2VWPA

Haloferax mediterranei glucose dehydrogenase in complex with nadph and zn.
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
357
structure length
357
Chain Sequence
MKAIAVKRGEDRPVVIEKPRPEPESGEALVRTLRVGVDGTDHEVIAGGHGGFPEGEDHLVLGHEAVGVVVDPNDTELEEGDIVVPTVRRPPASGTNEYFERDQPDMAPDGMYFERGIVGAHGYMSEFFTSPEKYLVRIPRSQAELGFLIEPISITEKALEHAYASRSAFDWDPSSAFVLGNGSLGLLTLAMLKVDDKGYENLYCLGRRDRPDPTIDIIEELDATYVDSRQTPVEDVPDVYEQMDFIYEATGFPKHAIQSVQALAPNGVGALLGVPSDWAFEVDAGAFHREMVLHNKALVGSVNSHVEHFEAATVTFTKLPKWFLEDLVTGVHPLSEFEAAFDDDDTTIKTAIEFSTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUCOSE DEHYDROGENASE
publication title Active site dynamics in the zinc-dependent medium chain alcohol dehydrogenase superfamily.
pubmed doi rcsb
source organism Haloferax mediterranei
molecule tags Oxidoreductase
total genus 116
structure length 357
sequence length 357
ec nomenclature ec 1.1.1.47: Glucose 1-dehydrogenase (NAD(P)(+)).
pdb deposition date 2008-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
A PF16912 Glu_dehyd_C Glucose dehydrogenase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vwpA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2vwpA01
3VPXA 1J4AA 5CG2A 1FF9A 4NIMA 1A7KA 3JTMA 5CHEA 5AXBA 1MC4A 1Q0HA 1DAOA 3RFTA 4CM8B 4E30A 5HA5A 2VTEA 1AN9A 2H6EA 1GV1A 2Z1NA 2AG5A 1KVTA 3D3WB 5HS6A 2Z1MA 1ZBQA 5FWNA 3X2FA 3WGOA 1NVTA 4DMLA 4XQ9A 4N5MA 3L4BC 3AK4A 4B3HA 4R5MA 1O9BA 3RBVA 4Q3CA 2Y68A 4HFMA 4K26A 3HHPA 1NFRA 5IZ4A 5JO9A 5DNAA 5IN4A 4Z6KA 4CLHA 1VJ1A 2PZJA 1EUCA 3NEPX 4FS3A 3MCVA 2WD7B 4L75A 5HS4A 4U0KA 3WNQA 2EW8A 1ZJYA 3JCZA 3UVEA 1JAXA 4IDBA 1R66A 1I5RA 1RWBA 4YQYA 2PKRA 4FFLA 4RL6A 4TQGA 2CFCA 4I5FA 4P4LA 4PZCA 4DIOA 3A9WA 3OQBA 1I8TA 1SPXA 2NWQA 4XGKA 1T4BA 3JQEA 3RBXA 3T4EA 4CLOA 1S7CA 3KHUA 3M6IA 2O2SA 1T4DA 4BNGA 4YBZA 4PFJA 1LI4A 3IP1A 2YV1A 5I7EA 4MVJD 2NUAA 3PHGA 5T8KC 4ND3A 4UUMA 3WGIA 3C1TA 3NDJA 4IXTA 3SXPA 3Q2KA 5I9MA 1XCBA 3GZ4A 4WLOA 3TNLA 3ZWAA 1UXJA 2VWPA 4NJOA 5F21A 5KWEA 1F8FA 3MWDB 3PQDA 1P1RA 4DREA 4RDHA 4MJLA 4QO8A 2Y1OA 1EDZA 1IB6A 1OBFO 3RROA 2FPGA 2O4CA 4IJWA 1ZH8A 1LQUA 4CM6A 4XRGA 2G1UA 1T2FA 3MJSA 1PSDA 3EAGA 1EVIA 4WCFC 1BXZA 3EZYA 3I52A 3C3XA 1V35A 4Y6RA 3TDKA 5H83A 3NYWA 4O1MA 2QG4A 4RZHA 2SCUA 3DC2A 4PZEA 3WB9A 1KVQA 1FK8A 2BELA 3AI1A 5EQFA 2GN9A 4FD3A 3A28A 1L1FA 4YJHA 1EUZA 1YJ8A 2NACA 2GD1O 3PVZA 3W8EA 3V1TC 2X9VA 5AXDA 2JHFA 1IZ9A 2E6UX 2OORA 4XB2A 2FWMX 1N5DA 4PG6A 2GLXA 4UULA 4G65A 1PX0A 4R41A 3L6OO 3B20A 5K6AA 3GRPA 4N54A 1GPJA 1ZUD1 4B79A 1X0XA 1CIVA 4WUVA 1G6KA 5K6AC 4NR0A 2D3TA 3NV9A 1DPGA 2X4GA 3AOEC 4QQRA 1H9BA 1ADGA 2VZ0A 5A9SB 4OSOA 4HX5A 1HDXA 1I30A 4CMKA 1ULUA 4QX6A 5BNIA 1EVJA 4ID9A 1E7WA 1BTOA 1IE3A 2C54A 1BDBA 2Y93A 1WW8A 3PWSA 3HB4X 3VZSA 4XGIA 3ANLA 4JQCA 3ZWMA 2OMEA 5KIAA 4KWIA 4YT8A 4W82A 3DBVO 1ZCJA 4D42A 2NVUA 4E12A 5BR7A 4BO2A 4BHTA 4JROA 1U3TA 2Y1EA 1LRLA 2CF6A 2EEZA 3OEYA 5CP8A 4NHEA 4AFNA 1S6YA 4S3MA 2I3GA 5G4KA 3V5NA 1PJSA 4OXKA 4R16A 2R00C 2AA3A 1A27A 3QHAA 1DRVA 4P4GA 5JS6A 4UREA 1C1XA 3EUWA 1JVBA 3GEDA 1HDRA 3MOIA 3O8QA 2GRAA 3UH1A 4ZHSA 1QLJA 3RQSA 4B4UA 4BO9A 1GD1O 1N1EA 1TA4A 5H81A 4FFMA 5TS3A 5A5FA 1ZIDA 2J5QA 4E2YA 4IQGA 4KMSA 3LK7A 4BL5A 6LDHA 1P44A 3LT2A 3PHHA 5EINA 5CDYA 3ZWYA 3DZBA 1FDTA 3UICA 2PKQP 4CM8A 2XXBA 2BD0A 1QORA 1EBFA 1T1SA 2PKQO 4IINA 4CM4B 4DIFA 1J0XO 3Q3CA 3GUCA 3D3WA 4BKRA 1GTMA 1OC4A 2WDZA 5LDHA 4BKOA 4M87A 1XYGA 1XSEA 1PJ4A 1EMDA 3WJ7A 1LRKA 4D3SA 1ZMTA 3VOSA 5TJHA 4FGSA 1UZLA 4FSHA 1NNUA 1O8CA 3INRA 1LQTA 2OO5A 2Q1UA 4HNHA 4I1IA 3S2GA 3JQGB 1YWGO 4J1QA 5ITVA 5HM8A 1HYHA 1NPTO 1SB8A 3AJRA 4GWKA 2GN6A 1B0AA 5BQFA 3RASA 3DHEA 2IEBA 3GMDA 4L4SA 2BHLA 2P68A 3AM4A 2WD7A 5IJZA 5I9NA 1HEUA 5JYEA 5HTOA 3VAZA 2HJSA 4RVUA 3NX4A 1MA0A 5F1KA 5CDGA 3IOYA 3ZWCA 1VJ0A 4KWHA 4OQYA 5T57A 4CPDA 1KEWA 3R3JA 2JL1A 4KTTE 1IZ0A 4YJDA 3CE6A 3FBGA 5CAEA 1HF3A 1YXMA 1MUUA 1XDWA 3AM5A 3PGXA 4JBGA 4Z9XA 4HKTA 2H9IA 4ZVVA 4PVDA 4NQZA 4G81A 4JK3A 3F47A 4OMUA 4BIIA 4GLLA 2G82A 4MVJF 3JYOA 4LRSB 5A05A 3IIEA 1E7QA 3KUXA 2H1SA 4BGUA 2TMGA 2VWQA 4ZGWA 2YV2A 2O3JA 3PYLA 2P9GA 2AMFA 2HMSA 2Y0DA 3KO8A 3RWBA 5C37A 3ZNNA 3I3OA 1QG6A 5GMOA 2EP5A 4R1SA 1R16A 3JD1A 1P9LA 4J90A 4E2WA 2OHXA 1E5LA 4IY1A 1TVEA 4IJVA 4OQZA 4XIJA 4A27A 1W8DA 4W9NA 3NT2A 3VTFA 1ZXLA 4Y9DA 4BB6A 1DOHA 3U9LA 5KJEA 2E48A 3F5SA 3RCBA 1LXCA 2FOIA 2NVWA 1MC5A 1PL7A 4BO1A 1UR5A 2X23A 5FI5A 1SO8A 4QT0A 2AEJA 2QX7A 1CWUA 4AG3A 1YL6A 3NDRA 3OMLA 1F12A 1GYRA 3BMCB 3PWKA 3H5RA 1V3UA 3GEGA 4WE3A 1ML3A 4BO3A 3ROQA 3WWYA 2OP0A 2DQ4A 3IUPA 2FZWA 3BIOA 4J9UE 2VNAA 5JMPA 3QVOA 1SOVA 3IC5A 4PGFA 4YQZA 2UUPA 4YA6A 3DAFA 4CV1A 3ZWNA 5ITWA 4J3FA 1U9JA 5G0TA 3HN2A 3KRTA 4E13A 4YXFA 4BO4A 1MXHA 3L77A 5A9SA 1I2CA 4LVCA 5CEJA 3ZNQA 1I0ZA 1LSJA 3ADOA 4BKPA 5CPFA 5L4NA 3P19A 1LC3A 4DA9A 1QYVA 3GAZA 4PRLA 2HRBA 5HWSA 3OQ1A 3H9EO 2WJPA 4CMEC 5L45A 1HETA 1E3SA 4IMRA 3OBBA 3Q9UA 1O0SA 1RYEA 2B4TO 2DFDA 3JD3A 1ZSVA 2GZ1A 3GHHA 4CM9A 4XX0A 1JVSA 5B4TA 4H3VA 4TRMA 4B4WA 2YDYA 4CV2A 2WYVA 3L9WA 1F0YA 2OUIA 2GPTA 3QWFA 4MVJG 4B3IA 4XR9A 3ASVA 4UUPA 1U28A 4M54A 2AEMA 4O0LA 1GYPA 4BNIA 4BNVA 1ZMOA 4IQ0A 1H6DA 4QTZA 2PGDA 2CSUA 1MB4A 3K73O 2R6JA 4YAIA 4GSKA 1IHXA 3RVDA 2EW2A 5KKAA 3NDIA 4E5KA 3K9QO 3K30A 4BMSA 3ROKA 1QYWA 4AJJA 1LDNA 4FPXA 1GUFA 3MJTA 4CM4A 1YS4A 4WCDA 3OETA 3ICPA 2VT2A 3FR7A 4A0SA 4DYDA 1ISGA 3CUKA 3WGYA 1ISIA 1GV0A 4DBZA 5DF1A 1LLQA 4FFRA 1D8AA 1F8GA 1MX3A 3C1OA 1IPEA 4RLSA 4CM7A 1NYTA 2OP1A 2GCGA 3BHJA 2BI8A 4RPLA 1M6HA 4FBGA 1K89A 1GZ6A 3I4FA 1BMDA 3PIIA 4I5GA 2EJWA 1MV8A 2B36A 2TMDA 4WPGA 4IS3A 5K0ZA 2EG9A 4Z9FA 3UCXA 3ZHYA 5CFZA 4EJ6A 1ISHA 5JE8A 1FDUA 2CF5A 4QEDA 4XQGA 2VRCD 2HRZA 4CQMD 5JSFA 4M86A 3H2ZA 4D44A 4G2NA 2VRCA 3RFXA 4AJKA 4YT4A 3FBTA 4CR8A 2GYYA 2WTBA 4D3FA 5BSEA 2PGJA 4OGWA 1R4MB 5G2OA 5L7WA 1HZZA 1R15A 1HRDA 1T24A 1KYQA 1DC6A 2D5CA 4YAGA 2VOJA 2O3UA 5L7TA 1KVSA 4ZQFA 3INTA 4YDRA 7ADHA 3ICCA 1QYXA 5KJ1A 4PG5A 4DPMA 1HKUA 3G3EA 2QHXA 3UUWA 4MVJE 4R9SA 4JCOA 1EK5A 1VM6A 2O7QA 1UP4A 4WOJA 4CL3A 2DBQA 1CF2O 2YHIB 3ZWOA 2VCYA 1VL8A 5KTKA 1WLYA 2FHSA 2O23A 3I9NA 3Q11A 4RPJA 2QQ5A 1N7GA 1PQUA 4MKZA 4C7JA 1IHYA 1O95A 4QFCA 3SC6A 1CDOA 3RUDA 5A9RA 1HSZA 5IDYA 1U2DA 4BB5A 4HWKA 1HDOA 4GAEA 3OF2A 3PJGA 4HP8A 1QMGA 3WLFA 2BH9A 3GF4A 4IM7A 5ADHA 2JKVA 1PGOA 3TJRA 1YB5A 2X22A 3LQFA 4BGVA 4CM1A 5TF4A 2EIHA 4EJMA 3AFNA 4OXYA 3AM3A 1JKFA 5U9CA 1DHRA 1XG5A 1KY4A 1DLJA 2DVMA 2ZK7A 3CTMA 5B37A 5JCJD 2OBYA 5EPOA 4MP6A 2YDXA 4IIUA 1KERA 3BYZA 5JCJA 3WIEA 1ZXBA 4L0QA 4KOAA 3D3EA 1Z7BA 3HADA 5IZCC 3WQRA 4CLXA 4GX1A 2I3AA 1Z82A 4LN1A 3L0DA 4M49A 1X0VA 4ZQGA 3PHIA 4HADA 3BMCA 3R0IA 9LDBA 1ZEJA 5DCYA 3IL2A 3VPSA 1VJTA 2VUTA 2GR9A 1ZK0A 2A35A 3TWOA 5AOVA 3GC6A 4D7AA 5EJ2A 2AQ8A 4YWJA 1BSVA 2HUNA 1DBVO 4BMVA 3FWNA 3LC7O 3ZNPA 1LDMA 5TX7A 4CUKA 3HDYA 3IMFA 3GY0A 3FCOA 4B4OA 4TZKA 5A04A 1E7MA 1U8XX 1U3WA 3ITKA 3JD0A 1VSUA 1NFQA 1PR3A 4R01A 4NZ9A 4DVJA 5KVCA 4ND5A 4Q9NA 3UHAA 5FYDA 2DUWA 3ZW8A 3F5QA 2NV6A 3QWBA 4XWYA 1FJHA 4P8RA 4WKGA 2HDHA 1G0OA 1TB4A 1C3VA 4CLEA 3PJFA 2BKAA 1UXKA 2ZB7A 5JCXA 3KXDA 4MIYA 2X1HA 1O89A 1HYGA 1GUZA 1ONNA 3PZBA 1DDOA 5EESA 3ULKA 4KUGA 4XYLA 1K6JA 1M75A 4GX2A 4TZTA 3L07A 4LSWA 2X9GA 1NASA 1LLUA 4YPOA 1LRJA 3ETGA 4CM5A 4J4TA 4W4TA 1WXDA 1YBMA 3O26A 2NU7A 3ENNA 2WE8A 1OZAA 3F3SA 3BA1A 1ENOA 3U4CA 3TN7A 3TZQA 1LLCA 1HE5A 1T1RA 3DEYX 3WQQA 2QRJA 3QW2A 4GQAA 4ZQBA 4E31A 5F5NA 1WP4A 4JJIA 3RD5A 2HK7A 3OHSX 1E5QA 3CXRA 2V6BA 4Z9YA 1KY5A 3GA0A 1G1AA 2C7GA 2DC1A 2HAEA 3SBOA 5A06A 1BVUA 1JQBA 1BG6A 4M8SA 3L6EA 4D43A 4IDFA 2FR8A 3HJAA 3EYWA 4MDHA 1O5IA 2ZQZA 5BT9A 2EHDA 3KYCB 4IDCA 4PLWA 3D1LA 2EKLA 5IDWA 4I08A 2CVZA 1BHSA 3LLSA 1P45A 4FR5A 3DAGA 4NK4A 1YONA 4CQLB 3E9QA 4XD2A 3K2EA 3DWFA 4O59O 3OJOA 4O6VA 1E3WB 1E3EA 1ZK2A 3RJ5A 2Z95A 3WGZA 4OM8A 4YR9A 5IXSA 2PLAA 4DL9A 4P4NA 5A1TA 1IOLA 2O50A 3IUSA 4U6SA 4HFRA 1NX6A 1XA0A 3PFFA 1K0UA 2QIOA 3SLGA 3EW7A 1GCOA 1E6WA 1ZK4A 3CZMA 1GEGA 2IXAA 3PZRA 4IMPA 3ZWWA 1R4MA 3PYXA 4J7UA 3VH3A 4XB1A 1BWSA 1NWCA 3KB6A 2FN7A 4WLVA 3RUFA 3UF0A 2O3TA 3GQVA 3LDHA 4AJNA 2EKPA 4BGIA 4E33A 1GADO 3EY4A 2F00A 4J4HA 4Q3NA 3JV7A 4ALKA 4F3YA 2NNLD 4I9NA 3IKTA 2YHIA 3JQFA 2I67A 5HBRA 5JW6A 1GEEA 1IUKA 2QRLA 2XPCA 2GZ2A 1HDCA 5DN9A 3DDNA 3R6DA 1LUAA 1V3VA 2CMDA 3H5NA 1D1SA 3OP4A 4YEDA 2RH8A 4PLCA 1CQJA 2HO5A 1VLLA 4YRDA 4NBVA 4J0FA 3B6ZA 3GAFA 3KSUA 5IDQA 1KETA 2Y1FA 4LSMA 1F14A 3UAGA 3PWZA 5I7VA 5JY1A 1CJCA 1KC3A 1QP8A 2XAAA 3W8FA 3KV3O 1UDBA 3ZW9A 1QV7A 2C7VA 3OFSA 1P33A 4J2OA 2VYVD 4DQXA 1LX6A 4IXWA 2HK9A 3JQ8B 2VYVA 3TSCA 4FFPA 4J6FA 4ND4A 4YAJA 3CINA 2EKQA 3CIFA 1HDGO 4MVJA 3WGGA 2AQHA 4E6PA 1ZK3A 3CZRA 5JDCA 2B5VA 1H6CA 4B7CA 3TFOA 2P5UA 2GN8A 4IZIA 4R4JA 4W99A 2JCYA 3ST7A 2YW9A 3KM0A 3D0OA 1T2DA 5L9AA 4NH4A 3CSDA 5COAA 4BNXA 3ZWVA 3AUAA 5C7OO 3DBHB 3E18A 3U0BA 4BNUA 3BHIA 3GVXA 1SCUA 3M1AA 1YH3A 3RAJA 2D5AA 3GOHA 4M55A 2X5JO 5I7SA 3ADPA 4P22A 1U8FO 2P4HX 1XELA 1KS9A 2FRDA 3QVXA 2YYYA 4A73A 1N9GB 3W6UA 5CEFA 5KKCA 1EZ4A 1DIGA 1VSVA 2RAFA 3WYBA 3LLVA 3FD8A 4BQRA 4HUJA 3H9GA 2JAPA 5DBFA 3VHRA 1Y8QB 5KVSA 4BKUA 4L4XA 4HV4A 4OAQA 3WGHA 3DFUA 2ZTUA 1KEPA 1M67A 1XQ6A 4LRTB 2ZIZA 3PQFA 3STHA 3HWRA 3WSVA 2ZTMA 5IXYA 4IUYA 3V2HA 3KETA 3LVFO 1SZJG 1VE9A 3QWHA 3JD4A 3I4CA 1PS8A 1PU2A 1E1LA 1WWKA 4QECA 3E8XA 4RPGA 3GPIA 2BF7A 2HQ1A 1X7DA 7MDHA 1WMAA 1KEUA 5GZ3A 2O48X 3AU8A 4HXYA 1DC4A 3W8DA 4TVBA 3PJDA 4MIEA 4RLHA 1RJWA 1ID1A 1UP6A 5B1YA 1GPDG 4FC7A 6ADHA 2YFQA 5DDIP 1P0CA 3VDRA 2BFPA 3HDHA 3OA2A 2LDBA 3R1IA 4ZA2A 5G0VA 3DOCA 1HDZA 1DFGA 2CVQA 2Q49A 3AY7A 3F4BA 4G5HA 4C7KA 3LF2A 2O3RA 1H0KA 2RBEA 4JXKA 4LVUA 3KLMX 2NSDA 1H6AA 2EGGA 1JKJA 3CEAA 4TRJA 4ILKA 4CV0A 1GQYA 2DKNA 4W7IA 3DR3A 4A10A 1JA9A 1XU7A 3HNPA 2RHCA 3DZJA 4WK6A 4QSMA 1BVRA 4OKIA 5I9LA 1I32A 3I9JA 2YFHA 1ENZA 3FWZA 4FC6A 5F1PA 2QZ9A 5CPBA 3NAQA 4DXHA 3SX2A 2D2IA 2PV7A 3KYCA 5TQVA 1RM5A 2P9EA 4KUHA 4L73A 3RUIA 1A72A 1LNQA 4D45A 1DFHA 3G49A 4JN6B 4B4VA 4ALMA 3DB2A 3G17A 3IAHA 1UP7A 4I9HA 3TL3A 3PTZA 4XR4A 4CQLA 4E2ZA 2WE7A 1E3WA 3DQPA 1NVGA 1RPNA 2V6FA 3NTOA 2IDZA 1LBEA 5FEUA 4L74A 2Q4BA 4DLLA 2E49A 2GASA 4J4BA 1C0KA 4Q3EA 2NU8A 2X7HA 2CVOA 4J7CA 2DBVO 2YJZA 4K1LA 3QE3A 3DBRB 1E3LA 2QW8A 1IYZA 3WSWA 4XA8A 3RC9A 3RU7A 4BV9A 4BS9A 3I9KA 3VH4A 2W90A 3PFWO 4NG5A 1V0JA 2WYWA 2X0NA 3MTJA 3HDQA 2HKIA 3AWDA 4PLHA 3DMTA 2EP7A 2FPPA 3D4PA 4E5PA 4Z3KA 4J16A 3I9LA 3LC1O 4XGNA 4MIOA 2DAPA 3NT4A 4TROA 1EBUA 4GX0A 4EUHA 2HU2A 2X0RA 1E77A 4IZHA 4BNFA 4EEXA 4UAGA 1LDEA 4BOYA 1H93A 1P0FA 3KYBA 1E92A 3OICA 4PLTA 4CQMB 4URFA 2GZ3A 2Q50A 1I2BA 3E82A 2HSDA 3LC2O 2JD1A 5TIIA 5EERA 1GDHA 5C5IA 3DL2A 4FJ2A 4MINA 3WTCA 1P31A 2Y0CA 5T67A 1JLLA 3VKVA 1JWBB 2FSSA 1U4OA 2ZTVA 3DZIA 3CMCO 5DBGA 5JDIA 4R1NA 2ZKLA 3JQBA 4L8VA 3JQ8A 4LCJA 2B35A 4ESOA 2DUUA 1KVRA 1HLPA 3DZKA 3JQBC 3VH1A 4DQVA 5ICMA 1R0LA 3I5MA 4ZD6A 2VHYA 3OJFA 8ADHA 3BTOA 3GUYA 3VVCA 2G0TA 5TC4A 4FQ8A 3GG2A 4LMPA 1B2LA 4PZDA 3FSRA 1MFZA 4RO0A 1ZFNA 1KC1A 3DBHA 5L3ZA 4YRAA 1RYDA 4C4OA 1ZKMA 2AQKA 3C24A 3QP9A 4MP3A 1NP3A 4BV8A 4OKNA 4P38A 4GMFA 3H9JA 1GQ2A 4XIYA 3C8MA 4XEHA 1Y9EA 2OL4A 1DFIA 3S55A 2O2YA 4NBRA 3ZH2A 1QRRA 3KLPX 1CRWG 4BO7A 1N9GA 1H2HA 1YQXA 2HK8A 2E37A 3PLNA 3D64A 4W9NC 1KOLA 2NTVA 2RCYA 1F17A 2A94A 3HSKA 2CNBA 4OHUA 5B4UA 4XYBA 3WIDA 5BSFA 2NU6A 2VWHA 4LISA 3RC2A 4RDIA 1Y8QA 4B7UA 2Q1WA 2GUGA 3QVWA 4AJPA 4JGBA 2H63A 3Q0EA 3H3JA 1NR1A 1UAGA 4OL9A 1L7EA 3ZI0A 3CMMA 3ZGYA 3BZUA 4YRBA 2ILTA 3F1KA 4LMRA 4L9RA 2UUOA 2VHXA 2ET6A 5AVOA 3RJ9A 3GT0A 3OEWA 3NRCA 1LSUA 4BO6A 5B12A 5A3JA 1P1JA 4FW8A 2NQTA 1J49A 1QV6A 5L40A 4NNJA 4U6QA 1GU7A 1ZNQO 3C7AA 1A71A 2C29D 5A3VA 2Y1DA 1K6IA 3FF4A 1YGYA 1VL6A 2AE2A 5KVQA 1PQWA 4D3DA 1GY8A 4FJ0A 3ROMA 3BMNB 2O7SA 3AUUA 3E1KA 1HZJA 3KTDA 3ZZNA 3JYLA 2VWGA 2Q1SA 1O94A 2W4QA 4BMNA 4E3ZA 3QV1A 3GRKA 2QRKA 4EYEA 3EVNA 1WPQA 2I5PO 3ORFA 2DTEA 1PZFA 3QQPA 1UUFA 5JBIA 1ZJZA 3E5MA 5EIOA 4CMGA 5JAQA 1P77A 1UDCA 3DONA 1PGJA 4R1TA 4TSKA 1FDWA 3D4NA 3DHNA 4L4RA 4Y8VA 4LCEA 4CV3A 1DXYA 2PR2A 1GYQA 2IE0A 1C0PA 1E1NA 3H4VA 1Y5MA 1U7HA 4CL8A 2I99A 3MJVA 4DC0A 2AHRA 4EZBA 1GZ3A 3DBLB 3GGPA 1P1HA 3SEFA 1D3AA 2J5KA 3ROPA 1WMBA 5ICSA 2Q45A 1GQQA 3HN7A 4JBIA 3UN1A 2VHVA 1BXGB 4UVHA 1UH5A 1BGVA 1EFLA 4RVGA 2R2GA 3ZDFA 4RVHA 3WX0A 2C5EA 5LC1A 4IDGA 4NFSA 2PZKA 2Q99A 1WDKA 3TFQA 1CETA 1I3NA 3GG9A 5COQA 5DZSA 1VRWA 4E32A 1YOVB 1I01A 2OOSA 3QWAA 1E3JA 1TLTA 2C5AA 2VHWA 3HZZA 5JMWA 1CERA 3O4RA 1B3BA 2Q46A 4XQCA 1HDYA 3DMYA 1DJQA 9LDTA 4RQTA 3K92A 2OBNA 1UJMA 3ZNOA 4GGOA 3DZFA 3QA9A 2JCVA 1H2BA 4PLVA 3PDJA 3JQGA 3ITDA 1GL3A 3TZKA 3I9MA 1V9LA 3VPHA 5G0UA 4B8ZA 1E7SA 4DBVO 3WICA 2G17A 1M2WA 3GN1A 3WMXA 1KEVA 3W4KA 2YQ4A 1GCUA 1KIFA 4R5HA 3OJ0A 3E48A 3C7CB 3GFGA 2CDAA 1K3TA 4BQPA 3QSGA 5GZ6A 4CQMA 3WDSA 2Q2QA 3P2OA 3LT0A 5JAZA 3MJCA 2HMUA 5BNTA 1DAPA 2NLOA 4BVAA 3BTSA 5DOVA 3ZHXA 3G79A 2B83A 4RF2A 1NHGA 4CJXA 1PWXA 3UKOA 1PL8A 2WM3A 1UZNA 1TXGA 5H82A 5CEEA 1PJTA 1QKIA 1Y9AA 3UCFA 2PK3A 1IL0A 3HE3A 2A4KA 2P2SA 2DBRA 3UXYA 5C7IO 1R4NB 3OIFA 1ISMA 4IBOA 2PZMA 3PPIA 4GPD1 3U4HA 3RUCA 4AL4A 1PIWA 3KSZO 3NTQA 2C07A 1ENPA 2CY0A 3H9QA 4ALIA 1NAIA 2X5OA 2B4QA 4ALLA 2IXBA 3BHMA 1ZSNA 3GHYA 1XR3A 5T6BA 1B7GO 1O6ZA 3L9XA 2I66A 1NQAO 3ZWBA 4RQUA 2HMWA 4IS2A 3GVCA 4Y6SA 4DYVA 4B3JA 3ZN2A 3W4IA 2JFFA 1TEHA 5I7FA 2JD2A 2O3SA 4IDDA 3L4SO 5B4VA 3RC7A 5KNLA 2DPHA 1OAAA 4J49A 1NVMB 4JBHA 1YB1A 1PS9A 3U3XA 4WGGA 2JFHA 3MEQA 2X8LA 5L51A 3PRJA 4J43A 3RUEA 1U3UA 3AOGA 4IPTA 1Y7TA 4BNKA 2FP4A 3IKVA 4PRKA 3VC7A 1MG0A 4RPKA 5DCUA 3OA0A 4ALNA 3BAZA 4OXNA 3P5SA 5LDGA 3ZCXA 1P1KA 4F46A 3JQ9A 4EJ0A 1HL3A 3GFBA 1DSSG 4II3A 3RI3A 3DTYA 1WNTA 1B8PA 4FDAA 4F45A 2ZQYA 1NFFA 4JP3A 1JTVA 1E7YA 1NPDA 2V6MA 4IDAA 3WGQA 4W7HA 3KVOA 3WYCA 3WXBA 4HFNA 3TQHA 1I10A 1V3TA 1DO8A 2VQ3A 4PLGA 2FMUA 2UYYA 1I3LA 2W2LD 4BKQA 1EQUA 3F9IA 1DHTA 2W2LA 3PDUA 2YUTA 4DMMA 5KOIA 3G0OA 3BMNA 1E6EA 1WVGA 4WCFB 1DRUA 5TT0A 1W73A 3GVIA 2J3IA 1XLTA 2BFOA 3N74A 4Z0PA 2VT3A 1PJ2A 2HLPA 1I3KA 3CKYA 3VPFA 1YJQA 4CMIB 4DPLA 5L95A 3DOOA 3JYQA 1Q7CA 3F4LA 4R68A 3JQ6A 4MVJP 3LT4A 3TZ6A 1Y8RB 1SNYA 3M2TA 4I5EA 3FNHA 4NBUA 2ZB4A 3A1NA 2E4AA 3BMQB 4IJUA 3K2BA 3CPSA 1ARZA 1E0DA 4TRRA 2V6GA 3WNVA 2BFAA 3K8ZA 1R0SA 2HJRA 5FI3A 2YQ5A 3H9UA 2UDPA 3WMWA 4A03A 4R54A 2POQX 4CMJA 4ZICA 3DBLA 3IDSA 1YBAA 4CR7A 5A02A 1D7OA 4N7RA 1A4UA 2PD3A 2RH4A 3VZRA 1KBZA 4FJ1A 3PHLA 1LEHA 3H2SA 3GNSA 5COBA 3VZQA 4BGEA 1JAYA 1SAYA 1TT5B 1YVEI 1BXGA 2C0CA 5F1OA 4BNZA 4I5DA 3H5AA 2J3KA 1LLDA 2IZZA 1W0CA 1XIVA 2DT5A 5T5QA 4BO0A 3HFSA 3PLRA 3FTNA 1PZEA 4UUNA 2UV8A 4GWGA 2W2KB 4GGPA 1EE9A 1YOVA 4ZN6A 4CLDA 2Y99A 3RU9A 1D1TA 4Q3BA 5TJ9A 1JDJA 3ONFA 3ETEA 1FDVA 1XHLA 1QYDA 1UAYA 2BGKA 3AU9A 3TL2A 2ZATA 1X14A 4AICA 1IY8A 5BNFA 1TI7A 1AHHA 1JKIA 3L6DA 2FSVA 2X9NA 4BNLA 1N8KA 1GAEO 2NU9A 3DTTA 3OJEA 4M89A 5TRTA 2UVDA 3G1TA 1ADCA 4PG4A 1YKFA 3E6AA 2GNAA 4RCVA 4FOSA 4JNKA 3LSYA 3E9NA 4YJFB 1G0NA 3ANMA 3AW9A 2X6TA 4RVDA 4ZQEA 1NM5A 4U0JA 5K9ZA 1SMKA 2W8ZA 1SBYA 4PG7A 2PD6A 2YZ7A 3GGOA 4U7WA 5U1PA 2D1YA 3GDGA 3FI9A 1YRLA 1L7DA 1CYDA 1PGQA 1CEQA 2Y0EA 2ZCUA 4OIMA 2Q2VA 4WLEA 4FIZA 4EW6A 4DRYA 1ZSYA 1U5CA 1UZMA 4RJTA 3WGTA 3GNQA 3WQSB 4JJFA 1EDOA 1PJ3A 2BI7A 3M2PA 1E3IA 2VHZA 3PEFA 2AE1A 2D8AA 2FY8A 4NPCA 4UVDA 2O3QA 1BDMA 1DLIA 1SC6A 4AJEA 5ILGA 3AUSA 3QJ5A 3V1YA 4N18A 3JQFC 4TMFA 1E1MA 4ITUA 3V8BA 4EI2A 1R4NA 4WNIA 1JU9A 2DTXA 5KCZA 3L4BA 4E5YA 2G5CA 3PI7A 1X7GA 4WEOA 3RUAA 4AJHA 3A4VA 4GX5A 4KDEA 5JXWA 2VNSA 5ER6A 5TNXA 1FDSA 3SVTA 3IJRA 3UCEA 1MG5A 1QXSA 1AE1A 2CZCA 4NFYA 1J6UA 1F06A 1NTOA 2GF2A 5G0WA 2AW5A 4RGBA 3RBZA 2BFMA 3PYMA 2VRBA 1J5PA 3E9MA 4KDFA 4AJ1A 4KTVE 1I2ZA 1Y5RA 3PGJA 3U62A 5F5LA 2F1KA 3Q2IA 3QLJA 3DZHA 3JD2A 5EQDA 1NAHA 3GK3A 3F6YA 3FTPA 5F3RA 4FCCA 3U49A 1T25A 4EGFA 2C20A 1RM3A 5EMHA 5A9TA 2YHUA 1H6BA 3EMKA 3GEMA 4EITA 4DLAA 5FF9A 3AI3A 4ROSA 2IYOA 5J23A 3T7EA 5JFOA 2JJYA 5JDCC 1DB3A 1LC0A 5C3MA 2JAHA 5MDHA 1EK6A 1EUDA 2BGMA 3INGA 1PGNA 2EGHA 3ZV4A 1ZW1A 1VI2A 3WTBA 4AJIA 5EL0A 4CLRB 2PNFA 4UVEA 1GUYA 4Q3DA 4RPHA 8LDHA 4D41A 3C7DB 5IAAA 1B8VA 1M6WA 3IS3A 5T8KA 1B14A 1U2GA 2CDBA 2PWZA 4DIBA 5IFLA 1PGPA 3H6KA 5L4SA 4BUCA 4OH1A 1DEHA 4XYGA 3PXXA 4H7PA 1PZGA 1N7HA 4MKXA 4AJLA 1YDEA 3E5RA 4NBTA 1Q0LA 2NADA 4ZRMA 3QRWA 2X58A 4RF5A 3F46A 1H5QA 4BNWA 1NBOA 4TRNA 1UXIA 4PVCA 4OOEA 4AJ4A 4F6CA 3AUTA 4MVJH 4J7XA 2CDCA 4XYMA 4XJSA 1PZHA 3ZV6A 4RVFA 1GR0A 1VL0A 3D5TA 2OGUA 5MGBA 4WCFA 5DULA 1A9YA 1YL7A 1Z7EA 3PJEA 4CMIA 4MPDA 1PEDA 1EEHA 4DC1A 4E5NA 5A03A 1ORRA 1YL5A 1T26A 4XQEA 5I8ZA 1P1IA 3NUGA 3JYPA 3WWZA 1Y8RA 4JIGA 3NGLA 2QZZA 3RC1A 1RM0A 3BMQA 3I1JA 4F6LA 4K6CA 3PQEA 3VTZA 5IN5A 4YCAA 1GZ4A 4J1TA 5C7LO 4DUPA 2C2XA 3WYEA 2PY6A 2G76A 3MOGA 4MVJI 5JLAA 4IDEA 3EHEA 4XRRA 3T7CA 3I83A 5DP1A 1Q1NA 2JCXA 3GDOA 1HE3A 1UXHA 4TKMA 4UUOA 1AHIA 4GVXA 1U3VA 4GH5A 1TT5A 2B4RO 5L7YA 5BSHA 1W4ZA 1U1IA 2ZYAA 1AXGA 4WECA 3QIVA 3Q9NA 3VVBA 3AOEA 1K6XA 4ZQHA 4YAKA 5DBIA 4K28A 2EF1A 1MLDA 4KZPA 3N58A 4CUZA 5L53A 3U09A 4GL4A 1Q7GA 1SB9A 2W2KA 3TZHA 4ALJA 1EVZA 1HWYA 1PTJA 4A26A 2VOEA 3OJLA 3TF5A 4U5QA 3VKUA 1C1DB 3OECA 1UXGA 3C1AA 2AG8A 4FN4A 2Q1TA 3KYDB 5EN4A 3QVTA 5DP2A 3QY9A 3DXFA 1OFGA 3LF1A 3ONDA 1YO6A 2JD0A 2ZTLA 4YYZA 4WNCA 2I76A 1Q0QA 3FN4A 2J3HA 5KJFA 2PGLA 2R00A 3JSAA 3D4OA 4YJFA 2P5YA 1EQ2A 2C2YA 4H15A 4WLNA 3VH2A 3GZNB 2FR1A 1M76A 2IRWA 4PLZA 4DGSA 4BNMA 4R3WA 1Z6ZA 4EUFA 5AYVA 2Z5LA 4GVLA 4CUJA 4EEZA 5IDXA 2NM0A 1VKOA 1NWHA 3FPLA 4BO5A 4FGWA 1XU9A 4N5NA 1PL6A 1P3DA 2V7PA 1Q7BA 4A2CA 5K1SA 1PR9A 4XKJA 3COSA 1AUPA 3GPDG 3SJ7A 1C14A 3PHJA 5TGDA 1X1EA 2WD8A 3WFIA 2PH5A 4FB5A 1I3MA 1QYCA 4XDYA 3DMTC 4YVFA 3V1UA 1EE2A 1OMOA 3DZGA 5BSGA 4OSPA 3WFJA 1SEVA 4Z0TA 2ZJ1A 2P9CA 3MWEB 3B1FA 4LGVA 3RKRA 4GLOA 3AY3A 1DJNA 2ZB8A 2IODA 4R9RA 4XCVA 4FFNA 5JPIA 3ZU3A 1IULA 1X1TA 2PFGA 2Y1GA 2NQ8A 5CDTA 1HYEA 2D0IA 5A5EA 4PG8A 1JW9B 2PD4A 3JQAB 4L76A 4XZ3A 5LCXA 4OOFA 3K5PA 3TRIA 2I9PA 3I23A 4RF3A 2DFVA 4A5OA 1WZIA 4Z3DA 1U7TA 4HBGA 5KVVA 3WBBA 3GR6A 3EGOA 4NI5A 4J2HA 5JDIC 1A5ZA 1PS0A 5KJCA 1C0IA 2I65A 2NVBA 4TWRA 5TSDA 4MOWA 3H7AA 3WS7A 3ZU5A 3FHLA 4I9UA 2DPGA 3BTUA 4D0SA 2DTDA 1DC5A 4W6ZA 4E5MA 2UAGA 1DIHA 2OFPA 5JAMA 3GGGA 2BGLA 1Y6JA 3W1VA 1R0KA 3GVPA 1NXQA 2J3JA 4GI2A 3BXXA 4CLRA 5U4QA 2W98A 5IF3A 3GH3A 1NPYA 1B26A 5JY6A 1ADFA 3LU1A 2YY7A 4Y6PA 3ZU4A 4KUEA 4ZJUA 4GSLA 5G4LA 2OXIA 1U5AA 2AEFA 1A9ZA 4RF4A 1Y81A 3S2FA 3BMOB 4O63O 4B7XA 2H5LA 4YJGB 2B37A 3A06A 3MJEA 3P7MA 2GERA 4DTIA 1TT7A 3UGKA 2IYPA 2EERA 3JQ7B 1NQOA 2NTNA 4RV9A 1B15A 3RFVA 1H94A 1MFPA 4FFOA 1LDGA 2XXJA 1DRWA 3EK2A 3I9OA 3FPCA 2ZYDA 3R3SA 4GMGA 2BRUA 4YACA 2O4UX 3GLQA 3S2IA 5JYDA 3LZ6A 3BTVA 1VC2A 2IEDA 4OO3A 3MJ4A 1NQTA 4EDFA 2PZLA 2DBZA 3W6ZA 4CMHA 1QLHA 1T2EA 3DAPA 1ONOA 1RKXA 4RZIA 4MVJM 4QFDA 2VUSA 1YE3A 3ZHBA 4NFHA 1KVUA 2VUUA 3NT5A 2Q3EA 3LYLA 2GSDA 4BNYA 5CDUA 2PH3A 1UDAA 4UVGA 5GZ1A 3V2UA 2DU8A 2ZYGA 2HCTA 4YAEA 3K6JA 3NGXA 5JAIA 1ADBA 4WEQA 3OIDA 3W4JA 3P2YA 5A4DA 1ZK1A 4IIVA 1AXEA 5G0SA 4JP2A 4RORA 4NMHA 5AXCA 3M1LA 3FNEA 3HG7A 3KSDO 2Y67A 1E6UA 1MXFA 1Q2XA 1HLDA 2VTDA 4X54A 5GY7A 4ND1A 1ENYA 3Q1LA 2Y1CA 1X15A 2FPIA 1I24A 4GKBA 2Y66A 4NJMB 1WZEA 3HDJA 1C1DA 4CMEA 3NJ4A 4AJOA 2EXXA 3KYDA 4KQWA 4IGEA 3AY6A 4R1UA 4Y67A 2BLLA 4PN3A 2JFGA 4E21A 1GFSA 4CM9D 2ZB3A 2X86A 3RKUA 3TPCA 3WJAA 1YQDA 4LK3A 4IJKA 1A7AA 1ULSA 1Y1PA 3EDMA 2AXQA 3EZLA 4UEKA 4OYRA 4WLUA 3V2GA 2B69A 4D46A 1LDBA 3F1LA 1QR6A 2Y05A 3O9ZA 3HFGA 1BXKA 3OQ6A 2GO1A 1I33A 4YTEA 5ER9A 5DT9A 3NTRA 3GZNA 3KOUA 1EVYA 2B0JA 1LU9A 2D59A 2HMVA 1JWAB 5ENDA 3H3FA 3H8VA 4JLWA 4BNTA 5AQ1A 5CDSA 5JC1A 5ES3A 1N92A 4E2XA 1DIAA 3Q6IA 3DBRA 4N5LA 1ZO8A 1QSGA 3JYNA 4J9VA 4INAA 1CQIA 1B3RA 1EFKA 3SC4A 3ZV5A 3C85A 1BRMA 2GGSA 3I6IA 4PLFA 4QO7A 4XYEA 3DFZA 3ZV3A 1BW9B 2V65A 1Z45A 4R3NA 3OSUA 3JQDA 1T2CA 1YDWA 2VN8A 4XDZA 1LSSA 3HB5X 4YB8A 4H16A 1Z73A 4JX8A 3B1KA 3SLKA 3VZPA 1XQ1A 1LTHR 4PLYA 3U4IA 5KJ6A 1Z75A 4B8WA 1LSOA 1HE4A 1DIRA 1N2SA 1XWFA 4Q39A 4ONEA 3E03A 3FR8A 5ENVA 3S2EA 2ZJ0A 4AVYA 4WASA 3WBFA 4NK5A 3KEQA 1X7HA 5TT1A 4OJNA 2I6TA 5CG1A 2WEKA 4NBWA 1MGOA 3ZWXA 4IGFA 4Z0HO 3B70A 3JQAD 3O03A 5L4LA 3JQCA 3JQAA 3MTGA 1R12A 3ANNA 3X2EA 2QYSA 3D7LA 4WOKA 1RM4A 3KZVA 4MKRA 1V8BA 1E1KA 1FXSA 2GN4A 3EC7A 3H65A 3UFXA 3GMSA 4CM3A 4UEOA 2PA3A 3AI2A 4R51A 1D4FA 4S1VA 1T2AA 3ETDA 1MP0A 3OH8A 2C59A 3RSHA 1PJBA 1VKNA 1A4IA 1HXHA 2WMDA 2GDZA 4U8GA 4HFJA 4PLPA 5FFFA 4EUEA 1YBVA 1R37A 2EJVA 1V6AA 3TZCA 3VDQA 2A9FA 3DO5A 4J91A 1M66A 5THQA 2X0JA 4JJGA 4QXMA 2Q2WA 5TLSA 3ON5A 3BMOA 4ZU3A 1VPDA 2Q4EA 1PQPA 4YJGA 1ISFA 4DQUA 4NU6A 3S8MA 5JC8A 4I8XA 1XGKA 3PP8A 4O5OA 3WLEA 1N1GA 3I6QA 3JQ7A 4PCVA 1PJQA 4J1SA 4GKVA 4MO2A 3D5QA 3KEOA 3AFMA 2EV9A 3IP3A 5T64A 2E82A 2J8ZA 4CLOB 1ZEMA 2P4QA 1P74A 2VZ8A 3GN2A 1LA2A 4DWVA 4KQXA 1OOEA 4Q3AA 3U4DA 1ZVMA 2X0IA 3ASUA 3JQ9C 1JN0A 1NQ5A 1AGNA 2XOXA 3U5TA 3S1LA 3ABIA 4ZRNA 3N7UA 2WSBA 5IZCA 1I36A 1K2WA 3OM9A 4Y98A 3IQDB 4ND2A 4YT2A 2D4AA 3UW3A 2NTJA 4CMAA 3ZU2A 2WYUA 3NJ8A 4E4YA 1SEPA 4YT5A 3UOGA 2FZEA 3MZ0A 4UEJA 2IZ0A 2WWRA 4CODB 3K31A 1Z74A 1B8UA 3FNFA 4D0RA 3QVSA 2VYND 4II2A 4UVIA 4D79A 4DLBA 5JNLA 2VYNA 1XEAA 4LW8A 3HUDA 2BMAA 1IPFA 3NKLA 4TKLA 1X13A 3WR5A 4E0BA 4BO8A 1WAMA 1YB4A 2PTGA 4WJZA 3PIDA 2DLDA 1WDMA 1PJCA 1H9AA 2EWMA 3ONEA 4PIVA 5HRUA 3G1UA 4DPKA 2CUKA 3WG9A 1OC2A 2X5KO 4AJ2A 4EBFA 4J1NA 2J6IA 2FR0A 2P91A 4KP7A 1PWZA 2RIRA 4YJHB 5AXAA 2ZCVA 4BNNA 4NJMA 2HMTA 1HTBA 3K96A 4A7PA 1ZZEA 3TOZA 1HT0A 2DM6A 3KBOA 1OI7A 2OZPA 3GNTA 2AQIA 5DCWA 3LT1A 4CMBA 1LJ8A 4BNHA 4XJTA 2XF8A 3IJPA 1NHWA 5DOZA 4RVSA 3ZWPA 1YQGA 5ILOA 3DOJA 1P1FA 3T4XA 5I8WA 2QYTA 4MP8A 4NU5A 1W6UA 1XKQA 4GBJA 2LDXA 2J5RA 3QWIA 1B16A 2IZ1A 4R69A 3GVHA 1LDYA 3FNGA 1U4SA 3ZHZA 1ONPA 3CH6A 1ISJA 4FOOA 2B5WA 1WDLA 2RHRA 2NVUB 1DIBA 3GDFA 4NDNE 4QUKA 4TVOA 2YV3A 3DHYA 1BW9A 3A14A 1NR7A 4M1QA 3B1JA 4CR6A 5G4KB 2A92A 5THKA 4HNGA 1R6DA 2CD9A 1C1XB 1SOWA 1C0LA 2VZ9A 4WLFA 4HY3A 4K6FA 5IG2A 3HQ4O 1PJLA 3OIGA 3ENKA 3O8QB 3RUHA 3SJUA 4IQ8A 4J0EA 3TOXA 4K9DA 3WOHA 1HSOA 2JHGA 3FRJA 1K5HA 2C82A 3O38A 3RIHA 1FMCA 4CMCA 3PK0A 1E7RA 1DC3A 3VPGA 1HE2A 5JO0A 3EVTA 4BNJA
chains in the Genus database with same CATH superfamily
2H48A 1JZQA 4C43A 3VPXA 1KK3A 3AHEA 5HR5A 5CHEA 3RFTA 2P79A 3W8NA 1VYHA 3HV2A 3AKCA 4E30A 1KNQA 4PZAA 2NO1A 1KFKB 2VTEA 1HEYA 2NO5A 5DWDA 4P5EA 4IH9A 2H6EA 1EU1A 1GV1A 2B8NA 2O20A 3D3WB 3K53A 3ORRA 3KUDA 3MWFA 1PZXA 4HNSA 1BKSB 3O3MB 2IBSA 2NUTA 1ZBQA 2G04A 1LJUA 4MCIA 4UMDA 5EMJA 3FUVA 4YHBA 4ZKEA 1YZQA 5B55A 5JANA 4DMLA 1S1CA 4B3HA 4R5MA 4Q4AB 3AL3A 1TGYA 4HZGA 2ZIEA 4MX8A 1H5NA 4ZVMA 5LP6B 1DAIA 4ZANA 2HIHA 4MWEA 1HFJA 1A2KC 4UCWA 1N78A 1KSHA 2PLFA 2D0OB 3ZK7A 4Z6KA 1VJ1A 5D3KA 2ZYTX 3NEPX 4O2AB 2HGZA 1JR6A 5FL7A 3MD9A 3GBPA 4C78A 2NXCA 4L8YA 1FVXA 3A10A 1C3OA 3UVEA 5LYJB 3DMPA 3ED5A 3UJDA 3NM6B 4LGCA 4D9MA 4YUZA 2Z2JA 2EFEB 4RULA 3PRYA 3Q3IA 4RMGA 1J2UA 1GGHA 1JA0A 2HXGA 4ODIA 4PZCA 5CAEB 4DIOA 5BUZA 4UTRA 1PVDA 4P3YA 3GA5A 5TEVA 4D8UA 3B9RA 3ZVNA 1V4BA 5CW1A 2F43B 3A9UA 1XTZA 4G8CA 2HA2A 4X1IA 2FP3A 4ESEA 2B61A 1FA9A 2JFWA 2ISCA 3M6IA 3F98A 3GCZA 1T4DA 4UM7A 1M8KA 3RTDA 3AKDA 1LI4A 2CD7A 2XLCA 3SYLA 4JZKA 4YH1A 2V1UA 1O77A 1UIMA 4YCDA 1U2GC 4HDMB 5REQA 4QIHA 1L0BA 1O08A 4CFSA 5DI3B 2FXVA 2G9QA 3GZ4A 5F21A 4KIUA 4B6FA 3KLBA 3A1EA 4ZI7F 1F8FA 3I12A 2HLNA 2BJWA 1D2EA 1EZZA 4RDHA 3IVRA 1JXOA 1YRYE 4EI9A 3C6ZA 3PDIA 5AK4A 1ZIPA 3OKAA 1XNGA 2FPGA 4GOKA 4IJWA 3R3VA 4Y1RA 4MRMB 5HX7A 2B4YA 4CM6A 2PLWA 3CPJB 4H4DA 2IYZA 1ZI8A 6CHYA 4J0QA 5EHXA 3F4KA 1MGPA 2DPXA 3ZI7A 1CHNA 3E58A 1CUZA 3C3CA 3C5WP 4F97A 4HC4A 3Q8KA 4EDHA 4NE7A 4NXNB 2O8FA 1B74A 3H6HA 4Z4GA 1ZGBA 1BKDR 3JAWA 4ARZB 5EKTA 3NYWA 1WUJS 4BZQA 2SCUA 2ZIVB 1EE1A 5KQLA 3TNFA 1DU4A 4HN9A 1U0RA 2BELA 2VSYA 1KZ6A 2XE4A 1SM4A 3VMMA 4AUMA 4Z4FA 1UK8A 4MCJA 1YVPA 2DEUA 1S2DA 3SJZA 4A6XA 2NACA 1G6OA 2X9VA 4HDKB 2JHFA 3IVAA 2ZJZA 2E6UX 3ND9A 4IEFB 4RH0A 1JH8A 4P80A 1CVLA 4XB2A 1WD5A 2JGIA 3FYCA 1SKAA 3PHBE 4ZT5A 3OLWA 4NATA 3DCNA 4N8SA 1E2DA 2CCKA 3PPXA 4B79A 3MHTA 1CIVA 5K6AC 2OD7A 1B00A 3X43A 3QX7A 1QGDA 2IJGX 2CYAA 2B78A 2X4GA 2X4IA 3IKMB 3DLIA 4QQRA 3WMFA 2AKAB 3VR2A 1I94B 2VHJA 2VZ0A 3O4IA 5A9SB 2AK2A 4RJJA 5J4KA 2F59A 1CBUA 4G1VA 3AT1A 3VU8A 3VYUB 3L4JA 2J5XA 1HORA 3MTEA 4ID9A 4OMCA 1CR2A 3HCCA 1NXOA 2RK4A 3CZ4A 4BAZA 4PYQA 1DKMA 1B43A 2WICA 1U9IC 1N6RA 1HNNA 1BQEA 1PV1A 1IHPA 3KXKA 1X80A 2Y76A 4RMNA 3VPAA 1D2RA 1ZG3A 2C8LA 4OXRA 4B09A 4X1KA 1ZCJA 3OZRA 5C1DA 2IEYA 2D2XA 2L2QA 4M2LA 5CP8A 1U3TA 4KBGA 2EEZA 2CF6A 1Q22A 4E15A 3NVAA 2XYRA 3TXYA 3ELWA 5AW2A 1YR8A 1D7AA 2I3GA 4RS3A 3UZUA 4WMLA 1FFCA 3V5NA 1I5OA 4B48A 2Q5QA 3FZEA 1PJSA 3GU3A 2IDMA 1QHSA 4S2UA 1JSXA 1PR6A 1PNOA 3GFVA 4RPIA 4LYGA 2YVAA 2YWGA 4LQ4A 3OHMA 1Q0SA 2XKJE 1AKEA 1Q16A 3RTCA 3FTEA 1JVBA 3GEDA 2RHWA 4KQ9A 4DDUA 1ODIA 1HDRA 3MOIA 3NWJA 2QLTA 2QMYA 3SFTA 5DW0A 3RQSA 1YZNA 1CVIA 1ZCBA 5DRTA 4FFMA 5H81A 4ABYA 3UJCA 1ZIDA 2J5QA 1JJIA 1XQXA 2C4HA 2VDRB 4IQGA 4BL5A 2R1UA 1BE0A 4OATA 2SKCA 1EXVA 2MSEB 4BQOA 3PUVA 3NC4A 4Z0NA 1K7SN 4HDQB 5CNKA 4BTVA 4S2EA 4OU5A 2GXUA 4U7GA 5DISB 3WRXC 1FDTA 1SJ9A 3ZBPA 3ZE7A 3ZD9A 4HAVA 4R0VA 1QORA 5BVGB 1EBFA 4EUSA 2PKQO 3T0FA 4BB9A 3TLBA 5C1OA 4GE3A 4FTWA 5LDHA 1SD5A 4PIMA 2FXIA 1OASA 1YZFA 1EMDA 3WJ7A 1D6JA 4YQFA 4D3SA 3U3OA 3V8EA 5TJHA 3G8YA 1VKZA 4EGCB 1JLKA 1RXEA 4QARA 2EATA 3CEPB 4FSHA 3SQOA 4FYHA 1LQTA 1NTRA 5B2EA 1VE6A 3TW8A 3JQGB 4J1QA 3U1VA 1HYHA 1SB8A 2DHCA 3AUXA 2VF5X 1MQSA 4G4SP 2GJ4A 3ESRA 4INPA 1B0AA 5CYOA 5LKRA 1CUUA 5LZ2A 1Q0ZA 2BHLA 2P68A 2Z5FA 1P2UA 5JYEA 2IELA 4KL8S 4RVUA 2HM7A 2VJMA 4AQYB 2JI8A 1GAQA 4JLSA 4RVOA 2QR2A 1R6VA 5F1KA 1DEAA 1NVUQ 2IYNA 3HKEB 5CDGA 1CUDA 3OQOA 4MEAA 4OQYA 5DBOA 1F8UA 3EBPA 1Z15A 4JQYA 4ZO6A 2GN2A 1PDWA 1ICIA 2C2BA 2RG1A 4HZIA 1SIBE 3VKUA 4MV6A 4YJDA 1UBTS 1ZICA 4LPKA 1KQPA 4XSHA 2J6CA 2O05A 3AH8A 3P0HA 1M2OA 2J59A 4LJYA 3X2SA 4CWAA 2ZUCA 3RAEC 1V43A 2H9IA 2X19A 4KO8A 3HJHA 2C9MA 4DT1B 3B1XA 1BU5A 4OGFA 4PVDA 5CRIA 3ANYB 3FBWA 5IM4A 4NARA 1LK0A 2JAUA 2OZLA 3E81A 2GCOA 1EX1A 3GJ3A 4OMUA 3LT5A 4P35A 2FW0A 4O3MA 4LRSB 3ISJA 1Z6XA 4KFTA 5G53C 2RHJA 3ZCSA 2X7JA 3O8RA 4ZT2A 3SXJA 2TMGA 1QG4A 1W34A 1ZCFA 2VWQA 3QVJA 4LX8A 3WB1A 9ATCA 1E62A 4HLUA 3BS4A 5HM6A 2P9GA 5IJWA 4H6VA 2AMFA 4IIXA 4EG7A 2PBFA 1OWNA 3A6HA 3HYNA 2XHEA 4ILEA 5FIUA 3FHTA 4R9UC 2J9RA 2VK8A 4OJYA 4BBJA 3GLGB 4QUHA 3PD7A 4US0R 4IHAA 4E2WA 4BN4A 2HSJA 4MKHA 2OHXA 5H3HA 3F8TA 1BX1A 3NMUF 4OGKA 3V4VB 1O7JA 1OX4A 1E1DA 5FJJA 2W5UA 3KOXA 5F3DA 2A0XA 4N3GA 1P7YA 5KNCH 1KEEA 3M9XA 3C5EA 3DCYA 4ZTBA 1XHFA 4TGLA 2QG6A 1ZD3A 3V48A 5LQUA 1H3NA 4UE6A 4NICA 1ISRA 3ZE1B 5GIPE 3D7SA 5CB6A 2GVZC 1LXCA 2FOIA 4Z8YA 2CVHA 1MQAA 4P9NA 1PL7A 4U8HA 4BO1A 5K09A 1JQLB 4HD8A 2X23A 2XRFA 3GP5A 4CNBA 3C87A 4XVQA 4WN9A 1MRNA 5SZJA 2WF6A 5KOJA 4DR7B 1F12A 1GYRA 3JYHA 3R5TA 3ADDA 1Z26A 2WFLB 2J85A 3HCFA 1NVEA 1ML3A 5KYKA 4QGAA 1HFWA 1KRXA 1Z7GA 1QK3A 1V95A 2MSKA 3ROQA 3IUPA 4HJRA 2FZWA 2OTCA 4ZK6A 1M34B 3KFXA 2UYQA 2CLIB 4RIFA 4YIKA 2OPBA 3HGTA 4GF5A 4H4CA 5AUQA 5CXUA 2ZROA 1A88A 3I2HA 3ZWNA 1VMEA 1F4PA 2QMZA 1XZFA 3WAJA 1I5EA 1YULA 3OLYA 4ESHA 5CB0A 1AQLA 1DTSA 3THOA 5ITWA 1R6XA 2FPKA 3CKMA 4LXUA 1T6YA 5G0TA 1GNTA 3KRTA 3OCJA 5CX1A 3PF8A 4Y1FA 1DE0A 2OGWA 4L3WA 2HOQA 3NBYC 5TV2A 1A8IA 4MLPA 4LVCA 4C7MA 3X3HA 5SYAA 1SPBS 3I53A 3RQIA 1V1RA 4QYIA 1WBDA 4TLLB 1G7RA 4D81A 1CT9A 1LSJA 4YI3A 1KZHA 3S5JA 5CPFA 4BKPA 1E2QA 5D3MA 3P19A 1NNEA 3EXEB 2BGUA 5JVDA 1MU0A 4DA9A 4Q4JA 4RK6A 4EGQA 1MJNA 1L7NA 3HPQA 1UK6A 2D6FA 1LS6A 3OQ1A 2WJPA 5ICFA 1JHYA 1KKLA 4LNUB 4OQDA 4DC9A 1KP9A 3ZGNA 5EWMB 1W46A 3DBIA 3VAAA 1O0SA 1F1JA 1JMVA 3O8OB 4RACA 3UMCA 4G25A 2W71A 2VS1A 4U2GA 4TKVA 4H3VA 4B4WA 2H51A 4FFVA 4UQLA 4JASB 3GZJA 2PZGA 3L9WA 1F0YA 2GAIA 2OUIA 2GPTA 2ZPUA 2GETA 4HMPA 4R2JA 3I64A 4CTNA 1IHUA 3OEHA 3OFNA 3SJCA 4B8YA 3NWEA 5B6PA 1KXZA 2Q3CA 2IYWA 1DX9A 1V11A 2FPLA 2ZWPA 1PFKA 3RAGA 1FLDA 4BNVA 5CJPA 1ZMOA 4IQ0A 4C4RA 1BYIA 1RQGA 3W1EA 2WAMA 5L3QA 3N0VA 1C1HA 2QTZA 2MYNA 2CSUA 2A84A 4GVPA 4UBNA 2C4TA 2YX1A 5TMPA 1FFDA 1R9MA 3IVXA 4GE0A 2I0FA 1CZRA 2PX5A 3EGXB 2XD4A 1SOUA 5AJVB 5KKAA 2E18A 2JLZA 5HJEA 3QEBZ 5I7WA 4H4EA 3I28A 5HUHA 1NRJB 1UFQA 2PAFA 1JQAA 2WFAA 4LV6A 4M36A 4UBOA 4AJJA 4RTKA 1LDNA 4FPXA 4QTTB 5CYGA 1GUFA 3ZD8A 4MV1A 1HC7A 3FR7A 4FEGA 4JLUA 4LF9B 2X8JB 4PHGA 3YASA 1BS1A 4HNUA 4D9JA 1NUSA 2RKBA 1MX3A 3C1OA 3FFXA 3A3YA 4QNRA 4CM7A 4RLSA 3S44A 1P8AA 4FE7A 1YHYA 3I4FA 3IEPA 4YRIA 2ZRPA 4AZSA 2FG7C 2GKGA 1G8JA 2F3RA 3SYMA 2AUTA 2YXNA 3M6XA 1MORA 2AZMA 3DGFC 1FW8A 3G2KA 3TI9A 6REQB 4OX9Y 5IKMA 1TQ6A 3RPEA 1RWQA 1Z0IA 2JEOA 4EJ6A 5CFZA 1ISHA 2VNHA 3D3JA 2LE0A 2XQFA 5BRNA 1SVOA 2JLQA 4XQGA 2VRCD 4FR0A 5FLEX 1C7JA 1MTOA 3IERA 4M86A 2CYCA 4CQMD 1JHAA 1U6KA 4R7TA 4WK4B 4D44A 2OE2A 3RFXA 1T0IA 2PEZA 4OUDB 2VSNA 2C99A 4G0WA 1MO6A 2WTBA 1R4MB 3DNFA 5G2OA 4RTMA 1HRDA 1T24A 4RTPA 3GQBA 1JR2A 3IPRA 2VOJA 4IV8A 4YAGA 3QHPA 5K0NA 3ZLBA 5L7TA 1SVLA 2RMKA 3BGOS 4ZQFA 2FF7A 4YDRA 3FOBA 4GD3Q 4OI4A 7ADHA 3FX2A 5AW9A 3VO8A 2GBFA 2PVCA 3AG5A 1Z2OX 1HKUA 4EVQA 1PV2A 1CUEA 1Y3FE 4OQFA 4AX8A 2ENWA 3V55A 2O19A 4RKQA 4WCVA 4BJHB 2I3DA 1XWIA 5C51B 1EK5A 4DMKA 3J7TA 1R9GA 1A5TA 2VCYA 2WWGA 4N0EA 4RIHA 5KTKA 3L8MA 2G5TA 2YQZA 1O95D 3ZY3A 2QL9A 1NYQA 1N7GA 2JFPA 2QI9F 2YXBA 3PGLA 1FTSA 4MKZA 4RZ2A 1NMEA 4YREA 1IH8A 2OYSA 4UHDA 1DI0A 4FHZA 4KODA 3TRJA 1AH2A 4BB5A 2X3FA 3FCAA 1HDOA 3GAAA 4PFKA 2WT9A 1K27A 4GYYA 3WRVA 5LSAA 3WLFA 1JG3A 5M5BA 2BH9A 2HPVA 2W6NA 1IEQA 3RU3A 3V8VA 1SHKA 2BEWB 3GRUA 3RGGA 4Z54A 1YE8A 2QRQA 3HNRA 2IV3A 4BLUA 1JR3E 2R5FA 2JKVA 2Z1DA 4PZ9A 4ZV9A 3UAYA 1FUEA 1ZJWA 2X8AA 4BX0A 2DPLA 3CNNA 1GPBA 4WVLA 4BGVA 4HPJB 1OAOC 2EIHA 4EJMA 1VHLA 3KB2A 3H7IA 3OTGA 5U9CA 1DHRA 1XG5A 1KY4A 4FFDA 5A4MS 3THYB 1MCZA 3CTMA 3MYRA 2YR0A 2F62A 3NH9A 5EPOA 2YDXA 3BYZA 1G42A 1DCFA 1DKPA 1Q77A 2FFRA 2Q62A 2WJHA 1BRTA 4RZQA 5H16A 4DG9A 3F5MA 1IUPA 1Z7BA 3BWMA 1XZ8A 1XP5A 2FK8A 2Z2KA 1FS6A 3AF4A 3D0KA 3HADA 3FSJX 1G98A 3LLCA 2DHEA 4GX1A 4Q02A 3FPAA 2MDTA 5IS2A 4I14A 3PXCX 4ZQGA 1JH9A 3CR3C 1IXKA 3FHJA 4HADA 4KPGA 3EGEA 5DCYA 3IOCA 5LQAA 3RBAA 5IM5A 4DYHA 2VUTA 2VJKA 4O4HF 5FWAA 2V7UA 5G40A 5B7NA 4X3OA 3F8WA 1ZK0A 2A35A 5IEBA 4KR2A 5K3BA 4IJQA 4D7AA 5IJ9A 5AI9A 2AQ8A 2KX7A 2HUNA 4TTVA 2FCAA 3V4OA 4BMVA 1ODKA 3DV0A 2C2KA 2I2DA 1XCJA 9MHTA 1ULHA 1E69A 2QM0A 5TX7A 4CUKA 1ZR4A 2F2TA 5TGTA 3IMFA 4H18A 4TT8A 3S7TA 4LY3A 4B4OA 2VA8A 3VNAA 1U8XX 2G70A 1KWGA 3JD0A 1AQIA 1UJCA 5J5CA 1QDLB 3NKVA 3R3UA 4DVJA 3IAM1 1RQNA 3QH4A 3UHAA 2DUWA 4X93A 3F5QA 2NV6A 4UNRA 1AF4A 4X6XA 2ES4A 1XTRA 4WKGA 2HDHA 4I81A 4NU8X 1G0OA 1C3VA 1WF3A 1NXPA 3GT7A 4AMVA 1QG2A 5CJJA 3R44A 3LCRA 2YIVX 4E4RA 1LY1A 2C7QA 2XDYA 4LC1A 4J8PA 5E7MA 4P4SB 3WYNA 5JI3E 5BWOA 1O89A 3URKA 3L01A 4D8WA 1ZHHA 3PC4A 2JJ2D 1J2JA 1GUZA 2H18A 4G8BA 2WU1A 1RRPA 2ZSIA 2IBMA 1TD1A 4RK7A 5A2GA 1G2PA 2F9LA 1N5JA 5EESA 1U1EA 4B7AA 3N8NA 1JPUA 1FUYB 4XYLA 1DX4A 1V1MB 1HNZB 2R65A 1RYZA 1KJWA 4IIBA 1S96A 2Q6VA 2BMFA 5HDBB 3A1VA 1BVYF 1G8KA 5KQPA 3LY8A 4LSWA 3EMVA 1UAAA 1GZ7A 1L4KA 4MRNA 1NASA 2WABA 2HMAA 1LRJA 1L5MA 3U3JA 1QQ5A 3HP4A 1YBMA 3BJZA 2XH8A 2JK1A 1N3LA 1OZAA 1RPTA 3EIFA 3HWX1 5DX8A 1TMOA 4Y6GB 5NLLA 2WY2D 2VYQA 4IHJF 5JMOA 4HMQA 2XTZA 3TZQA 2CLEB 1HE5A 1T1RA 4MQ6A 1OBOA 1C9YA 3WRWA 3WQQA 4JELA 1FFYA 3NTXA 1KZGB 3QW2A 4GQAA 1HY3A 2X9LA 1IM2A 1K4YA 5F5NA 3RTAA 4H27A 3TTUA 4H7JA 1GFIA 2ZE7A 4KV9A 3TR0A 3TSWA 4B75A 1A7JA 1BYUA 1E5QA 1NUQA 1O9HA 1V9SA 2V6BA 3CPHA 1JIQA 1DUSA 4GC9A 1ULBA 4Z9YA 3GA0A 3USZA 2DC1A 2C7GA 3SBOA 1CUJA 1AVTA 5H9VA 4QEKA 1D2AA 3BK2A 5CA1F 3LKBA 2QSZA 1OQAA 1Z4MA 1JQBA 2PJZA 4V39A 4M8SA 3SHFA 4DDVA 2CMKA 5JJ5A 1CP2A 1S3IA 3L6EA 4RTLA 3HJAA 4N82A 2ASEA 4KE8A 1Z0AA 1O5IA 5BT9A 4ENTA 3KYCB 4FU0A 4IDCA 5JZOA 5IDWA 2A7QA 3MUOA 3V8NA 1AMUA 3K71B 4NK4A 1P91A 3LW8A 2CUZA 4KDRA 4Q9KA 1YONA 4ZI3A 1DVRA 1GL7A 2P9BA 3VO9A 1NVVR 3OJOA 1E3EA 3N2LA 1ZK2A 3WGZA 5B5SA 1YIAA 2PGAA 2PLAA 4HHEA 5DE3A 3S2YA 4XUGB 4DUZB 4PYIA 1IOLA 2O50A 3IUSA 4U6SA 4HFRA 5LYYA 2DFLA 1K6MA 1K0UA 2WIFA 3AIMA 4YAUA 1YB2A 3DOEA 4Q19A 1AURA 3SLGA 1SR8A 5DNWA 1GCOA 2VBIA 3CZMA 2FF5A 3AR3A 4ZOLA 1X1RA 4J7UA 1L4UA 3VH3A 2G40A 1AU9A 2J3EA 1JSRA 3DV9A 3WGJA 3A7EA 4GU5A 4D4GA 1QIKA 1NBWB 1SCNE 5ALTA 3BSFA 2NQ2C 2HDNB 4FOLA 3RUFA 3UF0A 1SXQA 5C9ZA 2EKPA 1K88A 4C88A 2ODTX 4E33A 2Y92A 3GP3A 2CNDA 3PNLA 1KI6B 9GPBA 5J2TA 5DGHA 1A9TA 1IM5A 2FPPB 2KS6A 1GADO 4EHHA 2F00A 3E2IA 4Q3NA 3JV7A 1ZGAA 2AOUA 3VJMA 4D02A 1Z06A 2NNLD 3QE4A 3U6KA 2X4DA 3KPYA 4Q5IA 2V7XA 1UJ2A 1X1QA 4FEEA 4F5WA 3IKTA 3BRCA 1GEEA 3DL4A 2GZSA 3BHNA 3OQHA 4FZJA 5L3SB 2XBLA 3X1ZA 2BYTA 1KAEA 1HTTA 3U3ZA 2GPYA 3IIKA 4PLCA 2FZKA 1CQJA 1UMBB 5IU6A 3DT6A 2V9PA 1T5BA 1W9HA 4MUYA 3CVYA 2EJBA 3EFBA 1TO1E 2PL5A 3FYHA 1VZ3A 1KETA 4LSMA 5FNZA 2EVWX 1F14A 4W5NA 1Y1LA 1XRMA 5I7VA 5JY1A 1UPTA 2E89A 1CUXA 3H97A 3M81A 4HGRA 4B3GA 3DT9A 4G5XA 2KW5A 3PQ7A 1M1NA 1FQJA 1AUVA 1KC3A 2I6GA 1E2BA 3DPSA 3OFSA 1NUPA 2FLVA 3KQSA 1P33A 3QG5A 1SIWA 4EF5A 3G5LA 4FFPA 1IUNA 2ZRCA 1L1RA 2IXFA 3KSRA 4ND4A 3CJRA 4OHWA 1DAFA 1ZC3A 1HA3A 2I03A 3IP5A 3MINB 3PUKA 4FN5A 4PICA 4E6PA 1FJGB 2LKCA 1Y48E 4RTQA 5JDCA 3TFOA 3KBBA 2WA1A 4IZIA 4W99A 1YZUA 2JCYA 4ZHQF 3QOYA 3HLKA 3D0OA 2O8CB 3CJQA 4KXXA 2TECE 4BNXA 3QF4A 1PK9A 5JH7B 1U2SA 5C7OO 4UHCA 3U0BA 1WV0A 1JE0A 4XPZA 2ZW9A 4BNUA 1JKXA 2PGNA 3W5AA 4QDJA 4PANA 2BSQA 3V33A 3M1AA 3NORA 5ABPA 4EPYA 1WZCA 2QU8A 3GOHA 5CURA 2GZMA 1HYBA 5I7SA 3K0EA 1F4VA 1JR3A 1U8FO 3KYJB 4P22A 3AHDA 4JYMA 1RRGA 1PUJA 1L8XA 2E4XA 3Q87B 4O2BB 5E4TA 3OTOB 3L4EA 5INTA 1JFRA 1DIGA 1H4VB 1NZJA 1VSVA 4FI3F 2GAOA 3WYBA 1OIWA 3LLVA 4I4LA 2V97A 3CXUA 4WACA 5FORA 3CCCA 4G2TA 4WOPA 3UV7A 1NMXA 4A92A 5AHXA 5IH3A 3A7DA 4H0NA 5A2QA 5JCOC 4OAQA 2AOWA 4Q7JB 4A36A 2BM8A 2DWPA 4M53A 3EIHA 3FMPB 4TV8A 2VSXA 3V9AA 1PKXA 2ZIZA 3EGWA 2JAXA 2DCMA 3AWIA 3N5KA 4QXAA 2WT4A 3A1SA 1R8JA 4DW8A 1YIDA 4RM2A 4U63A 4QOGA 2O1SA 1PS8A 2R86A 3IKJA 2CB9A 2J9GA 2OAP1 2YZNA 2SBTA 3IDFA 4QUEA 4ZVSA 1Z8FA 5DM60 1PLLA 3VV3A 2V3VA 4GPBA 2VF7A 3AEXA 1RRVA 3DW1X 4TMVA 3KSAC 3KZXA 1QCDA 3WMEA 3WLNA 3ZD6A 2BF7A 3PX7A 2HQ1A 2OK8A 3MGBA 3W90A 2MSCB 2Q27A 4QUIA 2O48X 5DWQA 4OKSA 4I19A 3PPVA 5DXFA 4TVBA 1U2RA 1X7ZA 3PJDA 2W2PA 1ID1A 4FGLA 2WU8A 5B1YA 4OA8A 1YMQA 4A8JB 1OY1A 2BM1A 3R77A 2G8NA 4EW3A 2YFQA 4LNAA 4Q9IA 2UZ1B 3VDRA 4L28A 4Q03A 1QHNA 5EJEA 3HDHA 1C41A 3OX1A 2LDBA 3R1IA 1YASA 3N0WA 1TCAA 5AICA 3PUXA 4JVSB 3M6VA 2CVQA 4TXNA 3FWKA 3D6HA 3LHIA 4C7KA 2JG3A 2O3RA 2HBQA 2RBEA 3Q3EA 2QJWA 2EJCA 4BC0A 1M6EX 2EGGA 1ZM9A 1IG3A 3NRBA 5BY2A 5KDLA 4H7IA 2CXQA 3O92A 3WWPA 1T5DX 4BUZA 1GQYA 3V8MA 2DR0A 3HH8A 1XU7A 3WL5A 4F6RA 1OYOA 3EDOA 2IWHA 3PGMA 1DAKA 4GOJA 3HXOA 4I55F 4JJ4A 4RTNA 1CIJA 1KO1A 4YQEA 1ACJA 3L7OA 1MB2A 5ICSA 5TQJA 4INZA 2Q6LA 3FJYA 4P0TA 1G64A 2QZ9A 5F1PA 3SS7X 2YBDA 3SX2A 4BQEA 3KZCA 4U39A 5TQVA 4MHOA 1RM5A 1SOAA 4L73A 1OFTA 2AFVA 2XNHA 3MT7A 1DFHA 3IFSA 4M0MA 4JN6B 4I9GA 4B4VA 1YU9A 4V1CI 5CDHA 1C0EA 1RAGA 3UK0A 1TAGA 1UP7A 3H1PA 3IAHA 3PTZA 2CB0A 4BMZA 3DVRX 3L0PA 4C2TA 5MHTA 1UMCB 1OXSC 2P0AA 2YMPA 1NVGA 2VEDA 3MCUA 4LBYA 5A6SB 3SIWA 1P1BA 1TKRA 1RPNA 3ZEAA 3UTDA 2VUIB 3DNMA 3GLTA 3HYSA 2V9CA 3KWFA 4N6GA 3D6FA 4G4IA 4NTZA 3SQXA 1X1AA 2NU8A 2A5LA 5ESWA 4J7CA 4YRGA 4QUGA 2WM2A 1HUQA 4M9ZA 3TLZA 1Y89A 3CUUA 3BH6A 1OX5A 5CFRA 2IU3A 2C2OA 1E3LA 5JV5A 2B82A 1BCSA 3T3MB 4BS9A 3Q8MA 3RC9A 1T0JB 3PFWO 4G0QA 1FU7A 4WT7A 1V0JA 2X0NA 1U02A 2JKYA 2QQGA 3DZ8A 3CF2A 3MTJA 4PLHA 4K9LA 5LL6P 2WWYA 2GHRA 4EF4A 4Z3KA 5TMDA 221PA 5CTAA 4L95C 2FUEA 3OFVA 4J16A 4TV9B 1N5KA 3RSZA 2NX2A 1K68A 3OY7A 5CH8A 3LJKA 3NRJA 2ZT5A 2CVFA 1N2IA 1AZTA 4ZCTA 1BMQA 4TROA 3SFZA 1OZHA 3H11A 4DLPA 1VA5A 5K0LA 1H93A 1P0FA 3KYBA 4TS4A 4PLTA 5KTSA 2EARA 3LA8A 1WCV1 4URFA 2QW1A 4S1TA 3S8EA 2Q50A 2EFYA 3E82A 3EULA 5AK6A 2O5RA 2OV2A 3LC2O 3PUZA 4GI1A 3RREA 4CEHA 1GDHA 3BXOA 4R81A 5BMVF 2HXYA 4FJ2A 2OV6A 4MINA 3WTCA 4JODA 1ZGGA 5ALDA 2WSLA 3HBAA 4KQ1A 1EK0A 5K3OA 5KB3A 1L4LA 3W5IA 2B99A 2ZTVA 3TAUA 4TWBA 1Y42X 4JB2A 1U9CA 3COVA 4NOMA 4R1NA 3W6OA 5HMMA 3JQ8A 3EJWA 4IF6A 2B35A 3TTSA 3DZKA 1HLPA 3VH1A 5ICMA 1QQAA 3VZCA 3UBTA 1WSBA 2MTBA 3I5MA 2VHYA 4A2QA 3BTOA 3GUYA 2G0TA 4L50A 5DSZA 1QHIA 3RRYA 4HLUC 1CQWA 2PWAA 5ALOA 5CHYA 3C4JA 1XTTA 3DLTA 4WINA 4AZVA 2OECA 5KNCA 2VP2A 2RC5A 3P32A 2IDJA 2VRNA 1QQ7A 2B30A 2NTYC 5B6IA 1RYDA 3NEJA 5IC6A 4BFWA 3OUZA 3GLVA 4BV8A 2VA9A 1DRJA 1NP3A 2B9EA 4MP3A 4RD1A 5IBRA 5IJ0B 2AWOA 4G1BA 1GQ2A 4XIYA 3KQLA 2VYFA 2P9YA 2R7MA 2OL4A 1DFIA 5CNMA 5D7BA 1QRRA 2XTJA 1B8NA 3UFBA 3KLPX 1CRWG 1CJTC 4FZRA 4QVGA 1UEIA 4BO7A 3R74A 8AT1A 4RD2A 3UT5B 5F2NA 1VYUA 1KOLA 4C01A 2QMUA 3H83A 2E7ZA 1NVFA 4N12A 4TYYA 1Y3DE 4XYBA 3T1NA 5BSFA 1E79A 3QJGA 3FGNA 3OE4A 1Q84A 2A78A 3GJ7A 3QVWA 3UGQA 4JGBA 1L7XA 4F71A 3G0HA 4BE7B 5ALQA 3H3JA 1RC8A 2AOXA 4G8JA 4RS4A 1L7EA 2RHLA 2UUBB 3HZOA 2QRGA 3HUEA 1PJZA 2YV4A 2XYQA 1PLJA 4ZCQA 1MOZA 4BEVA 2QK4A 3UKDA 2ET6A 3RJ9A 2VDQB 4XE5A 5DU2A 3SZUA 5BR4A 5EIBD 4NZOA 5LJLA 3B6MA 1AA6A 3C15C 1KMCA 1VE3A 1IQ0A 3O8NA 1FP4B 1J49A 4F3TA 1W5FA 1XDUA 5CB8A 2PSDA 5M2QA 1KOFA 5LA6B 5C5DA 4ZO9A 4IX9A 3MPOA 4S0ZA 5FTKA 1HT1E 2KB0A 3KLOA 1ZNQO 4V24A 4WXEA 4CU2A 3ZKWA 3S2ZA 4C0QC 1Y5NA 4KWEA 4C5AA 2AJLI 1QH0A 4KXLA 3DMNA 2OCAA 3UAOA 3N7TA 1F9EA 5A3VA 1K8YB 1YGYA 2AE2A 4Y7CA 4AMYA 3O84A 4ND6A 1PQWA 3ZTYA 3ZXSA 5C8YB 1GY8A 2RGNC 3QUSA 3BMNB 3ROMA 4DS3A 1JFFA 1KAMA 1W87A 3AUUA 3E1KA 1HZJA 4MPPA 5KCMA 4DRZA 2QNIA 2VWGA 1JEOA 2OHHA 1ESDA 2P2NA 4B9EA 3P26A 1PFWA 4HAOA 5ALZA 5BW5A 4EKNB 3IMKA 4GGMX 4EYEA 3GV0A 2I5PO 4IDHA 3ORFA 1JIUA 2DTEA 1RJEA 4DAOA 3LUKA 4ZI2A 1GG9A 2BL4A 5JBIA 1SXJA 1ZJZA 5EIOA 3ZY5A 2MWMA 4BYGA 4Y9SA 1CZNA 1P77A 3DONA 3W9SA 1PGJA 4AS3A 3GJSA 4MS4A 5BW8A 4LSZA 2W6IA 5IHXA 1FPQA 4KQHA 4Y8VA 3DHNA 1OA1A 3DR5A 2GLUA 2CLMB 2PR2A 4J29A 421PA 1C0PA 3IQWA 3OMXA 1Y5MA 3S2SA 5AHRA 2I99A 1FL9A 3OCUA 2AHRA 5AI0A 5ITZA 4QTUB 3DBLB 4PTLA 2ZB2A 4W5RA 5DHPA 3B5EA 4EMBA 1N6KA 3TUJC 3AESB 1K97A 4KKVA 3MAAC 4YI5A 2XSZA 5EVJA 4AMBA 1DDGA 2ECPA 5HF8A 4BMDA 4DCUA 1N77A 1G16A 1BKYA 1JJAA 1WMBA 3IXMA 2Q45A 1GQQA 2M6RA 3OZSA 3ROPA 3TTTA 3LWBA 1P39A 2VHVA 3PFBA 1CZHA 3PBKA 4TVSA 1GFZA 1C3XA 3BGWA 1CHDA 2PMFA 1WZNA 1UBGA 3D81A 4AURA 3JSXA 1GT6A 4I46A 4RVHA 4J6EA 3FOZA 2HRDA 5ELMA 3ZVMA 4ZGBA 2Q5OA 4NFSA 2Q99A 3A1FA 3CTPA 3TFQA 3GG9A 5COQA 1VRWA 4A3SA 1YOVB 5GIOE 1H5UA 3TB4A 4QXQA 3WJ1A 3WP1B 1SUIA 3MRTA 2JARA 3K0SA 1SWWA 4KNYA 3O1HB 5K4GA 3EZFA 4IIFA 1JHVA 3O4RA 3GCWA 5G1NA 4HXGA 4BWYA 2IS4A 1KZ1A 1UT6A 1CUIA 1UBKS 2G0NA 5SY6A 3SXUB 4E11A 5C5CA 3V6MA 4AF7A 4LRXA 1Z0JA 2FN4A 5JTTA 3EZ2A 2WZCA 3QA9A 1G3IA 1EFDN 2A67A 4DEXA 3KP1A 4M7OA 2XX3A 2A30A 3RNLA 2OBXA 1J5XA 3HXTA 5ES4B 3WDMA 2V7GA 2A1IA 5IKEA 2GJAA 1O1YA 3E7PA 4ZP1A 4RESA 1GL3A 1NXWA 1OREA 4JEUA 2M9MA 3F71A 1A4RA 5AJUA 1JNYA 2DWCA 4GP7A 1EFRD 2YVQA 3OZWA 2AJ8A 3QVLA 3KQVA 4ITRC 3LV8A 3C0KA 4OV6B 4ECEA 3OAAD 2ZBQA 1GCUA 1Z8NA 1XF9A 4R5HA 4MR8A 4J3JA 4V0NA 3C7CB 5KHAA 1L4HA 1X8LA 4YRPA 3SU8A 6PFKA 2G4LA 3MMSA 3NTLA 4BQPA 3QSGA 1NI4A 2RH9B 3VV2A 4RD4A 2A4MA 3FUTA 3K32A 3LT0A 2VTVA 2JKZA 2O14A 4ZEVA 1FP6A 5BYBA 2NLOA 4K9MA 1R6UA 1X2BA 3LGAA 4MRVA 4AS1A 3G79A 1VLHA 4ZDJA 5KKNB 4GR5A 4LG1A 1PWXA 1YDHA 2J6HA 1JIIA 3ZQ4A 1UPAA 4R31A 2YHAA 5HGJA 5I7AA 1TXGA 5J2UB 2IEZA 1QKIA 4MWOA 5H5JA 3KKQA 4RY9A 3NALA 4QRDA 3HYTA 4WJLA 2CV1A 3ESQA 3OE1A 4M8KA 2PK3A 1IL0A 4CKCA 3B82A 1SELA 1XRSB 3SICE 2XHZA 1V8ZA 3UXYA 4K1XA 2NUTB 3UWOA 5CXXA 4ZJZA 5P8WA 3M5CA 4Z4IA 1K7CA 2E55A 2GN0A 3OU7A 4PSDA 3PPIA 1I1HA 2MSDB 1Y1SA 3I61A 3R9KA 2WMOB 1SA0B 3QPAA 2Z6UA 1II8A 1NVBA 2XRZA 2O52A 1T6NA 3UOWA 3PGA1 3EFEA 3FDZB 1N8TA 2X5OA 3LOQA 3LQYA 4HRYA 4IKEA 4ALLA 3SSAA 5E2IA 2VPQA 1ZSNA 3NO4A 3BCRA 4CDGA 3VKFA 1ECCA 3ZWBA 2PV0A 1S3GA 1JHQA 3WHKA 2FSFA 1RWPA 3GVCA 1OFUA 4WKCA 3WIUA 1U2PA 4PYKA 3ZN2A 4BJ3A 2JFFA 3M9WA 1OXKB 5I7FA 2JLWA 1HPLA 4QYWA 3N6XA 1YA4A 2AD1A 4IDDA 4PBSA 1Y5LA 2FUKA 3RC7A 5B4VA 3VHQA 3RV4A 3C3MA 4IG4A 7ABPA 2OVBA 1PS9A 2EQ5A 1JUDA 4WGGA 3KD3A 4JSTA 3AF5A 5K8IA 1TZJA 5HG0A 5L51A 4OHZA 3LVQE 3W7BA 1U3UA 5AOBA 4BNKA 4RCZA 2XEXA 1RNLA 5JXIA 4JSRA 2ZDGA 1L7BA 5DCUA 4R83A 4I6GA 5LXTB 2WF5A 3R4VA 5D84A 3GLUA 3M49A 4HR7A 4KXWA 2QX6A 2H5EA 4EO4A 2BI4A 4LDNA 3P5SA 2ODPA 4MGZR 4MI6A 4HDSA 4QDUA 5LDGA 1P2VA 5FAXA 1U0EA 3JQ9A 5DASA 3VTAA 4GOLD 1WHTB 5AW5A 2AJDA 2NIPA 3RI3A 5FOWA 4LV5B 4MYRA 4QGGA 5F5XA 3EF3A 2ZIWB 4A0RA 1USKA 5EPUA 3KEFA 2ZE8A 3LSTA 1NFFA 4M46A 5ICCA 1JTVA 4M9UA 1NPDA 1J39A 2V6MA 4PPGA 4W7HA 3WYCA 4OFBA 4YLYA 3U7QB 3LBNA 1KZ7B 3LNTA 3CURA 2W22A 3PGKA 4KVGA 1QHYA 5F33A 3ZGXA 3T9EA 4EJFA 4PLGA 2Y9MB 2UYYA 1G55A 1UM9A 1I3LA 4KQ2A 3TM4A 2WTUA 4AZTA 4BATA 1EQUA 3F9IA 4BKQA 1S2MA 2DR3A 2PQMA 2IZOA 2FW1A 2IYXA 2YUTA 3PDUA 5FBRB 3PJRA 3QMPA 3FZQA 4DMMA 5KOIA 2EAUA 1VSBA 4PYOA 5AWFC 2GBLA 1E6EA 4NZYA 2BP7B 4EYOA 1E4YA 3B1VA 3BGVA 2R8XA 4ZAYA 3S40A 2BFOA 4HQ6A 4DPLA 3DEZA 2HLPA 2P2ZA 1OFVA 3LUJA 1RQRA 1U0JA 4Q7LA 5DZSA 4PQYA 2QUKA 2BFDB 1KP3A 2AI2A 2VF4X 3JX9A 3T15A 3M89A 1VSTA 3K6KA 1Y8RB 1QGYA 1SNYA 2HCFA 2O54A 3A2NA 1KH2A 3HB7A 1A9SA 3A1NA 3HXLA 2FEPA 2HHAA 1UKYA 4GPEA 3UB4A 3BXGA 3CPSA 4H77A 1E0DA 3VC2A 2HSWA 4HF7A 2V6GA 1KBQA 2C78A 5FI3A 1R0SA 3FUXA 4XUCA 2YQ5A 2ZWVA 1JLRA 2CXPA 4L8WB 3WA6A 3WMWA 3EG5A 1YKGA 3GXOA 3RRZA 4UASA 4X5OA 3W5BA 1D7OA 3ABZA 4F9GA 1A4UA 2PD3A 2RH4A 3CB2A 3ZG6A 5LOVA 1TEVA 4MRSA 1G9TA 1U2ZA 1EP3B 2FJPA 3GNSA 1IJBA 2OSVA 1AT1A 4BGEA 1SAYA 3S8YA 4QUAA 1TT5B 4EL5A 1ZH6A 1O03A 4TLEA 3INYA 4M38A 4MHTA 4AUKA 1DCMA 1BGXT