2VWPA

Haloferax mediterranei glucose dehydrogenase in complex with nadph and zn.
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
357
structure length
357
Chain Sequence
MKAIAVKRGEDRPVVIEKPRPEPESGEALVRTLRVGVDGTDHEVIAGGHGGFPEGEDHLVLGHEAVGVVVDPNDTELEEGDIVVPTVRRPPASGTNEYFERDQPDMAPDGMYFERGIVGAHGYMSEFFTSPEKYLVRIPRSQAELGFLIEPISITEKALEHAYASRSAFDWDPSSAFVLGNGSLGLLTLAMLKVDDKGYENLYCLGRRDRPDPTIDIIEELDATYVDSRQTPVEDVPDVYEQMDFIYEATGFPKHAIQSVQALAPNGVGALLGVPSDWAFEVDAGAFHREMVLHNKALVGSVNSHVEHFEAATVTFTKLPKWFLEDLVTGVHPLSEFEAAFDDDDTTIKTAIEFSTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords GLUCOSE DEHYDROGENASE
publication title Active site dynamics in the zinc-dependent medium chain alcohol dehydrogenase superfamily.
pubmed doi rcsb
source organism Haloferax mediterranei
total genus 116
structure length 357
sequence length 357
ec nomenclature ec 1.1.1.47: Glucose 1-dehydrogenase (NAD(P)(+)).
pdb deposition date 2008-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
A PF16912 Glu_dehyd_C Glucose dehydrogenase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vwpA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2vwpA01
1JW9B 3GDFA 3OA0A 1VE9A 3ULKA 1LSUA 2WYWA 1ENOA 2WTBA 1HZZA 1I3MA 4J43A 3JYPA 4G2NA 1QG6A 3PGXA 3DO5A 1ZJYA 1DJQA 1VSUA 5DZSA 1ZEJA 2CDCA 4YRDA 2P5UA 4A0SA 4XJSA 3PXXA 3AW9A 1JQBA 1ZUD1 4OXYA 2EEZA 3KYCA 1PTJA 4J0EA 3NGXA 4XWYA 1XG5A 3C24A 5DULA 1QYCA 2VT3A 4CM3A 2NLOA 2YHIA 3CSDA 4YAKA 3H6KA 1GADO 1TI7A 4XR9A 4CM6A 1XDWA 2X5OA 2A9FA 3GFBA 3ITDA 3MJEA 3OIGA 4NHEA 3FN4A 4BNUA 1J4AA 3K31A 4PCVA 1PJ3A 1BG6A 4KTVE 1HE2A 1VLLA 1RM4A 1E92A 2B4QA 1MXFA 2VYND 3O26A 1P74A 3E9MA 2VUUA 3GPIA 5L3ZA 3WWYA 1JWBB 4Z0TA 5ILOA 4RORA 4LISA 4GSLA 1HE5A 2CDAA 3PQDA 4MJLA 1QV6A 1SPXA 4E12A 4CUKA 3DOOA 1ZJZA 3H2SA 3OA2A 4BO6A 3BXXA 3ZWOA 5I9NA 2NU6A 3PWZA 1ZSNA 4OMUA 3P2OA 3WIDA 3F3SA 4IDFA 4D3FA 3D3WB 1Q0QA 4CQLA 4AL4A 1BWSA 4BNMA 2RAFA 4N5NA 1XA0A 3GVHA 3GR6A 4J49A 1PSDA 1NTOA 4J4TA 1Y8RA 2OMEA 4H15A 4E13A 1G6KA 1NM5A 1NPTO 4RVUA 3ZCXA 2DFDA 4J9UE 1SC6A 4RZIA 1UXJA 2BGLA 3AJRA 4ONEA 2QRJA 3W4KA 1G0NA 5KVQA 4KOAA 3T4XA 1SAYA 3R3SA 4JJIA 3AI1A 3S2FA 1MV8A 3ONDA 5ICSA 2FPPA 1ZK2A 4YR9A 3A06A 3ICCA 4XJTA 4D0SA 1EZ4A 3B6ZA 1H2BA 2JAPA 3ENNA 1T2CA 3DC2A 1QYWA 4BKQA 4HY3A 5GZ6A 2R2GA 2DPHA 4J7UA 4GX1A 3K30A 2Y93A 2XXBA 1YONA 2B0JA 2HMWA 4J1QA 3ETEA 4CM8A 3DHEA 5DCWA 3KLMX 3V1YA 2FR8A 1GV0A 1PU2A 3BMCB 3KO8A 2EGGA 1DHTA 1GYPA 4TWRA 3UAGA 3KHUA 1DO8A 2IZZA 4HX5A 1RYDA 4EZBA 3UCFA 4FCCA 4LVUA 3DOJA 3ZHBA 4I9UA 3I9KA 1TVEA 1I0ZA 1F06A 4BNJA 3K2BA 4KZPA 4RQTA 3PYXA 1C1DA 3ZWMA 5B37A 3WLFA 3VH1A 2HRZA 1T2AA 4CQMB 1O89A 1R37A 1UP7A 2ET6A 1KOLA 3WGZA 2Y05A 3VDRA 1V9LA 5L45A 4MVJA 1LI4A 2VHVA 1LC0A 3TWOA 2ILTA 4BO4A 2G1UA 2YY7A 3JD0A 1YKFA 3O03A 3G49A 2HJRA 1ZFNA 4A5OA 4PIVA 1Y5MA 4FFPA 3H5NA 2W4QA 3A14A 2X86A 2R6JA 2X22A 3H5AA 4EUEA 4OQZA 5T57A 1HE3A 1HDYA 3EDMA 4HP8A 4RVSA 1T2FA 2DBZA 1JLLA 3RASA 2W8ZA 1P77A 5JLAA 4ZA2A 2W2KA 4RJTA 3QWFA 3NDIA 4E6PA 5B1YA 1KETA 2WSBA 3HWRA 1VRWA 4YBZA 3UUWA 4B7UA 4BMNA 5FI5A 4WLVA 2Q49A 1I32A 1M6WA 2NV6A 3KBOA 3PIIA 3IDSA 5ICMA 2Y1EA 5JSFA 4FOSA 3AU8A 4ID9A 5FF9A 4DPMA 3VTFA 1X14A 3P5SA 1NPDA 3OIFA 2VTEA 2C0CA 2OXIA 1WVGA 1IE3A 3RC7A 2FR1A 1PGNA 1NFFA 5L4LA 4A7PA 2J3IA 4DIFA 1ADGA 3PI7A 4Q3NA 5ENVA 3F46A 1ADFA 3ICPA 1SEPA 3QWBA 4JIGA 4CR8A 1ZMTA 2C54A 2IDZA 5A5EA 3V2HA 1E1NA 3U0BA 4E5NA 3I9JA 2ZYAA 4WCFC 3C85A 4XQ9A 1OC2A 1N92A 4OYRA 2VZ8A 3OH8A 2D5CA 2WD8A 1E77A 1Z82A 4JBIA 4L4XA 1NVGA 1H6DA 2FHSA 1U2DA 1C1XB 2H5LA 1U3UA 4HBGA 1PGJA 4LCJA 4R1NA 4QXMA 2QRKA 1C14A 4OIMA 4FFNA 2Q2WA 5KJ6A 5A3JA 2AG5A 1RYEA 4OSOA 1ISJA 1E6EA 4YJDA 3F5SA 3Q2IA 4R3WA 2HMTA 1HYEA 3MJTA 8ADHA 3IS3A 4IDDA 1U4SA 3JQEA 3RAJA 3DONA 4EUHA 1X0VA 3GMDA 5TC4A 1Z74A 4YAEA 1UDAA 5DT9A 1K3TA 1BTOA 4J1SA 4HNGA 4ZQHA 4XZ3A 4ZRMA 3R0IA 3WNVA 1G0OA 1TXGA 3SBOA 3W6ZA 1ZSVA 5CP8A 2NU9A 3IOYA 4CJXA 4A26A 1Y8QB 4ALMA 2YDXA 2ZQYA 4GLOA 2GDZA 4F6CA 1Q0LA 4B3HA 3ZDFA 1N5DA 3QVWA 4BV9A 4PLHA 4QQRA 4R4JA 4IQ8A 2Y1FA 1Y9AA 3ASVA 5T5QA 4FC7A 1L1FA 1XELA 3M2PA 3VTZA 4EJMA 5MGBA 4DLLA 4FN4A 1E3JA 4R1UA 4PG4A 3IJRA 2B37A 3S8MA 4O63O 1E3EA 5KVSA 1B26A 1VC2A 1TT5A 3IP3A 4YQYA 2UYYA 2NVBA 3IL2A 5JMPA 3KXDA 1B0AA 4Y67A 2JJYA 3PHHA 4W82A 3I1JA 2FZWA 3H4VA 4M87A 4BMSA 3D4NA 4MVJE 5G0TA 3MZ0A 3WICA 4BGVA 3GVIA 1UXHA 3QW2A 3JD3A 3RWBA 4PLVA 4CM1A 1EBFA 2EGHA 6LDHA 4RF5A 2BELA 3I9LA 5MDHA 3FRJA 4KUGA 3DBRB 3OJOA 2PD4A 2X5KO 4GKBA 4KQWA 4MVJI 3FNFA 5TF4A 1U3TA 1XLTA 2J5QA 3SC6A 4OHUA 3ZV6A 5THKA 1YH3A 2Y67A 3K2EA 3MJSA 4CMJA 4ZJUA 3KSDO 4NU6A 5AVOA 4PG5A 3L77A 3GUCA 5G0VA 2J5RA 3JQFC 5EERA 3ZU3A 1ONOA 1E3WB 1LSJA 4E32A 3TN7A 3GDGA 2DTXA 1NX6A 2DM6A 2GYYA 3VHRA 2GLXA 3FBGA 2Q1SA 1BVRA 1EUDA 4YT5A 2ZTUA 3U09A 4YAGA 1X0XA 5FI3A 2DBQA 1I3NA 2PZJA 4BMVA 4YACA 4WPGA 5KCZA 2QZZA 5I7SA 1XIVA 1RM5A 4UREA 4L4SA 2VWGA 4JX8A 1BGVA 1E0DA 3VZQA 2GD1O 4P38A 4R1SA 1FMCA 3GRPA 4ESOA 2P68A 4GX2A 1I2BA 1IHYA 4XGKA 3RKUA 3Q0EA 1N7GA 2NUAA 3AY7A 2X9GA 3JQ8B 3NAQA 1J6UA 1E7QA 3DDNA 2DPGA 2ZB7A 1LDBA 2ZTMA 3FNHA 4RPGA 3AU9A 4GQAA 1PQPA 1KC3A 3WFIA 1JN0A 2AQHA 3P2YA 4O0LA 5TT1A 4BNTA 1ZKMA 1KY5A 3SLKA 4CMGA 4CQMD 1HWYA 1JVBA 1PR9A 3FHLA 3G1TA 4I5EA 2CVQA 4AVYA 1E1LA 2GN8A 3RC1A 2CZCA 5AQ1A 3DZFA 5U9CA 3WXBA 5JO0A 1LDNA 1SBYA 2BKAA 2GO1A 2JCYA 1PIWA 4JJGA 2X58A 4F45A 2B83A 1GZ4A 3QIVA 4XYMA 4PLPA 1I3KA 2ZCVA 3EAGA 2Z1NA 3ON5A 1A9ZA 4MINA 4D3DA 4ILKA 2NTVA 3HHPA 3KYBA 3E9QA 3B70A 5JO9A 2PH5A 3GGPA 4RLHA 4E5MA 3RUFA 3UVEA 5DOZA 1JDJA 4DL9A 1ZK1A 1XU9A 1A4IA 4CM7A 4HFJA 3TQHA 2B36A 3CTMA 2E48A 2P4HX 4XB2A 4UVHA 1LLCA 3PWSA 4P8RA 1YL5A 1IZ0A 5IAAA 2Q46A 1LRKA 2PNFA 4RGBA 5COQA 1V35A 5BNTA 2GN6A 5THQA 4W7HA 1P3DA 1E6WA 2VHXA 4CM9A 4CV2A 1E7WA 1DC3A 2BRUA 2WD7B 4BNZA 2GCGA 2GSDA 3KSZO 3G17A 1LBEA 1KIFA 3WGTA 5JC8A 1HYHA 1PEDA 4BIIA 2D59A 2IXBA 3OJLA 2EKLA 4A73A 2JKVA 2AQ8A 3U3XA 3HFSA 2XXJA 1LQUA 4WECA 1AGNA 1R0KA 2I67A 3SXPA 3N58A 4ZGWA 4NDNE 1FDWA 4TRNA 4BKOA 2OL4A 4ND4A 3VH3A 1LXCA 4GAEA 5JFOA 3PPIA 2WYVA 5BSGA 3KZVA 3ANMA 1LTHR 4D43A 1PR3A 3S55A 4K9DA 4IIVA 5IZCC 1IHXA 1GCOA 1A4UA 4R01A 5L53A 1GYQA 4KDFA 1T1SA 4FJ0A 2BD0A 4YVFA 2JCVA 1CJCA 1IPFA 3WBBA 3WR5A 1EMDA 1QR6A 4UVIA 4I5FA 4XQGA 3NGLA 5DF1A 1Q7BA 1Q7CA 1UAGA 4XEHA 3WGYA 4BNIA 3HJAA 4Y6RA 4XYGA 5CHEA 3LDHA 2PZKA 3L6DA 1BXGA 1IPEA 1QSGA 1NQ5A 1QLJA 5JMWA 3DFUA 3SJ7A 3I9NA 1T24A 4NU5A 1PJ4A 2YV2A 2HRBA 4QT0A 2OGUA 1EE9A 2BH9A 3GG2A 4FQ8A 2Y66A 2O3QA 4IUYA 4EEXA 1NFQA 4Z9FA 1V8BA 1EBUA 2UUOA 2I3AA 4MKRA 2PFGA 4W6ZA 2V6FA 5TX7A 1IULA 1T4BA 2FP4A 3I6QA 1Q2XA 4J9VA 2OBNA 3DB2A 5T8KA 3WQSB 2D5AA 4BKRA 4MPDA 4BO0A 4CUZA 5JXWA 4DC1A 3BMOA 1QRRA 2CY0A 4RF4A 1GZ6A 2EG9A 4R68A 2PK3A 3VVBA 5F1PA 5A9TA 4BNGA 2H6EA 3IQDB 4EGFA 3MJCA 4IM7A 3GF4A 5B4VA 1U5CA 1ZW1A 2NVUA 3BMQA 2RH4A 4LK3A 1N2SA 4JBHA 1BW9A 4YJHB 5L7TA 4EJ0A 2X0IA 2E37A 2I99A 4B3IA 1Y1PA 1YVEI 3JQBA 3BTUA 4M49A 4ND3A 4RL6A 3ZGYA 3AI3A 4KUHA 4ZQFA 4CMEC 4KQXA 4Q39A 4Q3EA 3WTBA 5CG2A 5JAZA 2C5AA 3DR3A 1A7KA 1Q1NA 1VJ1A 1YDEA 4Z0PA 4BKUA 4XGNA 2YQ4A 4YYZA 2IODA 3WWZA 2O3SA 5JY1A 3TL2A 3GMSA 1IYZA 2CDBA 3A1NA 1XHLA 5DOVA 3RIHA 5IJZA 4W4TA 4YXFA 1SZJG 2C7VA 1KEUA 2EIHA 1KEPA 2VTDA 3ZWWA 4B4UA 4YT4A 3KSUA 3L07A 4DMMA 1U8FO 4CLOA 5TJ9A 2VHZA 2I9PA 4UUNA 1XWFA 4DBZA 4DREA 4F6LA 1E7RA 1U3WA 2QX7A 3PIDA 1X1EA 3O8QB 1H93A 4IXWA 1DLIA 5CAEA 1PJLA 3CZRA 4BQPA 3WOHA 1ISIA 1IZ9A 5C7IO 4B4WA 3KYDA 1J49A 3L6OO 2G0TA 1WMBA 3V1TC 3PWKA 1K89A 2CMDA 3D5QA 5HBRA 5JAMA 3JQ7A 3FBTA 3TJRA 1D8AA 3DQPA 5L7WA 2WYUA 1E7SA 4RVFA 4BKPA 4ROSA 3I6IA 3LVFO 3IJPA 3PYMA 2V6BA 1VKNA 3DZGA 4KWIA 3ST7A 3EW7A 4ALIA 1M75A 3CMCO 3DBVO 2Z95A 5A3VA 1ORRA 2BF7A 1ZBQA 1N1EA 2J3HA 4BNKA 3DAGA 5JDIA 4YQZA 3QA9A 2VN8A 4AJNA 3GA0A 2QW8A 3W8FA 4GGOA 3AY6A 1J5PA 3E03A 3NTOA 3PDJA 4EJ6A 2GNAA 3AUTA 4HNHA 3GH3A 3VAZA 1B7GO 2QG4A 4WE3A 4GGPA 5F3RA 3MJVA 1UUFA 4QX6A 3U4IA 3W6UA 3LT0A 4BHTA 5IXSA 1B8PA 1N8KA 1AUPA 3I83A 4XGIA 3GHYA 2BLLA 3L9WA 1EDOA 3CXRA 3AWDA 3QV1A 1YRLA 3RI3A 1HETA 2ZYDA 2VUTA 4RVHA 3WQRA 1DIBA 4BS9A 4OKNA 1PS0A 4UULA 2XPCA 1GQYA 2X1HA 3QQPA 1PJSA 2X0RA 3LQFA 3WDSA 2PTGA 3RBVA 3ZNQA 4BO9A 4MVJG 1G1AA 5G0WA 2JD0A 3G1UA 1C0KA 1H2HA 2DQ4A 4QO8A 5TRTA 4NFYA 3OETA 2O7SA 1PZFA 1OC4A 1U5AA 2DU8A 1OOEA 1O94A 2OZPA 4IQ0A 4ND1A 5EQFA 4DLBA 5CFZA 4IXTA 4YJGB 3HB4X 4YAIA 1IUKA 3RD5A 2QYTA 5B4TA 1WWKA 3H9QA 4D44A 3IC5A 4CODB 2PKQP 1SO8A 1V3TA 2YDYA 2DFVA 3Q1LA 2V7PA 1GAEO 4C7JA 1JAYA 5CDYA 4QUKA 3PEFA 3HSKA 1V6AA 4NBVA 5IFLA 2C2XA 4WCFA 2D3TA 2DTEA 3MCVA 4OAQA 1P1IA 3BHMA 4Q3BA 1E3IA 5KJFA 3DMYA 5T8KC 2Y0CA 3TZ6A 1YL7A 3F1LA 4NZ9A 2CFCA 3HDQA 1MB4A 2HMVA 4Y8VA 1YBAA 1GR0A 4XD2A 3PJGA 3UCXA 4CM4B 3JYQA 3HDJA 3G0OA 4JGBA 1VJ0A 5DBIA 1DIRA 4FS3A 4W9NA 1KVSA 1ZO8A 3QRWA 1GCUA 2FOIA 2NACA 4IS3A 1TT7A 5FEUA 2BFMA 1ULSA 3JQBC 4IIUA 2Q1WA 3MJ4A 2CSUA 2ZJ1A 3D3EA 4WLNA 4QFDA 4BUCA 3ZNPA 2O7QA 2V6MA 3TPCA 1NAHA 1EVYA 4XCVA 4ALKA 4E2ZA 4PLYA 2X5JO 1EFKA 3OQ1A 1I30A 5EESA 4TKMA 1LLUA 1GPJA 1C3VA 2E4AA 5FYDA 4YT8A 1U1IA 3INGA 4GL4A 5IDYA 4DIOA 1SEVA 4TVOA 5F21A 3GPDG 5I9MA 1BVUA 4NFHA 5TSDA 5G0SA 3AUUA 2GR9A 1JKIA 3DBLA 1P0FA 3I4FA 1KVRA 4WASA 1MFZA 2W90A 2C7GA 3L0DA 4EYEA 3MEQA 3NX4A 2Q4EA 5JCJD 5A02A 3H9EO 2P4QA 5BR7A 1N9GA 4HXYA 1NBOA 3B1KA 1LNQA 1Z7EA 4OSPA 5TGDA 4DQXA 4A03A 3U62A 3E48A 3K73O 1PWZA 4O1MA 2IYPA 2PR2A 2Q45A 3F6YA 3GQVA 4KWHA 4G5HA 3RUDA 1SOVA 1YQGA 4QEDA 4FB5A 4CLRA 2PGJA 4F3YA 3PDUA 4XIJA 4FFRA 3PVZA 1S7CA 3T4EA 5ENDA 4I5DA 3VPHA 4EEZA 3ROKA 3ORFA 1DLJA 3ZI0A 2BI8A 3JQFA 1B3RA 4PFJA 4LRSB 3DZJA 4A27A 5JDIC 3PHGA 3Q9NA 3LC1O 4M89A 1MP0A 4H7PA 4K6CA 3JQAB 3JV7A 3WMXA 4PVDA 3WYCA 3ZWNA 1HKUA 4MIEA 5I8ZA 1T25A 4YT2A 3TRIA 1I10A 1BXZA 3JD4A 5BNIA 2DAPA 5HS6A 2BHLA 4I9HA 2ZJ0A 4NJMA 3ZU2A 4IJVA 3E5MA 5J23A 2B69A 2PV7A 1K6IA 1YB4A 3VPSA 3KM0A 1EVIA 1TB4A 3AI2A 4D46A 1ENPA 2J5KA 5EJ2A 3GAFA 4EI2A 2GZ3A 2B35A 3H8VA 1CYDA 3NKLA 2IEBA 1UR5A 3G3EA 4J6FA 3WTCA 3AM4A 1LDGA 2O4UX 5K0ZA 1X15A 3GZNB 3MOIA 3O9ZA 3V2GA 2HMUA 3PHJA 2P91A 3GC6A 1U28A 3ZN2A 4ALNA 4B79A 4X54A 1CERA 4YJFA 3WB9A 3AK4A 3PZBA 3S2IA 1F14A 5IN4A 4BV8A 3HB5X 3HFGA 5T67A 3HDYA 1C0LA 2PKQO 2JHGA 2DBRA 4WLEA 1BRMA 2AEFA 3RUCA 1GDHA 4DGSA 2X6TA 3HZZA 4II2A 4WK6A 3FWZA 2DUWA 4BO2A 4CMIB 4J2OA 5KVVA 4MKZA 4H16A 3IIEA 3RVDA 3RJ5A 1J0XO 3UKOA 1FK8A 1HLPA 2B5VA 2Q1TA 1LDYA 2FPIA 3ZH2A 4R9SA 3IAHA 1CF2O 3ANLA 3PYLA 4NNJA 3INTA 4XQCA 1T4DA 1H6AA 4KUEA 2AQKA 4HFMA 5IN5A 5IF3A 4Z9YA 3VKUA 3VPXA 1CETA 3MWDB 4CUJA 3KB6A 1T2EA 3ROPA 5G2OA 5HA5A 1ZH8A 4PRKA 2DVMA 1B2LA 4W9NC 1WNTA 4P4NA 3D0OA 2VOEA 4ZVVA 1P1RA 2GN9A 3DTTA 3TNLA 1ULUA 3Q3CA 2ZQZA 1ZIDA 1PZEA 3QWHA 1DHRA 1GU7A 2E49A 3EVNA 3LK7A 3NDJA 3P19A 3UXYA 3VH4A 4CL3A 3W4IA 4RV9A 5T6BA 4DA9A 4ITUA 5DCUA 2IXAA 4GBJA 2EKPA 2LDBA 2AQIA 1RWBA 2EW2A 1HYGA 5ER9A 2B5WA 3TDKA 3ZNNA 3LSYA 2FRDA 1I5RA 1PGOA 5G4KA 2UUPA 2WDZA 4D41A 4Z3DA 1E1MA 3K8ZA 2RHCA 2VRCD 4PGFA 5EMHA 3AFNA 1Y81A 4J1NA 4XR4A 5IZCA 4CLOB 4BB6A 1KS9A 4G81A 4L9RA 3RUHA 1YB5A 4NR0A 1XSEA 3Q2KA 1EQUA 1YDWA 1M67A 1OBFO 2HAEA 3LF1A 2VZ9A 4UUOA 3ZU4A 4YRBA 1NXQA 4FFMA 4E21A 4OOFA 1LQTA 1YBVA 1R4MB 1D3AA 5JAIA 1U3VA 1Z7BA 4DMLA 3WYBA 1PWXA 1HXHA 1LJ8A 3VVCA 1QORA 4CMKA 4CLDA 1NASA 1LLQA 2VUSA 3U4DA 1O5IA 2VWHA 2Y1OA 3JQGA 2ZKLA 3FR7A 3QLJA 5TNXA 1I33A 3OSUA 1XR3A 1O6ZA 2AXQA 4WNIA 2PLAA 1JU9A 1ZXBA 4GH5A 3C1AA 2VT2A 3OIDA 1KERA 3QVXA 1XKQA 4S1VA 4IQGA 4XA8A 4NI5A 1Y9EA 2CD9A 1DC6A 1YOVB 3FWNA 3PJDA 2I66A 3D64A 2OHXA 1AXGA 5DBFA 4UEJA 3VPGA 2JD2A 4U7WA 5LDGA 4XB1A 1EVJA 2Y68A 3ZW8A 4E5YA 2WEKA 3C3XA 3JTMA 1M2WA 1KVUA 1HDGO 4TKLA 4O6VA 3M6IA 3RQSA 1DDOA 4BQRA 3WIEA 4ZN6A 1CIVA 1P1FA 3GVXA 4IDBA 1NPYA 5KJ1A 4E5KA 3IMFA 4IBOA 4L0QA 3PHLA 1A5ZA 1WMAA 4IY1A 2DUUA 3PQEA 4XYBA 1DRVA 1D1TA 2EW8A 4J4HA 1GPDG 2QQ5A 4PRLA 3VH2A 2ZTVA 1ZXLA 4EBFA 5JW6A 1W4ZA 3GVPA 3KRTA 2EHDA 2VWQA 3D4PA 1DFHA 2FR0A 4GMGA 4CMEA 2EJVA 1X7HA 4PG6A 4GSKA 4WOJA 3F5QA 3OMLA 7ADHA 2P9CA 5I7FA 1M66A 3AUAA 4UEOA 2OP1A 1YJ8A 4OQYA 3TZHA 7MDHA 4MOWA 4CM9D 1HEUA 5F1KA 3EC7A 3TF5A 4J91A 3JQAD 2Q50A 1PS8A 2EERA 4ZRNA 3NDRA 3E8XA 5B4UA 2B4RO 1O9BA 3D3WA 4QTZA 3C8MA 3V5NA 3ADPA 1MX3A 4AJJA 4INAA 3BMNA 1LRJA 3PZRA 4AG3A 1YE3A 3ANNA 3ROMA 1QXSA 1I01A 3KYCB 1V3UA 2RBEA 4XKJA 2FN7A 4WCFB 3ZHZA 4Z0HO 1WDMA 5G0UA 3DZHA 2YHIB 4BOYA 1GQ2A 4D42A 1K6JA 4BVAA 4YAJA 2C59A 1MUUA 3H3JA 5EIOA 5AXAA 3EUWA 3OJ0A 3ZWYA 3C7AA 5GMOA 2ZATA 1W0CA 4JLWA 3OP4A 3NYWA 1X1TA 1F17A 5JPIA 3RFXA 5JDCA 2PZMA 4TZKA 4Z6KA 1SCUA 1OZAA 2Z1MA 5C5IA 4L73A 1PGPA 4GVXA 1LUAA 2ZK7A 2VNSA 4IDEA 4GVLA 1M6HA 1X7DA 3GGOA 4GKVA 3GRKA 2C82A 3H9JA 5KVCA 3RJ9A 2ZB8A 3DFZA 4CQLB 1MC5A 4LSMA 1NHWA 3HNPA 5IZ4A 4FGWA 1NYTA 4CQMA 1Y8RB 1B3BA 4TSKA 2QIOA 1K2WA 4TRRA 3WLEA 1UH5A 2VYVA 1B16A 4IGFA 3WFJA 5AXCA 3PFWO 3GLQA 3CZMA 4BL5A 1P31A 4NPCA 5JCXA 4PLFA 3GT0A 3ROQA 4CR6A 2HO5A 3ITKA 1K0UA 3I9MA 2PGDA 3K96A 1NFRA 2G76A 1WPQA 1ONPA 3FCOA 4R5HA 5COAA 1N9GB 5L4NA 5A4DA 3JYLA 3DWFA 3E5RA 1IL0A 1ZMOA 5KTKA 4Y6PA 3LT1A 2EJWA 2PY6A 5CDTA 4CM8B 2JHFA 3ZWXA 2HJSA 4FDAA 4HFNA 4MIYA 4DLAA 5A04A 1RJWA 4G65A 5U4QA 4YCAA 2PWZA 3I23A 5F5NA 2QHXA 3TL3A 3PRJA 4D45A 2AE2A 4OM8A 4II3A 3ZWAA 4ALLA 1CQIA 1QKIA 3HDHA 4KMSA 4J3FA 4ZD6A 3UW3A 3CIFA 1C1DB 1UZLA 3AOEC 3RUEA 4R41A 4YEDA 1QYVA 5CDSA 5HTOA 3GAZA 1L7EA 4DQVA 2J8ZA 2WE7A 5HWSA 4BNVA 2JFGA 3OICA 4IDGA 5IG2A 3RUIA 1YS4A 2NU7A 3GFGA 3IKTA 1PL8A 4ZU3A 1DC5A 4HV4A 4IMPA 1DAPA 3EY4A 3Q6IA 5GZ1A 2CVOA 1P1JA 4GX5A 3OBBA 5A9RA 3EYWA 8LDHA 3FF4A 1HF3A 5BSHA 4LCEA 2YHUA 4GMFA 4CV0A 5I7VA 3U5TA 2RH8A 2DT5A 3TSCA 3NT4A 3D7LA 4XIYA 2Q1UA 5TQVA 2RHRA 3VPFA 4CLEA 4DUPA 4NIMA 2W2KB 4BGUA 3DHYA 1NR7A 5H81A 3I9OA 1C1XA 4NMHA 1C0IA 5U1PA 1CRWG 1DEHA 1KY4A 2IRWA 3KOUA 3TOZA 5H82A 1QLHA 3ZV5A 4U6SA 3FR8A 4GPD1 3DAPA 4L74A 3DXFA 1CWUA 3WGHA 4KDEA 4Q3AA 1PJBA 3A28A 4FJ2A 5K9ZA 2DKNA 3FNEA 3NJ4A 4YJFB 2OFPA 1LSOA 4PLWA 2EV9A 6ADHA 3VZRA 1E1KA 1ONNA 5AXBA 3QWAA 1EUCA 4RPKA 1GV1A 4IJWA 5BQFA 3HQ4O 5H83A 4EUFA 4TROA 4GI2A 3WGIA 2ZIZA 4PG7A 2PA3A 4CLXA 2NADA 1H94A 4UUPA 1E3SA 4S3MA 3KETA 4MVJM 3G79A 2CF6A 3JD1A 1KYQA 3NT2A 5AXDA 1A27A 5DP2A 3LZ6A 4HFRA 4BGIA 4BO1A 4K1LA 3R3JA 3BTSA 3ZZNA 5BSEA 2QRLA 2Y99A 4FIZA 2HK7A 3KLPX 3BTVA 4LVCA 1A9YA 4XX0A 1HT0A 1GUFA 3KEOA 5JBIA 5GY7A 5L7YA 5EQDA 4NBTA 2JFHA 4OXKA 4WLFA 3WBFA 5JYEA 1KEWA 1GEEA 4DXHA 5I8WA 5JDCC 1DIGA 4URFA 5ES3A 3ETDA 3M1AA 3CINA 3SJUA 5BSFA 2WJPA 4CR7A 4BO7A 4N5MA 2Y1CA 1U8XX 5FFFA 4ND2A 1L7DA 2IEDA 3DMTA 1HDOA 3DBRA 4NBUA 4P4LA 4CM5A 5C7LO 3LYLA 2F00A 1BHSA 4BO5A 4EITA 3P7MA 4XQEA 1DOHA 3K92A 3V2UA 2X0NA 3ZWVA 4K6FA 1NVTA 2VNAA 4MP6A 2BI7A 4U5QA 2GRAA 3AUSA 5A06A 3DEYX 1Z73A 2PD3A 4MKXA 1RM0A 3H2ZA 4M8SA 1A7AA 4GLLA 4XRRA 1YB1A 1W6UA 2W2LA 2VZ0A 1XQ6A 4J7XA 4B8WA 4FR5A 4E33A 1RKXA 2FSSA 3FTPA 2CVZA 5BNFA 3ONFA 1I3LA 3RBZA 2PH3A 1R12A 2HDHA 2X0JA 4NFSA 3W1VA 4LGVA 1IOLA 5CG1A 1TT5B 2R00C 3JCZA 3TZCA 2FZEA 4AJ1A 4WEOA 5LC1A 2ZB3A 1H0KA 3AM3A 5EL0A 3H65A 2Y0DA 3N7UA 1DFIA 2I76A 1PZGA 1GYRA 4AICA 2PGLA 4DRYA 5A03A 3JQ8A 4OGWA 5AYVA 2X7HA 1DC4A 2VWPA 3K9QO 3CMMA 4PZCA 4XDYA 3NUGA 3EMKA 1O8CA 1DJNA 3EHEA 3SLGA 4A10A 4WEQA 1K6XA 4IDCA 2NTNA 4MO2A 2C07A 1I2CA 3PK0A 2BMAA 2HUNA 4NJOA 5KNLA 1LC3A 4E3ZA 2YV1A 3OJFA 4GWGA 4JROA 3VDQA 4U6QA 2GZ1A 4I5GA 4WUVA 4J1TA 4PZEA 5HS4A 3CPSA 4JP3A 3VZPA 3A9WA 1NWHA 4YWJA 1VKOA 3DHNA 3PJFA 3OECA 1EEHA 3S2GA 2W98A 2D4AA 2V6GA 1QP8A 1X7GA 4TMFA 4C4OA 4PZDA 3CUKA 4NK5A 5C3MA 3B1JA 1D1SA 1HZJA 2O4CA 2Q2QA 3SC4A 3NJ8A 3D4OA 2G5CA 4MVJH 3CH6A 4Q9NA 5DN9A 2WM3A 1FDVA 3DTYA 3HG7A 4L4RA 4LRTB 1U7HA 5IDWA 1WP4A 1ZVMA 3C1TA 5CPBA 4IJUA 1ISFA 3PQFA 3RFTA 4IDAA 4BNNA 2IZ0A 2AE1A 1JA9A 4OXNA 3IUSA 3U4CA 4TQGA 3WJAA 5CEJA 2NM0A 4U8GA 2YFQA 1LX6A 4QECA 3L4BC 1MXHA 1LU9A 1UJMA 1KEVA 3FTNA 4JQCA 2DC1A 2XOXA 3C1OA 5F1OA 4ZICA 1KVQA 3WGQA 5KJCA 4FOOA 3QHAA 4JP2A 1GFSA 4MVJD 3GY0A 2WD7A 2GN4A 1VSVA 2UV8A 2SCUA 1IY8A 2AHRA 1R0SA 5L51A 1DB3A 4U0KA 1E5QA 2Q4BA 5I9LA 1OFGA 2J3KA 1N7HA 1XEAA 3BMNB 3F47A 3GNQA 4UVEA 3GNSA 5AOVA 3EK2A 3GN1A 3KEQA 4RPHA 3O38A 4E0BA 1DAOA 3T7CA 3WS7A 4YRAA 1EUZA 2EWMA 1WXDA 4DBVO 3OFSA 5I7EA 3WMWA 2CF5A 2C29D 4B8ZA 2LDXA 1I2ZA 3JQ9C 1NNUA 4FC6A 1Y5RA 2G82A 1I36A 2VOJA 1LSSA 4PVCA 4BNXA 2AG8A 1PS9A 1U7TA 4EDFA 1FDSA 3QE3A 3ADOA 3LLSA 5A9SA 2VYNA 3H7AA 1UP4A 1QMGA 5LCXA 2HQ1A 3UCEA 4I1IA 4B7XA 3GG9A 4ZQGA 4NBWA 3UGKA 5KOIA 1HDXA 4N18A 1BSVA 4F46A 1X13A 1VPDA 1T1RA 1UDCA 4FJ1A 4IJKA 3DMTC 1XCBA 1OAAA 1YXMA 3GHHA 3R1IA 4XYEA 5T64A 2FMUA 5KWEA 1NHGA 3U49A 3WJ7A 4N5LA 5HM8A 3TFOA 3IP1A 4UUMA 4BNWA 4J0FA 2JL1A 3LT4A 3OHSX 4WOKA 4O5OA 4E30A 3H9GA 1ARZA 3AOGA 4HUJA 4Y6SA 5JY6A 1AE1A 1B8UA 4J2HA 4OOEA 4RVGA 4RF2A 3LF2A 2JD1A 4IINA 5KJEA 4E2XA 1TEHA 1T2DA 4CMBA 4HADA 1KC1A 3DZKA 1ZCJA 4AJKA 2J6IA 4NQZA 5TS3A 1PJCA 2QZ9A 4BGEA 1DBVO 5JCJA 4FFOA 4WJZA 4LN1A 3RROA 2BGKA 1YJQA 2O3TA 4RLSA 1HRDA 1BXKA 3SX2A 1NQOA 1H5QA 2HCTA 2ZCUA 4WCDA 4YJHA 5G4LA 3ASUA 3F4BA 2IE0A 3LLVA 3QJ5A 1BXGB 5DCYA 1HLDA 2ZB4A 2C2YA 5KIAA 1GL3A 5IDXA 1XYGA 3W4JA 2X9VA 1ZEMA 2O3RA 4DPLA 2GPTA 1LRLA 4AJLA 1YWGO 3E6AA 4MVJF 3VZSA 5A05A 3L9XA 4RCVA 1R0LA 4K26A 9LDBA 4MDHA 3PGJA 3DOCA 3X2EA 3AM5A 1EK5A 1H9AA 2A94A 3BHJA 4OJNA 1RM3A 2HK9A 3CE6A 3FPLA 3C7CB 3OF2A 4IZIA 1ZNQO 1JWAB 5C7OO 3V1UA 3H9UA 2Y1DA 4JK3A 2HMSA 2C5EA 3BMOB 3INRA 4FD3A 1DIAA 3O8QA 4J90A 4DQUA 4YTEA 1UZNA 1EQ2A 4LW8A 5ITWA 4B7CA 1CDOA 4Z9XA 2NVUB 3BMQB 1N1GA 2ZTLA 3R6DA 3SEFA 1BW9B 2XF8A 3UOGA 1WDKA 2CUKA 4CMAA 3B20A 4FPXA 4HKTA 3RFVA 3DBHA 3RU9A 4DTIA 3A4VA 4BNHA 4R16A 4IGEA 3HUDA 5LDHA 3GNTA 4J7CA 3K6JA 3MTJA 4XDZA 1DIHA 1YGYA 3UH1A 3U4HA 3BYZA 3I3OA 1FDTA 1GUYA 3HE3A 3WGOA 3NTRA 4KP7A 2O48X 4DWVA 4CV3A 3ETGA 4J4BA 4XYLA 3I5MA 3WX0A 3PTZA 4IZHA 3Q11A 5K6AA 3M2TA 3NV9A 1PL6A 3PFFA 1PJTA 4JJFA 4D0RA 1GQQA 4TVBA 2UVDA 3D5TA 1YQXA 1B14A 3ZW9A 1W8DA 5KKCA 1ML3A 1P1KA 3W8DA 3B1FA 3QP9A 3LT2A 4XRGA 3LU1A 3E82A 1GTMA 1R4NA 3IKVA 1VM6A 2AEJA 2I5PO 1ADCA 3KTDA 1E6UA 3KYDB 4B3JA 2NNLD 1XGKA 3ZWPA 5TIIA 4I9NA 4ZQBA 4UVDA 2P9GA 1EVZA 2X4GA 3RBXA 1H6CA 3F9IA 3NT5A 2WE8A 3GEGA 3JQ7B 3T7EA 1R66A 3VOSA 4AFNA 5L9AA 1SNYA 1YL6A 1Y7TA 3SVTA 1YBMA 1DFGA 1NVMB 3WQQA 4WGGA 1KBZA 4LMPA 4AJPA 1KVTA 3PLNA 3WSWA 4Y98A 3HADA 1AXEA 2P5YA 4Y9DA 1HE4A 3PLRA 1HL3A 2AW5A 1P0CA 2H9IA 2Q2VA 3AOEA 4NBRA 4RO0A 2POQX 4M55A 1BMDA 2AEMA 1VI2A 3UFXA 1JAXA 1PJQA 2J3JA 1E3LA 2D2IA 2RCYA 1ZK0A 4J16A 3MTGA 4YJGA 2O23A 4YDRA 1S6YA 4I08A 4TRJA 3TOXA 4B4OA 4DYVA 3UICA 1Q7GA 3ZU5A 1FXSA 3PHIA 1IB6A 1V3VA 1HSZA 3FSRA 1XU7A 5BT9A 4FFLA 4RF3A 4CMCA 3JQCA 4AJHA 2PZLA 1PQWA 2GUGA 1LDEA 1EFLA 1CQJA 3I4CA 2VRCA 1FF9A 2P9EA 2VHYA 4OKIA 4CPDA 4W7IA 1DSSG 2I3GA 4M54A 1ADBA 2PKRA 4WKGA 2AMFA 3JQDA 2OORA 4LSWA 2NU8A 1HDCA 3WSVA 3M1LA 4CM4A 1TA4A 1JKFA 2GGSA 2BGMA 1VL0A 3LC7O 3VC7A 4C7KA 4UAGA 3GDOA 1P1HA 2O2SA 4E4YA 1ISHA 3JD2A 4MP8A 5FWNA 4WLOA 3RKRA 2OOSA 4AJ2A 3LC2O 5IXYA 1OI7A 4QFCA 3RSHA 4YPOA 1SB8A 4R54A 5K1SA 3QVSA 4TZTA 1UXGA 1HDRA 2GZ2A 3F4LA 3MWEB 4ALJA 5JC1A 5KKAA 1CEQA 4D7AA 2VHWA 4N7RA 1GY8A 2VRBA 3QY9A 4E2YA 1SB9A 1LEHA 4PLZA 3F1KA 1JTVA 1JKJA 1PX0A 3QVTA 1YO6A 3CKYA 4JXKA 4MVJP 4ZQEA 3U9LA 3OEWA 2BFOA 2EP5A 2VYVD 1K5HA 1MFPA 1SMKA 2P2SA 1BDMA 3FNGA 3OQBA 5CEEA 1Y6JA 2JFFA 3DZIA 2GF2A 4R9RA 4Q3CA 4WLUA 4AJEA 4MP3A 2GASA 1D4FA 1D7OA 3ZNOA 4OL9A 2O3JA 3I52A 5DNAA 2RIRA 2YYYA 1QYXA 2A35A 1B15A 1VJTA 4RPLA 1MGOA 2YV3A 3EVTA 4PN3A 3EGOA 1ZK4A 4AJOA 4YA6A 2YZ7A 1ISGA 3NEPX 3BMCA 4U0JA 2OUIA 2HLPA 4AJIA 4TRMA 1R15A 3WNQA 3BHIA 1AHIA 3UN1A 5COBA 3FD8A 4BB5A 1UP6A 2JAHA 3GN2A 4KTTE 1LDMA 3GUYA 3VKVA 4L8VA 3E1KA 4A2CA 4N54A 1ISMA 4D3SA 1NAIA 1ZK3A 4PLCA 3UHAA 2BFPA 5DP1A 1DRUA 1F0YA 4R1TA 1LLDA 4FBGA 5K6AC 3QVOA 1AHHA 2I65A 3AY3A 3JQAA 4CL8A 3O4RA 3IUPA 3DBLB 1O95A 4CV1A 2GERA 2HK8A 2NSDA 2TMGA 4LMRA 2CNBA 2VQ3A 3C7DB 1RPNA 2H1SA 4FGSA 3ZWCA 1UDBA 4PG8A 3MOGA 1GZ3A 4ZHSA 3WYEA 1U9JA 2BFAA 2R00A 3E18A 2EKQA 5DBGA 1ZZEA 5JS6A 1PJ2A 5A5FA 3EZYA 2X8LA 1M76A 4R5MA 4E31A 4DYDA 1B8VA 3GGGA 3RUAA 3BZUA 3BIOA 1MG5A 1DPGA 4QO7A 1FJHA 4AJ4A 4CLRB 4NH4A 2YFHA 3BA1A 3GEMA 5HRUA 2FSVA 1NQTA 1BDBA 3RC2A 4UEKA 3ZHYA 2WMDA 2D1YA 1UXIA 2X23A 3GZNA 4RVDA 5CDGA 5EN4A 4O59O 1MA0A 2V65A 3NTQA 4BNLA 4RDIA 5A9SB 2OBYA 1Z75A 5EPOA 4CMHA 3QSGA 4DPKA 2Y1GA 1R6DA 4E2WA 3ZV4A 1PQUA 1NQAO 2AA3A 4GWKA 3DZBA 4ND5A 2VCYA 4P22A 2UDPA 3FPCA 1ENZA 4BNFA 3TZKA 1ZSYA 2DTDA 2HSDA 2I6TA 2NTJA 3BTOA 2O2YA 5L4SA 4M1QA 3N74A 3JYOA 4NJMB 3UF0A 2NQ8A 4Q3DA 3L4SO 2YJZA 5ER6A 4BO3A 2NWQA 4CMIA 3PP8A 1EE2A 2H63A 1U2GA 2HKIA 4UVGA 1VL8A 4YB8A 3WGGA 2HU2A 4Z3KA 1AN9A 2D8AA 4BO8A 3GEDA 3DL2A 4D79A 1A72A 2Q99A 2OP0A 2IZ1A 3DAFA 4L75A 2Y0EA 1E5LA 4NG5A 4E5PA 1R16A 1U4OA 2E6UX 2FPGA 1DXYA 4I8XA 4MIOA 1NP3A 2YUTA 3L4BA 1P44A 1F8FA 5A1TA 3GOHA 1MLDA 4NK4A 1T26A 1NWCA 2ZYGA 1UZMA 4JCOA 3STHA 5TJHA 1PZHA 2NQTA 1PL7A 2F1KA 2PD6A 2UAGA 4PLGA 4JBGA 3KV3O 4DC0A 4QSMA 4B4VA 5L40A 1WZIA 1WW8A 5CDUA 2O3UA 3KVOA 1TLTA 4RPJA 1A71A 1MG0A 2DLDA 3BAZA 3KUXA 4GX0A 4K28A 1DRWA 1P33A 1E7YA 2DBVO 3GVCA 3NRCA 1Z45A 4FSHA 3RCBA 1HSOA 4H3VA 5DDIP 1Y8QA 5GZ3A 3HN2A 3CEAA 3OQ6A 3RC9A 2B4TO 5JAQA 1P9LA 1EK6A 3ZHXA 4IPTA 3JQ9A 1PGQA 2W2LD 5JE8A 1NR1A 1ENYA 2NVWA 1VL6A 2FY8A 1F12A 1WDLA 1GEGA 5B12A 1HDZA 4R3NA 5IDQA 4PLTA 1HTBA 2YW9A 3S2EA 1ID1A 1QYDA 1R4MA 4IMRA 4CLHA 3HN7A 5CPFA 4EW6A 2EP7A 2X9NA 2C20A 4FW8A 4IS2A 2EF1A 3H5RA 9LDTA 2OO5A 1EDZA 4OH1A 5JNLA 3JYNA 1I24A 1LA2A 4W99A 1O0SA 5EINA 2Z5LA 3DBHB 3FI9A 3OM9A 3L6EA 3H3FA 3AFMA 4DIBA 2XAAA 1F8GA 2E82A 3OEYA 1FDUA 3GZ4A 4BNYA 5CEFA 2FWMX 4JN6B 3ENKA 1YOVA 4RQUA 1H6BA 3S1LA 1GUZA 2D0IA 1E3WA 3ZWBA 4DVJA 3TZQA 5TT0A 3QWIA 1OMOA 1WZEA 5TLSA 4L76A 2EXXA 5G4KB 1QV7A 3E9NA 4JNKA 1C0PA 1XQ1A 1V0JA 2TMDA 5JYDA 3JQ6A 5F5LA 3V8BA 2G17A 3D1LA 1Z6ZA 3GK3A 3WG9A 1YQDA 3W8EA 3ZV3A 4R51A 2A92A 1UXKA 3OJEA 3COSA 1WAMA 1R4NB 2WWRA 3Q9UA 5ITVA 2O50A 2Q3EA 3PJEA 1E7MA 3ONEA 5ILGA 1P45A 1JVSA 2QYSA 2IYOA 2YQ5A 5L95A 2A4KA 3K5PA 3X2FA 4RDHA 1H9BA 4WNCA 1WLYA 1UAYA 3ABIA 3RU7A 5C37A 1W73A 4HWKA 3TFQA 1MC4A 3JQGB 1Q0HA 4P4GA 2JCXA 1SOWA 1I8TA 3JSAA 4M86A 4RZHA 4OO3A 4R69A 5ADHA 1GD1O 3EZLA
chains in the Genus database with same CATH superfamily
3QLEA 4B1FA 3GFPA 2UUBB 2B92A 1Z6YA 2WTBA 4M0LA 5AVTA 1F51E 1FMJA 1HZZA 1MEEA 3JRNA 3VOAA 4EY7A 1A3CA 1NLYA 3OCCA 4G2NA 5CNJA 5LBUA 3HA5A 3W5HA 1QG6A 4CCSA 2XDAA 3QUSA 4NEHB 1DJQA 2Y0PA 1UPFA 1GU0A 3Q7PA 5DZSA 1LK0A 3ANXA 4YMSA 1T5SA 2CJYA 4EFLA 4CKCA 4EOGA 4YRDA 2P5UA 3RWOA 3DVSX 1XMXA 4K8RB 4F72A 2W37A 2PDAA 4ZI3A 4UTOA 2ZJ3A 5JZ9A 3WHPA 2HADA 2PKYX 1GAJA 2W6MA 3AV3A 3EH1A 3IPLA 4DJAA 5LKRA 4OXYA 5HP4A 2EEZA 4II7A 4RS4A 4IHJA 3NGXA 3TG8A 2QRVB 221PA 1GNPA 3L7IA 4TUYF 2OCGA 3AETB 4CM3A 4FXOA 1X1DA 4L85A 5JEDA 5BSMA 4YAKA 1MZPA 4F11A 2D0OB 1HNWB 3F73A 4EL0A 3WGNA 2C97A 1TI7A 4ITVA 1NUUA 1I2MA 4CM6A 2QF7A 2IH2A 2X5OA 3MJEA 1M0WA 1VCNA 5D3MB 1TYAE 1KRXA 1PJ3A 3CEHA 4KTVE 4FQ7A 4CEJA 8ABPA 1HE2A 3IBSA 1M8GA 2JK1A 2O8CA 5JRJA 1FSPA 3G1WA 1P2TA 4G1EB 2QXTA 3E9CA 5FOWA 1OAKA 2ZGVA 2VYND 5L3QA 1G3QA 3HCCA 2VUUA 3HCFA 3JXEA 3AHDA 2H2WA 3K9HA 1TJ4A 4Z0TA 5L3ZA 2RGEA 5ILOA 3DWEX 5TQ0B 4B6JA 3HVUA 3DDCA 1NDHA 1XMIA 3ORRA 3WFZA 1HE5A 2CDAA 1J97A 3PQDA 1SPXA 1LVGA 3O2JA 1SQ6A 4E12A 2R97A 1YGPA 3BA6A 4BO6A 3ZWOA 5I9NA 4IH9A 2NU6A 3OQIB 1ZSNA 4K9NA 4U5XA 3IHLA 5IWAB 1YQTA 1I6WA 4EHLA 4YCLA 4DJDC 1O54A 2R6GA 4MKHA 1BWSA 4AL4A 4OP3A 3O5AA 3PD7A 4EPRA 1FJXA 3NHZA 3GVHA 5AWFC 3P4XA 4JL5A 2VDWB 4TPKA 1NTOA 3N76A 4P0PB 1Y8RA 1T6XA 2QUJA 4V1CB 5I47A 1CRPA 1ZC4A 3KX2A 1N0UA 4HTAA 1QO0A 2A0FA 2BFDA 4H3SA 3LFHA 4RVUA 4XTRA 2H06A 4C08A 3EG9B 1RVV1 4XVHA 3K1ZA 5J40A 3W4KA 2H16A 1V8ZA 4OB6A 5CT9A 4L5AA 3T41A 4C6TA 2PUJA 1MV8A 3C6QA 2OFFA 5DU2A 4A3SA 4P3YA 4LZZA 1RYNA 2FZ4A 1ZK2A 3BK1A 2OR3A 5ICSA 5JH7A 4PZYA 1FBTA 1JDPA 1ZI9A 4EB0A 2PXXA 4BRSA 1MAWA 2VG8A 4DMHA 2DWQA 4U2GA 5G40A 4WCVA 5JCOC 2R2GA 4BFZA 2VJOA 4J7UA 4JOSA 4ZCRA 4GX1A 3K0SA 4X1YA 3HCEA 5E6UA 3U7GA 1L3BA 1WLSA 2OO5C 3KVRA 1GDDA 1NXTA 5FLKA 1U9CA 3HXPA 4I6GA 3V32A 2XZOA 1T3ZA 2JZCA 4J1QA 2OO7A 4I9GA 4DZTA 1N2CB 1NDQA 3KLMX 1PU2A 2QS9A 3BMCB 4MW5A 1OCEA 1GYPA 2QUZA 3T5MA 3HCRA 1OY1A 1VMAA 1X7XA 3H18A 1RHRA 1RYDA 4EZBA 4FCCA 4DA8A 1UWCA 2GTHA 3ZHBA 2DQKA 1K8RA 4I9UA 4WERA 3TDNA 4JODA 2VNHA 3M89A 5ESDA 2X19A 3K2BA 2Z6QA 4FKMA 4BDTA 1W5TA 3MTAA 3PFKA 1GAXA 3VH1A 3GELA 3EOBI 3FFWA 4YCMA 1UP7A 4A2QA 5CRIA 2GRUA 2XUDA 5EGSA 2Y05A 2ICAA 1ZVJA 1SG0A 1TZJA 1JHRA 4AMGA 3L82B 3KQSA 1LC0A 4KR9A 1CYEA 1FL9A 3TGLA 2G1UA 5B1IA 4H1WA 2P7HA 2FB9A 2C3PA 3WK7A 2GLUA 1ICEA 1YKFA 3O03A 1IMOA 4ID3A 3AIOA 3SX0A 3G49A 4IILA 3LGXA 5CDFA 1VPWA 3K6SB 2HJRA 4K81B 2PUHA 3M5PA 4XI9A 5IDYA 3ZE1B 3O84A 3MRVA 4EJSC 3QA3E 3AHCA 3H5NA 2W4QA 1TM4E 4GEKA 2CHFA 2R6JA 3LJKA 2FDRA 1KDYA 5T57A 1TUGA 3LUBA 3OOYA 1HE3A 2JATA 2O1WA 3GLTA 3EDMA 1PQYA 2ZYRA 1CR6A 4Q1CA 5HDQA 2QRNA 4CYMA 4R8LA 1KDTA 3EWAA 1EVEA 2PS3A 4XUDA 1E0AA 1I3CA 2E89A 4B34A 3TOSA 1PLLA 1A8QA 3L84A 4Y2VA 5KDDA 5JYBA 4CW7A 3HACA 4PNPA 3GT3A 1N2ZA 2BEVB 3NO4A 4EQZA 1B0UA 1R4AA 1DDGA 4GDMA 1VRWA 1KI6B 3I76A 1I32A 3NYRA 4JR2A 4X20A 4YP9A 5L3VA 4CDNA 3GLFB 4FOSA 3CNEA 5EXEA 3NHPA 1X14A 3B5EA 3P5SA 2JJMA 4QVGA 5I7UA 2XITA 1O94C 2F9LA 3SBXA 1IDOA 1MOSA 1ILWA 4EFKA 2PZEA 1WVGA 1J8QA 2Q7OE 1PGNA 1NFFA 4PGMA 1BEZA 1WB4A 4MS1A 2J3IA 4DIFA 5IK2D 2RFLA 4YQEA 1O03A 2FEWB 3R6GA 4EGJA 3QWBA 1ORVA 2R4TA 1MQ9A 3TW4A 3ZXIA 1MIHA 4IRUB 3S6JA 3E7WA 2IDZA 1ONBA 3KYIB 1W48A 3BD8A 5ALIA 1KYTA 3ZNQA 4NCBA 1LNZA 4WCFC 5DASA 1CDEA 1WUYA 2B4YA 1EA7A 3C85A 5DX0A 1Z2PX 5FAXA 1OC2A 2HJGA 3BULA 1H3FA 5E2BA 1ABBA 2FN9A 2CLMB 2BMWA 3RTAA 1G20B 2V3WA 3LWDA 3AJ8A 1L5KA 1Z82A 4Q4CA 5CFQA 1A76A 2QX9A 2X0DA 1L5YA 4C14A 3NH9A 2FHSA 4DDMA 4X7MA 4HLUC 1C7IA 1C1XB 3ZLVA 5CCBA 2Q9CA 2FKAA 3FA2A 1UK7A 5D8DA 1RC8A 3K6RA 4NENA 1Q6ZA 2OAEA 1XDBA 2ENWA 4MDYA 4MICA 1MJNA 5DHQA 2PJRA 1TVCA 1C14A 1XK6A 1Z3IX 1N0IA 2NUPA 2TSYB 2HWUA 3ZC3A 5KTYA 2Q2WA 2GYUA 1AKMA 5ADWA 1U9IC 3TTYA 2GNPA 2JLXA 2AG5A 3V1NA 1WQ4A 4JQZA 3RS2A 5DNVA 2ZUEA 1KJJA 1HYEA 1BFDA 4RLQA 5BSUA 4K9OA 1ZMRA 1U4SA 4FE7A 3WB1A 3K70C 2I9KA 2X1MA 3HBMA 4Y18A 4EUHA 1VE1A 1X0VA 1EUCB 4IVPA 2Z57A 4QPNA 3UUGA 1GSAA 2GPYA 3DGFC 4O2AB 5DT9A 4S1PA 4QFMA 4ZQHA 4BP8A 2F3RA 2RAPA 4QELA 3PR1A 1R0WA 1IQRA 1J24A 3I6ZA 4LDNA 4QUDA 4HAVA 4RKWA 1G4HA 3EQ8A 4L2IB 4MWCA 5CP8A 4CJXA 4AF7A 1U0SY 1KSFX 2HIHA 3DDHA 4L4UA 4DCGA 4ALMA 2AW3A 2YDXA 4GLOA 2XWJI 5A6VA 2P69A 1G8MA 1QRUA 2WICA 1M54A 3LUDA 4KCGA 1PNOA 2C2HA 2Z08A 4PLHA 1PFQA 4QQRA 4R4JA 1K66A 5SY6A 3RPEA 1WXXA 2ADOA 3VTZA 1IJKA 2HIAA 3V55A 5KEIA 1YRAA 4FN4A 3H17A 2P8JA 4XX0B 4PG4A 3STYA 3ZCRA 4TQUS 3QMWA 5BYAA 3KQMA 2HHJA 1RI5A 2B37A 2ZFUA 3C4QA 5TV2A 4UNPA 3BD6A 1SQ5A 3A11A 1VC2A 4YQYA 4HH0A 1B0AA 1K75A 3K9BA 4N4AA 3MWGA 4R1MA 4OHPA 3EAFA 1TNDA 2EU8A 3NB0A 3RSFA 4M87A 2H2GA 1YJXA 2HV8A 4F85A 2W6QA 3HDGA 5G0TA 3H2BA 1BGXT 3GVIA 3PNOA 3QW2A 2Q9AA 3RWBA 4PLVA 5BVHA 3IURA 1ZUNA 2EGHA 1FP7A 2VJBA 4RF5A 4PYNA 3I9LA 1T1GA 5MDHA 2X1VA 3FRJA 3CFYA 1JG4A 4MVJI 3PVCA 2CNWA 4IIJB 1OFUA 1U3TA 1XLTA 2J5QA 4OHUA 3DVLA 1G8SA 3CU5A 1OGYA 1H8ED 3B6KA 3PB3A 4K9LA 1U9YA 3PNSA 5KOYA 1F4PA 3CCBA 4AZSA 3C8HA 2X2EA 3A6DA 3IP8A 5AVOA 2J5RA 2J9ZB 3JQFC 5EERA 1VMIA 3ZU3A 5DI9A 1LSJA 3O2QB 4E32A 2PCLA 2ASVA 2GYYA 4H1UA 2Q1SA 4G5XA 1EUDA 1Y8CA 3ANSA 4NZNA 3OKCA 1QE3A 4MUHA 4RKFA 4TVSA 1NXOA 5C2JB 2XCLA 1YB6A 1EWVA 2ZTUA 4BVFA 1OLXB 3ZUGA 3IEIA 3OFNA 4R9NA 1I3NA 1XCLA 1TEVA 1EK1A 4IGKA 3X1ZA 1E2FA 3HXMA 1SUSA 5I7SA 1XIVA 1RM5A 2PX3A 3D4IA 1YZYA 2CVFA 1X8LA 2MSWA 3K0BA 4LNHA 4UREA 3U7IA 4QDUA 1C8KA 3WYGA 4Q9JA 5HFNA 1DXQA 2EYUA 3CUVA 1E0DA 8MHTA 5E9JA 3QX9A 3T06B 1JEEA 1F6WA 1K9SA 2WPNA 4TV9A 4F3RA 1GARA 4P38A 4R1SA 5PGMA 1IG3A 4Y6QA 1FMCA 4B6GA 4QQFA 4RIHA 1LPNA 3N0XA 4UTZA 4ESOA 4QNMA 1JIKA 3ZHUA 3FGNA 3OWXA 4G0PA 1SQ0A 3M6UA 3RKUA 2GEDA 2WJIA 1K5DA 4IX1A 1E79A 3WLHA 3JQ8B 3CNHA 2O6HA 3VR6H 3DDNA 3H2IA 2DPGA 4PC6A 3E81A 4P4SB 5HKBA 3BM5A 3PQ5A 1KQPA 4G5RA 2C84A 3BIJA 4KO4S 4RPGA 3SR3A 4EPXA 4XOUA 1KC3A 4TL7A 3WFIA 3L0OA 3T1NA 2O8DA 1M2JA 4YP0A 5DXAA 4BNTA 3C4VA 1KY5A 3SLKA 3W06A 5HZHA 2J1LA 2IOFA 4CKBB 4FYIA 1U28C 3FOAA 1PR9A 5EZYF 5I7OA 5CBKA 5JZOA 2CVQA 3HBLA 3X1XA 1IHUA 2QN2A 2FX5A 4WW0A 4L50A 4BMZA 2V7BA 2EL9A 1EH5A 2GN8A 3QH4A 1UJBA 3RTGA 1CS0B 1Q1ZA 1YDFA 3U6KA 2WB2A 1RQ7A 2J6HA 4N5DA 1O95D 3RRJA 3TAHA 3W5UA 3FMIA 3LBIA 3LUGA 1FOEB 1SBYA 4LRWA 4MUBA 2QD2A 1XB2A 4LZJA 4WK2B 3SYTA 1XAGA 2O5EA 4A6XA 2EQBA 2B83A 5J58A 3U48A 3QIVA 3K2IA 2ZCVA 2W00A 3ZDEA 1O97D 2WV7A 3RFFA 1GPLA 1A9ZA 1QGDA 2JIRA 4MINA 2J09A 4N01A 3SOZA 4D3DA 1NBHA 2WFZA 3ZI7A 1T1EA 2D2FA 2PH5A 2E4YA 1A04A 4LV8B 4RLHA 2XADA 3AFHA 2I4NA 3EF3A 4J8PA 1JDJA 2J3DA 1RQXA 2V5VA 4LHWA 4U9UA 4ZQCB 4DF3A 1Y6FA 4CM7A 1A4IA 3TQHA 4F8YA 2ESRA 1EGAA 2OHOA 3CTMA 4GKJB 1FTWA 1KZGB 4XB2A 1VE6A 4UVHA 3KZXA 1R2QA 1CY4A 4KFSA 3KLNA 3SIRA 4MCIA 4F06A 1CK4A 2A58A 3CF4G 2HJVA 3QYPA 2PNFA 4K5QA 2GNOA 3RSLA 1Y3CE 2GKSA 1V35A 3QUQA 5JBNA 5THQA 2Z8XA 3FCUB 3S1AA 1ZCAA 3I72A 2CLFB 4NE7A 2VHXA 4UU1A 4CM9A 4E94A 2GARA 1IQUA 1LPPA 3V46A 5CX1B 1DC3A 1XZMA 4CV2A 1O96B 2BRUA 2WD7B 4BNZA 2EWVA 4C6HA 2F3PA 2GSDA 3WQBA 3BGVA 3IO5A 1Y0BA 3G17A 5CT6A 3WGTA 3ZY6A 1ZM9A 1XI2A 2Z2YA 1RU3A 5T4EA 3WLTA 4HAXA 1SVIA 1E98A 2YJNA 4A73A 3TKYA 1ZOSA 1NSFA 2HLDD 1EFDN 3MT9A 3H11B 4Q1BA 4KEAA 4RM2A 1AGNA 2NXJA 3FDZB 1T4MA 2YFKA 3L18A 3SXPA 5IXJA 3W90A 3A7DA 4N7BA 1KYXA 1QQ6A 2FRDC 1E9AA 4NS4A 2IUEA 4DDHA 1YVRA 3PPIA 3F4KA 1U0JA 3ANMA 4D56A 4OK6A 1ZH2A 4R7ZA 4K9DA 5CXUA 2OYSA 1DX9A 2WM8A 4MW2A 1IHXA 4HGOA 4R31A 4F5WA 5F2NA 5J5VA 5TPZA 2COEA 4KDFA 4YQFA 3UK0A 2GVZC 3U60B 5HIIA 1P91A 3KZMA 3E22A 1CJCA 3ZD9A 1MVOA 4TTIA 3A8TA 1QR6A 1AB6A 3B3FA 5ALRA 1K68A 3MFQA 3SJBA 4XQGA 4NV3A 4EHIA 1TK2A 4HEJA 5AI6A 1VPVA 4BWVA 3HJAA 2X41A 3ACCA 5SZJA 5CHEA 5FLYA 2PZKA 1BXGA 2IL1A 2VUHB 5BVGA 1D8TA 3HMQA 2BGRA 2QT1A 1E2KA 1T24A 1Z12A 2HHCA 3H7IA 4C4XA 5A6SA 2PUDA 2HRBA 2IOYA 1E2MA 3NC0C 3ABSB 1AB5A 4X92A 2J08A 5FPSA 4P5DA 1I13A 4FQ8A 4Q12A 3W3AH 2FUEA 2PNJA 4U7HA 2O3QA 5ALFA 4EECA 1JI0A 3MFYA 1NFQA 2XKKA 4DZZA 1EBUA 1PDVA 4TKZA 3Q7TA 2ODWA 4L16A 3ZUPA 2X6RA 3LXXA 1ECFA 4C7BA 1Y33E 3WO0A 2P4EA 4RAOA 1T4BA 3K9WA 4LOAA 4AN4A 3I6QA 4J9VA 5T8KA 4A92A 2OBNA 4CDMA 1EVLA 4MPDA 4WFIA 5SICE 4CUZA 1E5VA 1ZIYA 1YTUA 5JXWA 3BMOA 2B7LA 4L5CA 4OQXA 2Z8YM 4Q7LA 4JI5B 1WUHS 3RLFA 4ZKDA 4W8HA 3AI7A 4AAYA 1OXXK 2JHPA 3VVBA 1AMUA 4EGFA 1V1JA 1UKEA 4FQ5A 1FNCA 2P5TB 3GF4A 5B4VA 1YZLA 3W3AD 2QPLA 2NVUA 4Z1MD 2RH4A 1FXWF 4RZ2A 1JLLB 1KDOA 1TD9A 1BS2A 2KWIA 2IW3A 1VBNA 3I6YA 3PNKA 4YJHB 5L7TA 1KIMA 3T54A 1YVEI 3DVRX 3JQBA 4UM8B 5AVVA 2EFDB 3A6FA 2Z3WA 4ATNA 1RRKA 4DCJA 2FLWA 4M36A 3RVLA 1QHSA 2A88A 4KUHA 5DH9A 5JAZA 4TLEA 3PV0A 2C5AA 3DR3A 3OIVA 3JPYA 3DDUA 3NIBA 3WK6A 2AFHE 5F7XA 1R9NA 4Z0PA 4IJ6A 3JTEA 3ZGOA 2XHZA 1UFVA 2YQ4A 5ALDA 5JAOA 1WTAA 4MPTA 5KYWA 4P32A 5CIWA 3TL2A 1YB7A 2CDBA 2XVZA 4JJ6A 1CUXA 1YZHA 3EDOA 3Q3JB 1PJRA 2WJ3A 3LX5A 4KQJA 4UM9D 4UUBA 5FULA 4KQGA 4YLYA 5BSVA 1R8QA 4DHEA 1NBMD 1TMYA 2HT1A 3Q4GA 2QL9A 5HF9A 5LBIA 3KSUA 4YJ2A 4KFRA 4DMMA 2VHQA 4OXQA 5AM1A 3RG2A 2AJLI 4MIKA 2PX8A 4DREA 1E7RA 4XFJA 4OA8A 1RJ9B 1O7JA 1RMTA 1IOZA 4LHVA 5GONB 1KAQA 4F2WA 2CFIA 1PJLA 4BQPA 4D9BA 5C7IO 4ECAA 2C2GA 3KYDA 4QXRA 3O21A 3KVNA 5CVJA 2OWEA 5H9WA 3L6OO 2AB0A 4TT3A 1SFRA 4JQSA 3GRRA 3PWKA 2XVMA 2CMDA 3D5QA 3ESQA 3NOXA 9ATCA 4YMLA 5EZ6B 5EY5B 4YWHA 4RVFA 2EDCA 4ROSA 4RM3A 3LVFO 4KE9A 3IJPA 5IC6A 4XOIA 1JFSA 4X60A 2OLKA 5KNBH 4Z8YA 3WJ1A 1KPIA 2BHSA 4H4CA 4AYTA 3DBVO 1V1RB 3EXIA 2QLFA 3GJ8A 3NWBA 5K05A 1Z88A 1V47A 1JHQA 1Z2CA 1ZH4A 3NQ41 3AVTA 4FX2A 1U31A 1WW2A 2G83A 2UYGA 1G21A 4GGOA 4JQOA 2PS0A 1J5PA 3ILYA 3L0IB 4ZDJA 1YBHA 1E6LA 1TEXA 2NIPA 2W2OA 1B7GO 5IT0A 1N8TA 3BKWA 3BJMA 4RK0A 5F3RA 2R5WA 5BN3B 5IRCD 4BY9E 3W6UA 3LT0A 4K1XA 1LWNA 4BHTA 1CJTC 2OXFA 3BB4A 3TO5A 2PMCA 1N8KA 1R18A 1PJ8A 2V97A 4XIIA 3N2KA 1J00A 1BX1A 1XZJA 2BLLA 2RHWA 2VBFA 3AWDA 4JVMA 5AJHA 5JG7A 3HBJA 1L7QA 4Q1EA 1Y4DE 4KPFC 4KO1S 4BTLA 5KNBD 3RI3A 3KEGA 1M1NB 1M74A 3OMXA 3SSMA 2GZMA 3AQIA 4QRDA 4MWBA 1NUQA 1RR6A 2W8BB 2C9YA 3P9PA 4XLLA 1QZTA 5EHXA 4OUDB 1VP9A 5BQOA 3H84A 1G6HA 3A27A 2ZVPX 1UQTA 1UKBA 2IIVA 1MTOA 4JYCA 4D4JA 2PN1A 5BXQC 4J6EA 2A33A 3G9TA 2Y4NA 2Z83A 5EEGA 1H2HA 5JXGA 1BE6A 5K0GA 4G9GA 3C5CA 3N75A 4PAMA 1DAHA 3JRXA 4S0XA 2BTEA 1PZFA 1U5AA 3SBEA 3UFXB 2FDXA 4JMLA 3E4CA 3ZZTA 2OZPA 4JLOA 4ND1A 4QTXA 1R0RE 5C1OA 1S5PA 3NZEA 4ZYXA 4KMOA 1H0SA 1IUKA 2IPOA 2CE2X 3JQQA 5AJTA 4BCDA 3MWEA 3OOEA 4RLFA 5CH5A 3VJMA 3ZLTA 3BORA 1WXIA 2PM8A 1P8JA 1X3SA 3E7DA 3FNQA 2ETVA 5ALLA 2GFHA 2PKQP 5I6DA 1NW8A 2PWYA 5GIPE 1ISSA 2V7PA 1YR2A 3N07A 3Q1LA 4UZEA 4C7JA 1XNRB 5CDYA 3ILVA 3PEFA 1GGJA 2HJWA 2LNDA 1ZU5A 1ND6A 2C2XA 2FGJA 3RV4A 5A3QA 4K05A 4OAQA 3G2KA 3M4NA 3WWOA 2WUEA 3GGCA 1Y1LA 3DMYA 3HABA 2XGOA 5E7JA 1MHTA 4JI2B 2CFCA 3HDQA 1DCTA 2XWPA 2CHEA 3JWPA 1YBAA 3L6BA 3G6KA 4TXLA 2VR1A 4ES6A 1R0YA 3PIRA 1JFVA 3RB8A 4G5YA 3G0GA 5AM2A 1UXOA 1E1CB 2ZXEA 3UCXA 4EG4A 2C03A 5CW1A 13PKA 1INLA 1UDXA 4MUIA 4CU5A 1BEEA 2F3UA 1JYFA 5DTIA 2DUMA 2H31A 3ZE2B 1NMQA 2VHTA 3NUZA 2RI1A 4FS3A 1IU9A 3AP1A 4YCCA 3AERB 1KVSA 4IS3A 2WNHA 1GCUA 5FEUA 2NACA 5TMBA 3PTAA 1O9GA 4IV8A 1O9HA 3T34A 3CIOA 2E1PA 4J0CA 1I0IA 4M8NE 3PX3A 2V7WA 3SSNA 2ZBDA 4QFDA 4BZZA 4D9KA 2O7QA 3IFSA 3OE7D 7REQA 3W5BA 1OZGA 1P9OA 1WR8A 1CR2A 1EVYA 4Q4AB 3KCQA 4K7JA 3T1TA 2PLNA 3FCXA 2R751 3GRUA 4ALKA 4AP6A 4HNVA 1EFKA 2IUTA 4OQPA 3C3KA 4YRLA 4JP5A 1C3VA 5FYDA 5KSOA 1N3LA 3E27A 1WVMA 3W2IA 3A1UA 4TVOA 4HN9A 3L7OA 1N7IA 4FW9A 5ALMA 3VU9A 4MJ3A 4H7JA 1IBCA 3ID6C 5BQ3A 5ICGA 1N6KA 3IAFA 1C9MA 2UYOA 1MQ8B 5FPYA 2JH3A 2I55A 5LZ4A 4U63A 1PK7A 2P2DA 4G0WA 2C0QA 4WASA 5KQMA 2WUGA 3O1LA 2Q4EA 1NKTA 2AJTA 4YAFA 3USES 4BUZA 4L4YA 2SICE 1NBOA 1DMRA 2QLJA 1P4JA 2QYHA 3Q10A 4J76A 4QLOA 1QC5A 3E48A 3K73O 3TYXA 4DB2A 1PYDA 2PR2A 1FCJA 2Q45A 3OZDA 4N3GA 5SY9A 1P4RA 3RVNA 1SOVA 1YQGA 2PZBA 4QEDA 4F3YA 2FVXA 2XODA 3CV3A 4N8EA 4FFRA 2OZVA 3SJZA 1T3LA 2F43B 3DCNA 2D54A 3PI6A 2H5IA 1W59A 4CIDA 1GTSA 2YXEA 3EFBA 3OTOB 3ROKA 1Y8ZA 3C97A 5FT9A 3DLBA 2VUIB 2AG6A 2NOAA 4FNOA 1X1CA 1XXHB 4P82A 3ZI0A 1GZ7A 1T8PA 1VE5A 1OV4A 4MUKA 4CGYA 2AFIB 4LRSB 3DZJA 3KPUA 4QWMA 5A0FA 4A27A 3WNCA 3GBVA 1ZM7A 3UJ3X 2W2PA 4B0PA 4H7PA 3S5UA 4K6CA 3ZWNA 3WMXA 3ENQA 3WYCA 3NVMB 2RI0A 4O2BA 2ZJFA 8GPBA 5C9ZA 4MIEA 4XARA 4QJBA 2IGTA 3VUFA 4AI6A 3BFVA 2A7XA 1FSFA 1I10A 1BXZA 3PT5A 3KT3A 5BNIA 2EARA 1UM9A 2DAPA 1G7RA 2ERCA 2BHLA 2LE0A 1N5IA 3R6WA 4I9HA 1CR1A 2VTVA 4KLNA 4ZT6A 5BMVB 3ZH9B 4BP9A 3O8OB 3R7AA 2BN4A 3KXKA 2B69A 4E09A 4ZVOA 2EATA 1GRCA 3HKDB 4B35A 4CIVA 3MUNA 2GJ8A 3R5HA 3WLJA 3C8ZA 4JLBA 2A0UA 3CT4A 3PPWA 4Y0NA 4B2PA 1IBRA 5JSQA 1QBKC 4D46A 1P8AA 4KB5A 2J5KA 1GN9A 3GAFA 3R0JA 4IWYA 4H7IA 1VA4A 2EOAA 1J8VA 4TMKA 4YV7A 4MCHA 1CNMA 5K3CA 1MB2A 4HNUA 5LA6B 2VF8A 2V7VA 4B09A 4B8YA 2WHPB 4GBED 1EWYA 2PWAA 2IXFA 2D5LA 4A6DA 2P91A 2YYZA 3E7PA 3LCJA 3ZN2A 2VHCA 3K32A 1UANA 3KU4A 4QBHA 2WP0A 4G9BA 3AK4A 4X54A 1JT9A 1J8MF 2WIJA 1JDSA 3GJZA 4R3UC 3T5TA 3X3HA 5IN4A 1ULTA 2PX4A 4PC7A 4RSGA 3MHPA 2CWWA 2LBPA 2JHGA 3WV5A 2CNKA 3NBXX 4M9UA 2CXPA 3IV9A 1T15A 4DGSA 1IM2A 1JDBC 1NW6A 3TNJA 3HZZA 5TARA 4GYJA 2GPSA 3FWZA 2DUWA 2IWRA 5E4FA 4EG8A 3QF4B 5HX7A 3PDWA 4C4RA 4H16A 3TKAA 3RJ5A 1A9PA 3VNQA 1XTIA 3IVAA 5AOBA 3ZH2A 1Q17A 3HKEA 4R9SA 3PYLA 1CF2O 1Z4PX 1XZLA 2QQEA 3HKBA 2Z8ZA 1SOUA 3CT6A 1W52X 3QELB 4ZAVA 2ZSJA 3P9XA 2IHYA 2VRWA 3BXOA 3TH5A 3CZ9A 2C94A 2AQKA 2HHLA 4QVKA 2JLBA 5F2EA 4B3CA 4ZYUA 4YP5A 1NNI1 5CD1A 4G01B 3WLOA 3JQRA 3RVQA 4AUEA 5IF3A 1B93A 2OAGA 2YBEA 4Z9YA 1CETA 3VPXA 3MWDB 2GCEA 2W6OA 3QBTA 4MW4A 4ESEA 3LPLA 2WR8A 3KB6A 4BYMA 2IHUA 1IB0A 5TEWA 3D6VA 4KLRA 4BZPA 1B2LA 1WPXA 1S2MA 3M1IA 4LBYA 4UMEA 3M6VA 2LVBA 4BQNA 4P4NA 4YUZA 3RRMA 4FCWA 2VSYA 4JEHA 2VOEA 1PX2A 1QCDA 3F74A 1VBKA 1VJRA 5GVRA 4Q3KA 1XZHA 1MT0A 1P1RA 2GN9A 3DTTA 3LYUA 3SXUA 3F6SA 3FZEA 4GE3A 4J0HA 2QVZX 3IV7A 2XYRA 1U3DA 5D3QA 4YYEA 1ILEA 1OILA 1ZIDA 1DELA 3QWHA 4R2LA 3VH4A 2BFCB 3EVNA 3PNYA 3UXYA 4Z4HA 5CA1A 1L5HB 3VDNB 1BS9A 4C4AA 1LBQA 3OU2A 1CHDA 5FNZA 3S70A 2WIAA 2RK4A 4ITUA 4JYPA 5EWLA 2D74A 1BCSA 1RWPA 4GBJA 1RBYA 2XECA 4ESHA 3N39C 4O2RA 2GH1A 4LY0A 5K5EA 1FJGB 2Z3VA 3GP3A 3I0MA 5T4HA 1IY0A 2HA4A 5FWAA 4D5GA 1DTWB 4Z1OA 3L5KA 1RLIA 1Z6PA 1PDOA 2WDZA 1E1MA 4KLZA 5E9QA 1Y4UA 4PGFA 4YDSA 3AFNA 4J1NA 4Q7EA 4DR5B 2AI3A 5IZCA 3C5HA 5FUYA 3T9CA 4BB6A 4UKDA 4CLOB 4MUGA 1KS9A 4G81A 5IC4A 1YB5A 2G5TA 1XSEA 2HT6A 1BZYA 3Q2KA 5D84A 3CW8X 2HAEA 5GJWC 1GT91 4WZ6A 2VZ9A 3MMNA 5C0OE 2C98A 1Q6YA 1NXQA 1FSGA 3BL8A 4LC0A 2D1FA 2EJCA 4AULA 3DNMA 5JAIA 5CAEB 2QTLA 2WF6A 4B3GA 1JLHA 1PWXA 2OV2A 2V03A 3KWFA 1KK1A 1F1JA 1QORA 1N6OA 3FB4A 3PCRB 3LWZA 3OEHD 1DUSA 1XZEA 1MRSA 3JATB 5LL6P 1SELA 3BRCA 1M2VB 4DJ5X 2J7PD 1ZDMA 4IR7A 4KXWA 4N82A 1YJAA 3QLJA 1AMOA 1KOGA 4BPRA 3WP0A 4RPIA 3ANYB 2E21A 5CH3A 4DKXA 2BONA 1AQLA 2PXCA 5AW1A 5JSHA 3C1AA 3OIDA 4JVLA 1VQ1A 4ZPXA 3SF8A 3W2EA 4L27A 1N2BA 4NI5A 4OBXA 3A2NA 4I4IA 2QRPA 1Y9EA 1VOTA 2LKDA 3G6WA 3F6CA 1RPJA 4RKEA 1XZGA 2OHXA 2WTMA 3SIWA 4PRZA 1VIAA 3PXGA 4LE1A 4XB1A 4XGRA 1WX1A 4E5YA 1Q14A 2IF2A 2WEKA 3QW4B 1LBIA 4L3OA 3IEXA 1C9EA 3K0FA 1M2WA 4TKLA 3W34A 3W79A 3M6IA 1GG2A 1NI3A 1DDOA 3L8MA 2A3NA 5AFSA 4BQRA 3WIEA 3H2HA 3ZXYA 4IBOA 4EJSB 4OI0A 3G8DA 2C2OA 2FGKA 2XE6A 4OYHA 3Q8MA 4G0QA 2DUUA 3ONWA 3EGEA 3X44A 4AP5A 2GZRA 1VPLA 3EPPA 3H5VA 3OQMA 2WKQA 1EWRA 3I05A 4QICA 4DEVA 1OB2A 2EW8A 4CF6A 2WTEA 4X85A 3K94A 4PRLA 2OXCA 1V4VA 4HF7A 1ZXLA 2D13A 1T2UA 2PAFA 4E51A 3A6KA 2CLIB 4EBFA 3L7DA 1IQ0A 5FOTA 1W4ZA 2P9YA 3FDFA 4H77A 4KKVA 1IN5A 2VWQA 3FJ1A 3GZJA 4UDNA 2FUNB 2FDCA 4DEYA 3EZGA 1PD0A 4CMEA 4PQYA 4ENSA 4BLVA 1A0OA 1W85A 2I7CA 3F5QA 4R2KA 3HB1A 5KYUA 7ADHA 4X91A 3T1YB 3QUBA 5I7FA 1ZI6A 3LP5A 1T9ZA 3F8WA 2RJNA 7MDHA 1ETUA 1II8B 4FLMA 3WRYA 4KIGA 4CM9D 621PA 2PGXA 3PKJA 3PR3A 1EJ0A 2ZI6A 5F1KA 4JS0A 2CDNA 3BFKA 3JQAD 4J91A 3BWBA 1LVUA 1PS8A 2O7RA 1XD2B 4LC9A 5F3DA 3A0RB 3SD7A 2PU5A 3OKFA 3A32A 4QTZA 4DBLE 3ZHSA 3OP1A 4F93B 4QZVA 4KWEA 1U81A 1ZG3A 1JRLA 2L69A 1QPBA 1YE3A 1U5BB 2CYCA 5LM3A 1QXSA 1C9YA 1I01A 2AR0A 2HMYB 4UM7A 2OY0A 5JWHA 2RBEA 3OPYB 4YPFA 1PWYE 1K9VF 1W0KA 4OI4A 4WCFB 3MILA 5K3FB 5BN5A 4Z0HO 4K6GA 4ACBA 1WIWA 1JEOA 3H1BA 2A57A 3VA7A 4D42A 4BVAA 1XQ9A 2AI2A 5ABPA 2GKGA 3FW1A 4FR2A 3H3JA 4E1VA 4RTLA 2GM9A 5AXAA 3OJ0A 2DUJA 5EXSA 3BREA 5TPZD 4DBLC 3EVAA 1RPAA 1GRRA 1ZHHA 2ATCA 3KQVA 5GMOA 1W0CA 2W48A 4KN8A 4XUEA 4RD6A 4X6LA 1JSZA 4MVWA 2FQWA 4PO3X 2PZMA 4LV5B 1OZAA 4ERXA 3Q85A 4L73A 4RZ3A 1YE8A 4QGSA 4DIMA 2ZK7A 5B3LA 2VNSA 4CT0A 3GGOA 3O4HA 1ATIA 3RHTA 3DMPA 3EIXA 1ZWKA 3EPRA 1F38A 1UPAA 1NBEA 3BBPA 2CNLA 3KKPA 3B82A 3PT9A 1XP8A 3RJ9A 2UZ1B 3O47A 3SOPA 3NBAA 1YKSA 3I9V6 1ZN7A 3SC2B 3WIBA 4JYMA 4KR2A 1NHWA 5IZ4A 1IXKA 1V3QE 5CLLA 4MLDA 3I5YA 1J2RA 1NYTA 3BK2A 1F4VA 1WU7A 1JQKA 5E2AA 1QVWA 4C0AC 5J2TA 2YY6A 2HREA 4ZWNA 3KP1A 1N6LA 1J9EA 1NONA 3VHQA 4MB0A 1K2WA 3ZVKA 2QZSA 3CB2A 1GSHA 1EZ1A 1DT3A 2YZKA 3N7TA 1QONA 2P0YA 3QG5A 2B3DA 1FTGA 2B1IA 3CZMA 3E0XA 1ZC3A 1CUVA 2YXDA 3GGSA 4NPCA 5DCLA 3TD9A 5JCXA 4JH0A 3ROQA 5G53C 3OWOA 1H8HA 3O2NA 2HF9A 1K0UA 5AW7A 2JGAA 1K86A 3I9MA 4DW8A 2BR3A 1Y63A 4P2BA 2G76A 2EJUA 2OBFA 1Z0FA 2R85A 4R5HA 1N9GB 3FMGA 3ZDQA 4K88A 3PFCA 3RIYA 5A4DA 1SRQA 4NECA 1ZMOA 1Q0TA 4HDNA 2XCUA 3LT1A 4X45A 4BQSA 2EJWA 2P6OA 1J7JA 5JJKA 2PY6A 3R77A 3A2LA 2H2IA 1T29A 4Z86A 4ZI7B 3QPUA 2J7KA 2FMHA 2HJSA 5C34B 4MIYA 3FOCA 1MABA 3VX3A 1R5BA 3ESRA 3ZD6A 4RJ2A 1F1BA 3I2IA 3TL3A 2F9MA 1KP9A 2X77A 3FY4A 3KKQA 2AE2A 4OM8A 4II3A 2A1IA 4KMSA 2VSQA 2QTMA 1CCWA 4C30A 1CZKA 3IT1A 3O31A 3AOEC 2AK3A 2CBGA 2E0IA 4BVKA 2WFAA 1DAMA 1QYVA 3DYIA 3L7BA 3LD9A 5CDSA 5HTOA 3GAZA 3DAHA 1LKZA 1QH8B 1YJCA 4MV8A 3JS5A 2JFGA 4BNVA 5G1PA 3RUIA 4ZDIA 3D6FA 3F7TA 3UWKA 1DBIA 1YS4A 2D06A 2NU7A 2AR9A 3GFGA 3EAQA 2VI5A 3NLLA 4C29A 3AIMA 3BRQA 4HV4A 821PA 3D7MA 1DAPA 5EKDA 5CNMA 3UT6A 4EYGA 2WD9A 4DCCA 4DEXA 3UYKA 3QOFA 4IOMA 3I0ZA 1P1JA 2WMYA 5A9RA 8LDHA 5K6RA 5L8VA 1HF3A 3HKCA 4GMFA 5I7VA 4NE9A 3QFFA 5C5CA 3TSCA 1PV4A 3MS2A 1SZDA 2CLLB 4XIYA 4KH0A 3FFBA 3SEZA 5TQVA 5MF6A 3JAKA 1J5EB 1J0AA 2NX2A 1V71A 5KYVA 4B2IA 3K4QA 4Q9HA 4D4KA 2K4MA 2VJPA 5IMSA 3NYQA 1QVVA 2G4CA 5HOQA 2EAUA 2HW8A 2OORC 3I9OA 1RABA 4DIKA 5CJPA 5U1PA 1CRWG 1KY4A 4R2JA 1ST2A 1XPOA 1S3FA 2EBHX 3LYHA 1QLHA 4EPWA 3ZV5A 4GPD1 4R83A 1X6VA 3WGHA 4DMFA 1VLHA 4Z5XA 2V55B 2H1HA 3KUDA 5HFAA 1AHNA 1PJBA 3P9IA 1W36D 3ZZMA 2DKNA 3IVMA 3PRHA 2BGWA 1UDWA 2V3VA 3FZGA 4O4JB 1OUMA 4QDKA 3KB1A 1IBMB 3VZRA 1ONNA 2C4HA 4QXOA 3EQ7A 3OX2A 3WGJA 1AT1A 1TLLA 2H08A 2Q3FA 3SZ3A 3GJYA 1GV1A 4IJWA 3ZV7A 3A4NA 1XMJA 1K7XB 2I2CA 5BQFA 4LZOA 3FOZA 4EUFA 3CWCA 4TROA 3QEMB 2H7YA 4Y2SA 5E6RA 3WGIA 4PG7A 5P8WA 1GUAA 3SZRA 1E3SA 4R0MA 2JRLA 3KETA 5IUJC 3JD1A 3NT2A 2FF5A 1Q57A 4HDCA 5TMPA 1QTRA 3LZ6A 1JGTA 4LYYA 3ROGA 3T0GA 4BO1A 4L6CA 4N40A 3M4ZA 3R3JA 4ZVRA 2XKBA 3FGOA 3F8TA 5D3ZA 1XZFA 5GTDA 3BTVA 5IF9A 2KB0A 1ZXXA 3NBZC 5DNCA 1WDWB 4MVCA 5JS2A 3D3JA 1HT0A 3EBLA 3KEOA 1PP4A 3L1JA 3R3HA 4LE0A 5GY7A 2CV2A 1QRAA 4IO0A 5L7YA 4NDAA 5JALA 4E3WA 1HC7A 1U3CA 1YC2A 4UDYX 4WLFA 4LXQA 1B74A 1WDTA 4DDTA 3K8QA 5JYEA 3DDOA 4DXHA 3H5IA 2R1UA 1ZJ6A 2G67A 4RZXA 5JDCC 5I8WA 1CV2A 3KD3A 4HAOA 3EVDA 2Q6LA 1IFXA 3AWIA 1W9MA 4PHFA 1TU0A 1ZOPA 3SJUA 3N2GB 3ZBUA 1F3OA 1G2PA 5DK4A 4CR7A 4Q1DA 3UEOA 1Z5OA 4HMOA 3EIEA 1UMBA 2AZMA 1Q5PA 3C41J 2Y1CA 1A5BB 4ARBA 1CY1A 3EN0A 1ZD3A 5E8RA 2W6ZA 4P4LA 4EW3A 5I01A 5CXSA 4CM5A 1JR3E 2ATVA 1NOIA 2WM9B