3JYLA

Crystal structures of pseudomonas syringae pv. tomato dc3000 quinone oxidoreductase
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
325
structure length
325
Chain Sequence
MAKRIQFSTVGGPEVLEYVDFEPEAPGPQAVVVRNKAIGLNFIDTYYRSGLYPAPFLPSGLGAEGAGVVEAVGDEVTRFKVGDRVAYGTGPLGAYSEVHVLPEANLVKLADSVSFEQAAALMLKGLTVQYLLRQTYQVKPGEIILFHAAAGGVGSLACQWAKALGAKLIGTVSSPEKAAHAKALGAWETIDYSHEDVAKRVLELTDGKKCPVVYDGVGQDTWLTSLDSVAPRGLVVSFGNASGPVSGVNLGILAQKDSVYVTRPTLGSYANNAQNLQTMADELFDMLASGKLKVDGIEQYALKDAAKAQIELSARRTTGSTILIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of Pseudomonas syringae pv. tomato DC3000 quinone oxidoreductase and its complex with NADPH
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Oxidoreductase
molecule keywords Quinone oxidoreductase
total genus 100
structure length 325
sequence length 325
ec nomenclature ec 1.6.5.5: NADPH:quinone reductase.
pdb deposition date 2009-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3jylA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3jylA01
1FXSA 4J91A 1D4FA 4DPLA 1VC2A 2HMSA 4URFA 4AG3A 2O2SA 1W0CA 4WASA 3RROA 3QA9A 5TGDA 3S55A 3Q9UA 4YTEA 4HXYA 1AUPA 3CE6A 4R9SA 4LRSB 3WLFA 2NVWA 4G5HA 3UCEA 3L4BA 2JCYA 3I83A 4UEJA 5JS6A 2Y1FA 1H6BA 4BGEA 1X0VA 3ICCA 5KKAA 3D0OA 2BRUA 1EVYA 3V2HA 3ROKA 1IHYA 2RHRA 3TL3A 1W4ZA 5CG2A 2P5UA 3IUSA 5B4VA 5TNXA 1NPTO 3GGPA 4RPKA 2V7PA 4OSOA 1NX6A 3FNEA 4FIZA 4PRLA 3JTMA 5BQFA 3K92A 1QSGA 1U9JA 2POQX 3ENNA 5IF3A 1U28A 2DTDA 4AL4A 4IPTA 5I7SA 2E49A 3TPCA 4YAJA 4PLPA 1H2BA 2JHGA 2Y67A 3JQ7A 3VPXA 3O4RA 1C14A 3UGKA 4BKRA 5IZ4A 1ENZA 1QYDA 1W8DA 5JY6A 3OEYA 3HDYA 3RC2A 4FOOA 1C0KA 1GQYA 4D0SA 4BNKA 2FHSA 3D5QA 2FOIA 3EK2A 4X54A 2XAAA 3OMLA 1I8TA 1D7OA 3GN2A 4DQVA 1E3EA 3WJ7A 3U5TA 3BHIA 1P1HA 4FFPA 4NI5A 4IDAA 1U2GA 4BNTA 3AU8A 4BNIA 3IQDB 2ZYDA 5EQFA 4XJSA 4HKTA 2XF8A 3MWEB 2ZCUA 3DAGA 1TXGA 1NWHA 2GCGA 1BXGB 1Y5RA 1SAYA 5C37A 4DYDA 5CDGA 2Y99A 5A9TA 2D59A 3G49A 3I6IA 4TZKA 2NTNA 4OXNA 4XB1A 1U1IA 4UVIA 4QSMA 4XA8A 1ZIDA 1DAPA 4BV9A 5CEFA 3NTQA 3GH3A 3H2SA 4KQWA 4RZHA 1R4MB 2GZ3A 5CDSA 5JDIC 3JQAA 2ZTMA 2G17A 3ON5A 4LISA 1E7QA 4MVJH 4CQLB 2R2GA 3ONEA 4L76A 3JQGB 4FFLA 1NR1A 4J43A 4ZA2A 1EUCA 2OO5A 4W4TA 3OIDA 5C3MA 3PVZA 2Q4BA 1IOLA 4N18A 3ANNA 1PL8A 1YWGO 4Q3DA 3HDQA 4CM8B 2YV2A 1PQUA 3D1LA 4HP8A 5L3ZA 4QQRA 1ZK1A 1AXEA 3NT5A 5B37A 3ZNNA 3DO5A 1GUFA 3KOUA 2FN7A 2V6MA 5THQA 2VYNA 5C5IA 2I67A 2V6BA 3K30A 5MGBA 2HMWA 4I9HA 3LC7O 4AJ4A 4MVJD 2AQ8A 2BGKA 1JN0A 1DDOA 3Q9NA 4WOKA 3UF0A 1H6DA 2QZZA 3LK7A 3QE3A 3PYMA 4XX0A 3UCXA 4RV9A 1P3DA 2C2XA 1E0DA 4IDEA 4LRTB 1IULA 1U8XX 1LX6A 5JYEA 4WLUA 2JJYA 4PG4A 3UUWA 4BO9A 1R66A 2BGMA 1MV8A 4E31A 4Y6PA 4O0LA 4IINA 4BO1A 3NUGA 1BXKA 4BKOA 4ZJUA 2OFPA 5G4KB 3SC6A 4J6FA 2Y1DA 1V6AA 1PZHA 4NBVA 4JBGA 4TVOA 3V1TC 3DB2A 1JAXA 3EVNA 3LT2A 4HADA 1BSVA 4BO8A 2X0JA 2HLPA 4B7UA 4P4LA 4FQ8A 5JE8A 3A14A 1L1FA 3PFFA 3PTZA 3ANMA 4BNNA 4CLRA 4NK5A 2B35A 5F5NA 4FBGA 1M6HA 1HETA 3WOHA 1MB4A 3U9LA 1T26A 3CINA 4RPHA 1V3VA 5A3VA 3C7AA 3ROMA 1OZAA 4HWKA 4W6ZA 1PJ2A 3WYEA 2B4QA 4CM4A 3W6UA 2DQ4A 1ZKMA 4K9DA 2PKQO 5CDUA 9LDTA 4FCCA 2NWQA 1LRKA 1GADO 3WGHA 3IC5A 4JCOA 4OKNA 1ZK3A 1Q7GA 1LXCA 3JQFA 4ZQHA 3GEDA 4B79A 3EW7A 1HF3A 1YL7A 2UYYA 1IUKA 2X0NA 4II2A 1KC3A 1Z7BA 3IDSA 1WMBA 1A27A 5CFZA 1BGVA 1XU9A 2PFGA 3VTZA 1BWSA 1DLJA 3BMCA 3KYDB 1DBVO 3WMWA 1XYGA 4DPKA 5A9RA 3GT0A 4FSHA 3MOIA 4E0BA 4DA9A 4YT4A 3I6QA 1N7HA 2HJSA 2BFMA 4YQZA 4WEQA 2PKRA 5BT9A 1MP0A 4J9UE 1Y8RA 4XGIA 3RJ9A 4PLVA 3ZV4A 2JCVA 5I9MA 4GSLA 2Z5LA 3S2GA 1X15A 3GHHA 4KUGA 2O50A 4E5NA 3H5RA 4WKGA 5JNLA 4UVHA 3V2UA 4YT2A 3LT0A 3CMCO 3G0OA 3QVSA 4GX0A 3F4LA 1IB6A 3K31A 3GVHA 1Q1NA 4RQTA 1WLYA 5FFFA 2VYVD 3IKTA 2EEZA 1T1SA 4Y98A 5CP8A 1NFRA 4WLNA 2AW5A 3TZQA 1Q0QA 4LMPA 5ER9A 4Z0PA 4E5YA 5A9SA 5JW6A 1QR6A 3DZBA 3DZJA 5F1OA 4I9UA 4ALMA 3DHYA 4P8RA 4UEOA 3X2FA 4WGGA 2WE7A 3GLQA 2ET6A 1GFSA 5T8KC 4RVHA 4ALKA 4GX2A 1LSJA 1QORA 1KETA 2Y1GA 3RUFA 3T4XA 1C0PA 3F5QA 3FCOA 3QJ5A 1K6JA 4IZHA 4YAGA 1YKFA 3AOGA 1XHLA 3PJGA 3WQQA 1PGJA 1ADBA 1E7SA 1PQWA 1VI2A 3JSAA 3RC9A 4YACA 2H63A 3R0IA 2Y68A 1DXYA 1I0ZA 3U4IA 3L0DA 3HUDA 4WK6A 3D5TA 1R4MA 3FPLA 3I9JA 2YDXA 1IY8A 1UP7A 3PHIA 5BNTA 1NQTA 4YVFA 4OQZA 1V9LA 4H15A 3WWZA 2AE1A 1EFKA 4NPCA 2JD2A 4AJJA 1JU9A 5JDIA 1EVIA 2PGJA 2Q50A 2WJPA 5G0WA 1QLJA 4ND2A 4CMEC 1VKNA 4FFOA 1KEUA 3W6ZA 5AQ1A 2D2IA 2J3IA 1TVEA 3TNLA 4DLAA 3VH4A 1CEQA 1NBOA 1B16A 3JQGA 4F3YA 1HDYA 1YBAA 2AXQA 4DXHA 4JN6B 1CQIA 1U3UA 1AN9A 4JX8A 3AU9A 5U9CA 2P4QA 2WD7A 4EUHA 3QQPA 1BTOA 3RU9A 5BSFA 1NM5A 4O63O 3K96A 4DLBA 5IJZA 4YB8A 2FMUA 2FR1A 4Z3DA 2QYSA 3KYBA 4AJEA 2FRDA 4U5QA 1U5CA 4D79A 5JPIA 1EUZA 1LTHR 5A03A 3H3FA 1K6IA 4OAQA 2B37A 4BOYA 3H9EO 2HJRA 3M2TA 5G4LA 1Y8RB 4RVGA 1RWBA 3I23A 1YOVB 1PS8A 1T2FA 2IRWA 3HADA 3TFOA 4IDDA 3GQVA 4GMGA 1LRJA 1VSVA 3A4VA 2JHFA 1GPDG 4UVEA 4PIVA 4LVUA 3VAZA 4M55A 3DBRB 3GK3A 1KEPA 4IUYA 2I99A 5JAMA 5CAEA 1RM4A 1I01A 4BNYA 2Q49A 1DPGA 3WIDA 1LDNA 2J3JA 1G0NA 3MJ4A 4MP6A 1DOHA 5CEJA 2GLXA 3G1UA 4XGKA 4DC0A 2FR0A 4FJ1A 2P2SA 2YFQA 5KJCA 2C54A 1MA0A 2EKLA 3E18A 2Q1WA 4BO0A 4EW6A 1D8AA 4DTIA 4FN4A 2C2YA 1D3AA 1ADFA 6ADHA 3D4PA 2R00C 1PX0A 1DJQA 2ILTA 3Q0EA 1X7GA 3IS3A 1MC4A 2CF5A 1H93A 2Q2WA 3ZCXA 3MTJA 4RPLA 5K1SA 4IMRA 1P9LA 3H6KA 2Y0CA 2NVUB 4XJTA 1DIGA 3FWZA 4KTTE 4XR4A 1Q2XA 4LMRA 5JC8A 3B70A 4PG5A 1R4NA 2DPGA 1ISIA 3HB5X 3LT4A 4F6LA 4ZN6A 3DHEA 3JD3A 4BGVA 5BSEA 2YDYA 1I10A 3VHRA 4ONEA 5KJ6A 2H5LA 2OUIA 3KSZO 4B3IA 1SEPA 1I32A 1VL0A 1Q0HA 3WIEA 1P1KA 2YHIA 1PJBA 1LUAA 1PGQA 4XQEA 2HAEA 4N5LA 3INTA 1XG5A 1XR3A 1ZMTA 1I36A 2D5CA 3EC7A 3NJ4A 2FZEA 1NQOA 2GUGA 5ER6A 3PGXA 3LC1O 4RF3A 1DRWA 1AGNA 5IG2A 5L4SA 1BDMA 4ZU3A 2YQ5A 3H9JA 5DP2A 2CFCA 4Z9FA 4WPGA 3ITDA 2EP5A 4QFCA 4WEOA 2CY0A 2EW2A 2W2LA 3G3EA 4GWGA 4W9NC 4BKQA 1KYQA 4D43A 5I7FA 4XWYA 2CSUA 3P19A 2ZQZA 1EUDA 2J3HA 1HE3A 3AOEC 4R5MA 3QV1A 4WLVA 3L6EA 4IM7A 1N1EA 3WBFA 4Q3BA 4ZHSA 3O8QA 4OIMA 1LSSA 1LI4A 1YBVA 4OMUA 4P38A 1YQGA 4GKVA 1LJ8A 4G65A 4DBZA 3W4KA 3DZKA 1R15A 3KSUA 5G0TA 5TSDA 1E5QA 1Y5MA 4L4SA 5B4TA 2B36A 5GY7A 1FDWA 4OKIA 4H16A 5I8ZA 4CJXA 5KJ1A 2X9NA 3GA0A 2HRBA 1QKIA 1LLDA 4E3ZA 1ZEJA 2PNFA 2Y0EA 1JQBA 3FD8A 3QWIA 1T2EA 5DCUA 4UVDA 4EEZA 3ONFA 1U2DA 3SX2A 1FJHA 3GVPA 1F0YA 1AXGA 4RCVA 5CDYA 3AY6A 5TIIA 3HFSA 3AUAA 1BVRA 1MX3A 5EERA 2RAFA 3ZZNA 1CRWG 1ZMOA 5C7OO 4TVBA 1ZVMA 2O2YA 3GDFA 2IEBA 2EGGA 4GX5A 4Z3KA 2JAHA 3DZHA 2IEDA 1IE3A 5JY1A 4J16A 4MP3A 5A1TA 2V6FA 2W2LD 3ZU3A 2G76A 3CMMA 3HE3A 3C8MA 4F45A 5CEEA 1LLCA 1NQ5A 3PWKA 1WZEA 4BS9A 4K6FA 3VDQA 3SVTA 3OECA 1PJLA 4LCJA 2VHVA 3D3WB 1RKXA 4JXKA 4CLDA 2P68A 3DC2A 4NBTA 5GMOA 2DPHA 1M76A 4IQGA 3TQHA 4FJ2A 3TF5A 5T8KA 2GZ1A 3KEQA 4BO6A 2HSDA 4MVJF 3GNSA 3OJLA 4QECA 4PLYA 4R3NA 3ZWOA 4TWRA 4AJ2A 4GVXA 2NU9A 2P9GA 4NK4A 3HSKA 2ZYGA 2J5KA 1VJTA 4YA6A 3RVDA 1ENOA 3ONDA 4OXKA 4RVUA 5TT0A 4OL9A 4NH4A 2PA3A 1KVTA 2Y05A 3H2ZA 4PLWA 4EJ0A 3IL2A 5ITWA 5BNFA 3F1KA 3N74A 1O0SA 3IAHA 1WVGA 4ZQGA 4YPOA 4EGFA 2VYVA 4Q3CA 1MXHA 1Y6JA 4ZVVA 2AE2A 4IJKA 4UUNA 5DN9A 3WGZA 1BXZA 1EK6A 4B4OA 3FBGA 4WLEA 1ZEMA 2HU2A 3PIDA 3ICPA 1YDEA 5EN4A 4BNFA 3VKVA 2PY6A 1E3WB 2Q2QA 1ADGA 4NU6A 1M2WA 1EVJA 4CMAA 3DBHB 3WQRA 3FNFA 3KHUA 4OGWA 1ZXLA 2EW8A 3WTBA 3ZGYA 4N7RA 5FYDA 2X86A 3OQ1A 4HBGA 2O7QA 5GZ6A 1NNUA 5COQA 4CL3A 2A35A 3A1NA 4B8WA 1I3MA 1XDWA 1YONA 3FR8A 1YH3A 3JQ8A 5KVSA 2O7SA 1PJTA 4MINA 4OOEA 3KZVA 1T2DA 2RIRA 2EJWA 2GDZA 3GNTA 1A4IA 1MLDA 5JAIA 1N9GA 2Q2VA 4ZQBA 4WOJA 4ALLA 1ISHA 4IZIA 5ENDA 3WNVA 3HWRA 4NIMA 3EZLA 4W7HA 5COBA 1EVZA 4RO0A 4A0SA 4I5FA 4MPDA 3PHJA 4BHTA 4IQ0A 2O3UA 4JGBA 1PJCA 4AJIA 1XLTA 1E7YA 5IDXA 3E9QA 1M75A 5JYDA 4TZTA 2O3JA 4BNLA 1QYCA 4WECA 5TJ9A 1T2AA 4KDFA 4GWKA 4AJNA 3SJUA 4J7XA 3S2IA 4OQYA 5JDCA 1H0KA 1KVSA 2X5JO 4Y8VA 1XA0A 4ND4A 3KYDA 4G2NA 5AYVA 2X0RA 3U4HA 4IS2A 3ZHZA 4IDCA 4WCFC 3MTGA 3H3JA 2X4GA 2J5QA 1U7HA 4BNMA 1GV1A 1B7GO 1WPQA 3MJSA 3GZNB 2VHXA 5GZ3A 3MWDB 4PZDA 3JD0A 1LDBA 4A2CA 1W6UA 3ZDFA 2O4UX 5IDQA 4DBVO 2PD3A 3BHMA 3I9KA 3GRKA 1BXGA 5B4UA 3LQFA 4R3WA 4WUVA 1SC6A 3C1AA 1CJCA 1DFIA 1GZ6A 1ML3A 1P77A 2Q1UA 3P7MA 3WFIA 1BW9A 2X8LA 4Z0HO 3U4CA 3DMYA 4PVDA 3IKVA 2Q3EA 3HDJA 3T7CA 1PIWA 5TLSA 5THKA 3RI3A 2Z1MA 4O5OA 2IYOA 3MEQA 1UUFA 3QVTA 1IL0A 3WGGA 3GFBA 4CM4B 3SJ7A 5DNAA 1I2CA 3AK4A 4KZPA 3ZW8A 4L8VA 3QY9A 1EDOA 1GCOA 1M66A 1LDGA 1O5IA 2EKQA 4XYGA 4FFRA 1XQ1A 3KLPX 1BG6A 3ENKA 3WQSB 1UXIA 2BHLA 3P2YA 3V1UA 1GZ3A 1SPXA 2I76A 1Y81A 5KJEA 2GYYA 3ETEA 3VZQA 3PLRA 1LA2A 3CEAA 3OEWA 3K9QO 3ITKA 3VH3A 4HFNA 4R1UA 5BR7A 4GLOA 2X7HA 4PG8A 4U7WA 2AEJA 4MOWA 1I3KA 1DRVA 2JFFA 2QRKA 4DQUA 3GN1A 1DFGA 1DRUA 1AHHA 2HMUA 5ES3A 1B2LA 1CF2O 3S1LA 3BHJA 3RFTA 2WE8A 4MDHA 3NAQA 1BMDA 2NQTA 3GF4A 1O9BA 1LNQA 3ZV3A 3FR7A 3KBOA 3PI7A 1GV0A 1R6DA 1R4NB 2NACA 2OXIA 1KY4A 3GOHA 1H5QA 1JVBA 2WD8A 1OBFO 2BMAA 4FPXA 3C24A 1BHSA 3KB6A 4LGVA 4EYEA 4GQAA 1XKQA 4MVJA 1DSSG 1WMAA 2VYND 4UULA 4BIIA 4CM9A 5EIOA 1KVUA 4YRDA 1SB9A 1X14A 5HS6A 4NFSA 3ZNPA 4J3FA 3G1TA 3FNHA 2O23A 1KVRA 3H8VA 5MDHA 4ZQEA 3AI3A 2ZB7A 3KM0A 2BFPA 3E5MA 3AFNA 4TMFA 4CLOB 1ENYA 1VL6A 2GD1O 2W2KB 3TDKA 1SCUA 1SB8A 1H9BA 1UH5A 3D64A 3NKLA 3W8EA 4Y6RA 3WDSA 1SEVA 3OBBA 3JQDA 1LDEA 4XYLA 3ABIA 2J3KA 1XU7A 3QVOA 1CYDA 1PGOA 2NNLD 4CV3A 2GR9A 3F5SA 4NU5A 1Z75A 4EI2A 3IOYA 4NBUA 3JQBA 1LSUA 5AVOA 3EHEA 3QP9A 4JK3A 4Q3EA 1JVSA 1P74A 1UAGA 2B0JA 1WW8A 3R1IA 4DYVA 3PPIA 2QZ9A 3WX0A 4JROA 3CZMA 4OM8A 4CQMB 2HCTA 3CZRA 4GBJA 4GL4A 2X6TA 2O4CA 3LDHA 4BUCA 3D7LA 4D46A 3ZU5A 4BKUA 4O59O 1B26A 4E2XA 1GR0A 1HE2A 2A9FA 1V3TA 4TRMA 1PGPA 2WD7B 4CMJA 2AHRA 4GAEA 2JCXA 5FF9A 2VRCA 3ZU4A 3GUCA 3S2EA 4BNZA 3WSVA 4FDAA 3MJVA 2IXBA 4Q39A 3JQBC 1H9AA 2ZATA 2C7GA 1I2ZA 3EGOA 3VPSA 3A06A 3BA1A 4CLRB 1NFQA 4HUJA 3WS7A 2QRLA 3C1OA 3DEYX 1Z6ZA 3PDJA 2D8AA 3FNGA 1OC4A 4MVJI 2C29D 4TKLA 5KVQA 1WWKA 3WJAA 2Y93A 1K6XA 4N5NA 3LZ6A 3TOZA 2WM3A 4OYRA 3V1YA 1FDUA 3PZRA 4BGUA 2PV7A 1H6AA 3KETA 3ZWYA 1ZNQO 4MIOA 3RWBA 5FI5A 3BAZA 3WICA 4KUHA 4QEDA 1FK8A 4M89A 5HTOA 2TMDA 2XXBA 1DHRA 4C7KA 2YUTA 5K9ZA 2E37A 4ND3A 4RL6A 2GZ2A 3GHYA 3E82A 1ULSA 3FN4A 3OIGA 1C0IA 2C20A 4XYBA 1YB1A 4U8GA 1HE5A 3UFXA 4NDNE 1GUZA 3NDJA 2FP4A 3RBVA 4H7PA 5JSFA 2W2KA 1ONOA 2OBYA 2JAPA 4BQPA 3UW3A 1JTVA 3DFUA 3ZU2A 2R00A 3B1KA 2BD0A 2W8ZA 4D41A 3OM9A 1NWCA 1GDHA 4PLZA 4A27A 1F8GA 1EK5A 4PG7A 3JYNA 4JQCA 4E32A 3RFVA 4BB5A 3ZWNA 4I5EA 3QVWA 2X1HA 1W73A 1SMKA 5L4NA 4BL5A 2EERA 3JQ9A 3PLNA 4XZ3A 5B12A 4ND1A 1PJ3A 3C85A 2VHYA 2GN4A 3P2OA 4NG5A 3ZH2A 2HMVA 1EDZA 4BV8A 1PS0A 2PH5A 3U3XA 2QYTA 2NU6A 4WCFA 3SLGA 1DB3A 4WCDA 2X58A 2FPGA 1T4BA 3C1TA 3QW2A 1GCUA 3LF1A 2PGLA 2FZWA 2Y66A 3MZ0A 3WGYA 3QIVA 2C07A 2EXXA 4CM1A 4S1VA 5F3RA 1N1GA 3I3OA 4QUKA 2PK3A 1QV6A 2EKPA 4UUMA 3GAFA 4Y9DA 3WYBA 3OF2A 1GQQA 4YJGA 5T67A 4J1TA 4LVCA 2VNSA 3EY4A 1A72A 1PR3A 3WBBA 4BNUA 1F06A 4S3MA 2EHDA 4L0QA 4DRYA 4RVFA 3PDUA 4HV4A 3VZSA 3P5SA 1X1TA 5JCXA 3WNQA 1QG6A 3GPIA 2GN8A 4KWHA 3DOCA 1RJWA 4CMHA 2DM6A 3LYLA 4GVLA 3RU7A 4J0FA 5IZCC 1SO8A 2YV3A 4EEXA 1LC3A 2DUWA 4YT5A 3KLMX 3UOGA 3OFSA 2IZZA 4J2HA 2VRCD 4FB5A 3VPFA 5L7TA 2W4QA 4KOAA 5L9AA 1R37A 4E5PA 3GNQA 3RBZA 3RUHA 5HWSA 4NBRA 3JCZA 1YL5A 2G0TA 2JFGA 4RQUA 5JXWA 3H5NA 4QFDA 3TZ6A 3MJCA 1R0LA 2EIHA 4FFMA 2B4TO 4J0EA 3EAGA 2D1YA 1XEAA 3UICA 3C3XA 4CV1A 4R4JA 3PQDA 4GX1A 3GRPA 1T4DA 1ISJA 5ICMA 3JD1A 3PJDA 1KY5A 3H5AA 2VQ3A 1YRLA 4MO2A 3RFXA 4D3DA 1RYEA 3NX4A 3JQ7B 1L7EA 3E03A 4CQMA 1KEVA 1NTOA 2UVDA 9LDBA 4Y6SA 1ORRA 3DBRA 5U4QA 2Q1SA 4PZCA 1RPNA 5KVVA 1TT5A 3AM3A 4B4WA 2DTXA 4UUOA 1KBZA 4RLSA 3W4IA 5A3JA 1PTJA 1CIVA 4BQRA 3DOOA 3RKRA 3RSHA 4CQMD 1YJ8A 3K73O 3PJEA 2P9EA 1A7AA 1V3UA 3K8ZA 3U62A 3LU1A 3Q11A 4J90A 4ZRNA 2OORA 1HSZA 2FPPA 3NYWA 3DAPA 2IXAA 5CPBA 3Q1LA 3WGQA 1GEEA 2JD1A 5ILOA 1Y8QB 1IPFA 4RDIA 4DREA 4B3HA 3WSWA 4EDFA 5KKCA 3AUUA 1PL6A 3U0BA 5A5EA 4IGFA 4NJMA 2NVUA 4CLXA 1QYWA 3GMSA 3PP8A 3D4OA 2DVMA 2D5AA 4NNJA 4Q9NA 4CM3A 1K5HA 5DT9A 1LBEA 2OZPA 4J7CA 1UXJA 3BMOA 4M87A 5G0VA 5L7WA 1WZIA 3KEOA 2NM0A 2DFDA 4ALIA 1NPYA 5EINA 5A9SB 4BO7A 4NQZA 4Q3AA 5I8WA 5CHEA 1HLPA 3WR5A 4IJUA 1U4SA 3WYCA 1B8UA 5F1PA 5A5FA 3G17A 2PZKA 2I66A 3I9MA 5KTKA 1E1LA 4CM8A 3VC7A 2HO5A 2CUKA 1XGKA 4RVDA 1GYQA 1YB5A 3AFMA 4J9VA 4E5KA 4R51A 4XKJA 1JWAB 4RF4A 3DQPA 1AHIA 3UHAA 3K2BA 1EE9A 1CERA 3IJRA 3PQEA 3TZHA 5KVCA 4ESOA 1YJQA 1R0SA 3KXDA 3L9WA 4W7IA 4B4VA 5HA5A 5JO9A 3ZWXA 1XQ6A 3BMOB 4LK3A 3BZUA 1GAEO 4UAGA 3WGTA 3OHSX 3ETGA 4MVJM 2I9PA 4XEHA 1ADCA 4U6QA 4E2WA 1A9YA 3RASA 2VOEA 3C7DB 1U3VA 4PG6A 5KOIA 2BGLA 4BMNA 2VN8A 2CZCA 5JO0A 1CWUA 1H94A 1XSEA 1ZSYA 4J4BA 2W90A 4NFHA 3FRJA 3VOSA 2AQKA 1UDBA 1OC2A 4TQGA 3IJPA 3Q2KA 3ZV6A 1E1MA 2TMGA 4AVYA 3PQFA 2BI7A 3TZCA 4A5OA 2B69A 3A28A 1PWZA 2YYYA 3FSRA 4GLLA 1Z73A 1NHWA 3N7UA 3WFJA 4RJTA 1BVUA 3FTNA 3CTMA 4J1NA 4OO3A 1GYPA 4CQLA 3JD2A 1I33A 5BSGA 3VZRA 1SNYA 2YW9A 2AEFA 3ADOA 3F3SA 1DC3A 2PTGA 3QLJA 3ZWPA 1VPDA 4EZBA 1DC6A 3OJOA 1B8PA 5CPFA 2ZJ1A 5T5QA 1HDRA 4B4UA 5C7IO 2B83A 2XPCA 3OJ0A 3U09A 1T25A 5L40A 2HMTA 2YFHA 4O1MA 1FDTA 4DL9A 3AI2A 2WMDA 2P91A 3E9NA 3PWZA 2DAPA 4GI2A 5LCXA 1VE9A 1JKIA 1J5PA 1ISGA 2AA3A 4IJVA 4CR7A 4DPMA 2HUNA 5JMWA 2CNBA 1HYGA 5A02A 3OH8A 3L9XA 2VZ8A 1ZSVA 4R9RA 5HRUA 3QVXA 1ONPA 5IN5A 2X22A 5ENVA 3X2EA 4XCVA 3PYXA 3F9IA 2CDBA 4D7AA 2NLOA 4ZD6A 3T7EA 4CUJA 5DZSA 1GL3A 3OQ6A 1BDBA 1I24A 5DOZA 5G0UA 4A7PA 2VNAA 5JFOA 1HL3A 4OOFA 2X5KO 4Z0TA 5T64A 4NJOA 1HDGO 3PRJA 4YJHB 3ZHXA 5EMHA 1OFGA 5K6AC 3BMNB 3I9OA 2BH9A 4E21A 2O48X 5A05A 3I1JA 1DJNA 1CQJA 1LDMA 1T2CA 2PR2A 3V8BA 2VZ0A 4NHEA 1TB4A 4L75A 1VSUA 4D0RA 1WAMA 1X7DA 3JD4A 4M1QA 3ZNOA 3LF2A 1Q7BA 1UDCA 3CKYA 3OETA 3GFGA 4EJMA 3LLVA 3L07A 2VZ9A 2EG9A 3BYZA 1QXSA 4PRKA 1UDAA 5IDYA 2XXJA 1C1XB 1Q7CA 3GDOA 1JLLA 3AUTA 4CMIB 4YAKA 4YRBA 3T4EA 1HZZA 5IN4A 1GU7A 1JDJA 4CM6A 5U1PA 3VKUA 2J8ZA 2PD4A 3PJFA 3F1LA 5FWNA 4XQ9A 3E1KA 3CXRA 1H6CA 3MJEA 4GGOA 3JYPA 1R16A 3NT2A 4U0JA 1KERA 1S7CA 1E6UA 3QSGA 5T6BA 4AJKA 1A4UA 2A4KA 2B4RO 1YXMA 2NUAA 4MIYA 3BMNA 1YDWA 3UAGA 2A92A 1E1KA 1K0UA 3JQ8B 4YBZA 1ZFNA 3VDRA 4MJLA 1X1EA 2BELA 4QXMA 4XD2A 4RF5A 4MVJP 1HYHA 3DOJA 2BFOA 1P1IA 1EBFA 3V2GA 4W9NA 5DOVA 1YQXA 4JIGA 3F46A 5H83A 2NU7A 4DC1A 1DFHA 4HX5A 1XIVA 4XIYA 3ZHYA 2H6EA 5ILGA 1YB4A 4XQGA 3ZHBA 2X23A 4JJFA 4JJGA 4BNWA 4CM9D 4HFJA 4D45A 4CMKA 2G1UA 4NFYA 4YEDA 1P0CA 4MVJG 3PHGA 3SBOA 4BO3A 3GC6A 1GY8A 3NDIA 3M6IA 1WP4A 3QRWA 1F12A 1P0FA 2GASA 2P5YA 1N5DA 3MJTA 2DTEA 4E2ZA 4P4NA 2HDHA 4JBHA 1N8KA 5AXDA 3VVBA 4R16A 1JW9B 1OI7A 3L6OO 1PEDA 3WGOA 1P45A 1Z82A 5TF4A 1B15A 3OSUA 4XYMA 3DTTA 1GTMA 3NRCA 2D0IA 1U3TA 1U4OA 1V8BA 4KP7A 3GGGA 2A94A 2O3TA 4WLFA 1V35A 3L77A 1NVTA 3OA0A 3UH1A 1LU9A 1MGOA 2RHCA 3ASVA 4ILKA 2DBQA 4AFNA 4JNKA 3UN1A 3ADPA 2YY7A 1VJ1A 2YZ7A 3KTDA 4JLWA 2P9CA 3KO8A 3BXXA 4A03A 2V6GA 3BMQB 1LLQA 1P44A 2Y1OA 1PWXA 1Z7EA 1O89A 4TSKA 5ITVA 1N9GB 1U5AA 1E7WA 1U8FO 1VJ0A 1T24A 2DC1A 4PLCA 4E2YA 2CVQA 1R12A 4ALJA 3RD5A 4P4GA 2J5RA 4D42A 4CL8A 2F1KA 1NYTA 1LSOA 2X5OA 1D1SA 1NAHA 4R01A 1E7MA 3DDNA 3M2PA 4L4XA 4YJFA 1JAYA 3O9ZA 5DCYA 1C1XA 3DZIA 3PYLA 1FDVA 4PCVA 4R41A 3GG2A 5EL0A 3ZW9A 1YL6A 5I7VA 3WGIA 1GYRA 1WDMA 1HDCA 1F17A 2DBZA 3FHLA 3INGA 1DAOA 3F47A 3STHA 1PU2A 3DR3A 2HRZA 1IZ9A 4BNXA 3TRIA 3DZGA 4U6SA 3R3JA 2PZJA 4ID9A 2LDXA 5TRTA 5H82A 4AJOA 1PR9A 1V0JA 3DZFA 5JBIA 4A10A 1EZ4A 1ZJZA 4K6CA 4OH1A 3TOXA 2EWMA 4LN1A 4YT8A 3KV3O 3LC2O 4FW8A 3PIIA 1Y8QA 4MKZA 2WDZA 1K3TA 1FF9A 4ZQFA 1UZLA 2O3RA 3WMXA 2FSSA 4EJ6A 3INRA 4BMVA 3GVIA 2I5PO 4CMCA 4BVAA 3K6JA 3W8DA 4M86A 4OSPA 4KTVE 3DMTA 2LDBA 3RC7A 1SZJG 4KMSA 2VHZA 3I4CA 4I5GA 1KIFA 3SEFA 3DBVO 1EQUA 1RM5A 1ZO8A 4E30A 4OJNA 3KVOA 1ZK0A 4PLHA 2AMFA 5HBRA 3ZNQA 4D44A 5HS4A 1C1DB 4YCAA 1MFPA 4D3FA 2WYVA 5LC1A 3I9NA 3JQ9C 2QHXA 4XDYA 4QT0A 2ZK7A 1U7TA 2ZB3A 1PSDA 4DMLA 2QRJA 1H2HA 3IP1A 3SC4A 3QWBA 2C82A 1P1RA 4KDEA 3OA2A 1I3LA 7ADHA 3WXBA 3FF4A 1NP3A 2G5CA 2OHXA 3DWFA 1J6UA 1SOWA 1VLLA 2W98A 3E8XA 3GAZA 2IZ0A 1MUUA 1T1RA 4IGEA 2UUPA 4IMPA 1ID1A 3TSCA 3VH2A 4FGSA 1JKJA 1ZBQA 4E13A 1KS9A 2CVOA 3AUSA 4LSMA 1ZW1A 1HLDA 2ZCVA 4RPJA 4A26A 2VWPA 2VHWA 2O3QA 1IYZA 2IE0A 2CDCA 3RUCA 3TL2A 2P4HX 4CLEA 3LT1A 1PGNA 1GPJA 2UDPA 4FS3A 1UZMA 4Z9YA 2PLAA 4NZ9A 3BIOA 3U4DA 2GRAA 5EESA 3ROQA 1E6WA 1Q0LA 3HZZA 4HNHA 3VPGA 2Z1NA 1Z45A 4N5MA 2WYWA 4Q3NA 3EYWA 4KWIA 1DC4A 4IDBA 1OMOA 3GZNA 3JV7A 2HK9A 1QMGA 4DLLA 1DHTA 1B3RA 1SOVA 4XRGA 4PN3A 3PHHA 2HQ1A 3SXPA 1IZ0A 3EMKA 1KC1A 1N92A 1PS9A 4O6VA 3D3WA 2E48A 2HKIA 4CMEA 1QP8A 3LLSA 4IBOA 1G1AA 2FR8A 5AXAA 1GUYA 4FFNA 3CH6A 4G81A 1DC5A 8ADHA 2PGDA 3OJFA 1EBUA 5IXYA 5JC1A 2C5EA 2BF7A 2ZTLA 3HDHA 1R0KA 3LVFO 1TEHA 5F21A 3RQSA 4CR6A 2Q46A 2JL1A 5LDHA 3PK0A 3RUDA 2QW8A 4FR5A 4IJWA 4AJLA 1YE3A 1ZJYA 1E92A 5J23A 1HWYA 1ENPA 4QTZA 5G2OA 5CG1A 4XB2A 1LEHA 2CF6A 2X9VA 4WLOA 1ONNA 4EUEA 1DEHA 2ZTUA 4CMIA 1LRLA 1ZCJA 5IXSA 4J4HA 1DIBA 2ZIZA 5G4KA 3VH1A 4YXFA 4PZEA 3RUAA 1XWFA 1UP4A 2I6TA 3N58A 3R6DA 3PGJA 4FC7A 4BB6A 4CUZA 4J4TA 3BMQA 1F8FA 4U0KA 3JYQA 4YJGB 3GGOA 5TT1A 1Z74A 2B5WA 4BNVA 5IAAA 4DUPA 4XDZA 4NBWA 3WG9A 1QV7A 6LDHA 1HSOA 5BNIA 2VWGA 4R1NA 2YHIB 3TN7A 3JQAB 5KIAA 5TC4A 3VZPA 2FPIA 1E3SA 3ZN2A 3I52A 4ZGWA 1LC0A 2J6IA 5CDTA 2GN9A 4ND5A 4GH5A 4JJIA 2VOJA 2UAGA 1VKOA 2DBRA 1ARZA 4NJMB 3DBLA 3ULKA 4UUPA 1NR7A 1HTBA 2EF1A 4R69A 4IIVA 4RPGA 1UXHA 4MKXA 3H9QA 2JD0A 1OAAA 5I7EA 5L53A 3Q6IA 4YR9A 5K6AA 4EITA 3FTPA 4PLTA 2VT2A 2WYUA 4W82A 5FEUA 1MG0A 4B7XA 1YO6A 7MDHA 2WWRA 2C7VA 1MC5A 3I4FA 2YJZA 4I1IA 4RVSA 4CLOA 4PGFA 1JA9A 2UUOA 5H81A 5C7LO 1NVGA 2I65A 4WE3A 2Y1CA 1S6YA 1A71A 2CMDA 4DQXA 3DHNA 3KYCA 3A9WA 4BNGA 3DMTC 1DIRA 4XRRA 3H65A 2ZJ0A 5L45A 4II3A 3BTVA 1Y7TA 3HN7A 1PZEA 4L9RA 2XOXA 2FSVA 4XGNA 1I3NA 2FY8A 4HFRA 3ANLA 1O8CA 3FBTA 2AG5A 1E77A 3W8FA 3DONA 3B1JA 4EUFA 1ULUA 3EDMA 3DL2A 2X9GA 3HNPA 3DAFA 4H3VA 2RBEA 4PLFA 1E7RA 1TT7A 2VTDA 3OIFA 2GSDA 2PZMA 1C3VA 4C4OA 1KEWA 1I5RA 1MG5A 3IP3A 4MP8A 3JQ6A 1ISFA 1A5ZA 4J1QA 1AE1A 3W4JA 3ZWWA 1Y9AA 1HRDA 1BRMA 2JFHA 3FI9A 4R1TA 1LQTA 1B14A 3CSDA 3GY0A 4B8ZA 5JCJD 1XELA 5TX7A 4CLHA 4MVJE 2YV1A 2V65A 2RH8A 2H9IA 1M67A 4UVGA 4A73A 1HXHA 1PZFA 3JQEA 4WNCA 4FGWA 1E3IA 3ST7A 3WLEA 3H4VA 3H9GA 1VL8A 3IUPA 3CUKA 3K5PA 1KOLA 1L7DA 2RCYA 4B7CA 4GMFA 1RM0A 5DDIP 2GERA 1QYVA 2NTJA 2NV6A 4R54A 3PEFA 1J4AA 3WB9A 4PLGA 2NSDA 1MFZA 3AM5A 4GKBA 2I3AA 2EGHA 5KNLA 1HKUA 3TWOA 5EQDA 3NTOA 4YJDA 4KQXA 4F6CA 1B0AA 2VTEA 1DIAA 3S8MA 2JKVA 3DFZA 3GR6A 1U3WA 3GMDA 4CMBA 2C59A 3UVEA 1O95A 5AXCA 4IDGA 5DBFA 1UAYA 2H1SA 1TT5B 3FPCA 1ZUD1 5KJFA 4RF2A 1HEUA 4QO7A 5BSHA 3V5NA 4GSKA 2OOSA 3ROPA 4FJ0A 3TFQA 4N54A 4L73A 5DULA 4YJFB 3EVTA 2DT5A 2ZB8A 5COAA 2ZYAA 4R5HA 1XCBA 3H7AA 5A04A 3NGLA 2AQIA 1N7GA 4K1LA 2HK8A 4HNGA 2D4AA 3ZWMA 3VTFA 1X0XA 3KSDO 5DP1A 1M6WA 1YQDA 4CM5A 1VRWA 1X7HA 3HQ4O 1UP6A 2OBNA 2C0CA 3DXFA 4IXWA 3ZWVA 3RC1A 5DBIA 5DCWA 2Z95A 3RKUA 1RYDA 2FWMX 3PZBA 4YRAA 4BNJA 2AEMA 3ETDA 3PFWO 1QLHA 3M1AA 3Q2IA 4I5DA 5L7YA 3AOEA 3OP4A 1CDOA 3NDRA 1DIHA 1HYEA 1ZXBA 2IDZA 3AW9A 1P33A 2PD6A 4JP2A 1E3JA 2OP1A 4E33A 2Q99A 4NR0A 4BO2A 1A9ZA 2OP0A 5TS3A 2X0IA 3KRTA 3ORFA 1P1JA 2O3SA 2B5VA 2E4AA 3LSYA 3GEGA 3COSA 4YQYA 4CM7A 2C5AA 4HY3A 1J0XO 3OJEA 2VUTA 3RJ5A 2OGUA 3MOGA 1HDZA 1PZGA 3QWHA 3GPDG 3AI1A 5TJHA 5IDWA 4DIOA 4CV0A 2OMEA 4QO8A 3D3EA 2CDAA 1E1NA 3I9LA 2NVBA 1UXKA 5FI3A 2UV8A 2IODA 3ZWAA 1C1DA 3Q3CA 5F5LA 4LW8A 4CODB 2ZTVA 1QYXA 4JBIA 5TQVA 2GF2A 3HG7A 3PWSA 1ISMA 4CV2A 3NJ8A 3NEPX 2IYPA 2SCUA 3FWNA 1TLTA 3VPHA 1YVEI 4DIFA 1A7KA 4NMHA 1IHXA 4K26A 5EJ2A 4RLHA 4RDHA 2Y0DA 4IS3A 1ZSNA 5AOVA 1F14A 4ZICA 1GQ2A 4YJHA 3OICA 2Q45A 5I9NA 3TJRA 3GZ4A 8LDHA 4M54A 4AJ1A 2AG8A 4AICA 3PHLA 5JCJA 4ITUA 1GEGA 4I9NA 1SBYA 4BNHA 2VWQA 5JMPA 4BGIA 3PXXA 2IZ1A 3AY3A 1HT0A 1I2BA 4AJPA 3KUXA 3JYOA 3GDGA 3O8QB 4YWJA 2DLDA 4BO5A 1EQ2A 3B20A 1OOEA 3GG9A 4CPDA 3IMFA 2DKNA 4J2OA 1NAIA 3I5MA 2BI8A 1HE4A 3U49A 4INAA 4I08A 1YGYA 4P22A 4GPD1 3O03A 1WDLA 1C0LA 1WDKA 1E6EA 3HHPA 4MIEA 1O94A 1HDOA 4DMMA 4RORA 2WSBA 3ZWCA 1PJSA 3R3SA 3O26A 5A4DA 4DVJA 3E48A 1NHGA 5JLAA 4YYZA 1PJQA 3HN2A 3L4BC 4L74A 3W1VA 1FDSA 1K2WA 1P1FA 5K0ZA 3AM4A 2VRBA 3DBHA 3RAJA 1WXDA 2DFVA 4YDRA 3QHAA 4XYEA 4E5MA 1E3WA 4UEKA 3RUIA 4E12A 4Z9XA 4M49A 1GD1O 1YBMA 2DU8A 2F00A 3B6ZA 3OQBA 4RGBA 2QIOA 5KCZA 1FMCA 1PQPA 2VUUA 5B1YA 2NQ8A 2OL4A 3NV9A 4YAIA 1EMDA 1BW9B 2GN6A 2VT3A 2ZQYA 3RBXA 4DGSA 3K2EA 2QG4A 2AQHA 3VVCA 1K89A 1JKFA 2PWZA 1E5LA 1LQUA 4JP3A 5T57A 2QQ5A 4B3JA 3EZYA 3O38A 3JQFC 4TRRA 4YAEA 1TI7A 3M1LA 3S2FA 2Y1EA 1LDYA 5JAQA 5HM8A 3AJRA 4GGPA 4R68A 3E5RA 2R6JA 3L6DA 5I9LA 2GNAA 2ZB4A 5DBGA 3UXYA 2E82A 1NFFA 2VUSA 4W99A 3BMCB 3F6YA 4TRNA 2D3TA 1EFLA 1G6KA 4CUKA 3HFGA 3RCBA 5DF1A 3WTCA 2YQ4A 2EJVA 3GVXA 4IQ8A 3TZKA 1UR5A 2PZLA 1NASA 3BTUA 4M8SA 1J49A 3E6AA 1I30A 1YS4A 2RH4A 1G0OA 4FC6A 4CR8A 2E6UX 2I3GA 2BFAA 1MXFA 4AJHA 4RZIA 4EBFA 1UZNA 1Y1PA 3ASUA 4DWVA 3L4SO 4C7JA 5AXBA 5L51A 2G82A 4OXYA 5GZ1A 5JAZA 3G79A 1E3LA 2VCYA 1EE2A 4BO4A 4Z6KA 4BKPA 4I8XA 1B8VA 4CMGA 4MKRA 1O6ZA 4ALNA 1PJ4A 2Q1TA 3SLKA 3JQCA 3KYCB 4FD3A 4PVCA 4WNIA 4XIJA 1ZH8A 4IXTA 3JQAD 4J1SA 2GO1A 3HB4X 4XQCA 3UCFA 1TA4A 4XR9A 5ADHA 3AWDA 3NGXA 2PKQP 4E6PA 4QX6A 3UKOA 1D1TA 2QX7A 5ICSA 2DBVO 2BLLA 3BTOA 5G0SA 5A06A 2NADA 2NTVA 2YHUA 1RM3A 3RUEA 2CD9A 5L4LA 1WNTA 4WJZA 2Q4EA 4IY1A 3RIHA 1KVQA 1NQAO 4K28A 4J49A 1VM6A 3D4NA 5KWEA 4KUEA 3WWYA 1N2SA 4E4YA 3QWAA 4ROSA 1NVMB 3GUYA 1X13A 1P31A 1PL7A 1ZK4A 2EP7A 4UREA 2HK7A 4L4RA 1NPDA 4WCFB 2NU8A 4ZRMA 2EV9A 2GPTA 4D3SA 1DLIA 1DO8A 1GZ4A 4HFMA 4IDFA 4LSWA 1LLUA 4TKMA 1EEHA 4IIUA 2WTBA 1ZZEA 3HJAA 5IFLA 1HZJA 3DBLB 3F4BA 3NT4A 4R1SA 5L95A 3C7CB 4TROA 3BTSA 1UJMA 5F1KA 3AY7A 2ZKLA 4BMSA 5EPOA 1CETA 3B1FA 4OHUA 4DIBA 3MCVA 4PFJA 3ZWBA 4J7UA 4Y67A 5LDGA 2BKAA 1IPEA 1QRRA 2DUUA 1B3BA 3IIEA 3EUWA 3QWFA 1JWBB 3E9MA 3NTRA 2WEKA 4TRJA 2VWHA 3DTYA 3JYLA 4F46A 3ZV5A 1Y9EA 3CPSA 3CIFA 3GEMA 3GVCA 5JDCC 1UXGA 5IZCA 4LCEA 2CVZA 1HDXA 3H9UA 2PH3A 1ZK2A 2GGSA 4FOSA 3ZI0A 1NXQA 1YOVA
chains in the Genus database with same CATH superfamily
2QJOA 1FXSA 1D4FA 3HI4A 3MM4A 1E8NA 3OT4A 4KCGA 2FSGA 4URFA 4AG3A 4V1CB 1E4EB 3ZDCA 4WASA 1PJ8A 3QA9A 5FOQA 3S55A 3Q9UA 4YTEA 1CZKA 1ATIA 2R5FA 3HJGA 4MUHA 2H5EA 4R9SA 5EVCA 3LL7A 3EVCA 1XTPA 1C3LA 1FLNA 3G59A 3GRRA 1V8FA 2YJNA 3MWYW 4G5HA 4CEIA 2HB6A 3L4BA 4UEJA 4E4RA 3L1JA 5JS6A 2P77A 4Q1BA 5TGZA 1X0VA 4BGEA 5KKAA 2A14A 1F7UA 4M0CA 3FCYA 2GK4A 1IHYA 2V4UA 4KQMA 1W4ZA 3KPUA 4AX4A 2AXEA 1JALA 1QFSA 2BE9A 5B4VA 1FX0B 4RVNA 5FWDA 1UMBB 1M1ZA 2FQ1A 3ZVMA 2QX8A 3H05A 3V34A 3MSCA 3JTMA 2QTAA 2GBLC 3AM1A 3EZFA 4M0KA 1VZ3A 2LNDA 3UKJA 2POQX 3K8OE 4LGCA 5I7SA 2DUNA 1TM1E 2FDXA 3VOAA 3VPXA 3NHPA 1P73A 3UGKA 3UZUA 1LD3A 2J59A 5AJZA 4BKRA 1PK9A 3W6PA 1ENZA 1QYDA 4Q3OA 2YVKA 3HDYA 2GM5A 3WL3A 3ZE2B 1R8XA 3KQTA 1L1RA 2YXLA 5CNMA 2OQRA 5SZKB 1JL3A 4OI1A 1GN8A 4R8RA 1I8TA 5LL6P 1VE5A 2QNRA 1O95D 1YA4A 1E3EA 1P5RA 5BPHA 4LHSA 3BHIA 1U9IA 2ZFUA 1UJ2A 1E9CA 2ATEA 4FFPA 5HK8A 3VXKA 4D9GA 4X44A 1RWOA 4KN6A 1RRKA 1Z16A 5EJAA 1DTSA 1GGNA 1MCZA 3K2QA 1U2GA 5DHAA 3WRXA 4AB1A 2ZYDA 4HH1A 1OWMA 4IGIA 1UC4B 2XF8A 2GTHA 4HKTA 5BQPA 3MWEB 3SYKA 2IP2A 5KC9A 1VJRA 3TUZC 1F1BA 1NP7A 2ZCUA 3WKBA 2FG5A 3M49A 3IOBA 2DGDA 5C37A 4RZQA 5CDGA 2Y99A 4PZYA 5DX0A 5A9TA 1L4NA 4OB7A 3P9KA 1GZHB 3A1VA 3VX4A 5HDQA 3G49A 3KQKA 3IFSA 3NIWA 1A88A 1U5BB 4AO6A 3H13A 1U1IA 2DT8A 4TX1A 5BR8B 3HXOA 4XA8A 2Q6LA 3ODGA 3CEPB 5LMUB 3A1CA 4B1FA 3AVXA 1M7BA 3GH3A 1CRPA 4X91A 4Z5XA 3SF8B 1CY1A 4IDNA 3FTEA 3DLCA 4ZZ3A 3EIFA 4MZDA 2HHCA 2Z1DA 3KT6A 4RJIA 2C99A 3ON5A 4QAJA 2B1IA 2HDNB 1OTYA 2G28A 4L76A 2NO9A 4KRGA 4ZYYA 2ZM6B 4H7EA 4FFLA 3LXXA 3QYPA 1T4CA 3VUFA 4CDGA 3UB4A 4W4TA 1MOQA 3UO8B 2JLZA 1R88A 3BFJA 5HCUA 4DDWA 3IPXA 1YWGO 2VBGA 4Q3DA 4DEVA 5CX1B 1OWLA 3BZBA 3PEEA 5EAIA 1UADA 3AR9A 1RQRA 4HP8A 5L3ZA 5A4KA 5JSZA 1W1WA 4N3BA 3NT5A 3ZNNA 4JBYA 4YCDA 3KOUA 3QUAA 1WZCA 5HGXA 2BP7A 4RIFA 3KJNA 2H54A 4LOHA 2I67A 2XEDA 3K30A 1DELA 3ISJA 1HH4A 1B2RA 2B3DA 3LC7O 3LNTA 1Q12A 2XB8A 3U4GA 3AUKA 1VXRA 2JFWA 4HSGA 1G3QA 2X2PA 2IT1A 2NXNA 3UF0A 4B6OA 3BXEA 4LEIA 1EESA 4DSZA 1JHAA 4DABA 1S8AA 5EP4A 1FA9A 1ZHHA 1ZL2A 2JHAA 2LR0A 2EF0A 4IDEA 3DEAA 4LRTB 5CLHA 3I62A 5DWVA 3B2NA 3NHZA 4X0EA 2FMKA 3OG9A 3W05A 4O0MA 4O0LA 3NUGA 1BXKA 4BKOA 3R7NA 1FDOA 2H1CA 4DLRA 3IX7A 3OJXA 4NOJA 4PX3A 5TF0A 5DHSA 5G4KB 3SC6A 4MWTA 4FWBA 4G8JA 4GI1A 3E70C 4NBVA 4QG7A 4TVOA 2ONJA 1NVXQ 4BLTA 1W9HA 4YXWA 3OPVA 1JAXA 4DY6A 2HIMA 1NJSA 4TL6A 4O33A 2HLPA 5J4KA 1VJCA 4UFPA 1L4UA 1XRQA 5D3MA 1AMUA 3PFFA 2FZGA 3QMMA 4KMMA 3C97A 3PTZA 4LPKA 4KPFC 1VHDA 4R83A 5F5NA 3D2CA 1R6TA 3L46A 4P31A 1T26A 3EIQA 5GQSA 1N0UA 1ZI9A 3ROMA 2OV2A 1OZAA 3O3NB 1L8XA 1RWKA 2GILA 3R9XA 2DQ4A 1DJPA 1WCIB 1ZKMA 4Q7LA 1IM5A 3VBCA 2YWJA 2IOHA 3K2IA 4FUTA 4MAAA 5BSUA 2AL7A 2I6UA 1G8YA 4FCCA 2CHQA 1ZRNA 3V4FA 1L8AA 3IC5A 4YO7A 3DT9A 4JCOA 4Q9IA 1LXCA 2CBGA 2WQ6A 2BR4A 2YWDA 4JVMA 4PGHA 1OYYA 4K6OA 1YL7A 2GAFA 1F51E 2UYYA 1Q7RA 3FOEC 1XZHA 2BMEA 3DEFA 3IDSA 4IDPA 4EJSB 1Y6FA 4ZK2A 1EU1A 3OZGA 4NSNA 1BWSA 3W90A 4Q7JB 4GE3A 3WMWA 1XYGA 1XFAA 2ZJZA 4X6XA 3U7EB 5DGHA 3ZDRA 4FSHA 3JASB 3MOIA 4E0BA 4YT4A 2E4ZA 1N7HA 2BFMA 4YQZA 4WEQA 4DGQA 3DF9A 4AZ3A 1C30A 1S8OA 2JCVA 5JSUA 3BSSA 3C70A 3GHHA 3NPMA 3NBQA 3QKRA 1WU7A 4KUGA 3TLGA 4TTSA 4E5NA 5JNLA 1YF3A 4UVHA 3FCEA 4YNBA 2J6CA 3LT0A 1D6NA 3CMCO 4G0ZA 4GX0A 5LOVA 2E5FA 3K31A 4TMWA 4JYZA 1Q1NA 2BMJA 2V0CA 4L72A 1BQEA 3VV2A 1H05A 2EFDB 1Z34A 2EEZA 4DQKA 1TF7A 4YRGA 2HYDA 3AHGA 1GFIA 2H7XA 4K9OA 3W9UA 4H7IA 1Q0QA 2A9JA 2IYVA 5AI4A 4KI0A 3SFZA 4NYIR 2QPOA 2Y2VA 1AQIA 4NEQA 3DZJA 2N46A 5BOSB 3DHYA 3K9FC 5JEEA 3GLQA 3GP3A 4M7OA 4MWSA 1PWYE 2NPIA 4RVHA 5T8KC 5I7EA 1QRAA 5FHQA 2JGMA 3DL4A 3THXB 5AK6A 4YAGA 1JJBA 5CA1A 2XY4A 3ZXUB 1QFMA 1T8RA 2B7LA 3MD0A 1LI5A 2OHVA 3BE8A 3BCUA 3TLKA 1M0SA 1UWCA 1PQWA 1F9EA 1IBSA 5DI3B 1OXUA 2AFIE 5FQOA 4A8TA 2BSXA 3P4XA 3WO0A 2IHJA 1YK1A 1DXYA 1FSPA 2G36A 3M70A 3S2YA 1RHKA 2ZROA 3CRVA 5E38A 3D5TA 3L2OB 2P9JA 1NXSA 2XLCA 2AW3A 4YVFA 1K08A 4OQZA 3EBLA 2JARA 3QJGA 2QXUA 5LDDC 4R7TA 4NPCA 1GFZA 2JD2A 3SQXA 1Z62A 4FNGA 1FFHA 1R6XA 4FEYA 4BVGA 3LT5A 1QLJA 4MRMB 4ND2A 3IVMA 4CMEC 4FE4A 1KEUA 2BEVB 5BURA 3UB3A 1SXGA 2AI3A 1YA8A 1G8SA 2PRSA 3AXTA 5HYVA 2A5FA 5EE0A 3W8NA 1SK8A 2ZSJA 4DLAA 4RDXA 1T10A 4IV0A 4F3YA 1QGUB 4JSRA 1R4AA 1KO1A 2FPWA 1ZNZA 1YBAA 5E6UB 3I8XA 5FUWA 3SFVA 3GZJA 5FBVB 1RXYA 2ID7A 3TRFA 3BOSA 5KTPA 3OESA 5BMVF 2BOVA 3RU9A 2XGJA 2J7KA 1E3DA 5BSFA 5FBQB 3LA8A 1JLKA 2QZSA 3K96A 5CGZA 4AKSA 4BFZA 2D0OB 4BUJA 4DUGD 3VA7A 1AKEA 2FR1A 2WWHA 2QYSA 3KYBA 4MW2A 1Q77A 2XD9A 4JLKA 3VC1A 4KREA 1BYIA 1F2VA 1EUZA 4FEEA 2I03A 5A03A 1K6IA 4OAQA 3MJHA 3DMFA 3I0NA 2BFWA 3TBFA 2H4HA 2HJRA 3M2TA 1UWLA 4Q16A 2ZE6A 4RVGA 8ABPA 1U8TA 5DLQC 1HX7A 2ZR0A 5TY0A 2CFOA 1T2FA 4L2IA 1KZ7B 1WY5A 2ZZKA 4PHFA 4XGQA 5FP0A 4YR7A 2WFLA 1KI7A 2VRWA 3UH0A 3GEHA 4H35A 1SU8A 1LRJA 4HWOA 3TR0A 3KTFA 3LCJA 4PIVA 3KQVA 4RY0A 3VAZA 1GCGA 3DBRB 1M2JA 2Y0PA 5G1NA 4QPNA 3TCNA 3IR5A 2PX6A 5CAEA 1E8MA 2RI1A 2Q49A 4FHDA 3SC3A 1PFVA 1O6FA 5ELMA 4R2JA 1GWNA 1ILEA 1RQLA 4NOMA 4DDHA 5TS2A 4MP6A 3MJ4A 4Q03A 5CEJA 4XGKA 2AMVA 3P4UA 2FR0A 3M5PA 4WVLA 3QY0A 3D3JA 3T1QA 2VJNA 2C54A 2ZJYA 1KSHA 2EKLA 3E18A 2R6CA 4RWZA 2XE8A 4IXNA 5KTYA 1XQXA 3STTA 4G0XA 1E5DA 4ETWA 4J76A 4MW1A 2ZJ2A 1KQFA 1FX0A 1VG1A 2XWSA 3GFVA 5IMBA 2QD2A 2QAIA 1K4MA 1PX0A 4HQKA 2HU8A 2W2PA 1RPJA 3W7VA 3IUJA 4HDSB 1MC4A 2CF5A 2FOLA 2Q2WA 2Y2UA 3MCWA 1WLSA 2JI6A 1P7VA 1ADJA 4Z99A 3PX7A 1WP9A 1DIGA 1DKMA 4LZAA 4MUMA 3NEJA 3CEMA 4B6QA 4ZMRA 1Q2XA 3IJEB 2BE7A 3OT1B 1DJOA 4X7BA 2RGUA 2PEZA 3B70A 5T7BA 3JZMA 3FPFA 4F12A 1BX0A 1ISIA 2XDQA 3AP2A 2YIVX 2X7XA 3HB5X 3KYIB 4G56A 4H9GA 4MULA 1E9VA 3C41J 1XD2B 3DHEA 4QEZA 3PXEA 4BGVA 3DR5A 1VA4A 1Z17A 4B2IA 4YRPA 1I10A 5IM4F 2L19A 2QE7A 4KWEA 1J23A 1JLSA 3CUTA 3FOCA 4JZKA 1G2IA 3NC0C 4HRXA 4KK4A 4B3IA 4FTWA 1SEPA 3R8XA 1Q0HA 2G80A 4IFTA 3VZDA 3EIOA 4ENWA 2AJBA 5ALOA 4ZGWA 2PGOA 1D9ZA 3O8OA 4QD3A 1ZA1A 3NONA 2I62A 1T0PA 5IYZF 2DERA 2CC2A 2Q9AA 1JDNA 2K7FA 1WQ1R 2C9DA 3DE1X 2QTZA 3INTA 2VA9A 4RADA 5I8PA 3OCVA 1K3FA 1NBME 3R5XA 3NJ4A 4XUDA 1IRIA 1YVUA 4OTZA 1XYVA 4F4HA 1T5HX 1EJ0A 2V8OA 3LC1O 2ZRMA 2LTAA 2O9JA 3K1JA 4MCIA 5IG2A 5JNVA 4HLUC 5G02A 3H2HA 1SVOA 3H9JA 4GGMX 4W5HA 3ITDA 1TYCA 2HY7A 3IERA 1GNLA 2EW2A 4WEOA 4XLLA 5T6MA 3ZJ4A 1UDXA 4BFXA 4BKQA 1XZBA 2F62A 4IHQA 3RR2A 1P81A 4QFMA 3UFXB 1CG6A 3VISA 4AP9A 1P18A 4TV8F 3DP7A 4HMOA 5IUKC 1WW2A 3N2GA 2JFUA 4LJKA 4L1KA 3AFGA 1KMMA 3N70A 4IM7A 1N1EA 3O1HB 4FCWA 2A2ZA 2NO6A 3EZ7A 4CYMA 2FSUA 2J9XB 3C5CA 4HCJA 4O8CA 3O4JA 5IEBA 1LI4A 4ZHSA 3N6XA 1CUJA 1DAKA 1LJ8A 2AN1A 1J06A 4FMDF 4JVLA 5GVRA 1EFTA 4TKUA 1A4XA 3W4KA 1R15A 4A91A 1WXEA 1KEKA 2O2EA 1I1HA 2CZGA 5KSPA 5FWYA 5B4TA 1UKEA 4DMCA 1YMQA 1KFEB 1KYWA 2AJDA 1VHLA 4KMRA 4LOKA 3DKRA 5AKEA 4H16A 4Z7NB 3QSYA 4FI3C 2H16A 1GUDA 2HRBA 2J9RA 3U56A 1DC7A 2PNFA 2Y0EA 3LXMA 3TIFA 4BEWA 5JNWA 1ZD3A 4DV5B 3BWMA 5C8XA 1T2EA 5DCUA 3PQ4A 4UVDA 3O8DA 3BQMB 1U2DA 3ONFA 1XKLA 2HV9A 1PG0A 4D02A 2G9NA 1F0YA 1AXGA 4RCVA 4NULA 3T5GA 2O0LA 2IYFA 3AY6A 5CDYA 3MFYA 1PQYA 1QMPA 3OQPA 1NBMD 4BFUA 1OFUX 4RYDA 8OHMA 3Q41A 2P79A 4D8YA 4PO1A 5AM2A 3ZDAA 3OZVA 1QB8A 3L0PA 2PS1A 3LA6A 2NZ2A 1JEEA 2WPDD 1IZ8A 5C7OO 5JNUA 1QQ5A 5T4HA 3GDFA 1HT1E 3ITEA 3N8HA 1IATA 5BN3B 1Y5LA 2IEDA 2ACKA 2ZQ5A 3T8YA 1NGSA 4INJA 1SQ6A 1G2PA 4M83A 3DLTA 1TECE 1XJCA 3VSEA 3ZU3A 3OBIA 3HE3A 5K6TA 3P94A 3K0SA 2X8JA 1WZEA 5J47A 2DF8A 2XT6A 1CD5A 1NONA 4K6FA 1MX1A 4ARAA 2REOA 4MWEA 1HNWB 1PJLA 2ODNA 3D3WB 1MBZA 2ZVJA 3ML1A 2P0YA 5I4BA 4B6RA 2ERYA 5FOUA 2GCNA 1KRHA 2P68A 4NBTA 3GAAA 1X70A 2WV9A 4W1SA 2DPHA 5DHQA 3SZ3A 3TJZA 1EXMA 1S2NA 2IP4A 1SD1A 3KEQA 1S9HA 4FEAA 4BO6A 1FVFA 2J7PA 4I6GA 2GAIA 4MVJF 3GNSA 1ZMRA 4PLYA 4ARIA 4R3NA 2VDOB 3RHZA 3A6GA 3ZWOA 1L5OA 1DMSA 1V8PA 3T15A 4AF7A 2NU9A 3EN0A 3EXEA 4IRMA 2ETXA 3M6WA 2WM8A 3AV0B 4MA0A 4DNPA 1E2JA 2QTFA 3HSKA 3HVKA 5FBLB 2EARA 5T4BA 3HVHA 4YA6A 5BN3A 1RC1A 2RHGB 1D5CA 5TT0A 4D9NA 4HGQA 4NH4A 5ALVA 1WKCA 2A5LA 3BRWA 4EJ0A 2ZSIA 1J8QA 1XWIA 2BJWA 5CAEB 1FQKA 3QQ5A 5EKTA 5BNFA 5ITWA 3MT8A 1O0SA 2CW5A 2YIMA 3IAHA 3IO5A 4ZQGA 1STOA 1MEOA 3GUVA 1NLUA 5DYNA 2QD4A 4EGFA 4Q3CA 4ZVVA 1BXZA 3K0CA 5EIEA 2O0MA 1KYTA 2FG7C 3N2YA 1VPTA 1TGYA 4U2BA 1ZEMA 2Q1YA 2XZDA 3OOSA 2HU2A 3IT3A 3SYRA 1XDZA 4D82A 1M72A 2YMQA 4E5UA 2ZYWX 4AZ3B 3UUGA 3ABOB 1E3WB 1ECGA 4Q47A 3C5WP 5FJIA 4HS4A 3HCPA 2R48A 1EVJA 4CMAA 3DBHB 5EYPB 3WQRA 3N3BC 4NFLA 1BHQ1 3OIVA 4NZNA 3VNAA 2ZJ6A 1ZXLA 4OGWA 3WKDA 4WD3A 3WTBA 3H1PA 3QKSA 1T8YA 4N0DA 1SGWA 2O14A 4IIHA 4OXRA 3ZGYA 2FW1A 2X86A 2GBGA 1WXWA 1F4PA 2Q7XA 5DYWA 3WMRA 4BY9E 2YJ5A 1E69A 5BVHA 4N82A 1V3QE 2YIJA 1XDWA 3FR8A 4I0WB 1N6KA 3Q88A 1P91A 3FBWA 3QOWA 3TYXA 4EGAA 2O7SA 1PJTA 3NKVA 3H86A 1XVVA 1JPNA 3AHHA 4PYMA 1E9AA 3NEAA 1E9EA 1ZS9A 3UWDA 2OQ2A 3CFYA 4WOJA 1ISHA 3J81A 4IZIA 2ACEA 3LUPA 4MQEA 2JPDA 1XQWA 3CF6R 3VJMA 2VP6A 3HSSA 4MPDA 3DNPA 2CWWA 1A2KC 3PT9A 2RFLA 4PX5A 3RIYA 1JSLA 1PW5A 2O3UA 1PJCA 3G85A 2RHJA 2VI5A 3N2NA 1ODCA 1Y63A 5BSWA 2PPLA 1WIWA 1M75A 3HL0A 1QTQA 3ZXYA 1EX1A 4PCLA 1T3ZA 2I0FA 1POXA 5HCNA 3I05A 4YAWA 1SXJD 3MCAA 1XVTA 1GNTA 1PFWA 4Y8VA 1KH1A 3FHOA 1IOZA 3ZE1B 3PB3A 1QRTA 2MYTA 2XWQA 3IDZA 4D8TA 2GCPA 3DWEX 3X2SA 3T06B 5I6DA 5AYVA 5FAKA 2X0RA 2M1XA 4D25A 1DEXA 2GBFA 3ENQA 2JEZA 2QVBA 3FB1A 3PNYA 4WCFC 2V9PA 4B3BA 1JJ7A 1U0GA 1NXWA 1W88A 1GZSA 4UCXA 3GCZA 1YFZA 4E46A 1U7HA 4HO1X 1LB1B 2JAOA 4Q05A 3C5VA 3MWDB 3VX3A 3JD0A 4JA2A 3G0CA 3FAZA 4GT1A 2PKWA 4MAMA 3ECCA 1DAMA 4JSTA 1N2IA 2FGKA 2O4UX 4MR8A 4DCJA 1WZNA 3AVOA 3CQ9A 3P9PA 4DBVO 3GB9A 3GRKA 2EQBA 1XFDA 4X84A 3P9IA 4ECEA 4HXFB 4BECA 4ZWNA 5BSVA 4QPDA 5KZMB 1ML3A 4MMYB 5C5EA 4HJXA 1SVSA 4X65B 4PS0A 1O6CA 2QQEA 3OQNA 1CNEA 3NYQA 2J07A 2F1OA 1GAXA 1K7EB 4LNHA 4PYIA 4PVDA 1FMFA 2PJDA 5HFJA 2X3FA 3NOXA 2OGTA 4GLBA 3T7CA 3MOSA 5TLSA 1KAMA 5THKA 1TM3E 2XGSA 2I3BA 2PZEA 1VKJA 4O5OA 2PX5A 1Y3HA 3DVQX 3GCWA 4GYYA 1UUFA 3QVTA 4JUBA 1LTKA 3KUUA 4KFRA 3GFBA 3QYJA 3MTBA 4B73A 4QDOA 1TJ4A 1VCHA 1RI4A 3UWOA 4DJDC 4QU5A 4ERXA 2AFRA 1KDVA 1T1IA 1M66A 1FTSA 1W29A 2ZI6A 1ZNYA 4M0UA 5KU7A 5I7AA 1XQ1A 4ZCIA 3KLPX 3ZDXB 4TMZA 1U9YA 1ZCAA 3DT6A 3WBKA 2ID9A 1Q1AA 3FYUB 3V8EA 4BN0A 2ASVA 5EHIA 3WQSB 5K3CA 5CW2A 2B8JA 1XEWX 4YO8A 2NN3C 2XUIA 3KYJB 3DFIA 2Z2YA 3P2YA 4FBMA 1GZ3A 3VYRB 2NMVA 1VJGA 5KJEA 2GYYA 2YYSA 3B6IA 1VI5A 4QASA 3CEAA 4NEHB 5FQNA 4TKVB 2QRUA 3RSZA 4GLOA 2FWBA 3UXEA 1TK2A 2FEPA 2X7HA 2E5LB 3P0JA 5K51A 1NJGA 3SI7A 3AR4A 2YRXA 2AEJA 4JX9A 2E4VA 1DARA 1I3KA 4Y2PA 2QN8A 1V16A 3TLCA 4AQYB 1CTQA 1DFGA 2Y9PB 3GN1A 1ZU4A 3N87A 5H1YA 1P39A 3C4VA 1OLOA 3TLXA 4QKQA 3MNFA 2IH5A 1ECFA 4BV2A 4TWZA 1QQTA 4IJ5A 4OGGA 2YS7A 4MDHA 4YV0A 2H2DA 4MV8A 2NZJA 1O9BA 1JA1A 5DX8A 3BB3A 2F8TA 2OZEA 3FR7A 5JNSA 5M04A 4O1IA 3ETCA 1X1DA 5IHXA 3K3PA 1EG7A 1SBZA 1R4NB 3O1JC 2OXIA 3GOHA 2WD8A 5K20A 2QL5A 3KSAC 2BMAA 3AF2A 3ETNA 1QVAA 1YS7A 1RLOA 3C24A 5KX5F 1E6CA 3ABQB 2AR0A 3KB6A 4LGVA 1XU4A 4KO2S 2UZAA 4GQAA 4Q19A 1XKQA 4PQGA 1V11A 4UULA 3RFCA 1WABA 2BPOA 4CM9A 5JAUA 1G59A 1G9TA 4DZTA 1SB9A 1W1UA 2GEFA 1X14A 2HZ7A 3CR7A 4NFSA 4WY8A 3ZNPA 4BVKA 1NT2A 1DBPA 2VJKA 4WKOA 3PSAA 1GG9A 1P60A 5MDHA 1PR5A 1KU0A 2JFQA 4K8OA 2XQVA 4HNUA 3RHFA 2RE8A 1WXGA 1EH5A 1ZD4A 3IO3A 4IUBS 1JPUA 3E5MA 1FLVA 1Z4JA 2GHRA 4QRDA 5IUNC 1ENYA 2IHVA 1IAQA 2KSQA 3NEYA 3DOFA 1L5ZA 4CT0A 1GZVA 3TDKA 1P4SA 2Q3JA 4D3ZA 3D64A 2PGNA 2PM8A 4UHBA 1SEVA 3K0AA 4HMPA 1P62B 1EX6A 3JQDA 4UMDA 1U63A 2DWPA 4JMPA 4B84A 3LECA 3C3BA 4R3UC 1S0UA 3CNBA 4MKFA 4UE3S 5E1BA 2O8CB 1XRMA 1JP7A 2YC4C 5LMNB 3PUYA 2ZR9A 3PF9A 2GR9A 1EZZA 5AM5A 3FFTA 4NU5A 4C0WA 3NBAA 1Z75A 1JDSA 4RD1A 3CISA 4PAWA 3KXKA 4QQ8A 2AN5A 3ED1A 3TMYA 3D6HA 3L4JA 3NKFA 3J7AC 1H9CA 4Q3EA 1JVSA 1P74A 2B0JA 1M83A 2XB6A 2X15A 1HBJA 4CIDA 3PPIA 5LJLA 2WWYA 4KPYA 1XCJA 1QO7A 2PUJA 3LZDA 4RMHA 1K3UB 1P75A 1RWVA 4JROA 4G4JA 4KWTA 4DEXA 5CLLA 1WBDA 3LWZA 1LBQA 2OCYC 3FETA 3IUMA 3WWOA 3LLUA 3CZRA 5K8TA 5C4IA 4G0NA 3WGVA 1WHTB 2E85A 3DE4X 3BJRA 2YWHA 6NULA 5H70A 2A9FA 4BE7B 2XCIA 2WD7B 1XXLA 3TKLA 5AVWA 1DUIA 5FPHA 5FF9A 4PCAA 2WD9A 4PSUA 2CLEB 1HLGA 4I1RA 4W1PA 3U3ZA 4BJHB 2BFBB 3WSVA 4MCAA 1FPMA 1X1AA 3MJVA 4Q39A 4ISCA 5DPMA 3R5FA 3V7UA 3VPAA 4EG5A 2IW1A 5DYGA 3NCTA 3P26A 1WSAA 1Y34E 4MTCA 3VPSA 5A6SB 4HUJA 2BFCA 4HOYA 4Y0VA 2QRLA 3UJBA 2ZM5A 5GADl 2QLJA 3WLOA 4Y0AA 1AZWA 2D8AA 3K35A 3L49A 4GC9A 1ZY2A 1JKMA 3L7BA 4LJSA 3UMVA 3LZCA 4DADA 4BLSA 1FFGA 2DP4E 3P9YA 4NLLA 4BGUA 4WQMA 3V32A 5KTOA 4J7AA 4M37A 3TIIA 2VXBA 1P7WA 3ZDQA 3EXFA 4KXMA 4ZDJA 3DZ8A 3HBNA 4QEDA 4KH0A 3TKYA 2ZS7A 2XXBA 4NOLA 4Y1RA 2ZIFA 4EQ6A 5KUTA 2B34A 1IN4A 4YLEA 1VIDA 4MRMA 1QRSA 4ND3A 3K15A 1UC5B 2GZ2A 4DCVA 1YHZA 2PJRA 3SNHA 4V3BA 4E5SA 4U8GA 1L4EA 3PNBA 3VHQA 5AO9A 2XQGA 4X1IA 3RBAA 4YS6A 3TQCA 4M7PA 4C7XA 3COWA 3V6MA 1DAIA 1RPTA 2BDTA 3NDJA 5KX5B 2W2KA 2JAPA 3QZUA 4UMFA 4OJMX 4I1SA 1QHFA 2OZLA 1HQKA 4QUJA 4LHWA 5MHTA 1MO2A 2W8ZA 4D41A 4YRIA 4LZPA 1HNZB 3EQZA 5SV2A 1XLTC 1YJ5A 3U6KA 1ZIOA 3PKIA 1NUUA 1SCUB 4JQCA 2JLQA 4MPJA 4PSCA 5DYIA 5BWOA 4O3MA 4YONB 2ORWA 3ZWNA 1SRQA 2X1HA 1MNAA 1JHXA 1SUCA 2AV6A 2VP3A 2EERA 3JQ9A 3PC8A 3R3XA 4FFVA 4GOXA 2D0PB 3DBOB 4F1WA 5ADVA 1X80B 2FJPA 3K0HA 4EGQA 3AEUB 3K9CA 3DL7A 5IMSA 2HSWA 4WXEA 3P2OA 5I01A 5JAPA 1WB6A 2W58A 1WQ3A 4JQYA 4F2PA 4NXMB 3AF1A 2HCFA 5FO0A 2OMKA 3EE6A 1T5BA 3SLGA 4PC6A 3PXGA 3KZMA 4LZZA 2X2EA 2XMGA 2NSLA 5DK6A 1KQ3A 2HHJA 4QOFA 1R0WA 3DB1A 1GCUA 2PGLA 2FZWA 3WGYA 3QIVA 4MHOA 3L0IB 1VJ5A 2WMNB 1KTVA 1T2VA 1VKZA 2C3YA 2PK3A 2X40A 3H1BA 3KLOA 4QUKA 4ZPXA 4I19A 4LX0A 3OF2A 5JOQA 3BAFA 1GQQA 1CS0A 1UFOA 4OI4A 2IZ5A 4YJGA 5T67A 2JCGA 5LQDA 1R10A 2CXQA 2BEWB 3X1YA 5K4HA 3N2EA 3CKMA 1RRMA 1F06A 2OGSA 2EHDA 1F2DA 4L0QA 1XQ9A 4YIKA 2JIBA 2A1UB 4L85A 1DWOA 2RHMA 3JZAA 3PDUA 2ZKIA 4AKIA 3RRBA 4DUGA 3P5SA 4DFDA 3DFMA 1OGYA 3U39A 2I2CA 1LCIA 4HTFA 4N5IX 3K0FA 1QAOA 3ZH9B 5FT9A 3PFCA 1OI3A 3GLFA 3OCUA 2C1EA 4YRNA 3LPMA 3DOCA 2GM3A 1L5KA 4CMHA 2DM6A 4GVLA 4URYR 3TO5A 4J0FA 4EMUA 4ENQA 4CL2A 4KAAA 3KZCA 4EFMA 4CEHA 1D6SA 4L9WA 1FP7A 4X8MA 3KLMX 3CX6A 4J2HA 4H3KB 3VPFA 4AN0A 4EY8A 1PUJA 5ALWA 2CBZA 4QYMA 5HWSA 3BQNB 4CIAA 3IQFA 2INGX 1QO0A 4I36A 4DUZB 4P4UA 3RRYA 3H5NA 2AC4A 3F8TA 1KMNA 4I66A 4N6OA 1BROA 1V96A 2EIHA 1P80A 2OPBA 2RH9B 1CIPA 4P3KA 3OIUA 3D6TB 3IB3A 4I3GA 4ZXFA 3UK0A 5FX2A 4IHJB 4J0EA 2E3JA 3BB1A 3F71A 3H2IA 4M8NE 4NE9A 2XA2A 1XEAA 3LOPA 4Y2QA 5CYPA 3R5JA 1O5OA 2C94A 4B46A 4GX1A 3ESDA 2ZSAA 4P33A 4Q9LA 1ISJA 3NV7A 1TQHA 4U00A 3U3RA 1ZONA 3JD1A 2VIIA 2UVPB 1LJUA 3H5AA 4NABA 2CMHA 3RVRA 3EIXA 3R9XB 1YRLA 1DP4A 3RFXA 4JEIA 2RGXA 4NMWA 2XRFA 3RAEC 4X1KB 1NF2A 4K9NA 1WDTA 3E03A 4CQMA 3K16A 1KEVA 1NTOA 2ZXEA 1CR2A 1YMUA 3H2KA 4HYQA 1Q0ZA 1L4HA 3DBRA 1G3UA 3IAFA 1N77A 2WZQA 3KVYA 4PZCA 1MAHA 4FOPA 1BMTA 4LDAA 3MLAA 1MPTA 1RCUA 3ZBUA 4EW2A 1DQRA 4YUZA 2K87A 5FA6A 3JS5A 1GTG1 4ZYVA 3K72B 1S4QA 3OQIB 1FRVA 4P0PB 2JIOA 1CIVA 3DOOA 1OFIA 3PG5A 4CQMD 5KWSA 1RP1A 4WGFA 3EA5A 1A7AA 5F2OA 1CJSA 1ZH2A 2JFVA 2JIPA 2IZOA 3LGXA 3LU1A 2LXNA 4CFZA 2OK8A 1GARA 4ZRNA 2O0HA 3C6KA 1KEEB 2TMYA 1HSZA 2Q3HA 2ZTHA 1N3LA 1ELOA 3T4UA 5A7HA 3LS2A 3A4IA 3K1AA 3NYWA 2JD1A 2X5XA 3ZKWA 3DAOA 1ML4A 1EFPB 3NIGB 5ILOA 1QU2A 3H4IA 1CEYA 1P2TA 3FOWA 1J00A 4B3HA 5EIWA 2RG1A 3DVRX 1E2BA 1E20A 1Z88A 3GLHB 4A0RA 1H8HA 1F5SA 2G7MC 3D4OA 3LG2A 2VBIA 3PP8A 4NYMQ 4NNJA 4WW0A 3BK2A 3V3KA 3VR3D 4CM3A 5C1OA 5DT9A 2AZTA 5HOQA 4D4MA 5JFGA 1IIBA 3HRIA 3N07A 3PXCX 1U65A 4G8CA 3URKA 4U7DA 1IQ0A 1UXJA 3UHJA 5DB4A 5PNTA 3K70C 4MSUA 3AHEA 2FSHA 3BFVA 2GHIA 4KQ2A 4ZDWA 1VLHA 3NJRA 5FPKA 1JF8A 5K0TA 3TNJA 3KSRA 3QVKA 5CXSA 4LBWA 1BD4A 1GSHA 2GRUA 5KTTA 4ALIA 4JXZA 1ZM9A 1U6IA 3HCRA 1Z5NA 1M8GA 3F6CA 3IEPA 4NQZA 2Q0HA 4QGFA 4C3VA 2IYQA 2Z8XA 2H3HA 4LOAA 3AEQA 1ODSA 4IEEA 3BRQA 1B8UA 4DG5A 4W8HA 3IV7A 4WN3A 2PZKA 5K0EA 1U90A 2C95A 1J2JA 3R0XA 4TLLB 4KHPB 1JHUA 3M81A 3VI4B 4AZVA 4P53A 1F2TB 4KX5A 1GYQA 1S1CA 1YB5A 4FHGA 4WFJA 2PYIA 5HK9A 4E5KA 1CP3A 4R51A 4KYTA 3ZIAA 4BAGA 5IC4A 4RA9B 3G2LA 1CJMA 1CERA 3I58A 1JKJB 4F6RB 4ESOA 3PV0A 2GDJA 4B4VA 1VFPA 5JO9A 2C7OA 2UZ3A 3VUEA 3ER9A 3KKLA 1DL5A 2MJLA 3PRYA 3BZUA 4BJ5A 4UAGA 3LY8A 4BZXA 1P0IA 3E8MA 2LV8A 2C9ZA 1W2GA 4FHZA 3E3AA 2BEKA 2GD2A 3KNZA 1IU9A 4MV0A 3MPUA 5IT9A 1XQVA 3C7DB 2HJ9A 3LH5A 1WD7A 2BGLA 2GAAA 1TFRA 2VN8A 1RZUA 3EISA 2MYUA 2OSBA 3M6UA 1UT6A 4H7JA 2CJWB 3TEJA 3UJNA 1H94A 2G04A 5KHOC 4J4BA 1M8FA 3FRJA 1IBMB 1W2HA 5K03A 2EQAA 1RAGA 1UDBA 2ATXA 3WNCA 1IUPA 1OC2A 4ZCPA 5H80A 3TLJA 2V7XA 3GLSA 2Q9UA 7REQA 2F1RA 4AVYA 3FUTA 2QTWB 2J0UA 4NCXA 2GWRA 3A28A 1M8PA 1PWZA 4UM8B 1Z73A 2PVCA 3AR8A 1NHWA 1EK1A 4RFSB 1F0NA 2ZOSA 4ZVPA 2FW9A 2ZE7A 2ZJAA 5DLEA 3TXXA 3ZD9A 3HKEB 1RIFA 1SKUA 3VNUA 1EP2B 2YZGA 3PQ5A 1GYPA 2X0EA 4MK4A 3W2FA 1I33A 3D8SA 4EG6A 2H17A 1AS3A 4KODA 4L15A 3ZOZA 4GICA 3O7MA 2Q07A 1J2EA 3KQWA 3NBMA 1U8UA 3ZWPA 5JS8A 1PZMA 2BF4A 4EHIA 2I78A 2OV1A 2H2WA 1CLUA 3Q5DA 3R6WA 4EARA 1UMBA 2X13A 2LP4Y 3AONB 1CFJA 3B9BA 5C7IO 2XPCA 4NICA 3L1HA 3RVLA 5JWRA 1A98A 3TG2A 2PX8A 3SX4A 3IRUA 1LVHA 2QSJA 4EX7A 4Z4GA 2HMTA 3C2QA 1FDTA 4RU1A 3ZHVA 3AG5A 1TZKA 2WMDA 2P8JA 1SUSA 2DAPA 3N7AA 2QBYB 2ATCA 3SYMA 3V7YA 1JKIA 3LC0A 3LPAA 3M0EA 5FR1A 1NA5A 2HN9A 4TYPA 4CWAA 4CR7A 2IX3A 4MJXA 1RD4A 1ODIA 1TTHA 1OKKD 2HUNA 3IUYA 5AT1A 1QIGA 1HYGA 1RQGA 2CNBA 2C2MA 2GBCA 2ZT6A 4G0OA 4J0CA 4XX0B 5ALXA 2A9QA 5A02A 3ZEIA 1U9IC 1TUBB 4YECA 3RSGA 5HRUA 1ONPA 2O1XA 4TM7A 1FS6A 1GPAA 1L5MA 2X22A 1XX6A 1JDUA 2YNMD 2AF4C 5ENVA 1J1IA 3HB7A 3HYTA 4V0SA 4XIGS 4FMPA 2BR5A 4N49A 4CEJB 2PL5A 2FMIA 3EH1A 1Y3AA 5A62A 3RM3A 5IABA 2I7VA 5DZSA 1GL3A 3OQ6A 1CW2B 5F2EA 2VNAA 2J4FA 1HL3A 5SYMA 4AYTA 5HR5A 3KUDA 3V4PB 4MWZA 4NJOA 2B1GA 5BQXA 3AEKA 4L08A 2JG3A 3AVWA 3H0CA 1I7LA 1TKCA 2VYCA 4GM1A 1XZEA 1J8DA 2ZWVA 3BMNB 3EJWA 1QAMA 1RRVA 2YMMA 3NLLA 1QV9A 3CVWA 4FKZA 4A8PA 1ZLYA 2BHSA 4MQBA 3LUDA 2GXQA 4EKNB 2ZT5A 4UNRA 1CQJA 1LDMA 1T2CA 2HI0A 2PR2A 5FPQA 1AVTA 1NOJA 3OQIA 4L75A 1FU7A 4D0RA 3FW1A 3Q15C 2G1AA 5CJPA 5H5JA 3T3EA 3GFGA 1OE0A 2XIJA 1NG1A 2EG9A 1CHNA 3BYZA 1QXSA 4G1UC 4NU8X 3WGUA 2QLBA 4ML3A 5GVSA 3L0BA 1UDAA 4PRKA 3UWPA 1GTRA 3KKKA 4WZBE 3ZVNA 5TMEA 3FFBA 1KA9H 2BBTA 1HZZA 2VJOA 3RHSA 4MWGA 1GL7A 4JY7A 5SY6A 1JAZA 2PD4A 3D8RA 3TRDA 5FWNA 3CLRD 4IL5A 5EWLA 4D8VA 4U7JA 4U0JA 1KERA 4AJKA 2C8KA 2C5BA 2BW0A 1OYOA 1GFWA 2A4KA 2B4RO 3PNSA 4N3AA 1YC2A 3D3KA 5JVDB 3HV0A 1WPXA 2UXDB 3ZXIA 3HGTA 4IIJF 1K0UA 3ASZA 4YRZA 1N6RA 3PDIA 3QLUA 2HU5A 1V7QA 4HDCA 4MEJA 2EATA 3VSAA 2NT4A 4BYMA 4DCGA 1HYHA 2W6PA 5ALHA 1SXJA 1G21B 1EBFA 3ORQA 3H1EA 4HEQA 4LWOA 2AJTA 4ZIRB 2WI8A 1YQXA 5EJ7A 1UL1X 3GEIA 3F46A 4QBKA 5H83A 3UGQA 2CUTA 3MBKA 2DQSA 1U0BB 4UM5A 2Z43A 3EBPA 3O91A 4EA9A 4XQGA 4O4IA 2GPNA 1VL2A 4JJFA 4X90A 5HOEA 4FYIA 4HFJA 3PUWA 4D45A 4OP1A 3IILA 2G1UA 1P9RA 3PHGA 4JD5A 3OHPA 5LQAA 4GOKA 1WP4A 1YR9A 3P9SA 5ECGC 1EB9A 3WNDA 4N5DA 5BW5A 1N5DA 3G0DA 4BB0A 3OO1A 1ZCBA 4ZC1A 2HDHA 4R1QA 5E9AA 2HTFA 2FPMA 1PNVA 3L1UA 4R16A 2VQSA 2I2WA 2NU8B 5IJ9B 3O93A 1VYHA 1PEDA 2F3QA 2ATVA 1RI5A 3D6JA 3KHKA 3OSUA 4OREX 4XYMA 1KDRA 1S8FA 2XD4A 5JROA 4YRMA 1XMIA 3CF4G 1L7XA 2QA5A 2QUIA 3T54A 1OXVA 3ESBA 1SK9A 4WRRA 1GTMA 4EVQA 2FE1A 1DXOA 1QE0A 2FLKA 3VTAA 4RK6A 3DEJA 3OM8A 4X7RA 2KBEA 5WRFA 1NVTA 2DHDA 1IQPA 5C7YA 4JYMA 3N05A 4JNKA 2C1XA 1I3CA 4LQCA 1UPCA 4UATA 3AG6A 2C98A 2HPHA