2CDAA

Sulfolobus solfataricus glucose dehydrogenase 1 in complex with nadp
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
366
structure length
360
Chain Sequence
MKAIIVKPPNAGVQVKDVDEKKLDSYGKIKIRTIYNGICGTDREIVNGKLKGKDFLVLGHEAIGVVEESYHGFSQGDLVMPVNRRGCGICRNCLVGRPDFCETGEFGEAGIHKMDGFMREWWYDDPKYLVKIPKSIEDIGILAQPLADIEKSIEEILEVQKRVPVWTCDDGTLNCRKVLVVGTGPIGVLFTLLFRTYGLEVWMANRREPTEVEQTVIEETKTNYYNSSNGYDKLKDSVGKFDVIIDATGADVNILGNVIPLLGRNGVLGLFGFSTSGSVPLDYKTLQEIVHTNKTIIGLVNGQKPHFQQAVVHLASWKTLYPKAAKMLITKTVSINDEKELLKVLREKEHGEIKIRILWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structural Basis of Substrate Promiscuity in Glucose Dehydrogenase from the Hyperthermophilic Archaeon Sulfolobus Solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Oxidoreductase
molecule keywords GLUCOSE DEHYDROGENASE
total genus 122
structure length 360
sequence length 366
chains with identical sequence B
ec nomenclature ec 1.1.1.120: Galactose 1-dehydrogenase (NADP(+)).
pdb deposition date 2006-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
A PF16912 Glu_dehyd_C Glucose dehydrogenase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2cdaA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2cdaA01
3GC6A 4XGNA 3AU8A 3HSKA 5HWSA 3F5SA 2J5QA 3WNQA 2DFDA 4XRGA 3VC7A 1R15A 1NAIA 1QMGA 3QVTA 4DL9A 3LYLA 2FHSA 4CLRB 2NV6A 5BSFA 1HSZA 4IZHA 2X86A 2FP4A 5AXDA 3QWAA 1IUKA 4G81A 3VKVA 4WLNA 2PD4A 3OQ1A 1EE2A 3GNTA 3FR7A 3DBRB 4J7CA 4XZ3A 5IXSA 5IDQA 1I8TA 1YH3A 3FCOA 4HADA 2HCTA 4CLOB 2P4HX 3C1TA 3HG7A 4XQEA 3FBTA 2CDBA 3ZWPA 3HDQA 2VYND 3JCZA 4GGPA 4CODB 1UP7A 3VZPA 4E32A 4FGWA 1FF9A 1PTJA 1NR7A 3H8VA 3VZRA 1FXSA 1GV1A 1E3LA 4G5HA 4RL6A 1IULA 3MOGA 3TPCA 3WICA 4EUHA 5F1KA 2HU2A 3IP1A 1FDVA 1UXJA 4IQ0A 4W9NC 4WUVA 1DO8A 4BKOA 1QYWA 1PZHA 1CQIA 5IXYA 1YOVB 1W0CA 2OFPA 3PLRA 4TSKA 3OJOA 4CLEA 4IQGA 1GU7A 1JTVA 1V3TA 3GFBA 4FJ0A 1B3BA 4EEZA 2EGHA 4CLHA 4PLVA 5B4UA 4I8XA 1PL6A 3O8QB 4CPDA 1LQTA 4RCVA 1H0KA 1XQ6A 3DMTA 5CG2A 2NWQA 3TL3A 3GR6A 3ROQA 4YXFA 1YXMA 3UXYA 3GN1A 3FNFA 3HNPA 3GGOA 4GWGA 1LU9A 1GD1O 1I0ZA 2CUKA 1UJMA 2Y1FA 3O03A 1QYXA 1HE4A 1I30A 2W2LA 3GVPA 1XWFA 4J4BA 5DCYA 3ONEA 3N58A 1KIFA 3W6ZA 2IRWA 3AW9A 4YVFA 3ZV3A 2P2SA 1C1DA 1C1XA 1L1FA 4R01A 4OXKA 2ZIZA 2DKNA 1CEQA 3DC2A 4OO3A 4KZPA 3O9ZA 4CMGA 2UVDA 3JQ9A 2XF8A 1BXGA 3RC9A 3DAPA 5DN9A 2A9FA 5T8KA 3H9UA 4NK4A 3WFJA 1DB3A 3DZIA 4PVCA 4AJNA 2CDAA 3QQPA 4DPMA 1CRWG 3BMOB 3E5MA 5FF9A 4BIIA 3PZBA 2GPTA 3EZLA 4ND3A 2DBRA 3EW7A 4IIVA 4BQRA 4IBOA 2Q49A 2FMUA 4BKQA 4CMJA 2X0JA 2BFOA 4BGIA 5B37A 1OZAA 3H9GA 3EGOA 5DBIA 2VWPA 3B70A 3QVOA 1PQPA 1E92A 5G0UA 2HRZA 1XQ1A 2PH5A 3JQFC 3Q3CA 1WPQA 4E5YA 4CJXA 4WCDA 4WLFA 1ONNA 2HMTA 2IZ0A 5G0TA 1LSOA 4W99A 5G0SA 4K26A 5T8KC 4GKBA 5H82A 3OJLA 4YYZA 4ZJUA 4FC7A 4CQLA 3O8QA 1DPGA 2V7PA 3AY6A 1UP4A 4U8GA 3KHUA 4PG4A 2YY7A 4I5DA 5ICMA 3D64A 3FBGA 1HE2A 2HK9A 4Q3BA 5F21A 1E6EA 5JCJD 4HP8A 5LC1A 1PWXA 1VE9A 1TT7A 3RU7A 2QZ9A 3NTOA 4HFJA 1IOLA 3QW2A 1WMAA 3BMOA 3GMSA 3IC5A 3H9QA 5IZCA 1OOEA 5TJHA 4CMHA 5FEUA 3TNLA 1SZJG 3OA2A 4Z9XA 4AJ1A 3AI1A 3WJAA 1K3TA 3HFGA 3IAHA 2AEFA 4AFNA 3WQSB 1NQ5A 4J43A 1R0SA 3AY3A 4CMCA 1ENOA 4F6CA 5J23A 2C20A 3G79A 4RLHA 4HY3A 3GOHA 3CIFA 3O38A 5B4VA 2GLXA 4IS2A 4PLCA 2VTDA 4WCFA 3BHJA 2BHLA 3OETA 5BNIA 4HUJA 3KV3O 4DLLA 1U3UA 3NT5A 4K6FA 4O0LA 2O2YA 2HO5A 2C0CA 4GSKA 3WQRA 5IZCC 4IPTA 4L74A 3C85A 4Q3DA 1IB6A 4N5MA 3AUSA 3KYBA 2EP7A 1NQAO 2DBVO 4J1QA 1LEHA 2C07A 2TMDA 3SVTA 1H9BA 3U49A 1ISFA 1PJTA 4CM1A 4IINA 2X9NA 3WS7A 3NTRA 2GERA 2I3AA 3A9WA 2GN9A 2PZKA 3DBHA 1H2BA 3WLFA 3KLPX 3U4CA 1RWBA 2DPHA 2CVZA 4N54A 4DMMA 2CVQA 4PRLA 4XDYA 3S2GA 1VM6A 2PGLA 3CPSA 3ONFA 4PLPA 1AE1A 4RPGA 2C5EA 3VH3A 1V0JA 3PYMA 4BV9A 2VHXA 4MIYA 3KXDA 1R0KA 1H93A 2OMEA 1XU7A 1XGKA 2Y93A 3JD2A 4W7HA 2NLOA 2F1KA 3I4FA 5LCXA 4BO1A 2UUOA 2X0IA 2P5YA 3ZCXA 3E18A 3ST7A 4LMRA 4WNIA 2NTNA 4E31A 3EHEA 4D0SA 4NU5A 4GX5A 1NASA 2VZ9A 4FW8A 1GYQA 1HE3A 4E5MA 3E82A 1BXZA 1SBYA 4BNTA 4IMRA 5COQA 4DC1A 3NJ4A 4CMIB 4DIBA 3WJ7A 1UP6A 1QKIA 1T25A 5JYEA 1LQUA 2EW2A 1BWSA 1Y7TA 4Y67A 4B7CA 4FJ1A 5EINA 4J1TA 5BSGA 3MTJA 3S8MA 4FGSA 3V2UA 3WMWA 4B7XA 1Q0HA 1YBMA 2WE7A 3NAQA 3ORFA 3RFXA 4GKVA 3SXPA 2BGKA 2WTBA 3GAFA 2VTEA 3QWFA 3WBFA 1U7HA 1O9BA 5LDHA 1B15A 4Y6RA 4YPOA 2Q4BA 3D7LA 1PGQA 3PRJA 3ZWAA 1M66A 1PQWA 4LVUA 2XPCA 3HQ4O 3CEAA 4Z0HO 1I3NA 3M6IA 4HNHA 4MVJH 3LC1O 4I08A 1NFFA 5ES3A 4B79A 3JQDA 3TDKA 2NVBA 3PGXA 4AJPA 5MGBA 1HDGO 4LCEA 2Z5LA 2NM0A 2OXIA 1E77A 2GDZA 2UUPA 4IJKA 2YV1A 2DUWA 3ENKA 3JD3A 1YRLA 1IY8A 1F14A 1UZMA 1PL8A 1Q0QA 1P33A 1QXSA 1IHYA 4F46A 1HLPA 2DM6A 3WGTA 4ZVVA 1I3KA 3WGQA 3KLMX 4YAJA 3RJ5A 2VT3A 5CDGA 3BMCB 4LMPA 4DVJA 1ZK1A 4R9RA 3KYCA 1TEHA 2HKIA 1BXGB 2B4RO 4UUOA 3VKUA 3V5NA 4N5LA 5CDYA 3C7AA 4R3NA 3JQ7A 1LLQA 1B14A 1U2DA 2GSDA 2ZB8A 2RHRA 3HDJA 2H1SA 1E3SA 4HFNA 3S2IA 1UXGA 2A92A 3RC1A 5TIIA 3FTPA 5I7EA 1Q1NA 1XYGA 3G3EA 1YONA 3F4LA 4NPCA 2V6GA 1MC5A 1RM0A 4XQCA 4M87A 4MKZA 4C7KA 2OO5A 2QZZA 1PGJA 3DDNA 4LSWA 3WFIA 1QR6A 2ZTLA 5KJFA 1F12A 2BKAA 2H5LA 2W2KA 4NFSA 5JS6A 2E82A 2GN8A 5ENDA 4JBIA 3UCXA 5JDCA 1P1JA 3WWYA 5C5IA 1E3IA 3U3XA 1R6DA 3GEGA 1BVUA 1T4DA 1WMBA 3BTUA 2BRUA 3DTYA 3FNGA 3IMFA 4WKGA 4DTIA 3JQGA 1P45A 3ITKA 4CM6A 1AUPA 2B37A 2FWMX 2VHZA 1GFSA 1EMDA 4HV4A 2Z1MA 3FR8A 3NRCA 1JWBB 2NQTA 2VRCA 4TRJA 4I5FA 1GUYA 2ZB3A 1JVBA 3JYPA 3ROMA 1HDZA 5JY1A 2PD6A 2VYVD 1BMDA 2CVOA 5JE8A 1A4UA 4ZQGA 1DAPA 4IDAA 4IY1A 4UEOA 4BNUA 4GLOA 1I3MA 2V6FA 4KQXA 2EHDA 3QE3A 1ONPA 3E8XA 1MX3A 4TKMA 1ZMTA 5JAIA 4YJHA 1H5QA 3AM4A 3E9MA 3OQ6A 4RORA 1LSSA 4G2NA 3AI3A 4ZD6A 3X2FA 1L7EA 4ND2A 1PQUA 3WOHA 4BNLA 1Q2XA 5K6AA 2YJZA 2W90A 3IL2A 2Q1WA 3V2GA 4OL9A 4XCVA 4GSLA 1GQYA 4IDEA 4RO0A 2HUNA 3WX0A 4D79A 1CQJA 4MP6A 5T6BA 2C2XA 4E5KA 3QRWA 2VHVA 3HHPA 2PZJA 2AE1A 1NQOA 2X6TA 3FTNA 3VAZA 5GZ3A 3KETA 3L77A 5L4NA 2JD0A 2OUIA 4EI2A 2ET6A 1M76A 4EYEA 1HXHA 3VPHA 2Z1NA 1PJBA 3ZWNA 3DXFA 1SB9A 4MIOA 1LLCA 4JP3A 1VL0A 1ZUD1 2JAHA 4E2XA 1ADBA 1YGYA 3VH4A 4FFMA 4TRNA 4YWJA 5G4KA 4A7PA 5AXAA 2E49A 3JTMA 4KMSA 3F47A 4FD3A 4PIVA 4WOKA 2P68A 3QVXA 2PA3A 3PHJA 2C7VA 3P5SA 3G49A 2EGGA 5DF1A 2SCUA 5G0WA 4I5EA 4L76A 3VHRA 2G17A 2UV8A 4R1NA 2DQ4A 4CM8B 4CMEA 1WZEA 4RPLA 2ZJ0A 3GT0A 3MJVA 2C2YA 5HA5A 5DCUA 3GZ4A 1PZGA 2YHIA 1BGVA 2OL4A 2V65A 1P0CA 1ZEMA 4FIZA 4OIMA 5JY6A 3WQQA 2R6JA 3EYWA 3LDHA 4U5QA 4D3FA 1JWAB 2O50A 4MKXA 4W4TA 1WZIA 1LLUA 1LNQA 1A5ZA 2JCVA 4BMSA 2G0TA 3OICA 1AHHA 1PZEA 2DT5A 3BMNA 4XX0A 2VUTA 1EK6A 4MVJE 3GVHA 4XJTA 1DDOA 3RBVA 1EFLA 4ALMA 1E3WA 1JAXA 2UDPA 1C1XB 1TA4A 1ISGA 3NKLA 2I66A 1MG0A 1A4IA 3PHGA 4YAEA 3MZ0A 2NADA 2QRJA 4R51A 4YAIA 3HN2A 5IG2A 5A1TA 2Y0CA 1LUAA 4OQZA 1C0IA 4DBZA 2AEJA 1ZJYA 4BNHA 2LDBA 5ILOA 3F1LA 4RVUA 2POQX 3MEQA 2Y1OA 2V6BA 1H6CA 3NEPX 4R1SA 4XQGA 4XYLA 4B4UA 1ZSNA 5JLAA 1GPDG 4Q3NA 4R41A 4FFPA 3ZWVA 2C7GA 1PL7A 2A35A 5IF3A 3EUWA 3RD5A 1T24A 4U6SA 1BHSA 3DFUA 1UXIA 1N7GA 4OJNA 1T2DA 1X7DA 2HLPA 2I67A 3PFWO 3ZNQA 2H6EA 5HTOA 1UDCA 3EK2A 3GA0A 3NT2A 1R12A 4Z6KA 3GZNA 1G6KA 4FN4A 5CDUA 2D8AA 1ISMA 3O26A 3PDJA 4YR9A 4GX0A 1Z82A 3E6AA 3DOJA 1ZZEA 5IAAA 3WGYA 5L3ZA 3NDRA 4PZEA 1T2AA 5H81A 2FN7A 1GAEO 4MP3A 5A04A 1IE3A 3WB9A 5CEEA 2Y1GA 1ZNQO 2BMAA 3ULKA 4MVJG 5ITWA 3QIVA 2AQKA 2HK8A 2H63A 2XOXA 4GMFA 5C7OO 4XA8A 1VJ0A 2BGLA 2NVWA 1VJTA 4PVDA 3H9EO 2PV7A 1I10A 2X58A 1MA0A 4A73A 1GV0A 2B69A 3VDRA 4AJ2A 3EDMA 1PJQA 1KEPA 4BNJA 4UUMA 4TKLA 4GWKA 4M54A 1YS4A 4NZ9A 1KVSA 1E6UA 3JQEA 1KVQA 3MJSA 4NJMA 2H9IA 4RGBA 4WCFB 1BW9B 5BR7A 3L4SO 2Q2WA 4RVGA 3WSWA 1X13A 2V6MA 1FK8A 5ER6A 5I7FA 5B1YA 4QT0A 3SBOA 4TQGA 2P9GA 1QV7A 4XIYA 3U0BA 1Z6ZA 1HL3A 2X5OA 3GN2A 1E3WB 3KEQA 1U4OA 5EESA 3JQCA 4XQ9A 5G2OA 3C7DB 4CUKA 5JSFA 2EF1A 3E9NA 3A1NA 1PJCA 2D59A 3ROPA 4UVIA 4IDBA 1Z7EA 1PIWA 3ZHZA 1HDYA 1E7YA 4WJZA 4OSPA 1HDOA 3VVCA 3WLEA 1ZVMA 3NGXA 2ILTA 3ETDA 3Q0EA 4BHTA 2G5CA 4J91A 2B5WA 1SCUA 4CLXA 3ASVA 1DSSG 3LSYA 3INRA 2I6TA 3UCFA 1YB1A 3QLJA 2PD3A 3Q9UA 4D43A 3DAFA 5FI5A 4L75A 3GGGA 2JFGA 3JD1A 1NAHA 5JDIA 4GX1A 1JLLA 1NPTO 1X15A 4NJMB 4F6LA 7ADHA 1DC5A 4AJOA 3ENNA 3VPGA 5DZSA 3RIHA 3H4VA 4CV1A 3AOEA 4CM9A 4YAKA 3OBBA 1N7HA 4FBGA 1YO6A 5KVVA 4DUPA 1NPYA 4YQYA 1B16A 2P5UA 2DTEA 1B2LA 3TZ6A 1LRKA 1VLLA 4XR4A 1J4AA 5BNFA 3ADPA 2GRAA 5EQDA 5JCXA 3JYLA 3I1JA 1I2ZA 2YV2A 3NDJA 1T1SA 3ZWMA 4WNCA 4BB5A 5A06A 1GEEA 4A0SA 2AMFA 1DXYA 5FYDA 1XSEA 2UYYA 2C29D 4GVLA 1O94A 3PI7A 2OOSA 3ZN2A 3L0DA 1Y8QA 3RUHA 5KIAA 4R3WA 1RPNA 3GDFA 3DBVO 1P1IA 3PQFA 4A03A 3UAGA 1EUCA 3E03A 2X0RA 3QWHA 1Y8RB 3KSDO 3UN1A 4CQMA 1N9GA 4OQYA 4UAGA 4YT8A 1DIBA 4D0RA 1EUZA 3HFSA 2ZQYA 2I3GA 2IXAA 2W2LD 3SLKA 5AQ1A 3GVCA 2WD7B 4YEDA 5HRUA 1ZKMA 5DBFA 1WDKA 4ND5A 4L4SA 3AOGA 5K6AC 3PK0A 5L7TA 5JBIA 1WAMA 1NHWA 1CF2O 2RHCA 1RKXA 3ASUA 2VWGA 4I1IA 1B8VA 3I9NA 3GHHA 2AQHA 4R16A 4XYEA 4BO7A 3KYCB 2X7HA 3UHAA 2JD2A 1V9LA 4Q3AA 2I65A 4N5NA 5DULA 4CV3A 3AFNA 1C3VA 4J3FA 4BNNA 3NDIA 4BNVA 4QECA 1Y5RA 1I36A 5A4DA 1X7HA 3SX2A 1HDCA 5EL0A 3V1UA 2OBYA 3GNSA 3PTZA 4ALKA 2JAPA 3I9LA 3QVSA 3ZNOA 5I9MA 3OQBA 3ZNPA 2VUSA 4RPJA 2CDCA 1XLTA 1AN9A 3RC7A 5L51A 3N7UA 1W6UA 1YB5A 1XKQA 1B0AA 5ADHA 3F1KA 2JKVA 2RH8A 1B7GO 4OXNA 5ENVA 1C1DB 2WEKA 4RF3A 4Y98A 1CJCA 2DTXA 2NUAA 3GG9A 3LZ6A 3ZWBA 3PIIA 1DAOA 1GZ6A 3ZI0A 4XJSA 4PG8A 5JDCC 1QSGA 2NSDA 2AA3A 1K6IA 3ZWYA 1J0XO 4NBUA 3D5QA 3FI9A 3GPIA 4YAGA 3UOGA 5TNXA 5BQFA 2D2IA 1BXKA 5GY7A 4CL3A 3D0OA 1U3VA 1PS8A 4R1TA 3TJRA 1NVMB 3HADA 3WG9A 1CIVA 4RVFA 3JQAA 2HRBA 5A9TA 5KWEA 4BMVA 3IOYA 1P1HA 4MKRA 3OF2A 1P1RA 5IDWA 2FOIA 5DDIP 1OAAA 4ZN6A 1XIVA 3GHYA 3NUGA 2WDZA 4J6FA 3E1KA 2VOJA 3PJFA 2VQ3A 4QX6A 5C7LO 1X1TA 4E12A 4J90A 4ID9A 4Q3EA 4NU6A 2O3TA 3PHLA 4UVDA 4ALJA 3RCBA 3LT1A 4B8ZA 5KKCA 1A72A 2HJRA 2YZ7A 1DHRA 2B4QA 1W8DA 2BGMA 4PZDA 1Y9EA 4YJGA 1ISJA 1ZFNA 3MJTA 3WDSA 4KTTE 1GADO 4MDHA 4FFOA 1V6AA 4KUGA 2P91A 1AHIA 2HMWA 2NU6A 2YQ4A 2CD9A 5A9SA 1ZXBA 4IDFA 3MWEB 1YJQA 3TWOA 3I4CA 3GQVA 4EITA 3JYQA 1R4NB 3HN7A 3P2OA 2ZYAA 1IZ9A 2CF6A 2O7QA 3BMQA 4TROA 4A27A 5JNLA 4CLOA 4TZTA 2EG9A 2D5CA 1SPXA 5TF4A 4ALLA 1K5HA 4XB2A 4PGFA 4PG7A 4MVJM 5JO9A 4QSMA 5HS6A 2EERA 5I8ZA 4AJJA 2FY8A 4CR8A 5CEFA 4J4HA 3OM9A 3U09A 3GDOA 5F5NA 4LRTB 4UEKA 2OP1A 1NVTA 4NBVA 4U6QA 1XHLA 3WGZA 4LVCA 5L45A 2J5RA 1E7MA 4EEXA 4BO6A 1E7RA 3UKOA 4DLBA 5KCZA 1PU2A 1XELA 3ZW9A 4B3JA 4GI2A 2VCYA 4J7UA 5JAQA 4AJLA 4ZU3A 4JXKA 5DP2A 4BGVA 3VPXA 2JD1A 2Q1UA 3R0IA 1R66A 1H9AA 5T5QA 3UW3A 3K8ZA 2C54A 4AJHA 3B6ZA 3JQGB 3GPDG 4EUEA 2AG5A 1DRVA 1MFZA 4LK3A 4J2HA 1YE3A 2QW8A 3Q6IA 2AEMA 1K0UA 3Q1LA 4JCOA 3RVDA 3CSDA 4WOJA 4E2YA 2W2KB 2WE8A 3PXXA 2PKQO 2NQ8A 2DPGA 4FR5A 4EDFA 2Q45A 3TZKA 4PLZA 5EQFA 2BI8A 1F06A 4HKTA 1R4MA 3F6YA 3I23A 1GQ2A 3RFTA 2IE0A 3HUDA 2GN6A 4LSMA 4YCAA 3H65A 2JHFA 1YKFA 2Q50A 5C3MA 3PJGA 1H94A 2VUUA 4YBZA 2GUGA 1RYDA 5L53A 3UF0A 4OAQA 4BS9A 1HT0A 1O5IA 1YDWA 1ZW1A 4QTZA 5JPIA 3ONDA 4E4YA 5L9AA 3VZQA 2PGJA 1U8FO 3PPIA 1JW9B 4OYRA 2C59A 4KDFA 1ZMOA 1HZJA 3PLNA 3Q9NA 3D4OA 1TB4A 1LLDA 1HRDA 4BO8A 3W4KA 1MG5A 4PLHA 5DCWA 4K9DA 1QLJA 4QUKA 4IM7A 3H7AA 1DLJA 4YDRA 3ZHXA 2Y1CA 1K6JA 1ADFA 1FDSA 4O1MA 1P44A 4PLFA 2Y68A 3JYNA 3DO5A 4G65A 5FFFA 3MTGA 4E33A 2IODA 4M1QA 4RVSA 4J49A 1P77A 4NBWA 4PN3A 3U62A 5K9ZA 2AQIA 1VL8A 3DQPA 4II3A 3GUYA 1DFGA 1O0SA 4YT4A 3RU9A 1Q7BA 1NXQA 2DBQA 1HLDA 4CMKA 1XEAA 3UICA 4J0EA 3SLGA 1ORRA 1PJ2A 1IPFA 2NU8A 6ADHA 4FFNA 1KEVA 1M6HA 5CP8A 2EKPA 3QHAA 4I5GA 3W1VA 5HS4A 1LTHR 2YFHA 4RVHA 1T4BA 3GF4A 4ZRNA 4RF2A 1PGPA 2G82A 2BI7A 3FHLA 1YBVA 3KYDA 4YTEA 4OH1A 5JW6A 3KM0A 3QVWA 4GAEA 2Y05A 1ADGA 1ZK4A 2PNFA 2VYVA 2FZWA 3RUFA 4CUJA 1SEVA 2IZ1A 3I9OA 3LLVA 1A7KA 1PR3A 2QYSA 2P4QA 3A06A 3M1LA 5FI3A 3LVFO 4J9UE 1E3JA 3KSUA 3GG2A 2DTDA 2RH4A 3WIEA 3AI2A 1ISHA 1ADCA 3IKTA 3H5RA 1O6ZA 5IDYA 5FWNA 4N7RA 2E6UX 4IGEA 1E5QA 1LDBA 1O95A 3V1YA 4XYBA 1QYDA 2GYYA 4W82A 2XXBA 1I2BA 3U5TA 1HYEA 2AE2A 2YQ5A 1X0VA 2C82A 2PWZA 2C5AA 1E3EA 1LC3A 1AXGA 3T7EA 4ZQBA 4F45A 4R4JA 3I3OA 4MVJD 1GQQA 2AXQA 1PS9A 2VT2A 3L6OO 4J2OA 4JLWA 1N1EA 1D7OA 4FOOA 1EDOA 4E3ZA 4BGEA 3DBHB 1N5DA 2FZEA 1U2GA 2ZCVA 1EZ4A 1HF3A 4P8RA 1E5LA 5KNLA 2R00C 4KP7A 4NMHA 4O59O 3ABIA 2IYOA 4D46A 2Q2QA 1WVGA 1T26A 3DZGA 4MVJI 1Y8QB 3H5AA 4J16A 2X8LA 3Q2KA 4NFHA 1SOVA 1Y9AA 1YL5A 3AM5A 5B4TA 1M2WA 4RLSA 3NYWA 3RROA 4ONEA 3TZCA 1ENPA 1SC6A 1TVEA 3CZMA 5BT9A 3S55A 3VPFA 1IYZA 2GO1A 1M67A 2FSVA 2WM3A 1J49A 2IEBA 3RWBA 4FPXA 4JIGA 4DQXA 5TT0A 1PJ3A 1H6BA 4AL4A 4DBVO 4FCCA 1LC0A 4XKJA 3S2FA 4E21A 4IS3A 1LXCA 3KYDB 4RF5A 2QRKA 3OIGA 1ZJZA 3RSHA 1DLIA 2NTJA 5AXCA 2VYNA 2I9PA 3IIEA 3I9KA 3UUWA 2ZTVA 4GQAA 4JGBA 2DC1A 3HDYA 3FD8A 4B7UA 6LDHA 3G0OA 4CMAA 1GCOA 4ZRMA 3ITDA 3PFFA 3R3SA 4HWKA 3GDGA 5K1SA 4PRKA 2EV9A 5I8WA 3ZWOA 4XRRA 1J5PA 2FPIA 1EE9A 4D41A 2CFCA 5TT1A 4EJ0A 4WLVA 1B8PA 5C7IO 3JD4A 4BO9A 1YL7A 2PR2A 2Q46A 3DR3A 5BSEA 2HMSA 5DNAA 3W8DA 4YJDA 1T1RA 2X22A 2P9CA 1T2EA 2NVUA 4YT5A 2ZB4A 1U8XX 4YB8A 2IDZA 5I7VA 2PGDA 5AYVA 2FR0A 4INAA 3ZV5A 4DRYA 4B8WA 2DVMA 1RM5A 2NACA 4PCVA 4WASA 4CUZA 1SMKA 4YRAA 1LX6A 3HDHA 4FS3A 2YDYA 5G4KB 3PYXA 4UREA 1MUUA 3G17A 4IXWA 1VSVA 4O5OA 3V8BA 3WTBA 5KJ6A 1X7GA 4P4NA 3F3SA 1NX6A 4EGFA 5BSHA 3EVNA 3L6EA 3IUPA 1E1NA 4KUEA 3K9QO 2J6IA 3AUUA 3UVEA 3BTOA 1E1KA 3I83A 1E1MA 2CNBA 2BFPA 3VH1A 2PH3A 2PFGA 3FSRA 1ZXLA 3HB4X 4OKIA 4A26A 4BKPA 3LC2O 3ZU4A 1UZNA 4HNGA 2WJPA 4Z3DA 1E7WA 1LDEA 4L8VA 3NJ8A 4CM7A 3S2EA 4CLDA 3F4BA 1PSDA 1LRJA 3T4XA 3IS3A 4EZBA 4CM5A 4M89A 4JJIA 3OECA 2YHUA 3A14A 3DMTC 4LRSB 1U5AA 4IXTA 1BTOA 1WW8A 2OGUA 4IJWA 4BO3A 1JKJA 5TJ9A 1KOLA 1Y5MA 3MWDB 4L4XA 1EVIA 3S1LA 1NR1A 3RI3A 4CV2A 4BNFA 5TS3A 1MB4A 1PJSA 3OEWA 4WCFC 3H3JA 4O6VA 2VZ8A 5HBRA 2O3SA 3K6JA 2VZ0A 3K73O 3MJEA 1ENZA 1PX0A 5KJEA 4UVHA 4HFMA 3WR5A 2YW9A 4GMGA 4K1LA 3L4BC 4CQMB 3MCVA 4DYVA 4UUPA 1Y8RA 1HTBA 1R4NA 4OOEA 4XGKA 5CDTA 3DHNA 3WMXA 4URFA 5JYDA 3K2BA 3D3WB 3VOSA 3KSZO 1HDXA 1IL0A 4OHUA 1Y81A 3DHYA 1DHTA 3QY9A 1NWHA 3PQEA 4NI5A 5GZ1A 1WDLA 1GR0A 1M6WA 4A5OA 4DQUA 3HZZA 1TT5A 1WNTA 4GH5A 2NTVA 3PWKA 1HSOA 4P4LA 4NDNE 1EVJA 4IQ8A 5L7YA 3QWBA 3FF4A 3DZBA 2HQ1A 1JAYA 3BHIA 2QIOA 4JJGA 1LSJA 1EVZA 3R6DA 3EY4A 4GVXA 4R54A 5IN4A 2I76A 5JDIC 4MIEA 3BAZA 3M1AA 4WEQA 4IDGA 5ILGA 1K89A 4IMPA 1LDYA 3K31A 1LDMA 2CSUA 5F5LA 4H7PA 2VNSA 3EZYA 2O3JA 2EIHA 4MVJF 1NNUA 3P7MA 1SB8A 3TZQA 4HX5A 1KC1A 2OBNA 4DMLA 1NBOA 1P3DA 1BDMA 1MLDA 2GZ3A 5THQA 1A9ZA 1EQ2A 3WWZA 3RASA 4AJ4A 1T2CA 9LDBA 4YJFA 4CLRA 5IFLA 1B26A 4Z0PA 2ZKLA 2EKLA 3DONA 1P1KA 1KY5A 3RBXA 5JMWA 3A28A 2WYWA 4RZIA 3UFXA 1ZK3A 4KDEA 4WPGA 3IJRA 3AJRA 3L6DA 3OJFA 5GZ6A 3AWDA 3D5TA 2BELA 3N74A 4FFRA 4R68A 1RYEA 3FPCA 1IHXA 2O4UX 4Y6SA 2GGSA 2W4QA 4CMIA 5TRTA 3CUKA 1UH5A 3D4NA 4HBGA 3DZHA 3QP9A 4D42A 1Z7BA 4QQRA 3C1AA 1N2SA 2NU9A 3R1IA 1YQDA 5F1OA 1S6YA 2B83A 2ZATA 1EFKA 5IDXA 5L4SA 5C37A 1U7TA 5CEJA 1WXDA 4JBHA 2FPPA 1KEWA 4FDAA 3RBZA 4YJFB 3B1FA 2PY6A 4NNJA 2O2SA 3DHEA 2IXBA 1GYPA 2J3HA 2Q1TA 4IIUA 2EJVA 3T4EA 1TT5B 2QQ5A 3PQDA 2EW8A 2AQ8A 3ZWCA 5L40A 3FNHA 1E1LA 1VPDA 4KQWA 5JAMA 2FPGA 3AUAA 3I6QA 3W8FA 2CY0A 1UUFA 3D3WA 3PHHA 1UZLA 4AJIA 3OJEA 2J3KA 2VNAA 3JQ8A 3AY7A 2EWMA 1QLHA 1BSVA 2VWHA 4ND1A 3K2EA 2J5KA 3OIFA 2VWQA 4W6ZA 1DRUA 2IEDA 1OC4A 3I6IA 1GTMA 1XG5A 2Q1SA 1HZZA 4BNYA 4JROA 4W9NA 5AOVA 4TMFA 1HEUA 1YOVA 1WLYA 4J0FA 5CHEA 2CZCA 5TX7A 1ZK2A 1R0LA 2O3UA 1LDNA 3ICPA 4NG5A 3W4JA 2IZZA 5DOZA 2D3TA 1GEGA 1Q7GA 1W73A 2BF7A 4NK5A 1FDTA 2X23A 2A4KA 2X5JO 4BNWA 1E0DA 1D1SA 3CZRA 4YJHB 4D7AA 2BD0A 1NQTA 3WIDA 2FR1A 1I33A 3WNVA 3L9XA 4PLGA 1JVSA 2PK3A 2E37A 1EBUA 1ZH8A 4YJGB 3ZU3A 2B0JA 3EMKA 3I9JA 2X9VA 4UEJA 3UGKA 3W4IA 3OSUA 2B36A 4BNXA 1BRMA 2WWRA 4BQPA 1F8FA 1H2HA 1KYQA 2O7SA 5JMPA 1UAYA 4I9NA 4CMEC 2YDXA 1N9GB 4J4TA 2B35A 4AJKA 1VKNA 3FWNA 4BGUA 4B4WA 3M2PA 3IUSA 4NQZA 2Z95A 5EPOA 3BTSA 4CM3A 2AW5A 5KVSA 2WMDA 1WWKA 3C1OA 1JA9A 2O3RA 1HKUA 3IP3A 4QFCA 5CAEA 5CPBA 3UCEA 3RKUA 2BH9A 1MXFA 4E0BA 4WECA 3P2YA 3CMCO 3HE3A 4JQCA 4M55A 3ZV6A 1NWCA 1YJ8A 3QSGA 4LN1A 1IZ0A 3TL2A 4UVEA 2YUTA 4EUFA 2DU8A 1GDHA 2ZB7A 3RQSA 1Q0LA 1W4ZA 5CDSA 4ROSA 3DOOA 4BL5A 2RBEA 3EVTA 2OP0A 1YVEI 3GRPA 1CETA 1BVRA 3BHMA 5LDGA 5L7WA 4AJEA 2PLAA 3SEFA 1K2WA 4BNIA 1F17A 4XD2A 1ZO8A 1CDOA 3FWZA 4RQTA 1R4MB 5HM8A 1KERA 3ZV4A 2R2GA 5G0VA 1K6XA 2VOEA 2Q99A 3B1JA 1JN0A 3KBOA 3NX4A 2P9EA 3AUTA 3GH3A 1R37A 2VRCD 3LQFA 4TZKA 2AHRA 3GNQA 4WE3A 1P9LA 1LSUA 3LT4A 2QG4A 2EXXA 3PWSA 1X14A 3AK4A 3CKYA 4JBGA 3L07A 3D4PA 1OBFO 3RUCA 4GGOA 4H16A 4K6CA 1JDJA 3GY0A 3EAGA 3PYLA 5EIOA 1BW9A 3WGOA 3KUXA 5ICSA 3JQBA 1LI4A 3ADOA 3DL2A 2D4AA 3DAGA 4XGIA 5BNTA 1GZ3A 1ML3A 4BKRA 3G1UA 3GLQA 4J1NA 4IJVA 3GGPA 4QO8A 4M8SA 1LA2A 3K30A 1N92A 8ADHA 1PJ4A 4B3IA 2G76A 1KVRA 3GUCA 3DZFA 4HXYA 3QJ5A 5U4QA 2O23A 4TRMA 3HJAA 3GRKA 4BKUA 2EEZA 3AU9A 3D3EA 5A5FA 5KJCA 3I52A 2DFVA 2E4AA 1I24A 3D1LA 2FRDA 5AVOA 3DEYX 3U4DA 2GF2A 1I3LA 2OHXA 4CR7A 3PGJA 3F46A 2I5PO 5G4LA 3C8MA 4IZIA 3OIDA 2IYPA 3E48A 1U3WA 3TF5A 1VL6A 5JFOA 1E7QA 1N8KA 5H83A 3WXBA 2Q4EA 5I9NA 4NR0A 4D44A 5B12A 1KC3A 2F00A 3AFMA 4JNKA 2DUUA 1DIHA 3BMQB 3JQBC 1DJQA 2BLLA 3AM3A 1RM4A 4GL4A 4X54A 3VH2A 2JFHA 2X9GA 2PTGA 4RV9A 4OSOA 4LW8A 3IDSA 4E2WA 3JQ7B 1ZCJA 1YB4A 1EVYA 2WD7A 4RDHA 1BDBA 1D3AA 2JL1A 1E6WA 3ZNNA 4I9HA 1QYCA 4D45A 2Q3EA 4RF4A 5JCJA 4FJ2A 4YT2A 2VHWA 1XDWA 4BNKA 4L0QA 3K92A 4NBRA 4Q3CA 3NT4A 3I5MA 1BG6A 2NU7A 4FSHA 4LISA 1L7DA 4AICA 4L73A 4EJMA 4MINA 3JV7A 3DOCA 3VTZA 3OP4A 4IDCA 1XA0A 2R00A 3TFOA 2X0NA 2GR9A 2ZTUA 4QFDA 5TQVA 1V8BA 2J3JA 4OM8A 4D3DA 3C24A 3P19A 4BNMA 3DBLB 4M49A 4ALNA 4CM9D 5A9SB 1H6AA 2JFFA 3FRJA 4ESOA 5JC8A 4DGSA 3T7CA 4XYMA 1YBAA 1KBZA 4NFYA 3JQ6A 3H6KA 5A03A 3LLSA 3ZGYA 7MDHA 3RUEA 3VTFA 1QP8A 3MOIA 1FDWA 3PJDA 2W8ZA 1C0PA 4R5HA 1SAYA 1EUDA 4UULA 1YQGA 1DFIA 3TOZA 1O89A 4EBFA 3PHIA 1KVUA 5IZ4A 1V3VA 1UAGA 1ULUA 2WD8A 3MJ4A 2YV3A 1P1FA 9LDTA 1SNYA 3B1KA 3M2TA 4IUYA 1YWGO 2EJWA 4RZHA 3WGHA 3ZHYA 3LT0A 1I5RA 1OC2A 1YL6A 3HB5X 4S3MA 1V3UA 4ZQEA 4XWYA 5CG1A 3W8EA 3I9MA 3BMCA 3R3JA 1VJ1A 4W7IA 4ZQFA 2YYYA 5CPFA 4R69A 5T57A 1UDBA 4TVOA 3ON5A 1XR3A 3OH8A 2O3QA 1A9YA 2JCYA 4EW6A 1ID1A 2WYUA 4Z9YA 4XB1A 4ND4A 1DRWA 4XR9A 1MP0A 3OMLA 4DXHA 1X0XA 4L4RA 1DC3A 1VRWA 3QV1A 4TWRA 4CMBA 5ER9A 1DIRA 5L4LA 1YQXA 4TVBA 1D1TA 1G0OA 3LU1A 3JQAB 1AGNA 3KRTA 4KOAA 5A02A 2B5VA 1VI2A 1I01A 4J9VA 1G0NA 1HETA 2OORA 4NH4A 4PG6A 3Q11A 3BA1A 4OKNA 5EMHA 2DAPA 4JN6B 1PWZA 3AOEC 2CMDA 4BUCA 2JCXA 5IJZA 4XYGA 4H15A 2NVUB 3PVZA 3WYEA 1CERA 1DIGA 4ILKA 2HAEA 1A7AA 1UXHA 3NGLA 5A3VA 1QYVA 1GUZA 2GN4A 1NHGA 3CXRA 4BO2A 3BIOA 1NVGA 3U4HA 1PS0A 1GZ4A 1MFPA 3O4RA 4MVJA 4B3HA 4RDIA 4BVAA 2I99A 2WYVA 3FNEA 2Y0DA 4MPDA 4Q9NA 4C7JA 1JU9A 1KETA 2EP5A 4MP8A 4DQVA 4YRDA 3E9QA 3KEOA 1I2CA 5F3RA 3LF2A 2Y67A 4OOFA 4KTVE 1FMCA 3CINA 2JHGA 1S7CA 1ARZA 1QG6A 3L9WA 5U1PA 4FQ8A 3PJEA 5K0ZA 4CM4A 3Q2IA 1DC6A 2PZLA 3ICCA 3INTA 3QWIA 3DWFA 2B4TO 4BO4A 5KKAA 1GPJA 3KO8A 1NP3A 3H2ZA 2D0IA 4DIOA 1U4SA 4IDDA 4WEOA 1DIAA 4Q39A 3WGIA 2HMVA 4OXYA 8LDHA 3EC7A 1EQUA 2QX7A 1QRRA 2WSBA 3CE6A 4L9RA 3RKRA 5KJ1A 5JAZA 3H3FA 2GCGA 1TXGA 4PLTA 4YACA 1F8GA 4CV0A 1QORA 3ZW8A 1OMOA 3SJ7A 3SJUA 4DPKA 5L95A 4HFRA 3ANNA 1GUFA 3RC2A 2X1HA 5JO0A 4UUNA 1XU9A 4K28A 1U9JA 1EDZA 4QO7A 1PR9A 4GPD1 5GMOA 4D3SA 4BB6A 3JQAD 4P38A 2J3IA 2EKQA 3QA9A 1PGOA 5DT9A 4FB5A 2Y66A 1SOWA 5MDHA 2BFAA 4CL8A 5A05A 3V2HA 1HYGA 1PGNA 3IQDB 4M86A 1FDUA 4P22A 5F1PA 3STHA 4ZGWA 3SC6A 4A2CA 4MJLA 3TN7A 3F9IA 4DA9A 4AVYA 4ZA2A 4EJ6A 2RCYA 2YHIB 4MVJP 5AXBA 4DWVA 4ZHSA 1MC4A 5EERA 5THKA 1KVTA 3H5NA 3JD0A 1EEHA 4QEDA 4AG3A 1B8UA 4FC6A 3VVBA 2YFQA 4CQLB 3TOXA 3TZHA 5A9RA 1GCUA 4BO0A 1LBEA 1OFGA 3GAZA 1X1EA 2JJYA 4DIFA 4F3YA 1OI7A 1E7SA 3B20A 3TRIA 3WGGA 3DZKA 3FPLA 3F5QA 2ZTMA 3GEMA 4CQMD 5T64A 1Y1PA 3DB2A 3OA0A 4ZICA 1JQBA 4I9UA 1N1GA 4NHEA 2NNLD 3A4VA 4Z3KA 5COBA 4BMNA 4CR6A 1GYRA 3BXXA 4H3VA 3RUDA 1V35A 3HWRA 3LK7A 1UXKA 1Q7CA 4Z0TA 3CMMA 1IPEA 1NPDA 1U1IA 3PP8A 3WYCA 4E2ZA 3GMDA 3BYZA 1XCBA 3KVOA 4JK3A 2Q2VA 1VC2A 3KB6A 1T2FA 3PDUA 1KS9A 2XAAA 4XIJA 5I9LA 5DOVA 5EN4A 3U9LA 3DTTA 2D1YA 3SC4A 3BMNB 3LT2A 4DLAA 4YRBA 2J8ZA 4ITUA 4WLOA 2O4CA 3JQ9C 4PFJA 4TRRA 3K5PA 4LGVA 2HK7A 3CH6A 3DMYA 5EJ2A 5IN5A 1AXEA 3RJ9A 2ZYGA 1ULSA 4R9SA 3RUAA 4FOSA 3GVXA 5KVCA 2O48X 1EK5A 3DBLA 1LDGA 1M75A 2X4GA 4PZCA 1UDAA 4WGGA 4KUHA 2ZCUA 5A3JA 1SO8A 4P4GA 4MOWA 4U0KA 4O63O 2LDXA 3ETEA 3RFVA 4BNZA 1ZK0A 1HE5A 2RIRA 3H2SA 2ZYDA 4IJUA 2ZK7A 4RPHA 5KVQA 2HJSA 3G1TA 4JX8A 1KEUA 3OJ0A 1WP4A 2Y0EA 1F0YA 3WSVA 3RUIA 5ITVA 4DYDA 1ZSYA 1A71A 4LCJA 1VKOA 4U0JA 4B4OA 5JC1A 1DJNA 1GY8A 5A5EA 1PZFA 4DC0A 2TMGA 1ZIDA 4OMUA 4XEHA 1ZEJA 4PLYA 4BV8A 3PEFA 4E30A 4C4OA 2UAGA 1NTOA 3RAJA 3OFSA 4N18A 1U28A 2FR8A 3VDQA 1WDMA 1P74A 1TLTA 1U3TA 1G1AA 4NIMA 3NTQA 4YA6A 2Y99A 3ROKA 3VZSA 4GBJA 4IGFA 2PKQP 4BOYA 3DZJA 5T67A 3UH1A 1EBFA 3JYOA 1Z74A 5COAA 1QV6A 1RJWA 3ZZNA 5JXWA 2ZJ1A 4RVDA 2VN8A 1C0KA 1KY4A 1Z73A 2CF5A 4RQUA 3TSCA 3GZNB 2D5AA 3PIDA 1ZBQA 3H9JA 4UVGA 3KTDA 4CM4B 1VSUA 1O8CA 3BZUA 1GL3A 1HDRA 3JQ8B 1PEDA 2QHXA 1J6UA 1MV8A 1H6DA 3VPSA 1SEPA 4YQZA 1DC4A 3ZU5A 3CTMA 1NFRA 3V1TC 3X2EA 1DBVO 1JKFA 2BFMA 5U9CA 1U5CA 1UR5A 2VHYA 4ZQHA 2A94A 3E5RA 2HMUA 3ANMA 4GX2A 3ZWXA 4WLUA 4DPLA 4WK6A 1C14A 3ANLA 2HSDA 3IJPA 4R1UA 2PKRA 5DP1A 3BTVA 2FSSA 2XXJA 4J1SA 4FFLA 4XDZA 1R16A 1P31A 2GD1O 1CYDA 3ZWWA 3OEYA 1DEHA 1Y6JA 4Y6PA 3GK3A 1ENYA 3DBRA 2OZPA 1YDEA 1DOHA 4Z9FA 2GASA 5TLSA 3JSAA 4NJOA 5TC4A 3TQHA 4MO2A 4JJFA 1D4FA 3INGA 1I32A 4U7WA 4WLEA 5CFZA 5I7SA 1ISIA 3GFGA 2VRBA 2QYTA 4BO5A 5TSDA 1LJ8A 4B4VA 3ETGA 1ZSVA 3NV9A 5DBGA 3ZHBA 4ALIA 1NFQA 4S1VA 1PJLA 1MXHA 3WBBA 4QXMA 1JKIA 4E5PA 1FJHA 1C0LA 3L4BA 2HDHA 4NBTA 1P0FA 2GZ1A 1RM3A 1ONOA 4R5MA 5KOIA 2PZMA 4E6PA 3WYBA 2GNAA 4RPKA 1NM5A 2W98A 3LF1A 3COSA 3DFZA 3K96A 3FN4A 2RAFA 3U4IA 4Y8VA 3MJCA 4RJTA 1D8AA 1MGOA 4DREA 1DFHA 3WTCA 1Z75A 4PLWA 2QRLA 4J7XA 3TFQA 1HYHA 2Y1DA 4CM8A 2GZ2A 1Z45A 1LRLA 2DLDA 3KZVA 3PZRA 1A27A 1B3RA 1CWUA 3W6UA 5TGDA 1NYTA 3LC7O 3C7CB 3GVIA 3ZDFA 4KWHA 4GLLA 2DBZA 4JP2A 5KTKA 2X5KO 1TI7A 3PWZA 3JQFA 3ZH2A 3IKVA 4KWIA 4PG5A 3ZU2A 4OGWA 1HWYA 4E13A 4Y9DA 2AG8A 2Y1EA 2ZQZA 4E5NA 3KOUA 4A10A 3OHSX 2E48A 3GEDA 4II2A 2G1UA 4BNGA 3C3XA
chains in the Genus database with same CATH superfamily
2Y9MB 3GC6A 3PQ7A 1ODCA 3GZJA 4QTTB 5DBHX 3C43A 3F5SA 1NVVR 3GA5A 1Z18A 3P0EA 1NAIA 5LP6B 3NI2A 3PUHA 3HKDB 4M1MA 5GV7A 4DL9A 4YRTA 4QVIA 1USGA 4G0VA 2FHSA 1NU6A 1PR2A 3ME5A 3GELA 4LOAA 5ESRA 5EMLA 5G02A 1U8TA 1UBUS 1G5RA 5FCDA 1P7VA 1LWNA 2C88A 2FP4A 1WSWA 3C6KA 5AXDA 4M9RA 2A5YB 3OY2A 3OQ1A 1T5HX 4XXHA 4F84A 4ZVKA 2MINB 1L7OA 3FR7A 2CFIA 4J7CA 4JT8A 3HJGA 5EZSA 1I8TA 2AVNA 2YXNA 3S7ZA 5IDQA 5LKAA 1QS0A 2P4HX 1M2HA 3A1EA 2DUMA 2J31A 1A5SB 1QJ4A 4FZJA 2CDBA 3PCXA 3ZWPA 3HDQA 4JUCA 3K6SA 1WEHA 4FGWA 4YBRA 4OQMA 3VZRA 1FXSA 4FNOA 3BEOA 1H4TA 1KZ4A 2DE0X 4G5HA 4RL6A 1IULA 4MQ5A 5A4JA 3EY9A 4F9FA 1PYOA 4IGAA 3KZXA 3GEEA 4RCYA 2WSMA 1RP1A 1QNFA 1N2CA 2RFLA 5F1KA 3UIEA 2HU2A 1FDVA 5JVDA 1CP3A 2O8BB 2YYZA 4ZYVA 1FMTA 4WI1A 3T1YB 4QQKA 4JODA 4DIMA 2HFKA 3HBAA 1RHKA 1VI6A 1T13A 1W0CA 4BRZA 1HX7A 5I01A 1K27A 2MR6A 3PLRA 4TSKA 1L5HA 2GPYA 2QLNA 4GGMX 4L6IA 4CLEA 1JTVA 1FTNA 4LRWA 1V3TA 3CH4B 4U8HA 4YP5A 4V1CB 1BX1A 3FUVA 4JLOA 5DRTA 1B3BA 1W29A 3AFGA 3KXLA 4GLBA 3C5VA 2P30A 4GD3Q 3G13A 1RWWA 1T9HA 3M9WA 3O8QB 5EWMA 2YW2A 3QTBA 1ATIA 1EK1A 5JSKA 1CULC 1JLKA 1H0KA 3DMTA 3HV2A 3TTVA 1BDHA 4GPBA 3VZBA 1XMQB 3ROQA 1XN1A 1GAWA 5C8DA 2X14A 1R7RA 3ED5A 1PUIA 4R1LA 4ZJZA 1CUJA 1R4ZA 4ARBA 4OPMA 3S28A 3REQA 2WM9B 4KXFB 2WUFA 3TW8A 1UJMA 1XQXA 2Y1FA 3NVMB 1HE4A 4EATA 1I30A 1YI8A 4CT4B 1MEOA 1EVLA 4KMRA 4BX0A 1RWXA 1PWHA 3IGFA 3KKMA 4KNVA 1JKMA 1RQ7A 3W6ZA 1UBLS 4OXXA 2P2SA 3I6BA 5I51A 2J33A 4OP3A 1L1FA 5ALSA 5E8RA 1D2AA 2DPXA 3E3MA 1CEQA 1QIMA 3DC2A 4MI3A 4X1IB 1QANA 4G5XA 4B3XA 3BH0A 3DVAA 1UBFA 1QOZA 4TL7A 4QDTA 1H2ZA 1BJTA 1UQUA 5DN9A 5BSVA 3G9XA 3O1HB 5T8KA 1ESNA 3ECAA 4NK4A 4N3AA 3WFJA 2XMPA 4AJNA 5LMNB 5EWJA 4DPMA 1VHTA 1CRWG 4R2MA 1H1TA 1SRRA 2ZUDA 3PZBA 1VL2A 3EZLA 1GILA 1B6RA 3OX4A 1HFEL 1QO7A 3CGWA 1E6KA 3W5BA 4WT7A 2Q49A 3T0FA 4EYQA 3MTAA 4F9GA 3EPPA 3VPBA 2BFOA 5B5SA 3T8YA 4W5WA 4LV6A 1R9GA 2FMKA 1C7FA 3HB1A 3R09A 2Y0BA 1E92A 4P4UA 3T5DA 1UMCB 3CX4A 3NOVA 3IKMB 1KO7A 1PK7A 4HDNB 4A92A 2PJUA 4C0HA 2ZJBA 1ONNA 4EKGA 2CW5A 2HU7A 3EXG2 2IZ0A 3COVA 3JASA 1LSOA 3M0EA 5D6NA 2XADA 3PXAA 3ABSB 2FSUA 3T1QA 3WYNA 2QAIA 4PZZA 3PF8A 2XXAB 1SCAA 3CBQA 2BYTA 3KD3A 1DINA 4QYMA 2C0PA 1THZA 4NJEB 1S2OA 1TM4E 3UPTA 5JNTA 3VUEA 2O8CB 3MT0A 1DPGA 3AY6A 1IBCA 3F90A 2LUOA 3LPNA 2BKEA 3KHUA 1DBSA 1WXXA 4V0LA 3EMDA 3BORA 3IQGX 1NN3A 1QQBA 3ZI4A 2QD3A 1AF7A 1HE2A 2XE4A 2DUJA 1E6EA 1L8XA 4HZGA 4IMJB 3UO8B 2ES4A 3FDJA 1GTZA 1DZ3A 1JBEA 4E5SA 4F4CA 4ZYLA 1ND6A 3TTSA 4CMHA 1XA3A 4K9SA 1OHHA 1ZESA 4ZO6A 1WV0A 4EG3A 1CZKA 4OUDB 1QV9A 3I76A 5JJCA 4RHEA 1IMOA 5L3RA 3FWYA 3VNBA 2O2EA 3TNYA 3U9SA 3N2ZB 2NNWB 3FTQA 2AEFA 2VF8A 3KKZA 2QN7A 3R20A 2HA0A 1G8MA 3WQSB 6YASA 3TDMA 3AY3A 4BZPA 1ENOA 4U6NA 3TLXA 3U5ZB 3TE6A 3BGSA 3VO8A 3BREA 2ZAIA 1ZD2P 2WG2A 5M5BA 3GOHA 2JFUA 3GPBA 4UNQA 3MJHA 4DNFA 3HSSA 4MWDA 1AS2A 4WCFA 2XUAA 3VOTA 1HY3A 3MRTA 3A9UA 4F8JA 1A9RA 3KV3O 3RSCA 3TMYA 3TUIC 3OIVA 3LUKA 1S9HA 3ICOA 1Y3CE 3IELA 3IUNA 3WQRA 5IZCC 1SU4A 4QIHA 4BFVA 2I7VA 4Q3DA 4MROA 1PQYA 1NKVA 1P75A 3M82A 2RIPA 1LEHA 2Z6QA 1CZNA 1KO1A 1JIKA 4XSGA 3AR7A 1L7MA 3HCDA 4IDOA 1CB7A 2ZRGA 1MO6A 3FIJA 3NTRA 4DCSA 1J0EA 3JZAA 1UMBB 5IAOA 4U39A 4KR9A 1SVNA 4MQMA 3BK1A 2CVZA 3A1DA 3PRYA 2O07A 2OYSA 1SVWA 3L6UA 4QHSA 1K9VF 4EOGA 2XUZA 3ONFA 2RHWA 3PRKE 3A0UA 1V0JA 2YWJA 3EEYA 1K8ZB 4IGKA 2A59A 2VO1A 3G6KA 1R0KA 3HP4A 4Z1MD 4RXTA 1O97C 4YMWA 2Y93A 4WKPA 2F1KA 3KT6A 1FS5A 1GCGA 5LCXA 3UPDA 2X0IA 2GLTA 4B74A 2P5YA 3LNCA 4NNOA 4FT4A 3GRCA 3IVRA 5E6SB 3PGA1 1P18A 1T9ZA 2X6RA 4X1KB 3H8JA 1X3LA 3QU5A 2OHJA 3PL5A 1RAHA 2D2FA 2VZ9A 4FW8A 3AHGA 5LSAA 3HYLA 3AFOA 1FMLA 4E5MA 4BEWA 1XZBA 1I6WA 2J59A 4X3CA 1BXZA 1ST3A 4AKGA 4RV4A 1YB6A 3BM5A 4IMRA 4IZOA 1MAVA 4BNTA 2XE6A 3WJ7A 3IQXA 1UP6A 1E64A 2B7LA 1LQUA 5B55A 4G37A 2Y1WA 2IE8A 2HLDA 5HQTA 4Y67A 3H2HA 2GI4A 1A5TA 4AYTA 2WU4A 4US2R 2XUGA 1Z6GA 2OXFA 1TZCA 2PZGA 3GD7A 2ZE5A 4RFSB 3WMWA 4BC1A 4F3KA 4R71A 2ZRMA 3E3AA 1GNQA 2C3YA 2J09A 3GDHA 4ZYZA 2ST1A 2VHEA 4LMAA 3D6AA 3EGIA 3SXPA 2WTBA 4DDVA 3Q7PA 4WDRA 2VTEA 3QWFA 3K70D 1YZKA 4X9XA 2W2QA 1JEJA 1ZKDA 1ZNZA 5SYNA 5T3YA 4UPVA 1E5DA 3AIMA 2ZR7A 4COOA 5DSXA 3FSGD 1M66A 4HC4A 4LVUA 2XPCA 1P7WA 2EZTA 3HQ4O 2YZGA 4N49A 5KAMA 3CEAA 4H6VA 3DL7A 1C3JA 1VHLA 3M6IA 4JDUA 5EGNA 1DU4A 1N36B 1RAEA 1X8JA 3NHMA 3LC1O 2QSYA 1XQVA 3OLXA 3RYFA 3MXOA 4KI7A 1I3CA 3U44B 4W8OA 5BVHB 1B74A 4ZCSA 2NVBA 2PLRA 3NIFB 3T06B 3EH1A 5P8WA 4LCEA 1Z0SA 4C4TA 1ZM3A 2Z5LA 3RJMA 2HB6A 2GDZA 2QZJA 1XRQA 1R0WA 2QTZA 1EVEA 3ENKA 3P9XA 3UQYS 1V11B 3K4PA 4RY8A 3C8HA 1PL8A 3RVRA 4RTKA 1VHDA 1IHYA 1QH1B 3EZ7A 5CUQA 3K72B 1N9KA 1Y7PA 2IYXA 3RVKA 3VJKA 4DZRA 4ZDIA 1X92A 4WXMA 4ZVVA 2HMAA 1ZM2A 3RJ5A 1VECA 5CDGA 4HEHA 4S1OA 3M3DA 4EUSA 4AY2A 2NXCA 4DSNA 3V8VA 4DVJA 4OQLA 5E4JA 1TEHA 2FUG6 3G5MA 1Z8NA 2K87A 3MXTA 2FDXA 1FFAA 4X64B 1OLUB 4FGKA 4BGUA 1DX9A 4MTLA 4TTTS 1Z4OA 5TB5A 3U48A 3V5NA 4F7DA 4N5LA 3OQHA 3C7AA 1FSFA 5CDYA 1KKMA 1QIGA 1USIA 5IWAB 3ABOB 2Q3LA 1PKXA 2ZB8A 3R0XA 1W49A 4EMBA 1H4SA 1CJTC 1GVNB 4RTJA 1GGVA 2CL6X 4LF8B 1EI9A 4KN9S 3BXZA 3BXFA 4XM0A 1B76A 3R3ZA 1MH1A 3QSYA 3LCJA 5E95A 2W6ZA 3FTPA 1Q1NA 1RHJA 1X7YA 1AQLA 1YONA 2XTZA 3EF0A 3F4LA 2V6GA 3G0BA 3GFVA 1MC5A 3OZDA 3BUSA 4LV5B 2JF0A 4QOEA 5J4VA 2MCFA 1SBIA 2OO5A 4C7KA 5KYYA 4CWAA 4LSWA 2D1SA 1QR6A 3IOEA 2MSNA 4EF6A 3NDBB 4HLNA 3SSAA 2E18A 2GHQA 3BT7A 3DDZX 1Y82A 4J0CA 5ENDA 3VX4A 3FKQA 4HDOB 3H11A 3FFAA 3DL0A 1E3IA 4DSUA 1W36B 1R6DA 1WSBA 1T4DA 2RAUA 4JELA 4AKEA 3DTYA 3V7UA 5CA0B 1N1MA 3B7WA 3CQ9A 2JLCA 5IBRA 5LR6A 4QNNA 4MWTA 1AUPA 4BFWA 3QFHA 1Z0KA 4ZU1X 4DJ5X 1GFSA 3A05A 3VNQA 3IPLA 3FR8A 1CBUA 3NRCA 4EY6A 1JWBB 1J00A 1TX4B 1QYRA 1VMDA 1Z7YA 2NQTA 2YVUA 1FPQA 3ADCA 2J9FB 1Z7WA 4GUDA 5HIKA 3ZCUA 3SQLA 2JFVA 4X93A 4GYKA 5K2MA 2YJ6A 3O82A 4RAOA 4ZQGA 1KMCA 1D6NA 1GKYA 2COEA 2F1HA 3CLSD 4HQNA 2C95A 4IY1A 4LJSA 4ZHQF 3LY9A 1J70A 3CLSC 4REMA 4FR0A 2RI1A 4Y2XA 2PJZA 3EEBA 1MX3A 2NT4A 4RK6A 5SZIA 1G291 1OASA 3ML1A 3Q3JB 5JAIA 3AM4A 2Z8YA 3ND7A 3FPBA 2HWYA 2WT4A 2IEAA 3H8SA 3AI3A 4BC0A 4KGVA 3X2FA 2V9ZA 1L7EA 1UANA 2BW0A 4M8KA 4XPIB 2Q7DA 1V1RA 4BNLA 5HJEA 4A0RA 5K6AA 2B8JA 1AMNA 2NGRA 1QCCA 4Y2UA 4GSLA 3QPVA 2N0SA 1DPFA 1AKMA 2BMDA 4KIGA 4Q02A 5FUWA 2F8MA 2C2XA 3C5EA 3NOQA 5T6BA 3KQHA 4JR1A 2GA8A 3U3OA 4BY9E 3A1CA 2HN9A 4IX1A 1YTLA 2XTAA 3HPRA 2GXQA 1NQOA 3FTNA 3KETA 3HFRA 2D1QA 1FVHA 1QVAA 1E32A 4PC1A 2OUIA 1YFKA 4UDOA 1U9ZA 3VPHA 1D4OA 1V8OA 3DMHA 1JSCA 1VG8A 5CNKA 5HIMA 4DUYB 3LT5A 1M6YA 1NIJA 4AJ9A 1R2QA 3HL0A 2JAWA 3OHPA 4JVMA 4F11A 4JP3A 2CXTA 2JAHA 4MCHA 4XX0B 1NZDA 1QO0A 2W9XA 1X7XB 1TEZA 3VH4A 4FFMA 4YYEA 2DPMA 1SVOA 3USZA 1ZVVA 4KMSA 4OA5A 4FUQA 5B6PA 1WCYA 1NUUA 2FLWA 1DQZA 2CLSA 3QEBZ 2BMJA 2K2WA 3BCRA 3DAYA 4YK7A 4X44A 1FW6A 5H68A 1FNCA 4I5EA 4L76A 2J6HA 4JP1A 4PSUA 4XVQA 3WGLA 2UUCB 1TK2A 4Z53A 4DA6A 2PUDA 2DFLA 4PYIA 4IIJF 4R8SA 3ILVA 2IXGA 2IS4A 1H2WA 3HUEA 2AR9A 1L0BA 2RC6A 2X0KA 1ADYA 3DLCA 4OLFA 5HA5A 4ABTA 5DCUA 2HWKA 3VU3A 2YHIA 2HL6A 5GONA 4B35A 3OIWA 4DANA 2V65A 1P0CA 2OK7A 4FIZA 4X45A 3WQQA 1ECLA 3BFKA 5D3QA 4ZXFA 2M6SA 4BQEA 4W4TA 5FB3A 4BIMA 1L4MA 1WZIA 3AP3A 1FRNA 4DR1B 4DAOA 1K7SN 4WD3A 2UU9B 4MV0A 1RJEA 2CZQA 3GFFA 3K0AB 4NCNA 2DFKB 1WPXA 5KSYA 1JJAA 2FCRA 1YUBA 1EK6A 2VUTA 3QU7A 2PFKA 4MVJE 1SZDA 1MJ5A 4R0NA 1JAHA 3V8PA 1EFLA 3QE4A 1S1MA 1JAXA 3OE5A 2WIGA 4MITA 4ALMA 4YMTA 1C1XB 2VUIB 3L6RA 4YV7A 1MG0A 4LNAA 1XUOA 3TVYA 1TJYA 4YAEA 3P27A 2F7SA 1VOTA 4R51A 1QQ5A 3X0DA 2R6CA 2P0YA 5A1TA 2V1UA 2XYGA 4KNWA 1VIVA 1ELOA 1OFIA 4L95C 4B6GA 3HLYA 2OAP1 1OTYA 4DBZA 3N2LA 4HAXA 3PCTA 5JS7A 4BMXA 3F1LA 4XUGB 4JCCA 2AI2A 2JKYA 3DBIA 5CXUA 5SYAA 1UK7A 2NXWA 5KTOA 2QL5A 3O9VA 4ZO8A 4B4UA 1M72A 4KAFA 4XOIA 1T4MA 3HU1A 4KK4A 2C7GA 1PL7A 3T5MA 1GTVA 4B2LA 1SCJA 3SOZA 5FLKA 3RD5A 1T24A 4JA2A 5LLDA 5ITSA 4H3SA 1P5HA 4DM4A 1UXIA 4XPIA 4ER0A 2I4TA 1X7DA 3QLEA 2HLPA 2F90A 3K1ZA 2I67A 3L82B 3EQ9A 3ZNQA 4Z0NA 1P4JA 2PGNA 2R8PA 4KWEA 3NT2A 4P4SA 3JYHA 4O2RA 2PL5A 5DM0A 3LBNA 5AP9A 4Z6KA 1G98A 2CN1A 1P9OA 2FDRA 3U7EB 5JAHA 5F76A 2D8AA 4WKBA 2BC9A 3VR2D 3ORSA 1ISMA 3PDJA 1Y5NA 3R5TA 4YR9A 3NAZA 1RHQA 4YGYA 2ZWVA 2XB8A 1ZZEA 4RJLA 1G38A 1OAKA 3ZLBA 5BRNA 3B48A 10MHA 2RKBA 4CKBB 4WJKB 3RS7A 1L5QA 1IE3A 3WB9A 1DT3A 3PR1A 1ZUWA 3QFRA 4KEAA 3NFYA 2O52A 3WYDA 5DPMA 2UZAA 2V97A 1RXYA 3DT6A 4L28A 4PAWA 1GLVA 2OD9A 4WZAA 6GPBA 4BVKA 2XOXA 5JG7A 4DJJA 1VJ0A 2BGLA 4UMEA 1M6NA 4PXSA 5HFAA 2Q3BA 1XAIA 4OHYA 1GZDA 3FUCA 2ZRIA 2B69A 1JG1A 4RHTA 1S1CA 3B9BA 5GOZA 2QBYA 3UNXA 4G97A 4LZLA 4BNJA 1QQ6A 1JP7A 4TKLA 5JZVA 2HD4A 4M54A 3R9IA 3DVQX 1EIWA 3EB9A 3MJSA 2F48A 4RGBA 1BW9B 3BZBA 3JR7A 3Q15C 4C3UA 2ZSBA 1I1QB 2WU8A 4G3XA 3FLAA 3MMXA 2PFSA 5I7FA 4LJ9A 4QT0A 3U0BA 2P9GA 1QV7A 3LUDA 2ZS9A 1FDOA 1FW8A 4L0MA 3O4FA 2DFTA 5DX0A 1E3WB 3AP2A 1NQVA 3GIWA 1KYVA 3ZHCA 5HZKA 1PZXA 3NU1A 2FGKA 3C7DB 1PBTA 3HBFA 4CUKA 2EF1A 4N0DA 1KA9H 1PJCA 2NT3A 3LQ1A 2D59A 2P9YA 3N7AA 3QPWA 1E4VA 1OAOC 2GD6A 2NZ8A 4IDBA 4UVIA 1KK0A 4DLZA 1HDYA 1L9KA 3K71B 2Q28A 4Y7DA 3VVCA 3OU6A 3WLEA 3NGXA 4PYOA 2QS9A 1YR6A 1C3LA 4BHTA 1BA2A 3ZZUA 1WMSA 3OHMA 4CLXA 4INOA 4AY5A 5C8YB 4DR5B 3U61B 1DBQA 1KI3A 3RSSA 4TTVA 2QX9A 1A8PA 1D8TA 3N5CA 3Q9UA 1H2EA 3LWZA 4G86A 5FOTA 4XWGA 2HPHA 3C5HA 4E7PA 3GYGA 4LYEA 1RWOA 5FFMA 3EIOA 1TGYA 2HJWA 5DTJA 3OQJA 4IIYA 1KFEB 3KWLA 5GJBA 1NPTO 1FJGB 4F6LA 1F51E 3A7DA 4XFDA 5IT9A 4QUAA 4QYIB 1DC5A 2BY4A 3GUHA 2Q1YA 3VPGA 4BWYA 1NKTA 3G8AA 4CV1A 3AOEA 4CKCA 2V4ZA 4E22A 4CM9A 2VP5A 4YAKA 4FBGA 1N7HA 4KPUB 1Y6FA 1F6BA 1G8JA 1DUSA 1RWQA 4YQYA 3R7SA 4LHZA 4KB5A 4YJ3F 4ZI2A 3WRWA 4GW3A 3WHIA 5A5DA 1VHJA 2RJNA 3F74A 3E3NA 2IHNA 4TQUS 1B2LA 4WXYB 3A1SA 3KIPA 4P1ZA 1VLLA 2FOLA 5LJLA 1T5DX 3C4VA 3LHIA 5TQ0A 2XXAA 2I03A 5AJXA 3L7NA 2JIQA 5B57C 3I5XA 4ZCQA 1FQWA 1Z4PX 2W2MA 1I6KA 3M6MD 4LDZA 5DB4A 1C4WA 4J0JA 4MCIA 1L5WA 1FFCA 2PXXA 3V7FA 1GEEA 1VFNA 3PCRB 4K87A 1J8MF 4N40A 1FBNA 1G20B 2WA1A 3B7GA 1DXYA 1JEQA 4N7BA 4MS1A 5FYDA 2DFPA 1JX6A 3QUTA 1A77A 1M54A 2VRNA 1QQAA 3D9QX 1NG1A 2UZ1A 3PT9A 2C29D 2YRFA 5GVRA 3TQFA 5CLQA 5JZSA 1IVNA 2ISQA 2OOSA 2LKDA 1Y8QA 2XMRA 2VK4A 5LU8A 2CXSA 1N8SA 1SC3A 4A6EA 2E4XA 4KVGA 1N57A 3JPYA 4ZCPA 5IEJA 2IPOA 3DBVO 3CCFA 4GRAA 3GARA 4XWWA 2ZVJA 2OHGA 2HK6A 2JATA 1IPHA 3EFOA 1XPOA 5ALNA 5AIAA 2FZ5A 4TXMA 1ZIYA 2FOXA 4OQYA 2CXPA 4UAGA 1QGAA 1QFMA 1TAGA 1Y3DE 2CL0X 2WK1A 4LXUA 4QZVA 3M5DA 1TYDE 1D5CA 1SBCA 3HFSA 4MI9A 4I8DA 1BRTA 2Z09A 4YR7A 3K0FB 3K05A 4B09A 2MYPA 1KRWA 3E8MA 2DBYA 5A5GA 3WB2A 3SLKA 3R5FA 4MQLA 1OTHA 4FWBA 2AC7A 1FC0A 1BKYA 1O5TA 2VJNA 3JAKB 4YEDA 3I2JA 4QEZA 4B5KA 2LTAA 4CTKA 2PAFA 3ZDXB 4RMHA 1CUUA 8MHTA 4L0CA 3F3MA 3PK0A 1MVLA 4KQCA 5D8DA 1WAMA 1CF2O 4XI9A 1OX5A 1YDFA 4I1IA 3IHLA 2VWGA 2MU1A 3B1ZA 5J2TF 3T94A 1NTRA 3JZDA 1G4AE 3LY5A 3OPVA 3I9NA 4IIJB 4W9RA 2W70A 4BAGA 2ATEA 2YASA 2WZBA 3D8SA 3EVBA 3JZIA 5HOQA 2WB2A 1ND5A 2KLBA 3D5EA 4R16A 4XYEA 5EE3A 4PQGA 5EYPA 1T8RA 1YNOA 4Q4CA 1SN7A 5AI9A 3AVTA 4RK7A 4OMDA 1D1QA 3IV7A 3H2BA 1S3GA 5CLFA 5DULA 4OBEA 4CV3A 4I7EA 3DMGA 4TYMA 3INNA 1ZRHA 4RW0A 3QNWA 4BNVA 5GP1A 3RW9A 3ZWQA 3PGMA 2RGRA 4FXOA 1PFWA 4V0ME 2AXPA 1YS2X 3AXTA 3Q7IA 1OWMA 4RXMA 2GBIA 3GNSA 1E63A 3OM1A 4E88A 1EFPA 2BHTA 3BGWA 2G5GX 3NTLA 4S0XA 3I9LA 1YF3A 2FUCA 2C9MA 1NRJB 4HAOA 4KH0A 3ZNOA 3ZUPA 1AZLA 1N6LA 4L50A 5AH0A 3NWEA 2RAPA 5JJKA 1XLTA 1Z4IA 3RC7A 3QYJA 4RJJA 4RLFA 4ENRA 5M04A 3PC7A 3U31A 2R8BA 2ONKA 3F1KA 3AL3A 5ADHA 1J23A 1EYZA 4OXNA 1AIPA 1U02A 3O94A 5JTUA 4OJQA 4O4JA 3LXMA 1OU4A 2W6QA 4FR2A 1O96A 4LYJA 4Q18A 3L0BA 1CJCA 1PN3A 1DAOA 3K0CA 1GZ6A 3ZI0A 4IDHA 1W7AA 2IBSA 4XJSA 4PG8A 5I9TA 2NSDA 2RHBA 3GMTA 3O83A 4H0NA 1XTVA 2H17A 1J0XO 1OT3A 2ZQ5A 3D5QA 4PZ9A 3I53A 1JZTA 2WPDD 1QIFA 4I8IA 5KNDA 3Q3HA 4I6JA 1OHHD 4OI1A 3CU5A 2XWBF 1FP6A 1U3VA 3TD6A 2WBLC 4L9SA 1V7ZA 1J24A 3QXXA 1T5IA 1ZVKA 2CSXA 1UIMA 2ZUSA 4J76A 5A9TA 1BGXT 3LBIA 1KDZA 4D99A 4F7WA 4PYQA 5KWEA 4IWXA 4BBJA 3OZWA 1P1RA 1AQIA 1CUWA 4X8LA 2FOIA 1U1FA 5F64A 3T9FA 2WILA 1NSYA 3EGWA 5GV8A 1L4FA 2GKGA 2W48A 4G2TA 3ICQB 2WF9A 2J87A 2JJ2A 3SCZA 3PJFA 4NP6A 1M0WA 3VC3A 1UBGA 3AIIA 3ILHA 2FWBA 4ID9A 4OHMA 3ZY5A 3T5AA 4NU6A 3WMFA 4ALJA 4YCDA 1KMHA 5T4HA 1IXZA 1GGFA 4MKHA 1A72A 1ECFA 1G18A 3D6MA 3TTUA 2R1TA 4Q3KA 1N5MA 1W8DA 2B4QA 4I1YA 5LLTA 3L49A 2F3TA 2BH2A 2CV0A 4P2GA 1N6OA 4ZZIA 3WDSA 4FX2A 3NC1C 4MDHA 5LA6B 4FFOA 4CF7A 2OFOA 1OWOA 2BVNA 3HUTA 2A0WA 2NU6A 1KO5A 1PT7A 3IE2A 1K6EA 4C6SA 5F2NA 4NMWA 2KBFA 5BV7A 3TLGA 5A9SA 2D7CA 1ZXBA 1FUYB 2RC5A 2V6JA 1Q3TA 1NZFA 4LG1A 1WUYA 4E46A 3LCMA 4H18A 4ZU6X 4EITA 2CBXA 3JYQA 2C7OA 3HN7A 5FPKA 3M1YA 1YDHA 1IZ9A 2O7QA 2ZYAA 3K35A 3PUKA 3RIGA 3GXOA 1CJVC 4A27A 4CLOA 2W93A 4JNCA 4YJKA 3BGDA 4S0ZA 4BVHA 4AN1A 1VYTA 1CR4A 4XB2A 8ABPA 2J9YB 2F67A 1Y33E 2P5SA 3EXEA 3UPUA 1WP9A 3AEUB 1JR3D 5HS6A 1E1QD 4BB9A 3F8SA 1L3BA 2VZLA 3QEOA 4HMOA 5AJHA 4WY5A 4BDSA 2WM8A 2VAPA 3ZQ6A 3VOBA 1WKVA 3AF6A 2PVCA 3OM9A 2PZ8A 2W2XA 3HR7A 4IFTA 4HVTA 3KX2A 5K3DA 3T12A 5F5NA 4GNRA 1YS7A 3WNCA 4GM0A 4M1KA 5FOSA 1DTEA 3ZGNA 4DIDA 1LBSA 3TW4A 2N75A 1IM5A 1G1MA 2CYCA 4LVCA 1M0EA 4RSGA 2Y9PB 1IN7A 5LNK6 4HAUA 2XWQA 3B85A 1E7MA 3PDWA 4RJIA 2YZ2A 2NU8B 5JASA 1J2UA 3U4QA 3A6EA 3L84A 2PX4A 4IUDS 3DFMA 3OCUA 2P9JA 4IVPA 4QE3A 5NLLA 4AN4A 2QTHA 1ZICA 2R1TB 4J7UA 2ZUVA 3E7WA 4O2AB 4OJYA 3B5EA 2GAIA 5ABPA 1GNTA 3KBBA 3CEMA 5KNDH 4JXKA 1QC5A 3WK7A 1YR2A 4FW9A 4ZZ0A 1YC2A 5K3AA 1DELA 1OGYA 4M0PA 1J42A 1CYEA 4FEGA 2Q7XA 3HJBA 4P53A 1AMUA 1OWPA 2C54A 4NOMA 3WHPA 3I1YA 2VNJA 3RB8A 2YS6A 4P93A 4ZI3A 1DRVA 1JAIA 1MFZA 4GDFA 1N2BA 2CLLB 4EFMA 2ZVQX 2GZRA 1JALA 3Q6IA 4FFSA 3R74A 4WOJA 4E2YA 3AL0C 3O90A 3R8XA 2NQ8A 1SUSA 2DPGA 5IU6A 1GZ7A 3TZKA 4PLZA 5EQFA 3FTEA 2BI8A 1RTTA 4HKTA 5KYYB 4D96A 2V6IA 4N01A 1Y42X 2BBSA 2G04A 1W76A 2I7DA 3F7NA 1KL7A 3N2KA 4HDMA 5AK0A 3FF1A 5FWXA 2YWGA 4IHKA 1NW6A 2WNHA 3P2MA 4BE7B 2Q50A 4ZO4A 2GFIA 2GBGA 3PJGA 4BCBA 2FJPA 4GC5A 3PA6A 1HH4A 2PPLA 5AJYA 3K70C 3AWIA 3DDUA 4EFKA 2O5VA 2OYRA 4EGJA 3ONDA 3WIBA 4CQNA 4IKOA 4RFSA 4JSYA 2D3WA 2HPVA 3A4TA 1U9YA 4LYAA 1BDIA 4YRRA 1ZAKA 4V1CI 4PPNA 1BX3A 1NXWA 4ITVA 2A7XA 3Q9NA 5G1NA 2D5LA 3EZ2A 3HJRA 1TB4A 1LLDA 1HRDA 2JLQA 2V0CA 5BSMA 1ZUNA 4PLHA 3MWJA 2Y6UA 2DR0A 3NHAA 4CF6A 3EC1A 2F1IA 3WL8A 2O2DA 3ZHXA 2VDNB 4RQAA 5LQKA 3EGXA 3QX7A 3JYNA 2BEVB 1OFTA 3DO5A 4LC0A 4X20A 3CNQS 4X1KA 5DK6A 1KEZA 2IODA 2R7MA 5LDDC 4M1QA 2FMTA 3RS8A 4RVSA 4NAHA 1P77A 1W2HA 3FMVA 4ZRDA 3U62A 4PN3A 2QQGA 5JADA 2C92A 2FWNA 4JL5A 3U44A 1CDDA 3GUYA 4IG9A 6AT1A 2RH5A 3GJ3A 4GZMA 5K51A 1IBKB 1IWOA 3CVWA 1M2EA 4ZV7A 5KU7A 1OB2A 4FKBA 2QTTA 2H0QA 4B6EA 4Q4AA 5KB3A 2AFIA 3D31A 4J0EA 3V4LA 1UEJA 4ZDWA 2VJYA 2GB4A 3KU4A 2OOKA 2ZT6A 4YRMA 1A1VA 1DBIA 2CLFB 3EIHA 3QHAA 1ZD5A 3SQMA 2D62A 3F71A 4G67A 1GDDA 1SKYE 2AJ8A 1PGPA 2QL7A 3L7KA 2G82A 2WVAA 3N6RA 3PEEA 1YBVA 4DJEC 2H1IA 1T4GA 2DQSA 13PKA 1MJNA 1D2CA 3DLIA 3EA4A 3KM0A 1QAQA 4P9NA 4D0LB 3AINA 5FORA 2JLVA 4MO9A 1AN0A 1M5RA 2XB4A 3Q8XB 2IUSA 3VVLA 3U6KA 2R1VB 2QDXA 2RGCA 1YB7A 3DZDA 1OXBB 2GO7A 1CUAA 2QYSA 3NALA 1GPH1 1FYEA 5CCBA 1Z37A 2X2OA 4OYYA 4IICA 4V0SA 2DXIA 3GG2A 4KMOA 5I7UA 2XRYA 3AI2A 4OQQA 4RTOA 3H5RA 3ZGLA 2AIRA 5FWNA 3HCNA 4N7RA 4BFTA 5PGMA 1IBRA 1TF5A 1O95A 2CV2A 2QU7A 2GYYA 3THWB 4NOJA 4JUDX 1HYEA 3AKEA 1R8SA 4BQSA 5CLJA 4MI6A 1FSPA 1YJBA 2PWZA 1KORA 1QS0B 3S44A 3GLFE 5L3SA 3HSYA 3MCUA 4H4EA 1I13A 1LC3A 2QR2A 2RK3A 3UJAA 3JWIA 4RTSA 2QRQA 1TMYA 1QBKC 2QP3A 5TMBA 1VJ5A 3I3OA 3KQSA 3L6OO 3GRYA 3OX3A 1N1EA 2B8EA 3WRYA 1ZGZA 4AF8A 5C4MA 1EDOA 4E1VA 5BR1A 5IAEA 4K8OA 2OVFA 1JPNA 1NY6A 1N5DA 2PH7A 2P2NA 4Z2YA 1IB0A 1Z4NA 3BCUA 3ZKAA 3OOWA 4ZP1A 3LI2A 4NMHA 4JI5B 1OX6A 3ESQA 3R5JA 4C4AA 1R0BA 2ECFA 1C9NA 4F2WA 2Q4OA 2AB0A 1T26A 2F3SA 2O2JA 4OP1A 2CLHB 4UASA 5JRDS 4KQFA 1Y8QB 1NUHA 1L5YA 3N2GB 3FYUC 2X8LA 1P8AA 1U1DA 4Z7NB 4MDFA 1Q15A 1SC1A 1YL5A 1NUAA 4YECA 5NULA 5B4TA 1UK8A 1M2WA 4LDQA 4NCAA 3NYWA 3OY7A 2PR7A 1TTHA 3RTEA 1FP2A 4ONEA 1NLUA 2V7TA 2FFJA 2XMSA 3IV9A 4ZT6A 2IEBA 1XE3A 1G3QA 4N0MA 4B3FX 2UUBB 2IKSA 1PJ3A 3EF3A 2QP9X 5FAXA 4DBVO 2IOFA 3AHHA 2ODQA 2CJFA 4PX2A 4E21A 2I6SA 1IH8A 1C3XA 1FMJA 3IEKA 2YRWA 3KSRA 3MUEA 3OE7A 2IW3A 2PMCA 2QRKA 4IFBA 2A9QA 3OIGA 4BV3A 1ZJZA 1AD2A 1DLIA 2NTJA 2G71A 4TS9A 1I5EA 4DCNA 4DV4B 2VSNA 4DKJA 5HSGA 1A9PA 3HDYA 4HEA1 4QPDA 4QL3A 5BOSB 6LDHA 1O08A 3QMMA 1F0PA 3G0OA 4LIPD 3RR2A 3D02A 5CNMA 1BFDA 3SXUA 4CYMA 5ALLA 5IT0A 3ITDA 4TSRA 2XQFA 5K1SA 3GDGA 5CB6A 4PRKA 4MV6A 2HSZA 1Q0TA 2C9ZA 2FPIA 4JKYA 5T6MA 3SIPA 3RAFC 3DYIA 1TKBA 1YZQA 5FPTA 4UOEA 2R7NA 2CFCA 1CS0B 4IJ5A 4KGXA 3SG0A 3X1WA 3ZCRA 4CG0A 3OD5A 5C7IO 3WWEA 3JD4A 2QTGA 2ZSUA 5PNTA 3P9SA 1J0CA 4QC2A 4HSEA 2VYCA 2NUAB 2EAUA 2PQMA 2R87A 3WC4A 4DKXA 4F5EA 4YT5A 1T2EA 5KWVA 1NC1A 2VP4A 3Q40A 1U8XX 2BDEA 4YB8A 2JJ1A 4KYTA 1M5TA 5D86A 2C5HA 4OHPA 2PGDA 4PYJA 3M9LA 2VSFA 3FUUA 3T9AA 3MWKA 4B8WA 2C2GA 4KIUA 1CLEA 1NYRA 1OKKD 4PCVA 4WASA 5B58T 4CUZA 2NP7A 3HY3A 3I28A 4FS3A 1J2JA 2AI1A 3G8BA 2VJMB 1PR5A 2HEGA 1A50B 4ZYXA 3T5PA 2WJWA 1EPUA 1X7GA 4KKVA 4P4NA 4QYWA 3VKHA 1NX6A 2UVPB 4EGFA 1FP4A 2VPYA 4KK3A 3ENVA 3NATA 5HIAA 4KUEA 4M9CA 4CCWA 1TTTA 2RBKA 3BTOA 4J0DA 2ZXUA 3UG7A 1IQPA 1GRNA 3HXLA 3I83A 4FMCB 3UJHA 6NULA 3VH1A 2FSVC 1BQEA 3F5FA 4JI4B 4MQFA 2PFGA 1IIRA 4U63A 1G9XA 1Y8ZA 4CT5A 4A26A 3UBTA 3KQQA 2ORWA 4BKPA 4HWRA 4KXYA 2PXCA 1KEKA 4LF7B 3OQNA 2LKCA 4DCGA 2O2XA 4J2TA 1SWWA 1PX2A 3NNDA 4IR7A 2XB2A 1E7WA 1LDEA 3NJ8A 1XZQA 3S2EA 3IS3A 3CXUA 4INJA 1U7UA 3OTQA 2ENWA 4CM5A 3CEJA 1NZJA 3K0SA 3PUIA 3RG2A 2WINI 5D01A 3K09A 2FN4A 3NHLA 4BMPB 3V4SA 4JOBA 1R00A 3A14A 3TH5A 3WMRA 5M2QA 1U5AA 2Z98A 4IXTA 4MRVA 5EVJA 1J8FA 2ZTSA 3ZBTA 3BIXA 1JKJA 4WH0A 1Y5MA 1ULAA 4C6RA 4H60A 3S1LA 4CV2A 2R79A 1XDSA 1Z29A 2VP3A 3E0XA 3R4VA 4HK4A 4NPAA 4X7BA 3REOA 1MB4A 5AUNB 4LFAB 1PJSA 1EG7A 2GM5A 4MUAA 1MX5A 4TMWA 3K2QA 4YDQA 3RRZA 2FLVA 2VZ8A 5HBRA 5JYBA 3SMVA 1JHMA 5DTQA 4DMKA 3K94A 5CLIA 3MJEA 1L5VA 5IK2D 1C1HA 5HDQA 1ZHOA 4JKIA 1MC8A 4UVHA 2R44A 4CI0B 3CH5A 3N75A 2IELA 2YW9A 3BDAA 3HY6A 4GMGA 3IPAA 2YWDA 3VR3D 4DYVA 1Y8RA 1EFRA 2OCXA 4TKVB 1HTBA 4KQJA 4J16C 4RH1A 4XGKA 1OREA 4DMRA 3BE8A 1NURA 5EMNA 3FSJX 3VOSA 3S3TA 4PX3A 3H2GA 1HDXA 4UNNA 4NZOA 1Y81A 3BIJA 3KVVA 4K03A 1DHTA 3QY9A 1NWHA 2BOVA 5J43A 3MILA 4GOMD 3TLJA 2UZ3A 1UOPA 3DLAA 5HF6A 3RVQA 4A5OA 4KR3A 2XUKA 1BE0A 3HZZA 2AOWA 1SCIA 1TT5A 4GH5A 4DARA 2NTVA 4GXNA 4K7JA 3L7DA 1XCOA 5EC8A 3ADBA 1HSOA 4I66A 2JIMA 2HSJA 3OE4A 3EASA 3RYTC 1YS9A 3KQPA 4A2WA 2HQOA 1ZG3A 3L02A 2ZRCA 1KR5A 3IR6A 1T9CA 2A0XA 4P6VF 4PQRA 4BEBA 1MOPA 2PZAA 1Y34E 2IQIA 2MWMA 1LB1B 3BHIA 1EVZA 3IAS6 3KPJA 2KX7A 1KMQA 1VBKA 3V6LA 3W5IA 4WBNA 3O3CA 5TEVA 4MIEA 5IN4A 5JDIC 1C9KA 3ZUGA 2I78A 4C4YA 3KT8A 5L8VA 3M1AA 2UYGA 1DRKA 4YGXB 2IYFA 3T35A 1LDYA 2PBFA 1Y80A 4C03A 1DWUA 2QAGC 4I4IA 4Q1FA 1QMPA 4GP9A 4N1AA 1IZ8A 3NYIA 2NU6B 3F4KA 2CSUA 1QGOA 3QLUC 1EGHA 4BU1A 4BE4A 2FW9A 1WXHA 4FHCA 4N5IX 3CRW1 3P7MA 5HK9A 3TZQA 3NC4A 1EUQA 1KU0A 3UAYA 3F2IA 2D6FA 4GI7A 2QTBA 1W36C 1NBOA 1P3DA 3JAWB 2EC5A 3LUBA 3OZEA 4O3MA 3AVYA 4AJ4A 3FVQA 9LDBA 1MR3F 5IFLA 4Z51A 1FTQA 2C2WA 2FX3A 3LXUX 1R0YA 2EKLA 1KYTA 3RBXA 5JMWA 3BL6A 2GPNA 3A28A 3CRMA 3G89A 5JCZA 1IY1A 3WV5A 1R9NA 4TYQA 3RIYA 1KFCB 3EEOA 3TTWA 1W5AA 1ZK3A 4HUQA 4I99A 5LP6C 5DN6D 3FCEA 1KAEA 1XAHA 3L6DA 3QBJA