3JYLA

Crystal structures of pseudomonas syringae pv. tomato dc3000 quinone oxidoreductase
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
325
structure length
325
Chain Sequence
MAKRIQFSTVGGPEVLEYVDFEPEAPGPQAVVVRNKAIGLNFIDTYYRSGLYPAPFLPSGLGAEGAGVVEAVGDEVTRFKVGDRVAYGTGPLGAYSEVHVLPEANLVKLADSVSFEQAAALMLKGLTVQYLLRQTYQVKPGEIILFHAAAGGVGSLACQWAKALGAKLIGTVSSPEKAAHAKALGAWETIDYSHEDVAKRVLELTDGKKCPVVYDGVGQDTWLTSLDSVAPRGLVVSFGNASGPVSGVNLGILAQKDSVYVTRPTLGSYANNAQNLQTMADELFDMLASGKLKVDGIEQYALKDAAKAQIELSARRTTGSTILIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Quinone oxidoreductase
publication title Crystal structures of Pseudomonas syringae pv. tomato DC3000 quinone oxidoreductase and its complex with NADPH
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Oxidoreductase
total genus 100
structure length 325
sequence length 325
ec nomenclature ec 1.6.5.5: NADPH:quinone reductase.
pdb deposition date 2009-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3jylA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3jylA01
2BFPA 1NVMB 4ALJA 4YXFA 3PGXA 4ID9A 3JCZA 1NM5A 1XG5A 1Z7BA 1N7HA 3A1NA 4YCAA 3UF0A 4E31A 1EFLA 3LSYA 1ONOA 4H16A 5L4SA 1GQQA 2Y68A 3DZHA 4D79A 5K1SA 4JX8A 1JKFA 2ZB7A 3KETA 4A03A 3H5NA 4MO2A 3RD5A 5G2OA 2WE7A 5DBFA 2ZIZA 3Q9UA 1H93A 3JQBC 3QY9A 4OAQA 3VTZA 5I7FA 1LLQA 2ET6A 5FYDA 4EDFA 4O59O 3QVSA 4XIYA 2PZLA 3GHYA 1Q7GA 1HE2A 1O0SA 3WGYA 3CZMA 1ZSVA 3IQDB 3VPSA 1B8VA 3GC6A 1E5QA 1MFZA 1LQTA 1U3UA 2Q46A 3UH1A 4N5LA 4N5MA 1ZK0A 1KERA 3DR3A 2WWRA 1Q0HA 1EUDA 4CLOA 4XQCA 2X9GA 2D8AA 1PJCA 1GPJA 1QORA 4BO7A 1T4BA 3F3SA 3WWZA 1YL6A 5B12A 2P91A 3WGIA 1PS0A 4C7KA 4CR8A 1HDYA 1ML3A 2FR8A 4AICA 3EDMA 1X13A 3ONFA 3F47A 4CM8A 5L53A 3KV3O 4OXNA 4ZRNA 3H3FA 4NBRA 2P5UA 4PVCA 3EUWA 2O48X 2NADA 2NM0A 4Y6SA 1UR5A 5TGDA 1Q2XA 4LGVA 3UOGA 1UXJA 3MCVA 1YQXA 2P4QA 4CM7A 3RBVA 1P1RA 3AFMA 4YBZA 2G1UA 3PK0A 1LI4A 3V8BA 3WYBA 4E5PA 2TMGA 4J7CA 3EC7A 4M54A 4H3VA 1K3TA 1YBMA 2RHRA 1H2BA 4D3SA 3ZWCA 3V2GA 2VWQA 2IEBA 4XR9A 3NT2A 3PQDA 1UP7A 3V1UA 3U0BA 4BNJA 1JLLA 3U9LA 1TT5B 4I9NA 2YHIA 4B4VA 5CDYA 3R1IA 1I3MA 3FBGA 3RC2A 4JN6B 1NTOA 2VRCA 3L4BA 1GV0A 1CERA 1GFSA 2HK7A 1QLHA 3GNTA 2VWGA 4JP2A 1XWFA 5TJHA 4Y8VA 4RVDA 4OO3A 3ICCA 4CPDA 4RQTA 3G1TA 5A5FA 2BLLA 2AE2A 3Q2IA 4EBFA 1ZMOA 4Z3KA 3AOEA 1XGKA 2VT3A 5G4KB 5JXWA 2DFVA 2I76A 4ZQFA 2O50A 1Z74A 3OIGA 5BT9A 5IN4A 3JQGB 2P9CA 1EVJA 4FD3A 2B0JA 1PQPA 4A5OA 1QSGA 4FB5A 4JQCA 5JDIC 4NNJA 1TEHA 1SBYA 3DBLA 5JDIA 1HF3A 4ROSA 1R12A 5H82A 5TC4A 2OP1A 3JD4A 3MOIA 4K1LA 1R4MB 5A1TA 4FC7A 2BELA 3I9NA 3PGJA 3VPXA 3ZWBA 1EFKA 2ZTLA 3CUKA 2C20A 2ZCUA 3OA0A 4BVAA 4PN3A 1HT0A 1CYDA 3DHEA 2AQIA 2NQTA 5A04A 3ZW9A 5GZ3A 3D3WA 5JCXA 1J5PA 1Y8RB 2YV2A 3STHA 2B36A 3IMFA 4DLLA 4II2A 1MG0A 3OH8A 3DAFA 3WLEA 3ADOA 1H6DA 1LC0A 2EF1A 3M1AA 1PJSA 5B1YA 3QVXA 3I4CA 5CEJA 5ITWA 4AJLA 4GPD1 5I9MA 3D4NA 1H6BA 3WMWA 5A9SB 2JCXA 3BTOA 4QUKA 1TB4A 4NU5A 4CV0A 4DL9A 4YRBA 4QQRA 3RU9A 4WLVA 2BI7A 3O26A 1DEHA 1PQWA 2ILTA 3H9GA 4YAKA 1I8TA 3LZ6A 3TN7A 1RKXA 3JQDA 3O03A 4MVJG 1UZLA 1KY4A 5DCWA 3RKUA 2AXQA 1C0KA 2X9NA 2Y0CA 1B3RA 3U3XA 3ORFA 2FY8A 2UUPA 2UDPA 2GERA 5FFFA 2QQ5A 3OA2A 3KEOA 1FDUA 2V6FA 4F3YA 3FR8A 3D4PA 1GZ3A 5L7YA 1E3SA 4XYMA 3L07A 1UXGA 4CL3A 3N7UA 2HQ1A 4KQWA 2EWMA 3D5TA 4Y6PA 1KS9A 4GWKA 4BQRA 2EKPA 1ZCJA 2NACA 1P77A 2WYWA 5BSFA 2V7PA 3IJPA 1VI2A 4E30A 1DOHA 5COBA 3HFGA 2X8LA 5EIOA 1GUZA 3ETEA 3KEQA 2AHRA 1E92A 1YL7A 4UUNA 3ZWWA 5ILGA 1SNYA 3CMCO 2WMDA 3KB6A 4CMJA 4IJUA 2FOIA 2J3KA 1HDXA 1JW9B 1HDGO 3D0OA 4BNLA 4DIFA 3FTNA 3PQFA 1VSUA 2Q49A 1N9GA 3U4HA 1XA0A 1G6KA 4L73A 4IQGA 3KSUA 2VWPA 4P8RA 1QYXA 4HV4A 3W1VA 1HSZA 3PHJA 5DDIP 3SEFA 4R01A 4WLUA 4WLEA 4J7UA 2PK3A 4KUEA 1KEVA 5HWSA 2YUTA 3DTTA 4PGFA 4XQEA 4RDHA 5JAMA 1EK5A 4GSKA 1W0CA 1ZK2A 4XRRA 1T24A 4GLLA 1MC4A 3AWDA 2R6JA 1R6DA 4NI5A 4IPTA 1GADO 2B4QA 3KBOA 3IDSA 3RAJA 4QEDA 4WJZA 1MB4A 2EGHA 3EMKA 5FEUA 2J5RA 3DBRA 4CM9A 4W7IA 1VLLA 3WSWA 3GMDA 1R66A 5T8KA 2H63A 3K92A 1KOLA 1F0YA 4RVGA 2GF2A 1C1XA 1N92A 2X58A 4RPKA 2G5CA 1DIBA 3DAPA 3SJ7A 1PJBA 1H9AA 4JJIA 2E82A 2RIRA 4K6CA 3AK4A 1V8BA 1T2FA 1HDRA 1WWKA 1HZZA 2V6BA 4KTVE 4D3DA 4XQ9A 4D43A 2DBVO 2A4KA 2HU2A 3M1LA 3RBZA 2GD1O 1H2HA 5JMWA 4CM4B 5L9AA 2AG8A 4L76A 3A06A 2PD6A 3ZH2A 3BMNA 2XXBA 3ROKA 3WIEA 4BKPA 3FBTA 3CSDA 1FDVA 5K6AA 1NHGA 5JSFA 4LK3A 5IZCC 1Z7EA 3TWOA 1UP4A 1GEGA 4URFA 1KC3A 2IXBA 3UW3A 4Z0TA 2GN4A 5TT0A 2G17A 2YHUA 1UXIA 3HWRA 1H6AA 1FDWA 3G49A 2BI8A 1U7TA 2NVUB 1Y8QB 2PD3A 3RKRA 5KJ6A 4KOAA 1U3TA 1T2DA 3OJ0A 1D3AA 4NHEA 3TRIA 1WZIA 4AJKA 4KWHA 3C3XA 4UVHA 3ZWXA 4PLTA 4ND2A 1UZMA 1P1HA 5H81A 4CQMA 2IDZA 3ZWPA 1ZEMA 3QP9A 4FJ0A 4MP8A 3ZU4A 5ITVA 4CM1A 1UXHA 1U4OA 4TRMA 1NFRA 3L6DA 4Z9FA 4DRYA 1DFIA 2B83A 4GLOA 5LCXA 1WDLA 3A28A 1MG5A 4FFRA 3I9LA 4I5DA 4PFJA 2VYND 3S8MA 2Q4EA 5A9RA 4U6SA 3A14A 3O9ZA 1VM6A 1CIVA 4NQZA 4DLAA 1R0SA 1F17A 3EY4A 3TSCA 5DN9A 4E5MA 1WZEA 2VHYA 1LDYA 3GZNA 3QHAA 1XU9A 2ZJ1A 3GUCA 3F5QA 1HYGA 2NSDA 1SOVA 3AY3A 5CEEA 5JC8A 4R9RA 1PR3A 1WVGA 4GVXA 2NWQA 2YV1A 3KSZO 4XKJA 4A0SA 2VNSA 5L95A 4P4NA 1Z45A 3F4LA 5HA5A 5JW6A 2EG9A 1HZJA 3DMTA 3ANMA 4YTEA 4XB1A 1LDBA 3ROPA 1GUYA 3BHMA 3JYNA 3MJSA 3WGQA 2EP5A 2FP4A 1YRLA 1R37A 3I52A 3RUDA 3HUDA 3S2IA 4B4WA 5T64A 3AUSA 2RBEA 4AJNA 3WTCA 3HB4X 1OC4A 2BKAA 4I9HA 1ZK3A 1MXFA 3KYCA 2ZKLA 2JKVA 2D1YA 4M89A 1B8UA 2HMTA 4AJEA 2DUUA 3PI7A 2Q2QA 1SC6A 4C7JA 4MKXA 5L4NA 4EI2A 4HNHA 1VPDA 1YOVB 3HNPA 4R1UA 2OZPA 1DBVO 4YWJA 5L51A 4EUHA 4GH5A 4MIYA 5DOVA 3S1LA 3TOXA 5GZ1A 1G1AA 2DFDA 4NJMA 3GVIA 1EBFA 4QFCA 1VJ0A 5HS4A 4KZPA 5DZSA 4W99A 3IIEA 3WFIA 1DIGA 2DPGA 3FNGA 3NJ4A 4IJKA 3JQEA 1YB5A 2J5QA 2W90A 2OOSA 1Q7CA 3QE3A 2C2XA 2XAAA 2PD4A 4NG5A 4QX6A 4DYVA 1MLDA 1YJQA 1YJ8A 4B7CA 1HLPA 3S2GA 1BHSA 3OEWA 4TWRA 1CDOA 1VRWA 4UEOA 4EEZA 2DAPA 4WGGA 3BMOA 3LYLA 3UAGA 4CMKA 3H3JA 1NWHA 2V6MA 5J23A 1ADGA 1BMDA 4ZQBA 4U0KA 4PCVA 5CDUA 4MVJH 4PLYA 1XR3A 2EEZA 3SX2A 2DM6A 3AI2A 1E77A 2GRAA 3TZQA 3K8ZA 3OIDA 3H6KA 1PWZA 1A7AA 3I6IA 3JSAA 1Q0LA 4IDEA 5TF4A 4WEQA 3UKOA 1NAIA 1OZAA 3PWKA 4BKUA 4ALKA 3NKLA 1HDZA 4ZHSA 3GDOA 1I0ZA 1LSSA 2QRLA 1KYQA 2UUOA 1O94A 1M76A 3ZCXA 1DJQA 3C7CB 4ZRMA 3WDSA 4CV2A 3KM0A 4DC0A 3PJDA 2GDZA 4YR9A 2EKLA 2B4TO 2CVOA 2JJYA 2E48A 4CLDA 4R1NA 4W9NC 4Y67A 1Q1NA 3P2YA 4W9NA 1VKNA 1RYEA 3SC6A 2GO1A 5A9TA 3WYCA 3KO8A 1Y9EA 1SEVA 3DZBA 1ULUA 4L74A 4LVCA 2JL1A 3ZWOA 3FHLA 4EYEA 5KWEA 4CQLA 1NR1A 2YY7A 2VT2A 1IE3A 3RROA 3SLGA 2XF8A 5JAIA 3PLNA 1GEEA 3PFWO 2IEDA 4JJGA 3A4VA 4Z9YA 3W8FA 3JQ8B 3GN2A 3PIIA 3HZZA 1A4IA 3DFUA 3NV9A 4YYZA 2JHFA 2VHZA 3TPCA 3OIFA 3OSUA 1P31A 2PY6A 1LQUA 1C1DB 4A2CA 4BGEA 3RUCA 3D5QA 5IFLA 5AVOA 3C7DB 3RUIA 4II3A 2X5OA 1U4SA 4R68A 2OBNA 4FR5A 4OMUA 1YKFA 4WEOA 2FPIA 3ZWMA 1U2GA 3HN2A 4WCFB 4LISA 1FDTA 1X1EA 1U8FO 4NMHA 1QRRA 2PGLA 3CZRA 4WKGA 2QYSA 3MWEB 2J5KA 1LRKA 2C07A 2HSDA 3WS7A 3ZDFA 1L7DA 2WD7A 3C7AA 4IQ0A 4J2HA 3UGKA 3VVCA 3D4OA 3F5SA 3OJEA 1NASA 3PTZA 4WCDA 3I23A 5JYDA 4CLRB 2VRCD 4UEJA 1IZ0A 3ZWVA 1VL8A 1GZ4A 2QRKA 2Y1OA 5EPOA 3X2FA 3P2OA 4LCJA 1D1TA 2WSBA 4FFLA 1JQBA 4XGKA 2VUTA 3ZWYA 1YGYA 3HFSA 3Q3CA 3SJUA 1KVQA 2EXXA 3GAFA 3BAZA 3BMQB 2O7QA 3HHPA 1U5CA 3KSDO 3CINA 3MJ4A 3B1KA 3PEFA 1B3BA 2NVBA 4FGWA 4ND5A 4RPGA 1DDOA 4DREA 1KIFA 3U09A 3SXPA 2ZQZA 3CEAA 3VZSA 1AXGA 4TQGA 1E3WA 4DA9A 1OC2A 1PEDA 2C54A 3INTA 3KTDA 1ZSYA 3K31A 4L0QA 4BO8A 1I32A 3HSKA 1KC1A 2F00A 1UAGA 4ILKA 3Q2KA 3IUPA 4QT0A 2RCYA 5F1PA 1EUCA 5DBIA 1ZIDA 3LDHA 3TFQA 1ID1A 2PH3A 4IUYA 3DONA 4FIZA 2PKRA 4OSOA 5DOZA 3E82A 4Q39A 3IL2A 4XX0A 1CQJA 4BV8A 5JE8A 1K6JA 5ENVA 1HE3A 1A9YA 2RH4A 4CLOB 5ADHA 4DBZA 1ZO8A 4JBHA 1CRWG 2CMDA 2VZ0A 1QYWA 4XQGA 1W6UA 4ND3A 4BO1A 2Z5LA 1RM0A 4J1TA 4GX0A 3JQAA 3GFBA 5U1PA 2CSUA 4LMPA 4CM8B 4KDFA 4MOWA 3WGOA 4BNTA 5CEFA 4FOSA 3WNVA 1HLDA 3GVPA 5F1OA 4WLNA 1R4NA 5EMHA 3W4KA 4F6CA 3I6QA 2I6TA 1Q7BA 3ASVA 5TX7A 5DNAA 3GOHA 4NBVA 3PVZA 1ADCA 1DXYA 1V0JA 1RWBA 3T4XA 2UAGA 3E5MA 4ESOA 3TZKA 1QG6A 5CFZA 3VC7A 3GFGA 3GK3A 3ITDA 1MFPA 4S1VA 4G81A 4BOYA 3L6OO 3JD3A 1RM5A 1RM3A 3K6JA 4BB6A 3KYDA 4BNWA 2I3AA 3FI9A 4RPLA 4YT5A 1HRDA 4CJXA 1VJTA 4IZIA 3DXFA 4GX2A 3CXRA 3TDKA 1C0LA 3JD1A 1SZJG 2VZ9A 2YHIB 4IS3A 4PG7A 4PLPA 3TZCA 4F45A 2D4AA 2R00A 1QYVA 4L8VA 1M67A 5CG1A 2GZ2A 3EW7A 1BWSA 2VN8A 3E03A 1FJHA 1D1SA 1IPEA 3UHAA 5JO9A 3I9MA 5JYEA 1DAPA 2DBQA 5KOIA 3PDUA 1XKQA 3VAZA 4J1SA 4XJTA 5C3MA 2BGLA 5CPBA 2HK9A 3L9WA 5FI3A 3IP3A 3T7CA 2NU8A 3NGXA 2O4UX 3GPDG 1UDBA 2ZYDA 3FRJA 1L1FA 1KVSA 2CFCA 2X1HA 4Q3EA 5IZ4A 4UUOA 1DIAA 1EUZA 1E7YA 1UZNA 3B1JA 2FWMX 5JPIA 1E3LA 1B2LA 2X0NA 2BFOA 1TVEA 2AQ8A 4CLHA 3GDGA 4BB5A 1BTOA 3EVNA 1HDCA 1K2WA 1NQAO 3PLRA 1XSEA 4RO0A 2Y05A 5T6BA 5BR7A 1PSDA 3GH3A 4CM9D 1GYRA 4ZQHA 2X4GA 1SAYA 4PZDA 1AE1A 3OP4A 4WASA 4ZD6A 4E21A 2UV8A 2B35A 4XEHA 3D3WB 3AI1A 2D3TA 4CMIA 3RBXA 5GMOA 4J0EA 3VZQA 4GKVA 1UUFA 2CVZA 3D1LA 3NTRA 3DDNA 4TVOA 4EUEA 3LT4A 5A05A 1MUUA 3K73O 1QV6A 3GGOA 4IIUA 4LN1A 2YYYA 5I8ZA 3GGGA 3ZHZA 2EERA 3UXYA 1GZ6A 4OKNA 3FNHA 4CMAA 2FN7A 3WGGA 2G76A 2PV7A 4UEKA 2DU8A 1UDAA 1LRLA 1U7HA 4GVLA 1FK8A 4LVUA 4MDHA 4BO6A 4BNVA 3P7MA 4BNIA 4CMEA 3L4BC 3C24A 1DSSG 1PR9A 3KHUA 1Z73A 2C29D 2Y67A 3EVTA 4K6FA 4B8WA 5JLAA 2NTJA 1WW8A 2YJZA 3KLMX 5L45A 2OP0A 1K5HA 2X86A 4A26A 1B7GO 1NXQA 3PWZA 3QWBA 3H5AA 3KZVA 4DPMA 5IXYA 1YH3A 4JP3A 1ONPA 5L40A 2O2YA 3AOEC 4CQMD 1ENOA 1PJ4A 3C1TA 4I08A 3QWFA 1SOWA 1V6AA 2ZYGA 2O3UA 3BXXA 3EHEA 4Q3DA 2PNFA 1ZBQA 3U62A 4PZCA 1HE5A 4R5MA 5FWNA 1F8FA 1QXSA 2ZK7A 2QW8A 1FF9A 1UH5A 1GY8A 1WXDA 1WAMA 1DHTA 4DLBA 2TMDA 1O89A 4YJHB 4DIBA 4RVFA 1N9GB 3WIDA 5I7VA 3PYMA 1HWYA 1T2EA 2AG5A 3TOZA 3F1KA 3DZGA 4YJFB 4CMBA 3GA0A 4FW8A 2AW5A 2H1SA 2Q4BA 4OGWA 3DBHB 3LF1A 1S7CA 3MJEA 3OECA 3NTQA 4TROA 1GD1O 3V5NA 2BGMA 3QSGA 2AEJA 5LDGA 1N1EA 4S3MA 4TZTA 4AJ1A 3ZV3A 2HO5A 3U4DA 5C7LO 1JN0A 1E1MA 5JY6A 4TVBA 2WEKA 2FR0A 3KLPX 1BXZA 1T1RA 3E9MA 2G82A 4IZHA 4DUPA 4MP3A 3ULKA 2J6IA 2NNLD 2YV3A 3WR5A 3DC2A 4TRNA 4YAEA 5ICSA 4QSMA 1EVZA 1AUPA 5G0VA 1X0XA 1SPXA 3SLKA 3VH4A 3IAHA 1D4FA 2VZ8A 1DAOA 2GR9A 4BO9A 3NDIA 2AMFA 1ISIA 3MTJA 3DB2A 3TFOA 2VRBA 3NJ8A 2Y1DA 3LT1A 1PGNA 1DC5A 4U6QA 1O6ZA 3BMNB 1Y5MA 1UP6A 1JKIA 3LC1O 2EKQA 1SB9A 4HNGA 4TRJA 3TF5A 2RH8A 3WB9A 1IY8A 1YS4A 3PXXA 4NJOA 3VTFA 1PL6A 3BA1A 1PIWA 4EITA 1P0CA 3WNQA 3AW9A 4CLXA 2V6GA 3GZ4A 1DIRA 4NU6A 1T1SA 2I9PA 1YBVA 2XOXA 3LLSA 3GPIA 1U28A 4OSPA 4XGNA 2OBYA 3LF2A 2EHDA 4NK4A 4ZVVA 4OKIA 2EP7A 5B4UA 1YL5A 4NFYA 1MV8A 4O6VA 4CR7A 2NQ8A 1WDMA 5F5NA 1CWUA 4DMLA 3N58A 4XJSA 2CDCA 1LX6A 3JYOA 3W6UA 5G4KA 2NVWA 2WM3A 2Y0EA 4IDBA 3QW2A 3B1FA 3JYPA 1EVIA 5JY1A 2DBRA 3JQGA 4NBWA 4RLSA 2IE0A 4IINA 3H8VA 1BXGB 1NQTA 2F1KA 5C7OO 2X0IA 1XLTA 3BYZA 3JQFC 3GG2A 3HDYA 2B5VA 3FNFA 3JQFA 3H9EO 1R4MA 3RFVA 2RAFA 3FD8A 3HN7A 1C3VA 5DP2A 4D41A 1EMDA 3INRA 3FWZA 3KVOA 4DXHA 3TQHA 4RORA 2PTGA 1DHRA 2VYVA 3I83A 4KTTE 4XWYA 5T8KC 2ZTMA 5JBIA 3FR7A 3W8DA 3WYEA 2I66A 3B20A 1Y8RA 5AXAA 2FRDA 2HMVA 3FF4A 2OO5A 5C37A 5IJZA 2GCGA 4WUVA 2I67A 3TZ6A 2GN6A 1G0OA 3UVEA 1RYDA 2OGUA 4EUFA 1O9BA 4W7HA 5BSEA 4Z0PA 5T67A 1GDHA 1EVYA 2QYTA 1B0AA 3E9NA 3JD2A 1NPTO 4HBGA 4BO4A 4EGFA 5KJFA 3R0IA 4L9RA 5A9SA 2PWZA 1OI7A 1MGOA 2YFQA 4BO2A 3KYCB 3C1OA 4RCVA 3AU8A 1RPNA 2G0TA 3Q9NA 5THQA 4IQ8A 4BO5A 5K6AC 2I5PO 1DB3A 3EZYA 1X7DA 3H9QA 5DCUA 1V3TA 5A3JA 4QTZA 1NFQA 3F6YA 1TT7A 1EZ4A 1LLDA 4UVEA 3VOSA 1XIVA 2J3JA 1ZEJA 1YB4A 3CE6A 3GVCA 5DT9A 4A73A 1EEHA 4OH1A 4D42A 1NVGA 2A9FA 3ZHYA 5AOVA 4R41A 2DQ4A 4IXWA 3TL3A 1ZXLA 1BVRA 3OETA 4E4YA 2C59A 1K6IA 5EL0A 1LUAA 3I1JA 4NJMB 2Z95A 3P5SA 4OQYA 3ZU5A 1ZJZA 1PL8A 3QJ5A 1QP8A 4N18A 3TJRA 3PYXA 5JAQA 3Q1LA 2QZZA 3CKYA 3HADA 3R3JA 1ENYA 2WYUA 1JU9A 1E7WA 1CETA 4J7XA 5CDSA 2FZWA 3GDFA 3I9KA 4I5EA 5IDWA 3RQSA 2P68A 3BMCB 2O3TA 4NR0A 2WDZA 5EQDA 1PZHA 1DLJA 3JYLA 3DTYA 2FMUA 4N7RA 3DOOA 4YAJA 3A9WA 4X54A 2IODA 3K2EA 4PLCA 2ZATA 4RJTA 4D3FA 4CV3A 4J90A 1Z6ZA 5KJ1A 1MP0A 4B3HA 1AHIA 4XYEA 1EK6A 4K26A 4XIJA 5TJ9A 2Y66A 1VE9A 4Z0HO 2WTBA 3IKTA 4CMCA 1V9LA 3LVFO 5T57A 1DRVA 4GI2A 4J4BA 1Y5RA 2IXAA 2CF5A 2VHVA 3DMTC 1QYCA 4BNGA 4AFNA 4J16A 1BW9B 1XDWA 1KETA 3DZFA 2DC1A 3UUWA 3GLQA 2PZKA 4J3FA 1VL6A 4B4UA 1E3IA 1R0LA 1NQOA 3O8QB 4BNUA 3N74A 4BKRA 4FFMA 4CUJA 4YT8A 4J1NA 5I8WA 3ON5A 1I2CA 2UYYA 4FFOA 4LRTB 2LDBA 4E12A 2Q1SA 3DWFA 1I36A 3BIOA 4IDAA 4JBGA 1ZW1A 3AM4A 1P33A 2BGKA 1XYGA 2NUAA 2J3HA 3D7LA 1Y1PA 1ENZA 3JQ9C 4RQUA 3PZRA 3JQ9A 1H0KA 4PLFA 4XYBA 4ALMA 2FPGA 2W2LA 3PJEA 5KKAA 4RDIA 5DCYA 3JQAD 3SVTA 1W4ZA 4LSWA 2PZJA 3QVOA 3PIDA 4HFMA 4CM4A 1DC6A 2P5YA 4RF2A 3RC9A 3UICA 3UCFA 4FC6A 1P1KA 3SC4A 1ZH8A 1F06A 1T25A 3WX0A 3K30A 3FPCA 4K9DA 1W73A 3L4SO 4FQ8A 3ZNOA 5A06A 2X9VA 2W8ZA 4N5NA 5B4TA 1C0IA 3NDJA 1HL3A 4MJLA 3WGHA 5GZ6A 1KVUA 1LRJA 1N7GA 1YQDA 1YVEI 5ICMA 3GVXA 2NVUA 8ADHA 1Y8QA 4OQZA 3G79A 4PLWA 4BNHA 2DPHA 4CUKA 4EJMA 4D44A 5I7EA 1IL0A 4IGEA 2P2SA 2Q3EA 4U0JA 2JCYA 5A5EA 3GUYA 4YJGB 2FSVA 3ROQA 3Q11A 5G0UA 4I5GA 4HADA 4FFNA 4B3JA 3GR6A 1BXKA 1CEQA 4PLGA 5K9ZA 3GT0A 1SMKA 3RC1A 1H6CA 2QX7A 3TZHA 1QV7A 2HAEA 3F46A 4HFNA 4MP6A 3PYLA 2AA3A 4D0SA 5IDQA 1E1LA 2C82A 4NZ9A 3IOYA 3RIHA 1ZZEA 4GKBA 5H83A 4R1SA 2AQKA 4PZEA 4JIGA 1ORRA 4J9UE 1YWGO 5COAA 3NT4A 3NX4A 1B14A 1IHYA 5T5QA 3ZWNA 3OJFA 1XQ6A 1YO6A 4I1IA 4YQZA 3V1YA 1LXCA 1I3LA 1PS8A 2E4AA 2HKIA 2PZMA 1TLTA 4NBTA 1XHLA 2DT5A 5JMPA 3JTMA 1TI7A 4LCEA 2BRUA 4CV1A 1GCUA 2D5CA 1RJWA 4R4JA 3JQ7B 5I7SA 1YE3A 3B70A 4HXYA 4JBIA 3ZNPA 5A02A 2VHWA 1Z82A 2FHSA 2FZEA 2E37A 4ZU3A 4D7AA 3H2ZA 4CLEA 4CMHA 2VQ3A 1WDKA 4FBGA 2HMSA 3D64A 2J8ZA 3W4IA 3TNLA 4GMGA 3BTSA 2CDAA 4UAGA 1LA2A 3FWNA 3WQRA 3BHIA 3VKVA 3WTBA 4NDNE 1ONNA 3ITKA 4MVJI 2JD1A 3CH6A 1R0KA 5TRTA 3NTOA 4B7UA 4DIOA 3R3SA 4GSLA 4GX1A 4CODB 2Q45A 2BF7A 5L7WA 2O7SA 4PLVA 3EZLA 1HKUA 2O3SA 4HUJA 4E13A 1E7MA 2VNAA 1PJ3A 2Y99A 3OHSX 5JC1A 4Q3AA 3DHYA 4IBOA 2H9IA 1F8GA 1NAHA 4HX5A 4HP8A 4B8ZA 4RV9A 1OBFO 1IZ9A 1U2DA 5AYVA 2O3QA 3EK2A 3MOGA 1ADBA 1ZKMA 3QV1A 5JCJA 2CD9A 5ES3A 4LRSB 1SB8A 1MX3A 5G4LA 1NP3A 2DTDA 3PWSA 1ZUD1 4Q3CA 4CR6A 2B4RO 2HJRA 1O5IA 1Y7TA 5L7TA 1MC5A 1JAXA 1NPYA 2CY0A 3JYQA 4WPGA 1L7EA 3M2TA 1I3NA 1HSOA 3HJAA 1GPDG 4GX5A 3VPGA 2POQX 2DVMA 3ZW8A 3I9OA 4DYDA 4FJ1A 2X0JA 2NLOA 3INGA 5CP8A 1O95A 4GAEA 4RZHA 3WOHA 1Y81A 4YPOA 2C5AA 3ANLA 1JVBA 3ZWAA 1JVSA 3ASUA 1NR7A 3ZU3A 2EW2A 4U5QA 3ZV5A 3AUUA 1YB1A 3KYBA 4HWKA 4JXKA 4Q3NA 4J9VA 3F1LA 3HG7A 4LSMA 3ONEA 1ISMA 4FOOA 3G3EA 2X7HA 5A03A 4JNKA 1K6XA 1LDNA 1P0FA 3JQ8A 4IDDA 3OJOA 1OMOA 3HE3A 2D59A 4YA6A 3QLJA 1ISHA 2P4HX 3E8XA 1XQ1A 5CDGA 2IRWA 1A9ZA 1Y9AA 4WLOA 4RVHA 4I8XA 1LSUA 4CMIB 1C1DA 2NU9A 1AN9A 2VHXA 3ZN2A 3AUAA 1N8KA 2CUKA 2LDXA 2W98A 5JDCA 4OOFA 1EE2A 1HEUA 1WMBA 4M86A 5JFOA 3VKUA 2D5AA 3I3OA 1OFGA 1UXKA 2PA3A 4DC1A 4O5OA 3GMSA 3LU1A 4FS3A 4FJ2A 5CDTA 1PX0A 1CQIA 4DTIA 1E7SA 2JFGA 2GZ1A 1DRUA 4DGSA 4R9SA 4E32A 3L6EA 3GY0A 1P1JA 1LC3A 2J3IA 4C4OA 2R00C 2OHXA 5C7IO 3ICPA 4PLHA 4YJDA 1HXHA 3CTMA 4CLRA 4F46A 3V1TC 1GYQA 4NBUA 3SBOA 4YB8A 4A10A 2Z1MA 3JQCA 3K2BA 4RPHA 1T2CA 4PRLA 4PG8A 2CNBA 4G5HA 3PRJA 5EESA 1IOLA 1LTHR 2QIOA 3RU7A 3BMQA 2YQ4A 3DMYA 2VOJA 4BL5A 4JK3A 5KVSA 4EJ6A 3JD0A 1I10A 1I30A 1BRMA 1NQ5A 3LT0A 9LDTA 3E48A 7ADHA 2Y1GA 1IYZA 1VKOA 2O4CA 2WE8A 4NIMA 4AL4A 5CAEA 3PQEA 5AXCA 1ZMTA 4RGBA 4BGIA 3JV7A 4CM3A 3DBLB 2HRZA 3GN1A 4LW8A 3JQBA 4OM8A 4E5KA 1ISGA 4FSHA 3AUTA 5F21A 1JTVA 3L9XA 3ENNA 4NFHA 4AVYA 2JD2A 1MXHA 3ZV6A 4JCOA 3PHHA 1DJNA 4KUGA 4R5HA 1B15A 1W8DA 2VYVD 2HJSA 3C1AA 4BNFA 4BGVA 2X23A 3OFSA 4GGPA 5B4VA 4NPCA 1TA4A 1P74A 3WJ7A 4EW6A 1PZEA 4NFSA 1ISJA 5TSDA 4ITUA 5EQFA 5B37A 5A4DA 1EDOA 1A72A 4IS2A 3P19A 3NEPX 1A7KA 2HUNA 4W82A 3RC7A 2C7VA 2VCYA 3PPIA 4U7WA 4PIVA 2JFHA 4PG6A 1DLIA 1KY5A 1GAEO 5IAAA 1NHWA 3HDHA 4PVDA 2X5JO 4J49A 5G0WA 1KEPA 4L4RA 4A27A 2W2KA 3B6ZA 1ADFA 4XGIA 3ZGYA 2VWHA 8LDHA 4CMEC 4FCCA 4E0BA 3WJAA 4DPLA 5AXDA 3PJFA 4TKLA 4IIVA 4XYLA 4OXYA 2I65A 4ZQEA 1E7RA 3IKVA 3I4FA 3WQQA 3DFZA 3PHGA 2HDHA 3GRKA 2B69A 3IJRA 1CJCA 4BO0A 2GPTA 1CF2O 2JAPA 1J0XO 3WWYA 3AFNA 5TIIA 2ZTVA 4YVFA 4J1QA 2D0IA 3ENKA 4RVUA 3ZI0A 1NYTA 1HDOA 6ADHA 1PZGA 4J2OA 5HTOA 2BD0A 4IJWA 4E6PA 1EQ2A 3ZHBA 3R6DA 2ZQYA 4MPDA 2IZ1A 1VC2A 1YDWA 3E6AA 3VDRA 2AEFA 4MKZA 4OXKA 1X7HA 1B8PA 4NK5A 4AJOA 2HRBA 5L3ZA 5JO0A 5AQ1A 3HDQA 3COSA 5F5LA 1U3VA 1Y6JA 1E1NA 1XEAA 2O3RA 3V2HA 4QECA 3E9QA 4RF5A 1KEWA 2DLDA 5GY7A 4N54A 4B3IA 1E5LA 2GASA 2Q1UA 1YONA 1V35A 4GL4A 4D0RA 1AXEA 3U4CA 4M87A 1E3JA 1QKIA 3KUXA 4MINA 3PHLA 5CG2A 1GV1A 4MVJP 4YQYA 5EJ2A 3HQ4O 2OMEA 5ER9A 4XB2A 3GNQA 1I33A 5FI5A 5BNFA 2DUWA 5TNXA 4ALLA 4AJJA 1H5QA 3QVWA 2Y0DA 4BUCA 2CZCA 2PKQO 1LLCA 3DBRB 1E6UA 4TRRA 5KJEA 2HLPA 1DFHA 4M8SA 1IPFA 2OFPA 4FPXA 2GUGA 2YW9A 1X7GA 3OBBA 1C1XB 5KKCA 4TZKA 5L4LA 4YAIA 1DC3A 2GN8A 4FFPA 2C2YA 3GEDA 2IYPA 1GYPA 3U5TA 3VVBA 3WQSB 2W2LD 3WXBA 2Z1NA 1WMAA 3WBFA 3OQ6A 5KVCA 1NWCA 5ILOA 2Y93A 4I5FA 1Z75A 3BTVA 4AJHA 1U9JA 5BNIA 2DKNA 2GYYA 2I99A 3OICA 4EJ0A 5HS6A 4OIMA 4GQAA 4H15A 1K89A 1LU9A 2NU6A 1TT5A 4MVJA 2D2IA 4Y6RA 4CUZA 3WBBA 1QMGA 4RF4A 1M6HA 1A71A 3LQFA 3WMXA 2Q50A 3LT2A 2C5EA 5DBGA 1H94A 3AY6A 4KQXA 1FXSA 4D46A 5LDHA 5IXSA 4J43A 3DO5A 1Q0QA 2OORA 4BKQA 2V65A 2BMAA 3NAQA 3C8MA 4CQMB 2VTDA 5KVVA 4P4LA 1TXGA 5I9NA 2IZZA 3FN4A 3GHHA 4E5YA 4OOEA 5THKA 3JQ6A 4XZ3A 5CHEA 3IC5A 1I24A 3IS3A 3PZBA 4TKMA 3FTPA 1IULA 3WG9A 1D7OA 4RPJA 1DO8A 1VJ1A 2GLXA 2YFHA 2YQ5A 4JROA 4F6LA 3OM9A 3GQVA 2QG4A 1I2BA 1JDJA 1LDGA 2OL4A 2C7GA 3RSHA 4YT4A 4DPKA 1PTJA 1NVTA 1GCOA 4BNKA 5EN4A 4XCVA 1SCUA 1E7QA 1GQ2A 4R69A 3QA9A 1DIHA 2H6EA 1UJMA 4HY3A 3H9UA 2AE1A 4H7PA 4YJHA 4ZQGA 4JJFA 3GZNB 3DOCA 1U3WA 3CIFA 4YJFA 3UCXA 2RHCA 1UAYA 3DBHA 4BIIA 4ZA2A 1NBOA 1V3VA 2QHXA 3T4EA 4E2ZA 2X22A 3PHIA 4G65A 2PR2A 3GGPA 3DOJA 3QWHA 5CPFA 3VPHA 2PLAA 1PJLA 3MJTA 1YXMA 2FR1A 2Q2VA 4E2XA 4IDFA 3DZIA 4O1MA 3QQPA 4ND4A 1C14A 1P45A 3ANNA 3H5RA 3BTUA 2EJVA 2C0CA 3MJVA 4JGBA 4YACA 1JA9A 3OQBA 3MZ0A 4IM7A 3ZNNA 1A4UA 4OJNA 3FSRA 4D45A 2CF6A 9LDBA 2Q2WA 7MDHA 1F12A 1WPQA 1JWBB 3GAZA 4PG4A 3VPFA 2XXJA 1P44A 2A94A 4Z3DA 3RVDA 5TLSA 1WP4A 1E6WA 1XELA 1JAYA 4DBVO 3AOGA 1BSVA 3QWIA 4QXMA 3D3EA 1KEUA 2Y1FA 4P22A 4RVSA 4YRDA 1QLJA 2CVQA 4KDEA 3Q0EA 3BZUA 5JAZA 1ZK4A 2DTXA 2GSDA 1M2WA 1GUFA 1PZFA 1IUKA 2OXIA 3NGLA 2PGJA 4DQUA 3ZZNA 5IZCA 1U5AA 2CDBA 3IP1A 3DEYX 4ONEA 4ND1A 3DBVO 2QRJA 3QRWA 5JCJD 1PGOA 1K0UA 1U1IA 3BMOB 1X1TA 3U4IA 4GMFA 2AEMA 3AI3A 1ZXBA 1EBUA 4UVGA 1LDMA 3ZNQA 2GGSA 4LMRA 4RF3A 3WICA 2ZB4A 5KTKA 4P4GA 1D8AA 3MWDB 5BSHA 3ETGA 4DWVA 1QR6A 2O23A 3PJGA 1ULSA 4M55A 4IDGA 4IXTA 4B7XA 1X15A 4WOJA 4XYGA 4GGOA 1U8XX 1EE9A 4R51A 2P9EA 4BNZA 1E6EA 2ZCVA 4J0FA 4IMPA 1BXGA 3NRCA 4MIEA 3VZRA 5DULA 5BQFA 4MVJM 3MJCA 3RJ9A 1M66A 1LNQA 3F4BA 2HMUA 1LEHA 1PJQA 2XPCA 4ZN6A 5KNLA 1PL7A 4OL9A 4OHUA 3G17A 3EYWA 2YDXA 4OYRA 5LC1A 1DRWA 3RUEA 1A5ZA 4UVIA 3ZV4A 1H9BA 4BS9A 4IMRA 4L4XA 3W6ZA 2W4QA 1IHXA 2JCVA 5TS3A 1PJTA 1T4DA 4IY1A 1N1GA 3OF2A 3U49A 5I9LA 5C5IA 5F1KA 4CQLB 1BG6A 3H4VA 4B4OA 5A3VA 4AJIA 2PFGA 5COQA 4E2YA 5TT1A 3KRTA 4Q3BA 3ZU2A 1BDMA 3ST7A 1PQUA 1QYDA 1IB6A 1YDEA 3O38A 2BFAA 1GU7A 5TQVA 4IDCA 3NT5A 3VH3A 3NUGA 5EERA 1NFFA 2DBZA 1NPDA 1XU7A 4GWGA 5IN5A 5F3RA 1HETA 4JLWA 4MIOA 2WD8A 4NH4A 5HM8A 1J6UA 4FDAA 4BNXA 2HK8A 1VL0A 3WFJA 4MVJE 1ZFNA 4XR4A 2WYVA 4PG5A 4QO7A 4ZJUA 4UULA 1WLYA 4XD2A 3W4JA 3PFFA 4MVJF 4PLZA 4BHTA 1PGPA 2JFFA 4RZIA 3KOUA 2WJPA 3M2PA 4R3NA 5DP1A 4ALNA 4YEDA 1DPGA 4HFJA 1V3UA 1A27A 1J49A 1P9LA 4I9UA 4YAGA 1HYHA 1J4AA 2WD7B 4P38A 2IYOA 1JWAB 1X14A 3GG9A 4J4TA 5IF3A 3CMMA 3TL2A 3I5MA 4YT2A 4KP7A 3W8EA 3VH1A 3LC7O 3DQPA 4DQXA 4QO8A 1LLUA 1P3DA 1P1IA 2SCUA 4AJPA 2HMWA 2A92A 5AXBA 4BO3A 3HB5X 5IDXA 2FPPA 1S6YA 3EGOA 3BMCA 1I01A 3L77A 4J91A 1PU2A 3LLVA 3WSVA 3OJLA 1E0DA 4FN4A 3GEGA 4FGSA 5KIAA 5G0TA 4XDZA 4J6FA 1KBZA 2EW8A 3V2UA 1ENPA 4E5NA 4YDRA 4BMVA 3I9JA 4G2NA 4R54A 3DAGA 4L75A 4Z9XA 1I3KA 1E3WB 4BQPA 1N5DA 5HBRA 2Y1EA 4BNYA 1NNUA 1ZSNA 4O63O 5JS6A 5HRUA 2GNAA 2ZYAA 4CMGA 1HTBA 1GQYA 5IDYA 1BW9A 2B37A 1B16A 4UVDA 2DTEA 1BDBA 4O0LA 1UDCA 2JD0A 1ZNQO 2Q1WA 1I2ZA 3O8QA 4Z6KA 2VTEA 3AU9A 3WLFA 2FSSA 2I3GA 2JAHA 3H2SA 1YBAA 2NTVA 1PGQA 1YQGA 4HKTA 2O3JA 3IUSA 3PP8A 3RFXA 1ZK1A 2ZJ0A 2UVDA 3GF4A 4RL6A 4EEXA 5K0ZA 3H7AA 3S55A 4CM5A 5IG2A 3AJRA 1ISFA 1P1FA 1PGJA 2EJWA 4BMSA 1YOVA 3VHRA 4DQVA 2EV9A 3F9IA 1LSJA 4RLHA 2JHGA 5BNTA 5KVQA 3JQAB 1PWXA 3UFXA 1HE4A 2NV6A 4KMSA 2Q99A 3RWBA 2EIHA 2P9GA 1E3EA 4XA8A 2NTNA 3GRPA 3DZJA 5FF9A 1R4NB 4E2WA 1OOEA 4U8GA 5EINA 4GBJA 4K28A 4TSKA 5G0SA 5ER6A 2PKQP 4BGUA 4DVJA 3AM5A 4A7PA 3K96A 3AM3A 4M49A 3MEQA 2GN9A 3KXDA 1FDSA 2O2SA 3RFTA 3OEYA 1LJ8A 1NX6A 3RUHA 1BVUA 3CPSA 1B26A 1PJ2A 3KYDB 1E1KA 3ONDA 1FMCA 2QZ9A 3ROMA 4ALIA 1ARZA 3H9JA 4W4TA 1DC4A 3G1UA 3L0DA 3ETDA 2NU7A 3VZPA 2YDYA 4YJGA 1SEPA 3T7EA 4INAA 4KUHA 4QFDA 2VUSA 3OQ1A 3S2FA 4WNCA 3C85A 3RUFA 1T2AA 4W6ZA 4WLFA 3WGZA 1EQUA 2YZ7A 4UUPA 4BNNA 1R16A 1R15A 2VYNA 4CM6A 3O4RA 1M75A 3MTGA 3GNSA 1EDZA 2BH9A 4HFRA 3FCOA 3E18A 3UN1A 1PS9A 5DF1A 3LC2O 4TMFA 4IGFA 3RCBA 4WOKA 2VOEA 1MA0A 3NYWA 3M6IA 5MDHA 5KCZA 4M1QA 3UCEA 3RUAA 4Q9NA 1HYEA 1F14A 2A35A 2B5WA 2ZB8A 5MGBA 1I5RA 4DMMA 4IJVA 4UUMA 4WECA 3E1KA 4WNIA 1OAAA 4L4SA 2E6UX 4J4HA 4B79A 1KVTA 4ZICA 2GZ3A 3GVHA 4XRGA 1ZJYA 1G0NA 2PH5A 5JNLA 3JQ7A 2VUUA 1AGNA 3K9QO 4Y98A 4R3WA 3WGTA 1O8CA 3RI3A 4Y9DA 4E33A 1AHHA 1VSVA 3QVTA 4YRAA 1WNTA 3QIVA 3S2EA 3PDJA 1T26A 2H5LA 3FNEA 4EZBA 2EGGA 5ENDA 3GEMA 3ABIA 1GR0A 3LK7A 3OMLA 2Y1CA 1JKJA 2BFMA 3H65A 5JDCC 3G0OA 4BMNA 1X0VA 2X0RA 1LSOA 4UREA 3DL2A 1GTMA 5U9CA 3VH2A 3EAGA 4MKRA 5KJCA 1XCBA 4E3ZA 1LBEA 3NDRA 4ZGWA 1N2SA 1RM4A 4WCFC 4WCFA 1GL3A 3Q6IA 4CL8A 4AJ4A 4BKOA 6LDHA 4PRKA 5U4QA 3FPLA 2X5KO 3RJ5A 3QWAA 2W2KB 2X6TA 4XDYA 4AJ2A 2PGDA 4WE3A 4WK6A 2R2GA 2Q1TA 1C0PA 4R1TA 4MVJD 3ZHXA 3X2EA 4AG3A 3E5RA 2ZB3A 1KVRA 2OUIA 5BSGA 3BHJA 4BV9A 3K5PA 3DZKA 3VDQA 1M6WA 3HDJA 4R16A 3DHNA 1LDEA 3ADPA 2HCTA 2ZTUA 4KWIA 1BGVA 2AQHA 1ZVMA 3AY7A 4BNMA 1SO8A 2BHLA 1DFGA 2IZ0A 3RASA 2E49A
chains in the Genus database with same CATH superfamily
5CA1A 2BFPA 5CURA 3RIMA 4WOPA 2IIQA 1PR2A 2DJIA 4FNGA 2WPDD 1NM5A 3DCJA 3FUUA 3I30X 1X2EA 2B3DA 1OT3A 2J5BA 3JCZA 3Q5GA 3TUJC 3UV6A 2ZBVA 5DNUA 5FPKA 3ZXXA 3F97A 2PEYA 4YJKA 3BC1A 3QUCA 2Z2KA 4FDVA 3U3KA 2G0NA 4DIUA 2P65A 2WKRA 3R5KA 4H16A 4XLLA 2WF7A 3PDCA 4GOND 4I36A 3DZHA 4OVKA 3SDBA 4D79A 4FUTA 5B7QA 1G42A 3R7SA 3P9CA 1JKFA 2JGRA 1S5PA 4Q9LA 1IG0A 4H7FA 2IYWA 1SBQA 2ZT6A 4MO2A 5DBFA 1GQSA 1P1BA 1PV2A 4UTXA 5G2OA 1PWHA 4AYWA 5I7FA 4PHCA 5CFMA 1Q91A 2OZLA 3D2CA 5FYDA 1N0VC 1VE3A 4AY4A 4ZP1A 4TYQA 3QVSA 4TV9A 1XA3A 5IKOA 4EKIA 1M3SA 3EDYA 2IH2A 2OK8A 5DXJA 5EJEA 2ZUCA 1B8VA 1N36B 3GC6A 4CF7A 1Q1BA 1HUQA 5EPUA 3WIBA 3OP1A 3LYHA 2Q46A 1OX4A 4XM1A 1ZK0A 1AGPA 1G20B 1KERA 4AX4A 3TUZC 1Z5OA 4PV7A 2WWRA 1WUIS 1IZZA 3AZQA 3U3JA 3QXXA 5LU9A 1EUDA 1YHZA 2IOFA 2DWQA 3WO0A 1L9XA 1W4LA 5BW5A 4A23A 1RHRA 4EG6A 4M0MA 1Y82A 5FA6A 3B6EA 3F6SA 5B12A 2P91A 4F96A 1V8ZA 4NOJA 4C7KA 5C35A 1HT1E 3HKCB 3WGIA 3LRTA 2WUDA 2FR8A 1ZGZA 2O1XA 3DSRA 2I1LA 3GT7A 4NP6A 1KSFX 2D3WA 3RVQA 1Z29A 3P9YA 2FQYA 3F47A 3R4CA 4CBVA 4ZYTA 3LQYA 1F9EA 4HPJB 1CP2A 4R2MA 4OXNA 4ZRNA 1JQJC 1PX2A 1WZCA 3EH1A 2COUA 3FCEA 3VJMA 4C4AA 2O48X 1GRNA 3PITA 2B3TA 2UZAA 4E03A 2IXEA 3OQOA 1MO4A 2C4TA 1Q2XA 3KQMA 1PLJA 2YC4C 1UXJA 3QJGA 4RVCA 4UE6A 5ESRA 2P4QA 4KYTA 3RBVA 1X3SA 4CM7A 4RESA 1P1RA 2OAP1 3IH5A 3FMOB 4U00A 2W37A 4PZAA 4Q9HA 1LI4A 4N3GA 4D74A 1Q44A 3EC7A 1YIAA 5LIPA 5HP4A 4H3VA 3EA5A 3BS4A 3V80A 1UBTS 2HD4A 3GLUA 2IUUA 3QLEA 3V2GA 4HTFB 1VG8A 3BCRA 2PZAA 3LPCA 2IEBA 4XR9A 2M6KA 3PQDA 2HTEA 2A0FA 2X3YA 3MMXA 4NZOA 4L3WA 4BMPB 1JLLA 2YJ5A 4DRXB 4N0PA 4IKPA 3EXFB 3UT0A 1Z4MA 2IXGA 2FJ0A 5K8UA 1V2HE 1ES9A 2BMJA 4I1OA 3AKDA 4C7XA 4YP0A 2HK7A 1X1SA 5LZ8A 3KTAA 1XU4A 2VWGA 4JP2A 3VJLA 2WI8A 2JLCA 3JXEA 4EVQA 7REQB 3B7WA 2WJJA 4MYUA 3GLIA 2GAJA 1OZHA 3ZJVA 4N5DA 2C9OA 4RQTA 1X1DA 4CPDA 4OGKA 1U5BA 5EHNA 6CHYA 2BLLA 3NM5A 2AE2A 3A6ZA 1XRNA 2O06A 3EWIA 5PNTA 1GPAA 4O4HB 2W00A 4UASA 2YRFA 1KWGA 4Y1GA 3C3KA 4M8LA 5EVJA 2HIAA 2JVJA 2A0WA 3W7BA 4F04A 2DFVA 4IILA 1E5VA 3L0CA 2YQZA 3G8YA 5IN4A 2FXIA 1L5QA 1GO2A 1XV5A 2PUDA 2ERYA 1M83A 1EVJA 4UM9B 3AL2A 3EVZA 5F23A 1MRZA 5JDIC 4M0UA 2FH5B 1TEHA 3DBLA 1M8PA 1HF3A 1R12A 4OM7A 1C8KA 1RVDA 1H22A 4COOA 3JD4A 3FKSD 3MOIA 4D4IA 1QQBA 3IKJA 2A9KA 3KP1A 1WCIA 3R24A 4FC7A 2BELA 1FX0A 3I9NA 1SC1A 3VPXA 4D81A 3NXSA 1EFKA 3CUKA 4FMCF 2C20A 2ZCUA 4L0CA 1W581 3W2TA 1HT0A 4WKCA 5IW8A 3QF4B 5KC8A 4AZ0A 3D1JA 1GG2A 2AQIA 3DGFC 3DJYA 2Z6VA 4IV8A 4GRIA 4WERA 1HTWA 3ZW9A 3IBFA 5A04A 2E5LB 1FVXA 1NT2A 1KAOA 4S04A 1T0IA 1Y8RB 1QX4A 2ZVQX 1CUXA 3STHA 3IMFA 3PR2B 4I14A 3UAXA 3ZGOA 4BTVA 2WJ4A 4DLLA 3DAFA 3VHLB 3WLEA 3ZKWA 4HDNA 2AI3A 1AKVA 1OZ0A 2EF1A 3M1AA 2J3LA 1QTNA 2P6NA 4PE5B 3TNJA 1FYDA 3I4CA 3NBQA 5ITWA 4TLMB 4ISBA 3LQ1A 4RK4A 1SR8A 3WMWA 4OK5A 4LBWA 4GRDA 1PD0A 3TLXA 3FCYA 3LP6A 4CV0A 2C7PA 1EP1B 2I7DA 2VBFA 2AL7A 1NBEA 3PFIA 4Z86A 5DSTA 3L0SA 3M4NA 1BO6A 4Z1MA 2BI7A 3A1VA 3ZY6A 5ITZA 4OHFA 3TW8A 4MW9A 2W2XA 3SZGA 4CKCB 3KE8A 3H9GA 1XVUA 1YS2X 5I7RA 4R1LA 3TN7A 5DCWA 1UZLA 3E23A 4IHJB 4QNMA 3G0DA 1C0KA 1DKQA 2B4AA 1UMCB 2Q5QA 2Y0CA 3C5HA 3ORFA 2AFHE 5FJJA 5J47A 3SX4A 5IVKA 1MC1A 2B6HA 1W8IA 1P6UA 1JEJA 2OORC 5JBNA 1M1XB 1V1RB 4V24A 4PTZA 4II7A 4FHEA 1D1PA 1UBLS 3D4PA 3FR8A 4XVHA 4W5OA 5HOEA 3CB2A 4DZRA 3EMVA 1E3SA 3PEVA 1FFBA 1AZLA 3CF4A 1GP2A 3LK6A 3L07A 4XYMA 3WP1B 4CL3A 3L5OA 1OREA 3RS3A 3PL5A 3ZHSA 4BB0A 4MCIA 2FU5C 1Y4SA 1ZCJA 3AW8A 2F43B 3F2IA 2WYWA 4BFUA 5BSFA 3IJPA 1U0LA 4E30A 4IP0A 5COBA 3D8BA 3SP1A 2X8LA 2OSBA 1J2TA 3ETEA 4XPZA 4Y2UA 5EIOA 1E92A 5A4AA 3I0ZA 3OD5A 3BDIA 2WIFA 3CMCO 4B44A 1J2JA 2DFTA 4NYMR 2FOIA 2OKCA 1FS6A 1ZL0A 3S68A 2YOHA 1LK5A 1NUSA 4FGLA 4IG4A 1CBUA 1J8VA 4QOFA 4WKOA 4ZAXA 9MHTA 1XA0A 1G6KA 4IQGA 4EJ2A 2A5DA 3KSUA 4WV3A 3TLGB 3VPCA 4DV6B 4TXMA 2VWPA 4Z4GA 1QYXA 1ZPDA 1DUVG 1NBHA 4FGUA 4WLUA 3Q8XB 2G7MC 1VLHA 3SEQA 4WLEA 1N78A 3RC8A 2WJVA 3DTTA 4HRYA 4PGFA 2XF2A 3BEDA 2ZR0A 1V9SA 3LUKA 1T24A 4JWTA 4B3MB 1W19A 4F60A 5I7UA 2R6JA 3AHCA 4NI5A 1W85B 2YL2A 1RHKA 1Y0BA 4ZOLB 3J80A 4QEDA 1M2GA 1FU7A 2QAGA 3RSSA 3N3BC 1UMBB 4DY4A 2PSJA 3DBRA 3UWMA 4CM9A 2D5BA 5AHXA 5J2UA 4LEIA 4J94A 3D59A 5LNK1 3ROTA 4RVGA 2OHOA 2X58A 3HJHA 3B1XA 4RPKA 2G5CA 1DIBA 4X1OA 2J3DA 1PJBA 3LBIA 2ZI4A 4JJIA 1T9GS 1TC2A 2E82A 3MSCA 5ESWA 1T4CB 1N3IA 1FYXA 1NVEA 5D2CA 4D43A 1HZZA 2I4NA 2QQFA 1EJ0A 5K09A 2HSWA 3ETCA 1AVTA 3QITA 1MPTA 2H0RA 2AZXA 4C76A 1MRNA 2C3MA 4WJLA 2VTBB 4KRYA 2AG8A 4IIYA 4UCXA 4L76A 1NE7A 4XSVA 4CCYA 2QSYA 1I7SB 3BMNA 4HTAA 3ROKA 3WIEA 2HZ7A 3BXHA 2ADMA 3LMKA 2FNAA 5MFZA 5BNFA 4LKRA 3FBTA 3N6XA 5E2IA 2FG6C 1PNQA 4QBFA 4JFAA 5K6AA 2R66A 2V74B 3NH9A 4K8RB 1NMZA 1UP4A 1GCAA 3T7AA 4CKEA 2PUAA 3I1FA 1DG3A 3P94A 1D9ZA 3SE0A 4OPMA 2H3HA 2BBSA 4P0TA 1L5WA 4PZUA 2C2OA 1QF9A 3Q12A 3UAOA 2WU8A 1U9ZA 5LNK6 3HWRA 2BI8A 3EVCA 3HWWA 2NVUB 3OZXA 3GLIE 2IS4A 4KE8A 3THXB 1CIPA 3AR8A 4KOAA 1A5BB 1U3TA 1NNSA 2ADOA 2VDPB 1TJ3A 3BXGA 1XTQA 4NHEA 3VU9B 3NHRA 2Y76A 2CNWA 2P9HA 3KNZA 2XECA 3OE7D 4PLTA 3BM5A 1UZMA 5HKAA 1RRCA 1O97D 2Y1KA 1URPA 3ZWPA 2VAMA 1ZEMA 4MP8A 3ZVMA 1KQPA 2CLSA 5ITVA 2H1OA 4QJ3A 1U9IC 2YS7A 1NFRA 2JVIA 4Z9FA 4DRYA 4OBWA 2A5GA 2OXTA 1Q1QA 3B6MA 3WLKX 1YMQA 2H4WA 3O75A 4NZZA 2X0EA 1TQDA 3EBLA 5HKKA 3GPLA 2FPPB 3SNKA 3VNAA 1W5SA 3MLEA 3BD9A 4B17A 3SHTA 4YBRA 4KR7A 3O9ZA 2XUOA 1WOYA 3DPSA 1Z16A 1F17A 4NQZA 4O2LA 4V0RA 4DLAA 1LZKA 3SR3A 3IR6A 4OLHA 4MWZA 4OHPA 4DIMA 4JELA 1OROA 2AN5A 1JHPA 5E4FA 5DU2A 4MS3B 4R3UC 1KAQA 3GUCA 3KVRA 4OJKA 5GONB 4LWPA 4CETA 1BXRA 3F5QA 1HYGA 3E70C 1U8UA 2IHTA 4AWXA 4JQOA 1BCRA 1SOVA 2Z98A 2BM9A 3HY6A 1PR3A 3UNXA 1MN6A 1NVUQ 1Z2PX 4JL6A 2YV1A 4XKJA 4ZALA 4A0SA 4R84A 3ZBUA 2C00A 4EUNA 3W5BA 1H0RA 1ZOIA 4L02A 4MARA 5LQMA 4P7KA 4YRCA 1MQ8B 3FGNA 5BYAA 3O84A 2YJ6A 3IKMB 3KWJA 3WGNA 2X41A 3DMTA 4DZZA 4XB1A 3PCRB 2P62A 2GN0A 1LDBA 2DPXA 3T52A 2C7OA 3PE4A 1GUYA 4LHYA 4Q4JB 1QAQA 1M6VB 3RUDA 3CNEA 1JH9A 1R27A 2PGXA 2J6HA 4AJNA 1BX1A 1S3IA 3HB4X 3H4TA 2UYGA 3NTLA 2BKAA 5CVUA 1WUYA 4B2LA 2WTNA 3KYCA 3HM9A 4HGQA 1LLFA 2CUZA 4FIDA 4GPBA 4CT0A 2HK6A 2QD2A 4EFNA 3K09C 3KDAA 3HGMA 4Q4AA 2MSLA 1YFLA 4TS9A 4Q3OA 2ZSDA 4W5JA 2Q2QA 4C7JA 3JAKA 4X0EA 5L4NA 3G9XA 3CUSA 4I6EA 1MIOA 3HA3A 4L51A 1JG1A 1YOVB 2I4TA 4GYYA 4I55B 4J0DA 1DBVO 1MJGM 4NFLA 4QVIA 1P3JA 3ANYB 3BCUA 4UXJA 4EUHA 2CNNA 4RYLA 4GH5A 4MIYA 4QREA 4XCXA 2CV0A 1JEOA 3S1LA 4YUWA 3HFRA 4CHTA 3ERCA 4ZC1A 3D3KA 2DFDA 1Z4JA 3AERA 4PM4A 3L0OA 2CHUA 3W77A 3HEMA 4NOKA 3FNGA 1KK1A 4C78A 5LA6A 4NMXB 3UA4A 1NVWQ 4TTRA 3F73A 5GPBA 5LKRA 4TTQA 5AK3A 5T4BA 4QWWA 2C5HA 1YJQA 4Q9KA 1HLPA 3TLKA 4RTSA 4LDNA 2YN2A 1HQKA 2CLLB 3WFZA 4JJEA 1WMFA 3DL4A 4HLCA 1GPMA 4UEOA 2DAPA 4UCFA 1P2TA 3GEIA 3LYLA 3TD9A 3L8HA 4EEZA 3HVRA 5JVDA 5J43A 1QTRA 2NPFA 4DLXA 3NHFA 4PLYA 3SX2A 5CDUA 1PLLA 2DLNA 1E77A 1IY1A 1WXGA 3U9SA 2WHPB 2RGYA 4AZ3B 5CJ2A 2V97A 1SBZA 1Q0LA 1CJBA 4C6TB 4P84A 1FP4A 4KXXA 5KKNB 3HEAA 1E79D 3GZJA 3DA8A 4BKUA 4DLKA 1HDZA 4GE0A 4NE9A 3S5UA 4HEQA 1I0ZA 1NE2A 4ID3A 4KN9S 4M60A 3RVSA 5BPHA 1PFQA 1LSSA 2W71A 1Q15A 1HI9A 4JVOA 1ILEA 3H86A 1TYCA 4TUYF 3CW8X 1SKAA 2Q5OA 4URYR 3LHFA 4KLRA 1KH1A 3C7CB 3LFUA 2GLUA 2EKLA 1QE3A 2E48A 3UTDA 4CLDA 3L84A 1V1MA 2VC2B 4W9NC 1VKNA 2REXB 2Y4OA 3FPBA 4TMYA 4OHYA 1F8YA 3W2GA 2FFQA 2H4HA 3N2NA 3NWJA 1PO7A 2XNDA 4LV5B 3B7GA 3AQ4A 5TGTA 2OQVA 3ZG6A 4INOA 4W5HA 3ZWOA 4LFBB 1L1RA 3M83A 3FHLA 5IP5A 4M1KA 3LDAA 3TX6A 3ZH9B 2X1MA 2J9ZB 2XF8A 3VGPA 5BUZA 1GEEA 5KSWB 3N75A 4EA6A 2YVQA 3PIIA 4I4IA 1NZFA 3HL0A 2M6SA 1A4IA 1XTVA 1Z88A 2H9AA 1GZUA 3NV9A 5AI9A 4CEIB 5DNVA 4DEVA 2XBUA 2VHZA 3TPCA 3OIFA 2V7QA 1P31A 2N46A 1T35A 3AHDA 1LQUA 3L82B 3Q85A 3IAAA 1JKJB 3H75A 3G59A 3BB1A 4QAQA 3D4IA 1J39A 2AUNA 2VDVE 3OOHA 3VU3A 4MGKR 4H0CA 3ESRA 2DT8A 2HHJA 3SMQA 4Y2QA 3IVRA 4R68A 1WTCA 1JHXA 1SC3A 2DQYA 2HBQA 3BPSA 1UT6A 4OMUA 2PVCA 2C2GA 3U44B 3P71T 1IDOA 4WCFB 4UDOA 1FDTA 1ZH6A 2OG2A 4NMHA 1V16B 1GTSA 5JSZB 3BJZA 3KJFA 2PGLA 3CZRA 3RVJA 4NL4H 3SKXA 3T5DA 5BSMA 3MWEB 2FZ5A 2H1FA 1MRSA 2KJQA 1LRKA 4FXOA 4PW0A 3VVLA 3WS7A 4ZDJA 5I01A 4DR1B 4UAVA 4CE6A 1FDOA 4IUCS 4D9NA 5KREA 4I50A 1Z2NX 2BFEB 5B1SA 3VVCA 2G5TA 3PTZA 3WDLA 1FP2A 2ZP1A 2R8XA 3IAS6 2J7KA 3KXPA 3EFOB 1VL8A 1GZ4A 2QRKA 4EG5A 4LF5B 1NYQA 1TQ2A 4N6OA 5KX5F 2FSUA 1C9KA 2I29A 1DKPA 1P7PA 4LCJA 3GIDA 3AKZA 1BQEA 2OTCA 3HSYA 1EJBA 3AHJA 1JQBA 2BHTA 3MINB 2WJHA 3MYYA 4M8KA 3TGPA 5KNBH 1XQYA 2Z8XA 3Q3CA 4IIGA 2EXXA 5AHOA 2A86A 2GEDA 4EFKA 3U1VA 3BAZA 5HE9A 1E1RA 4BVFA 1TJNA 3HHPA 5BOSA 2ZS8A 4FZ5A 3PNYA 3PEFA 2AZTA 4UXHA 1JL3A 2G9QA 3BILA 4BE7B 4DREA 4MQBA 3SXPA 3CEAA 3IELA 1OZGA 3PKJA 3ESBA 3DVLA 4A8JC 5K3EA 4TQGA 5CAEB 4DA9A 5KDOA 2AXPA 2XUAA 1DRKA 3QPDA 4GBED 3RK1A 3INTA 3QMMA 2B4YA 3P45A 4IRXA 3TQIA 4BAZA 4CF4A 4EATA 2H9YA 2X2FA 3G6WA 3V8EA 4BTEA 1FQWA 5ADUS 4LXQA 1QU3A 4X1IB 3ESYA 3HSKA 1ISSA 1KC1A 4LY3A 1TGYA 1OLUB 2F00A 1UAGA 4OHKA 5L8VA 5DYTA 3JS5A 5F1PA 5DYIA 1I13A 4IUDS 2ODQA 3LDHA 4GL2A 4KH1A 4E13A 4NV1A 2YIJA 1ID1A 1CE8A 1QMPA 3DONA 1IEVA 1YK0A 2PKRA 5J4KA 3AEYA 3E82A 2WSSA 4Q39A 3IL2A 2ZE7A 3QVVA 3VDXA 4AM8A 4BV8A 2YY6A 1XDGA 2ZI7A 1HE3A 2FKAA 4PC3A 3THYA 3RADC 5LZ7A 1A9YA 1TLLA 1U2ZA 2RFLA 2PPLA 4QUHA 2JGNA 3LL4A 4DBZA 4GDMA 3KUKA 2VZ0A 1LKZA 1L5SA 1T8YA 2E4WA 3KAJA 4O2RA 3QKSB 3D4BA 3S8EA 4C0QC 3ABOB 4MHSA 3MN1A 3ZR4B 2P9YA 4JSTA 2FRXA 2KE5A 1IG3A 2HNKA 4GX0A 5G1PA 3JQAA 5IDVA 3GFBA 4LMPA 1G41A 1XZLA 3HCOA 2QVGA 1ZAYA 3K9NA 4GRAA 3V2IA 1HQCA 5M7EA 3I62A 2PLWA 3F78A 3FUXA 5DW3A 4ZCRA 1HLDA 4NAVA 2QRVA 3ER6A 2WFZA 4YN3A 3W4KA 2XCTB 5K8JB 5BR1A 2PHZA 2IYZA 3R0ZA 1RWBA 3T4XA 1UEXC 5M3BA 2YKGA 1KP2A 2ZWPA 1XLWA 4ND6A 4EGJA 4IVQA 1FPQA 4W1QA 1N34B 3GFGA 3GK3A 1BE0A 3ITDA 4S1VA 1TO1E 3P9QA 4P7JA 3WK4A 4QKQA 2BYTA 4BOYA 2GEBA 3CUWA 3JD3A 1KXZA 3L1UA 3RHFA 1Z6PA 3ZVLA 1HRDA 3GNLA 3F9CA 2PIAA 1N2JA 1E1YA 1IJFA 1VLMA 1SQ0A 3AGPA 4GX2A 5EJIA 3VISA 4N3AA 1SZJG 4MO9A 4GPAA 2D4AA 4CGZA 4JYMA 3EWAA 1WB5A 1IZYA 2AH5A 4YXWA 5JADA 4QU5A 1R0WA 3PF9A 3A9CA 5T3YA 4GBMA 2NO9A 2VN8A 1X1RA 1D1SA 1U9CA 3BK2A 1WNFA 3A3KA 3GRCA 1UWKA 4QXPA 5KQSA 5JYEA 1DBWA 3K5WA 1BH2A 3C15C 3NETA 4OI1A 3HP4A 1KI1A 3IP7A 3HCEA 3VZCA 1SKQA 4BE9A 2JH3A 5C3MA 1NI3A 1XEWY 1B6GA 1LPNA 1MV5A 2HPHA 5CPBA 1P81A 1PZNA 3NXKA 2NU8A 1USWA 3KJEA 3C5EA 4FT2A 2XSZD 5IZ4A 2X1HA 4N49A 4Q3EA 2RHJA 3HABA 1DIAA 1D2RA 2GSWA 4ZOQI 5L3QB 5IU6A 2FWMX 4FHCA 3NBZC 2H1HA 2XZTA 4WVLA 3FSGD 3SSAA 1USUA 5L3RA 3HFJA 1R4AA 2I80A 4MUNA 10MHA 4FYKA 1MOSA 2CFSA 2P2DA 3PLRA 1X7WA 1FNSA 1N7JA 2Y05A 3SIXA 4HSEA 4DGQA 1AGRA 1ZLXA 3AVUA 2PWPA 1PSDA 4NWIA 4ZQHA 2X4GA 3AILA 4PZDA 1AE1A 3IOBA 4L9SA 4H1VA 3P2EA 3I09A 2XUZA 3OC0A 2IKQA 5GMOA 2H08A 3QBJA 3O1IC 1MOPA 5EG5A 5IH7A 3NTRA 4FMDB 4V0NA 3DDNA 1J0BA 1G7CA 3LT4A 1UZUA 2AN9A 2OVFA 2OXEA 3KD3A 1GA4A 3K1AB 1QV6A 3PCTA 4OLAA 2YYYA 1ZIXA 2AZ4A 4WUTA 1U3FA 5E2BA 4Y7DA 4C0XA 1O6FA 1OUMA 2EERA 5EEHA 1GZ6A 2CCJA 3HKDB 1VRVA 3FNHA 4CMAA 4F72A 1MJ5A 1WW3A 1QG2A 1YZYA 3II6X 3IV7A 3M9LA 3QU5A 2HDOA 4I5IA 4UZFA 1BE1A 1P6QA 2NO0A 2PV7A 5H02A 2F8TA 3ZEAA 1U6JA 3R20A 1YSCA 2DHQA 2FQXA 5JH7A 4PXSA 1FK8A 1W0JD 2NSYA 9ABPA 1KZ9A 2NU6B 2PANA 3PX3A 1EGQA 3QBVA 4YECA 1THGA 3P7MA 5K51A 5F51A 4BNIA 1T4GA 5A6SA 4MKIA 1ZGGA 2W6MA 1YOBA 1EG7A 3HA7A 1EDEA 2O0JA 1HRKA 1Q83A 3KHUA 2C29D 4K6KA 4K6FA 3WRWA 4B8WA 1XJCA 2CXHA 5JLAA 4RUKA 5M5BA 1WW8A 2D8MA 2YJZA 4QUBA 2G70A 4CYMA 4Y2HA 4A26A 2CXRA 3PWZA 4HNVA 5JUWA 1YIOA 3KV1A 4GEGA 4WKBA 1QH8B 1WY7A 2W2QA 5L40A 3BA6A 2FEXA 3HLTA 4IFEA 5FR2A 2HXYA 4IKOA 3C1TA 3Q7SA 4R9NA 2FA9A 2WWFA 5K0GA 3EHEA 1KJJA 4Q3DA 4RACA 3TE6A 4M9ZA 2PNFA 3EIQA 2RGNA 3UY4A 2D2VA 2E9SA 5FNVF 3NASA 1HE5A 4GOJA 1PDWA 4NYJR 3HR8A 4FU0A 2A78A 3CVOA 1GRCA 1VCMA 2ID7A 3ME5A 2ZDGA 1QXSA 3ADCA 2ZK7A 1M10A 4JLSA 4JH0A 3CJTA 1UH5A 1D2GA 4PCUA 1NVDA 1B23P 4C6RA 1WXDA 1WAMA 3FPJA 2TMDA 2HUPA 2EFDB 4OYYA 3MXOA 3TZBA 4ABTA 1N9GB 3DOHA 5GOTA 5TDHA 3PYMA 3PNLA 3BJEA 1L4UA 3LOPA 2YMMA 3F1KA 1BS9A 3FZQA 4X3OA 3DZGA 4YJFB 4BU1A 3LZDA 1NOKA 4FW8A 4DMHA 4QOIA 2H1SA 3WKDA 1T5OA 2BT4A 1NJ6A 2Q4BA 2QVBA 3C6QA 3NZEA 5MF6A 3HZOA 1O6CA 1T29A 2AWNA 1Z6QA 5I6DA 1S7CA 1G20A 2JAOA 2XNHA 1N6KA 2PAAA 3B8HA 3LWZA 3M4ZA 4LJKA 2CVFA 3MWJA 1A95A 2AEJA 2V7XA 4G2TA 1EJ2A 3BRQA 4KH0A 4X94A 4EMTA 1N2XA 4S3MA 3OPVA 1F7UA 1OXUA 2HO5A 1ZH0A 3U4DA 1JN0A 4OREX 1YRAA 1OWMA 1E1MA 2ZEJA 4J0JA 3WLOA 3DWGA 1PJRA 1U7PA 2DEUA 2HXGA 2ZWMA 4E11A 4PPQA 3E9MA 3EGVA 4IZHA 1XP8A 5FHQA 3R9IA 1YQQA 4BTLA 2CLMB 1F0KA 3ULKA 4DUPA 5CBPB 2NNLD 2YV3A 3OE5A 2K2WA 3PEUA 3DC2A 2C57A 5J2TF 5BMOA 1V8DA 5ICSA 3MELA 1T2NA 4QSMA 3FVRA 4BCBA 3AVYA 5G0VA 1ZCZA 5HIIA 3O90A 3SLKA 3IAHA 4B6SA 4ILEA 2PTHA 4M2LA 1DAOA 5DHTA 3HKEB 5CIWA 2GR9A 2ZJAA 3T1VA 3UAWA 2EZTA 3NDIA 2AMFA 4QRIA 3UYKA 1JMKC 3F71A 2J31A 5CR9A 3DB2A 3EJWA 4RJJA 4N9QA 3OU2A 4FZ3A 3SZMA 1JQAA 2AUTA 2GBIA 2NZ8A 1Y5MA 3CT4A 3LH5A 4HTFA 4MJXA 4MYTA 4EG1A 4MGEA 4RTOA 2XI4A 5EZ6B 4ZGBA 3TF5A 1NC3A 1K63A 3WB9A 1IY8A 2ECKA 3SLRA 4DRXA 2V5VA 3CGWA 1RAIA 1PL6A 3F5FA 3OLZA 2QL9A 4B3DA 4DIDA 4B2PA 4PINA 4RH0A 4IH4A 2QLMA 3WNQA 4F2DA 2V6GA 4EHHA 1DIRA 2PKWA 4ER5A 3FOFC 3LLSA 4E88A 2P6MA 1O87A 1YKSA 3P0RA 1U28A 1H9CA 3A0RB 3TSOA 3SYMA 1K4YA 2OBYA 3A2MA 1N33B 4PYQA 3L0BA 4KGDA 4ZVVA 3RFFA 1V8PA 2HLHA 2P1ZA 4ENSA 1KZ4A 1BQ3A 1O03A 5C1DA 2B98A 3DE0X 4JB3A 4O4HA 3UHPA 2IYAA 4CR7A 3O8OA 1GT91 2I2WA 4JHLA 3WRXA 5CXUA 1XX6A 3KUUA 5BWNA 5JARA 1V5EA 1NDQA 4XJSA 4KXNA 2WM3A 1DU4A 2Y0EA 221PA 4EQZA 1PQYA 3B1FA 3MJRA 4R0NA 4NAHA 2ZOSA 4X1KB 5CM9C 1YZHA 3RS9A 5JY1A 4YDSA 1T9DA 3SHOA 2C3OA 2IE0A 2EZ4A 3W7AA 4L27A 3PFGA 3H84A 3I0MA 2IHZA 1VBNA 3AHEA 3K0SA 3BYZA 2HO4A 2IHNA 1ATZA 3UB3A 3FNFA 2W9XA 4L50A 3A6KA 3P96A 2IU6A 3H9EO 3RFVA 1Z47A 2RAFA 3U7JA 3A32A 5E6RA 1AKTA 1KKLA 1Z18A 1JF8A 4L72A 4ENTA 2R7AA 3QF4A 4TVSA 4YMUA 2VYVA 2P8SA 3B38A 821PA 5AVRA 3B9PA 5BMVF 1CUJA 1XTBA 3GO4A 4LC1A 3RSZA 3VMMA 3WRYC 2QTMA 4ASUD 1Z37A 3FR7A 4Q4HB 1MJFA 1KFKB 2BFFB 2I66A 3HN6A 4QBIA 1Y8RA 4PCLA 5HZHA 1O3YA 5J4YA 3VA7A 2AK3A 4KOEC 1J9EA 2DR3A 2B6NA 4PAMA 3TAUA 4C89A 1XDDA 4I0WB 4U7TB 1IIRA 1Y6QA 1TD9A 1T8UA 2GA9A 5T67A 5F7XA 3V1LA 2QYTA 4HMPA 1ECPA 4BO4A 1NPTO 3FLAA 4F6RA 4L9RA 2QDKA 3LPNA 3OCWA 4NBLA 2YFQA 4BO2A 2FP3A 1VZ2A 3EARA 3C1OA 3AU8A 3E7XA 2G0TA 2HA7A 2Z2ZA 2DULA 2QR5A 1DB3A 3VTAA 1FFDA 1ZQ1A 2R8YA 1TVKB 4QTZA 4ZVUA 2X7JA 3R8CA 4S05A 3HJUA 4ENRA 1NF8A 3FKJA 1ZEJA 4IHJA 2OCBA 5DT9A 1NVGA 1TAQA 2A9FA 4Q82A 1UMCA 5BN4B 5JQGB 2MCFA 3TVDA 4UJ3A 3K1TA 2DQ4A 3T7JA 5KOJB 3O73A 3TNDA 1FRVA 1DJLA 1R9NA 3F90A 4BPRA 4E4YA 3DV9A 4CXMA 1V1RA 1LUAA 3HCRA 1F4VA 1PHRA 1OYYA 4OQYA 2O9JA 1PL8A 3MMZA 3QJ5A 3ZU5A 1ZICA 3IUQA 3PYXA 5EWLB 3W8RA 1QU2A 3VHXB 3L1HA 3AFOA 2DFPA 2QZZA 4C5AA 1F5SA 3KLBA 1N2ZA 1OAOC 2X40A 3I61A 4GM4A 4EF5A 2CHGA 5HUHA 5TMBA 2F43A 1FFHA 1EXDA 1WMSA 2J48A 3I6MA 4J7XA 1GGJA 2FZWA 3IIMA 5IDWA 4I5EA 3RQSA 1OJ7A 3O93A 5DBHX 1QF7A 2O3TA 1UEJA 3QXSA 4RD3A 3D6UA 1V7QA 3QOXA 2WDZA 3I01A 5C31A 1PZHA 4DLSA 2NSHA 4CIDA 3O91A 1IN7A 3BWMA 5FPQA 3ETNA 5KYYB 5BQOA 2VNKA 2Z2IA 3AHHA 1SKYB 2ZXEA 2GZDA 1R7RA 2FMUA 3DOOA 2JW5A 3LP5A 1RR6A 1CUEA 3ZGVA 3SQMA 3UATA 4MS1A 1OIXA 1MP0A 3BH7A 4L1KA 1VPEA 1MO2A 5TJ9A 2Y66A 2JASA 1ECLA 1G4AE 4Z0HO 1JG2A 1QG4A 3MMPA 5CM2Z 3RQIA 1KO4A 3L1KA 4GI2A 1B2RA 2IDMA 4HYEA 4MWTA 5IVIA 2Y6UA 1G20E 1YJBA 1IBSA 2O5VA 3TRHA 1TF5A 3USCS 1ST2A 1EM8B 1VCHA 1NRWA 3CKKA 4BNGA 3EEYA 4AFNA 5FDFA 4J16A 3Q7QA 1E69A 5DX0A 3OOJA 2R25B 5IC5A 1KETA 2A5YB 621PA 2OCGA 2DC1A 1GNLA 3H2BA 4ZOLA 1PNVA 2PZKA 1VL6A 3JR3A 4GOLD 4B4UA 1QF6A 2FOLA 4QGHA 4BKRA 1HTTA 4FFMA 1L4NA 2SKCA 3X1WA 4YALA 4KMOA 4UTVA 3MCZA 4W7SA 4YT8A 2NYVA 3MLBA 3DNPA 1K9SA 3I04A 3PFNA 2ZUEA 4E12A 2Q1SA 3HO8A 3ZKAA 2JLSA 2PGAA 5LSAA 3BIOA 1ZW1A 2FW0A 3NHMA 1P33A 3R0JA 5DYWA 3AKCA 3WLIA 3GX1A 5B58C 1Z7WA 3IDOA 4HNQA 3V8QA 5MHTA 2W2LA 4FFVA 4RDIA 5DCYA 4EF6A 3RRNA 3AIIA 4YAFA 4B9EA 1NSYA 5D1HA 5C2JB 2IW3A 3QEKA 2QT0A 1KYZA 2XQVA 5FLKA 3PSHA 4P93A 4QPCA 3T7IA 1V47A 1F06A 3GGSA 1LJLA 1QZXA 1WU8A 2J30A 3K30A 1SQ6A 3KX2A 1KPGA 4WXEA 3FPCA 3WX0A 5KWSA 1N3YA 2XR1A 4FQ8A 2X9VA 2W8ZA 1U8YA 4N5NA 1RLOA 1C0IA 1T5DX 1KJQA 3LPMA 5AM0A 5BURA 4MJLA 4PBSA 5H68A 2FX5A 4WW0A 1R0XA 4QBHA 4FYXA 4HF7A 3EDQA 3WISA 1KVUA 5HIJA 1A82A 5ICMA 2ZZMA 2NVUA 2XE6A 3WAGA 4Q7JB 4BNHA 1JHZA 2D13A 4GZ3A 2DPHA 3TIXB 2H57A 3L8FA 4IGEA 2P2SA 2FUNB 2I1VB 2H29A 1SXJA 2ODBA 2Q3EA 2WWGA 4OSEA 4U0JA 3VU9A 4CDGA 3FTCA 3MCAA 1BC5A 2UKDA 3ROQA 3Q11A 2IDKA 1PSWA 4P2GA 1QOZA 4DV3B 4JXXA 3BFVA 2IEIA 4Q3LA 3NVAA 1L4GA 4EB0A 1F8XA 2VNHA 2RI0A 4Q4CA 2JEYA 5BRJA 1V3QE 1Q1ZA 4AG5A 1H6CA 3KQQA 3F46A 2B4KA 2EX4A 4F7DA 1CDZA 8OHMA 2AA3A 1K7XB 4D0SA 3AH8A 3Q7RA 4HSGA 3IOYA 3L2OB 4JBNA 4DJAA 2RHGB 1BA2A 2CFTA 5B64A 1O5OA 1VB5A 2AQKA 2CB0A 3REFA 1P61B 2G5GX 3AMVA 4LQ4A 4LZWA 4F56A 4DMFA 1G16A 1IHYA 5T5QA 1SK9A 3HVIA 4MS3A 4R2WA 1FIUA 1J09A 1QZ3A 3PU6A 1DEAA 2H4XA 3UB4A 4A91A 1RXWA 4IYRA 4Y6OA 1UPBA 2CFOA 2O2HA 3RAPR 4IG9A 1ZXXA 1KMCA 2HKIA 1NMYA 2HOQA 1L7VC 5A7GA 5KMGA 4YCDA 2WSYB 4E5SA 1TLTA 4FMCB 4NBTA 2DT5A 1VL5A 2GN1A 3T06B 2C99A 1RFLA 1EJ6A 1TI7A 2IITA 1GZVA 2BRUA 2XVZA 3JTMA 1TLFA 5CLQA 4MB6A 3JQ7B 3S2ZA 3B52X 2XLBA 4HXYA 1PCXA 1MHTA 4U9UA 4A6PA 2IZ5A 4KEAA 4V0LA 4OHVA 5LQCA 3JPWA 1L4KA 3IOMA 3N07A 1P29A 2FZEA 4F4DA 3G5UA 4F1WA 3K6RA 3ZZ1A 2E37A 4AUEA 2KM1A 2QW0X 1P2FA 4CT5A 5KJCA 2X13A 2IPLA 3WQBA 3L05A 4RM2A 5F2KA 4C2AA 4C4YA 2VQ3A 4FBGA 2HMSA 4L3OA 2PL3A 2RI1A 2IS1A 1SQFA 2FN3A 1XDSA 2J07A 2JJ1D 5DTEA 1G5FA 3AR5A 3WQRA 1HV8A 3OJCA 4HDRB 3TZEA 1EFAA 3ITKA 3IHTA 2B25A 4IFBA 1U2PA 4OHWA 1NF2A 4B7UA 3H5TA 3BWCA 3R3SA 1K8QA 3KKLA 2HJ9A 2I4MA 2ZE8A 3ZK8A 4CODB 2RI6A 4JYZA 4U7JA 3H99A 1CY7A 3EZLA 3GJ0A 1QVRA 2F6RA 4W8GA 3UMCA 2W0MA 1C9YA 1XHEA 1E89A 2PZFA 1HOTA 1C3OA 2QXYA 4GC9A 2BGTA 3ND7A 3RHTA 2PLFA 1YR2A 5CA0F 5GJVC 1ZNWA 4Q3AA 2PT5A 2WU0A 1XEWX 3JVDA 1BD4A 3KWMA 5HX7A 2NZXA 2R4QA 3WHPA 1NAHA 4GFDA 1G59A 1ZM2A 4QOSA 3ELYA 5CVJA 4AULA 4M3NA 2XUGA 1U2DA 5AYVA 2X2EA 4J76A 4ZWNA 2O3QA 3QV1A 2Y0BA 3PXAA 1EXWA 3LRPA 4YAWA 3CRNA 3T5GA 2AOTB 2XBLA 3LQ4A 2ID8A 2UXCB 2F9FA 1RXCA 3C8DA 1NR5A 4DWWA 2IYNA 4F5WA 1TEVA 1J23A 1T43A 2C3UA 3NBXX 2WV9A 1W5FA 3PWSA 5SZKB 4CR6A 1H3EA 2B4RO 2QUHA 3M3PA 4DJ5X 2WHPA 3OFJA 4QNRA 1O5IA 2CHQA 2DHEA 4R31A 3RYHB 1KEKA 2GEUA 3R8FA 2E87A 5F76A 3AR3A 5L6LB 1EWYA 3NUZA 3B5EA 4WPGA 5G53C 4EJSC 4ZCSA 1U2EA 5BO5A 2JPDA 3A2KA 3HJAA 1GPDG 4FX2A 3VPGA 3P26A 2POQX 4GG1A 3MM4A 1OPRA 3PL1A 3ZW8A 1YZVA 4DLUA 1PUIA 1X42A 4LY9A 4HDKA 3NAZA 2OCXA 1H3NA 1PBTA 1RYMA 2Q6IA 2NXWA 3EE6A 3SDSA 4ANFA 1XTSA 5K01A 2QBYB 5BVGB 1VCIA 5FYQA 4BVJA 4DCVA 2YR0A 4NCIA 1XTTA 3BSFA 3C3EA 3WOHA 1LFAA 1SD2A 2M6RA 1YC5A 3B36A 2IZOA 3BWDD 2JDID 1JVBA 3WL4A 1JVSA 3ASUA 2EW2A 1A8UA 3C98A 3ZV5A 2H2WA 1RJFA 1W36D 1ESEA 3KYBA 4LHWA 1TRHA 4BCCA 4KHPB 3HG7A 1ISMA 4FOOA 2H1LA 3CJQA 5G3ZA 3R74A 3C6KA 3NVDA 4JC8A 4MR7B 4OB7A 2JLRA 1KYXA 2X7HA 5AH0A 1PUXA 1QHGA 5A03A 3I6YA 4LSZA 3UH0A 2PS1A 4IDDA 5A3RA 1OMOA 4XH9B 1XRSB 5J59A 3HACA 1HYQA 2RGAA 4CEIA 1EH5A 2PRSA 2QMOA 4BU0A 1UDXA 1YE8A 4C4ZA 2IRWA 3I42A 5TS2A 4EELA 4EARA 1SU6A 4PO3X 2I3DA 4NBKA 3KALA 3R3HA 5ALGA 4MV5A 2YWGA 4CMIB 5EHGA 4DR5B 1AN9A 4ZV7A 3ZN2A 3BFJA 1YS1X 3AUAA 3DDSA 1JFRA 4PZ9A 3PDWA 2QVXX 1H4QA 2W98A 1KSJA 4OOFA 2FPOA 4B73A 5B1EA 2WHRA 1FNMA 5JTUA 1OXVA 1IK4A 4BLTA 3F7OA 5C0OE 4XCQA