2CDAA

Sulfolobus solfataricus glucose dehydrogenase 1 in complex with nadp
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
366
structure length
360
Chain Sequence
MKAIIVKPPNAGVQVKDVDEKKLDSYGKIKIRTIYNGICGTDREIVNGKLKGKDFLVLGHEAIGVVEESYHGFSQGDLVMPVNRRGCGICRNCLVGRPDFCETGEFGEAGIHKMDGFMREWWYDDPKYLVKIPKSIEDIGILAQPLADIEKSIEEILEVQKRVPVWTCDDGTLNCRKVLVVGTGPIGVLFTLLFRTYGLEVWMANRREPTEVEQTVIEETKTNYYNSSNGYDKLKDSVGKFDVIIDATGADVNILGNVIPLLGRNGVLGLFGFSTSGSVPLDYKTLQEIVHTNKTIIGLVNGQKPHFQQAVVHLASWKTLYPKAAKMLITKTVSINDEKELLKVLREKEHGEIKIRILWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structural Basis of Substrate Promiscuity in Glucose Dehydrogenase from the Hyperthermophilic Archaeon Sulfolobus Solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Oxidoreductase
molecule keywords GLUCOSE DEHYDROGENASE
total genus 122
structure length 360
sequence length 366
chains with identical sequence B
ec nomenclature ec 1.1.1.120: Galactose 1-dehydrogenase (NADP(+)).
pdb deposition date 2006-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
A PF16912 Glu_dehyd_C Glucose dehydrogenase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2cdaA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2cdaA01
3I9MA 5TC4A 1D3AA 4CR8A 4A5OA 4DMLA 1XHLA 2QYTA 2CNBA 3EZLA 3EDMA 1X0XA 2ZTUA 1EVIA 4CR6A 1VL0A 3L07A 3HHPA 2O3SA 3AM4A 4N5MA 5BT9A 1ENPA 3ZHBA 2D2IA 4HADA 2OFPA 2OHXA 3IP3A 3IL2A 3ZV3A 3ZU3A 2HJRA 2X9NA 3JD1A 5A02A 1NVTA 3DMYA 4N54A 4ILKA 3RSHA 3Q9UA 3C85A 4TSKA 4XYBA 4OXYA 5AQ1A 3Q0EA 3RJ9A 1TI7A 4PFJA 3T7CA 4CQLB 5DOVA 3PQDA 1M6HA 2X0NA 4CMCA 2H1SA 4A10A 1ENOA 3WTBA 1O5IA 1T24A 3EHEA 2CF5A 4J7XA 1TT7A 2NTVA 4O5OA 4Y6SA 4IUYA 1W6UA 5CDYA 4PG6A 3TSCA 4GX0A 4HFJA 1UJMA 4CR7A 3TFQA 4D3SA 1IZ0A 3VC7A 2P5UA 4ROSA 4PLPA 5AXCA 3RIHA 1ZJYA 1B8UA 5JS6A 1JKFA 5DBIA 2JFGA 4BO3A 4D0RA 1PGQA 1A4IA 1LDEA 3GGOA 1TVEA 1ISJA 2OGUA 5TJHA 4NJMB 1A27A 2DAPA 2FMUA 3WNQA 1MC5A 2HJSA 2YQ5A 1ID1A 2RAFA 2XAAA 5KIAA 5L9AA 1BTOA 2FPIA 3PWSA 5G0UA 7ADHA 1N7HA 3ZWVA 2F00A 3F1LA 1S6YA 4R68A 3DONA 3GMSA 3OIDA 2B4RO 2CZCA 3AW9A 3V2UA 4BKRA 2RBEA 5EINA 5A5FA 2W2LA 1PJLA 4KQWA 2NNLD 1EFLA 3H5RA 3MZ0A 1WW8A 4RLSA 5TSDA 4B7CA 4N18A 1P1HA 2NACA 3OIFA 4XB2A 3MJEA 5A5EA 2X4GA 4BO1A 4J6FA 1TT5B 3D3EA 5F5LA 2GUGA 3W8FA 5L7WA 2AMFA 4RCVA 5B4VA 3BYZA 3JYLA 2G76A 4L0QA 3UN1A 1J5PA 1XU7A 5AOVA 4KWHA 5TLSA 3UOGA 1XEAA 4GGOA 1IHYA 3ZV4A 3D7LA 3KYCB 1EE9A 4GL4A 2WM3A 3P5SA 3ON5A 2NVBA 4MP3A 1L1FA 3PVZA 5DP1A 1GPJA 3EC7A 2VQ3A 3D0OA 3QWHA 4KDEA 4OIMA 1QG6A 3KSUA 5IN5A 4AFNA 3GY0A 4IBOA 4K28A 3ZW8A 2H6EA 3SXPA 1WDKA 2PGDA 3GNSA 4DIFA 5JYEA 5EQFA 2SCUA 1XKQA 4TZKA 4ZQFA 3TQHA 2EG9A 1E3SA 3F6YA 4LSWA 5ER6A 4RDIA 1BW9A 2WYWA 1EEHA 2GN9A 3B1KA 4Q3DA 1PR3A 1T2AA 3U09A 3I3OA 4GLOA 2VYND 2XXBA 1E7QA 4CL8A 2BFPA 1X7GA 2I66A 4J9UE 5ILOA 1D1TA 4S3MA 3WLFA 4ID9A 3H9QA 4XQ9A 5DCUA 3BTSA 7MDHA 3RD5A 4JP3A 4RF2A 4O1MA 2C5AA 1HZZA 1SOVA 2O4CA 3OJEA 4RL6A 4Z0HO 4FC6A 3WG9A 5B4UA 1VI2A 4JCOA 2AG5A 2ZATA 4LW8A 4NQZA 1E3LA 4CM4B 3TZ6A 1ORRA 4HY3A 1MFZA 5L4SA 3OSUA 2O2YA 3ASUA 4WGGA 3JYOA 3BTOA 1A71A 2VTEA 3D3WA 1N92A 2CDCA 3OQBA 1F12A 4UUNA 2VCYA 4WOKA 4YJHB 3GFGA 2J5QA 1R15A 4NK4A 3TZQA 3FNHA 4CLOA 3LT2A 2B37A 2BMAA 4FOSA 4MVJH 1TA4A 3WMWA 5L95A 4M55A 1SPXA 1QYWA 3OFSA 4M89A 4R3NA 1J4AA 4YJDA 3BHIA 3QVXA 3PYMA 4EEXA 1LC0A 1DRVA 3CH6A 2AQHA 6LDHA 4XQEA 1LLQA 4QUKA 1DHTA 3ANNA 3F4LA 3GA0A 1UAYA 1D1SA 1Y6JA 3AOGA 4YR9A 3ZZNA 4ZGWA 4HBGA 3G3EA 4J3FA 5KVCA 1Z73A 1Y9EA 3VDQA 4K1LA 4PLVA 2C5EA 4QO8A 1UXKA 1NTOA 2HK9A 1UP4A 4AICA 3GAZA 1IULA 4ZVVA 3U9LA 4Q9NA 4XYLA 2VHXA 1U7TA 4TQGA 4WLEA 3S55A 2Y68A 5B37A 4DC0A 4W82A 4DWVA 4BNZA 4GWGA 3WYBA 3OEYA 1O0SA 1PGPA 3Q6IA 4E12A 4KWIA 4GSKA 4R01A 4YACA 4Y6PA 1YH3A 1I2BA 2J5RA 1Z7EA 1U8FO 1Y8QB 4NI5A 3UAGA 3I83A 4BNHA 4XKJA 4Y8VA 1SBYA 4YCAA 3ZV6A 3TF5A 1KY5A 3I23A 1K89A 4WCFA 2W2KB 2DM6A 3FD8A 1KYQA 4UAGA 3GEDA 5LDGA 3EK2A 5U1PA 2E4AA 3GG9A 4G65A 1T4BA 1QORA 2YHUA 4XYGA 2AG8A 2O3QA 3GPIA 1PJSA 4RF4A 4BB6A 1C0KA 3ZWMA 1PJ4A 3EAGA 1R0LA 1P1IA 3KHUA 3LC1O 3MJVA 3TL2A 1E5LA 4IDDA 1V8BA 3UCFA 1DLIA 1NFFA 1I36A 1FDVA 1Y5MA 2C2YA 2I9PA 2Q45A 2OOSA 2JAHA 3ETGA 4ALIA 4BIIA 4YRBA 4CMIB 4Q3EA 2POQX 1EMDA 2PA3A 3PWZA 4ALMA 3UHAA 4RPGA 1IY8A 2YDXA 3WYEA 3CINA 4BNIA 3I52A 3BAZA 1HDRA 4RVDA 2IZZA 5G4LA 3GOHA 4R1NA 4NBRA 3LT1A 3ZNNA 4HFNA 3NX4A 4RDHA 5FF9A 3ADPA 3ETEA 4CQLA 1HLPA 4WPGA 2UUOA 2EV9A 1LLCA 3ZW9A 2O50A 4I5FA 1PQUA 3GK3A 2D1YA 1I2ZA 1I24A 1T2CA 3DBRA 1UH5A 4XYMA 1IYZA 3WICA 1GPDG 1BXGA 4MPDA 3ZWPA 1ISMA 4Z3DA 3ZWXA 1E7RA 1E7SA 4J1QA 3PIDA 3OF2A 3TNLA 2VRCD 3K2BA 1BG6A 3ZWOA 3MCVA 2A94A 3I4FA 4YAEA 5AVOA 4DLBA 5C3MA 1P1JA 1J6UA 3MOGA 1QLHA 3HB4X 4FD3A 3AUUA 3ORFA 4FJ1A 3W8EA 4BNKA 2X7HA 1HZJA 3ENNA 3ASVA 1UDCA 3AWDA 1PQWA 2PGLA 3E48A 5DZSA 3C7AA 3UW3A 1DO8A 3WGZA 1YBVA 3I4CA 1P77A 4U0JA 3JQ9A 3BMNA 3QWIA 5HS6A 3TOXA 3GVXA 4TVBA 1HYGA 3U4CA 2PZKA 1BMDA 3PK0A 4IQ8A 3KV3O 2FPPA 1WDLA 3JQ7B 3OHSX 1F0YA 3ICCA 4ITUA 3HJAA 3U3XA 4BO4A 4L4XA 1JVBA 4AL4A 5DT9A 3A4VA 4WCFB 1C0PA 1B14A 1GUZA 4PLYA 3T4EA 1FDSA 1LLUA 4MIEA 2YV3A 1VL8A 3C1OA 2AA3A 4KQXA 1PJCA 4B3JA 1B26A 1AN9A 4F6CA 4ND2A 1YL7A 4MJLA 1VRWA 2WDZA 4R3WA 4B4UA 3ZN2A 2F1KA 1UZMA 4ZQBA 1BXKA 1P1FA 3NT5A 3QIVA 5KKCA 2JFHA 3K6JA 1F06A 3BTUA 2RHRA 3PDUA 4U8GA 3RUIA 3UXYA 2NTJA 4A27A 4E2YA 4EW6A 2VHWA 3W1VA 1I33A 1IPFA 4L75A 4W9NC 2PLAA 2FZWA 1GYRA 1B7GO 2BFMA 1SEPA 4IM7A 3FPCA 3ROQA 2ZB8A 2YJZA 3KYBA 4CM9A 2VRBA 4B8ZA 2D5CA 1JLLA 5TX7A 3PGJA 4IZIA 4CUZA 3DO5A 4P8RA 4GSLA 3ZWAA 4BNMA 2ZYAA 3JQBC 1BVRA 1E1MA 1X0VA 2EW8A 2H5LA 1EUZA 2ZB3A 4W99A 3DAFA 3H3JA 2IRWA 3AM3A 4A03A 5ENVA 3G1UA 2DTXA 1HXHA 3L6OO 3FPLA 2O3RA 3OA2A 1OOEA 2BRUA 4DMMA 4GWKA 1L7DA 2DBVO 1CRWG 1LXCA 2PTGA 4CLHA 1BDBA 2WSBA 1B16A 1PJTA 2GPTA 1ZMOA 5LC1A 2Y67A 2PD6A 1LJ8A 1E3WA 1EBFA 3QA9A 4GX2A 1I32A 1R0SA 3JQAB 4W7HA 4XR9A 4XGKA 4NJMA 5TT1A 3ZWYA 1E3IA 4AJ1A 5T8KA 1JU9A 2V6BA 3RU7A 4I5DA 4IQGA 3ZU4A 4E5PA 3UFXA 4FC7A 3I9LA 1UDBA 1ZKMA 4ZRMA 1QYCA 4BNLA 1EVJA 5I7VA 4BQRA 1NQTA 1VE9A 4M86A 3LLSA 4DLLA 4LMRA 4J0FA 1QYDA 3KVOA 5BSEA 4ZQEA 4MKXA 2FP4A 3E9NA 1GDHA 1T25A 4FFRA 5L53A 3DZHA 4XDYA 1K6XA 3HDQA 3H2ZA 2NVWA 5K6AC 1ZCJA 4ND4A 4RPJA 2WYUA 2X0JA 3ETDA 3P7MA 1N9GB 1RPNA 1ML3A 5FFFA 1E6WA 4ZA2A 5JDCA 1HE5A 3QLJA 3RJ5A 2PFGA 4YT5A 3OJLA 4FW8A 1H6AA 5DCWA 2X22A 1IHXA 1LLDA 3F5SA 2C07A 3PIIA 1GADO 4XRGA 4IJVA 4J1SA 5BSGA 4JNKA 3ZHYA 4IDAA 1ZJZA 1ZK2A 1ZUD1 5L7TA 3DBRB 5IFLA 1DXYA 4WCFC 4CM8A 2YV2A 4DQVA 8LDHA 3ONFA 2X86A 1LU9A 5I9NA 4F46A 3FR8A 5EERA 3GN2A 1LQTA 4J0EA 4AJPA 2BF7A 2BH9A 4DC1A 2CMDA 4BNUA 1HDGO 4GX1A 1HF3A 2IXAA 4YT4A 3DDNA 1BXZA 3C24A 2BKAA 2CVOA 4PLGA 3G79A 1YE3A 1R0KA 2X9VA 4GI2A 3VH3A 3WGYA 1LBEA 4CMKA 4MINA 3COSA 3S2FA 3INTA 4WJZA 1VLLA 4J43A 1MXFA 3C1TA 4OGWA 4RVFA 2HDHA 4XX0A 4A73A 4L73A 4RPKA 1X7DA 1YB4A 1P74A 3DFZA 4TRRA 1KC3A 1KVQA 2VWPA 4FR5A 1HSOA 1PTJA 4A7PA 4FBGA 3OBBA 4FPXA 1NHWA 4BO2A 1GZ3A 1Y5RA 2YFQA 3H6KA 4JBHA 4BNXA 1U1IA 3SX2A 1LSOA 3ABIA 2LDXA 3ITKA 4FGWA 4HFMA 2PKQO 2HMWA 1NBOA 3WMXA 1T1RA 1EQUA 3H9UA 4OHUA 3FTPA 3WIDA 2FN7A 5TT0A 1NYTA 3HFGA 3FWZA 3BZUA 3PJDA 1KVTA 4MKRA 1DRWA 2C82A 4OM8A 1GYPA 4DLAA 3JQGA 1XDWA 3TL3A 5T6BA 1DIHA 4IDBA 4FFMA 2QW8A 1M2WA 3N74A 3DQPA 4CLDA 1HRDA 4LCEA 1D7OA 1N1EA 4J4TA 2J6IA 2C20A 1SNYA 3GUYA 2IEBA 3JV7A 3O38A 1U9JA 2Y0DA 3NTQA 3WQSB 4ZJUA 3GT0A 3DHYA 1X7HA 3GH3A 2R00C 3OIGA 3C7DB 3GGPA 1ZXBA 4GKBA 4RORA 5G4KB 4EDFA 1B8VA 2C0CA 3FRJA 1JAYA 2YW9A 5KJ6A 3WGGA 3BTVA 4BNTA 1X14A 5JLAA 4RVUA 2YHIB 2C2XA 4O63O 1C0IA 3VH4A 2AQ8A 1DC3A 2WD7B 3LC2O 2IZ0A 3DOOA 4A0SA 3CMMA 1LTHR 5IDYA 1LX6A 4QSMA 4XZ3A 4D0SA 4AJ4A 5F3RA 3GVHA 1NXQA 2HAEA 1PJ2A 1SEVA 5KTKA 3U0BA 1LNQA 4GMGA 5F1KA 5A3VA 3ZU2A 4P4GA 4KUHA 4DQXA 2GR9A 5LDHA 1T26A 3CZRA 3JQ6A 4RPHA 3LZ6A 4J1TA 3NEPX 1E0DA 3R3SA 1O6ZA 4J2HA 4EITA 1HKUA 2CDBA 3DBHB 3ZV5A 1G6KA 2PK3A 1CEQA 3IMFA 3K92A 4NPCA 5EMHA 1ZSNA 4YRDA 1LDYA 4OAQA 2IZ1A 1PR9A 4IPTA 1LSJA 3RWBA 3HFSA 4CMHA 4NBUA 1V6AA 3IC5A 1Y81A 2JL1A 2O4UX 1PGNA 1XG5A 4R5MA 1VJ0A 3WQRA 1KIFA 4HP8A 1QKIA 4BB5A 5K6AA 1B3BA 4QQRA 3CUKA 3OJ0A 4ALKA 1J0XO 2WD8A 4DPMA 2OBNA 4YYZA 4PIVA 3WLEA 3EY4A 4BO5A 1XU9A 2GF2A 1ISGA 1E5QA 1HTBA 1UAGA 3K31A 5TIIA 2PH3A 2FSVA 4CLXA 1S7CA 1TLTA 4WNIA 4CLRA 1F14A 3AM5A 5G0WA 4UVEA 2QG4A 1WAMA 3KBOA 3LT4A 3GVIA 4GMFA 4KZPA 1GCOA 1ZBQA 2X58A 4YJFB 1PL8A 2ZB7A 5KJCA 2DUWA 2H63A 4A2CA 3JCZA 2OORA 2DFDA 2VOJA 3EVTA 3V2GA 1WLYA 1H6CA 3JD0A 2O3UA 4U5QA 5JYDA 3PXXA 5DDIP 2DC1A 3CIFA 3IAHA 3RC9A 4W6ZA 4I9UA 1Q0QA 1N2SA 1ADGA 1KEWA 2FR0A 4C7JA 5FI3A 1UDAA 1A72A 4JP2A 1N1GA 4CQMA 1P1RA 5A9SB 2EGGA 4CMIA 5KCZA 3GRPA 2Y1CA 1DDOA 3NDJA 5EPOA 1SOWA 3M2TA 5T57A 2CVZA 3PHHA 4CMBA 1AHHA 1QYVA 4WLFA 3BMOA 5ILGA 6ADHA 4XGIA 2CSUA 1WNTA 1ZK4A 1ZIDA 4ND5A 4E21A 1LDGA 1ENYA 3ZWWA 3H5NA 4RQTA 1RKXA 1IE3A 4Y98A 4CM9D 3IQDB 4GPD1 3Q2IA 5JDIC 3KOUA 2EEZA 5JDIA 2Q2QA 3JD4A 1I3NA 2YHIA 1W4ZA 2Y99A 4IGFA 4DUPA 1CETA 1GCUA 1DIBA 3JQ8A 1HSZA 4N5LA 4MOWA 3L4SO 2HO5A 5C7OO 4CM8B 5EL0A 2OUIA 1GEEA 1SO8A 3E18A 4IDFA 1GUYA 3WJ7A 1B3RA 2NADA 1BGVA 5L51A 1HE4A 2A9FA 2I3GA 3LDHA 1ISHA 4I8XA 4ZQHA 1PGJA 2VWGA 3M2PA 1JN0A 3DB2A 2DQ4A 3D4NA 4Y6RA 4EJMA 2JD1A 1AXGA 2ZIZA 1I3LA 4Z3KA 5HA5A 5JY1A 1FDUA 2GZ1A 1XYGA 2ZYDA 1LC3A 4QEDA 3GVPA 2GGSA 3WB9A 3S1LA 4FSHA 1M76A 3Q1LA 2FWMX 2GO1A 3W8DA 2BI8A 4YT8A 5K0ZA 1CF2O 1JKIA 5CAEA 3C3XA 5A1TA 1H2BA 3JQBA 5JAZA 1NASA 5JNLA 3SC6A 3KYDB 4ZQGA 5DN9A 1YQDA 1TB4A 1XSEA 3VPFA 1YB1A 2AXQA 2NVUB 4DPLA 4Y9DA 1P44A 1Q7GA 3STHA 1JW9B 3I9JA 2VHYA 3AUSA 1M66A 2QRJA 3GNTA 4P38A 4IIVA 3NJ4A 2D4AA 1HL3A 2EP5A 4R4JA 3ZWCA 4XA8A 5A06A 2YV1A 4CMGA 3KRTA 1DFHA 1H5QA 5F1PA 1U4SA 3ENKA 1U3TA 4NU6A 5I8ZA 3PJGA 1U4OA 1MA0A 3RC1A 3U4IA 2AEMA 4LN1A 4K26A 1R6DA 5DBFA 1YJQA 4O6VA 4RV9A 5CHEA 1FDTA 1NQAO 5BNIA 1U3UA 3ITDA 5L7YA 4IJKA 1OI7A 2JD2A 4IS2A 4I5GA 2CFCA 3V2HA 3MOIA 3DZBA 5HM8A 4YWJA 2LDBA 3JD3A 3PHLA 2B4QA 4XEHA 3D5QA 1NFRA 1ZNQO 2I67A 1HDXA 1RM5A 3DMTA 5C5IA 1LRLA 4FQ8A 3JQFA 4E3ZA 5KVSA 1RM3A 4D44A 5IJZA 3FNFA 3JQGB 1CYDA 1DC5A 2Z1NA 1DBVO 5CEEA 2X1HA 1XIVA 5FWNA 3HB5X 3GLQA 2Y0CA 2X5JO 4UEJA 1MUUA 3RUCA 4E0BA 1AUPA 4ALNA 1CIVA 3AK4A 4TVOA 3AU8A 3DBLA 3O26A 3L4BC 3QY9A 5L3ZA 5JW6A 2XOXA 1IUKA 3S2GA 4B7XA 1HDZA 3GDGA 1HETA 4ZN6A 4PGFA 2IXBA 4Z9XA 1R4MA 1C14A 3GQVA 2GN4A 3FI9A 1U5CA 3N7UA 4O0LA 3WS7A 4CM4A 3O9ZA 4RZHA 2O7QA 4W4TA 3RFTA 5A04A 3FWNA 2WTBA 3HSKA 2HMUA 2P5YA 3OMLA 1GAEO 1KVRA 4J4HA 4EBFA 2R00A 2DT5A 4BO9A 5IZCA 4LVCA 3GN1A 1NWHA 1EZ4A 2GZ3A 3HG7A 3Q9NA 5JXWA 4I9HA 1ZO8A 1Y8RA 2JAPA 2V65A 4CMAA 2O3TA 1K5HA 2EJVA 2AE2A 2WWRA 3LT0A 1QV6A 3QSGA 4B7UA 3RC7A 4BNYA 1DIGA 3W4JA 3IUSA 4R69A 2JHGA 3M1AA 3BXXA 4FCCA 3VAZA 1B8PA 2EWMA 3LF2A 4YJGA 3H4VA 3O4RA 2GCGA 1X13A 1WDMA 2HMTA 1PZHA 3O8QB 3SEFA 3QWAA 5THKA 4FS3A 3RFXA 1PX0A 1VSUA 2X5OA 2DUUA 4R9SA 1AXEA 4DREA 4R1UA 3C1AA 4CL3A 2NUAA 3H9JA 3PZRA 1GY8A 2ZK7A 2DTEA 2NLOA 3WWZA 2HKIA 2GASA 3GEGA 1P31A 3D4PA 4ZICA 5IN4A 1U3WA 4QO7A 4YJHA 4Z9YA 4BMSA 4YAIA 3AI2A 5G4KA 1C1XA 5FYDA 3BMCA 1KVUA 2HU2A 3L4BA 3ANMA 3DZIA 1E77A 4Z6KA 1PL6A 3CSDA 2VTDA 1GFSA 2O7SA 3PDJA 5CPBA 3L9WA 4D3DA 3HDJA 2PNFA 1IL0A 3FTNA 3R1IA 1LQUA 2WE7A 4JIGA 3WQQA 4W7IA 2Z1MA 3FSRA 4YBZA 1XWFA 2Z5LA 3PHGA 1G0NA 2G1UA 2Q49A 2B36A 3V1TC 4WEQA 1BDMA 3SVTA 4NBVA 3E03A 1R12A 1NR7A 4J1NA 2AHRA 2FOIA 1RM4A 4JJFA 1H93A 3M1LA 4YJGB 2A35A 5IDWA 1V35A 1V3VA 2J3IA 3NV9A 3RUHA 3RUAA 2PD4A 4ZU3A 4F6LA 2TMGA 3AUAA 4WEOA 2VHZA 3ZWBA 3FN4A 3HN2A 1ISFA 3SC4A 3MJSA 1V3UA 4C7KA 4EEZA 4IDEA 2QQ5A 4KTVE 4BMVA 4LK3A 2X6TA 2E49A 3P19A 3QWBA 4IXTA 4CMJA 1HDOA 4DTIA 1ARZA 1IZ9A 1YL5A 1FJHA 1I3KA 4PG7A 1WZEA 2RH8A 2YYYA 3E82A 4Q3NA 1C3VA 1R16A 1MC4A 3F1KA 3HNPA 4EGFA 3LSYA 1PL7A 3WBFA 2C7VA 3GMDA 3ROPA 1JTVA 1OBFO 1ADCA 2DBRA 4LCJA 2W98A 3MWEB 3DOJA 4DBVO 3X2EA 3E1KA 3B6ZA 5A3JA 3OQ1A 3WR5A 3TPCA 2EP7A 1MLDA 4MVJD 1GV0A 2GYYA 5A9SA 3FBTA 1VPDA 2UVDA 5CEFA 3PFFA 3CTMA 1HEUA 1E7WA 2CDAA 4NFSA 2VNSA 4BMNA 4IGEA 1KETA 4LISA 5ES3A 1YONA 1UP7A 1RJWA 3AFMA 4K6FA 4OOFA 3WGTA 2FY8A 2ZJ1A 3UKOA 2H9IA 3PI7A 4GH5A 1Q1NA 4MVJM 1WMAA 2EKLA 4NDNE 3ZNOA 3V1UA 1VKNA 3QWFA 2J3JA 4BGUA 5H83A 5CFZA 1GTMA 4QXMA 3GDFA 1DLJA 1C1DB 1DFIA 3HE3A 2FR1A 3DHEA 4IJUA 4TRJA 2CY0A 3VH2A 3M6IA 4EJ0A 4HV4A 4H7PA 1LDMA 2V6FA 4URFA 1EK5A 1XELA 2Z95A 4FOOA 4BV8A 1XA0A 2D3TA 4FDAA 2PY6A 4EI2A 1EDOA 3DTTA 4OKNA 2HSDA 3ZU5A 1ENZA 2NWQA 2VYVD 4R51A 3GAFA 1ONNA 3KEOA 2ZCVA 4F45A 1DAPA 1P1KA 4ND1A 3WBBA 2VUUA 2Y1GA 4J49A 1MGOA 5COBA 4D41A 2IYOA 3TOZA 2X8LA 4F3YA 4KMSA 4PVCA 1LI4A 3RROA 2HMVA 4D3FA 4UVHA 1QP8A 3PP8A 4I1IA 3W4KA 1EVZA 3K2EA 4BGVA 3WGOA 1YVEI 3B1JA 3GZNA 1XR3A 3CE6A 3F3SA 1YXMA 1EE2A 5ICMA 1SZJG 3A9WA 3ANLA 3VPXA 4DVJA 1D8AA 3L0DA 1N7GA 3WTCA 1PZEA 2EKQA 3L77A 5JE8A 3WWYA 4J91A 1MFPA 3JQ7A 2Q46A 2Y05A 5JMPA 1ZK3A 4II3A 3E5RA 1NHGA 2BLLA 2GNAA 1YB5A 2X9GA 5ICSA 1R66A 3L6DA 1PEDA 4CODB 4GQAA 3QVTA 5JPIA 2W8ZA 3H5AA 2X23A 2E37A 4YJFA 4BL5A 1OMOA 3C7CB 3IUPA 4BVAA 2DKNA 3GNQA 1DJQA 1JA9A 2OBYA 1EUDA 1GL3A 2DPHA 5TQVA 3LQFA 3ZNQA 1LDNA 1UXJA 3KZVA 4FJ2A 1X1TA 3QP9A 2P4HX 4BO8A 4XIYA 5H82A 3V1YA 4XD2A 3DWFA 4XGNA 1ADFA 2IDZA 1Y1PA 1T1SA 3LLVA 3FCOA 3PRJA 3VH1A 4FN4A 4S1VA 4TKLA 4EZBA 5C7IO 1Q2XA 2PKQP 1FDWA 3DBLB 2R2GA 3WGQA 2JCVA 4JJIA 1T2EA 2NU6A 5EQDA 4O59O 4A26A 2PZJA 2V7PA 4CPDA 4E13A 5I9LA 1NR1A 1QRRA 1MG0A 4TMFA 3W4IA 5K1SA 2PKRA 4KDFA 3FNGA 1HDYA 1LA2A 4G5HA 3RUFA 1V0JA 1Z75A 4YDRA 3ZNPA 4Z9FA 4L9RA 4BV9A 4NU5A 5THQA 1P3DA 2ZTVA 1NM5A 3ONEA 1YBMA 3UUWA 4BUCA 2ZQYA 4NH4A 2W2KA 1QV7A 2FHSA 1OC2A 3DHNA 2VHVA 2B69A 3WFIA 4YEDA 1N9GA 4JLWA 5G0VA 2AQIA 3I9OA 4LRTB 3Q11A 2HUNA 4EUHA 5JY6A 5KOIA 1WZIA 4CUJA 3JQAA 3QW2A 4WOJA 4B3HA 4MKZA 1KS9A 2Y1FA 5F21A 1CDOA 3CXRA 4J2OA 4DL9A 5COAA 4PN3A 5L4LA 2Q4BA 1KC1A 1GZ6A 2BELA 4IZHA 4E5MA 2I76A 3S8MA 3H8VA 1LUAA 3KYDA 5TS3A 1SC6A 3JQDA 1DOHA 4NFHA 2FZEA 4N7RA 5TJ9A 1Z6ZA 4AJJA 5A9TA 2EF1A 4XR4A 3I9NA 1JQBA 5CDUA 4HXYA 4L4SA 1A7KA 2VWQA 5J23A 4GVXA 4L76A 3RUDA 3OETA 2W2LD 3AI3A 3JYQA 4JXKA 4BNJA 2UUPA 3B1FA 4R9RA 1K3TA 5HRUA 3WJAA 1TT5A 4RF3A 4I5EA 2VYVA 4PZDA 1C1XB 2JJYA 3U4DA 2JFFA 2ILTA 3IDSA 3DFUA 5KVQA 2D0IA 4QTZA 4LVUA 3WGIA 1I30A 1C0LA 4AJOA 3D5TA 5KKAA 3NT4A 2PH5A 2C7GA 2DLDA 3KETA 3BMQA 4M8SA 5AXDA 4E5NA 5DOZA 3GUCA 5G2OA 4M54A 3X2FA 2Y93A 3QE3A 5JSFA 1A5ZA 3DZFA 1A9ZA 4HKTA 4NIMA 5I7SA 1E3WB 2X0IA 2EIHA 4CJXA 4GBJA 4GLLA 4DIOA 4IMPA 4QT0A 3DAGA 1NAIA 3DZJA 4PG8A 3I1JA 5IZ4A 4RGBA 4NBWA 3VZSA 3WGHA 5ENDA 3L9XA 5JAMA 2OO5A 4E2XA 3NAQA 5MGBA 5JFOA 3K9QO 3RBXA 2BGLA 2GERA 4FJ0A 1NPDA 1XQ6A 3I6QA 4INAA 3KTDA 4MVJP 2C54A 3PHIA 1NQ5A 3H7AA 2Q1WA 4CMEA 1UZLA 3BHJA 4XCVA 5JO9A 5A9RA 3KB6A 2E82A 2O2SA 4J4BA 3H9GA 2UYYA 3RAJA 5ITVA 3ADOA 4OSPA 1Y9AA 4XIJA 4WLUA 2HCTA 4IIUA 4E30A 4U0KA 1PWZA 5DNAA 5L4NA 5FEUA 8ADHA 2NV6A 2B0JA 2W90A 1H94A 5U4QA 3ZWNA 1Z45A 4CLRB 1DIAA 1D4FA 2PZMA 1I8TA 4NFYA 4II2A 5TF4A 5C37A 3P2YA 3NTRA 3V8BA 1G0OA 2BFOA 5JDCC 4B79A 2BI7A 4P22A 4UVGA 2O48X 3IS3A 2WMDA 4E2ZA 1HT0A 3S2EA 3UGKA 5TNXA 1YOVB 4YAKA 3CKYA 1BW9B 3OICA 4BNFA 2IODA 4PG5A 5KNLA 2P68A 2B35A 3RU9A 2PGJA 3FHLA 4G81A 3VTFA 3WDSA 4ONEA 3RBVA 4KTTE 5GZ3A 2ZTLA 5DP2A 4Q39A 3VPHA 2I5PO 5JC1A 1RYDA 2HRBA 2NU9A 4NHEA 4CV1A 5HS4A 4KUEA 3V5NA 4NJOA 3QVWA 9LDTA 4YAJA 2QX7A 2ET6A 4J9VA 1EDZA 2QHXA 1MV8A 3EZYA 2ZQZA 4PLCA 3H3FA 1DRUA 1NP3A 4U6SA 1IB6A 3PJEA 4OXNA 4E5KA 1ISIA 3WX0A 1ZXLA 1TXGA 3DZKA 5AXBA 4BNVA 4E32A 3OP4A 4FFNA 1XCBA 4DXHA 2IEDA 5I9MA 3SBOA 2G5CA 3R0IA 2VZ9A 4KP7A 2CF6A 5HTOA 3RI3A 4ND3A 1GQYA 5G0TA 4B4WA 1JAXA 3VVBA 1PGOA 1I5RA 1P45A 2J3KA 1U2GA 2VUTA 1NVGA 2QIOA 4CM6A 1BHSA 3R3JA 3WOHA 5JO0A 4YQZA 3E5MA 1CWUA 3WXBA 1TEHA 4AVYA 4YPOA 1E7YA 5KWEA 1V9LA 4NR0A 1L7EA 4GKVA 3CZMA 3W6UA 4XWYA 5CP8A 4MP8A 5ER9A 1WVGA 1CQIA 3QRWA 1DJNA 2A92A 3KXDA 2AW5A 4TROA 1EBUA 4QFDA 2DPGA 4QX6A 1YOVA 4OYRA 3NGLA 1EQ2A 3OA0A 2OXIA 5K9ZA 5L45A 2Y1EA 4LSMA 4J7CA 1KOLA 4B3IA 5H81A 5IXSA 3MJCA 5JAIA 4PG4A 2CD9A 3DC2A 2YUTA 2PV7A 2AEJA 2GSDA 2Q50A 2X5KO 1RM0A 4IDGA 4UREA 3MJTA 3TZHA 1X1EA 3DOCA 4JJGA 3NJ8A 2I6TA 1O8CA 4PZCA 4DBZA 2J3HA 3E8XA 5T5QA 1MP0A 1Z7BA 4AJ2A 2WD7A 2GD1O 1ZK1A 1LSUA 3B20A 1E92A 2WYVA 3IKTA 4L74A 3MTGA 3G49A 2XF8A 3GDOA 2ZJ0A 4H16A 1W8DA 3WNVA 4FFOA 1F8FA 3AY6A 3GPDG 2EW2A 4U7WA 3QHAA 3EGOA 2Y66A 3K30A 1RWBA 1GEGA 5IF3A 4NG5A 1VL6A 4WCDA 3T4XA 1BSVA 2P9GA 1OAAA 2FR8A 2JD0A 3NRCA 1SB8A 5F1OA 4YTEA 4J16A 3NDIA 4X54A 1EK6A 4E4YA 1YWGO 1DC6A 3KUXA 1EFKA 4WK6A 1XQ1A 3MTJA 4PRLA 1LRKA 4ZHSA 1ULSA 1I2CA 2D5AA 1RYEA 3MJ4A 4G2NA 3LC7O 3O8QA 4IDCA 1O9BA 4XJSA 2NVUA 2P2SA 4CQMB 5MDHA 4TRMA 1PIWA 2QZ9A 3CEAA 4WLVA 3ZDFA 1HWYA 5CDTA 4J90A 4DPKA 3OECA 3JQ8B 1ONPA 2D59A 1YRLA 3BMOB 1R37A 4R1SA 1N5DA 3F4BA 4UUMA 4IY1A 3RKRA 1FF9A 1K6IA 3FF4A 2AE1A 3PWKA 4LMPA 3JQEA 4MO2A 2GDZA 3E6AA 4RF5A 4BHTA 2Q99A 4BNNA 4MIOA 4AG3A 2QZZA 2X0RA 2HK8A 1MXHA 2QRKA 3LF1A 5JAQA 5ITWA 4YT2A 3KLPX 3VKVA 5AXAA 4AJNA 2A4KA 2FPGA 2O23A 3E9MA 3GZ4A 4WLNA 4YVFA 4U6QA 2JHFA 1VM6A 3P2OA 1DFGA 4I08A 1DC4A 1CJCA 1VJTA 4MVJE 4CM1A 1NFQA 1VC2A 4H3VA 2V6GA 1WP4A 2EERA 1ZZEA 3GEMA 4MVJG 1ZEMA 5CG2A 5GMOA 2NM0A 3SLGA 1PSDA 4NBTA 1GV1A 4JBIA 4W9NA 3BA1A 3PYXA 2AEFA 3TZKA 2DU8A 1MX3A 1SCUA 3I6IA 4AJHA 1F8GA 2FSSA 3Q3CA 4NMHA 1T2FA 3OEWA 3A06A 1IPEA 4GGPA 3QVOA 1ONOA 1E1KA 1E6UA 3A28A 2ZTMA 2GN6A 1PJ3A 4BNWA 3DTYA 3BMNB 4MVJF 2NQTA 1YL6A 2I65A 4WE3A 5HBRA 4BKPA 3W6ZA 3OQ6A 5CEJA 2UDPA 1OZAA 3VZQA 1LEHA 3F9IA 4CM5A 5IZCC 5EESA 3MWDB 4BOYA 4R1TA 1ZSVA 1UUFA 2VUSA 1H0KA 4PLWA 3TWOA 4D7AA 2Y1DA 1PJQA 1JDJA 3SJ7A 1EUCA 2HRZA 3DZGA 3JQ9C 3GRKA 4RPLA 5I7EA 4M49A 1YBAA 1KY4A 1LSSA 2VZ8A 1Q0HA 5T64A 1B0AA 3HWRA 3WFJA 5KJEA 3PLRA 4Z0PA 1E3JA 2EXXA 4FFPA 4UVDA 3JTMA 3G0OA 1BWSA 5C7LO 3GGGA 4EUFA 1O89A 2DVMA 4I9NA 4BO6A 3I5MA 1BVUA 4BKQA 1I0ZA 4D79A 3FR7A 1CQJA 2HLPA 3R6DA 1KVSA 1ULUA 1Y7TA 3GR6A 4D46A 4OMUA 3WIEA 2Q2WA 4BS9A 1HYEA 2R6JA 4E6PA 2P91A 1F17A 2G17A 3DL2A 4TKMA 3NT2A 5DCYA 3DMTC 4BO0A 5HWSA 4JN6B 4AJKA 1Y8RB 2P9EA 3I9KA 3ULKA 4TZTA 3IJRA 2HMSA 3BMCB 4GAEA 5AYVA 1I10A 5CDSA 3ZH2A 1A4UA 1DAOA 4IINA 5KVVA 4IXWA 3GFBA 4JBGA 4H15A 4KUGA 2P9CA 4QFCA 1GZ4A 4AJLA 1ZMTA 2J8ZA 2VT3A 3RQSA 5KJFA 1WPQA 4RJTA 5IDXA 3MEQA 1H2HA 2RIRA 3RCBA 4AJIA 4YQYA 3DR3A 5A03A 2WE8A 5B12A 3O03A 3D64A 4AJEA 2JCXA 1PS9A 1PZFA 3PEFA 1A9YA 1W0CA 3ONDA 1N8KA 5CG1A 3FNEA 3JYNA 1YQGA 3TFOA 3B70A 2I99A 3UVEA 3D1LA 4XRRA 3JYPA 4OJNA 4R54A 1H9AA 2OP1A 2UV8A 3KSZO 5DULA 4CM7A 4R41A 1HYHA 5BSHA 4BGEA 1VJ1A 2YDYA 4MDHA 3D4OA 4EUEA 1UP6A 2VWHA 1UXIA 4DRYA 2BGKA 1DEHA 2DTDA 1R4NB 3U49A 1U8XX 1MG5A 1R4MB 4QECA 4WECA 2YFHA 3PZBA 3UCXA 1KEUA 2P4QA 1PS8A 3GZNB 4UVIA 3LK7A 4OL9A 4EJ6A 4OXKA 5T67A 3F46A 3GF4A 3AOEA 2JCYA 2ZCUA 1Q0LA 3JQCA 4FFLA 1K2WA 3IIEA 4P4LA 4D45A 4RZIA 1YDEA 1YO6A 4WLOA 1ZW1A 3HDHA 1GU7A 4ALJA 1GUFA 1E3EA 4PZEA 2DBQA 3QJ5A 4GVLA 3T7EA 4IJWA 3F47A 4CMEC 4PLZA 5IDQA 2EJWA 1ADBA 1JKJA 3VHRA 4DGSA 3OH8A 4Y67A 3H2SA 3AU9A 4Q3CA 3LYLA 5KJ1A 1KBZA 5T8KC 4HFRA 4HWKA 4XQCA 1V3TA 3ROMA 4DIBA 2ZYGA 4PLFA 2B83A 5COQA 3IP1A 1AE1A 2FRDA 5B1YA 4PVDA 3PTZA 4BGIA 4FB5A 1YGYA 5G0SA 3PLNA 3EMKA 4OQZA 5GZ6A 1JWAB 1Q7BA 2OZPA 4P4NA 1ZEJA 2XPCA 5DBGA 2TMDA 1K6JA 1ZSYA 3FBGA 1OC4A 4WNCA 2EKPA 2CUKA 4PLHA 1JVSA 2GLXA 2Q1SA 1SB9A 2W4QA 2YY7A 3C8MA 3GVCA 4HNHA 4BQPA 4D43A 5U9CA 2PD3A 4MVJI 1X15A 1E6EA 4UEOA 4M87A 4YA6A 4PLTA 2RHCA 1AGNA 4XYEA 1U2DA 3TRIA 5I8WA 1C1DA 5JBIA 4CV2A 5JCJA 4BNGA 3SLKA 4UUPA 4JK3A 3AI1A 1DHRA 3ST7A 3RBZA 1HDCA 1LDBA 4OH1A 3TN7A 3K73O 2B5WA 4JGBA 1P33A 3TDKA 3RC2A 1U28A 3ZHZA 1P9LA 1Z82A 2PWZA 1VKOA 4CLOB 5CDGA 4BKOA 3AFNA 2HK7A 1MB4A 1GQQA 2PZLA 3IOYA 4CLEA 1ZK0A 4LGVA 4BO7A 3WSWA 4R16A 3UF0A 1I3MA 1M67A 1NQOA 1GR0A 2Y1OA 4B4OA 4DYVA 3UCEA 1XGKA 3EYWA 5IXYA 1UZNA 3VVCA 1U3VA 3ZHXA 1ZFNA 3F5QA 1U5AA 3A1NA 1I01A 1DIRA 4B8WA 3PQEA 4XDZA 1QSGA 1JWBB 2GRAA 1PWXA 5F5NA 3VKUA 1QXSA 1IOLA 1WMBA 2GZ2A 1T4DA 2NU7A 3H9EO 3KEQA 1CERA 1B15A 4M1QA 5L40A 1NPYA 3LVFO 3HADA 3DXFA 2DFVA 5BNFA 4DYDA 4NZ9A 4K9DA 3D3WB 3DBVO 3K8ZA 5EN4A 2RH4A 1G1AA 1UXGA 2BGMA 3KLMX 4R5HA 3BHMA 3GG2A 3U4HA 4N5NA 3WYCA 3RKUA 3OM9A 2Q4EA 2EHDA 2Y0EA 3NYWA 5A05A 3KO8A 3RASA 1U7HA 5JCXA 3PJFA 4MVJA 1PS0A 5EIOA 4L4RA 3AJRA 4UEKA 5TRTA 3GHHA 3HN7A 4E33A 3AY7A 4XQGA 3TZCA 3BMQB 2D8AA 4GX5A 4RVSA 5A4DA 1UXHA 2B5VA 1Q7CA 4XJTA 4J7UA 3RUEA 5BSFA 4HX5A 5IAAA 2WJPA 4FIZA 3TJRA 1NNUA 3VOSA 5GZ1A 5IG2A 1YQXA 2I3AA 3ROKA 1LRJA 3QQPA 3GHYA 3A14A 1EVYA 3OJOA 3G17A 4MP6A 4Q3BA 2J5KA 1DB3A 1R4NA 3L6EA 1KEVA 4BKUA 1HE2A 2Q2VA 1P0FA 1PQPA 3NDRA 4UULA 1QYXA 4KOAA 3G1TA 1T2DA 4B4VA 3KSDO 2OP0A 3H65A 1NVMB 2Q1TA 4E31A 3VZRA 3INGA 3CMCO 2PR2A 5FI5A 2OMEA 1O95A 3JQAD 1XLTA 3AOEC 4K6CA 2BD0A 1NAHA 4CQMD 2G0TA 3VTZA 4EYEA 5I7FA 5JCJD 1K0UA 5BQFA 1GQ2A 2NSDA 4TRNA 3BIOA 1GYQA 1PU2A 4MIYA 3VDRA 4JROA 1YDWA 3HQ4O 2UAGA 4HNGA 2QRLA 1H9BA 5LCXA 2VN8A 3EUWA 4RO0A 2Q3EA 4ESOA 1Z74A 3NGXA 5DF1A 4PRKA 2BFAA 1NPTO 1GD1O 3S2IA 3JSAA 3IJPA 1E1LA 3ZCXA 4CUKA 3UH1A 5B4TA 4HUJA 4XB1A 1BXGB 4JQCA 2NQ8A 1M6WA 4WUVA 3AUTA 1DSSG 1PZGA 3ZI0A 4RLHA 2BHLA 1FXSA 1DPGA 3EW7A 3UICA 4Z0TA 2WEKA 3DBHA 2HQ1A 2VT2A 3QVSA 3QV1A 5ADHA 3OJFA 2XXJA 1O94A 1E1NA 1FMCA 2VYNA 1YKFA 3CPSA 3PQFA 4OOEA 3HUDA 3RFVA 4JX8A 2Q1UA 5JC8A 1E7MA 5BR7A 4E2WA 3KYCA 5TGDA 2C29D 3PPIA 4FGSA 1B2LA 3K5PA 3NKLA 1QMGA 4ZRNA 4PCVA 3ZGYA 1Y8QA 1YS4A 2YZ7A 5JMWA 1KERA 2E48A 4C4OA 4LRSB 1WWKA 4WKGA 3DAPA 1BRMA 4OSOA 3LU1A 4ZD6A 2RCYA 1W73A 1AHIA 3JQFC 4OKIA 3WSVA 2OL4A 2VOEA 4CV0A 3NUGA 2IE0A 4OO3A 4D42A 3PGXA 1KEPA 2C59A 3JD2A 3E9QA 5EJ2A 2O3JA 4IMRA 1H6DA 5CPFA 1OFGA 4NNJA 3K96A 3ICPA 5GY7A 4YAGA 4ALLA 4YRAA 2DBZA 4CV3A 4RVGA 1J49A 1H6BA 1P0CA 2ZKLA 3DEYX 3GC6A 3IKVA 5BNTA 4RVHA 3Q2KA 1YJ8A 3EVNA 1WXDA 4L8VA 3HDYA 4IQ0A 4Q3AA 4TWRA 1HE3A 2AQKA 3RVDA 3PFWO 9LDBA 3HZZA 1NX6A 2ZB4A 1SMKA 2VZ0A 2CVQA 1M75A 4DA9A 3U5TA 4IS3A 2JKVA 1QLJA 1A7AA 3KM0A 2B4TO 1ZVMA 3SJUA 1QR6A 3VZPA 4NK5A 3VPSA 2VNAA 1ZH8A 2YQ4A 1UR5A 1SAYA 1FK8A 1HLDA 3U62A 4UUOA 2QYSA 4OQYA 4YXFA 3PHJA 4E5YA 3VPGA 3PYLA 2EGHA 3N58A 2IYPA 3AY3A 2NU8A 1NWCA 4WASA 3INRA 3NTOA 4CM3A 1VSVA 2G82A 2VRCA 4DQUA 2E6UX 4YB8A 1PJBA 2NTNA 2V6MA 4RQUA 2GN8A
chains in the Genus database with same CATH superfamily
4HGZA 1Z6AA 2MMCA 4QJIA 4TPKA 3SHFA 4CR8A 4Q7KA 3O4GA 4FOTA 1APBA 4Y0AA 1HT3A 1Z5OA 3QHQA 4Q4AB 1X0XA 2XODA 2ZTUA 5IEJA 3NR2A 2O3SA 3AM4A 2LCFA 4N5MA 1ENPA 5BT9A 3SJAA 3E23A 1WMSA 1AA6A 1NL3A 2AL7A 1NN1A 2OHXA 1T0PA 5D85A 1U11A 3DXZA 2R751 4HDRA 3JD1A 1NVTA 2H2WA 3DMYA 5E6RA 4ILKA 4XYBA 2Z0MA 1RQPA 3O1JC 3Q1KA 4EGCB 1NN0A 1TI7A 4AIIA 2GQ0A 5DOVA 2Q6OA 2X0NA 3TO5A 2HSEA 4CMCA 4R1OA 1ENOA 2P2DA 2ZRNA 4QE3A 3OZVA 4FI3C 3UJ6A 4G8JA 4PHFA 2NTVA 2OCDA 2FPPB 2I2CA 4IUYA 2X5NA 3HM2A 5CDYA 3H42B 4GX0A 2H1WA 1P2BA 1UJMA 3A1FA 3F9CA 3FCXA 3W3AA 2YYSA 1U31A 5EXPA 3TFQA 1IZ0A 2P5UA 1B2RA 4WVLA 1H1TA 2NUBA 3R2JA 1T5OA 4HWSA 5E0KB 2DFLA 1J33A 1T3SA 2DHEA 4Q1BA 4URVR 2FE4A 4PRZA 1M34B 1RRVA 4DA4A 5KYGA 3OCCA 1L4BA 1A82A 2OGUA 3EPPA 5EWJA 5TJHA 1Z8DA 4BRWA 1GA6A 3LVQE 4RVCA 2DFPA 4A1FA 5JJKA 3LWBA 1V7PC 3AVUA 4L15A 5L9AA 1V5WA 2FPIA 2PN1A 4LRUA 1DEAA 5DE3A 3ZWVA 2F00A 1U6IA 3F1LA 3ADKA 3DONA 3GMSA 3NLLA 3FJYA 2CZCA 1OXTA 1CUCA 2DUJA 1ZC4A 2IUTA 5EINA 4MR8B 5FUQA 1PJLA 5TF0A 4IEEA 3SSMA 1WXIA 3MZ0A 4OHRA 1N9KA 1WW8A 4ZWNA 3I5XA 1U5BA 5PNTA 3OPYI 2QQEA 1P1HA 2B5OA 3BFPA 2WFZA 4KQ2A 1SUCA 4GM4A 1TLFA 1D8TA 1W6RA 2X4GA 3MJEA 4NAVA 4BO1A 2G4VA 3UMMA 1CY6A 4KXLA 2WMOB 2GUGA 3CH7A 4TOIA 3UH0A 4GC5A 1A8PA 1QVVA 1H2AS 1ORHA 2AMFA 4PQGA 1UJNA 3HUEA 2YWRA 4UKDA 1MB9A 3DMFA 4OJQA 4BJ5A 1J5PA 1XU7A 3UB4A 1P4GA 2ENUA 5H4GA 4HZGA 1SG0A 3RABA 4JP5A 4G0XA 1VGRA 5LQCA 2L82A 2JAWA 5TLSA 1O87A 2IW1A 1XEAA 4EI7A 3G0CA 2IEAA 3D7LA 3KYCB 1EE9A 1Y3HA 1XDDA 3P5SA 2BBWA 1B6RA 4TLLB 3ZDCA 3QU2A 1O5TA 3LPDA 3EC7A 2RHHA 2VQ3A 4OIMA 5EUBA 4KDEA 4WKBA 4R83A 3DWEX 5IN5A 4GZMA 2MU1A 3AJEA 3GY0A 4IBOA 4K28A 1U80A 3B5JA 3SXPA 4AF6A 4BMPB 1YGPA 1JFFB 1T1JA 1OWLA 1J0EA 4U2DA 4LJKA 2SCUA 3A6GA 4TZKA 1VQ1A 4TVSA 3GLTA 1ICEA 3C41J 1I5EA 1E3SA 2EG9A 4MA5A 1EEHA 2HL6A 1PR3A 1T2AA 1TUBB 2HNKA 5DRYA 2YXLA 1HR0B 2DWOA 5AVYA 3QLTA 2ON6A 4GLOA 4Q4LA 5K0TA 1T5IA 1DBWA 4KSCA 2QXYA 2VLBA 4N65A 1E7QA 3ECCA 1Z7GA 3MELA 3T1NA 1T9DA 3HA3A 2BFPA 1X7GA 2I66A 2Q4OA 1Y98A 3KR9A 2O7RA 3W5AA 4W1SA 1STOA 4HDKA 4UTXA 1YIOA 1BMQA 1DG9A 1PHPA 1YMUA 3AR4A 3HJBA 4RD1A 3VHXA 4NYJR 3BTSA 1V4VA 2OAQ1 1TO2E 2GUWA 1A8QA 4HAVA 1ZHFA 4O1MA 2GBCA 2GD2A 2PXCA 3K9BA 1U3FA 4TLCA 4Z0HO 3OJEA 3J80A 4ZYTA 4PO1A 4JCOA 2YZKA 1KOGA 2IU4A 3O94A 4I66A 5KZMB 1GTRA 2QL7A 3BZWA 3TZ6A 3I01M 4HY3A 4CM4B 5JZVA 1ODFA 3N75A 5LMZA 4C7OA 2CMKA 2O2YA 3OSUA 4WGGA 1XB2A 2NO0A 3OX2A 2O8VA 3L46A 1LKZA 1C7ZA 1YJAA 3D3WA 3OQBA 3T61A 3TLXA 1W36D 1F12A 5MFZA 2UZ4A 5DYGA 3Q5GA 3GFGA 4QBGB 1M6VB 5DK6A 2ZRJA 4LTDA 4PTLA 2OMKA 4PBRA 5H80A 4ZXFA 3VDXA 1YR3A 2FRVA 2MJLA 4QTYA 1OBHA 1B73A 4Z9BA 4OLBA 3U13A 4X8OA 5JNSA 2V1UA 3LY9A 4F97A 4EEXA 1MQ9A 2HPHA 3DLIA 2D1QA 1EVQA 1QMPA 1DBPA 2FLKA 2J85A 3E84A 4X1YA 3WO0A 1CXZA 1G2IA 4LXYA 2VK1A 2X0FA 4V1CA 3OOJA 4MZDA 3GA0A 3ZE6A 2J3MA 3ACCA 1UAYA 5BUZA 2AGVA 5BW4A 4UJ5A 2Z3VA 4N3GA 1MB0A 1Y6JA 3BXPA 3AOGA 4K6GA 5F7JA 4PC7A 5C81A 3Q8KA 4QXRA 3G3EA 5L3VA 4BQSA 5KVCA 1YA6A 5EWLB 2BBSA 3IKLA 2XGGA 4K1LA 3ZXSA 4BC1A 2C5EA 3A7DA 4U6NA 1KJ8A 4G6ZA 4WERA 1F0PA 1US8A 2HHJA 2IHBA 3HCWA 4XFDA 5K0JA 2BZ0A 1C7FA 4GU5A 5CB4A 5AOBA 3ZJVA 1ZCZA 2OWDA 4AICA 3HHEA 2BEWA 3G9TA 1XRQA 4A8PA 1J25A 2VHXA 1GNTA 3PDIA 2G07A 2IUSA 4MW6A 5F5XA 3SNHA 5B37A 4LQCA 1XWWA 4DWVA 2VEOA 1EHYA 3AUXA 3KZKA 4H7JA 4PU0A 4BNZA 4DHWA 3OEYA 1TF2A 5EP3A 1QO7A 2H5IA 3GCDA 1OXBB 3IUBA 4Y6PA 3C14C 2YNMA 3F6EX 3WGKA 4DNPA 4NI5A 3UAZA 4O1IA 5FR2A 3I83A 1XKTA 5FPKA 3H0KA 4YCAA 1K66A 4NAUA 1GSIA 3ZV6A 2X3UA 4X85A 4BQNA 5B1EA 4WH0A 1K89A 4C4XA 2A9JA 4HG2A 1XZGA 4UPDA 5AW8A 2I1LA 1E1CA 3K2IA 3I0ZA 4MKIA 2V58A 3TLAA 2BRUC 3FD8A 3IMCA 4UAGA 2VA8A 3RRJA 5LDGA 4N49A 5U1PA 2N42A 4G65A 1K1EA 3K71B 3LTNC 4XYGA 1W48A 2ZRFA 3OKFA 4J2TA 3QEJA 1KXJA 3GPIA 2WF5A 2IYRA 3WR5A 3W5HA 3QKRA 4QTTB 1QANA 3UT6A 1DI0A 4FHCA 1DDGA 1P1IA 2AJTA 3Q6MA 3AESB 4QPZA 5CLJA 2RC5A 5IYZF 3MJVA 4QDTA 4RKFA 5JLJA 2YRXA 1HI9A 2IKSA 3PE3A 4DADA 3ROTA 4FMDF 4KLCA 5KYWA 4RBNA 2OXTA 2L42A 3V1MA 4H6WA 4HYTA 3T5TA 4CEHA 4MV7A 3OO0A 1Y5MA 2C2YA 5DGIA 2C0QA 4BWVA 1I2DA 4QBFA 4F9GA 1HM5A 5TV2A 5BQ3A 1YA8A 4U3JB 2DR0A 1J9ZA 3ETGA 4BIIA 3ZDAA 5EXEA 3R5KA 2BGWA 2G3YA 2GA8A 1QZUA 4PM4A 1ETHA 3NQ41 4V1CI 2QMYA 3PWZA 5AHXA 3A9TA 4PS1A 4RPGA 1VGVA 4IDNA 3UHAA 4N3AA 5JD5A 3OQPA 3NZEA 3CINA 3HVUA 3I52A 4R8LA 1UFVA 4RVDA 1DUSA 5SZIA 1P18A 2ACWA 4HWTA 4NBRA 2VBIA 5K8VA 1GTG1 2PT9A 1OLSA 5FF9A 3ADPA 3B7GA 4LWPA 3LIIA 3CF4G 1AHNA 1VSQA 4DJ5X 4V0MA 4JY7A 4DVGA 3M0EA 1TO1E 2X8WA 2ZBFA 3MWKA 2HZBA 1PQUA 1T6BY 1WSWA 1WHTB 3DAOA 3OQIA 3PSAA 1T2CA 4O8CA 2MR5A 1VBKA 2OVFA 3I2IA 1KSJA 3QMMA 1ZX1A 4D0SA 4IXNA 4YI3A 2Q5JA 4AYTA 1E7RA 2ZJAA 5B3LA 5B6PA 3G8AA 5LIPA 4J1QA 3L06A 1KO7A 3O8NA 2Z08A 2RKWA 3TNLA 4MW7A 4DNQA 1WMFA 2VRCD 1RXYA 1I6LA 1JSZA 4O2RA 5C4IA 2WWFA 3TQCA 3U4MA 5AVOA 4DLBA 4YAEA 3S4YA 5JRZA 2AI3A 5C3MA 5K4GA 3ZIAA 1N77A 1ADYA 1E59A 3NDPA 3RRXA 2GILA 5E9WA 4DJFC 1JH8A 3W8EA 5IRCD 1W5FA 3CR7A 2X7HA 3CUYA 1HZJA 3JWHA 5LA6F 2YX1A 2QW1A 1PV4A 3VR6H 3U3MA 1IEVA 3ASVA 4ZV7A 3AWDA 1XZPA 5FX2A 4R2IA 1PNQA 3UV6A 4UCFA 1KYIA 2DUMA 4YH1A 2EC5A 1YBVA 2IXTA 3BX1A 2BEVB 3QWIA 3EA5A 1Y9DA 4G36A 4TTSA 1WCIB 2GDJA 4TV8A 2CJXA 1FFWA 2JDIA 2YFKA 1E3MA 3FWPA 4P81A 2IV2X 2PZKA 2YOGA 4IQ8A 5AJWA 4BBJA 2N46A 4DCJA 4XWTA 4UHFA 1WDLA 4DS3A 4QNNA 1F0YA 3ICCA 1T9BA 5JAOA 1QIHA 2OXEA 4NOJA 4Q9JA 3HJAA 3H1TA 1QDEA 4WZBB 4MV9A 1JVBA 4LFAB 4ZIRA 1XA4A 2ZJFA 3AO0B 4ND6A 3UV7A 3UMGA 1PR2A 2XEXA 2BKLA 1GUZA 3T4EA 2VJOA 3MYYA 4MIEA 3C1OA 3EXG1 2JW5A 2R97A 1T0HB 1B26A 2QD2A 3DNFA 3OHMA 4HDOB 3H6GA 2JIMA 4R3WA 4Y2SA 4YBRA 4AO6A 2ZJ7A 2NQ2C 3ZN2A 5B2FA 1IHDA 1UZMA 1VDMA 4Q66C 1BXKA 2X7JA 3NT5A 4ZQBA 1DARA 5KKCA 1JFFA 1PFVA 3BIJA 2GFIA 4O3MA 4K46A 2RHRA 1TKAA 1WD7A 3RUIA 1EM8A 2G0AA 2NTJA 3N0TA 4E2YA 4EY6A 5J4VA 3W5CA 1UPFA 2ZDHA 2H4WA 2QMHA 4QUGA 5A6SA 2PLAA 4LWQA 4ZEXA 3QBTA 2H17A 1SCUB 2FYTA 1TTTA 1SEPA 5JZMA 3P9PA 1MC1A 1DP4A 1K98A 1JQLB 2YJZA 3FAKA 3KD2A 5LP6C 4CM9A 2WHPA 5GJBA 1X2BA 2NO6A 4QUIA 3C2QA 3W6PA 4DT1A 1DEXA 3ED5A 3OVMA 2P1RA 2O8EA 4Q4HB 1EVKA 1Z5GA 1KJNA 1CNMA 2BCGY 2IDMA 4Q5IA 2ZIXA 4K05A 4DCGA 1L3CA 1TKCA 3CISA 5CVTA 1E1MA 2XVYA 2XUJA 4PONA 2B21A 1N2XA 2H5LA 4QT4A 3GRVA 1DQZA 4HK4A 5CK4A 2ZB3A 4ZMRA 1OILA 3DAFA 1ZMXA 2KJQA 2D00A 3UHJA 1RWPA 3HBNA 4U4AA 3EIWA 1J8VA 1RRCA 3V1KA 4DILA 1KSGA 3ZDZB 2IHVA 5JXJA 2Y92A 1DMRA 1T0JB 1V8ZA 3MFYA 1P29A 4B09A 4UNRA 4ZDJA 2NSHA 2O3RA 2YZ2A 3OA2A 4ER7A 5DM4A 4DMMA 1L7DA 4WK2B 5DIFA 1TZMA 2LVBA 2PTGA 3NI2A 4CLHA 1BDBA 2W2VA 5LC1A 1KIMA 4MV0A 4ZKEA 2GCOB 1I7DA 4PSDA 3ZGLA 2MDTA 2OGTA 1RAIA 5KU1A 3JQAB 2YVKA 4XR9A 4ZAGA 4EM6A 2B1JA 2YBDA 3ZWYA 3GX1A 1QHSA 4W5WA 1LK0A 3LYAA 4S0ZA 4ZVMA 4YJ3F 2ANCA 2AKYA 4KN8A 3X44A 3DMDA 3ZS9A 4W5RA 1G2QA 3NHUA 5DSZA 4X65B 1NQTA 4YDQA 4P98A 4M86A 4RU1A 4MR8A 3W8NA 2ZRHA 2OPHA 2FPRA 3KQWA 4IYRA 4KLZA 4XM0A 5BSEA 1TAQA 2RGGA 4MKXA 4EB6A 4L9AA 3HJCA 2QRGA 4NBNA 3GZJA 1JEQB 2FP4A 3E9NA 4B6PA 1GDHA 3FH0A 1T6YA 1I7NA 3GEPA 1M1YA 2GM9A 4F6RA 4CEJB 3DZHA 3A2MA 4RDCA 1KNXA 3RVSA 1PI3A 2R5NA 3H2ZA 4Y0VA 4G8DA 1N8SA 4WKCA 1G9XA 1JXMA 1KAEA 3OPXA 2W2TA 3C98A 1ZCJA 2A5DA 4ND4A 2AF3C 4NXNB 2WYUA 1NDHA 3N7TA 2HUPA 1N9GB 4HS9A 1RPNA 1ML3A 5ALEA 1P7WA 3PGKA 2NZYA 4UATA 6REQA 3QLJA 3FTDA 3CLTC 3R5XA 4R0VA 1OFTA 3L01A 4FW8A 5DTEA 1JHMA 1II8A 3OZCA 3JU3A 1W29A 1LLDA 3IE2A 4OHVA 4Y0NA 3RUPA 4AF7A 4C3ZA 4GGMX 4EF4A 3BE6A 4IJVA 4US0R 3X3HA 2HTEA 3AYXB 5BSGA 3FPFA 1D03A 1EK2A 1YHYA 3BWBA 4JNKA 4NENB 4WOCA 5HF6A 2V97A 3T38A 3ZHYA 1ZJZA 4O8ZA 3DBRB 8GPBA 1DXYA 1E1QD 2MYPA 5B2EA 1RPAA 1AOXA 4DQVA 8LDHA 4KPFC 1DX9A 3ABQB 1QU2A 1RI4A 4YUYA 1RQNA 5JMOA 4F4JA 3SVZA 3UHOA 3NM5A 1WW3A 3DM9B 5FOQA 1IN4A 1HYBA 4PPYA 4TSRA 4K03A 5CX1A 1VG9B 4FYMA 2AN1A 4PNZA 5EQJB 1XA3A 2ZUSA 3N3BC 4XD7A 1UC4B 1LFDB 1CP3A 3H9CA 2BF7A 4HRAA 4LJ7A 2PGOA 2XUKA 4UZFA 4BMOB 1XEWX 1GG5A 4GX1A 2IEYA 2IXAA 3ZXUB 2RH5A 3BFVA 3E1SA 3IEPA 3R3ZA 4X95A 4ZAXA 4E70A 1M72A 4B6QA 1I0LA 2BKAA 4QBKA 4LDRA 5LZ5A 4X45A 1E3QA 1WM1A 3G9QA 4HDMA 4DA7A 1ZD8A 2P1ZA 3HGTA 4CMKA 2J87A 4ZGBA 1PNVA 5AW4A 4DXDA 4CEHB 3S2FA 3PJRA 5BSMA 6GPBA 2Q07A 1RWMA 4TQUS 4XX0A 4F3YA 4C7OB 4RPKA 3WWCA 4H1TA 4TRRA 3OI7A 4MR9A 1J39A 5J2UF 2Q7XA 1YHNA 1NVUQ 2C2KA 2PUDA 3LUBA 4FR5A 1HSOA 3NV7A 3URMA 3KXLA 4XIGS 1GZ3A 1LTQA 1NBHA 2YFQA 4HATA 1VTKA 2X8JA 1K6EA 3ITKA 3GPCA 2PUEA 4HFMA 1ZVKA 4DCTA 2PKQO 2F3UA 1VE1A 1WD5A 1NBOA 5SV2A 1XHFA 3N05A 3WMXA 4N48A 1T1RA 1J5XA 1TEXA 1CQPA 3D7MA 2EYUA 1U7XA 4L9SA 2WV9A 1JIKA 4IVRA 2Q3CA 4MRAA 4WDRA 3WIDA 1AN0A 4LY9A 3SIWA 1PR1A 1GWNA 1X8LA 4X63A 3PJDA 4B81A 5B57C 1WHTA 4PFKA 5E4TA 4OM8A 1XZMA 3EBLA 3KD3A 4ZJZA 3KQHA 4OYYA 2FA9A 2CNLA 5MN4A 4IHJB 3S5JA 3A36A 5T6BA 3WLTA 4RJ2A 2B1IA 2QW8A 2HMAA 1U8TA 1QR2A 3ZIAD 1NBMA 4KX3A 4BIMA 5HNKA 4D4MA 1SNYA 3JV7A 3O38A 3FKQA 2Y0DA 1XRPA 2P6PA 1EJ0A 3LQYA 4W8HA 3EZFA 3GH3A 2D1TA 2R00C 4NMMA 2GMWA 4EOGA 3OIGA 1DAIA 4GE0A 5JFGA 4DF3A 3GFQA 5REQB 2R25B 3MAAC 4RORA 3MB5A 2OY0A 3WL6A 5IK2A 2Y0PA 1GAJA 3WGGA 5JLAA 1O58A 1W5AA 4RHFA 4RVUA 5IDVA 4KE6A 1W30A 2C2XA 5KNBD 3C3AA 3ZVMA 3V34A 3REQB 5B2ZA 2R8OA 4ZP1A 4WKOA 1DC3A 1H2ZA 3DOOA 1TQDA 1S96A 1GT91 1N1MA 4HGPA 1LX6A 3F7NA 4MLPA 4XZ3A 3ZBUA 4UNNA 2B94A 1SBIA 2GZRA 5D86A 1VYTA 1TZ2A 3C3CA 1SIOA 4PHCA 3HP4A 2OG2A 1CY4A 1E9RA 1LNQA 2O14A 3T9EA 3W9UA 4F2GA 4QRIA 5KSWB 4P4GA 3QVVA 3CIOA 1T26A 2W37A 4YR7A 1EP3B 3JQ6A 3SDZA 1DKUA 1A1SA 2BFDB 2H7CA 4EITA 2K6GA 5A6VA 3CCFA 4ZTBA 4FKBA 1G6KA 3Q41A 4OXQA 3UUGA 5EAIA 1NI5A 2F59A 3HBMA 2HIMA 2VNHA 1LDYA 1E5VA 1HOXA 2GZHA 3G0IA 3PGMA 1GNLA 2W2PA 4OAQA 5EWJB 3ASZA 3VC3A 3MGKA 5IUKC 3U17A 3UOWA 1V6AA 2Z6VA 4Q0MA 2XWJI 1L7NA 2IPNA 1FB5A 3FPBA 1EP1B 1PLKA 1ZISA 2JL1A 2O4UX 3D7NA 4URYR 3VU9B 1VJ0A 5KREA 3WQRA 1ISRA 2ZJ6A 1QKIA 5I5GA 3BSFA 5JHGB 1SCAA 1JPVA 1XCLA 2QUAA 2QB5A 2RG1A 1SWVA 2OBNA 2WD8A 3BREA 3HBLA 3N76A 3VOAA 1SUPA 2Q7DA 4P5EA 1MHTA 5LLSA 1OSNA 1GGVA 1KQPA 1A9XB 2I87A 4B6SA 1KP9A 5ALOA 1ISGA 1YDMA 1UAGA 2CT8A 2QOEA 4PINA 1IMOA 1RMTA 3SSNA 3VR2A 1Y3BE 3PFIA 3GLFB 4CLRA 4OHWA 2WU3A 3TBFA 1ECLA 3TXXA 4IILA 1NUQA 4DA0A 4GMFA 1TA9A 1S2LA 3NTLA 4P83A 3BRWD 4R84A 1PDWA 2Y8EA 4MWCA 4JNCA 2NAFA 2JGJA 3ISJA 2ZB7A 1XEXB 4YJFB 2ACEA 4RVOA 2DUWA 1VCMA 1Q84A 3ZOKA 5KJCA 1IN7A 2FPWA 2QVCA 4MAAA 4HL6A 2BCJQ 3CNEA 2DFDA 3O9MA 4EEKA 1WLYA 4DC9A 1CUGA 1HFKA 2O3UA 3JD0A 3UWKA 3VGPA 1LBQA 1T4CA 5C4MA 1Z56C 3QXJA 2B9VA 3O3MB 1PT8A 3E22B 1N2SA 5ALUA 2O8DB 3SKXA 3QK7A 1GTVA 5FI3A 2YOHA 1N1GA 4HAYA 1LI7A 1UBGA 5A9SB 2XUZA 1PF7E 4W5JA 4CMIA 4HRXA 3WDMA 2Y1CA 1BXRB 1LBHA 2XWSA 3NDJA 1NW4A 4LJ8A 5T57A 1OB5A 3KBBA 4BPRA 1SUWA 3K94A 1K9VF 4WLFA 3BMOA 3LOUA 2XNHA 3Q8WA 1JDPA 5ILGA 3W5IA 1ESEA 3HRHA 5J63A 4AX4A 6ADHA 1EYZA 3ETCA 4BN0A 4INOA 4E21A 2I78A 4NCHA 1CUYA 2HRQA 1VIDA 3D8UA 2P65A 4RQTA 1DMSA 4HI0E 3IR7A 4R0MA 3RVMA 1UIMA 2QZ4A 3M33A 1YUNA 5AK3A 4KG7A 3EMVA 3R3VA 3CO5A 4FNOA 1F4LA 1GZVA 1KI6B 3VYUB 3KOUA 3X1KA 4J7AA 2W2OA 5KTYA 1Z4MA 5JDIA 5LNK6 2H2FA 4M7PA 1I3NA 1RXSA 1SBNE 2HY7A 2R62A 1F2UA 3EH2A 4O2BF 4DUPA 2ZE6A 3JQ8A 2WPNA 3SQDA 4XSHA 4YRFA 4FTWA 2A1UA 2BC9A 2HO5A 4ESVA 4CM8B 2Q6VA 3EJWA 3FI0A 1GEEA 1PDOA 2YJTD 4BE4A 4DCMA 5LN1A 1HE4A 1U6JA 2C84A 1Y80A 2A9FA 1ISHA 2IVFA 3FHJA 1CSEE 5E7MA 5BYJA 3ZI4A 1PGJA 1G7TA 4EJMA 3B8EA 4L8LA 2JD1A 2VXYA 2ZIZA 1I3LA 3UYLA 4A1OA 1KI4A 4E09A 2O54A 4TTIA 5DJ5A 1U0OC 4H7KA 1SXJE 3JWPA 3PX2A 2HBYA 5EKUA 1NQXA 3M1YA 5T4FA 2GGSA 1NQWA 2XZLA 1S1CA 1TZCA 3S1LA 2PA0A 4C6SA 2O0LA 3Q1LA 2W5UA 2GO1A 3VTAA 3W8DA 3ML1A 2B7CA 1B6SA 1XTKA 1IWOA 1CF2O 2BY4A 2FZCA 3FPGA 2AWNA 5CAEA 1GNVA 1E1DA 1H2BA 3JQBA 5JAZA 5KDOA 1L9XA 3VX3A 2YKGA 4BUZA 5DN9A 4CVNA 1TB4A 2H59A 4CI9A 1NURA 2AXQA 2NVUB 4GMKA 1OHHA 4DPLA 4Y9DA 1Z16A 4F06A 1CEXA 3F49S 4YRMA 4FB4A 2VHYA 2CCJA 1RRGA 3G2QA 4P38A 4QG7A 4IIVA 1L5MA 2V8BA 3NJ4A 3ER9A 1EIWA 3MFQA 1QZTA 2G1JA 2WNIA 1UMCB 3BDVA 3GOQA 3HDVA 4XA8A 3ZWCA 5A06A 5BVGB 3AF3A 3SYNA 1WKBA 3ENKA 4NU6A 4WDQA 4IR7A 3UHPA 3OQJA 1KDPA 2QAIA 3B3FA 3RC1A 3VKGA 3BG5A 1AK2A 1Q2UA 1M54A 2COEA 3AH8A 3IUQA 4LN1A 2XBMA 3QEKA 3ZWDA 4RMIA 1Y3IA 2G9NA 4ZI7B 1FDTA 5CM8B 3SQXA 3ITDA 2QRVA 4FBMA 3R7DA 2OV8A 1OI7A 1Z4JA 1D0IA 2R1VB 3DZBA 2V3VA 1JFTA 4YWJA 3PHLA 2G67A 2B4QA 5FOTA 3U81A 1U0JA 4LS3A 4IFBA 3OQOA 3H5VA 4DV4B 4QHSA 5C5IA 1KYVA 1LRLA 5K3OA 3EQZA 1A9TA 4X1IA 3TLGA 3L7KA 4LVNA 1RRFA 3JQGB 3M5WA 5IJZA 2H07A 1DC5A 4IHQA 2ERXA 1MTOA 2QSYA 1JILA 3CW9A 4QXPA 1SQSA 3CZ9A 1ZM3A 3ZDQA 4D4GA 3BQNB 1W8IA 4OJTA 4DJDC 4X71A 1JJ7A 5D5PA 5FWNA 1N0HA 4B44A 2Y0CA 1G5PA 4REOA 4RZXA 2HADA 4UEJA 5TGTA 4DARA 4E0BA 16PKA 4L9WA 1TQ8A 3O26A 2IBMA 2QLJA 5H7XA 3O2QB 3QY9A 4OSEA 2XYVA 2CNWD 3D4BA 3S2GA 4AWAA 1MV5A 1LPOA 1HDZA 2C2MA 2VPTA 3GDGA 3PGLA 4B7XA 5BN5A 4EH1A 3F7OA 3KAKA 3PKJA 4YUAA 2ROQA 3T9DA 4R8RA 1YR8A 1R4MA 1L4LA 4IHJA 1M1YE 1RBZA 3FKSA 2N1MA 3IBYA 3PXGA 1U0SY 3L0ZA 3LE8A 5EJGA 2VEDA 1OGIA 4L85A 3WS7A 3B3GA 3BS4A 1H9CA 4R2LA 1KZHA 4EPWA 5GINE 2NZ8A 4C07A 5KNCH 2ZR9A 1J0BA 2FUNB 2P62A 1SRQA 2NUPA 2Q4RA 5J5AA 2DT5A 2BEKA 1MORA 1ODTC 2A1TR 4RTMA 2V1XA 4JMLA 1EZ4A 3Q9NA 3IQWA 1ORWA 1FSPA 1FVXA 4DMGA 3LZDA 3FNBA 4QTXA 4YLEA 4AD8A 5BY2A 1H8EA 3C6ZA 1E61A 4UXHA 1JHUA 1KGSA 1K5HA 3OCUA 3WRYC 2DCMA 2EJVA 1QV6A 3QSGA 4J76A 1SVOA 4BNYA 2Q8NA 4DG9A 2PS9A 3SS8A 3W4JA 3FXAA 4L57A 2EBWA 2HBQA 1LK5A 2CE2X 2JHGA 3EODA 3G8BA 1KDVA 1UEJA 5EZSA 1NXWA 1GT6A 4FCCA 4MQLA 3VAZA 3WK9A 1B8PA 2EWMA 1D6MA 2QRPA 1R6UA 3IUMA 4M9SA 1QRDA 3O4RA 2XNSA 1L7RA 4L8FA 1PVDA 1X13A 1XMQB 1PZHA 2EJBA 3A6LA 5J47A 4PC1A 2Z3ZA 2ZLBA 3RIEA 2Z2ZA 4TX1A 1EGQA 2VF2A 4FS3A 4GSYA 5M2QA 3LWZA 2KQUA 4QM7A 1VSUA 4GPEA 4N8DA 4QFMA 1AXEA 2J0UB 4YNBA 4F85A 5AICA 4CL3A 1SURA 5MN6A 3H9JA 4V0RA 4RTNA 4BMYA 3PZRA 3LX4A 2Q9CA 3D6TB 1JR6A 2HSWA 3B89A 2WSSD 4KXNA 3U7IA 3WYFA 1X42A 5FLKA 5K3FA 4BB0A 2FPSA 4EAQA 5FOUA 2M98A 3UQZA 3G2MA 2F9MA 3D4PA 4ZICA 5IN4A 2CSXA 3JVUA 4HXEB 4UHKA 1PR6A 4YJHA 4TN1A 4CDMA 4GR5A 3KHTA 5IFKA 1AKVA 3BMCA 2QP9X 3TH5A 3ZE8A 1T1GA 2IHJA 1IWPB 1O97D 1YUBA 2D06A 3HGQA 3UJCA 3AI7A 4PX9A 1E77A 1UEXC 2C95A 1T2VA 5DI3A 4BP3A 5A4IS 3G6WA 4KYUA 1WXQA 3B7WA 2O7SA 5J40A 4HDCA 3ZJYA 1UKZA 2WD9A 3UMYA 1D2NA 2C9MA 2YVQA 5T4HA 3O21A 3SXJA 3OJCA 3T5CA 5LL6P 2F48A 3TNJA 4TV8B 4ZT5A 2TYSB 4D3DA 1Y63A 2AUTA 3WLLA 1JFSA 3Q88A 3HZHA 3A1WA 5I3CA 1Y89A 4U2CA 7ABPA 1IL0A 1UBOS 1NMXA 2P3QA 2WZDA 3MMZA 3OBIA 2WE7A 3B1YA 3HKDA 3P0FA 2FN3A 4JIGA 4P5PA 4C1BA 2YR0A 2JLRA 3WQQA 5I51A 2C3PA 2Z5LA 2VQSA 1CLEA 3AR8A 3DTVB 1GCGA 1KMMA 1G0NA 2Q49A 1ZUWA 3AINA 3N86A 4G0QA 3CLRD 5KSYA 4C89A 3QYAA 4JVNA 3OF3A 1D2RA 2VJMB 2FOIA 3BFXA 4JDUA 2BEUA 4HDRB 5T6MA 1X39A 1H93A 1B0PA 3M1LA 1VKRA 4UARA 4YJGB 3OUTA 2VPZA 1RC8A 1TL7C 2CV0A 1NRWA 4IH1A 4R1PA 4F6LA 2OGWA 4WEOA 1XK7A 2JHAA 2O9JA 2OVBA 3HN2A 4OHMA 3MJSA 3ORYA 1KS2A 4WCVA 4C7KA 3W06A 2WJWA 1CE8B 4IDEA 3T9BA 3QXCA 1RRKA 1DBSA 2JIZD 4GE3A 3NBUA 4IXTA 4DTIA 1DC7A 1IEWA 1NW5A 2GBGA 1PP4A 1DVRA 3PD0A 3G2KA 3SZ3A 2GN0A 2JGNA 1L8AA 2VVTA 1WZEA 2OR3A 5ALKA 1KKUA 5JNVA 3IH5A 1OVMA 3TD6A 1QJ4A 3A05A 1E2LA 2FWNA 1UPXA 3M89A 1UBRS 1XKXA 4U7FA 1BE8A 1M7BA 4ZV4A 2FRDC 4UPEA 1E9EA 3H84A 1ACLA 4EGFA 4HNUA 5DNVA 4G1VA 3SZMA 2VDWA 1PL7A 3WBFA 2ZYVX 4MQ4A 1W36C 1XE3A 5FNVB 4AZ3A 1DADA 5HFAA 1JTVA 4JOSA 2Q0SA 4MW1A 2VAVA 1PT9A 2QWXA 4DSAA 3BCRA 2DBRA 2OENG 4ZPXA 3UB2A 4MI9A 1JQEA 3KT6A 1CZNA 1Y7HA 3EIUA 4OPMA 3F78A 4DBVO 2UXCB 3B6ZA 2EDCA 1P4HA 1YB7A 2CLHB 3OQ1A 1E2KA 4L7VA 4ND8B 4KX5A 2EP7A 1XAJA 2OLJA 4XI9A 5TARA 1IVNA 3KCQA 1Y7IA 1QUFA 3A31A 1GV0A 1XQYA 2GPNA 2H4ZA 2WT9A 2UZAA 1VPDA 2UVDA 3AEKA 4WAUA 2GCOA 1HEUA 1E7WA 3BIFA 4BMNA 5AVUA 3HLKA 4JL6A 4JI0B 3QKSB 1DT5A 1PT5A 1UP7A 4OOFA 2NU6B 2OWEA 1U0BB 4I1RA 1O1YA 1CQWA 4EHJA 3NNDA 1PW5A 4EUNA 2R1TA 4IF4A 2Q3BA 5D5QA 2DECA 3HO8A 1A96A 3NEAA 1ZH2A 1WMAA 1P0IA 4OK5A 2VRNA 4NDNE 3V1UA 1VKNA 1T9CA 1NJ5A 1L5SA 1H22A 1JBQA 1FNMA 1XF1A 4AY4A 3HPRA 4DV0B 1H2RS 3GDFA 1ZM4A 3QFFA 1YR1A 4YV0A 4QQKA 3VUFA 2IH4A 1NMYA 5AM1A 1Z36A 1KBQA 3PEYA 1C1DB 3HE3A 3E3NA 2UZ0A 3BL5A 3M6IA 3ONWA 1YZLA 2FCRA 1LDMA 2RGXA 3AUFA 4XJVA 3C3YA 5BXQC 5JZOA 1XA0A 5C1IA 2W70A 4MPRA 4DY6A 4RXUA 3NBFA 3U56A 1UMBA 1T8RA 1UWVA 1QHEA 4Y1GA 1BCSA 5B3KA 2FI1A 4EI2A 3DTTA 2HJWA 2AXPA 1ORDA 2ZBVA 1Z4PX 4OKNA 4N12A 4R8MA 3L92A 1JIJA 4XUEA 2OFWA 4XWWA 3FMIA 1OKKA 1ONNA 3TRDA 4KIFA 2QUHA 4NKRA 1DQPA 3OUUA 4EABA 2QTGA 2JAXA 3NB0A 4MTLA 1XRRA 1QG2A 3OM0A 2HQSA 5COBA 1KJZA 4D41A 3TOZA 4MUBA 1EX9A 1LI4A 2AFIA 3CCBA 3ZQUA 4B34A 4D3FA 4UVHA 3PP8A 5E6UA 1YVDA 5JANA 4R98A 1S2DA 3FZEA 3EGVA 3LYUA 4FX5A 1YVEI 1E2MA 3CE6A 4EECA 5ICMA 1LJLA 1SZJG 2QN1A 4R54A 2RBGA 1GZ7A 3DE1X 1TTPB 4K9RA 1CR1A 2D74A 3L0DA 3MXOA 4DCCA 4DVJA 1Q12A 3L77A 3WWYA 1J2YA 5AW3A 1IM5A 1MFPA 1R18A 1G8SA 2H3EA 2I3DA 4EKEA 1HE1C 3M83A 4JP1A 5TMPA 4C0HA 1C80A 1NHGA 2BLLA 5ERYA 2ZT7A 2ZDQA 3IVGA 1ECPA 3L6DA 3NKFA 3RTDA 3SOZA 4CODB 4HWPA 1RTKA 1ZL2A 3LDAA 3PL5A 1MAAA 4B6RA 3QKIA 2BM0A 1V6SA 1ACJA 1SA0A 1H66A 1XYYA 5JYCA 1BGXT 1XTJA 2OBYA 3IELA 4UTZA 1EUDA 1OI4A 1NMZA 2ES4A 3PF9A 2NSLA 2ZFUA 2AJBA 3LQFA 4PX3A 1LDNA 2XUPA 4LNAA 3I92A 3KZVA 3TPZA 1YQ9A 2WTEA 1FP1D 1ZN7A 3WDKA 2PMDA 4FYXA 1X9GA 3T7IA 4JVSB 3G7SA 1Z18A 2QTHA 2F3RA 2GRJA 2GPSA 2PRSA 4KRGA 1YZHA 3USES 3SC2B 4CQNA 3FCOA 4FN4A 5JQGF 4C0AC 3T1OA 4RMNA 4YJ3B 1L5KA 3W2TA 5HYVA 1JJAA 1H42A 3L8CA 4PCUA 2IE8A 4OHKA 3SM3A 1CPYA 5EQDA 4O59O 1Z4OA 3CLUC 4UPVA 4V0QA 2RD2A 1ECBA 4RC9A 1B4DA 1NR1A 1MG0A 3BWVA 3CEJA 1AHPA 4CDRA 4BPBA 2MYUA 4DKJA 1HDYA 4UQOA 1U8UA 5L6LB 3LLMA 5C8DA 3GBSA 3GI1A 1U8YA 4WTOA 2A59A 3B5IA 1ST2A 1YUMA 3CX6A 1QGZA 3GD5A 3RREA 1POWA 2CFIA 4LJAA 2R86A 4WKNA 3G8YA 5THQA 2ZYRA 2ZTVA 3UJPA 1D5WA 3VMMA 3VYWA 2ZUBA 2EBFX 2QTCA 1F2TA 4NJEA 3UUWA 4EPXA 1QO9A 2AHOA 2ZQYA 1UJBA 3RYIB 4NH4A 1K7SN 1DCMA 4PYKA 2B69A 4HAWA 2AZ4A 1BNCA 4FLMA 4YIHA 4JLWA 1TK2A 4R1LA 4FFBB 2E4YA 2H8KA 3HABA 4G5RA 3UAWA 4JSYA 1HG1A 4IWYA 3VSDA 2J3DA 3HCBA 3S6JA 2IX3A 5J2UA 4JEIA 4ZQIA 3OMWA 1EUCB 3QW2A 4ECAA 4WOJA 4B3HA 1Q50A 2D4HA 2Y1FA 4N82A 1CDOA 4J2OA 1IY2A 3OU6A 4KMRA 4LIPD 5DW0A 4LXTA 5F21A 4GF5A 3P9ZA 3QENA 3O6VA 4L50A 1GZ6A 2BKVA 3C8ZA 1BX0A 4AO7A 4KE9A 3V2IA 1KDTA 1AZTA 2G6TA 2FZEA 4N7RA 1KQGA 1H65A 1QG0A 3QMVA 5A9TA 4FIDA 1X1AA 4EA8A 4G0UA 2GH1A 2H2IA 2OXCA 2XUDA 1W4RA 1THMA 5HIMA 4HXYA 1MJNA 4PICA 1WZNA 2VWQA 5FWAA 3FGOA 5HKKD 5J23A 1O95C 2I2XB 1V1RA 3K1AA 5FWXB 1OGJA 1AQ6A 3FGPA 1RHRA 2IEGA 3D43A 1SU6A 2JHCA 3R5TA 1N2ZA 4P3OA 3TTSA 4BNJA 5HE9A 4EG5A 3WJAA 3FIUA 3RHTA 1A5SB 2XWQA 3RK4A 5CA1F 4DB2A 4IH4A 3B82A 3WISA 2VYVA 1VHTA 1JG1A 2Q3FA 2WBLC 4YONB 5K0EA 3HVKA 1NW6A 3N2LA 4RPCA 5KHLB 2JFFA 4CHTA 5ARBA 3P94A 5B7NA 3CGGA 1JR2A 3IDSA 5EKSA 1FSSA 3DFUA 1BWPA 3G82C 3WB2A 1A9QA 2OK8A 1SQ5A 1Z35A 2XITA 4LF8B 3KJXA 4LVUA 1ZQ9A 2WIJA 5JAHA 2FW6A 1SVMA 2J6HA 4CIAA 3WGIA 1P62B 1G8YA 3A1EA 4E6EA 3CKLA 1WQ3A 3KETA 3BMQA 3K1YA 4M8SA 3JQQA 4OAPA 3W79A 4RFLA 4EL0A 1P5FA 4M2LA 1NJ8A 4MIKA 4MWSA 3DG9A 3IOBA 4S0XA 3K1TA 1VA5A 4HKTA 5DH9A 2BHNA 2R60A 5DLQC 2ORVA 2X0IA 4LJ6A 5I7SA 4CJXA 4GBJA 3K3PA 4H6VA 4DMKA 3MINB 5LQRA 1NAIA 3DZJA 4F1JA 3R23A 3LDGA 4OB6A 1N5LA 3GRCA 4RGBA 1PX2A 4DCSA 2JIRA 2O1EA 4NBWA 4FMCB 3L9XA 4BZWA 2EKZA 1IXKA 1FP4B 4P86A 2V59A 4E2XA 1IZ8A 4WFQA 1NSYA 3EIFA 3LTEA 2BM1A 2DJ5A 4N39A 1IUPA 4ND8A 4UBIA 4G25A 3H2IA 1E0SA 3GPBA 4PPQA 1W88B 2BGLA 1ONSA 5KYXB