3JYLA

Crystal structures of pseudomonas syringae pv. tomato dc3000 quinone oxidoreductase
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
325
structure length
325
Chain Sequence
MAKRIQFSTVGGPEVLEYVDFEPEAPGPQAVVVRNKAIGLNFIDTYYRSGLYPAPFLPSGLGAEGAGVVEAVGDEVTRFKVGDRVAYGTGPLGAYSEVHVLPEANLVKLADSVSFEQAAALMLKGLTVQYLLRQTYQVKPGEIILFHAAAGGVGSLACQWAKALGAKLIGTVSSPEKAAHAKALGAWETIDYSHEDVAKRVLELTDGKKCPVVYDGVGQDTWLTSLDSVAPRGLVVSFGNASGPVSGVNLGILAQKDSVYVTRPTLGSYANNAQNLQTMADELFDMLASGKLKVDGIEQYALKDAAKAQIELSARRTTGSTILIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Quinone oxidoreductase
publication title Crystal structures of Pseudomonas syringae pv. tomato DC3000 quinone oxidoreductase and its complex with NADPH
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
total genus 100
structure length 325
sequence length 325
ec nomenclature ec 1.6.5.5: NADPH:quinone reductase.
pdb deposition date 2009-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3jylA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3jylA01
1UXHA 5KJFA 4EGFA 1GQQA 2VQ3A 1UDAA 3BXXA 1KIFA 3GUCA 5A9TA 1PZEA 4YAJA 1LXCA 2JD1A 2Q1WA 5EMHA 4YA6A 1ONPA 1UZMA 2X86A 4GX1A 1EBUA 4JJIA 3QVOA 1TXGA 3HZZA 3VTFA 5C37A 4YT4A 4CM4A 4IQ8A 4QUKA 1P44A 2NTVA 2O3UA 1UZLA 4OXYA 5H81A 5IAAA 2NU9A 3PHIA 4J49A 1QP8A 3MJEA 3E9QA 2HMUA 3DXFA 3I1JA 3K73O 4CQMA 1F14A 4WLVA 4UUMA 5JCJD 2O3SA 3PHJA 4JJGA 1IL0A 4PLTA 4GI2A 3L6DA 3IL2A 2PKQP 3M1LA 2E82A 2Y05A 3GZ4A 2FP4A 3VPHA 1CWUA 5JNLA 1XU7A 2ILTA 3FWNA 4XZ3A 3L6OO 3ZWXA 2BGMA 1YO6A 3GGOA 1HDYA 4BKRA 2AG5A 5JAIA 1HL3A 2C2XA 3PYXA 1K6JA 4TRRA 4C4OA 2JAPA 4II2A 2I76A 5DCUA 3NTRA 4WE3A 5KJEA 1N2SA 1OMOA 1VRWA 2V7PA 4NBRA 3WTBA 2EV9A 1EDZA 4XKJA 2RHRA 1H2HA 4DBZA 5ICSA 6ADHA 3JQ9C 2BHLA 3PJDA 3BA1A 3PFWO 3C7DB 2C5AA 5U1PA 3JV7A 4CMEA 1JLLA 2FRDA 4YJHA 4CQLA 2X8LA 2PLAA 4ALKA 2G0TA 2DUWA 3U4CA 3ZWYA 3GAFA 3RKUA 4FW8A 3AUAA 3DZHA 1LDMA 2NV6A 1DJNA 5EIOA 3S2GA 4FB5A 5AQ1A 4QQRA 3C7CB 3LT1A 1PZGA 3WQQA 2NVWA 4D46A 1K5HA 3VZQA 4BNMA 5JYDA 1SEPA 3JQFC 1DFHA 1HTBA 1ZVMA 5L95A 5F5LA 1I3KA 3PP8A 2FOIA 3DMYA 2DAPA 4IZIA 3O8QA 4FC6A 3ZZNA 3SXPA 4MIOA 4IZHA 5ER6A 5BSFA 3OECA 1EVYA 1X1TA 2O3TA 3UCEA 2QIOA 3RJ5A 4YXFA 1N1EA 1JWAB 1ORRA 2EERA 2PKQO 2HU2A 2PA3A 5T6BA 4CV0A 1QORA 3WQRA 5TS3A 1J4AA 4XIYA 4FCCA 4E32A 1GFSA 4B3IA 4E2XA 4GMFA 3CH6A 4J9VA 1ZSNA 4UEKA 1YQXA 3I3OA 1YH3A 2HDHA 1R15A 4BNYA 3TFQA 1ZK0A 3NDJA 2I9PA 1S7CA 4BNTA 4FD3A 4IDCA 2B37A 3GH3A 1B16A 1L7EA 4E30A 3VPGA 4NBTA 5I9MA 1U7TA 4CR6A 1PQWA 5IDXA 4Z3KA 5EINA 1NHGA 2C20A 2WDZA 1BDBA 4GGPA 3WIDA 3WWYA 2Q2WA 1ONNA 1NVMB 1K6XA 1GEEA 1LDGA 1QR6A 5I7SA 1SBYA 1OI7A 2AE2A 3P7MA 4RLHA 1Q7BA 1DIRA 1KETA 1LEHA 4E5KA 2GN4A 1GUZA 4ZHSA 4HFNA 3S2EA 3KSZO 4BGEA 1T25A 4DWVA 2GASA 4PVDA 3EHEA 4CJXA 3IMFA 2O4UX 5JAQA 2W98A 4BS9A 3ZV3A 3MJCA 2X9VA 2NNLD 4J0FA 4OH1A 4ZQFA 3ONFA 1E7MA 2I99A 1M67A 3DFUA 1PJ2A 3OJOA 3QQPA 4YRBA 3DOOA 1A9ZA 1XGKA 2JFGA 3G0OA 2QZZA 4WKGA 1P1JA 3T7CA 1Q0QA 4RVDA 3W1VA 4D3SA 3QP9A 4DIOA 3S1LA 4FQ8A 3GK3A 3I9OA 4MVJA 4P4NA 4XGNA 2NU6A 1LNQA 4XGKA 1VI2A 4KWIA 4Q39A 2ET6A 2BH9A 4IMPA 4HP8A 4TVBA 4CLEA 3KUXA 3ROPA 4MVJF 3V2UA 3Q6IA 1ISGA 2HRZA 4BVAA 5COBA 4HUJA 4W7HA 1FDSA 4YB8A 5IZCC 3F9IA 4PG4A 4EJMA 2WTBA 1NAHA 3U4IA 4PG7A 4HY3A 3VH2A 4BNWA 5LDGA 1PZHA 3HDHA 2YV1A 4H16A 2CF5A 2EKQA 2V65A 4CMBA 1PIWA 3QWHA 1LI4A 4K26A 3A14A 4W82A 3D1LA 4MVJM 1I36A 3JQBA 2YHIB 1SCUA 1LA2A 5FI3A 4XYGA 1SMKA 1PTJA 4ALLA 4NPCA 3NTQA 3U3XA 2AEJA 3MJ4A 1DBVO 4CPDA 2PD4A 1JTVA 1TVEA 3ROQA 1BSVA 1X0XA 4LISA 4OOFA 1KVRA 3AFMA 4U0JA 4D43A 2PR2A 1PJ4A 4A26A 4RDHA 3E82A 3R3SA 5JXWA 1W6UA 3K31A 1X7HA 5THKA 2VCYA 4IMRA 4ZVVA 1ZSVA 5TLSA 2GGSA 1ENPA 3PDJA 4CM9D 3GNQA 3VKVA 2Q1SA 4A5OA 3LYLA 3WSWA 1DLJA 5A5FA 4IXTA 4YQYA 2Y66A 4R54A 4ROSA 1WNTA 4CM6A 3W8FA 5B4VA 4FJ2A 2XPCA 3OA0A 4KZPA 1B8VA 2VRCA 3PJEA 3ZWAA 1GAEO 1AE1A 2WE8A 2YQ5A 3GOHA 1N9GB 3W6UA 5DBIA 9LDTA 5L7WA 2CD9A 3PFFA 5DBFA 3I52A 1EFLA 1Z45A 4Y6SA 3WYBA 4QFCA 1B2LA 4KQXA 4ND2A 3VDQA 5T8KC 1HWYA 2Q45A 1P3DA 4DMMA 3PLRA 5BSGA 3DO5A 1EQUA 2B83A 2HO5A 3E9MA 5KKAA 1WLYA 3UH1A 4LMRA 3GY0A 4BKPA 4GPD1 3SX2A 3E18A 4WLNA 4OAQA 1JU9A 1UR5A 1V3UA 1MV8A 3ICPA 3UXYA 2POQX 3SC6A 4EYEA 2TMDA 1ADCA 3NGXA 2GERA 4IIUA 3PQDA 2P91A 4NBUA 2VHVA 1XKQA 3G1TA 2GN6A 5CPFA 3W8DA 5COQA 4TROA 1SAYA 2DVMA 3V1YA 3QWIA 4YAIA 3UF0A 2P68A 3DMTC 1UH5A 3CZRA 1UXJA 4BIIA 1ISFA 1ZJZA 4NJMB 1ZEJA 2C82A 2VHYA 4XGIA 3DWFA 4BGVA 1XCBA 2WYUA 1A7AA 2IE0A 4XQGA 3INRA 4RORA 5G0VA 3VDRA 2YHIA 4I08A 1MP0A 1TEHA 1ZUD1 2GZ1A 4GQAA 3RFTA 1M2WA 5G4KB 3ZU4A 4IGEA 1R0SA 5CDSA 2DC1A 4XWYA 5F3RA 4A10A 2YYYA 1F12A 5TGDA 2C2YA 1NFRA 1VJ0A 2XXBA 1PR3A 3OBBA 3I9KA 4O59O 5KVVA 5EQDA 2YJZA 4BO6A 3BZUA 1U1IA 4J9UE 3TL2A 1KYQA 5DULA 1XWFA 3PTZA 4BQPA 2NVUA 2PY6A 3E48A 3NDRA 1GU7A 3QIVA 4YWJA 1B14A 3KEOA 2EXXA 1I30A 2X23A 3Q3CA 1P1IA 1GCUA 2J5QA 4PRKA 5KCZA 2C7VA 2W8ZA 5CG1A 3RASA 3WTCA 2ZB4A 2ZATA 1QV6A 4BNIA 4CMAA 3PVZA 4D45A 1D1TA 3AOEC 5IFLA 3JQAD 3WS7A 1DRWA 4J90A 1HDZA 4WASA 3OSUA 4JGBA 4QFDA 4ID9A 2RBEA 1QG6A 5F21A 1N9GA 4JK3A 3C1OA 4Q3BA 1MC4A 2JD0A 1I01A 4IDDA 5ES3A 2ZTLA 3C85A 2GLXA 4DXHA 3DHYA 3D64A 2UUOA 4U5QA 1HE2A 4IS2A 1ISIA 3JSAA 5BQFA 4YT8A 4FPXA 3ROKA 2HJSA 4D0SA 1TA4A 2FPPA 2R6JA 4CM3A 3L0DA 4J91A 3GHYA 3IJRA 4NJOA 1R16A 2WD8A 3A28A 3QSGA 5CEEA 1PWXA 1HE4A 3D4OA 4L74A 3CTMA 3C1TA 1KVSA 2ZB3A 3L4BA 3FPCA 2ZB8A 3ZV5A 1QXSA 1F06A 3W4JA 4JP3A 4UULA 4PFJA 5CPBA 2WMDA 4XCVA 3KXDA 3HADA 4OSPA 1ZK2A 2PH3A 4M89A 3P19A 2VNAA 5B1YA 5FEUA 3ST7A 5B4TA 3C24A 2J5KA 4B8ZA 5LDHA 3RWBA 3TDKA 1ZK4A 2VWGA 1I5RA 4J7XA 4NJMA 2H5LA 4YRDA 3WGGA 3VTZA 1HT0A 3E5RA 1OFGA 1J6UA 4Z0HO 3GFBA 5U9CA 4RVFA 5F5NA 1V8BA 4CLDA 3KM0A 4FGSA 5HRUA 4N5NA 1FDWA 4M55A 5AXDA 1JAXA 3KBOA 3WGTA 1DDOA 1E77A 4BMSA 3B1KA 4PLCA 2X0NA 5G4KA 1ZK3A 2VNSA 1P33A 1HDOA 1ZMTA 4FN4A 1H9AA 1O6ZA 3JD1A 2CF6A 3PQFA 3RFVA 1XQ1A 3OA2A 1CF2O 1TT7A 3ZWBA 1HSOA 3F6YA 1YXMA 2ZYDA 3U49A 5DDIP 2PZLA 3OM9A 1XYGA 1PR9A 1YL7A 4TSKA 4XJSA 4WK6A 5DT9A 4E6PA 2GSDA 1PJQA 3WX0A 4F6LA 3GVHA 2Q99A 3CMCO 3FNFA 3PZRA 4BMVA 1MGOA 2I67A 4Y8VA 2J3JA 3CPSA 2VYVA 4O6VA 4EUEA 1NTOA 1E3SA 5GY7A 4BNLA 2G1UA 4O1MA 2W2LA 4LN1A 4CL8A 2GZ2A 3GT0A 1Z74A 2DBZA 2AE1A 5T5QA 1PGOA 3D0OA 2IDZA 3JD2A 4UEJA 1L7DA 1IHXA 3BAZA 3I5MA 5I7FA 1ZO8A 4CV1A 2ZIZA 3RCBA 3KSDO 1Q0HA 4J2OA 2FZEA 3ZI0A 3DAPA 3PHGA 5HWSA 2X0JA 3DZIA 4W7IA 2I5PO 3ZCXA 5KVCA 3VOSA 4ALJA 1A9YA 1BXKA 4AJNA 3WLFA 1IYZA 1AXEA 4M87A 3ITDA 4B7CA 2B4RO 1Q7GA 4YACA 2HMTA 5I8ZA 7MDHA 3FR8A 5JE8A 2O7QA 4PGFA 3JQDA 3OJLA 4Y6PA 2NADA 4G81A 3PYLA 3GNTA 1EBFA 2VUSA 4CM8B 4MKXA 4GLLA 3H5RA 2VYND 5A1TA 2VZ0A 4NZ9A 4BGIA 2OORA 4RPLA 5L4SA 5A03A 3DTYA 4UUPA 1H6CA 2FY8A 1PJTA 1ADFA 3LVFO 4FS3A 2PWZA 2AEMA 3DBVO 3EYWA 5L4NA 1MX3A 1MG0A 4ONEA 2OHXA 4R9SA 4PG5A 5EQFA 1DRVA 2FHSA 1E5LA 5COAA 1CIVA 2AQIA 3DOJA 3EAGA 4XA8A 4CV3A 4AJOA 5K6AA 2Y1CA 2PK3A 4TZTA 2YFHA 2YFQA 3ASVA 1NQAO 2B69A 2Y68A 3DFZA 4LW8A 4OO3A 1LLCA 4PLVA 1JWBB 5KWEA 3HN2A 1K89A 4FJ0A 3OIDA 3RUIA 4J3FA 5TJ9A 3HUDA 3JQAB 3EZYA 1DHTA 3H9JA 2TMGA 3JQGB 5JYEA 5IJZA 2VTDA 4RCVA 1SC6A 3OICA 3TPCA 3IQDB 3I23A 4HADA 3X2FA 4BGUA 1I2ZA 1P1RA 1C0LA 4IQGA 4Q3EA 1MLDA 4DLBA 1XR3A 2G5CA 1D3AA 4RL6A 4ZGWA 1PJLA 4L76A 1U4OA 1O95A 1PGPA 3F4BA 4B7XA 2CFCA 4TMFA 4NIMA 1PL6A 1U3UA 2FSVA 4NDNE 1LSOA 3QHAA 3KB6A 4GMGA 4BNXA 2CDBA 4ND5A 5BNFA 3UHAA 1AUPA 3T4EA 4MVJI 4HFMA 2JFFA 2NACA 1E7RA 2JCXA 4DGSA 1EZ4A 1PJSA 2SCUA 3HWRA 4JXKA 1TT5B 1YOVB 4GKVA 1PX0A 3TOZA 4QTZA 3FR7A 1C0IA 2JJYA 1BMDA 3K9QO 1AHIA 3MJSA 1MG5A 4LCJA 1H6BA 4RZHA 4Z6KA 3SJUA 1ENOA 4MVJE 1Y81A 2WWRA 1N92A 4LSWA 4D7AA 1B8PA 5HTOA 1O89A 4FOOA 1LDBA 5J23A 1RM5A 1XHLA 1YL5A 1DC3A 3FTPA 3KSUA 2B4QA 4HX5A 1VSUA 1ENYA 1XSEA 4OM8A 1ULUA 2GUGA 4IDEA 4L9RA 5EJ2A 1WAMA 1WXDA 1JQBA 5T64A 2P9CA 1IOLA 1XU9A 3HFGA 1PS0A 3MWEB 4KUGA 3K2EA 3WSVA 1N8KA 1X0VA 5L53A 3H7AA 2PGDA 1YJ8A 4D44A 1NVTA 4PZDA 2PV7A 3GMDA 3RU7A 1Y1PA 3GAZA 1EQ2A 3WICA 4DUPA 4NBWA 1PGJA 4PLFA 3G17A 4WLOA 1K0UA 5HA5A 4PG6A 3AWDA 3F3SA 4OMUA 3ENKA 4E5YA 2EW8A 2W90A 2Z1MA 3NT5A 5KIAA 1LRLA 2CSUA 3ON5A 1ISHA 3TOXA 3TF5A 2OUIA 1LUAA 4BV9A 4RQUA 1CQIA 2HMVA 3DZBA 5JMWA 1YRLA 3ZNPA 2DPHA 4U7WA 1RJWA 4XRGA 2PD6A 1X1EA 4JROA 3JD3A 1K6IA 1QV7A 4TRJA 2PFGA 2JKVA 2QRJA 4PIVA 3I6QA 4DC1A 5KVSA 1D1SA 4U8GA 2X22A 2EGHA 4N18A 3ZHZA 3JQAA 1M6WA 3JQGA 4LCEA 4XRRA 2P9GA 3K92A 1B15A 1NXQA 2VRBA 4D79A 4N54A 1LRJA 1GQ2A 1KC3A 2P9EA 2PZMA 2XXJA 4QEDA 4J2HA 3MJVA 3FNHA 3N74A 4D41A 4K9DA 2E4AA 3I9LA 3M2PA 3HE3A 2CDCA 1TLTA 2B4TO 4JQCA 2ZB7A 3COSA 2NUAA 4EBFA 4EW6A 1XQ6A 3GGPA 4TWRA 1UJMA 2YUTA 3HN7A 4II3A 1JKFA 5L3ZA 4RPKA 3WFJA 2EHDA 4UVDA 3F1KA 4PZCA 4BO2A 2E6UX 2UAGA 1Z7EA 4J1NA 2FN7A 1PU2A 4FR5A 4A2CA 1GY8A 2Q1TA 1N7GA 2ZQYA 3KEQA 3KZVA 1NWCA 3C1AA 3JD0A 3UUWA 4W6ZA 4M8SA 3JQEA 4W9NC 5KNLA 1WVGA 1Y7TA 3ZU5A 2RH8A 1TT5A 1WZIA 1YOVA 4Z9XA 5GMOA 4XYEA 1H6DA 4RVHA 1Y8RB 1XDWA 3VHRA 3IKVA 3MZ0A 1SEVA 4ZD6A 5CDTA 2FR0A 4BO8A 3OP4A 3GRPA 3U4DA 3RUDA 1Y5MA 2ZTMA 5JO9A 4IUYA 1UP6A 2PNFA 2V6GA 2QYSA 4BOYA 1UDCA 4DLAA 4Q3AA 1SNYA 4IDGA 4PLPA 4WOKA 3FF4A 3OQ6A 4J1SA 1ZJYA 2J8ZA 4NK4A 1V9LA 3SJ7A 5K1SA 1K3TA 3DL2A 1GTMA 1ZIDA 2BFPA 4YRAA 1GUFA 3JQFA 3OEYA 2HAEA 1NASA 3AOGA 3IUPA 4NK5A 3VKUA 1V3TA 3H8VA 1HYEA 2AEFA 4XB2A 2IZZA 3QA9A 3IKTA 1CYDA 1Z75A 2J3KA 3EY4A 2UV8A 5KOIA 2RAFA 2A4KA 4KTTE 3AUSA 2BGKA 3DB2A 4I5DA 5U4QA 4TQGA 3AM4A 3QVTA 2XAAA 1P45A 3P2YA 3GG2A 4E2YA 2YV3A 2LDBA 1SOVA 2I3GA 3WOHA 4XDYA 1P77A 2DTEA 2VHZA 4BNZA 3UN1A 1UAGA 3LK7A 1ZK1A 4MKZA 4JCOA 1BVRA 3DZJA 3F46A 2VWQA 3GR6A 5DBGA 5EPOA 3L77A 4A7PA 3UW3A 3V2HA 3FN4A 2AA3A 1WW8A 5AYVA 4BKOA 3ABIA 3WLEA 1DPGA 1EFKA 1G0NA 1I32A 1PJBA 2FPGA 1O94A 1I2BA 1NPDA 1ML3A 1ZNQO 3B1FA 3EVNA 1YJQA 1IE3A 1SZJG 4M54A 1YKFA 1R0KA 5ITWA 2BI7A 4S1VA 5GZ3A 1DSSG 4Z3DA 2Y1DA 4JBIA 3ETDA 3L9XA 5JY1A 1G1AA 1K2WA 4FSHA 4GX2A 4K6FA 1LTHR 4CUKA 4D3FA 4PG8A 1DC4A 3ZWVA 1B8UA 1HZZA 4DA9A 1DIAA 3WBBA 5H82A 3SBOA 1FDTA 1WMBA 3QLJA 1PGNA 2O7SA 3CSDA 1RM0A 4J7CA 5CEJA 4OQZA 4PLWA 1GPDG 1Y8RA 3GUYA 1DFGA 3STHA 4BL5A 3EDMA 2VOEA 2ZJ1A 5G2OA 2HJRA 3H9GA 2VYNA 4TRNA 3EW7A 3CUKA 1GYQA 3RAJA 4BB5A 4BO1A 4E4YA 4L4SA 2YV2A 2O3JA 3Q2KA 4WNCA 2X5OA 3QE3A 3W6ZA 3WGHA 2DFDA 3K96A 3PLNA 1XG5A 2RH4A 2BF7A 3BHJA 1PJCA 3ZWOA 4CV2A 1KVUA 4QXMA 1U28A 3NV9A 3GGGA 4WNIA 5C5IA 3Q1LA 3AUTA 3FI9A 1ARZA 1A4IA 2W2KB 4UVHA 3LZ6A 3NJ4A 2G82A 2FZWA 3NT4A 1MUUA 1NFQA 1V3VA 3ZWMA 4MVJP 4F46A 1BTOA 1IY8A 3JQCA 4RF5A 5JDCA 2NVUB 1Q7CA 4NG5A 3N7UA 3RI3A 2WD7B 1EUCA 2DKNA 1E6WA 3RSHA 9LDBA 3ZV6A 2C59A 3O38A 1A72A 2IXAA 3V5NA 4D3DA 1ZSYA 3HSKA 1DRUA 3BYZA 1NYTA 4IM7A 4ZRMA 1B3BA 1E3LA 2DPGA 1WWKA 3T4XA 3WFIA 4QX6A 1JVSA 1QYVA 1C3VA 3EZLA 3T7EA 4L0QA 4IJUA 4R68A 4J43A 4YCAA 4RVGA 4Z0PA 4IDAA 1KS9A 3RBVA 3RKRA 4DC0A 5A4DA 3TFOA 2WYVA 4GBJA 1JW9B 5EL0A 2I65A 3CINA 1C0KA 4CUZA 2EW2A 4BMNA 5C7IO 3ADPA 4Q3NA 4XDZA 5IDQA 4UREA 3GVCA 4YYZA 1DLIA 2P5YA 1NPTO 1YWGO 1QLHA 3LT2A 3LT0A 2Y1GA 4XD2A 4EDFA 3SEFA 4BNJA 3JD4A 2OBNA 3EC7A 2RCYA 3ONDA 2FR8A 1UXIA 3A06A 4OKIA 3RC9A 1VLLA 4EJ6A 4AJ1A 4UVGA 3PGJA 1NQTA 2DBVO 3BMCB 5JCXA 4DTIA 1GADO 1U8FO 4HFJA 2DT5A 2HMWA 2Q2VA 3I9MA 5KJ6A 3QY9A 1OC4A 3UGKA 4KMSA 3VH3A 3AM3A 5TX7A 2Y0EA 3EVTA 3K2BA 2BELA 3NT2A 4Y67A 4WLUA 4XR4A 5ICMA 2JFHA 3TZQA 3DAGA 4ZQBA 2D59A 5B12A 3BHMA 2X4GA 4TZKA 3RUHA 1DFIA 4Q3CA 1OC2A 4QT0A 1QYXA 3FHLA 3LLVA 4G2NA 3DQPA 4Z9FA 1ULSA 4DRYA 5KJ1A 4FC7A 3PDUA 1GEGA 1PZFA 3AJRA 1Y8QB 1T1SA 4AJHA 3D3EA 4GGOA 4GKBA 4R4JA 4DPMA 3CEAA 1Z7BA 3DMTA 2EEZA 2LDXA 4D42A 2OL4A 1BXGB 3AU9A 3L6EA 3VVBA 2Y1OA 4E21A 2W2KA 2DTDA 7ADHA 2FSSA 1DOHA 2PH5A 4WCFB 5ILGA 2QG4A 4N5MA 3H6KA 4YR9A 1IPEA 3MTGA 4ZJUA 5CG2A 1OAAA 3LT4A 3AY6A 3PWSA 2R00A 4W4TA 5JCJA 4OXKA 4F45A 1U7HA 3EGOA 1R37A 3S8MA 2DLDA 6LDHA 2WD7A 5TQVA 4PLHA 4Q9NA 1PSDA 3HDJA 4AFNA 1T2FA 1KY4A 2A92A 2AQHA 3P5SA 1HLDA 3DTTA 2NU8A 2X58A 2DFVA 1GZ3A 3GVPA 4E13A 1PL8A 3VZSA 5G0UA 3DZKA 3QW2A 1C1XB 3MOIA 1CERA 1KEUA 1P0FA 1DAPA 2DM6A 3KRTA 3PPIA 1MXHA 1OOEA 4E0BA 3IS3A 3ONEA 4MJLA 5JAMA 1HE3A 1UZNA 3DC2A 4YJGB 4ZQGA 3FNGA 3FRJA 4I9NA 4ND4A 1NPYA 4BKQA 4YEDA 1NM5A 5EESA 3HJAA 4CQMD 5JO0A 5F1PA 2JCYA 4R69A 4IQ0A 2J5RA 3F5SA 4TKMA 5A05A 3HHPA 1T2CA 3ZGYA 1KY5A 4LVUA 2FR1A 2GN9A 1QYCA 2GR9A 5G0WA 5JLAA 5THQA 4BNFA 4CODB 5A9SB 1ZZEA 3QWFA 4G65A 1GCOA 1HSZA 1U3WA 3WMWA 1MB4A 1QYDA 4P4LA 1GDHA 4B4VA 3BMCA 3PIIA 4GX5A 3JYPA 4RF4A 1R4NB 2NQ8A 3ASUA 3GEMA 4IDBA 3MJTA 2FMUA 1YBAA 3L4BC 2B5VA 2BD0A 1FMCA 4RGBA 4RQTA 3F1LA 4XEHA 4EEXA 3WGYA 3G3EA 4EUHA 2DQ4A 2F1KA 1VKNA 3B20A 4YAEA 4IINA 1FDVA 2O2YA 4LK3A 5FFFA 3OQBA 3IOYA 5L40A 4NU5A 2QYTA 3K6JA 1F8FA 1R12A 2C54A 5L45A 1DAOA 2WM3A 5DP1A 3U5TA 4WEQA 3UCXA 1E7YA 1QRRA 1HYHA 1GPJA 2CZCA 4J4BA 5K0ZA 1PEDA 4P8RA 4NFHA 1Y8QA 5A04A 1Y9AA 2D8AA 3UOGA 5AOVA 2CVOA 2O4CA 2YDYA 5A3JA 3L07A 2ZKLA 1BXGA 4K1LA 4BNVA 3NUGA 1YONA 3ETGA 3JTMA 3H3FA 3QVSA 5AXAA 5KJCA 2VT2A 1E3WA 1Y6JA 2NQTA 2WYWA 2CDAA 4WCFA 2EF1A 2E49A 4JBHA 5TRTA 4GH5A 4NHEA 3AW9A 1XLTA 4DYVA 1NP3A 4L4RA 1VL0A 1IZ9A 4Z9YA 3ULKA 4MKRA 3D4NA 3AI2A 3VAZA 3VH1A 1GV1A 2IYOA 3IP1A 4MOWA 2GD1O 4CLOA 4LRTB 1MA0A 5JDIC 4IBOA 5MDHA 2OGUA 5F1OA 1YQDA 5LC1A 1R4MB 3G49A 3ZWPA 5CDYA 3C7AA 1HDCA 3FCOA 1CEQA 3BTVA 3NRCA 1C1XA 3L4SO 2GYYA 4MP8A 2Q2QA 3PIDA 2UUPA 1H93A 4IDFA 4UUNA 3RUAA 3VPSA 2P2SA 5A9RA 1BVUA 3ZNNA 2OOSA 3BMQB 1IULA 5EERA 1EK6A 4YJGA 4D0RA 4W99A 3LU1A 1GZ4A 3OJ0A 4XB1A 1A5ZA 1N1GA 1RM3A 2YDXA 1MFPA 2DTXA 1EE2A 3R3JA 1W8DA 3OFSA 1ZXBA 3DZGA 5HS6A 1PQUA 4WLFA 3QWBA 4ZU3A 5A9SA 4CLRA 5L51A 2HQ1A 5ILOA 1DIBA 4J0EA 5C7LO 1IB6A 2OMEA 3CMMA 2Z5LA 4CMHA 2PGJA 5IXSA 1R4NA 3MWDB 4FFPA 5IN5A 3HDQA 4MVJH 3WR5A 2XOXA 3TRIA 4JBGA 3WB9A 3ANMA 1FDUA 5H83A 3PWZA 4BB6A 2X9GA 1RKXA 3OHSX 3DZFA 4CR7A 3GVIA 3AI3A 1DIGA 3R6DA 3JYNA 3DOCA 3NYWA 5JFOA 5JC8A 2D5AA 4OKNA 5TNXA 3W4KA 1AHHA 3RC7A 2JAHA 2Q49A 1EDOA 4WEOA 1EVZA 4M49A 2VUUA 1WDMA 5EN4A 4P38A 1U5CA 4UVIA 4FGWA 3IDSA 3HQ4O 3L9WA 4QSMA 4R9RA 2D4AA 5HBRA 1IHYA 1HE5A 3TZCA 5TF4A 3GQVA 2P5UA 1H9BA 5B37A 3RQSA 5KTKA 1DJQA 2V6BA 4NU6A 4DIFA 5BR7A 5K6AC 1VM6A 3Q2IA 1IUKA 1MXFA 3F47A 1E7SA 4CM9A 1M76A 5JBIA 4UAGA 5B4UA 1F17A 1SB9A 5DZSA 1LX6A 3GEDA 1J0XO 3MOGA 4HXYA 5DCWA 1Q1NA 5TC4A 1W73A 3I83A 1LC3A 1MFZA 2EKLA 1O5IA 3NTOA 4A0SA 4FOSA 4KP7A 1Z82A 4CMKA 1UUFA 3BTUA 4G5HA 3U09A 5ITVA 4ITUA 2C07A 1KEVA 4FFNA 2O48X 4OL9A 3DHNA 4DIBA 3LSYA 3N58A 3HG7A 1WMAA 1R4MA 3B6ZA 1U2DA 5JW6A 5L7TA 5HM8A 2EWMA 3DBHB 1RPNA 1XIVA 1L1FA 4BO4A 3EUWA 4EJ0A 4R3WA 5KVQA 2VZ9A 2O50A 2HRBA 2GDZA 4RVSA 3BMQA 2WE7A 5FI5A 4IJKA 4H15A 3BIOA 3GNSA 1CRWG 1ZMOA 1O0SA 1SO8A 3NAQA 4J1TA 3WGZA 1CJCA 2HUNA 1A71A 4J16A 1BGVA 1BW9A 1H0KA 1VSVA 1H6AA 4O63O 4DREA 3G79A 4LVCA 4FFOA 4PLGA 1D4FA 1DEHA 3CE6A 1BG6A 3PQEA 3RBXA 4PVCA 2ZCVA 2CY0A 4R1SA 3GZNB 1RM4A 3IJPA 4NQZA 5DN9A 3PXXA 3TWOA 3KHUA 2J3IA 1VPDA 4B4UA 2HKIA 4R5MA 5FWNA 2X0IA 4Y9DA 3D3WB 4FFRA 1EE9A 1LSSA 2E37A 4UEOA 2O2SA 4JX8A 3ZWNA 1NBOA 2B35A 2X9NA 1ZXLA 3KOUA 4YJFB 3TZKA 3PJFA 1T2EA 5A02A 4AJIA 3KYCB 1JAYA 1QKIA 3E8XA 3UAGA 3H9EO 2UYYA 1G6KA 1QSGA 1YBVA 2DUUA 3PWKA 3GHHA 1P0CA 4IJVA 3FWZA 4B4OA 4DYDA 3DAFA 4LSMA 1YVEI 2QRKA 3FBGA 5TIIA 4B3JA 1O9BA 2DU8A 1NVGA 2BKAA 1UDBA 3NGLA 4WUVA 3RIHA 3ZU2A 1G0OA 3A4VA 2E48A 1H94A 4TKLA 2A35A 5A06A 1YS4A 4R01A 1RYEA 2GNAA 3K5PA 4GWGA 5DOVA 1UXGA 3FTNA 3MTJA 1IZ0A 1I33A 3IP3A 4IGFA 3RUCA 4E5NA 2HK9A 5AXCA 4J6FA 4B7UA 1EK5A 3DBHA 2WJPA 1R0LA 4IS3A 4NMHA 5G0TA 4HBGA 2D3TA 3TZ6A 3VZRA 4MIEA 1E1NA 2NTNA 5DOZA 1NWHA 3NJ8A 4OHUA 4HKTA 3RC1A 4CMEC 8LDHA 2HSDA 1GYRA 2OFPA 1X15A 3DDNA 2OXIA 1E6UA 4PRLA 1KEWA 4FFMA 1HXHA 4RVUA 1Q2XA 2PGLA 3E6AA 3PZBA 4AJEA 1O8CA 4WPGA 4AL4A 4HNGA 1HEUA 4OQYA 4PCVA 5CDGA 1T2AA 4YT5A 3JQ9A 1NAIA 4CMCA 3PI7A 4YPOA 3S2IA 1T2DA 3GZNA 3ZHBA 3H2SA 3PK0A 4R1NA 4PZEA 4W9NA 4L8VA 1EUZA 1E92A 2EGGA 3BHIA 3JYOA 4I5GA 3WG9A 1Y9EA 4BO7A 1EVIA 3GVXA 3D3WA 3WXBA 5IZ4A 4DBVO 3WBFA 3GPDG 3AY3A 3TJRA 4R1UA 2YZ7A 3Q11A 3JCZA 3S2FA 2Q46A 4A27A 1U3TA 4KWHA 1KEPA 4BNKA 3OEWA 4YJFA 1CETA 1VL8A 4JNKA 4LRSB 4E2ZA 4XIJA 2V6FA 3KYCA 1C0PA 4CR8A 4GL4A 2GCGA 3FPLA 1YB5A 5DF1A 4IXWA 1I24A 1NR1A 4EI2A 1X7GA 2PTGA 2X5KO 2CNBA 2PZKA 3I6IA 4GVXA 5ADHA 4HNHA 3GF4A 2EP7A 3DONA 3KV3O 1LQTA 3Q0EA 2EJWA 4BKUA 4BNGA 1I3MA 1JN0A 2GN8A 3ZNQA 5I9LA 3FNEA 3VC7A 4BO0A 2OP1A 4RPJA 2B5WA 4WJZA 4XYLA 4YQZA 5L7YA 5A5EA 1UXKA 4WCDA 5JC1A 1W4ZA 3OETA 4KTVE 4Q3DA 1KOLA 4GSKA 4EZBA 4CM5A 1TB4A 1I3NA 1LC0A 4F6CA 2VOJA 5GZ6A 3AUUA 1KVQA 3V8BA 1KVTA 1P31A 4HWKA 1LDNA 3H4VA 1R66A 5G0SA 4Z0TA 2RHCA 2ZTVA 3ROMA 3HB4X 1E1KA 3AFNA 5K9ZA 3H9QA 4C7JA 4J1QA 4K6CA 5GZ1A 1TI7A 3C3XA 1E6EA 2H1SA 2Y67A 1PS8A 3DBLB 3R0IA 1GV0A 3GN1A 4JIGA 3ADOA 4KOAA 4PLZA 4BO9A 4BV8A 1V0JA 1WDKA 2ZQZA 3NKLA 4CM7A 5I7EA 3I4CA 1RWBA 3KYDB 2VYVD 1U3VA 3HDYA 5TT0A 1X13A 2NWQA 2J3HA 4TRMA 2W2LD 2PD3A 4ZICA 1IPFA 4I5EA 4L75A 4URFA 1ENZA 2D2IA 3GDGA 3R1IA 5G4LA 1T1RA 2VT3A 3QRWA 3BMNB 1DXYA 5DP2A 4I5FA 4JJFA 3WQSB 2BLLA 2YHUA 3ZWWA 2B36A 2DBRA 2Z1NA 2BMAA 3TNLA 2Y99A 1YE3A 3WYCA 8ADHA 3WMXA 4JN6B 3GA0A 3H65A 4UUOA 3H9UA 3JQBC 3UKOA 5IF3A 4WGGA 4B79A 5MGBA 4BNUA 4DQVA 2Q3EA 3UFXA 1B3RA 3RBZA 3M2TA 4NFSA 1VJ1A 2NSDA 1ZH8A 1GR0A 3GC6A 4GWKA 3ENNA 5I9NA 3WGIA 4GAEA 4IPTA 4R41A 2WSBA 3QWAA 2O3QA 5IZCA 4DPKA 2Y1FA 3U4HA 3MEQA 3PJGA 5ER9A 2G76A 1KC1A 1UAYA 3D7LA 3JQ7B 3OJEA 1JKIA 1KBZA 1V6AA 4AJLA 5JDCC 1P1FA 4YBZA 5JAZA 3O4RA 4CMIB 1BHSA 3ZNOA 3E03A 3WJ7A 5KKCA 4AJ4A 4R3NA 1YB4A 3VZPA 1XA0A 2O3RA 1W0CA 1VL6A 4RDIA 3PHHA 1I3LA 4GLOA 3CKYA 3TQHA 1PWZA 4R16A 5T57A 3V2GA 5IN4A 1F8GA 2QQ5A 2P4QA 5BNIA 1M75A 4AICA 4OYRA 4RJTA 1E1LA 2NU7A 3LC1O 4L73A 4MP6A 4AVYA 1XELA 4KDEA 4QO8A 2C5EA 1U9JA 2IRWA 2EJVA 1NR7A 4O0LA 2CVQA 2VZ8A 2VWHA 4AJPA 2UDPA 4FJ1A 1SPXA 1WDLA 3ANNA 2NLOA 1NQOA 1RYDA 1LLQA 2HCTA 5LCXA 4E5MA 2FPIA 3RC2A 3E5MA 4J4HA 3QVXA 1B7GO 1EVJA 1U4SA 2BFOA 4OXNA 4YJDA 4F3YA 2R2GA 3ANLA 1KERA 2OZPA 3V1UA 1JDJA 5TT1A 2X7HA 1T26A 4YAGA 3F4LA 4DVJA 1M66A 3DBLA 1QYWA 4B4WA 3UICA 2EG9A 1NX6A 4CLHA 3U0BA 3OF2A 4MVJG 5T8KA 4E12A 2AQ8A 3KYDA 5TJHA 3ZW8A 4J4TA 4UVEA 3PEFA 1H5QA 2X5JO 2ZCUA 4EUFA 5AVOA 4NFYA 4QECA 2C0CA 2ZYAA 1SB8A 4M1QA 4QO7A 1E7QA 5ENVA 1LJ8A 3KVOA 5T67A 4RZIA 5IG2A 4IJWA 3BMNA 1ZFNA 2UVDA 3DBRB 3GMSA 3IC5A 4NNJA 4A73A 4BQRA 3IAHA 3GDFA 1FK8A 1P1KA 1DB3A 2QW8A 3U9LA 1NHWA 1LLUA 3ZN2A 1ONOA 2D1YA 4CUJA 1BDMA 4C7KA 3MCVA 4XQEA 1QLJA 4FBGA 4RLSA 3A1NA 1GL3A 4ND3A 3M1AA 1HETA 1NQ5A 5CEFA 4L4XA 1QMGA 4N7RA 3RVDA 4ZQEA 4OOEA 4CM1A 3WJAA 2OO5A 1E3WB 2G17A 2YQ4A 2AG8A 1AN9A 3PRJA 3JQ7A 3I9JA 4E3ZA 1X14A 1Y5RA 1ID1A 1OBFO 2R00C 3GG9A 4LGVA 4CMIA 1HLPA 3GN2A 5DNAA 4CLOB 3CIFA 1ZBQA 4U6QA 1WPQA 2O23A 1J49A 4OGWA 1E3JA 2GO1A 3GFGA 3U62A 4ZA2A 5I7VA 2ZTUA 4DMLA 4NR0A 3LQFA 5IDWA 1HRDA 3HNPA 2EP5A 3RUEA 2D0IA 2H63A 2GRAA 4KUEA 1VJTA 3H5NA 5JPIA 4ALNA 2H6EA 5CHEA 2Y0DA 2Y1EA 4M86A 1UP4A 2VHWA 2VUTA 2QHXA 3I9NA 1I0ZA 1D7OA 2IYPA 3SC4A 2XF8A 1S6YA 4B8WA 1Z6ZA 1CDOA 4MINA 1LBEA 3I4FA 1Q0LA 1B0AA 3VH4A 1ZW1A 1GUYA 1LRKA 4OJNA 5BT9A 3AOEA 3CZMA 3W8EA 3DR3A 4CLRB 1HKUA 3RFXA 1AXGA 1GQYA 3Q9UA 2NVBA 3K30A 1U5AA 1V35A 4KDFA 1WZEA 4XX0A 4BHTA 4GX0A 1VE9A 1I8TA 1XEAA 3INTA 2I3AA 3VPFA 1EUDA 5DCYA 4FIZA 3FSRA 1YQGA 3DHEA 2CUKA 1E1MA 1DO8A 3JYQA 2DBQA 1NNUA 1C1DB 4NI5A 3ZH2A 4YAKA 3O9ZA 1ISMA 4CL3A 1N7HA 4U0KA 4X54A 3GPIA 4EITA 4XJTA 1PQPA 3WWZA 3B1JA 1GD1O 4E33A 2HK8A 4I9UA 2JL1A 3H3JA 1EEHA 3PHLA 4ZQHA 5FF9A 3NX4A 3DBRA 4I9HA 4RF3A 4H7PA 2VTEA 1PGQA 4YT2A 3S55A 2OP0A 3QVWA 2BFAA 4GSLA 4JLWA 1ZKMA 1FJHA 2IXBA 3GEGA 1ZCJA 4BO5A 3WYEA 2VHXA 4CMGA 2A9FA 1JVBA 2C7GA 3EK2A 4RF2A 3JYLA 1M6HA 3KTDA 2AQKA 1DIHA 3F5QA 3IIEA 3NEPX 2Y93A 5BSHA 1GZ6A 3E9NA 4ALIA 2NTJA 1CQJA 1LQUA 2QRLA 3INGA 5C3MA 4JP2A 4WCFC 3GRKA 1T4DA 2EIHA 2Q4EA 4HFRA 3GLQA 2VWPA 2AW5A 4PLYA 4WOJA 5L9AA 3WDSA 3VVCA 2JHFA 3ZV4A 4YTEA 5TSDA 4P4GA 4DQUA 5CAEA 3ZW9A 3LLSA 1PJ3A 1BRMA 2W4QA 1MC5A 3RJ9A 4NBVA 5JMPA 1GYPA 2BI8A 1R6DA 4INAA 3OQ1A 4R51A 1PL7A 3ZHYA 5JY6A 3NDIA 1P1HA 2QX7A 1E3EA 4ND1A 4CMJA 4BUCA 4YDRA 2F00A 3KLMX 4ZN6A 4ESOA 1T4BA 3V1TC 1FXSA 4ZRNA 4CLXA 4P22A 1B26A 3D5TA 4B3HA 5JDIA 3ZU3A 1P74A 2Q1UA 4BNNA 4R5HA 4S3MA 3ZDFA 1AGNA 1D8AA 4XR9A 5JSFA 2X0RA 3KYBA 3UVEA 1BW9B 1A27A 5A3VA 1LU9A 1BWSA 1N5DA 3E1KA 3JQ8B 3WGQA 1LDYA 2V6MA 3BTOA 4R1TA 2H9IA 2HMSA 4E2WA 3ETEA 1X7DA 2BRUA 3Q9NA 1YGYA 3WNQA 3H2ZA 2I66A 4MDHA 4AJ2A 2IEDA 1C14A 1J5PA 4E31A 5CDUA 2Q50A 2BFMA 2IZ0A 3RU9A 3WIEA 3JQ6A 2X1HA 4WECA 1HDRA 2IEBA 2P4HX 1C1DA 2ZK7A 3TZHA 1E3IA 4MP3A 3SLKA 3G1UA 4A03A 3WGOA 2YW9A 1A7KA 3KETA 3KLPX 2HLPA 3O26A 1HDXA 3QV1A 4MVJD 3OMLA 4HV4A 1HDGO 3H5AA 1F0YA 3OJFA 4K28A 4DQXA 2JHGA 2JCVA 5IXYA 3OIFA 1YB1A 4KUHA 1YBMA 1U2GA 5AXBA 4RV9A 1YDWA 3VPXA 1DHRA 3O03A 3LDHA 3RUFA 4DLLA 3AM5A 1ADBA 4EEZA 3B70A 4GVLA 2GF2A 5L4LA 4DL9A 1ZEMA 3X2EA 3P2OA 3BMOB 4Y6RA 2RIRA 2Y0CA 3W4IA 2CVZA 3RD5A 3EMKA 1HF3A 1SOWA 1DC6A 5F1KA 1EMDA 5I8WA 1I2CA 1VKOA 1LLDA 4XYBA 1P9LA 2HK7A 4XQCA 4WLEA 3PGXA 3ZHXA 2OBYA 2IODA 1Z73A 3FBTA 4CM4B 4XQ9A 1BXZA 4YVFA 5IDYA 1UP7A 4I1IA 3FD8A 1E7WA 1DC5A 4IY1A 1JA9A 4N5LA 3D4PA 4CQMB 2J6IA 1ISJA 1T24A 2AHRA 4OSOA 3ORFA 1VC2A 4MPDA 4XYMA 4BO3A 4E5PA 2AXQA 3OH8A 3HFSA 1HYGA 3AY7A 2B0JA 1OZAA 1PS9A 2ZJ0A 3GDOA 4FDAA 1FF9A 2X6TA 1LDEA 3M6IA 2WEKA 4RPHA 1NFFA 3LF2A 2YY7A 3TSCA 4I8XA 4FFLA 2VN8A 1ADGA 2IZ1A 1E0DA 5CFZA 2D5CA 2VRCD 2Z95A 4MO2A 1HZJA 2CMDA 2BGLA 2FWMX 3JQ8A 4H3VA 2A94A 1A4UA 1I10A 3CXRA 2C29D 3LC7O 4YJHB 3LC2O 4CQLB 5BNTA 1YDEA 4Y98A 3C8MA 5ENDA 4U6SA 3ICCA 2EKPA 2GPTA 3DEYX 4PN3A 4ILKA 2PZJA 4AG3A 2PKRA 4TVOA 2Q4BA 3UCFA 3BTSA 3D5QA 4DPLA 3AK4A 3A9WA 3HB5X 3SVTA 3O8QB 4O5OA 5CP8A 3QJ5A 3PYMA 4NH4A 2GZ3A 5BSEA 1U8XX 2ZYGA 3OIGA 3SLGA 3ZWCA 5HS4A 4OIMA 4KQWA 2JD2A 1LSJA 3ITKA 1JKJA 2I6TA 3TL3A 4CM8A 4RO0A 2AMFA 4J7UA 1YL6A 4AJJA 3KO8A 3RROA 3K8ZA 5FYDA 4IIVA 3TN7A 1WP4A 5JS6A 2QZ9A 3WNVA 4MIYA 1LSUA 3IUSA 1H2BA 1E5QA 2NM0A 3AI1A 4RPGA 4ALMA 4AJKA 5C7OO 4LMPA 3BMOA 4BNHA 3AU8A 3LF1A
chains in the Genus database with same CATH superfamily
1D6JA 1UXHA 3HKDA 3JVEA 3M33A 1GQQA 2N42A 3LCUA 4CG3A 1WDTA 4FLFA 5BW8A 4FSDA 3GUCA 4XTRA 1PZEA 2NZ2A 2BUCA 2R8YA 2CL0X 2Q1WA 1SXJB 3SGLA 1ONPA 3BGOS 2YMQA 1EBUA 3L18A 5FR1A 1T5HX 2VF7A 3WWPA 5C37A 3AF1A 4CM4A 4YT4A 4B6GA 1P44A 2O3UA 3ND9A 5F3DA 2H59A 5HBGA 5HK9A 5C9ZA 3B89A 5KWVA 3W3ZB 3NM5A 4AAYA 3OPMA 1WCXA 5BP7A 3CW2A 3DXFA 3K73O 3VR1A 4CQMA 1Z35A 1F14A 3OZSA 4KWEA 4MGHA 1DTWA 2O3SA 4ZVNA 5KNBA 3UHPA 1LBTA 2BEWA 4ZTBA 3L6DA 4YECA 4O2AB 5IM5A 3HMKA 4WZBB 4X1KB 4LJ8A 1VJCA 5HCNA 3U2QA 2D4HA 2Y05A 2DR2A 2YXBA 1YZ3A 2FXIA 2D1FA 2J9FB 1CWUA 4OV6B 5EXXA 3MS7A 5JNLA 1XU7A 3MPOA 5L6MB 4XZ3A 2PYDA 3L6OO 4JA0A 5BO5A 4OHPA 4XGRA 4LQ4A 3K53A 4JR1A 3GGOA 1HDYA 4MQFA 5K3FB 4BQEA 1HL3A 2C2XA 3PYXA 2EFDB 2SECE 4B35A 1CY7A 1L5YA 4II2A 4C9BA 3NTRA 4FS8A 4GMHA 3DT8A 1KS2A 1NJGA 3F8WA 3L7LA 1COZA 3KPWA 1OMOA 2V7PA 4C0XA 1U9CA 4O3MA 2C42A 2XIJA 2EV9A 4LDRA 1EDZA 4JYBA 5AK5A 5HZHA 5C8VA 3SSAA 5JH7A 5ICSA 4DBZA 4TYNA 2H2AA 4R40A 4CG0A 1MF7A 3PJDA 2FB9A 1V16B 1VYUA 4HEQA 3ZXIA 5U1PA 2I2CA 2FRDA 3T5DA 3QBDA 2DJIA 3VV2A 5EMLA 2DUWA 4LK2A 3TTXA 4ALKA 3U4QA 2JFOA 4FW8A 3RKUA 1ZJ6A 3TLMA 1LDMA 2NV6A 3QVUA 1JSLA 5AQ1A 4QQRA 4A6DA 1HR0B 5CB4F 4LE0A 2MCFA 4CT0A 4Z4HA 4CCAA 3KT3A 4D46A 1VQ1A 2XJ4A 4XLLA 4I7EA 1PQYA 4ZVSA 2QMEA 1DMSA 1SEPA 2CLFB 3R74A 1DFHA 5T4HA 1RU3A 1HYBA 1VZ3A 2ZI4A 1SBNE 2DAPA 3W05A 5KO2A 2NP7A 1AZLA 4DUGA 3ZZNA 1KFKB 2ZROA 4JWKA 1JI3A 3SYTA 1LNSA 3UCEA 2FU5C 2WHPB 4D8XA 3S1AB 3IHTA 2IHUA 3RJ5A 2HU2A 1OFHA 1B00A 2M6RA 3UMFA 2ZI5A 5ALEA 4XDZA 1Y7LA 3LI2A 4L5AA 2MINB 1J4AA 1GFSA 4W1PA 4B3IA 4KR2A 2P78A 4R71A 1ZSNA 3AP1A 3LHDA 4OF4A 3BIXA 1UC8A 4HZUA 5IX8A 1FFBA 3PQCA 3BKWA 3ZW7A 5AVUA 2D74A 1R15A 4BNYA 1PWYE 3W6OA 1HPLA 1ZK0A 3J7TA 4DARA 1JLRA 1S7CA 4IDCA 1FU8A 1PUJA 4RFLA 4BNTA 1X1RA 3WZMA 2FOXA 3TI9A 1MX5A 4GPZA 3KR0A 3BFJA 4BFXA 4FWBA 4CR6A 5K51A 3CNOA 5CT8A 3BXGA 1C80A 1M34A 2Q21A 1Z5GA 5EINA 2ATVA 3G2QA 4JMLA 5LA6A 1UWCA 5BSRA 1Z4KA 3HJCA 3HJFA 1EWYA 8LDHA 3ZY2A 1QR6A 1W76A 1SCAA 1E79A 1XAGA 4U2DA 1JE1A 2VNJA 3SYKA 5JEDA 1KETA 5G41A 5I4KA 2GN4A 2JGFA 3A6JA 2H5JA 1EQAA 1T1EA 4M1MA 5IWAB 3K0AB 4Y1GA 3KSZO 3BXZA 3AUFA 5C51B 4QHYA 1B6TA 4V24A 4ENTA 5ABPA 2XKAA 4AMVA 4PVDA 1NU6A 4M46A 4RYLA 4XUGB 5LSAA 2H0AA 4DV3B 3G82C 1G6Q1 2O4UX 4B6FA 1ZY2A 5HFJA 3Q87B 2RGWA 3DGFC 4FT4A 4DILA 4IGIA 4CW7A 4DADA 4YX9A 2WAMA 3LVQE 3FTFA 3R0QA 2C9DA 1AQLA 4QQ8A 1ECPA 2XNHA 1E7MA 1GG5A 1HI9A 4O2RA 4UCQA 2I99A 3KWMA 1B0PA 3OJOA 1U11A 3IV9A 1RBZA 1GFIA 3PKIA 2GCPA 2PIDA 2WB2A 3EF0A 1FP7A 1N2CA 2B94A 4CBVA 2RARA 1WSBA 3EG9B 3U37A 4DCMA 3GPLA 3BPSA 4D3SA 3S1LA 1F3LA 1SUCA 4RTJA 3I9OA 2D3WA 1ZLXA 1U2ZA 4XGNA 4Z0NA 3SQWA 4P0PB 1U2EA 1LNQA 3P0JA 1VI2A 4DDMA 2W5UA 1P7ZA 2BH9A 4IMPA 1W5SA 5HMLA 2XUFA 5HKBA 3CM0A 3A2NA 1EZZA 4G5XA 2ROQA 2H2GA 2ZAYA 4QXPA 3B1VA 3Q6IA 1ISGA 5IKXA 2EZ4A 2HT6A 2IS6A 1KDOA 3MT8A 3IEPA 4MV6A 5IYZB 2IU3A 3PBKA 2G9VA 2WWGA 1FDSA 4IH1A 4YB8A 2RHLA 3AEKB 4R6WA 3EPLA 4PG4A 3VH2A 3SBDA 5EKTA 3HDHA 1XJCA 5LDGA 1GPUA 4H16A 3SYLA 3SZUA 3V48A 1XDSA 4XPZA 3ZE1B 1LI4A 3NYQA 3P0RA 3A14A 4W82A 1RLIA 1TM2A 3D1LA 4MVJM 5LFAA 5DWDA 4MS4B 5AW9A 1Z26A 4NX2A 4X24A 3V8RA 1KPIA 1SCUA 4F3NA 4YP7A 4XYGA 1N3YA 4GPTA 4MUJA 3SHVA 4NPCA 1W9HA 2G36A 1U04A 4ZYZA 3MJ4A 1JZQA 1DBVO 1CUJA 5KU1A 5A6SA 2REBA 3FGZA 1TVEA 2LWIA 1BSVA 1X0XA 1S7GA 1AGPA 2FQWA 5SYMA 4MS1A 1F2TB 3SJZA 2M1XA 1R8JA 5DE3A 1E2UA 4DIUA 2YZGA 1D6NA 5EHNA 4AJ9A 4EGCB 3V2IA 4N65A 4EJ2A 3QX7A 3T06B 2HF9A 5H4GA 1MH9A 4NONA 4MYSA 3K31A 4BCDA 4ASUA 3K0CA 2FF5A 4IMRA 3IA7A 5TLSA 3J80A 2GGSA 4BLTA 1D8TA 4CM9D 2PUBA 3C41J 3DYBA 3GNQA 1QDEA 1TD9A 2Q1SA 1PNTA 3SVZA 3BXOA 4H3KB 4DBLE 4E46A 2M6KA 4RK1A 1E59A 2VDWB 4JJ6A 1RWWA 4MROA 3SJBA 1CIPA 1RI3A 2Y66A 4TTRA 4YQYA 2EKZA 4R54A 4EQ6B 1JKMA 4JLJA 1AZTA 1QO9A 4K9OA 2N1MA 3CRRA 5ILQA 4ZU6X 3OA0A 1D0SA 2CL6X 4KZPA 2JF0A 4GVPA 5KYYA 2JFVA 2YHAA 3A1CA 3G2NA 4HDCA 3VU9A 4BMOB 4GYYA 2Y0PA 1Z29A 4ZP1A 5A6VA 3V9AA 2IZ7A 5B1IA 5DBIA 5L7WA 1YT5A 5I5GA 3I52A 1G9XA 4XB6B 4Y6SA 4FP9A 4KQXA 1RAGA 1O5TA 2IYZA 1MNAA 3R3ZA 5BSGA 2Q45A 1QTIA 2Z09A 3D3NA 3PLRA 3DO5A 3R41A 1JBKA 2EP8A 3KTAB 1EHYA 1WLYA 3UH1A 1KHTA 4BKPA 4US1R 4MUXA 2FPPB 4V02A 3LS2A 5JEEA 4D9HA 3AF6A 4K0KB 3B3JA 2IOFK 1EJBA 4OAQA 4PHCA 4RK4A 1HNXB 1MT3A 1P4GA 2QTZA 1KYYA 3ICPA 1WKVA 3TM4A 3UXYA 1OI4A 2POQX 3U9TA 1X8LA 1WMEA 2H4YA 4MWZA 1XJ0A 2ECKA 1ZGZA 4LDQA 4R84A 3GLGA 1Z47A 3O2JA 2MU1A 1M54A 1LLFA 3BBPA 2CLKB 2VHVA 4HH3C 2GN6A 2G70A 4UXIA 3FFWA 3DTNA 1XTSA 2B1IA 1YHZA 3IPLA 4G56A 1Q3TA 5COQA 1Z2OX 2RAPA 3KR9A 4NY1A 3VKGA 3FXAA 3GCXA 3WLTA 1OXTA 3DQQA 3MIIA 5K0EA 2B92A 2G71A 1UH5A 2XMRA 3CZRA 3DMTC 3MLEA 2JCGA 3HEMA 4MVYA 4EPYA 1A5AB 3JVUA 3PR2B 3PQ6A 4IR7A 3O47A 4C06A 5TEVA 1V7PC 2Q27A 3EXEA 5PGMA 3I6YA 3DWFA 3BVPA 1XCBA 4QU5A 1W19A 3H83A 5KBYA 5M34A 3F5MA 3AR2A 1H4QA 5K3OA 5HKAA 4C6SA 3K20A 3TS1A 4BEBA 1X39A 3PC3A 4K87A 1FNCA 1MP0A 3X1YA 2IX3A 2BHSA 4PC7A 3QOWA 3RS4A 3R44A 2Z3ZA 3RFTA 5TPZD 4TKVA 1UJ5A 1O1YA 4KRXA 5J2UA 4I3HA 2D7DA 1VLZA 3U81A 2JFYA 1P2SA 2Q5CA 5ESXA 3ZK8A 4AKSA 4CIVA 4Q34A 5TGDA 3T3EA 1NFRA 4G97A 4R8VA 5DI3A 3G0DA 3OPQA 4WXEA 3SC2B 4R1QA 3WIVA 5CA1A 5JZBA 5KYYB 3L2OB 4JUCA 4M9XA 2ZT8A 4KKXB 5A71A 1PR1A 3KFVA 5BPFA 4EY3A 1UFKA 1Z9BA 2H4JA 3CF0A 3QIVA 1BKDR 3E2IA 4Q9DA 1BEZA 1XZGA 3EZ2A 1B14A 2XLCA 2ZAOA 3KEOA 4HAYA 2IYEA 4YWJA 3ZHCA 2X23A 3Q3CA 3L7JA 5INTA 2J5QA 5DHAA 4RHXA 3LTEA 2I03A 3FVVA 4RHTA 2C7VA 2D2FA 2MMGA 4BFUA 4O4JA 3AF0A 4ZVPA 3G6WA 1RYNA 1KJWA 1QQ6A 3AJ8A 2GCOB 3IQHX 4G4JA 4RLQA 3RASA 3T1NA 3DOHA 3WTCA 3ZZMA 5BRAA 4QGGA 4BNIA 4D45A 1VRVA 1Z5WA 3AOEC 1ISSA 1R0CA 1OX4A 1VKZA 1JXQA 3GLHB 3FPEA 3AFOA 2PM8A 4JGBA 2B1QA 2YIVX 3LUDA 2RBEA 2XGMA 1N9GA 4CHGA 2XDWA 3CX3A 5EEHA 1AUQA 4L4YA 4JK3A 4Z9BA 2QSJA 1JP7A 2JD0A 4LXQA 4RIGA 1GKKA 1I01A 1FP4B 1C7EA 2XUAA 2HHLA 6Q21A 2IXEA 3DHYA 3BJZA 3D64A 5CD9A 1IUPA 1JHZA 1KE2A 2R97A 5G1NA 5FNZA 2WU8A 5ITSA 2HC9A 2XE7A 3H84A 4KQ6A 1TA4A 1FMTA 1VMIA 3D6AA 1ZR4A 5ESDA 3N87A 2ATEA 2WD8A 3D3JA 2POCA 3BQ9A 5IH3A 1PWXA 1KKUA 3T7TA 3A1UA 4C0HA 1XFAA 4QJ4A 3L8MA 3NHJA 1I2MA 3I2YX 1NQUA 4KU4A 1A8HA 5FWDA 4BLRA 3THYA 3W2GA 4HLUC 1RJFA 2ZB3A 4RK5A 1MA3A 2FETA 1S02A 2V58A 3P94A 3ABSB 4PCUA 1QUFA 6GPBA 4IRMA 3ZBQA 5GJVC 2QAGA 3NDBB 2YZKA 4LQLA 5JHGB 4GRIA 4JP3A 4YUVA 1Z6TA 3RM3A 1L4UA 2GB4A 1NVEA 5CPBA 2V7EA 4XCVA 3HADA 4OSPA 1ZK2A 1SXGA 2FWNA 1SCNE 4NKRA 4A8PA 1RQ7A 2J46A 3ST7A 5FEUA 1ZN7A 1CJMA 2O8DB 3JAKA 4J7XA 1IM2A 1I5OA 4NJMA 1OKKA 2H5LA 5J3JA 4X20B 2O59A 1FTSA 3OAAA 3MCZA 3KIPA 1XTQA 5BQOA 1VDZA 4PO9A 4YMLA 5FUVA 2O9JA 1OFGA 1J6UA 1DUVG 1X9HA 2AF3C 1NLMA 1YUBA 3WRVA 4EQ6A 1XJQA 1WZ2A 3K0BA 5F5NA 1KDTA 1THTA 1FDWA 5AXDA 1ZUIA 2PT7A 2ZP1A 1RWNA 5B1HA 2VF4X 2DY1A 1JJBA 4BMSA 1Y37A 4CG1A 4U7JA 5G4KA 4BLQA 1ZK3A 1JQJC 2C1ZA 3T95A 2B5OA 2CF6A 2NSYA 4AMYA 1ZQ1A 2JIPA 2VDUE 1R6AA 3ESDA 4M99A 2V1XA 3VZDA 1TT7A 5MN6A 2WF6A 2ZWMA 4G8JA 3ZDXB 1TLLA 2R79A 1HSOA 1QZUA 1T8SA 4F4DA 2ATIA 1OBVA 4P98A 1OIWA 2BEUA 2VP2A 2ZYDA 4EPVA 2D1SA 2V7TA 4P53A 3OM9A 4JU8A 1PR9A 3MWYW 1YL7A 2Y27A 3KYIB 4TSKA 5KMGB 2C3MA 5ADWA 4E11A 5DT9A 3J7AC 2GSDA 1AB5A 3HWWA 3AVOA 3FWHA 4EFDA 1QPZA 4E03A 1WXHA 3THXA 4QQFA 1JQ3A 5HILA 3GVHA 3L41A 4TZ0A 1Q16A 2O07A 4NJEA 4HDMA 4JLKA 3CPSA 4O6VA 3U31A 3I6MA 2XX3A 4I4CA 2PPLA 2O2IA 2PVSA 1YZTA 2JJ1D 1E20A 1UANA 2C8LA 4FZ5A 3V7UA 2M1ZA 2E87A 3NV7A 3RIGA 4PTLA 4NF2A 1IB0A 1EWVA 4IHAA 4R2LA 5EP1A 3GT0A 1DAHA 1UQUA 4G41A 4HR7A 5T5QA 3D0OA 5BOSA 2XJ9A 1FX0B 5HVNA 4WY8A 3FETA 4NPHA 1USIA 4PZYA 1ZO8A 4XVUA 4J2OA 1Q0HA 2C2GA 3F71A 5CPFA 1GUAA 3ZI0A 3PHGA 1VIYA 3TE7A 5HWSA 4TTAA 4IF4A 5LBTA 2O2XA 3GRAA 2ZQ5A 4W7IA 2ODNA 1MORA 4HB0A 4DQLA 4ALJA 2EFGA 3ZGVA 5ESRA 2IVZA 3BAFA 4M87A 2FSIA 3EN0A 3ITDA 4F5YA 4I1SA 1FMJA 1NP6A 1PT6A 1CEXA 1L8XA 1U8AA 2NUPB 5I8ZA 4CG2A 1MO2A 1WQ4A 3FR8A 4LPSA 2OXRA 1NKTA 3FB4A 1SUBA 2WT9A 4KYVA 3IR6A 3KAPA 3TQQA 2IU0A 2FJPA 2W2VA 1OV6A 1MX1A 3GNTA 5GJCA 4BQSA 4CU5A 1ZOOA 3HXMA 4MH0R 4HCJA 5AP9A 1FP2A 2R6CA 3IALA 1N6RA 1YZUA 4AMUA 4K86A 2G4LA 4G5RA 3I04M 1R8XA 1QTRA 2ZUWA 4BGIA 2HJHA 2WPDD 1P0QA 4LOLA 4RPLA 1QO0A 3ETHA 4PPNA 5A03A 4BJ1A 2XWJI 4K9LA 5J1SB 2YJ6A 2QU7A 4XDGA 6REQA 1ZM2A 2NO7A 5AK0A 2IP1A 4ZYLA 4PC3A 1DAKA 3UXMA 1DG1G 5H0IA 3SF8A 1P4SA 1MX3A 4C0QC 2L0XA 1XZMA 1VCHA 3LE8A 1GSIA 3HCEA 4ONEA 5IAJA 2XNDA 4R9SA 3LOQA 4B4DA 5B1EA 4B3TB 3DVSX 3ODPA 4QQKA 4G1CA 4O4LA 5BVHA 2FHSA 4U3JB 3A9CA 5COAA 2AQIA 3WMGA 2XB4A 2P6OA 3EAGA 2DQSA 4CV3A 4W8OA 3IX7A 4F5DA 3AY0A 1XD8A 2Y1CA 1IATA 1NMSA 2HWXA 1CC1S 3JATB 3KOWA 1T34A 3JPYA 3LPMA 5IKMA 2C7RA 3V4OA 2HV9A 1NW5A 2CNKA 1JGTA 1CUFA 1UMCB 3VHQA 3V4RA 1K89A 4FJ0A 3OIDA 4LE2A 4HNUA 1SUEA 1SXJE 3LLMA 4PCLA 1OIVA 1WZCA 2C4HA 3P96A 4G2TA 4EHNA 2HQRA 2OWDA 5BQPA 2GBFA 1NBMA 1HGXA 2FEWB 3WKAA 5ITZA 1Z3IX 2JFZA 2VTDA 2QT0A 1I4LD 3QVLA 1VECA 2QGZA 1SC6A 2WAXA 3WO1A 1RXVA 3DB1A 1ZOSA 5EMJA 1RIIA 1X94A 3SKVA 1UEJA 4HADA 4EG6A 4QVKA 3C3AA 4HS4A 3SZ3A 2RGEA 2A30A 2IYRA 3HHEA 5C8ZA 1MLDA 2ACWA 2J31A 2WTAA 4C4RA 5I4IA 1NRWA 1R8SA 4ZGWA 3LO8A 4GD3Q 1BA3A 1PGPA 2NUAB 3CRVA 2JIMA 4M0EA 3FDJA 3FYHA 5A3SA 1NVVQ 4NDNE 1LSOA 4MQ4A 4BNXA 3TRJA 3MBKA 3B3QA 4QASA 4K46A 2YH2A 4NV1A 4EWLA 1ODIA 2WUDA 9GPBA 2SCUA 4X1IB 3ZIAD 3ENVA 4TT3D 5H9WA 4F6RB 4PNEA 2AGVA 1V25A 1ZD2P 4PEVA 4UBKA 3IPRA 4QTZA 4NZOA 3FR7A 1RAHA 2UXBB 4CKWA 2XZPA 2JJYA 4K6HA 1KFCB 4O5AA 5DRTA 3QXSA 4KFCA 2MSNA 3QV2A 3SQMA 2WWRA 5EKUA 3NFRA 1B8PA 2FRVA 1O89A 4KN9S 4YP9A 1KU0A 5J23A 1SOUA 3ZS9A 1XHLA 3MWDA 4MUYA 2V55B 3FTPA 2OC4A 3WHIA 4ECAA 4G07A 1VSUA 1XSEA 4ZEMA 5JJ5A 1ULUA 4MARA 2Z8XA 2OA0A 4N48A 1GZSA 4L9RA 1KP2A 1WXDA 1EVLA 5EJ2A 5HP4A 4QELA 4HQ6A 2P9CA 2WF5A 5DW0A 5K7SA 1I94B 4WOBA 3X1ZA 2JA1A 2AK2A 3K2EA 2Q9UA 2IHZA 2IV7A 3EQ2A 2KYRA 1N8KA 1X0VA 2AIRA 2PGDA 1YJ8A 5EIXA 5ARDA 4M7OA 4RH3A 4UOEA 2PV7A 3GMDA 3UW1A 3THOA 2AN3A 5F2NA 2O1SA 1EQ2A 5HR5A 2RHWA 1PGJA 4NBWA 4PLFA 5HA5A 3EGEA 2FPLA 3JQQA 3NXKA 1OHHD 2VA8A 3I58A 4ENRA 2QP4A 3NZEA 3AWDA 3F3SA 4OMUA 4UTOA 5CURA 5FAKA 2HSGA 4LRUA 4UTRA 2YHBA 1QGAA 3TRDA 1BCSB 3LPDA 1LRLA 1FSSA 3HYRA 4B7AA 3N2IA 2XWBF 3PUXA 1LUAA 4BV9A 1A5TA 1F20A 2BJWA 2JHPA 2PUVA 3GGDA 4IUBS 3CU5A 3DZBA 1BMFA 2R85A 5JMWA 3IEKA 2ZXUA 3UT5A 1XMIA 1Z2AA 3BBLA 2W6MA 3LWNA 4FOTA 4NMLA 1T8RA 1XNHA 1JH9A 1VKRA 2CMKA 4Q4DA 1H8HA 1AXRA 4RMNA 4BQOA 5JNTA 1VL5A 3SDSA 4DHEA 4KX3A 4NYIR 2BFBB 3SCZA 3CR7A 2ZYSA 3DYIA 2WSYB 2C94A 5HQTA 5FPSA 2FW8A 3AH8A 4HLQB 4NYMR 3A6FA 1SD1A 3JR7A 2IPAB 4UDNA 4ZRDA 4RIFA 3ZHZA 4DWWA 4UQLA 3U44A 2FQYA 4W1QA 1Z5ZA 4LCEA 1UBCA 3FYUA 5DTQA 3W78A 1RRGA 1B15A 5AI8A 3R8XA 4Q4JA 5J2UF 4TGLA 1GA1A 1RRCA 2PZMA 4QEDA 3PRHA 4URZR 3GLIE 4J2HA 3QVMA 2QYOA 1Y3DE 3N74A 4D41A 1EDBA 1WF6A 5HUQA 3C15C 2BFEB 1WMFA 2REQA 3HE3A 1TLTA 3TQRA 4ECEA 1H1DA 4JQCA 2ZB7A 4TL8A 1KMHB 2IA5A 1ZVJA 1N2CB 2WFAA 3GGPA 3Q40A 3HU5A 4G4IA 3GLFE 2AFHA 1V9CA 1WHTB 4R0VA 4WTOA 1PZNA 3BFPA 4F2GA 1IWOA 3I05A 3STXA 3WFJA 4UVDA 1WBDA 5DRYA 3DOIA 1FLNA 3NWEA 3WDMA 1CLEA 3G9ZA 1PU2A 4JLDA 3KKNA 3H1AA 4P3XA 3UUWA 4AMBA 4Z5XA 5H4HA 4M8SA 3JQEA 4LS3A 4BQNA 4W9NC 5KNLA 1WVGA 3MAGA 4WZAB 2OAEA 3STTA 4E22A 1ZJWA 4B71A 3NVMB 1G5HA 5GMOA 2Q9BA 1H6DA 1PVVA 2RC5A 4JR0A 1Y8RB 1XDWA 4JI8B 5JCOA 4CT4B 1RDFA 2XUZA 3QLVC 3IKVA 1NYRA 1GSAA 2DWQA 2QTHA 1F9EA 5DNEA 2WVGA 2XTAA 3V46A 3NKVA 5CDTA 4DQKA 3UV7A 1JEYB 1QFZA 1T2NA 1HQCA 3ROTA 3NFYA 1L7PA 1Y5MA 3IV6A 3O1JC 4XIFA 3ZS8A 5JXIA 4MUMA 8GPBA 1WXGA 1E4YA 2PNFA 3HJRA 3VHLB 4BOYA 1JR3A 1ULAA 1UDCA 3X1XA 5DBOA 3E53A 4M37A 1SNYA 3H4MA 1CF9A 1XEFA 4N49A 2JLBA 4MR7B 2V3VA 4GPAA 1V9LA 1E3QA 3L7OA 1K3TA 1U8YA 5C52B 4QNRA 3QITA 4PSUA 1GTMA 1P5RA 3DKKA 1ZIDA 2IP2A 1OILA 4C3VA 5LYJF 2D1QA 3C1UA 1KF0A 3K94A 4HDKB 2CJYA 2CK3D 3IUPA 4NK5A 3U4MA 5DBHX 4MS1B 3H8VA 1HYEA 2AEFA 2VYFA 4RTNA 1M8FA 5F12A 2UYHA 3E5HA 2XUIA 4RLFA 1L1QA 5EIFA 1CYDA 5H59A 1IZZA 4ITVA 5BN3B 2QRMA 3N28A 4G9EA 1VCOA 3VYUB 4OTZA 2X1LA 3EQ9A 2WJ4A 5NULA 1SVKA 3HKEA 2QD4A 1N9ZA 1H5NA 3MVEA 1TUBA 4KDRA 1C7RA 3QVTA 1THMA 5E1BA 4MDFA 2QD5A 3P2YA 2H1LA 3GG2A 2QENA 2I6QA 3GA5A 1W5TA 2WKSA 3BXEA 2R3SA 5AHOA 2VTBA 3K6SA 5KEIA 1BDHA 1WJGA 4FQ5A 4QFBA 3SFTA 3WOHA 5K09A 1OTHA 1XU4A 2QLNA 1EVQA 1Y6QA 1ZH2A 1ZYUA 3UN1A 1XEXA 1PNQA 5EP2A 2WYOA 1GRCA 1UK8A 5C1DA 3VJKA 1E2PA 1Q77A 4D9EA 3CHYA 2DH6A 2OPHA 2GI4A 2V59A 3DZJA 4Q3KA 4U9HS 5T4BA 1R2QA 2H5EA 1ORWA 5HF6A 3ZG6A 4BV2A 5LLDA 2HM7A 4YNBA 5EJFA 1IBSA 3DPSA 1OGJA 5C53B 5HG0A 5AYVA 2ID4A 2FPGA 1IN5A 5CNMA 3OTQA 3B1FA 3EWSA 4I4TA 3EVNA 3I42A 3IIJA 1ZHOA 1DG9A 3RIMA 5BV0A 3OLCX 1R0KA 1GGEA 3K8OE 3KXPA 4D92A 1I1HA 2BI7A 2VC2B 1U1CA 2QIPA 2YWDA 2I6UA 3AEXA 3PSAA 3PUKA 4Z3DA 5E1MA 1V1RA 1Z0JA 4D9MA 3GFSA 3RR2A 4IQFA 1MB0A 2R1VA 4F92B 3C98A 5EUBA 4HF7A 4FSHA 4K6FA 4OP1A 1KTVA 5I4BA 3OY7A 1P6XA 3G2PA 4UHBA 2VDOB 4MWDA 1JG2A 3PUWA 4A0HA 1DC4A 4K9MA 2RG1A 4DLZA 4IV8A 3ZVLA 3WAJA 1HZZA 4KQEA 4DA9A 3WBBA 5F73A 3EOZA 4J7CA 3FUCA 2O7SA 3CSDA 4LHVA 3QTBA 1ITZA 3PDHA 4V0LA 1GPDG 1DFGA 1MHTA 3GD7A 3BRSA 3EDMA 3B48A 3FFTA 4BL5A 4F96A 4B3RB 1IXRC 2XUKA 1P2UA 3U7QA 4BB5A 4BO1A 2EJTA 3SIXA 1QVZA 4LXGA 2ZDQA 2EYQA 1WV1A 4QUIA 4L4SA 2YV2A 3H2GA 3ABQB 3Q2KA 2IQ5A 4WNCA 1I5EA 3AXTA 1O03A 3B3AA 4TKUA 3F73A 3D2LA 4ER6A 4YUXA 1W1IA 1D6MA 2ZB2A 4PYMA 1N6IA 3OZEA 1M2OB 3BHJA 3ZWOA 1KVUA 4DNPA 2JLUA 1QIHA 1PTJC 1LPPA 2DULA 4IAOA 2PXHA 4RH0A 1MJGA 3BICA 1U28A 2OHGA 1G42A 2JVIA 1TM4E 1Z5OA 4CF7A 1VLMA 3Q1LA 3FI9A 2EGUA 1DAGA 5C32A 2W2KB 4UVHA 3LZ6A 4BRWA 4P84A 3M49A 1CUCA 2YASA 1VCNA 2FZWA 2MTBA 1OWLA 4JC0A 3MYYA 1V3VA 1GNSA 2GTHA 3GB9A 4UBIA 2ZIXA 4QU8A 2CXRA 4HN9A 5HSGA 5E0KB 3D8SA 4RF5A 1QTQA 3L1VA 4JZYA 4NG5A 3RI3A 1JQ5A 2DCMA 4OQQA 2DKNA 1E6WA 3RSHA 2ZWIA 2Q8NA 9LDBA 3ZV6A 4E5UA 3DNMA 3N2LA 4CDNA 4B48A 1CNMA 1A72A 2P0AA 3HSKA 1YRAA 4K6MA 3RQIA 2JGDB 3DFIA 3LPAA 3AHHA 2GF9A 3O92A 1E3LA 4ZRMA 2NU8B 3GLIA 4YFYA 2WQ6A 4TT8A 4Y2GA 2GFQA 1L5WA 5C5EA 3WFIA 4QX6A 1BE6A 3PFGA 1JVSA 1KYIA 1MEEA 2VBFA 1C3VA 3DTVD 4H60A 3UAWA 5FT9A 4I5IA 4YCAA 1DX4A 4O25A 2HOQA 5FUWA 5FWXA 4RA9B 4GBJA 3KFLA 3KSBC 4ID3A 3E22B 5CIWA 4EDHA 3CINA 3SHWA 5DHQA 4ESEA 5LP6B 5C7IO 2JKYA 1RHUA 1VBNA 1DVRA 4ZC8A 3M4NA 2FDCA 1MO3A 4QARA 2CW5A 4ZO4A 2J6BA 5AJVB 2H54A 3WWCA 1DLIA 2QLLA 3DEKA 2ZM6B 4G5SA 5IBQA 4DLXA 1N2BA 4ZALA 4X91A 3CR8A 2DHEA 4XD2A 3IQGX 2HRCA 1ZXXA 3CZAA 3RYIB 4BNJA 3VSEA 4DDHA 3SZOA 2Q0QA 1I2AA 1W5FA 3GLHE 1CEEA 1J2JA 4IRUB 4WA8A 1VLLA 5DJ5A 4UVGA 4V39A 3EOAI 4A2WA 5EJ9A 2V54A 3PGJA 4QJIA 3G8AA 4V3BA 1SQSA 5CK4A 2JGMA 3THYB 2AZXA 4HFJA 1ICIA 2ZPAA 3HB7A 2HMWA 4EX6A 2E89A 1QH8B 3D0KA 4TUYA 1G6HA 3ZHUA 5KJ6A 4Q9AA 3GXOA 2FUG1 3PX7A 4CEHA 1JB9A 1RWMA 1E5DA 3CWZA 5EI5A 4YWHA 3ZHVA 4IGAA 4TSFA 5AWFC 1SU7A 3KZCA 2OHJA 4Y67A 2PT6A 1N4AA 2ZSFA 4JOSA 2Q6TA 2ONYA 4RKEA 1RRKA 3EZFA 2JFHA 4XR4A 4P80A 3TZQA 4Y9UA 1UBGA 5FFMA 5FQNA 4HGOA 3ZKAA 4TTVA 1RVDA 4Z7QB 3QJYA 2X4GA 4UFOA 3RUHA 1DFIA 1OC2A 4QT0A 2BMJA 2KBFA 4PFKA 1G3QA 1YV9A 4Z9FA 4DM3A 1ZP6A 3MXOA 2PTHA 2H0QA 2MSLA 4FC7A 1SBIA 4TS4A 2AJ8A 4DRYA 3UK2A 3UBTA 1XRJA 3AJRA 1Y8QB 4QICA 3Q5GA 4IVQA 2OQ2A 1TU0A 2P77A 2PGNA 4GKBA 1LVHA 3CEAA 1RQRA 1Z7BA 1ZD4A 1T9GR 4NV0A 5SY4A 3O7WA 2EEZA 4HYEA 4M0PA 2OL4A 1XZPA 3C5WP 3CO0S 4XFKA 3LCRA 3ZD8A 4EH1A 2QOEA 4KO4S 5TPWB 2BUBA 3ECSA 4W8HA 5J5VA 4GXNA 5KYUB 2EIXA 4AECA 2ZUDA 2HHHB 1OYOA 2BTEA 1UT6A 3NIFB 4CDRA 4D81A 2QG4A 3TXAA 4LFAB 1JJFA 1P8AA 4Y2QA 3KALA 3RJMA 1LPMA 2FVYA 2QN9A 3AF5A 1YZLA 3MTGA 4JBWA 1R0WA 4WNYA 1JIVA 5JCJA 1R37A 1XMSA 4TM7A 2B3TA 6LDHA 3IAS1 2WD7A 3PU6A 4AQDA 1S9DA 2D0OB 4G24A 4PLHA 4PR3A 3HDJA 2AC4A 5ICGA 2SKDA 2YICA 2ZCJA 3QFRA 3TZLA 1ZA1A 2P3QA 1L4FA 2X58A 1P18A 1IOVA 2DFVA 4E13A 1PL8A 3ETCA 5DH9A 4ETWA 2A9KA 2C3OA 3SDBA 4GW3A 1P0FA 1VIAA 2X1VA 2F9FA 3B9RA 1BH6A 1DAPA 1T8TA 2DM6A 4RS4A 4HC4A 4IW3B 3PPIA 1MXHA 1RFGE 5FR2A 2OD7A 3TLGB 4BMCA 1HE3A 1UZNA 4J76A 4YJGB 3PEYA 4TS9A 4TQ9A 3HCNA 4OA8A 4YEDA 1NM5A 3HA2A 3HJAA 4NOLA 3IQEA 4CIBA 2QLTA 4U7PB 1B73A 2VJCA 5K4AA 5BYJA 4UCFA 3HHPA 1O08A 4BAGA 4L28A 9ATCA 3ZD7A 4UDXX 1IZ7A 1ZZEA 4Q18A 1VXRA 4GM4A 4G65A 3MHTA 3RS0A 1UAAA 1U3WA 3FM9A 1R9GA 4P4LA 1U9YA 1UEIA 1GTRA 4HWOA 3QI2A 2D2XA 3AVYA 2R0QC 2FMUA 3L4BC 1WUTA 4RSMA 2BD0A 1EP3B 1K1EA 1L1EA 3PHBE 1S2DA 1M74A 1V43A 1IOZA 2N9UA 3KAQA 2JJMA 2VDLB 4HNAB 1VKNA 1Z08A 4RZSA 3OQHA 5GVSA 2ZI6A 5H1YA 1CNEA 2XMZA 3C3EA 4M8LA 4MHTA 3QVJA 2ZJ6A 2IOFA 2QYTA 4E15A 3IIMA 5TGZA 3OZWA 1F8FA 2F59A 3M7IA 5L45A 3RU2A 5KHLB 1SUDA 1V5IA 2PWYA 4WEQA 1JXOA 5EJ7A 3M3DA 1HYHA 2ZUUA 4IIYA 1PEDA 3NS7A 2FW6A 3VNQA 3ZD9A 5A04A 5FLXA 3DE5X 4WY5A 2UZIR 3Q6NA 1AUOA 4J0IA 2QRHA 4MWEA 3R5TA 5AOVA 1RC1A 2UXCB 1PW5A 1LQ2A 5A3JA 3VZBA 4CKBA 1TLFA 3M9LA 4JCCA 1YONA 2J7PD 2Z57A 1X7YB 3O9VA 4ZFNA 3QYJA 3QVSA 1XXHA 1X7WA 5KJCA 1G3UA 1Y6JA 3K16A 2WYWA 2CDAA 4HATA 4F4FA 5JJIA 4PGMA 3AETB 4HAOA 4JBHA 5TQJA 1EK0A 3V1KA 1V6SA 3EEBA 1XLTA 5J63A 1PLKA 4DYVA 2X3UA 4GZLA 3DTVB 4LF6B 3RH0A 3A3YA 5EXDA 5FPYA 4FGUA 3D0RA 1GV1A 3UJ7A 2CLHB 4MOWA 1S8FA 3MQFA 5H3HA 2WIKA 4PC6A 2F48A 1J2UA 3P9XA 5MDHA 1WHSB 2BEVB 4X61A 5IJXA 4W5WA 2VXYA 3I0MA 2HBQA 4JB0A 4F2WA 1HDCA 3LLUA 4ZIRB 1N8TA 5DTJA 1C1XA 4MRAA 4I8DA 1QBGA 2UUPA 1RLJA 3VPSA 2PZ8A 3AHJA 1RCUA 2ZAGA 1TJ5A 2ADFA 2C88A 2XBUA 3QVGB 1QFYA 4H7EA 3UUFA 1C5KA 2RGCA 1EK6A 2W93A 1QGZA 3L1KA 5YASA 3LU1A 1Q57A 3IJ5A 3OJ0A 1GTJ1 1ONBA 1BWQA 1N1GA 1P8JA 1RM3A 2FSGA 2VP0A 1PV2A 4TN1A 3WLQA 4DJJA 3JYHA 2Q7OE 2HBRA 3KKMA 3NYIA 4YRFA 4GKKB 1W8DA 2E5FA 3A2LA 3OFSA 4FDUA 4F1JA 3OTOB 4G0UA 3DZGA 4OPMA 5HS6A 1RXYA 4ZCSA 1PQUA 1UOQA 4ZU3A 1WRBA 4S04A 4CLRA 5ILOA 1TZMA 3H86A 2CBZA 5EEGA 1PG5A 3HCRA 2I7VA 2WHQA 4PBRA 1Y5IA 2FW0A 4B6JA 3AEUA 3MWDB 1TUIA 2A67A 3TRIA 3HRKA 4AKTA 2MSDB 4JBGA 3KLBA 3N2GA 3DWEX 3AESB 3NHMA 1VB5A 4KXNA 4JT8A 3DZFA 2C7BA 3GVIA 3K32A 1W35A 1M2VA 1RFLA 3AI3A 3UXHA 1SKYE 1QIMA 3R6DA 3DOCA 4S1PA 1DBIA 3BGSA 5DHTA 5TNXA 2OAQ1 1AHHA 1JR4A 1P39A 4CETA 5H5JA 5C46F 3N2KA 2FPUA 4ZO9A 3MCWA 4M49A 1WDMA 4XM1A 3G9XA 4NU8X 3K9NA 1Q83A 3HQ4O 4QSMA 5CVVA 1KBQA 1IQRA 1Q91A 3L6UA 1P2TA 2CDNA 4Q1DA 5P8WA 2XDYA 4D9KA 5HQ3B 3ZD6A 4XW2A 1QGUA 2G06A 2P5UA 3DHVA 1QC5A 3RQSA 1XYYA 2C2MA 4AUKA 1C7IA 5BR7A 2C98A 1XDUA 5I51A 4RDXA 4UUAA 4IVRA 4R3UC 1ECCA 3EIXA 4GPEA 1GGNA 1TVKA 2K2QB 2QSZA 4Y18A 4CM9A 4EL5A 4TXLA 5A4FS 4BPBA 4UE2A 1J0XO 4A92A 4C2TA 4H6XA 4M1ZA 1MFZA 2Q1XA 1ML4A 3NTOA 2R1TB 3COVA 4ZAGA 3T9BA 1OV4A 4A0SA 1J7KA 4D25A 1L5ZA 2WSIA 2XHZA 4LOHA 2F64A 4CMKA 3BTUA 3UJHA 3U44B 3H5LA 5ITVA 1KEVA 3IURA 2A5JA 2D1TA 2O48X 2H2IA 2OZEA 3AR9A 5LBUA 2G7MC 2P75A 1CIJA 4IWYA 1IEWA 1OPRA 1R4MA 5E7MA 3AF4A 1RP7A 4F3TA 2ZSHA 3Q8XB 2DMRA 1ZD3A 4J0HA 1RPNA 3EUWA 5KI6A 3I2IA 2EJCA 4EJ0A 1YQTA 1Q1ZA 3F6BX 1GT91 1O95C 5KVQA 2FQ1A 5HE8A 3VXKA 2C1EA 1VB3A 2WJAA 3IPXA 2R87A 1UPBA 2VDRB 1ECBA 1XNRB 1FSGA 5EQTA 5JBQA 1P9WA 2WE7A 1JLHA 5FI5A 5IAGA 1YRWA 5AW6A 1SUPA 4E7OA 3DUFA 2IUEA 1ZMOA 1SO8A 2DXIA 1ACLA 1QKJA 1J2YA 3QBJA 1ORDA 2N1BA 1MO5A 4J07A 1UMBA 2HUNA 3OO0A 3TBHA 3WGZA 1A71A 4AKEA 1MN6A 2IYXA 4J16A 2AFIB 3EVAA 4BZXA 2HO4A 4ENQA 3WK7A 3C8HA 1XNJA 1NXWA 1XF1A 3IVGA 4IFEA 4LVCA 3B9QA 4FFOA 1RAEA 4DSOA 2Q7XA 4QFMA 1DEHA 3PXUA 3MELA 4ZODA 2XE6A 1HYQA 2DPLA 3VX3A 2R6R1 4ZKDA 1UJCA 3GCZA 4JYPA 3OOWA 3WA6A 3LGAA 2P2LA 2CY0A 4DDUA 5HIIA 3GZNB 4Y0VA 4PBSA 1JJAA 4WZAE 2J30A 3OP1A 4X1YB 2Q0XA 5IMSA 1VPDA 5A4JA 4R5MA 5TARA 4YDSA 5JAUA 5DMHA 1C1HA 4QQNA