLA 1B7GO 3PFWO 1ZEJA 1UZLA 1Z7BA 2A35A 3DZFA 1Y8RA 3WB9A 4TZKA 3HADA 3TL2A 1I2BA 3B1JA 2X4GA 1LX6A 4GLOA 2X23A 5JO9A 3UFXA 4IJVA 3HDHA 4MPDA 1LSUA 1UDBA 5CG1A 3OH8A 4QX6A 5KKCA 2BFPA 3R6DA 3NTQA 4O1MA 4XYBA 3RUFA 5HS6A 4CM8A 3HE3A 4TMFA 4MP8A 5HA5A 1OOEA 1QLJA 4J91A 5A06A 2PKQO 1SNYA 1T26A 1ADFA 4PLVA 4ZQEA 2X0RA 4FFMA 4LK3A 3VPSA 4J1TA 2X9VA 3GEGA 1ZJYA 4JIGA 4E2YA 2D5CA 1DIAA 1VJ0A 2EW2A 3KOUA 4WEOA 3GGGA 3DZKA 1G0OA 2P91A 4EDFA 2WD8A 4CLOA 1U4SA 3ICCA 1IZ0A 1CEQA 1WNTA 3L4BC 3N74A 3C3XA 3IAHA 1JW9B 4O59O 3HSKA 5LC1A 4D42A 3PIIA 3UICA 5ER9A 5CAEA 1NVGA 1B8UA 1B8PA 2W8ZA 3H9JA 3RASA 4A27A 1Y9AA 2CFCA 3R3JA 1KOLA 4CLHA 3JQGB 5JDIA 1MX3A 1O6ZA 4XJTA 3UVEA 3ZWYA 3I6IA 1UH5A 3JQ8B 1PZHA 3F6YA 3H3FA 1XG5A 4M89A 4TRJA 2BFOA 2NTJA 3L6EA 3KM0A 4KDFA 2B37A 4L75A 2EV9A 3SJ7A 4EEZA 1T4BA 2X9NA 3DZIA 4MVJI 3ZW8A 1D8AA 1DFHA 1PWZA 4IZHA 1JTVA 4CUKA 1PJLA 3NT5A 4OAQA 1Q7GA 1XR3A 1YDWA 2P5UA 1NAHA 3BMCB 4GH5A 4RPKA 4D43A 1G0NA 1Y5RA 5FI3A 5ENVA 3HN7A 3LU1A 1ENYA 4CQMA 3IDSA 3JQBC 1KVQA 2NTVA 4MOWA 3ZI0A 5JY6A 1VJ1A 3I5MA 4XR4A 2QIOA 4YA6A 2AXQA 3TWOA 3PVZA 2W2LA 3DONA 1K0UA 2DU8A 1GPJA 4FR5A 1PTJA 3ST7A 4NQZA 1MG0A 2BGLA 4CLXA 4ONEA 2W2KA 2AE1A 3AU8A 4A26A 1HWYA 4R5HA 5COBA 3RJ5A 1UUFA 3M2TA 1YQXA 4UVGA 4RZIA 2OUIA 1ZXLA 5I9LA 5L53A 1JWBB 1IB6A 5JYEA 1I24A 1E3WB 2R6JA 2ZCUA 4E4YA 2YFHA 2A9FA 3JQBA 5G0UA 1H9AA 3X2FA 3ZU4A 5TX7A 3D1LA 2D8AA 3QE3A 3WGIA 3W6ZA 4OXKA 1PJSA 2PLAA 2IYPA 5JAIA 4XYEA 1YXMA 1HEUA 4TRMA 1DIRA 2QZZA 3QV1A 4LRSB 1E1NA 2BI8A 1U4OA 2DBZA 3KYBA 3MOIA 5JE8A 3KSDO 2EGHA 3GAZA 1YOVA 3HUDA 4WLOA 1A4UA 4BV9A 5KCZA 1DLJA 3JD1A 2X86A 5LDGA 5JMPA 2VUTA 4DUPA 4R16A 5L7TA 1NAIA 2AQHA 4PLTA 3FPLA 3PZRA 1UP4A 4E32A 1YKFA 1NWHA 1D1SA 3WIDA 4BB6A 4D0SA 1DHRA 4YVFA 4FPXA 3OF2A 4Z9FA 3AY3A 3GLQA 4BNWA 1KEVA 3BMOB 4CMIA 1I32A 3K6JA 3INTA 4EJMA 1ISFA 4EZBA 3ASVA 4D7AA 3MTGA 1CF2O 5DNAA 1ARZA 3KTDA 3I9OA 3KV3O 3E5RA 3GZNA 4BHTA 2WD7A 4ZQFA 1EDZA 4FC7A 4D0RA 4ZN6A 2BH9A 1N7HA 3EZYA 2BHLA 3WGGA 2D1YA 1I30A 3DTTA 3JQAB 3W6UA 4OOFA 3KEOA 4B79A 2CY0A 3FWNA 1GD1O 4O0LA 3VHRA 1ENZA 3OJFA 2DTDA 2NLOA 1DRWA 3HWRA 3TN7A 5FF9A 1ZBQA 3D5TA 1YL6A 4PG5A 4XB1A 3PJDA 4YAGA 1ISJA 1DC5A 1QRRA 1N2SA 3B6ZA 2GSDA 4E33A 1PWXA 2Q49A 4E3ZA 1LRKA 5CEFA 4CPDA 5IZ4A 2NU9A 2PFGA 4UVIA 1XCBA 3TDKA 1UDAA 2FR1A 1F0YA 1R66A 1RPNA 2Y1OA 5DZSA 3B20A 4BNNA 1CJCA 1VI2A 1YL7A 5AXDA 2RIRA 5F3RA 1KY5A 1EVJA 2B69A 4IUYA 1VLLA 2Y0EA 4BUCA 2FOIA 4LSMA 4ALJA 5BQFA 3PFFA 1AXGA 1CWUA 1N7GA 1N9GB 3RBZA 3OIGA 3M2PA 3OJOA 1DRVA 2DAPA 2HMWA 4YXFA 2WMDA 4U0JA 4WUVA 4Y6RA 3UCFA 3KYCB 4ALKA 2ZB3A 1IPFA 2PA3A 4BGIA 3FSRA 3T4EA 4I5GA 4AICA 2HK8A 2P9EA 1XDWA 3NTRA 4FDAA 1B16A 2FPGA 2O3UA 4YJHA 4I9HA 1D7OA 3LF2A 3OA2A 5DOVA 2Q1TA 3ONEA 3RFXA 3IL2A 1F8GA 2EIHA 2OFPA 5CEEA 5C7LO 5KIAA 4JJIA 4NBWA 1T2DA 3BMNA 4CL8A 2C29D 3CZRA 4YJFA 1Q7BA 2DBRA 2J5RA 3TOZA 3DOJA 4YTEA 2EHDA 3JYOA 4YRAA 1IULA 4QUKA 1NVMB 4FIZA 4A5OA 1NTOA 4HKTA 1M75A 2FZWA 4CLRA 5B1YA 4AJ1A 1K6XA 2NM0A 4PLZA 1HSZA 2NWQA 4DLAA 1JKJA 3ICPA 4IGFA 5CDTA 1ZK1A 1ZKMA 3TL3A 3U4HA 4GVLA 3EW7A 2J8ZA 1Z45A 4NHEA 3U49A 3DBHA 1ZFNA 3JQ9A 4HFJA 1R12A 4GAEA 1JDJA 3WFIA 1AN9A 3IJPA 3ZWAA 3GVHA 3UH1A 1E5LA 3E18A 1LA2A 1QYWA 2GERA 5A03A 5GZ6A 4CMHA 4P4LA 1A71A 4BNLA 4CM7A 3EVTA 4QT0A 3FNHA 4RVGA 2I6TA 5T67A 1VKOA 1F17A 5L40A 1C1XB 5DBIA 3VVBA 3BA1A 1DIGA 1VC2A 3M1AA 4QFCA 1WDMA 3DAPA 3QRWA 1EK5A 1P31A 1ZUD1 2A94A 4GX0A 4HX5A 4XGIA 3WGZA 4R51A 5JPIA 1XA0A 5U1PA 3TFQA 3WWZA 1HLPA 2IZ1A 2Q1WA 1N8KA 4B3HA 3V1UA 2PZKA 5IN5A 4PVDA 3Q1LA 5HBRA 3IKTA 4WEQA 3RVDA 3TZQA 5DCWA 3DAFA 4KUGA 3FHLA 5TNXA 2D2IA 1VL0A 3PWSA 4PG4A 2B0JA 1LQUA 2I66A 3KETA 4PLHA 1SOWA 1X1TA 3LT4A 5TLSA 1ADCA 4KQWA 1HYHA 4FSHA 2Y68A 4U0KA 2ZQZA 3ZNNA 7MDHA 2R00A 4IIVA 4KUEA 1MC4A 4XQ9A 5DBGA 2H63A 3QVSA 3DR3A 3WOHA 2CNBA 1O8CA 3F5SA 1R4NB 3S1LA 4AG3A 3U4CA 1A4IA 5JXWA 1P0CA 1XKQA 3HDQA 3IKVA 1QXSA 3RC1A 1JA9A 2AEMA 3QWAA 4CR6A 5HTOA 3UN1A 3ITKA 4QEDA 2IEBA 1VJTA 3RAJA 4CV1A 2X0JA 1BRMA 1U3WA 3A06A 2YHIB 3ZWBA 1LC0A 2AW5A 2ZYDA 4NH4A 1VM6A 4P4NA 2FRDA 1FJHA 2PKRA 2H5LA 3D0OA 2BRUA 4QTZA 3ABIA 1E3LA 3SVTA 2EWMA 1L1FA 1P44A 1ZK0A 2AEJA 2VRBA 1YWGO 4OSPA 2D59A 5TJHA 3A14A 3KO8A 3DHEA 2FR0A 3I9JA 1HL3A 3K8ZA 4EYEA 3P5SA 1V3TA 4ZHSA 1PS8A 1NP3A 3WTCA 4IS3A 4OXNA 4WCFA 4GL4A 1V3VA 2HAEA 4INAA 1IE3A 1O5IA 1EQ2A 5KJFA 4DMLA 2P2SA 4J2HA 3OEWA 2POQX 5HS4A 2RBEA 4NBVA 2JCVA 1NQAO 1CQJA 2J5QA 5A1TA 1MG5A 2JD1A 4BO7A 4I1IA 2ZKLA 4H7PA 3E82A 4OOEA 4K6FA 3O03A 2JFFA 4DIFA 1P9LA 2BGKA 3SXPA 5T57A 1ONOA 3KUXA 1NQOA 3L4SO 1PJ3A 2WJPA 3PP8A 1ZW1A 3ZWOA 4ND1A 4WGGA 1LSSA 1M66A 3GEDA 2GN9A 2OBYA 3JYLA 4J2OA 4FS3A 1LC3A 1X7DA 1TT5B 4FJ0A 2Z1MA 3WJ7A 1ZK3A 3UF0A 3KYDA 2G76A 2EEZA 2B35A 2G82A 2ZB8A 2VWHA 4Y6PA 3OMLA 1SAYA 3D4NA 1N5DA 1IHYA 2AHRA 2HU2A 4BNJA 5B4UA 4GX5A 3ZHXA 1CRWG 1YB1A 4MVJE 3U62A 1V35A 3AM5A 5FI5A 1QKIA 3IS3A 4BNIA 4XWYA 4N5LA 2QX7A 1BTOA 1MV8A 2Y05A 2GLXA 5H81A 5JAZA 4WPGA 4MKZA 1I3NA 4BNTA 1QV7A 2FWMX 3PZBA 5AXAA 8ADHA 3NJ4A 4B4OA 3OETA 4R4JA 1PZGA 2YY7A 4A0SA 4YAIA 3BMCA 1V3UA 1NASA 5A04A 1TI7A 4MINA 5L3ZA 3LF1A 1YB4A 4NJOA 3PHJA 4BO3A 3ITDA 2DPGA 3E9QA 1SB8A 4HP8A 4CODB 3Q9NA 4ZRMA 2QRKA 1LTHR 1IOLA 1J4AA 3COSA 3KYDB 3L9XA 4J4HA 4C7JA 2DTXA 1U5AA 2QYTA 2VZ0A 3JQAD 2OO5A 3TJRA 1WLYA 3AK4A 1PJQA 1WDKA 3DB2A 1PIWA 4PCVA 5C5IA 2C0CA 4BO9A 1XYGA 4YT4A 1NHGA 2WYUA 3PLRA 4A10A 2YDXA 4B3IA 4WLVA 4IINA 1M76A 1WDLA 3W4JA 4UUOA 1YONA 4RZHA 3PHLA 3GR6A 4IXTA 5TS3A 1GAEO 3EZLA 2CF6A 4IDGA 1LEHA 4RLSA 2PGJA 3FBTA 4XA8A 4DXHA 1U28A 1XWFA 4XKJA 5JLAA 1QMGA 3JQGA 3OM9A 4YAKA 2AG8A 3DFUA 2HCTA 4I8XA 1BW9A 2EKQA 3K96A 4FFOA 1OFGA 1XEAA
chains in the Genus database with same CATH superfamily
4TMYA 3TGWA 2WB2A 3JAWB 4XLTA 3WGNA 3KKKA 3NGMA 2AMJA 4DBLE 2QLBA 2H07A 4RK5A 4KQMA 4YLEA 1WV0A 3UAZA 1EP9A 1XEWY 1ZMRA 2ZIFA 2B9EA 3D8SA 3JTMA 4HQFA 2PSSA 4HL6A 1MUUA 1UC4B 2F64A 4KXFB 1LDEA 4Q4JA 1H2ZA 1EB9A 4WE3A 5A6SB 3H0KA 1OT5A 1SQGA 3KLMX 2JFHA 3OOSA 4ZT6A 4ATNA 4QJ3A 4UUMA 4KFSA 3ZGXA 4YO7A 3MF4A 4IEFB 3CVUA 3TOVA 3RB8A 2FW8A 5HHTA 1JKIA 4S0XA 3LT2A 2QLJA 5TQ0B 1XEXB 3DP7A 3C4JA 3L9WA 4DLLA 1GXSB 3WGKA 4LF8B 3V1TC 3IPLA 3GC6A 1B3RA 3GX1A 5BSEA 5JD5A 2BLLA 1CP2A 2WE8A 5HFNA 5SZIA 1JDZA 2Z4SA 5AI5A 2PH1A 2PSHA 3LSTA 1QE0A 2W4IA 3AR5A 4KW7A 1E2FA 2EZ4A 1LS6A 2W83A 3GZNB 5FTKA 1NUAA 3T9FA 3MB5A 4Y2XA 3PQ4A 2R00C 2RHRA 4O2BF 1G4AE 3BE6A 1TZMA 2Y99A 3OHPA 1IUNA 1G60A 1SD5A 4Q7QA 5JNVA 2ZSAA 1VL2A 4F3YA 3UM9A 1E3WA 2B2CA 2TMGA 2CCGA 2ZUSA 3OO0A 4Y1EA 4BLWA 3AMVA 2C5LA 2HBQA 3L7LA 1V1MB 2YRWA 3HN2A 4JDPA 3GRZA 2GBLC 1ECFA 2LE0A 2HXGA 3LWBA 4PFSA 2VSXA 2XTZA 4J7AA 5EP3A 2FG7C 1GPAA 3ZPXA 4X1OA 4PC6A 3IA2A 3I37X 4CQLB 3IVGA 4H3HB 3BJIC 3GDFA 1EM8A 3IPXA 1OAAA 4MP3A 2FR8C 5EHNA 4JZYA 4OYHA 4UHHA 2R1VB 1WHSA 3T4XA 3VTKA 2FFRA 3AFMA 4KQXA 5K8IA 5GWXA 1UMKA 4Q6BA 1CS4C 4PLGA 3I53A 2GCEA 2KSQA 2CLDX 1FFXB 4S35A 1GQOA 3GNQA 4JN6B 4DV7B 1YDEA 1L7DA 3KXPA 4E32A 4MRPA 3WIBA 2ONCA 3FUCA 4RYLA 5AW3A 1K5HA 2XXJA 4RV9A 2FUKA 1FXWA 3LUDA 3OPYI 4HWKA 5AJTA 1COWA 1IHXA 2XNDA 2CK3D 1WPXA 1UMBB 2JH8A 4BGDA 4ENUA 2C3YA 3OEEA 4ZV9A 5CT6A 1O6FA 3UW3A 2UUOA 3NHKA 1RKXA 4BQOA 1MBZA 1MEOA 1FYFA 2Q3FA 2GPNA 2BEWA 5LN1A 1ETHA 3NHJA 5JYBA 2ZXEA 4ZQBA 5CB0A 3SQXA 3EJ6A 3IIMA 1I1QB 5KHOC 3KVRA 3H9EO 3K2BA 3NVKI 4FMBB 4RTMA 1FDSA 4DG8A 3ESZA 3KJHA 4BLPA 4ZOLB 4GQBA 4O63O 3W3AD 3GFSA 4DWWA 2A58A 4W8GA 4IMIB 5C2JB 1TKCA 2NZVG 4HQ6A 4W1PA 1A8HA 1O54A 3KR0A 3QEKA 1USVA 4BLRA 5B4TA 1MU0A 4GC9A 4KR7A 1QS0A 3LDAA 1WD5A 3MN1A 4HZUA 1TFUA 3Q7EA 3NDPA 1KJ9A 1PJTA 3G2IA 3PEVA 5BQ5A 1TK3A 2AJBA 2AZDA 3H8WA 4Z1MD 3KQHA 2AKEA 4JZKA 2Q5CA 3SE7A 2ZE8A 2C58A 4PAGA 4ECAA 4EYOA 3GLTA 3AJ8A 4FXOA 4OP3A 3R9IA 1M1YE 1F2DA 3STTA 5K3AA 1C0PA 4FI3C 2A0YA 3SC4A 3WX0A 2GPTA 3JZMA 2NVBA 3RUEA 4L15A 4UHCA 2DR2A 4TYQA 3G49A 4J16A 1UWVA 3QYJA 1NBME 4RO0A 1JVNA 5L9AA 1NIJA 5KDLA 1PJ2A 1GQRA 4BATA 521PA 1X1QA 3IJ5A 3K9QO 1OY1A 1QP8A 3BB1A 2HKIA 2PAAA 3ESYA 1UP7A 2ZYVX 3JZAA 3PFBA 4GPBA 4XUEA 3EJWA 5FWXA 3ZX4A 1LW7A 4CMIB 3QEAZ 3WLSA 2A5DA 1AOXA 1YS4A 1OVGA 1QG2A 2AKYA 2QQ5A 1DEAA 2YXDA 3RRZA 4M49A 4F9EA 1LJUA 4V1CB 5BV0A 1DO2A 2YBEA 2IPOA 2R8XA 5HQTA 1EK0A 2FOLA 1TK9A 1W4CA 2PV7A 5TB5A 2G1AA 2YYAA 2YQZA 3MWKA 1YI0A 3P27A 3FB4A 3PXAA 3TZHA 3A4LA 1LKZA 4YJ3B 3K8YA 5JS6A 2OCBA 4C2AA 3C7AA 5G1OA 4L8VA 1ES9A 1J6UA 2IK8A 1I6MA 1R18A 2PJZA 2QLLA 3MWDA 3NIFB 4D3FA 4CEIA 1F7UA 4XVQA 5K3EA 3C5EA 3NG1A 3ZLVA 5JMOA 1ZNWA 3KVVA 5C81A 2WV9A 5CDSA 2YBDA 1NQ5A 5K7SA 4A1FA 3R1IA 3MIZA 3QW4B 2YWDA 4IIYA 4GS5A 2XXAB 3RK4A 1B6GA 5C8VA 1DE0A 4DA4A 3BGWA 4P35A 3R0IA 2V4UA 4ESVA 2N42A 4GPAA 4PN3A 3AIKA 4J03A 3A25A 2W8BA 2PQ2A 3L0DA 2UVQA 4PPYA 3U3XA 2UXBB 3FLAA 4OXQA 3G2KA 4AXBA 1ZZEA 4ZV4A 1W88B 4I9NA 5LIPA 2YUTA 2O8FB 1KO1A 1C1HA 4O4IA 3EVCA 2BF4A 2CNKA 3AUTA 1U31A 2CHEA 4UDOA 2HJVA 1JR4A 3Q7RA 1E62A 1QK3A 2PD3A 4BV3A 5KVSA 3W6NA 3EA0A 4MW6A 4RORA 3LI2A 2OILA 1U65A 2IXGA 4C3ZA 2QM3A 2CXSA 1W6RA 1VI5A 3IPYA 3H7AA 5LKAA 4I6GA 4X00A 5EIOA 1EFKA 4UKDA 1VMEA 1ULSA 3JQ9C 1WBDA 3DE5X 1CQIA 4QFDA 1B2LA 2IDKA 1VKZA 3KLPX 1ENPA 3WC4A 3P9QA 5KHAA 4JGBA 3J81k 4R7TA 2VDMB 3OTOB 1FW6A 4P3OA 4Y2QA 2BM9A 5JDIC 2VHYA 4EUSA 2G9VA 1PE0A 2XF2A 4AIIA 2UU9B 4YDSA 1Z4KA 4DR1B 2JF0A 2ZUUA 4LYAA 2B7CA 4DZRA 3RV4A 4RDIA 2XZOA 3EGXA 2G28A 3BQNB 2ZBDA 5B3AA 3R8CA 3O5AA 4G1BA 1J20A 4Y9RA 1NT2A 1GADO 3PDJA 5FBWB 2OLJA 3ZLTA 1N92A 4FINA 5LSAA 2VP0A 3E5HA 1SD2A 4KLNA 5JAQA 1IPEA 4D8WA 2G5CA 2CBXA 4A73A 2QUIA 3NS7A 4CIAA 2M1ZA 2WEKA 5FUVA 5B12A 2C9DA 4K1LA 3B9RA 1ZMOA 3BGIA 3L6RA 4B6SA 3MERA 4CR7A 4DPMA 4H6VA 5HUQA 4ZEMA 2YASA 5DTIA 3OQ1A 1XVTA 4GBJA 4M8SA 2O52A 1A8IA 4CT0A 2I4MA 4JSYA 4KH0A 5E8JA 4ND8A 4F2PA 3VU1A 3FZYA 5KJEA 1IVYA 3M5DA 1NW5A 4RF2A 1C7RA 4QNMA 1K6JA 4IHJA 2O2XA 5G1PA 3W2FA 3CEMA 2C4WA 1KZYC 1NJ5A 1AGNA 1SG6A 3MGBA 3TZ6A 1P4RA 3OP1A 3S1AA 4BYGA 1P0QA 3DGFC 3OE7D 4BN4A 3GU3A 4DC0A 6LDHA 4L8LA 5K1ZA 4B3JA 2E3JA 1SUAA 2XCLA 2Y2VA 3FDZA 3M1YA 4MWTA 4PVCA 2MIIA 4BEWA 1JE0A 4X95A 4NZYA 4GPIB 4R9SA 2ATXA 3L18A 4E11A 5BR4A 2BEVA 4AZWA 4CKBA 3KQKA 3DE7X 2FEKA 1PZXA 4RZUA 3A6HA 2HM7A 2OT3B 3QNMA 2J0EA 3AY7A 4FZ3A 4MS3A 4PBTA 2QSZA 2IELA 4GRAA 2JDID 3B9QA 1P75A 1PZNA 1EFVA 3B8EA 2AN9A 4YQEA 3Q0EA 1D6NA 1HL7A 3AYXB 3GFPA 4Z8YA 3SM9A 3SS8A 3P0IA 4TUYA 1CDDA 1TC1A 2IV2X 1CR6A 3ROMA 1WMSA 2NTNA 2VF5X 4ND8B 4D4IA 3A2KA 1AU9A 3FOWA 1JDSA 1VCHA 2BFFB 2QKYA 4LVUA 5K2MA 4G9BA 4KTVE 3TSZA 4B44A 3M81A 4E2XA 5ITZA 5KMGA 1NC1A 2E55A 3EVFA 4US1R 3RUHA 4RVSA 3TGLA 5I7EA 1AHIA 5DASA 5THKA 3CHYA 5KKNB 1ISSA 3OFNA 4GLJA 3TBHA 4WXPA 2GO1A 5E95A 5BVGB 3BXFA 1C7EA 5L4SA 4CLDA 1V1JA 1J0AA 3EC2A 4GKJB 3PC8C 3BIFA 1MN6A 3N8GA 1F3LA 1LTQA 2FHSA 2XAAA 2Z8YA 3N5KA 4Y6LA 1E9AA 4LKRA 3KKZA 2B20A 3PHHA 2HL6A 1F3OA 1NGSA 2JI4A 3WVNA 2OHVA 2ZRHA 5JSYA 2XRZA 4IUBS 4P0PB 2C7PA 3EHEA 1E1DA 1D2AA 1J09A 3JRWA 1VIYA 3K9GA 3RUIA 3LFHA 5JS8A 3K5WA 4I1RA 4J07A 4QOFA 4BO6A 2HJ9A 1WVIA 2R9VA 4GKBA 2BFEA 4BJHB 2HIAA 4TUYB 3ZV5A 2VK1A 4N9QA 5KWIA 1IZZA 2WTXA 5FOWA 1V16A 4A91A 5A9SB 4L51A 7GPBA 3H6KA 3HDTA 3W2GA 3AVYA 2HQRA 3AETB 1AZLA 1ELOA 1ODKA 5SYNA 3U39A 3K0CC 4BCDA 1Q0LA 3KDAA 1KGSA 1Y1QA 4HRXA 4ZVMA 2PKYX 3FUVA 2NO1A 1F38A 1RCTE 3HABA 1TJYA 2J09A 2AEFA 3HUEA 3JWJA 2GN0A 2WM9B 3PHIA 4QSMA 4QHYA 2IH5A 4LYGA 2ZJ0A 3Q5GA 4CBVA 3O3MB 3FPBA 1SHTX 3E9YA 3IT0A 3I05A 4N0QA 4XSHA 2HXSA 3T38A 3U1TA 3X3HA 3D3NA 1QHFA 4I4IA 4K8RB 4N3NA 4C7KA 5J2UF 1ZK2A 2CUKA 3Q41A 5B6PA 1V26A 5GIPE 3C74A 5EXPA 3KOXA 3S7TA 5EHZA 3W2EA 1IYZA 5IF3A 2FLKA 2QYHA 5L51A 4X63A 2P6RA 3WOVA 2BMEA 4CG1A 1IBLB 4Q4HB 1YKGA 2H2DA 5K6TA 2ZR0A 2IXFA 2CFRA 3MTIA 5DOZA 3TUIC 3MLAA 4DIDA 4HDKA 3KB6A 4HF7A 4BNYA 2KJQA 2QNBA 1HG0A 1RBQA 1T9GS 1GFWA 3FPEA 4MKGA 5AJXA 5DBFA 2XNKA 4G3XA 1YUMA 1NZDA 2PZGA 2QVGA 4KACA 4XB2A 3O84A 4NU6A 2FWIA 1IBCA 2J45A 3OQIB 4FGLA 3DLTA 1DEHA 3RC2A 1PV1A 4YRNA 4PZUA 2AIRA 4CHGA 2A4KA 1I7DA 1OI4A 5J5VA 3IDOA 4EF4A 4F1JA 4B7UA 3HEBA 2ADOA 4ZVQA 3JATA 3JVDA 4ZA2A 5G3ZA 1QFYA 3UANA 2P4QA 2VH1A 4J76A 3ZYZA 5KQSA 1GR1A 2EQAA 2OLKA 2ADFA 1EFTA 2GEBA 4J43A 4TV9A 1GYRA 4YJGB 3UZUA 1OIWA 3ZWKA 3DLBA 4ND6A 1LJLA 1RP7A 1QTQA 4B4UA 2QN3A 1XZJA 2IYAA 3MIIA 4E5PA 5EXDA 2QZSA 4JDUA 2JA2A 4OY3A 3RCBA 2NXNA 3D3WB 2VAVA 4DYDA 1E0AA 4DCTA 1KEPA 3DDZX 1T6XA 4P93A 5ES4B 2E4YA 2J6HA 2LPMA 3UJ3X 4HYEA 1CY6A 4KGXA 1XQ1A 1J56A 1FS6A 2FJPA 2NGRA 3A37A 3A4MA 4GX2A 5DHPA 1T43A 3TRIA 4EBBA 1X3SA 2LWIA 3G9TA 1X6VA 1L1RA 2PQ6A 2R8RA 1TA4A 4ETNA 1UPBA 3U16A 5HF5A 1O8BA 4R2MA 3ZWPA 2X5KO 4Z4QA 2FV8A 5FBVB 3UJCA 3OC0A 2JZNA 1GPBA 4DSNA 3TQFA 5AW8A 5KYWA 1YOVB 4DZTA 5HK8A 2UZ3A 2H6EA 4EABA 3LUKA 1ODFA 1Q22A 1J39A 1PK9A 1PLKA 4P32A 4XUCA 3WLTA 4AJ2A 5KNBH 3QYPA 3V2UA 1G4UR 3PGXA 2A84A 4V3BA 2AN1A 5I9IA 1E2MA 1GR0A 1FLVA 2C9YA 4MSUA 1FLDA 1UBRS 1H2BA 1RQRA 5TT0A 2CLCX 3NT2A 4LY0A 1W9HA 3OY2A 2IUFA 5AYVA 4B0OA 1JPNA 2NU8B 2ZB4A 3LBYA 1ZUHA 2O1WA 2HH9A 2JGAA 2REQB 2Q28A 3GP3A 4H08A 2J5XA 5H80A 3UH0A 3OQMA 3BMOA 4UVDA 5F51A 3RT1A 3T1QA 4ZJZA 2G63A 5FUYA 5F9HA 5DGDA 4RTPA 3MYYA 1C1YA 2X9GA 4R1UA 4LF4B 5A0VA 4K0RA 1QPGA 2C3UA 1CU1A 2BPOA 3QFRA 4K28A 3TNYA 4DT1B 3R6WA 1GCUA 5TY0A 3HBMA 5K9ZA 2O8BA 3SQNA 4BJ5A 4G1MB 1VL6A 4W7HA 1M67A 3FZNA 5DYYA 1H9CA 3RSQA 3AU9A 3EFOA 1HDIA 4I4TA 1HKHA 1VHQA 1MC5A 3VC7A 5CXXA 4L3OA 3GGCA 5AHXA 4YMIA 4AJPA 1AQLA 4HZGA 2XVXA 3V7YA 4TVKA 3AC0A 1L7MA 5DB4A 5IK2A 3VOAA 3H8VA 1GKLA 2RGXA 3ENWA 1N0UA 1ISRA 5A02A 4D9GA 2CMGA 4LV5B 5K8LA 2PE5A 1CF4A 5CTAA 1EWQA 3R4VA 3MJVA 1Z82A 1H2HA 3QBTA 5ALLA 3P94A 3G8BA 4ZDWA 2PYDA 4FYPA 4RK1A 5BT8A 3VH3A 4ER7A 4DRXA 3S2ZA 3IHTA 5KCMA 5A7HA 2DHDA 3WR5A 1LPNA 2HW8A 1TO1E 4Q9JA 4CYMA 4FEGA 2FMFA 4DILA 4BAUA 1EQUA 3MM4A 4QFMA 5KYNA 3WBFA 1UZAA 2PZMA 2I5PO 3HR8A 1KJJA 3P8ZA 1MCZA 5FEMA 2FF7A 1YR3A 5ALZA 5FJIA 3ZQJA 4DT1A 5EAIA 2F4VB 3CLRD 2ET6A 3F6PA 2FHPA 2ETVA 4C7BA 1KH2A 3D4IA 2VPIA 3GJTA 5JI2E 5AKXA 3TCNA 3HBFA 3KR2A 2XUIA 1YR6A 3I6ZA 4RESA 5DGCA 1MHTA 1L3IA 3A4VA 4YRBA 1I6WA 2ZE5A 4XIJA 4A0FA 1PWEA 3B3GA 1SKMA 2ZSJA 3VR3D 1GJRA 2R6HA 4AO6A 3L07A 1NY5A 3VHQA 2HSDA 1H1TA 3PGKA 5KHLB 1Z28A 4Q4JB 3DAHA 4AP6A 1BDMA 1QHSA 2F3RA 1Q84A 1J8DA 3LY9A 5EWJB 3N0WA 4K5QA 3AUAA 2Z6UA 1CV2A 1LSJA 5C8ZA 4EHDA 3IXQA 3LY8A 4L4XA 1DWOA 1ENOA 1YK0A 2ZRPA 3LX6A 1X1RA 1SBYA 2AG5A 3C3YA 3TNJA 1NG1A 3PD1A 1NFFA 4PSKA 5FUXA 4JLSA 3GLFE 1P2FA 1LWNA 1OX6A 5DSZA 3T3IA 3ZE8A 1T5BA 2JIQA 1QAOA 2YWRA 3WLPA 2NZUG 1A96A 4ED9A 3PUJA 4KDCA 4DCVA 4EGCB 4PQRA 4F84A 3P9CA 5DM60 4U4AA 1P5JA 2CNWD 3M4JA 2EP8A 2DFDA 3OO1A 4GI3A 3WAJA 3CW8X 2SCUB 1NVTA 1RI3A 3AXSA 4PG6A 4MCIA 1ZCJA 4MICA 1B3BA 4BN5A 1PGQA 2AB0A 1UMBA 4LOHA 1BCSB 3T7RA 3W2HA 2FN3A 4DMFA 1AQNA 1GN8A 4E1AA 4IRUB 5KO2A 2V7UA 1D5CA 4JP5A 4K40A 3TE7A 5JQWA 2I8CA 4CEHA 1U2ZA 2QRGA 1JFRA 1PS9A 3B78A 3DKIA 3BPSA 3QYAA 4OMDA 5KC9A 3ZHYA 3D8HA 4AIRA 1MP0A 5K8JB 4NBKA 2VVTA 3IE2A 4P08A 3C6YA 3PXEA 2C9MA 4S0ZA 1XLUA 2VP4A 4LJAA 3UUWA 1QHXA 3W8EA 3FYUB 1I5RA 1K92A 3IESA 1X38A 4TLEA 5DM0A 4DMGA 1PGJA 1QG0A 3SJCA 5IJWA 3D7RA 1JHPA 3V2GA 5ADWA 1WHSB 1N7JA 1KC1A 2HJHA 1XL1A 3IMFA 3JD4A 4UNNA 5H3LA 5DT2A 3RSFA 1K5PA 1X1DA 1JR3A 2XTMA 4TN5A 3TXAA 4DLVA 4C6RA 3JQAA 4JI0B 3HC7A 2ZU6A 4KWHA 4DY4A 4F2GA 4UZSA 1O5TA 2C61A 5JVDB 4FSDA 1BYIA 4UDNA 4L1KA 3YASA 4YRGA 5J3JA 3N8KA 1S1MA 2JJ8A 5KNLA 3Q7QA 4XX1A 2Q50A 4NMWA 5F7JA 2I99A 1CZKA 2B5VA 2YXLA 2XCRB 1WZUA 1BS1A 2QD1A 3BRWA 4M60A 5LDDC 2B1IA 4WXRA 3IUMA 2MMGA 3REGA 1D2EA 3HBJA 4RK6A 1LSOA 4E4TA 3D7KA 4PINA 1BA3A 2QL7A 1D5WA 3HYRA 2G9UA 3HZOA 4RPLA 4M22A 1HFKA 4LUCA 5J5AA 2OM2A 3I2JA 1JAHA 1XDDA 2QMOA 3LNTA 2V59A 5ALEA 4OFWA 2Q6IA 2XWBF 3ZW9A 3F8WA 4M0PA 3O6VA 2BELA 1M8KA 5K01A 1OYVA 1KKLA 3QE4A 1Z08A 3R5XA 2Q1SA 4LJKA 3ILXA 3LLCA 3T9BA 2WTNA 1AA6A 5H9WA 4RJLA 2XD9A 3JR7A 3Q3EA 4ZVUA 4B34A 2YWHA 5TQJA 4EZEA 1JV2B 4Y6SA 1A5SB 3EXEA 3FFWA 3L1JA 4YV7A 5JARA 3DYBA 2PVPA 1XC7A 1EE2A 1WP4A 3L7DA 4GSYA 4B4VA 3H86A 3TG8A 1YJ5A 5AKJA 3M6MD 4CMKA 2XUOA 1VHWA 1DOHA 4PYKA 3F3SA 4RKQA 1WEHA 3MCVA 3PYLA 4BXOA 1ZD4A 2ONKA 1H8HD 3HKBB 2F3SA 2PH3A 3NH9A 1UMDA 1ZCZA 3ZG6A 3MPUA 4WJZA 4N3AA 3ZLUA 5I7RA 3RUDA 2FSGA 4YCNA 3E8XA 5ECYA 1T1EA 2HQ1A 2VKTA 5FADA 3WL4A 4RJTA 4CU2A 3CUTA 1YCDA 3DPIA 3GFQA 3M6LA 4K26A 4KVGA 4KP7A 4WXEA 2C7RA 3BD7A 3V48A 5DGIA 3ME5A 2ERXA 5DM1A 2YHBA 4JJKA 3SZ3A 4LJYA 5CEJA 1E3IA 5HM8A 1AKVA 3U44B 4RDCA 2XDWA 1IBRA 1U2GA 3FIUA 5BWCA 4WAUA 1GV1A 3DM9B 3R6GA 4DNOA 4JQCA 1O4WA 4JT9A 4L9WA 4W5NA 4YR9A 2JBAB 3SK0A 3KXDA 2PT7A 3OOHA 2FPGB 3TB4A 3UK0A 4XVUA 4IQFA 5A6VA 3LHSA 1GRRA 3W5JA 2BYTA 1L5HB 1OWMA 3CMMA 2O3TA 4GI7A 3H6HA 2FSVC 4X60A 3ZU3A 1BKYA 5G0VA 5JHHB 4LXGA 3C8DA 3TLKA 3UOGA 4D9NA 4TQGA 1D0IA 1QAMA 2WTEA 1PW5A 1N9KA 3BD9A 1X3LA 3F6BX 3QU5A 4R01A 5FB3A 5AK5A 4QVIA 1CK4A 1TDJA 4MR9A 4A23A 1U7ZA 2AC7A 1JTFA 4C5CA 1R88A 1T9AA 2HPVA 3KLBA 5A3JA 1ONBA 1DC8A 1Y8QA 2OYSA 3MRTA 4S1WA 1KI3A 3CPEA 4MJ3A 4URXR 5JXJA 1BWRA 2P69A 4J0EA 2MYPA 4P5PA 4I1UA 3DZCA 2P5TB 4AJKA 1A9QA 1CQWA 1A95A 3BVPA 3JTEA 1RWMA 4PSAA 4IHAA 4Z4GA 2BN4A 1KBZA 1K1EA 3BBPA 4WNIA 5J4VA 1PU2A 5I8PA 4HLQB 3E03A 4PSDA 5ALFA 3T0GA 2ID8A 1DSSG 1WZIA 4PX3A 1JEJA 1CB0A 2J3IA 2OHXA 3O8OA 3TIGA 4M1EA 3R3SA 4CKEB 4XAQA 3C45A 3B1ZA 3SLRA 5KOYA 1L4FA 1F2UA 4ZOBA 1QGOA 4R9NA 4D3XA 1P9WA 1FTWA 1LLCA 2GRUA 1UK9A 2H3HA 3BEOA 3EVDA 1RXWA 1CY0A 1QC5A 3B6MA 3OX1A 2ZLBA 1G8HA 2O6LA 4ZFNA 4B4WA 4GSKA 1B76A 5AP9A 3BJZA 1JEYA 3N87A 3QELB 2HDOA 4JITA 1R8SA 3G7SA 4QRDA 3E8MA 5EJ8A 5FL3A 3VR5D 3Q5EA 1Y98A 1POXA 3JVVA 4DE5A 4DAEA 4DLSA 1L7RA 3FFBA 3BRSA 2IP4A 4I5DA 1DXOA 5LP6B 4DMHA 2R65A 1LDBA 2V7QA 4KZKA 2BEUA 2W58A 3PGJA 5IG2A 4EO4A 3K0FA 2OM6A 3DL7A 2J3JA 3ZC3A 2PX6A 2ESRA 1ZJ6A 2CLSA 1DAOA 2VF8A 3CGGA 5A9SA 4CUZA 2N0SA 2YL2A 4UD2A 5DTQA 5JHGB 2DUUA 1NSTA 3HGQA 3ICVA 1ZA1A 2GKSA 2OSVA 2OWEA 3E3OA 1TUGA 3JSAA 3SEQA 4YCLA 1EFLA 3DC7A 4AK9A 4RHTA 1LK5A 1T9ZA 3QNUA 3IT1A 5ESDA 4Y2VA 4EBFA 3RSCA 1V7PC 5JEEA 3FI0A 4LY9A 3VR1A 5F2KA 4OL9A 2NU7A 2QRVA 1PTKA 1EFVB 1JU9A 4QL3A 5EEHA 5C1IA 4AKSA 1A27A 3A3PA 1H6AA 1ZMTA 2I3AA 4Q01A 3WKBA 4B3TB 3P20A 1T2FA 4PYQA 5TQVA 9MHTA 1T5SA 1RFLA 3FETA 5CFNA 2FQXA 1JJFA 1PD1A 1R4MA 3KQMA 3P26A 1BD4A 1CNFA 4DKJA 3NYQA 1PVDA 1VLJA 3DJFA 1E2NA 4IL5A 4V03A 2CNNA 1BDIA 1L8AA 2P75A 3IRUA 3JD3A 4KIGA 4MWZA 4B3MB 4KNVA 5GJBA 2AR7A 4TXMA 1SVSA 5H4HA 3I73A 2G5GX 4OLHA 3BL8A 3U1VA 3AKZA 4FCWA 1JDUA 5CP8A 4HPWA 1E2PA 2I6FA 4HNAA 4CMCA 2NUPA 2OOSA 3QHQA 4H1VA 2G07A 4ERNA 3ODPA 5H3CA 4K6KA 1A7AA 3TQHA 1VJDA 2Y93A 1RADA 2ZJAA 2CMHA 1TAUA 5BSMA 1FDRA 3RFFA 1SBHA 2JAHA 2W43A 4P34A 1WEKA 2ZQYA 4JL6A 5D01A 1E1LA 2IYYA 3T7TA 4XYGA 2IIQA 3UK7A 3QYFA 4DS3A 3O8RA 2WF5A 1I3OA 4LBWA 2APJA 1NUQA 2VF4X 2H8GA 2XD4A 4QGAA 3VI3B 1UM9A 1W8IA 4EHNA 4HDSA 1A72A 1CQIB 2WHYA 5CIQA 3UOAB 3AEQB 4LV8B 2XITA 3Q1KA 4K05A 3CVWA 3NRBA 3AL3A 4J6EA 2VYND 1AIPA 1SIBE 2X2EA 3D0KA 4W63A 3ROEA 3VPAA 3QUQA 1W87A 5JVDF 1SK9A 3BORA 1KO4A 4Z5XA 2XEDA 1SCDA 4M9RA 1DKPA 1GUDA 4JC5A 1RPAA 2RBGA 1UXGA 2F9MA 4G41A 4GO1A 3QUBA 1HGXA 2H4YA 4DR5B 3EVBA 4TVBA 4NV0A 1E5DA 2ZYAA 1CRLA 1XZAA 4XI9A 4UTRA 3QVXA 1KKMA 4BZWA 2GUGA 1PLJA 1YRQA 3PNQA 3G89A 4AN0A 2RE8A 4G84A 1NI4B 4IV0A 2PT9A 3OQPA 1JIQA 1KMNA 1ZU5A 2C9OA 2QK4A 2PRIA 3O2NA 4MV5A 4X8MA 5EE0A 5HKKD 3THOA 4DQUA 4Z2AA 4NU5A 2CHQA 1FNDA 2QXUA 4CXMA 2NVOA 5FI1B 4LE1A 1BQ3A 1I10A 4FUTA 4YMVA 3JYPA 2FA9A 1CZNA 2V3WA 5JBIA 2QI9C 2OXRA 3W5IA 1UXKA 4MJ7A 5LQAA 5IABA 1V9CA 2VQ3A 1KSFX 3VRHA 3OIUA 1DDGA 1OJLA 4O33A 1YR1A 3REOA 2R8YA 3OA0A 3ZBQA 3R9KA 1E1KA 3G79A 3CVYA 3CRW1 3L8EA 2HR1A 3H13A 4LXTA 4WLUA 3LBHA 4MUEA 1JG6A 5BW5A 1BOFA 1N3IA 3NAGA 1LS1A 5KI6A 1SA0B 2Z5LA 3MWGA 3RQSA 1OLOA 3OCZA 3LS2A 3BCHA 3OCUA 4UREA 4BRWA 1YBHA 2IU4A 1QGUA 1ZRSA 2Y1FA 3VX3A 2VPYA 5BNTA 4QBTA 2ISSD 3KSAC 1Z74A 5JW6A 4DXDA 3WMXA 1JVSA 1E9FA 1MRSA 4C6TA 1NR7A 1EKXA 2VPTA 5K0ZA 1EVYA 2GJSA 1XA3A 2MMCA 1BD3A 2YWFA 5CB4B 3VKHA 5CUQA 3DBIA 3RLFA 1KAEA 4EG1A 3DA8A 4PNEA 5IT0A 4FQ7A 4IKOA 3CVOA 4YJGA 2VHWA 1JDTA 4RTSA 3K70D 4NCAA 3BSYA 5LB4A 1UT6A 3NUGA 3PQEA 1E79A 2NXCA 2GAAA 5J63A 4O29A 2QT9A 2VL7A 3GIWA 3TXYA 4BU0A 2ORED 4XPIB 2QVZX 2W0MA 1PR0A 3EVAA 1G8GA 1SXJE 1IFXA 5KAPA 3WQSB 3AHGA 4ER0A 3L0OA 1PJCA 1R0BA 3D6UA 4FKBA 4OM8A 1F1JA 2PX0A 4IHKA 4G07A 3OZXA 4ITRC 3C6BA 3RJ9A 1YIOA 4M46A 1CUCA 4G67A 3DWGA 4DIMA 4N18A 5EJ9A 5J2TB 3CPSA 5DP1A 2NQ8A 3S68A 3IOYA 3PTZA 5F1YA 1W1IA 5C8YB 1YS2X 3AJEA 2QJOA 3JAKA 4NHOA 2PBRA 4ZO6A 5LFAA 4PGMA 5ALIA 2WSMA 4A92A 3N6VA 4BGEA 2NZJA 2IUYA 4D96A 4W5OA 3K9FC 1AQYA 4ARSA 1G6OA 2H1HA 3QH4A 3GJRA 1Z0SA 4HS4A 3E7DA 4WOBA 4Y0NA 3V2HA 3U9SA 4B7XA 3GRUA 3DW3X 5EPUA 1YJCA 2JA1A 4NTZA 1IXSB 1KQ3A 2IXBA 3JQ7B 3PBKA 4UHKA 3UWDA 2WPDA 1DXYA 2ANBA 3IR5A 1RYZA 3K2EA 4UM7A 1H0HA 2JJ1D 2WWVD 5J4YA 5REQA 3RAPR 4QEZA 3NHSA 4PM4A 1QF7A 2J7PA 3TI7A 2HMSA 4Q9NA 3FYSA 3CNQS 4KQCA 1W48A 3PDUA 4K87A 2GK6A 3SX4A 1JHZA 1EM8B 3A9UA 3Q88A 1RZRA 4Y0AA 2QA5A 2RI0A 1NATA 3W7AA 1OH6A 3Q9SA 4G37A 1EP3B 4M8KA 1D1QA 2Y3IA 4OHWA 4E6PA 1ISGA 4KXXA 3U31A 4BFZA 2JKYA 3PGVA 1U3UA 3JVUA 3FHJA 1C81A 1GPMA 3VYRB 4DUZB 2AWNA 3OQHA 1Y80A 2CDCA 4Q9HA 2LGJA 1UJMA 2DBYA 2J0VA 4FOSA 1USIA 4IXNA 2OXIA 3U48A 3VU3A 1L7OA 2JIBA 5K8CA 4QG7A 3JSXA 4MQLA 2J3KA 2R6CA 4Q66C 5CLIA 1Q3TA 5F7OA 2ZUFA 1YSCA 3ES9A 5HG0A 4CJXA 3AJ9A 3T5CA 1FJGB 1GAQA 1SWWA 1Z9BA 4YAEA 3EQ6A 3ESBA 4RHYA 1Z17A 1GRCA 1QM5A 1TCAA 2OD9A 1X15A 4BNGA 2PRSA 1TMOA 2BKVA 2FN7A 2NACA 3NPMA 1V2HE 4ISCA 3EC7A 4O0MA 3U09A 1R6TA 1GXSA 5ICCA 4XH9B 2YFKA 1AQUA 1BJTA 2X2OA 5JS2A 1NMYA 3AIMA 4HBZA 5FYDA 4C0AC 1JMKC 1KAMA 2RJNA 4QU0A 3ANYB 4QUJA 2ZR8A 2YY5A 1KDZA 1X70A 1XHLA 1TU0A 2AMYA 4GUDA 1N6KA 5DISB 4INPA 4RF4A 4B33A 5LQNA 2O8NA 3AG5A 2PGIA 5HE8A 1ABEA 5DVZA 4M83A 4PZZA 4DQKA 2FF5A 3UGKA 4JLVA 4Y67A 4EJSB 4XM0A 1ZD9A 2CYAA 5AOVA 5I4CA 1N1MA 2PL3A 1V8OA 3HB5X 4HD8A 1V8ZA 5EE5B 3WAKA 5LD2C 1S6YA 3QOWA 3SC2A 4TPKA 4DGQA 2HMVA 2VF2A 4YUVA 3IMEA 2RAPA 4KGZA 5CAEB 3QEMB 3TE6A 1ISHA 2AOXA 4EFLA 4DB2A 3UXYA 2BHTA 4RK7A 1U9IA 3MWEB 1CC1S 2YJNA 3R41A 4X3CA 5ALMA 4PGFA 3IIIA 5JZVA 1OB2A 3T3NA 2VK2A 3D5QA 4MLDA 4D1YA 1T8UA 3TR0A 3KSUA 3E9RA 1KQOA 4F4HA 2X0EA 1BMFA 3ZCPA 3P9RA 1ZLYA 3A4IA 4OK3A 1H85A 1CBUA 1QG6A 3E3MA 3PSHA 3TL6A 5BSGA 3QUTA 3SIPA 1K6MA 4UDYX 4ZJUA 2BTQB 4Q9DA 1GDHA 3NW9A 3TEFA 2NSDA 2WIKA 1N2XA 1W35A 4UQPA 1K5GA 4YBZA 3T1VA 1I2AA 4G0ZA 4NDNE 2GA9A 1W4BA 2F4NA 3LUHA 2O1XA 4OXRA 1F12A 1U1IA 2DR0A 3TIIA 5IDQA 4UCFA 1BE0A 3QLTA 3A9TA 3U4GA 4EHLA 5ALWA 3LHIA 4A82A 2UXDB 1XEFA 3P9PA 5B1IA 4D4GA 2AL7A 4DLRA 2EAUA 1XFAA 4GVXA 3WLFA 4C4ZA 2A9QA 3A3OA 1JHUA 1U5BB 5FBRB 1ZM2A 4NDZA 4IZ6A 3LC2O 4HQNA 1ODSA 1GL7A 3MWEA 4PAOA 5C52B 2YZ7A 5ALYA 2BKLA 4RA9A 5FPPA 4DLYA 4AJHA 3R9XA 1MAWA 4V0LA 2Q7OE 1KNQA 1GQQA 2GF2A 4CV3A 4WUTA 3LVBA 5CNIA 5FPTA 5CDFA 3NXSA 2D54A 3D0QA 2CYCA 1NVEA 1JJAA 1IMJA 3QJ5A 4G5GA 3S70A 5H8WA 2Z2IA 5EC8A 3SJBA 3TINA 5IMSA 1ZVVA 1JG7A 3GAMA 1GPKA 1KDPA 4Q3CA 3FBGA 5KWEA 2FSIA 3LUPA 3NC1C 4QDTA 4RLFA 2CVZA 1YZQA 4LJ9A 3AZPA 1A77A 1HZZC 1TAGA 5G0TA 1J1ZA 4G85A 5A05A 1WZ2A 5JCOC 1QDLB 1VPLA 2FG6C 3HHEA 3LPMA 5ESWA 1T25A 2XQJA 2ZJ8A 1U8XX 4H2DA 2FGKA 1NVUQ 2AGVA 3DL2A 1SQSA 4RABA 5ADHA 1GAJA 4OB8A 4NK5A 5I9BA 1E79D 1U0SY 1T9BA 5JYDA 1EGVB 1V8DA 2NPIA 3ORHA 3VR6D 4RIEA 4QVKA 8ATCA 2ZYTX 1RHMA 1ESZA 1T5LA 1NVWQ 4ZEOA 1E94E 3EGOA 3HXQA 4J4TA 5E4FA 5G0WA 3GLSA 4B32A 2QDXA 2GHIA 1OKKD 2WYVA 3NWJA 4V1CA 4OH1A 4B8YA 4BQIA 3ORSA 1G5PA 3VKVA 2DFVA 2GVNA 2X4DA 4Q1VA 1SU7A 1BHQ1 3ABRB 1VE7A 2GK7A 3KWFA 5M3BA 2YCLA 1R3DA 2C88A 2J3DA 2ZRDA 1AZSC 1P7YA 1L4YA 2Q4BA 2JFQA 3ZE1B 2FEWB 1KQNA 4NICA 5LP6C 5HRAA 1SIOA 4X84A 2F43B 3AP1A 2AC4A 4IH9A 3FGOA 2ZK7A 3GJ0A 3SEZA 2CEKA 2PUTA 2ZT8A 2PAFA 4F4DA 3EWNA 4GYKA 1OD6A 1F0NA 4P2BA 5I01A 3BIOA 3MWFA 3LCRA 2JRLA 2VP9A 3TQQA 1F0KA 2NU6A 3A26A 2W2VA 2V8OA 4OSOA 3PC6A 2VQFB 3GARA 4CG2A 3WBJA 1YS6A 1TVEA 5DE3A 2AX3A 2D2XA 3K5PA 4UNRA 1FTSA 3K1ZA 4CW7A 4FB5A 3CLSD 3FMIA 4MGYR 4X62B 1S3GA 4ZTUB 3AY0A 2EDAA 3GLRA 5ALTA 5I7OA 5BVGA 5JJ5A 3I9LA 3ZE9A 1FYXA 2EYQA 3QWHA 5D00A 5AJUA 4G23A 3TTTA 2DHEA 3GOQA 3M1LA 4M8LA 1GZ5A 1IC6A 1XEWX 4KR6A 2HYDA 1BX1A 3EFBA 3KZVA 1TUIA 4O8CA 5GJWC 2B8NA 4CN8A 4DC1A 4DXAA 5CCBA 2X9LA 4EUNA 3WWYA 3Q87B 4CKZA 3L0BA 2ZTLA 4IDAA 1Q6YA 1QUEA 2BGMA 3H5NA 4HXFB 4JLKA 4TL9A 4TXHA 5ED4A 4EUFA 1I36A 3MT7A 2DC1A 3N86A 3PHGA 3FVVA 1PL0A 1PK8A 2VHZA 2W6NA 3EXIB 2QNIA 2XX3A 4CMJA 2Q4EA 2V9ZA 5JEDA 2GPAA 2P9GA 3NKFA 4Z4CA 4JYCA 1E98A 1Z4QA 2GN8A 3SKXA 4LMRA 3O31A 4H16A 1B4DA 2OECA 2LR0A 2TYSB 3L84A 4OFBA 4UBKA 3KPWA 1Y6JA 2EG9A 4HEJA 4Y2SA 4A8JB 3R40A 4I14A 5THQA 3E23A 2FJUA 3A4YA 3QI7A 4S1VA 1JSCA 3QVMA 5BMOA 1X80A 1Z2AA 3MCTA 3MUEA 4E30A 2IYZA 4F85A 1JUDA 1TMYA 4BNVA 5P8WA 4EG0A 2ZULA 1S8AA 2BM8A 4RVHA 1EUYA 1ILWA 5HVNA 1KVRA 3OQNA 4LVOA 5D3KA 2KBFA 2GXAA 2YWJA 3AM1A 1DJQA 2DBQA 4QYSA 4BZXA 3CGWA 2FRXA 2V7WA 2GCOA 2ZSIA 3GFGA 2C84A 4IDOA 4NZMA 4URYR 1OV4A 1VG0B 1Y5NA 2JI6A 1Q7CA 3MJRA 4YPFA 3SAJA 3ZCRA 4EVIA 3MTEA 1UC8A 4MEAA 3KU1A 3GEMA 1OXBB 3WGYA 3T4PA 4FE4A 3VZQA 1CHDA 3CN7A 1J9EA 2XB6A 4AJJA 3DBRB 1DJOA