2VWPA

Haloferax mediterranei glucose dehydrogenase in complex with nadph and zn.
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
357
structure length
357
Chain Sequence
MKAIAVKRGEDRPVVIEKPRPEPESGEALVRTLRVGVDGTDHEVIAGGHGGFPEGEDHLVLGHEAVGVVVDPNDTELEEGDIVVPTVRRPPASGTNEYFERDQPDMAPDGMYFERGIVGAHGYMSEFFTSPEKYLVRIPRSQAELGFLIEPISITEKALEHAYASRSAFDWDPSSAFVLGNGSLGLLTLAMLKVDDKGYENLYCLGRRDRPDPTIDIIEELDATYVDSRQTPVEDVPDVYEQMDFIYEATGFPKHAIQSVQALAPNGVGALLGVPSDWAFEVDAGAFHREMVLHNKALVGSVNSHVEHFEAATVTFTKLPKWFLEDLVTGVHPLSEFEAAFDDDDTTIKTAIEFSTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active site dynamics in the zinc-dependent medium chain alcohol dehydrogenase superfamily.
pubmed doi rcsb
source organism Haloferax mediterranei
molecule tags Oxidoreductase
molecule keywords GLUCOSE DEHYDROGENASE
total genus 116
structure length 357
sequence length 357
ec nomenclature ec 1.1.1.47: Glucose 1-dehydrogenase (NAD(P)(+)).
pdb deposition date 2008-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
A PF16912 Glu_dehyd_C Glucose dehydrogenase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vwpA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2vwpA01
5F5NA 3NDRA 2B35A 3E9QA 3JQCA 5A9SB 5I9MA 4J0FA 4NMHA 3INRA 1FMCA 5AQ1A 3GF4A 2NNLD 4LGVA 2O3QA 2J3JA 3EMKA 4HADA 3IDSA 5KTKA 2VTEA 4DPLA 3PI7A 1GD1O 4Y6RA 3S2FA 1BSVA 2YDYA 1WMBA 1E1KA 4DWVA 3NJ8A 1K0UA 2PKQP 2Y93A 1U5AA 1VC2A 4LK3A 3AY3A 3GAFA 1FDTA 2QYSA 4G81A 3NGXA 1JN0A 4ZVVA 5BQFA 4XB1A 3PYLA 3WSVA 1FDSA 3VVCA 3CXRA 2DUUA 3PYXA 4Q3NA 3B6ZA 3LDHA 4IBOA 3PEFA 3GOHA 4W7IA 3ZHZA 4XZ3A 6LDHA 1D3AA 3SC6A 1FDVA 4TVBA 2IEDA 4FQ8A 5GZ1A 4LSWA 3WGTA 2WYWA 1HE3A 2I5PO 1BHSA 2NUAA 2QRJA 5G0VA 1CETA 4YYZA 3INTA 1YGYA 2RIRA 4WGGA 4XJSA 4N54A 5CFZA 4DTIA 3GVCA 5DULA 3N58A 3RU9A 4CMEA 2J5QA 3PDUA 4ALIA 4GMFA 4HNHA 1MFPA 1PTJA 1WZIA 1GEGA 4DIOA 5ER6A 4ALNA 1BVUA 3PLRA 2VOEA 2WSBA 3RUIA 1HDGO 3LT4A 1GU7A 4YAIA 1NFRA 4UVEA 1R15A 5EQDA 1IPEA 3RASA 3PVZA 4IDAA 5JSFA 1T1RA 4RF3A 5CEFA 4BIIA 7MDHA 3PJEA 3MWDB 4GX5A 4L0QA 1ZKMA 1I3KA 4E6PA 1XSEA 1ZBQA 3S2EA 5A5FA 2O7QA 3GUCA 3PWZA 2CZCA 2XF8A 4RVHA 2DQ4A 1C1DB 2D3TA 2OUIA 1NXQA 4CR7A 4G5HA 2X6TA 3BIOA 4J4TA 2Y05A 1P0FA 3ANLA 3JD1A 1TA4A 3GGPA 4M55A 2CD9A 3EZLA 5IZCC 5FI3A 3F46A 1SB9A 5FF9A 1TLTA 3RFXA 1HDZA 1BWSA 1YQGA 5IDXA 4BHTA 1ONOA 2FN7A 2VRCD 2VTDA 4MIEA 2NQTA 4BO5A 4OXYA 4A26A 1F0YA 4URFA 2UYYA 3V5NA 1V3TA 2Q4BA 3JD0A 2NVUA 3DDNA 1E92A 4MJLA 1R0LA 3GUYA 3DMTA 2CVOA 4GSLA 3LK7A 1L7EA 1HYEA 2FPIA 1NQAO 1E7MA 2EJWA 3KSZO 3AOEA 3V2GA 1LEHA 3UCEA 4ROSA 5B4UA 3DWFA 3VKVA 1PJSA 1LC0A 4JK3A 2VWHA 3RD5A 2YW9A 4OQZA 1W6UA 1EQ2A 4DYDA 1AN9A 1EE2A 1R4MA 4KZPA 3ZH2A 5GY7A 2Q50A 1M6WA 1Y1PA 3QWAA 4BVAA 3L6EA 4E13A 3WQRA 3RKUA 4B3JA 4DBZA 4B7UA 2YQ5A 1DIGA 4PZEA 4OAQA 3F4BA 3R1IA 3QV1A 3CIFA 1N7GA 3F5SA 1ML3A 3KLMX 2Q2VA 1U2DA 2PD3A 4DIBA 1HE4A 3PHGA 3DHNA 1MXFA 1ONPA 3RU7A 1WPQA 3TZCA 1NYTA 1Q7GA 4JJFA 4RF4A 1JKFA 3LC2O 4RVDA 4Y6PA 5GMOA 3PWKA 3HJAA 3GVPA 4Q3AA 1E3SA 1PGNA 2WTBA 4XQGA 4A03A 2W90A 1N1EA 4R41A 1MC5A 3BMNB 2Q2WA 2GLXA 5CDSA 5A05A 2JD1A 4FSHA 3TOZA 4BS9A 2VT3A 4P4NA 4U5QA 2B4RO 1Y9AA 4DPMA 3DMTC 2TMDA 5LDGA 3GA0A 1IHXA 2C5AA 4CMIB 5EINA 1ZEMA 3NEPX 5A03A 4KUGA 1VSVA 2HCTA 3NT4A 3C7CB 4H15A 2Q4EA 3H9JA 2G0TA 5HTOA 1ARZA 3IJRA 4RDHA 3M2PA 1YBVA 1H6BA 1LUAA 4GLOA 1EE9A 4WECA 5EPOA 3UF0A 1NX6A 1LI4A 1XCBA 3EVTA 4CM8A 1NR7A 2DTXA 3JQAA 2AEMA 3UOGA 1NPYA 3SXPA 4L8VA 2FZWA 4CR8A 4R54A 2BGLA 4GVLA 2X9GA 1JVBA 2E48A 1PGPA 4R3NA 4UREA 1HDXA 1XIVA 1R4NA 2GD1O 4CMAA 1P0CA 1UXGA 4YJHB 2G1UA 4Q9NA 3KRTA 1GQYA 1NM5A 2IXAA 3CZMA 4CV2A 2OORA 4BGEA 4I9NA 1A27A 1AGNA 1IYZA 1PS8A 3P5SA 3TZHA 4BNJA 1R4NB 1Y5RA 2VHXA 2ZYAA 2WEKA 4J9VA 1LDMA 4P4GA 3ROQA 1I2CA 2Y99A 4YJGA 1LDYA 3T7EA 1VSUA 2VT2A 3WWZA 4C4OA 1P33A 3ZWVA 3GPIA 3DBLB 4E5YA 1LX6A 5TGDA 3FTPA 3FR8A 5A1TA 3QA9A 2PA3A 3KXDA 1LLDA 4BNFA 1P3DA 4S1VA 1GV1A 3F4LA 1SPXA 3UN1A 4FJ1A 3RC2A 2OMEA 4Y98A 3HG7A 3NTQA 1NVTA 1UXKA 5DZSA 1VJTA 2GZ3A 4JNKA 4YVFA 4BMSA 1B14A 1HE2A 2D1YA 2HMUA 1YQXA 2B4TO 2E82A 1IULA 4CPDA 1RWBA 1YXMA 2PKRA 3OICA 4U0KA 5G4KA 1MG0A 1SO8A 1Z82A 1SEVA 1ZJZA 1ZXBA 3GK3A 4W7HA 3HN7A 3D4PA 1XHLA 3GLQA 1XG5A 1X0VA 2P9CA 5TRTA 1C1DA 3T7CA 5FI5A 2D2IA 3IAHA 3A06A 3U4DA 2QX7A 1LA2A 1U7HA 4FB5A 4CM9D 4GX1A 4MIOA 5KVCA 2Y1CA 1IL0A 3UICA 1MA0A 4OKNA 4R1SA 3PP8A 4RL6A 5ES3A 4XB2A 3WB9A 4BO9A 4JP2A 4H7PA 3RUAA 1Q0LA 4FW8A 1KVRA 4HP8A 2C0CA 3RIHA 1ZSVA 4KQWA 1N92A 3DZFA 4Z6KA 2ZB4A 4I5EA 1P44A 1DC5A 4EJ0A 3K92A 1K89A 1OMOA 1U4OA 4OIMA 1PL6A 4QQRA 1MLDA 4M89A 4CR6A 2DTEA 4ESOA 1B3BA 4IQGA 3GZNA 4PG8A 4J91A 2P91A 1U9JA 3CPSA 4CLOB 4D46A 3GDGA 2PD6A 4XYGA 4OJNA 5EL0A 4TRRA 4Z0TA 4DYVA 2W8ZA 3ZNQA 1FK8A 1LSUA 4OMUA 3JD2A 3I9KA 4PG7A 5JE8A 1ULUA 1YL5A 3BMQB 1NBOA 1V3VA 3JQAB 4ILKA 3RVDA 5H83A 3UW3A 4GWKA 2JCYA 1V0JA 1PQPA 3ADPA 3KOUA 2O3UA 4XQ9A 4B8WA 3IQDB 3JQDA 1YH3A 1W73A 3I23A 4J43A 1D1SA 1ISHA 4N5NA 3PJFA 3QW2A 2PFGA 1YO6A 1PWZA 3RJ5A 5TQVA 3GN1A 1U2GA 4Q3EA 1V6AA 5G0TA 1NASA 5CPFA 1DPGA 3MJVA 2AA3A 3C7DB 3JYOA 4AJHA 4D42A 4NBWA 3NT5A 1YQDA 2BMAA 4AJ2A 2JKVA 2F00A 3CMCO 3WBBA 4RVSA 2P4QA 2O50A 1U4SA 2FPGA 2WDZA 3TFQA 1I01A 2W2KB 1PL7A 4IZHA 3HE3A 3L0DA 2ZK7A 3FI9A 3FPCA 2ZTMA 1GQ2A 3R3SA 2EKLA 3CMMA 3UKOA 4N18A 1W0CA 2NU8A 2HMSA 3K6JA 2EG9A 5EN4A 3AK4A 2QG4A 2YHIA 3N7UA 3TL3A 5JO0A 1UJMA 1E3LA 2Z95A 4IS3A 4PLHA 5DF1A 1Y8QA 2A94A 1DO8A 1IE3A 1VL6A 4KWHA 1SBYA 2FR1A 4BNWA 1DC3A 2TMGA 2WD7B 1QLJA 2IRWA 1GADO 2O4UX 4YRDA 4EUHA 3KYCB 2G17A 1J5PA 3DC2A 1LQUA 4CLRB 5JY6A 3AY7A 1ADFA 1R37A 4PG6A 1ORRA 3GNSA 4AJLA 3AJRA 2C7GA 2ZB8A 3CINA 5DCYA 2X0NA 4E5NA 3IMFA 5IJZA 2ZJ1A 1CQJA 1XEAA 1JKIA 4FD3A 4PRKA 3D4OA 3SLGA 5L9AA 2B37A 3H5NA 4Q3CA 4ZHSA 1E3IA 3L9XA 5ICMA 2ZJ0A 1I36A 1KVTA 1O94A 3ULKA 1H5QA 2X58A 3E48A 1YBAA 4Z9FA 3A28A 5KWEA 2B0JA 4Z0PA 2BKAA 3GVXA 4PFJA 3G0OA 4ALMA 2XAAA 2OO5A 3GG9A 4E5KA 5BR7A 1O9BA 4UVHA 2C2YA 1ADBA 1XQ1A 1CDOA 1XQ6A 2PNFA 1ADCA 2BHLA 1DJQA 2H9IA 4OH1A 4B7XA 3Q9NA 1E7SA 3G3EA 1K5HA 4N5LA 1B8UA 4CMBA 5GZ6A 2DPHA 1YB4A 4E0BA 2I9PA 3DXFA 4K9DA 1KYQA 3EZYA 1AXEA 4RPGA 4YPOA 1GUFA 1YE3A 1ZJYA 1ZNQO 5BSFA 4GX0A 1NAIA 3ZV6A 5CP8A 4EJ6A 5KJCA 3MJEA 3PXXA 2O3RA 3MTJA 2I65A 4FFMA 1V35A 4WCFB 3JD4A 4M49A 1TB4A 3FBTA 1Y8RB 3EGOA 4FJ0A 3U9LA 4J7XA 5HWSA 4NG5A 1NPTO 3FNGA 1F12A 5F1OA 1WLYA 1GPDG 4OXNA 2UVDA 3SLKA 3TOXA 1B8PA 1KEPA 4KUHA 3EVNA 4WEOA 2DFDA 5A5EA 3NRCA 3W8FA 4I5FA 4OKIA 4DGSA 1GDHA 2AMFA 3NT2A 5JPIA 4FOSA 1O95A 1UZMA 3GEGA 4EUEA 4GMGA 3VZPA 3E9MA 3V1YA 3CUKA 5JAQA 4JIGA 2GN4A 4FDAA 3GQVA 1KY4A 1LU9A 1UXJA 3H2ZA 3BA1A 1S7CA 4YEDA 3L07A 3C1OA 3VH4A 1R66A 1K3TA 2DM6A 4ZRNA 4CMHA 3OHSX 5IFLA 3VZQA 3Q11A 1GZ4A 1A5ZA 1ZW1A 2X22A 1FF9A 2HK9A 3ETDA 3KYCA 3WIDA 5JAIA 2O48X 2PH3A 4UUPA 4FGSA 3ROKA 5IXYA 1DDOA 4MKXA 1ZIDA 3RC9A 4MOWA 1BTOA 1SCUA 3GY0A 1RYEA 1U8FO 4FC6A 3FF4A 3WYEA 3JQGA 5BSEA 1QYCA 3TQHA 1F14A 3KBOA 4MVJM 3JQBC 4QXMA 3IOYA 1GYPA 4I9HA 2I67A 1LNQA 2C20A 4GGPA 3PJDA 5LCXA 4CQMB 2D5AA 4QFCA 3UGKA 1YOVB 4BV9A 5JAMA 3G1TA 2NQ8A 3KVOA 1B26A 4CUKA 5H81A 2ZQZA 2RH8A 1T2DA 3PYMA 2V6GA 2W4QA 1PEDA 4I08A 2ZTVA 3L4BC 3DMYA 3KUXA 1BXGA 1QRRA 4TMFA 3ZDFA 5BNFA 4DLAA 5CAEA 1E3JA 4O6VA 5KJFA 3B1FA 4WKGA 4EUFA 3TSCA 2AQIA 1QMGA 1SZJG 1BW9B 3E03A 3VC7A 1QYXA 3FNEA 3SEFA 1RKXA 4RF2A 2V6FA 4BNMA 1R0SA 3HQ4O 5IAAA 2Q1UA 5U4QA 1EVZA 3B1KA 4BKUA 4AICA 1ZK1A 4CMKA 1RM0A 3AI2A 2CSUA 3L6OO 3GC6A 4RVUA 3ITDA 5GZ3A 4AJOA 2VUTA 5HRUA 2NVUB 4EEXA 1U8XX 3DAFA 1BDMA 4R1UA 1M66A 4FR5A 3GN2A 4IGEA 3RKRA 1E77A 1GFSA 1PS9A 4NFSA 3ENKA 3DBLA 5CDTA 1S6YA 2A9FA 1HYHA 2P9GA 1RPNA 1CIVA 4HWKA 1JDJA 2GZ1A 4J6FA 1KVQA 1DRWA 5KJ1A 4RQTA 3NAQA 4K1LA 1DEHA 1JAYA 1ZMTA 3VDQA 2EXXA 3GZNB 2PK3A 2Y1EA 1N5DA 1GCUA 1E3WA 2AHRA 4IGFA 2I6TA 4DLLA 5JAZA 1CWUA 1O0SA 1D4FA 2O23A 2W98A 4CM6A 4FFRA 1DOHA 1KVSA 5IDQA 3BZUA 4HFJA 3ENNA 1M6HA 3BMOA 3DBRA 2NACA 1ZSYA 4BKPA 4J1NA 4YJDA 1E0DA 3TF5A 5HS6A 3WX0A 2BFMA 2PZMA 1U3WA 1DHRA 2D5CA 4QUKA 3BHMA 2VZ9A 3LLSA 4R69A 4R4JA 1GEEA 3O9ZA 3CKYA 3ICCA 2G76A 3JSAA 2PTGA 5COAA 1XKQA 4QX6A 4KOAA 4RVFA 1PZEA 2WD8A 3VPFA 4TRMA 1Y8RA 1H6AA 1GL3A 4D44A 4FN4A 3PLNA 4IJUA 5ENVA 2AG5A 2HLPA 2J8ZA 3G1UA 2EGHA 1LJ8A 2XOXA 4TQGA 4H16A 4TVOA 3JQ6A 4LRSB 2RH4A 3C7AA 5IZ4A 1MGOA 5L7WA 4M1QA 1PJBA 1HDYA 2X0RA 4LISA 5THKA 4EJMA 1DRUA 2I66A 1YL7A 1PGQA 2RHRA 2FSSA 4MO2A 1NQOA 5T64A 5IDYA 3CTMA 2NVWA 5MGBA 2A4KA 3LYLA 2ZIZA 2PLAA 1MX3A 3LU1A 2W2LD 3WNQA 3ZWYA 1UXHA 4Q3BA 1PIWA 3I4FA 3ABIA 5KVQA 3DZHA 1T26A 5AXAA 3VZSA 2D4AA 4IM7A 5A9TA 1U7TA 2NV6A 3I9NA 1B0AA 3P2YA 4NBRA 4E31A 1ID1A 4MINA 4XDZA 2EW8A 1FJHA 2UUPA 2Y67A 4MPDA 1LRKA 1MUUA 3HUDA 3RAJA 5DNAA 1CERA 2IEBA 5EESA 3KYBA 4IDEA 1PJ2A 5AXDA 1RM4A 1QR6A 4NBVA 3JCZA 3KLPX 3Q6IA 5F1KA 4WLNA 4P38A 1VL0A 5DP2A 1VLLA 5DN9A 2YFQA 4LVUA 3HSKA 1X13A 1KVUA 2Q1WA 3M6IA 5IF3A 3S55A 1HKUA 3JQBA 2IDZA 3F3SA 3LF2A 4WLEA 1ZFNA 2OP1A 1B16A 3OECA 2CUKA 5IXSA 5CEEA 3O03A 3DB2A 3UCFA 4RGBA 1PGJA 4HV4A 4K26A 2QQ5A 2JD2A 1IHYA 1RJWA 1ZUD1 3KYDA 4P8RA 2ET6A 2X9VA 2BI7A 3QVTA 2W2KA 1CYDA 1N2SA 4BNVA 2JL1A 2HMVA 5JLAA 4H3VA 3GMDA 4NHEA 4WPGA 4JP3A 1Q0QA 3D7LA 2QHXA 3DBVO 4HUJA 2BFOA 4JBIA 3H65A 4WASA 2JCXA 2Y1GA 1LRLA 1C0KA 4M87A 3D4NA 1MXHA 1TXGA 2VHWA 1YJQA 1UR5A 3DL2A 3GRKA 4XDYA 1PQUA 4FFNA 3RC1A 2CNBA 3OQBA 5DBIA 1SMKA 2PY6A 3W4IA 4II2A 3AY6A 4J1QA 3WMWA 1KERA 2DTDA 1UZLA 4GPD1 4RPKA 4AJ1A 4E32A 3GFGA 2IZZA 3ZWBA 4O0LA 4D3DA 4J1TA 5JCXA 2P2SA 3GHYA 1PGOA 4BNNA 5LDHA 3I9MA 2QRLA 4IPTA 3ICPA 2X8LA 3TN7A 4WCDA 4MVJD 4MVJG 1N1GA 3O4RA 1ZZEA 2B5VA 2GRAA 5CEJA 1T25A 2YHIB 2ZCVA 1HSOA 3GPDG 2VWQA 1OOEA 3IIEA 5C7IO 2QYTA 3E82A 2CF5A 2EF1A 4MP8A 1PX0A 2FY8A 2FZEA 4BKOA 3I9JA 4XCVA 2X0IA 2OBYA 4C7KA 2VUSA 2YZ7A 1WAMA 3DFZA 4TRNA 1IPFA 2DFVA 3O8QB 5I9LA 1Y9EA 1E7QA 1B2LA 1NNUA 4CM5A 1E1MA 3MJSA 2I3AA 1PJCA 3GR6A 3K2BA 4IZIA 3S2IA 4D0SA 3GNQA 4UUOA 1C0PA 3WGIA 2OL4A 3D3WB 3PQFA 2EP5A 1UDCA 3HFGA 4YAKA 3GVIA 1OFGA 2GN8A 5AXBA 2E4AA 2XXJA 1WVGA 3PPIA 3DR3A 5KVSA 1B3RA 1I30A 5ICSA 3UVEA 4OOEA 3VH2A 1E1LA 1SOVA 4XYMA 4AJEA 3GG2A 5TLSA 4W99A 4B4UA 3H9UA 4QTZA 3INGA 3H7AA 3JYPA 1KY5A 1Y6JA 2P5UA 3DQPA 2HKIA 1C0IA 2Y0EA 1DFIA 3G79A 5ITVA 4AG3A 3FR7A 4IUYA 2AQ8A 2OXIA 1PJLA 2DT5A 3MOGA 4CMGA 2H63A 2YYYA 4QSMA 3W8DA 1DRVA 3OEWA 3ZWMA 4LVCA 3RSHA 4PG5A 2EJVA 3DOOA 4XRRA 1VRWA 2CVQA 1E1NA 4ITUA 1VE9A 4LW8A 4CUZA 4JJIA 2VNAA 2WMDA 4M8SA 3W1VA 1YWGO 4PLWA 2QRKA 3ZHYA 1VJ1A 2Y68A 1KEUA 2OGUA 4NH4A 2VRBA 3STHA 1EVIA 1JLLA 4BNKA 1HLPA 1D8AA 2DC1A 1Z7EA 2Y0CA 4R16A 1DHTA 4FBGA 5AXCA 3JV7A 2X1HA 1A7KA 3PFFA 1GTMA 3E5MA 3OH8A 4ZQHA 1H94A 3TFOA 4K28A 3B1JA 2BRUA 2W2LA 3MEQA 3GDOA 4BUCA 3PHHA 2B69A 2C2XA 3U0BA 2VZ8A 3D5QA 4FFOA 5IN5A 2ZB3A 3D5TA 3CEAA 4ID9A 1P1FA 2VYNA 1PZGA 4F6CA 4W9NA 1LDBA 2OP0A 5CDYA 4BNIA 3RUEA 3C1TA 1DAPA 4R9RA 4JXKA 4J16A 4ZRMA 2OBNA 3MCVA 4NFHA 3UUWA 3BMCB 3H6KA 2JD0A 1HT0A 3HN2A 4IQ8A 4DQXA 5JDCA 2CF6A 1P31A 2DAPA 3VPHA 5EQFA 4NU5A 4CM8B 2BLLA 2HAEA 3NV9A 4BB6A 4KDEA 2V7PA 3LC1O 1HTBA 2NADA 4MKRA 4DA9A 4YT2A 2YHUA 2Q1TA 1QLHA 4J7UA 2PGLA 3BMCA 5JY1A 4EI2A 2D8AA 4X54A 3BXXA 1TEHA 4XD2A 1TI7A 2B5WA 4XYLA 1EQUA 1NPDA 5C7OO 4GSKA 4PLPA 3PRJA 3PWSA 3KB6A 3LC7O 3KEOA 3PIDA 4UEKA 4UVDA 4W9NC 2DPGA 3AFNA 3N74A 4E3ZA 2YJZA 4I1IA 3L9WA 1ULSA 1KS9A 1Y8QB 4Y67A 5F1PA 1K6JA 2Q46A 3A1NA 4CM1A 4HXYA 2HUNA 3BTUA 3KSDO 3GDFA 3C85A 1QYVA 3OJEA 5T5QA 3AM5A 1LTHR 2C07A 2V6BA 3DOCA 4MIYA 4GAEA 2POQX 5F21A 5HBRA 3RWBA 1EFKA 4TSKA 1QORA 1JVSA 1VKNA 1I33A 3PHIA 3EK2A 2VRCA 3WGHA 4WOKA 5JW6A 1T2CA 3JQGB 3I3OA 4J2HA 5JCJD 3AOGA 4CLDA 2GNAA 2AEFA 3AM3A 2O3JA 2B83A 4QECA 2I99A 1I2BA 4IINA 4ONEA 2C82A 4TKLA 1UZNA 4GGOA 3UCXA 4YJFB 3F5QA 3MZ0A 2GASA 4BO4A 4BO3A 5L45A 4D3SA 3PHJA 5B37A 4RORA 4CMIA 3M1LA 4EEZA 5I7SA 1CQIA 1PR3A 3PQDA 4E5MA 3C24A 3PHLA 4J7CA 3IL2A 3VDRA 4J4HA 4DIFA 3VPXA 4R5HA 4UUMA 4RVGA 3NYWA 4BNYA 3B20A 1NFFA 3I5MA 2D0IA 2PZKA 3E6AA 1YB5A 4U7WA 4YBZA 5ENDA 4NDNE 4MVJE 5DDIP 3C3XA 3PFWO 4CODB 4NZ9A 4YB8A 1ZSNA 4BNLA 1QG6A 2YV3A 3EY4A 4YJGB 3WJ7A 1EUDA 2C54A 1GZ3A 3O38A 5IDWA 3TZQA 3RFVA 1ISJA 1SOWA 4A0SA 1VJ0A 1VM6A 3PIIA 3GEMA 1E5LA 5JFOA 3Q0EA 2PR2A 4TZTA 5G0SA 4GLLA 5IN4A 1L1FA 3QVWA 3PTZA 2HK7A 4D0RA 4GI2A 4ZGWA 4DC1A 1N9GA 4PRLA 1AHHA 3EYWA 4RCVA 4OSOA 3HHPA 4PN3A 1I32A 3I1JA 1KIFA 2YY7A 2NSDA 3ON5A 2YV1A 4B79A 1LRJA 1WW8A 3E1KA 2R2GA 1WZEA 3UAGA 4WLUA 1JA9A 4EZBA 3W4KA 3I52A 4U6SA 1FDWA 1VPDA 2J3IA 2LDBA 5T8KA 4CQMD 4FFLA 4TKMA 4AJKA 1D7OA 1E7WA 1UXIA 1EMDA 1R12A 1NFQA 1ZK0A 1N7HA 3HB5X 3DHEA 1V8BA 4IDDA 4A5OA 5CDGA 1HDCA 3K73O 4RF5A 2AEJA 4KTVE 1E3EA 3BTSA 3W6UA 4D41A 3AU9A 3D64A 5EIOA 5G0UA 1Y5MA 4ALKA 2P5YA 2PWZA 2BFAA 4G65A 3WR5A 5CPBA 1LLQA 4O5OA 4GX2A 3OA2A 2Z1NA 3EDMA 4BGUA 4BO1A 4CMJA 5G2OA 3BMNA 1EVYA 2NLOA 1X7HA 4FC7A 3ONEA 2HSDA 3HB4X 1DLIA 3NUGA 1IY8A 1WDLA 2HDHA 4YTEA 5DCUA 3K2EA 4M54A 3HZZA 1F17A 1K6IA 1UUFA 3E18A 4XIYA 4BNGA 4EW6A 1UDBA 1MFZA 1ZVMA 3VPGA 1X15A 2OZPA 1DJNA 2Y0DA 3BAZA 1EUCA 2FR8A 3WFIA 1PJ3A 5COBA 3VH3A 4YT4A 2P9EA 4XWYA 3KTDA 1EBFA 1H2HA 3WYCA 3PK0A 1M67A 5L4LA 1FXSA 1B15A 1GQQA 5IZCA 3ZNPA 4ZICA 1BXZA 2JFHA 2CDAA 3QWIA 3DZKA 1PWXA 1ISIA 3EAGA 3FNFA 3RROA 3DHYA 2JCVA 5ADHA 3WS7A 3E8XA 3CZRA 2V65A 1P45A 2X5KO 1BGVA 3WTCA 1DC4A 4F46A 1SNYA 3DZBA 3LZ6A 3AUUA 3QWBA 3MJ4A 4KDFA 5A04A 4NJMA 1HSZA 5C5IA 5ILGA 1PS0A 3ZHBA 1G1AA 4PVDA 4YT8A 4G2NA 3ZW8A 1DIBA 1CRWG 3ORFA 1YB1A 3WGYA 2A35A 3NTOA 1H93A 1KOLA 3WBFA 1K6XA 2AG8A 1HXHA 2R00C 5CG1A 1GY8A 5JS6A 4E2XA 1I5RA 2VCYA 3OFSA 4FOOA 4CV0A 4KMSA 1GYQA 4CM4B 1OC2A 2DBZA 4Q3DA 1U3VA 2PV7A 3G17A 2AXQA 3COSA 4CLOA 4R5MA 1Q1NA 3G49A 5JNLA 4HX5A 3KYDB 4B4VA 2EGGA 4MVJA 3WLFA 4OOFA 3WLEA 3PJGA 1EDOA 2WD7A 3ASVA 1DLJA 1P77A 4JGBA 3GGOA 5ER9A 5T67A 2Y1DA 5DOZA 3W6ZA 4EBFA 2YDXA 4CM7A 3UHAA 1XDWA 4NQZA 4OGWA 1Z45A 4BQRA 1H9AA 3T4EA 2HRZA 1P1RA 2C5EA 1E5QA 1YL6A 4N7RA 3ONDA 4IJVA 4RV9A 4NFYA 2EKQA 1ZMOA 3AM4A 3MJTA 4I9UA 4J4BA 4PLFA 1P9LA 3ZV5A 2BGMA 1YDWA 5THQA 3K8ZA 4Y6SA 4DC0A 3U62A 2ZKLA 4UULA 5L95A 4TZKA 4YJHA 4PGFA 3U3XA 5DBFA 1CF2O 5TS3A 2OFPA 3ROPA 4OYRA 5JYEA 4II3A 1BG6A 4PZCA 5KKCA 1MB4A 3GT0A 1A7AA 4YWJA 2EV9A 3QWFA 3L4BA 5JC1A 4WOJA 3MWEB 2RCYA 2CVZA 3OETA 4J90A 3RUCA 3QRWA 3E5RA 1NQTA 3H5RA 4IS2A 3UFXA 1T2FA 4AVYA 4XIJA 3K96A 1NQ5A 3IUPA 2O7SA 5T57A 1UAYA 3WYBA 1R0KA 1OC4A 3PGJA 2ZYGA 1G6KA 1KC1A 3Q9UA 4CM4A 3FRJA 4OM8A 1HLDA 2ZYDA 4AL4A 1HE5A 2GGSA 1EDZA 3TZKA 2GYYA 4FJ2A 3OA0A 4R1NA 1ZEJA 4JQCA 1I10A 2G5CA 4KQXA 4S3MA 2DLDA 3H9QA 2X7HA 5DP1A 3GHHA 3V8BA 1EZ4A 3AW9A 1IOLA 4UAGA 2X9NA 2Q45A 1DBVO 1U3UA 3AWDA 5ILOA 4A27A 1Y81A 3V2UA 3FD8A 3NGLA 1ENOA 4ND3A 2X5OA 4FPXA 2YUTA 2ZTLA 1PR9A 4WK6A 3ZWOA 4BL5A 1XGKA 3WQQA 3W8EA 2ILTA 3RUDA 5EERA 1UP6A 4ZN6A 4JCOA 1LXCA 4E2WA 3WIEA 4LCEA 1Q7BA 2PGDA 3PZRA 1PZFA 2DBRA 4GQAA 4IDFA 4TROA 3ZWPA 4AFNA 2WWRA 1F06A 4IJKA 4QT0A 5JYDA 3JYNA 3K31A 3WOHA 3ANNA 5L4NA 4MP6A 3U09A 3DAGA 3GVHA 5F5LA 1O6ZA 3OJOA 5DBGA 3KSUA 5C7LO 4D43A 1LDGA 5C3MA 5JXWA 4W4TA 4IDBA 4YA6A 3OSUA 4YQYA 3HDYA 5U1PA 3V2HA 4BGIA 3VTZA 5A06A 1MP0A 4B4OA 3GNTA 1U28A 1OZAA 1TT5A 1GCOA 4FGWA 4WJZA 1DB3A 3OIGA 4AJIA 4GVXA 2J6IA 3B70A 1IUKA 4L4SA 1A71A 1PZHA 1X1TA 2BI8A 5K6AA 3DBHB 2NTNA 5FWNA 2QZ9A 4NJMB 2E6UX 2HMTA 3K9QO 3OQ6A 3EC7A 1TT7A 2GERA 5H82A 5G0WA 4TRJA 3WGOA 1N8KA 1BW9A 8LDHA 2AE1A 5TNXA 1IB6A 1E6UA 2DUWA 4YT5A 3IS3A 4IMRA 4EDFA 3IP3A 4GH5A 4IQ0A 4NBTA 5B1YA 5TC4A 4BNHA 3WSWA 2RHCA 3HNPA 3GMSA 4HNGA 4M86A 2EP7A 1AXGA 5G4LA 1V9LA 2P4HX 5L3ZA 1X0XA 1T1SA 4BMVA 3BTVA 3OMLA 5KNLA 3WDSA 4B7CA 4BO7A 3DTYA 3CH6A 1GYRA 5CG2A 2H1SA 1EBUA 2B36A 4ZQFA 4E12A 1QV6A 5I7VA 1N9GB 2IZ0A 1ENYA 3LQFA 3H3JA 3F9IA 4ND2A 4Z3DA 1DIHA 5FFFA 3S1LA 2VN8A 4EGFA 3I6IA 4F6LA 4XKJA 1W4ZA 1LBEA 3O26A 3AFMA 1EK5A 5ITWA 3UXYA 4I5GA 3D0OA 2JAHA 1PQWA 3E9NA 1KETA 3S2GA 3KHUA 3QVOA 5I8WA 3IC5A 2AE2A 3QHAA 3AUTA 1C1XB 1F8GA 4RO0A 3VOSA 1KC3A 2VHYA 1XELA 2Q2QA 3D1LA 1RM3A 1QKIA 4JJGA 3ZV3A 4ZJUA 5K6AC 4YRAA 2HJSA 4UVGA 2YQ4A 3X2FA 4AJNA 2GR9A 3DZGA 2HQ1A 2FRDA 4ZU3A 3TPCA 2J3HA 3L6DA 3DFUA 3ZN2A 4AJJA 3L4SO 1A9ZA 3R6DA 4MVJP 4QEDA 2GN9A 1UP4A 1WWKA 2WYUA 3I9LA 2PZLA 1BVRA 1RYDA 5FEUA 5JMWA 1LSSA 4DBVO 1WXDA 2JFFA 3ZU4A 3HWRA 4W82A 1DIRA 3KV3O 3VTFA 4HKTA 2O2SA 3TDKA 3W4JA 4U0JA 3F1LA 1JWAB 3I9OA 3KEQA 3V1TC 4WCFC 4DMMA 4DVJA 3D3EA 5F3RA 3ZNOA 4CLEA 1BRMA 3DONA 3DO5A 5B4VA 4JBHA 9LDBA 4NNJA 4UVIA 4PLCA 5I7EA 3WICA 3RJ9A 3VH1A 2WE7A 4CM9A 2Z5LA 4DPKA 2I76A 1MV8A 3ZGYA 4J2OA 4Z9XA 3JYQA 1Z7BA 4L74A 2EEZA 1A9YA 4GBJA 4GL4A 3LLVA 4XGIA 2C29D 3VAZA 2NVBA 3VZRA 1PJTA 4UEJA 1Y7TA 1Z74A 4JN6B 5I8ZA 5BNTA 1QYWA 3JQ7A 4FS3A 4RJTA 3TJRA 3GRPA 4BNTA 1J4AA 3LSYA 1DC6A 5KCZA 2V6MA 2GCGA 4N5MA 2QW8A 2NU9A 3GEDA 3NJ4A 1JWBB 4YACA 1M2WA 1YVEI 4BNZA 4ND5A 5L7YA 3TNLA 4O59O 1YBMA 3RCBA 4RZHA 4XEHA 3BMOB 1NWCA 1PU2A 5KJEA 3ZI0A 4WLVA 4JBGA 1H6CA 3WQSB 3RQSA 2CMDA 1GR0A 4YCAA 4CLXA 3OP4A 1O8CA 4GKVA 4ND1A 4EITA 3ZV4A 1A4UA 4U8GA 4IIVA 1H6DA 2DU8A 4YDRA 1Z75A 3PZBA 1I8TA 2DVMA 3I83A 4PZDA 4Y8VA 1X1EA 4EYEA 5L40A 1XA0A 4PG4A 4D7AA 5L4SA 3OM9A 4UEOA 2G82A 4AJ4A 1GAEO 2PD4A 2Q3EA 1HL3A 3X2EA 1JAXA 1WNTA 4IXWA 1X7GA 3PQEA 3ZHXA 7ADHA 4KP7A 4CV3A 3R0IA 3U4HA 3A9WA 1PL8A 1NHGA 5JC8A 3C8MA 1UP7A 2GZ2A 2GDZA 2CDCA 4F3YA 1A4IA 4ALJA 1J0XO 3IKTA 3RUFA 3F1KA 4MVJI 4Y9DA 4B3IA 2GF2A 1KBZA 5DOVA 2GO1A 4IXTA 3LT2A 4IDGA 2VQ3A 1T2AA 8ADHA 5KOIA 5KJ6A 3WG9A 4IDCA 2BELA 1JU9A 1P1JA 4P4LA 4I5DA 4ALLA 1EK6A 3GFBA 4NIMA 1QYDA 1HEUA 2YFHA 4HFNA 4OXKA 3RBVA 4J3FA 4B8ZA 1R6DA 4R9SA 4YRBA 5JDIA 2HK8A 3U4CA 1LC3A 3DOJA 4RLSA 4XGNA 1BXGB 1UDAA 5J23A 1VL8A 1J6UA 4UUNA 3H8VA 3ONFA 2UUOA 3VKUA 3AUSA 2O3SA 3WNVA 3AI3A 1EUZA 2HO5A 4INAA 4XR9A 5U9CA 3RBXA 5K0ZA 3HDQA 1YOVA 3NDIA 3P7MA 2Z1MA 1LSOA 2VWPA 2OOSA 2UV8A 4JX8A 3C1AA 2OHXA 2CDBA 4L4XA 1GUZA 1GPJA 3DTTA 3F47A 4E30A 3Q3CA 2NU7A 2FMUA 1HETA 1I3MA 1X14A 2PZJA 5TT0A 1ISMA 4I8XA 2VZ0A 2AQHA 1XU9A 4Q39A 4OSPA 4DMLA 4XQCA 5TIIA 1WDMA 1HF3A 5BNIA 1TT5B 1C0LA 1W8DA 4ND4A 3DAPA 1V3UA 4J0EA 2IZ1A 4IY1A 1H9BA 3TL2A 2J5KA 4L9RA 4MP3A 5JBIA 2I3GA 2C7VA 3OBBA 4DRYA 2PH5A 3FWNA 1C3VA 1E7RA 1HYGA 1RM5A 2IXBA 1SC6A 3A14A 2E49A 5MDHA 4KTTE 2FWMX 5HA5A 2NTJA 2Y1FA 4D79A 3HDHA 3FHLA 1YONA 2JHGA 1G0NA 1VKOA 3IKVA 3PGXA 3JQ9A 4NI5A 3AI1A 4CV1A 2WJPA 2CFCA 1P74A 4E21A 1CJCA 2VHVA 1ISFA 3BTOA 5EMHA 3FN4A 5FYDA 4LRTB 4CQLA 2H5LA 4IJWA 3WXBA 4E4YA 1QXSA 3OIFA 2EKPA 5A3JA 2DBVO 2UDPA 3JQAD 3H5AA 4BQPA 2GN6A 2B4QA 1LDEA 5AOVA 1DFHA 5L51A 3NKLA 2WE8A 1Q7CA 1Z73A 4NK5A 4J9UE 4O63O 2YV2A 4CQLB 4DLBA 1AHIA 3AUAA 2Y66A 2RAFA 1Z6ZA 3DBRB 4RZIA 2X86A 1R16A 1K2WA 5L53A 3ITKA 3CSDA 2PKQO 4WCFA 4BKRA 4BO8A 1ZCJA 5TJHA 2BFPA 1TVEA 2NU6A 2Q1SA 4MVJH 3U49A 2JAPA 5B12A 1XR3A 2ZTUA 4BO2A 3JQ9C 3PDJA 3RUHA 3HDJA 5G4KB 4CL8A 3H3FA 1U3TA 3VHRA 3F6YA 1GZ6A 1UAGA 4XR4A 1XLTA 3UH1A 3DBHA 3GZ4A 3SVTA 1YS4A 4C7JA 3JYLA 4D3FA 2P68A 1F8FA 1CEQA 1ZK4A 1DIAA 3JD3A 4DL9A 4YR9A 3QVXA 1OI7A 4FCCA 3WJAA 3QVSA 3FTNA 1G0OA 2GSDA 1L7DA 2O3TA 1HWYA 4P22A 3OF2A 1HDRA 3P19A 4XJTA 3ZNNA 2EHDA 1ZH8A 3BMQA 4IIUA 1BMDA 1LDNA 1DSSG 2Q49A 2ZB7A 3WGZA 3EW7A 4QO8A 2F1KA 1DFGA 1T2EA 3LT0A 4WNIA 5TF4A 4Z3KA 4CLRA 4RPLA 4E2YA 5HM8A 3LVFO 3WMXA 1C1XA 1JTVA 3P2OA 3EUWA 3WGGA 4OQYA 1KEVA 1H2BA 1XU7A 2ZQYA 4YJFA 5DCWA 4DQUA 2VHZA 4O1MA 4RPJA 3MTGA 1NR1A 1HZZA 3JTMA 3RBZA 3SJ7A 4J49A 3KO8A 5A9RA 3U5TA 3QP9A 3IP1A 2O2YA 2Y1OA 2IYPA 4XX0A 4YXFA 1YKFA 2JHFA 2VUUA 3NX4A 5A4DA 1NP3A 5JDCC 2DBQA 4CLHA 4L4RA 3GGGA 2FP4A 9LDTA 2FOIA 4B4WA 3RI3A 3LF1A 2HRBA 3QLJA 4XQEA 4F45A 1LLCA 1Q0HA 2C59A 3O8QA 3CE6A 1T4BA 4KWIA 3JQ8B 3U4IA 5T6BA 4CM3A 2IE0A 4NJOA 4QFDA 4BNXA 2EW2A 3KM0A 2EERA 1E3WB 3QSGA 4WUVA 3WGQA 2DKNA 1JQBA 5LC1A 3ZU2A 5T8KC 1WMAA 3DEYX 1IZ9A 1XWFA 3JQFC 3LT1A 4IMPA 4NK4A 5AVOA 4ZD6A 4RDIA 4LMPA 3ZU5A 4A10A 4PVCA 1E6WA 4NR0A 1UH5A 5CHEA 1LQTA 2FR0A 1E6EA 5TX7A 1BXKA 4QO7A 4JLWA 1ZO8A 5JO9A 4FFPA 3K30A 1U5CA 3VPSA 1I2ZA 4WEQA 3FCOA 5TSDA 3RFTA 1JW9B 5IG2A 1QV7A 4R51A 5BSGA 4R01A 4ZA2A 3D3WA 2GPTA 4A2CA 3DZJA 4L73A 1DAOA 3MOIA 1WDKA 2VNSA 1D1TA 2ZATA 4HBGA 3T4XA 3I6QA 1MC4A 5K1SA 2Q99A 4NU6A 5DT9A 5A02A 3AOEC 1Q2XA 4PLYA 3WFJA 2FSVA 2IODA 4DUPA 3OEYA 4PLVA 4MVJF 4WNCA 2VYVD 3IUSA 3M2TA 2LDXA 4TWRA 2WYVA 4E33A 3H9GA 4DXHA 1BDBA 4AJPA 5JCJA 4HY3A 3JQEA 4U6QA 4BO6A 3ZCXA 3R3JA 4BOYA 4BKQA 1HDOA 5B4TA 4LSMA 4W6ZA 3Q2IA 4PIVA 1U1IA 3WTBA 4CJXA 1ENPA 1NHWA 2AW5A 4BO0A 3K5PA 1DXYA 2EWMA 4A7PA 2O4CA 2QZZA 3ROMA 1B8VA 4HFMA 1WP4A 4RQUA 3OJFA 2D59A 2WM3A 4YQZA 3SC4A 2HU2A 2QIOA 4Z9YA 4YAEA 3ANMA 4DREA 3FPLA 1X7DA 2X23A 1IZ0A 5TT1A 3QJ5A 3L77A 3ZWAA 4K6FA 1T24A 4CMEC 5L7TA 2JJYA 3SBOA 3Q1LA 4R68A 1JKJA 1NVGA 4L75A 4BMNA 1PSDA 2HMWA 4GKBA 3GAZA 4PLTA 1FDUA 3OIDA 1ZXLA 3QIVA 5C37A 3FSRA 1NTOA 4PLZA 2R00A 2VOJA 2XPCA 3FBGA 1KEWA 1I0ZA 3OJ0A 4XGKA 4CL3A 1ZK3A 1P1IA 3ZWWA 4FIZA 1PJ4A 4NBUA 4BNUA 3I4CA 3QY9A 4LMRA 1HRDA 1J49A 1P1KA 2BH9A 5CDUA 1AUPA 3HFSA 1P1HA 4E2ZA 1O5IA 2BD0A 3QQPA 3BHJA 1ZK2A 1ISGA 2NTVA 3KETA 1I3NA 4L76A 4BV8A 1ENZA 1QSGA 4OO3A 3HADA 4MDHA 5KIAA 4XYEA 4ZQGA 5KKAA 3OJLA 3ADOA 1OBFO 1SEPA 3SX2A 1O89A 2J5RA 3ZWCA 5HS4A 2R6JA 6ADHA 3WWYA 3JQ7B 4BGVA 3ZW9A 3ASUA 4E5PA 2XXBA 1M76A 3H4VA 3ST7A 1HZJA 2X4GA 1NVMB 5KVVA 1E7YA 3H2SA 3RC7A 1NAHA 5BSHA 3S8MA 1SAYA 4WLOA 4CQMA 1MG5A 3A4VA 4LN1A 4J1SA 5I9NA 3GH3A 1EEHA 4XYBA 4ZQBA 1T4DA 1PJQA 5TJ9A 4B3HA 1A72A 1EFLA 3FWZA 1LLUA 3SJUA 4WE3A 1NWHA 2JFGA 1XYGA 2AQKA 3Q2KA 3ZWXA 2FHSA 1I24A 2E37A 3ETGA 1B7GO 1M75A 1QP8A 2NWQA 3H9EO 3KZVA 5I7FA 3VVBA 3QE3A 4A73A 2BF7A 4OHUA 2HJRA 3NDJA 3ZU3A 1GUYA 1H0KA 4NPCA 4PCVA 2UAGA 2PGJA 1ONNA 2X0JA 3AU8A 1SB8A 4CMCA 3JQFA 5A9SA 5EJ2A 1OAAA 2X5JO 5K9ZA 4MKZA 4XRGA 4Z0HO 1AE1A 4CUJA 4D45A 2SCUA 1I3LA 2VYND 4WLFA 2GUGA 3TRIA 2EIHA 3ETEA 3ZZNA 4PLGA 4LCJA 1YRLA 3BYZA 3EHEA 3DZIA 2ZCUA 3BHIA 2BGKA 1VI2A 3JQ8A 3MJCA 4KUEA 3V1UA 4ZQEA 5COQA 4XA8A 3FNHA 2CY0A 4BB5A 5AYVA 3OQ1A 1LSJA 4RLHA 2H6EA 4R1TA 2IYOA 4HFRA 2FPPA 4OL9A 3ZWNA 4DQVA 1YDEA 4RPHA 4R3WA 2RBEA 3M1AA 4JROA 1YJ8A 3NTRA 2VWGA 3QWHA 1ADGA 3IJPA 1C14A 5JMPA 2J3KA 4YAGA 2VYVA 1GV0A 3TWOA 4GWGA 5A3VA 5JDIC 5BT9A 2A92A 1R4MB 3TZ6A 4YAJA 2NM0A 4K6CA 1EVJA
chains in the Genus database with same CATH superfamily
2ZU0C 3FA2A 4RU1A 3AR6A 3E9QA 1Z4MA 5I9MA 5A9SB 3HPRA 2IYWA 1UBFA 1FIUA 1FMCA 3GF4A 2NNLD 3GPCA 3OCJA 5BW8A 2J3JA 3EMKA 3IDSA 4P4UA 5FPQA 4IJ6A 2FW8A 2F55A 2ZYTX 4IDQA 2QRQA 4NOKA 4KHPB 4I55B 4D99A 1SUIA 1TVMA 2LUOA 2G4LA 4AKGA 1KI4A 4NBLA 5AW7A 1GD1O 3CPJB 4Y6RA 1CUHA 2O52A 3QZUA 3S2FA 3N7TA 2YDYA 4K9RA 4QBGB 5JHHB 1I7SB 5AM4A 2YIMA 4KQMA 1XTJA 2BFBB 3UY4A 1K0UA 2PSEA 2Y93A 1X2EA 2GFQA 3X44A 3VKGA 1VC2A 4TT8A 3EEIA 4FZ5A 1BVYF 4G81A 1ZM7A 3DLHA 1Q3TA 3GFQA 3PYLA 4HEHA 1P4JA 1FDSA 2ISCA 3P0RA 2O5EA 5AOBA 3CXRA 2DUUA 3JASB 2ZE7A 3PYXA 4CDNA 2AZMA 4ON9A 4GO1A 2OC4A 3GOHA 1T5HX 1KAOA 4W7IA 1NW8A 3B2NA 5F2EA 6LDHA 3CV3A 4X8OA 3G23A 4IHJF 1MQ9A 5JXIA 4QE3A 2DWUA 4RZ3A 4EO9A 2UU9B 4YYZA 2CEAA 1O0CA 3AEXA 2RIRA 3IMEA 1RXCA 2GYWA 2VP0A 4QXOA 4O2BB 4DTIA 3TIVA 3AG5A 4AN1A 1U04A 3EZ6A 2Y0BA 3PKIA 4I6JA 1UJ2A 1MFPA 1PTJA 2OO3A 4MYTA 1Y4ZA 5DK4A 1N0WA 4DNQA 5KTPA 3KSBC 3DE4X 1BVUA 1I3OA 3JARA 1T0IA 2ATCA 3BWYA 4JITA 5KYUB 1N8TA 3Q8MA 1AJEA 5ULLA 3I28A 1GU7A 2Z5VA 5E6RB 3BMXA 1EHYA 4YAIA 1JFTA 2RB5A 4ANFA 1JDBC 1JRLA 2KQUA 1IPEA 3KR9A 5EQDA 5BY2A 5JSFA 3ZY3A 1Y7IA 1T1RA 4V0SA 1QGUA 3RW9A 4N47A 5BMOA 2AFHA 2A3NA 3FDZA 5A7HA 1NBWB 1HEIA 3VHQA 1U2TA 2FUKA 1KE1A 3S6JA 4C0WA 4TV9F 2ACVA 2ONJA 1YIAA 2ZJ2A 3S2EA 3HM9A 1QOPB 2GFHA 2OY0A 1T4CB 3SM3A 1V11A 3SYMA 2XF8A 5SYAA 2Q8PA 4Q1EA 5ALRA 2VJMA 3L4JA 3CVOA 3MTIA 3KLBA 5FI0B 1C1DB 5B6JA 1Z16A 1ZA2A 4C7XA 2ZUBA 2WJ3A 2WA2A 2WU1A 4S12A 2O6LA 7MHTA 1U0TA 2PYZA 2QPTA 3ZBQA 3QPVA 4G5FA 3GGPA 1PD0A 2QAGC 5DPMA 4RVOA 3RYIA 2VPXA 1JLHA 4X8HA 1FDRA 3EAQA 3F46A 4DZZA 1P61B 3TXXA 1PW5A 3H11A 3A31A 3X3HA 2B8TA 1HDZA 1PKXA 2AZDA 5DLYA 3TTVA 1B0PA 3S28A 1PR4A 1NVDA 4HXEB 3F3MA 1CDEA 3LSTA 5EIBC 3ANYB 3OLVA 1L7AA 5K0JA 2O5CA 3R5HA 4NXNB 1OGYA 4PGGA 3OTOB 1OV6A 4A26A 1FTGA 1FA9A 2BFFB 2LCIA 3JAWB 4IKEA 5JS8A 2DWCA 5KNBH 4MV8A 2DEUA 2JAOA 2O0MA 2E9SA 2Q4BA 2NVUA 1RJGA 3CY6A 4N40A 2FG5A 5FEMA 4LHSA 1E92A 1H42A 5C4GB 1R0LA 4NCXA 3DMTA 4MUMA 4RZUA 4GSLA 4KLAA 3LK7A 3DMFA 3X1KA 2VTBA 1N7IA 4GXTA 4R9NA 3KV1A 2H3HA 3T35A 4L78A 1ZJ6A 2GF9A 3UCEA 2IPLA 3PFBA 1TUBA 4Z54A 2C4WA 4OI0A 3OIUA 2OT3B 4PFSA 3UANA 4P0PB 4P93A 3KAQA 4GI5A 4GW3A 4EQ6B 3OT5A 4D9MA 2J9FB 4R31A 5B2ZA 1UJ6A 1W6UA 1XTTA 1AN9A 1EE2A 5IJ0A 2FB9A 3L5OA 5IS2A 1E9DA 4MGZR 2Q50A 2FMHA 1Y1PA 3OUUA 3QWAA 1E2UA 2VDRB 4B3JA 3RKUA 5CDFA 4B7UA 1YGPA 3AHJA 5KTNA 2A7QA 3N0TA 1AK2A 2VJYA 4LXXA 4D8XA 1WJGA 1YNSA 4DCUA 1QIIA 5F7OA 1XDSA 3ZQ6A 2PLRA 1TK3A 4CL0A 3R1IA 4EMUA 1I5EA 1XLVA 4V38A 3SEZA 4YRKA 2FPWA 3QV1A 2Y1XA 3CIFA 2UYGA 5BT8A 3QK7A 4JB8A 4XM2A 3IIKA 4DA8A 3KLMX 2V98A 3R7LA 4J0IA 2CB0A 3W7AA 4DIBA 1NM5C 3WHPA 3PHGA 3TZCA 3LI2A 2FUCA 1W0JA 3HS3A 4HWOA 4U5XA 4E7OA 1WDWB 3F6CA 3L0OA 3BILA 1JKFA 1L7MA 4RVDA 5FT9A 3ESXA 3ERCA 2HPVA 2PGXA 3FMIA 2WF9A 4Q7KA 4XQGA 4KVFA 4E88A 1RZRD 3INYA 1JU4A 1SBZA 2ONZA 3IEUA 4F3NA 4PZUA 1D5CA 3DMGA 1UBCA 1V5IA 1G6OA 3CCCA 4WBXC 4F1WA 2VT3A 2CDNA 2KSQA 5KYXB 3KELA 3LUHA 4B81A 2QTVB 5J2UF 4CIAA 4EJ6A 1J0CA 1T10A 2TMDA 3F6BX 2O5VA 1IHXA 1LF0A 5B64A 1W47A 4KQKA 5EINA 5K8UA 3MWFA 4KUGA 1VSVA 1QIDA 1MDFA 5BWNA 1FRZA 2DCUA 4B33A 2Q5FA 5EIHA 1T35A 1NVAA 1ZIPA 4MS1A 3KQNA 1ARZA 4F4IA 2ZZKA 4BU0A 5BV1A 5FKJA 2M6KA 5FOUA 3BK7A 4GLOA 2EFEB 3N6VA 3H13A 2BRUC 2FG7C 2C7PA 2ZBUA 1GP2A 4PZLA 2VP2A 1S8OA 1SU6A 4M99A 2LP4Y 3N0XA 1CG6A 2DTXA 4Z3OA 4QPZA 4L4UA 1RWOA 2JFYA 3TG8A 4BLPA 1NKSA 2DQKA 2HTEA 1SXJD 1DAGA 3PXAA 2FZWA 4X6UA 4CR8A 3NOOA 4C4ZA 4D98A 2GCOA 4ZYUA 1DKRA 3AESB 1YBHA 1YHNA 3W05A 5JQGF 3PC7A 3BAFA 3KRTA 3CZMA 2WTXA 2JCBA 2YWFA 1BA3A 3PE3A 3JXEA 4ARIA 1USGA 4J0JA 2J30A 1D9ZA 3HA5A 2JAXA 2WUVA 3BE5A 4TV9A 4XVQA 4B6PA 4LPKA 1UJBA 3WLJA 4N3BA 5E9AA 3K09A 4H77A 3UK0A 3ZDXB 4DLYA 3PUJA 4FFDA 5FHQA 3SSMA 3HJRA 1Y3BE 4U9UA 3ZWVA 4C4OA 1CUFA 1DADA 2NQ2C 3DBLB 3PHBE 2G9NA 5TGDA 2XBUA 4JJ8A 2O2ZA 4BBPA 2FWIA 5DTRA 1FRNA 1TUEA 2JI9A 2PLFA 3G7SA 3IP5A 3OZRA 3QA9A 3DS8A 3I05A 4YP9A 3KXDA 1VZ3A 1GL7A 1LLDA 1XTRA 3QBDA 4RK4A 4XOUA 2XUHA 4S1VA 4BNFA 3URKA 4QKQA 4NZMA 5LXTF 3F4LA 5EMKA 1SCJA 1X3SA 4FJ1A 4XIFA 1V71A 4LJ7A 3ZLBA 2ACWA 5HF9A 1VJTA 2WWGA 3N05A 3WQBA 2ZE5A 1HE2A 3NNSA 1ETHA 2D1YA 2HMUA 3HBMA 1IULA 1NY5A 1ZN9A 4AG5A 3OICA 1FLNA 2YYAA 5FQOA 4URXR 3MGBA 3BWEA 5JH7A 1ZJZA 1SEVA 1ZXBA 3GK3A 3Q7QA 4BFLA 4W5QA 3OFND 4C22A 3ESZA 1FTYA 3D4PA 5I4CA 4IMJB 4LRXA 1RIIA 1URPA 4L15A 2JAWA 4UZEA 1YK1A 4HNUA 1BROA 3ZYCA 1JG2A 1X0VA 4RW0A 1SIWA 4LNUA 2A1TS 3T7CA 5C1PA 1Y7PA 4L0DA 5FI5A 1Q0SA 4P7JA 1Z0DA 1EK1A 4PIPA 5AO9A 3AF3A 1KYIA 3U4DA 3F9RA 1IDN1 2CC2A 5LJIA 5KWSA 1QVZA 3EIHA 2YRWA 4IIHA 5CB4F 1WPGA 2JVKA 4BO0A 5KPDA 2JBHA 1X8KA 4B31A 1P4SA 2J3DA 4OKNA 3QKSB 4RX1A 3UXHA 1Z3IX 4R1SA 1F2UA 3WB9A 4DCVA 4BO9A 3ISJA 2CXOA 2YC4C 1C29B 1IFXA 1Q0LA 4FW8A 5CIWA 4B6QA 4N41A 1KVRA 3FB4A 4HP8A 2C0CA 3RIHA 4YP5A 3MJRA 4KQWA 5I3CA 2P11A 3TTWA 3CVVA 3WKCA 4HLQB 4ZVQA 1I9CA 4OI1A 3N2GB 4EJ0A 3JR3A 3K92A 1OMOA 3TAXA 3KPJA 1PL6A 4AO7A 5KSPA 3ZD9A 4QQRA 4WKPA 3MPUA 4LXIA 5AVJA 5KX5A 1AMNA 4WHMA 1ZR4A 4CR6A 1CRZA 4M89A 2GMWA 1TU3A 2FEWB 3ASZA 4IOLA 3N75A 4ZWNA 4AY2A 2W6MA 2ZGVA 1VE3A 4PYMA 3CPSA 2JBAB 1VE5A 3E1GA 4D46A 4FMDF 5K0FA 3KFVA 2TS1A 4XYGA 4WT7A 5ALPA 3AGQA 3REOA 4TRRA 2V1XA 4DYVA 4B83A 1FK8A 1LSUA 1YR3A 4QDUA 3I9KA 2RAPA 3AFGA 1YL5A 3LA8A 5LOVA 4LWPA 2QEQA 3B6EA 2D6FA 3H2YA 2H48A 4GWKA 1F4LA 1H3EA 2JCYA 4KWEA 5I47A 1Z6XA 2O3UA 4XQ9A 4B8WA 4Q18A 4C2BA 1QVWA 3JQDA 4J43A 1ISHA 1L5WA 3AJAA 2QMUA 3IPXA 4M1SA 5DGTA 1Z0IA 3INNA 4UU7A 5CVUA 3VO9A 3ZLUA 3DZDA 4DLKA 4NNPA 3J81A 3RJ5A 3GJ5A 3PR1A 2C98A 5FV4A 1LBQA 1V6AA 1TJ3A 3PSAA 5CPFA 3GO4A 3PXEA 4H27A 2YMPA 2GZRA 4D42A 2QUJA 4MUJA 2O5RA 4RCYA 3SYKA 4BB0A 3IEXA 5JWRA 4NBWA 3LRPA 2JGJA 2ZYIA 2GK7A 3NT5A 4WL0A 4AX4A 4DM3A 5FJIA 1TECE 1T5DX 3V7NA 2NZXA 3AF0A 4TM8A 5ISMA 3WI7A 3Q5GA 4W5OA 3GW8A 3WBBA 4RVSA 2O50A 3RVKA 3HU2A 3I0ZA 2WDZA 1HTTA 1L5MA 5LYJA 4DJTA 4R81A 4F21A 4Z49A 2XZLA 1PL7A 5AI9A 2B3TA 3RGGA 2ZK7A 2ZR8A 3FI9A 1ESEA 4IGKA 5EYPB 4WQMA 1RBMA 2IA5A 1X8JA 1QIKA 3ZHRA 4PU0A 5EJEA 3K0SA 2EKLA 2B2NA 3UKOA 2Q07A 4XVCA 4ZK6A 3MAAC 1IHDA 1N25A 5EG5A 4YGXB 1MB3A 2GZAA 2VLIA 1OR8A 1AQYA 3AK4A 2ZI5A 4MJXA 3TLEA 4IXDA 4AWBA 4EUSA 1KFEB 5J5AA 3A6GA 5DM1A 2LNDA 1AK9A 1PLLA 4DCCA 1SCUB 4TXNA 1I4DD 3QBTA 4UCWA 3TSAA 4C2UA 4ECEA 5FULA 4KWHA 2EJCA 5BWCA 1GNQA 1QS0B 2QRUA 1VPVA 3CZQA 4CKEA 2A0FA 2WUWE 1RRCA 2IXGA 4C01A 4BB9A 3KYCB 1WR8A 2IVFA 4ZDIA 2ZRFA 4Y0AA 5IWAB 2QW0X 3PR3A 3CNOA 5CXUA 3E84A 3K4PA 1LQUA 4G4IA 4ZQIA 1J2RA 1XZFA 3UK2A 3ZIAA 5KBYA 4P6VF 5DWQA 1F38A 4K8OA 4F04A 4H0CA 3TR5A 4ARBA 4AJLA 1FY2A 4IP0A 4E5NA 5IU6A 5FBQB 1IJBA 5HMLA 4J2TA 4M7WA 4C06A 2B37A 3DT9A 4XPZA 3L9XA 5ICMA 4OUDB 2VP5A 4L5JA 4P82A 1Q7TA 2QGZA 4KRFA 3A28A 2B0JA 4Z0PA 2BEUB 1TZKA 2IUTA 1Y1TA 3G0OA 2ZS8A 2XAAA 2PT7A 1SGWA 4MYDA 3VV3A 2VA9A 3VNRA 5JXGA 5K5EA 3PNLA 2H9IA 4DCMA 1DJQA 3PXGA 3JAKB 4YCCA 5CB4A 3LPLA 1E7SA 3G3EA 3Q9NA 4N5LA 4RTOA 1B8UA 2ZDGA 5CLQA 4G0XA 2PQMA 1AMOA 1PSZA 2I9PA 4HHEA 2JLUA 2OXEA 2BFDB 1C4XA 5I8PA 1RYFA 2I2WA 1U8EA 3HZRA 3NWOA 4LJAA 3SQMA 4D9BA 1RI1A 2AR7A 3BOSA 1Q77A 4YPOA 2QUAA 5BSFA 1NAIA 2VAVA 3ZV6A 5LYJB 1IQRA 1M9NA 2BKEA 2O3RA 2I65A 2HGZA 2RBGA 4LOKA 4M49A 3BE4A 2W22A 4FNGA 4P92A 2Q7XA 1O96B 1Q95A 1XDDA 2ZRLA 5K4GA 4J7XA 1P1CA 4V03A 3O84A 1ZJ4A 3QF4B 1MOQA 1N5LA 1E2PA 1NJSA 4LDNA 2ZULA 2J4CA 2HHLA 1C8KA 1E2KA 2Z0MA 4EENA 4FDVA 3IH5A 1OF1A 2JLYA 4OXNA 2UVDA 1KJJA 1VL2A 3DPIA 2AYXA 4L02A 2YR0A 2A14A 1V16A 1WW2A 2D1QA 2GJSA 3Q8LA 1WB4A 1FYDA 4NYIQ 3NVDA 2I6GA 5UKDA 5IVKA 2QMHA 4XD7D 5AKJA 4P7GA 3IKMB 5LOVF 4HQKA 5AJVB 3NIFB 3L7YA 2A6PA 3N3AC 4N4AA 4FMPA 4KH1A 3CLRC 3TMYA 3VZPA 3E9MA 1MW9X 3V1YA 1TL7C 2JGAA 5JAQA 2EKZA 1A98A 3NBYC 3X43A 5IK2A 1RVDA 4FDAA 3HCFA 5JI2E 1LU9A 1UXJA 3V4LA 4OX9Y 4KU4A 3GJTA 3UMSA 2HCBA 3LBHA 1E3TA 3L07A 1UBSB 3C6ZA 2ZXEA 5C80A 1GCAA 2B1GA 5IFLA 1JMVA 3VZQA 3Q11A 4Z8XA 1A2KC 3CIOA 1BQ4A 1KY2A 1XE3A 3KYCA 1G21B 5JAIA 2SICE 1MTOA 4DARA 3DOIA 4MW7A 1M0WA 4UUPA 1S2IA 3ROKA 4FCWA 4BU1A 1B6SA 3EFBA 1XNQB 2PBRA 1ZUIA 4FB4A 3DV0A 4YMIA 3EDQA 4MOWA 1CW2B 1NF9A 2JGNA 4ZEVA 5FRDA 5EUQB 1W2HA 2VSNA 1L5SA 2QD2A 1SCUA 2Q21A 3LY9A 1RYEA 3GZTB 3HM2A 4ARVA 5EHGA 4DNOA 4QLBA 5BR4A 2XF2A 3P0JA 5KTTA 2WZCA 1SUFA 5F78A 1A7UA 5FA8A 1XMXA 3BCHA 2Q3JA 3TQHA 1AKWA 1F14A 1AY0A 3JQRA 3KBOA 3P0FA 2Q28A 1R5JA 2XTMA 2OORC 3IOYA 3KSRA 3O5AA 4MRNA 2VSFA 4MI1A 5AJYA 4GGPA 4EX7A 5AM1A 4BMCA 1NP6A 1QCCA 5F3DA 2D5AA 1SFRA 4BV9A 1M2OA 2ZSEA 2PBLA 3AL2A 1EH5A 1CUGA 1YKSA 3W3AA 4M9CA 4UZSA 3ZZMA 2Y71A 3L6RA 4ZIRA 5HJEA 3SZOA 3SC2B 1KIMA 2ZQZA 3GT7A 3OU2A 3VNBA 5B7GA 2RH8A 2GDJA 1DO0A 3PYMA 3K5HA 1EX6A 2ILVA 1K5GA 2RGAA 3FMPB 1CP2A 4LZPA 5F2KA 4TMFA 3ZDFA 1QRRA 5KJFA 1JAHA 4HDKB 3SYLA 1L4YA 4GEGA 1JKXA 5GM1A 3EE6A 3GGJA 2OZKA 2Z8YM 4OGLA 4E15A 3NQ41 3IQGX 3CNHA 3HJHA 3CWZA 3TQSA 2XDQB 1PR1A 4PGAA 4C0AC 1R0BA 3K0CC 2PT5A 2OYCA 1RKXA 1C80A 1VTKA 2V6FA 3AESA 4RF2A 2P1ZA 1RCFA 4CL2A 5J43A 5LQJA 4NBSA 4R0MA 1J90A 3ABRB 2PMKA 3F98A 4XVUA 1R6TA 3VI4B 4M76B 3RVNA 4C0QC 1ZISA 2HK6A 1YDMA 2WSLA 3GC6A 4Q6BA 4DSAA 2OHFA 3K0FB 2V7QA 2JANA 1UZUA 2VUTA 5D1NA 2NVUB 3SX4A 3TEJA 1A9QA 1SA0A 3GRVA 3R75A 4IGEA 1AV7A 2H2IA 2DE0X 5IXJA 2HB6A 1K1EA 2CXSA 2ZSJA 3DBLA 4HC4A 4M60A 4MQEA 3A25A 4CKBA 2RI1A 3BGSA 1LV8A 1RYMA 1XL0A 3A1TA 1RPNA 1PZXA 2JLQA 1V2HE 1IWPB 1KP3A 3KJZA 1ZNXA 1Q11A 3QYPA 3D4IA 1WXQA 2F17A 2HWUA 2CXRA 2H65A 2RBKA 3DOHA 3HUUA 3UMYA 2EXXA 2YNMA 1ZA1A 4M53A 2A1UA 3IPLA 3RYIB 3V1LA 3ZKWA 2Y1EA 1FYFA 1N5DA 2ZJOA 4X1YB 4FTWA 4LOIA 3RSFA 2PKWA 1CZHA 1KH3A 1LZLA 1N3BA 1XRNA 3KAJA 4EL5A 4HWSA 5AK4A 5DT2A 3IALA 4G5SA 3BZUA 3OX4A 2H08A 2MJLA 2IYAA 4FZ3A 4HFJA 1M6HA 3NKVA 4HMOA 4P3YA 1O1YA 3ILXA 5J47A 4M0EA 3HSSA 4YJDA 4CCAA 1SQGA 2CDRA 1E0DA 5JXJA 3TF5A 2R8EA 1G8HA 2D5CA 3BHMA 3LLSA 2ZUTA 4AZWA 3MFYA 4RHCA 2GPBA 5EMJA 5DEIA 3HLKA 2YMLA 4QGSA 1FBTA 4EGCB 2PTGA 2AG0A 1PKEA 5P21A 5TQ2B 2C7RA 4WZ6A 1GPBA 2Z2YA 4RVFA 16PKA 1PZEA 2WD8A 2GAOA 3IR6A 5BMVA 2XQKA 3JARB 2C8JA 2P9QA 2R5NA 3MELA 1AM4D 4BMOB 4IJUA 5ENVA 2FFJA 2J8ZA 2XYVA 2FG6C 1TCBA 5FNVA 3NV7A 4XWTA 2PZFA 4ND8A 4YRNA 5L3VA 5ALSA 4M0FA 2F8LA 2WNSA 3PXBA 4R8VA 1EVLA 4H16A 4EHIA 1JQKA 4TLEA 5CYGA 4RVCA 4LRSB 1OYYA 5EMMA 3R7WA 4MDEA 1F6WA 1FFGA 4NS1A 1L2TA 2KWIA 5IZ4A 3NETA 5L7WA 5DBOA 2WKSA 2DFTA 3QOYA 1HDYA 1SUBA 3SOZA 4I55F 4JBNA 1YL7A 2AHOA 3B9QA 2HU7A 5T4FA 2RHRA 5T64A 5IDYA 4JELA 1DQRA 1LGYA 5MGBA 2HPHA 1FQWA 1SM4A 1J1IA 1EU1A 1VKZA 1NE7A 3TI9A 1N36B 1ND5A 2CHUA 4RHYA 3WNQA 4ZV7A 5EWMB 3AV3A 1ECPA 5LLDA 1PIWA 3I4FA 2YTZA 4NCIA 3W5HA 4C9BA 1GTG1 1T26A 3MWEA 5AXAA 1SXGA 2D5LA 3IB6A 1JAZA 1AIPA 1HFWA 1VHJA 3VZSA 4BN4A 3LG2A 4IM7A 4KR0A 5A9TA 1AQ6A 2ZVQX 3D6VA 3MW8A 4YUXA 4YX9A 1Z63A 1VJRA 4RSMA 1B0AA 3P2YA 3LIIA 2C94A 4FSDA 4H35A 3TQRA 2FXVA 3UBMA 4N0DA 5JD6A 3BEOA 2VTVA 4MINA 3THSA 1XD2A 3IQHX 1U2PA 3KKZA 1N8SA 2XDQA 4N49A 1C3EA 3NRJA 1I6KA 3RAJA 4Q82A 2IEBA 1QH9A 3KYBA 4UBNA 5AXDA 3EEFA 3MIIA 2PX5A 5B3JA 1DPFA 1UF9A 4KB5A 2HQOA 4TTIA 5KTRA 5EVJA 1H1LA 1Q83A 3Q6IA 5CFLA 2NSYA 5KTYA 2VQFB 1K98A 3QEMB 1VL0A 4DZRA 1AA9A 2V3WA 3GNLA 1DO2A 1VLLA 2O0HA 5DN9A 4QQNA 4LVUA 3DV9A 3T38A 4UKDA 4BX0A 4EZEA 2MR5A 1SELA 3M6IA 4MB6A 1QF6A 3LUJA 3SHFA 1IHOA 1K9VF 2IDZA 3LCUA 1ZUNA 1ZFNA 2CJXA 4OJTA 2R5FA 4JLVA 1CUUA 4DHWA 5KWIA 4ZI7B 4MRPA 2VHEA 1TIKA 3UCFA 1E3MA 3AIKA 1QGUB 3NHSA 1GKLA 3ZJ4A 3C3YA 4L0MA 5FO0A 1JH8A 4NTZA 4URVR 2BE7A 3F8TA 4Q9JA 3FI0A 3EH1A 3QVTA 1EWTA 1SBIA 2IIBA 1CYDA 2P79A 1RBYA 3PITA 4S24A 3ZTTA 4TUYA 1AKQA 3EIQA 1M0TA 2HBRA 5ICGA 1RFGE 3VJMA 2OHGA 2QGFA 3HV2A 4FFBA 5CRIA 4BNDB 4A91A 4FCVA 3DBVO 4HUJA 2BFOA 2NW6A 4YLEA 1Z4PX 1ZS9A 4L7QA 4S1OA 1J1ZA 2C4VA 2MSEB 2WHXA 1QMPA 2JCXA 3H65A 4TX1A 4WASA 4EA8A 5DIZA 3ZXXA 1YVPA 1THGA 3F7NA 2MWMA 3RVSA 4ENWA 2OAGA 1FXWF 4JASB 1MXHA 1W76A 1YJQA 3L0IB 5IFKA 4G97A 4FFBB 1PQUA 2YOHA 4FFNA 4F93B 3T3GA 1UWCA 1A9XA 4GKJB 1L7BA 1TMGE 1T34A 4HYQA 3DKVA 2BM1A 3IQXA 1SMKA 2GKOA 2IOFK 3W4IA 2QT1A 4ZJZA 1Z7GA 2K2WA 4J1QA 2AFIA 3WMWA 1KERA 4AJ1A 1UZLA 2P6UA 3GCWA 4TWBA 3GFGA 3CNBA 1R8JA 4TLDA 1J00A 1V6CA 4PC7A 2P2SA 1RP1A 3GHYA 4GPEA 4HQNA 1PGOA 1XFAA 5LDHA 4INOA 3TN7A 1HK7A 3BQNB 3OWOA 3PX2A 1RWWA 2I22A 3Q7TA 4PHCA 3O4RA 1CJKC 5LMCA 2B5VA 1YFLA 1WMDA 1ZUNB 1TF7A 2J9RA 1YZTA 2GRAA 2YVQA 3DWIA 3HNRA 4DJAA 4E4RA 3GJXC 3JVVA 3MCAA 3QJYA 2NXCA 1MAHA 3WYDA 3SM9A 1IU9A 2Z2IA 3TTUA 3ZPXA 3OHMA 2QUKA 2QYTA 5EGSA 3ZCQA 3H1FA 2EF1A 2VBCA 2W6ID 4GXQA 4JSTA 4O8CA 2FZEA 3EFOA 4RHTA 3BDAA 3I9JA 3RODA 2CT8A 2ZJ5A 1RLMA 4IOMA 2PGAA 1FUUA 3PC3A 3PNOA 3UUGA 2WLTA 4B87A 3DFZA 1IPFA 1V43A 3T1VA 1VJDA 2PU5A 5TQ2A 4INJA 3IRUA 4B6EA 1B2LA 1SOMA 4NBNA 5FTJA 1E1MA 2O05A 3WL6A 2G9QA 4UUOA 4PBSA 1C0PA 2IUUA 4UAUA 3HJTA 1SURA 2OL4A 1KQNA 6YASA 3WGIA 4G41A 1DZ3A 1UDCA 3DP9A 3E4DA 2YWRA 4MZXA 3OZIA 4FHGA 3WHLA 5HQ3A 1XAJA 1QX4A 1OFGA 2VT7A 1LB1B 5ALFA 3UJAA 1QIGA 5AXBA 3I8OA 1RS0A 5KVSA 1B3RA 1QO7A 1CXZA 3SF8B 3UO8B 3MFQA 1UBEA 2XIQA 3KKKA 2AJBA 4XYMA 4AJEA 2GNPA 4I4IA 3IV9A 4JKIA 1A04A 4P22A 4QTZA 1N57A 4CZ2A 1KNXA 3TECE 1FFHA 4MLZA 1PT6A 3U1VA 4QXAA 1Z9BA 5ITZA 3TOVA 2WM9B 3DQPA 4NICA 2Y0EA 3G79A 4KPFC 4RJJA 4IUYA 2JGDB 3RARA 1QJCA 1FPQA 1PJLA 3MOGA 1Z15A 2H63A 2J0UA 1O8BA 1KSFX 5HK8A 1RAFA 5EWLB 4PO3X 5TXGA 4X71A 3VXKA 3PRYA 5H59A 3RSHA 3ZWMA 4DMUB 4PG5A 2EJVA 3DE0X 3DOOA 3MRTA 4XRRA 2CVQA 1CS0A 1AQNA 2GM5A 4ITUA 3QOWA 4Y2QA 2AXNA 2B6NA 4RFLA 4CUZA 4K3VA 5K0LA 2VNAA 2YMMA 2B1RA 3OJXA 4HAIA 4Q1BA 2YVUA 2QRKA 5BMVB 3ZHYA 5KQMA 1WMSA 4L3VA 2D00A 1D8AA 3NOXA 3BL8A 4F2DA 1U90A 2Y0CA 1XF9A 1XQWA 2QQGA 2PT6A 4FP9A 1E59A 4FBGA 5J5CA 4QG7A 1ZGCA 1DKOA 1CJMA 2X1HA 1A7KA 4K2HA 3TX2A 1EHIA 5KYKA 2OVFA 3E5MA 3RTDA 1QIMA 3SYRA 1Y8CA 3OZUA 1H94A 3QG5A 4K28A 2PFKA 3B1JA 4ZQHA 5EKXA 3TFOA 3WIVA 1JIJA 1OA1A 1UFRA 3VOBA 4EWLA 4BUCA 3VR3A 1UBGA 3ME5A 2W2MA 9MHTA 3AM1A 1U8UA 4AZ3B 3RRFA 1VI5A 2C4UA 2VZ8A 3KDAA 3V4ZA 3RC3A 3I5XA 3V7UA 3OY2A 5D7BA 2RHGB 2ZB3A 1U81A 5LD2C 4DV0B 1PZGA 2H4WA 3ML1A 3EA4A 3GRCA 5GVRA 3GJRA 3OOEA 2K6GA 4OJQA 3GLHA 5CDYA 3UHOA 2ZRNA 1MGPA 2NGRA 1R6VA 1MB2A 1XRQA 2XNDD 3D7RA 3E7PA 4US1R 3UMJA 3I0NA 1NUAA 2IS6A 4M9SA 2PWBA 4PGHA 3D9QX 1R0XA 1V1RA 3MCVA 2VHUA 2HWYA 3AYZB 3H6KA 5G0VA 1ETUA 5ICCA 4IQ8A 4JP5A 3OHPA 2IV7A 5IHPA 2KS6A 2QLMA 1P31A 4ENVA 1JSCA 3KL4A 1G3UA 1CZKA 1XNJA 4ZJYA 1RABA 1SA0B 2PS1A 3D2LA 3NV9A 2CV2A 1Z2OX 1S01A 1XZ8A 3LC1O 4WKNA 1HTBA 2NADA 1M8KA 3E9CA 4MKRA 5TVGA 2YHUA 1QLHA 4FFWA 4J7UA 4F9EA 4LJ5A 3CFYA 2PGLA 1ISRA 1O6CA 3TLAA 1JEEA 5JY1A 3KAPA 2HT6A 3NP7A 2P9ZA 5E2BA 3RKSA 4AM8A 4J76A 4WD3A 3BXXA 2HA4A 2WSMA 3L8CA 4PXAA 1W94A 3GUVA 4L51A 1EQUA 3DJYA 4QJ4A 3WSTA 3ZR4B 5FPHA 2WWFA 5C7OO 2R6FA 4R1PA 2H4XA 3OC0A 3PRJA 1Z33A 4HTFA 3PS9A 4D9EA 2Z9DA 2BTOA 2B61A 3OT1A 3R9KA 1IXZA 1SHZA 3PIDA 4F4FA 1C9MA 4POAA 2X2FA 3PFIA 4MQFA 2QMEA 1IBMB 1V4NA 5IYZF 1KJNA 3N74A 3R20A 2VEOA 5AKIA 1DC7A 3G2HA 1QQAA 3BXEA 2VDKB 1VYTA 2BR4A 3U0VA 1VE7A 4WNAA 4Y67A 4YAUA 4C21A 4L8GA 2PH1A 3EXHC 2X6QA 1QCDA 4YCMA 2HUNA 3KSDO 3GLIE 3C85A 3JW8A 3IHLA 4X84A 3K5WA 4JVOA 3WJ2A 2G4CA 1IY0A 2V6BA 4N0QA 1SCQA 4GAEA 4UARA 1O58A 1PNOA 5F21A 3RWBA 4TSKA 3BL6A 3QXSA 1JVSA 1VKNA 2O2IA 5B3AA 2CXUA 4OSEA 2MSKA 3TKAA 3WOVA 3BDIA 3PPXA 2O8DA 3EK2A 2VRCA 4QGAA 3Q3EA 1L5HA 2JGEA 2ZJ7A 5JW6A 1ZYUA 2EGUA 2V3VA 4DDVA 3VM6A 4J2HA 4GP6A 4UJ3A 1PFVA 4WOPA 2R68A 3AM3A 2O9JA 1F9AA 2O3JA 3EGDB 3DHWC 3F5FA 1UM9A 4OAOA 2BUCA 5E38A 2I4LA 3AJ9A 1RZUA 2R1VA 1LVHA 3P9YA 4RIHA 1ACJA 3VSDA 5T4HA 1JZSA 2WWHA 4JBLA 4EHNA 4QTUB 5A2GA 1DBRA 1II0A 5LYYA 2NO7A 2C92A 4X0EA 4BO4A 3AETA 3WNBA 3SXJA 1TMYA 2ZWVA 3KTAB 4H1HA 3VNUA 5I7SA 4RORA 4CMIA 2AI1A 1CQIA 2OKCA 3GGDA 4NC9A 5FUMA 3AVOA 3I8XA 3TS1A 3PHLA 5AVQA 3FDJA 3VDRA 3UJBA 1UADA 4DIFA 1VIDA 2LTAA 4PBRA 1IATA 4RVGA 4BPRA 4BNYA 4GZ6A 4ZOEA 3SBEA 4C0LA 5BSVA 4KR2A 2YZKA 1S3SA 2D0IA 3E6AA 3NASA 2HLDA 1E2JA 4DG5A 2JW5A 1YZNA 1J9EA 3DEHA 3HKDA 3OZBA 4CODB 2TECE 1WTAA 2VPZA 1U02A 1ZSNA 1Z17A 5AI6A 2X7JA 5AJTA 2YV3A 3EY4A 4E14A 1RRFA 4OHRA 2XCSB 3WJ7A 2PKYX 1EUDA 2I6XA 2YVLA 3DEFA 3H05A 3LZCA 4U2EA 2PANA 3MTEA 4M1ZA 1YV9A 4R2WA 3STXA 1SOWA 3TXYA 2BZ0A 4A0SA 2J09A 2GF0A 4TWIA 3A36A 1Y6ZA 5ARCA 2EQAA 2LCFA 3DLPX 1NU8A 2X14A 4NYIR 1P91A 5HILA 3RAEC 1UFKA 3Q0EA 2FPXA 2PR2A 1DARA 4G0NA 2HCJB 4GLLA 4KE7A 1CULC 1G55A 4EG1A 5FCDA 4R8KA 3QEBZ 3HRHA 3I5UA 1L3IA 1YCHA 4KR9A 3UAZA 3K0AB 3ZDZB 4F91B 2RK4A 5FR1A 1VCMA 4C6RA 4GI2A 3LQYA 4ZGWA 4K6HA 5KQSA 2YVAA 1BS2A 2COUA 1N9GA 2REQA 4PRLA 3ZLTA 4BIMA 4BBJA 3DVLA 4UCXA 4RCVA 1R9JA 2WJ4A 3HHPA 3VU3A 1I32A 1VPTA 4A3SA 2WHYA 1SHLA 1KIFA 3FZQA 2D0PB 2DT8A 1NXXA 1XJCA 3I2YX 4HSEA 4O1HA 1L4FA 1V8ZA 4EKGA 4HB2A 2PLWA 4KXWA 3OD5A 4Q3OA 4X65B 3I52A 4G8DA 4MGKR 4U6SA 3HBAA 4UUAA 4EUKA 1LKZA 2EFJA 4ZTUB 2LDBA 3ZXIA 2R4QA 4FFLA 3TLMA 4DA4A 2VDLB 1NOIA 4OI2A 2FLKA 2OCDA 4C1BA 1UKEA 1UXIA 1BYIA 5B3KA 3HB5X 3DHEA 4DB2A 1EGVB 5CDGA 5JROA 1NLFA 3K73O 3UK1A 4RF5A 2YXBA 4BE4A 4KTVE 1LH0A 3CLHA 1KRXA 3IP9A 1Z38A 2IYNA 3AU9A 4B3FX 4U7FA 3D64A 5EIOA 4YXWD 4EPWA 3FYHA 4JR2A 3IAEA 5ESWA 4CG2A 5KNCH 2NN3C 3JAKA 4F5DA 5EEHA 5LIRA 1ZN2A 4QGBA 5CJJA 1IVSA 4QHSA 4DSTA 2BFAA 4TPKA 4G65A 3B1ZA 3TUIC 1ZM2A 5CPBA 1E32A 1K86A 2UZ0A 3MCZA 2YIJA 4ARZA 2HFKA 5CGQB 4CEJB 3G2IA 1JJVA 1L4GA 4M3NA 1LK5A 2YXEA 1EVYA 5A0TA 1GL9B 3DE1X 3LZDA 3RVOA 2HSDA 3HB4X 5F2OA 4F5ZA 1OBVA 2REOA 3Q7RA 4Z4CA 3H9BA 2ZRPA 4PHGA 2YIVX 4HNRA 3QUCA 4HS4A 3L04A 1ZQ1A 3ZXYA 1K6IA 3FRHA 1FX0A 2O8CB 1RYYA 2CK3A 3E18A 1NR5A 2GARA 3IEPA 5TE9A 3VPGA 5FJJA 2Y0DA 3R7BA 3BAZA 3WFIA 2EX4A 2AOTB 1PJ3A 2H2HA 1OFVA 1Z2NX 2IYRA 3P8ZA 5COBA 3VH3A 4YT4A 2P9EA 3VNQA 5IAOA 1CRPA 5LMZA 3WYCA 2HF8A 2BWJA 1M67A 1FRVA 3VKFA 2C2GA 4HZUA 3ZNPA 1RXYA 2H29A 4LDRA 3T95A 2OV3A 5ARDA 2AN9A 2PSFA 4WZBA 3QWIA 3NC4A 1U8ZA 2CLDX 3HABA 3HXLA 1BEUB 3FNFA 2JCVA 4MUGA 1KMHA 2FPOA 5JU6A 1EFPB 4OHVA 1I4LD 3DDSA 1BGVA 1WXIA 2IZ7A 2R87A 4RXMA 5REQA 3WTCA 5A5DA 1Z28A 4EQ6A 4Q4JB 3LZ6A 2EL9A 3QWBA 5IK2D 3EPHA 3EVCA 3BRWA 5C0OE 2WIDA 4RPCA 1AZSC 2BAGA 4KDFA 4RFVA 5B53A 2FFAA 4DRZA 1UK8A 2AN1A 3LPAA 4OBBA 1HSZA 3MMXA 1PS0A 2QUHA 4DEXA 3NDPA 4ARZB 1MKYA 3ZW8A 2WMYA 1DIBA 2WKQA 3ZY5A 1OU0A 2A35A 3NTOA 2H51A 4N65A 2AG8A 1HXHA 2HA3A 2R8ZA 2AYZA 4Y6QA 4FMCF 4R1OA 1Z35A 3TQCA 1NXVA 3CLKA 4RXUA 5CG1A 2G83A 4ENRA 2AFIE 2WHRA 3B7WA 1USIA 4ZYTA 4DJ5X 4JIMA 5AW9A 3NDBB 4CV0A 4GUAA 1QOQB 2ZZNA 3LO5A 2NPOA 4IGIA 1X7ZA 1JA1A 4FLEA 4IIBA 4DUYB 5E2AA 2ERYA 3VZCA 3Q6NA 4R5MA 3EEQA 4EMTA 3SS8A 1Q1NA 1W5TA 2IIPA 4RFSB 2WQ6A 1GGKA 4FCTA 3DL7A 5ECYA 2A9PA 2YJ5A 3KYDB 2DHQA 4ESVA 4LF9B 1GITA 4EVSA 3RT7A 1BX0A 3QW4B 1II9A 3A0RB 3IOCA 3HR7A 4ESHA 3PJGA 3ASVA 1J8YF 1POWA 3CKKA 3KQTA 3N0RA 4JGBA 5ER9A 2I9KA 4CIXA 3WE7A 2YDXA 4CM7A 2PT9A 2HL6A 4OGWA 3VKWA 1GU0A 3GEIA 4EHHA 3V3KA 4FEYA 3HI6A 2QLFA 4DANA 2QNBA 4RL4A 5CBPA 2NU7B 4JEUA 3IDOA 1ZD8A 2J32A 4JI7B 1FYEA 1WCV1 4J6EA 2ZZMA 3BFPA 2EKQA 4FE7A 5E6RA 4GECA 4BDTA 4DA6A 2QJRA 5GONB 2X9QA 2ZKLA 2B1QA 3I2GA 4UULA 5DHAA 4AU1A 2XJ9A 4YJHA 3ZGLA 3R0VA 4R98A 1P5ZB 2H17A 3U3XA 3DMDA 3L8MA 4RKEA 5TS3A 3ROPA 3NG1A 5AKHA 1CUCA 4LC0A 2GCOB 4LXTA 5LIPA 3UAWA 2J9GA 621PA 2XT6A 4PZCA 1EDEA 2ZT7A 4I3HA 1OGJA 3GT0A 4AP6A 4G26A 4YWJA 2EV9A 5B7PA 4WOJA 2F1RA 1W52X 5ESXA 4AK9A 1YR1A 2IP2A 1B4DA 2O7NA 1DAMA 2CVZA 4J90A 3RUCA 3U26A 1CUBA 2ZI6A 2VPQA 3TBHA 3E5RA 3T3IA 3MQ4A 4X6YA 4U3JB 3WISA