3JYLA

Crystal structures of pseudomonas syringae pv. tomato dc3000 quinone oxidoreductase
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
325
structure length
325
Chain Sequence
MAKRIQFSTVGGPEVLEYVDFEPEAPGPQAVVVRNKAIGLNFIDTYYRSGLYPAPFLPSGLGAEGAGVVEAVGDEVTRFKVGDRVAYGTGPLGAYSEVHVLPEANLVKLADSVSFEQAAALMLKGLTVQYLLRQTYQVKPGEIILFHAAAGGVGSLACQWAKALGAKLIGTVSSPEKAAHAKALGAWETIDYSHEDVAKRVLELTDGKKCPVVYDGVGQDTWLTSLDSVAPRGLVVSFGNASGPVSGVNLGILAQKDSVYVTRPTLGSYANNAQNLQTMADELFDMLASGKLKVDGIEQYALKDAAKAQIELSARRTTGSTILIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Quinone oxidoreductase
publication title Crystal structures of Pseudomonas syringae pv. tomato DC3000 quinone oxidoreductase and its complex with NADPH
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Oxidoreductase
total genus 100
structure length 325
sequence length 325
ec nomenclature ec 1.6.5.5: NADPH:quinone reductase.
pdb deposition date 2009-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3jylA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3jylA01
1YE3A 3WBBA 1OBFO 1A9YA 1PZFA 2GN8A 5KJFA 3V5NA 1Y6JA 3FCOA 5T6BA 3TWOA 5JDIA 4AJHA 3W4JA 1NAIA 3N58A 3VZQA 4DLLA 4CM9D 1HLDA 3RI3A 3PI7A 1GCOA 1I3KA 2Z1MA 3MWEB 1H2HA 5CEJA 2I6TA 4GL4A 5JS6A 1U5CA 4N5LA 3I6IA 1NHWA 2VUSA 3X2FA 4L4XA 5G0VA 4IDBA 5BSHA 2IZ1A 1U8XX 2FHSA 3KO8A 3OQ6A 4IINA 3C3XA 4WE3A 4XGNA 4N54A 3H3JA 3TOZA 5IXSA 4QO8A 3DHEA 2IODA 3RQSA 4XD2A 3VC7A 3O9ZA 2WE7A 1GEEA 1ZMOA 3PHHA 1P31A 1WP4A 3DZJA 3K2BA 4BGIA 4GX2A 1I10A 4D3DA 3ZU5A 5IZ4A 3QE3A 2J5KA 2ZTMA 4YDRA 2O48X 3AFNA 2J8ZA 4YB8A 5JAIA 1GZ6A 5F21A 5T5QA 1DIHA 1YB1A 3JQEA 4DGSA 4E33A 4BHTA 4BOYA 5C5IA 5GZ6A 2GDZA 2Z95A 1TLTA 3KYCA 4UAGA 5B37A 1UUFA 2VWHA 1H6AA 5AYVA 1R37A 1SBYA 3VDRA 4BO8A 4XWYA 2QZZA 4R9RA 1ZK0A 1ZVMA 3OJFA 3FPCA 5HA5A 2P9GA 1MFZA 2HMTA 1O0SA 1DHTA 4XDZA 5U1PA 2PD4A 4FOSA 3S2GA 2J5QA 4GQAA 4CMCA 5CEFA 3JQGA 3FSRA 1SZJG 4BKQA 5K6AA 4CMJA 3GDFA 1PJSA 2YQ4A 4N5MA 4YPOA 3RVDA 2P5UA 1FDTA 2BFPA 4RLHA 1C1DB 4XCVA 4TRJA 1EVZA 1ISHA 5DN9A 3VPXA 2X7HA 3AY6A 1MLDA 1TT5B 5DULA 4RGBA 2YFHA 2FZEA 4U0KA 5IFLA 3OJLA 1PJCA 1ZEMA 2OL4A 4BNTA 5FI3A 1YDWA 2BI7A 2H1SA 1LEHA 3LC1O 3D0OA 1HL3A 1N5DA 1VPDA 1Y5RA 4AVYA 3WLEA 1P33A 4RVDA 1ZCJA 5IDYA 3OECA 1EE9A 1DFIA 5TC4A 1WW8A 3C85A 3PJDA 4MO2A 3ULKA 1YQGA 2I3AA 3S2IA 1P3DA 3HE3A 4BL5A 5JCJD 5ER6A 5ADHA 2NU7A 4H7PA 1XWFA 4KMSA 5BSGA 2Y68A 3E1KA 1ZK2A 1JAXA 4FR5A 3UCXA 2ZCUA 4GKBA 3OA0A 4PZCA 1DIAA 1I2CA 3RIHA 4QECA 3U3XA 3MJSA 2HQ1A 1H9BA 5ER9A 1KYQA 1FF9A 2XPCA 3LT2A 4I5EA 3IP3A 1ZIDA 4LW8A 2HJSA 1QXSA 4MDHA 4YJHA 4CR8A 3OICA 3PVZA 4D3SA 2ILTA 2BELA 1HDZA 3PRJA 5KJ1A 3WLFA 4HV4A 3QWBA 5L4SA 2VUUA 3RD5A 4AJ2A 4S3MA 3JYLA 4RORA 4CM7A 2VWGA 1PTJA 1RWBA 3A28A 2Q4BA 2JAHA 4RQTA 3CMMA 1ZXBA 2HRBA 1E1MA 4IGEA 4WLFA 4RQUA 1WZEA 1EDZA 1J49A 3Q9UA 3E9QA 4DQVA 5L45A 5LC1A 1L1FA 4A10A 4K1LA 1KS9A 2FR1A 3JQ7A 4GX5A 4Z0PA 1XA0A 2G0TA 4D3FA 2Q1SA 4E5YA 2Y99A 4BNLA 1PGJA 1ISIA 3TZQA 3PJFA 1PJLA 5ILOA 4FN4A 5JDCC 3JTMA 4WLEA 1UXGA 3WTBA 4J9VA 4FFOA 5TX7A 1R6DA 1G6KA 1R4NB 4B3JA 1ZBQA 4CMGA 2HK9A 3DOCA 3AY3A 4RPKA 1QRRA 2Z1NA 5KVCA 4YQZA 2Y05A 4YQYA 3LLSA 3WSWA 4JGBA 1A4UA 3QWHA 7ADHA 1QYWA 2QZ9A 1YBAA 4ROSA 3C24A 1GUZA 1LTHR 3LK7A 4EJMA 1UAGA 1W0CA 4CV3A 1NQOA 5GZ1A 4MKRA 2EF1A 3L6OO 2J5RA 3CKYA 4UEKA 4K9DA 4AL4A 4E12A 4RZIA 1DFGA 5KJCA 4EJ6A 2D5AA 1BW9B 1QMGA 5L4NA 3R1IA 4UEJA 4RVFA 3BMCB 1P9LA 5JCXA 4WKGA 3ENNA 1LDBA 1BVRA 1YBMA 4OGWA 3L6DA 4F6CA 4OL9A 1E6EA 1Y8RA 5A06A 4LVUA 4G65A 1PL7A 4KUEA 4MPDA 1YL6A 2X9VA 3MTGA 4YR9A 5JAMA 4CMEA 1XU7A 1YOVB 5J23A 1A72A 3DTTA 4J7CA 4WEOA 3I9LA 4ZD6A 2JKVA 5ENDA 3S2EA 1MB4A 4PLWA 3KETA 3V1UA 3WWZA 1PL8A 3VZRA 5MDHA 1XCBA 4R01A 3FWNA 2DUWA 2VTDA 3DMYA 3BMOA 4B8ZA 3PWKA 1CQIA 1N7GA 3PJGA 3PTZA 3O8QA 1FK8A 4II2A 3AY7A 5JE8A 2CNBA 3K6JA 1C0LA 4WLUA 1SOVA 4MIOA 2QIOA 4OIMA 1N8KA 2DC1A 1YRLA 3PWSA 3P19A 2GZ3A 3KLMX 3E6AA 3ZN2A 3GRPA 4R41A 1X13A 4KQWA 5HS4A 5GMOA 2Q49A 2HK7A 2HDHA 2J3JA 4CQMD 1WXDA 2PGJA 3RKUA 4B7CA 3ASVA 1DRUA 4AJEA 4PFJA 3D3WA 4FFLA 3BHIA 1SEPA 4XR9A 1E3LA 5THKA 5EPOA 5I9LA 5GY7A 4GBJA 2DLDA 2J3IA 5DP2A 3QVWA 3PYLA 1L7EA 2A35A 1PX0A 4GSLA 1OZAA 1GV0A 3VDQA 3AUSA 3TPCA 5COBA 4FB5A 5F1PA 3PIIA 4CLDA 3WMXA 3KSDO 3LVFO 1PZGA 5TT0A 3LZ6A 3H5AA 5BNFA 5TJ9A 3ZNQA 1PS0A 1K6XA 3JQCA 5DDIP 3OHSX 5DP1A 4WNCA 5BT9A 1LBEA 3WGGA 1QKIA 2EKPA 2CMDA 3P2YA 1HE5A 1QLHA 1LLCA 3Q2IA 2GLXA 4Z6KA 3BMNA 4IUYA 5IN4A 3DOOA 1HDGO 3ZI0A 1X0XA 4Q3BA 1K6IA 4B3IA 4CM4A 3OFSA 4L4RA 3U49A 2VWQA 2GGSA 2C5AA 4BNFA 1PS8A 3PWZA 4DPMA 3D3EA 2CSUA 3PP8A 2ZYGA 1ZKMA 5AOVA 4Y6RA 4E21A 3WGTA 1E7RA 3ROQA 4CM8B 1YB4A 4FFMA 4L75A 2D8AA 2DUUA 4OJNA 3ZV6A 2Z5LA 1NAHA 5JFOA 1E1NA 2HAEA 2JCXA 3SC6A 2B0JA 5IZCA 1QYXA 3MTJA 4ALIA 3FNFA 4Y67A 1Q1NA 4PRLA 1XYGA 1E92A 4ZRNA 3DBLB 4QSMA 5TQVA 4J1NA 5JMWA 3VTFA 4MJLA 5CDTA 3M1LA 2GYYA 4E0BA 4W82A 4W99A 3QWFA 4FC7A 5A1TA 4RVHA 1I01A 3CE6A 1XSEA 3BHMA 4PLZA 2GRAA 3SLGA 3EZYA 4U8GA 3K31A 4J6FA 1A71A 1F17A 4W9NC 2W2KB 1W6UA 4K6CA 5TRTA 4BNZA 1GV1A 3WWYA 1PWXA 2O3TA 1MG0A 3I23A 4XA8A 3WQQA 4M49A 4TKMA 1UZNA 2CY0A 4YAEA 4ITUA 1P45A 3W8DA 1HE2A 1PQUA 1ISJA 1R0SA 2OP0A 3ZWAA 1BTOA 2JCVA 2GERA 2ZTVA 1JN0A 1DC3A 1HEUA 3KSZO 4HFNA 3JQ9A 4NJMA 4KDFA 3W1VA 2AE1A 2C29D 1VLLA 5I8ZA 4O6VA 3TSCA 4B7XA 2CF5A 3RUEA 5DBGA 2VHWA 1KEUA 2DBQA 2FSSA 2LDBA 3C7AA 3CSDA 5BNIA 1LLQA 1JQBA 2AQIA 3ZWNA 1ORRA 1ENPA 3ADOA 4GI2A 1VSVA 3TZCA 5EL0A 3ZWMA 1EMDA 2WD7B 1U3UA 4BNJA 3DAPA 4ND2A 1ADFA 3F4LA 4J16A 2SCUA 3FNHA 3FR8A 5F5NA 2D4AA 2FR8A 2FN7A 4AJ4A 4DLAA 1NR1A 4DPKA 2VOJA 1ZUD1 1UZMA 3VHRA 2E4AA 5JC8A 3BIOA 4CMAA 3EC7A 4ZQEA 2W8ZA 1A5ZA 3NT5A 2EEZA 3GDGA 3K5PA 3F5SA 2QQ5A 1LDNA 2BHLA 1OFGA 4CV0A 3GG2A 4XQGA 4JBGA 4TWRA 4DPLA 2NU9A 3RC2A 4RF5A 1P1JA 1K6JA 1LC3A 3FI9A 4H15A 4BO3A 4OXNA 5K9ZA 3V1TC 4E5MA 2HMUA 3GNTA 3ETGA 3SBOA 5L7YA 1XG5A 1M2WA 3F1KA 2EGHA 3HN2A 4WLOA 4BVAA 3JQ8B 3A06A 4EBFA 4KDEA 1JU9A 2YHIA 2NTNA 4JQCA 4XYBA 3UCEA 3DL2A 5CDUA 3ROMA 2O4CA 1ADBA 1LRLA 4R5HA 1A7KA 2R2GA 3QRWA 2NVBA 1DRVA 2JFFA 3WB9A 4J49A 1DIRA 4YXFA 1Q7GA 4WJZA 1RKXA 2AQKA 2RAFA 3WJ7A 1M66A 3JD0A 4A26A 4CUZA 1HKUA 3WSVA 5L53A 4BNVA 3WDSA 2NQTA 1DDOA 1JWBB 1H9AA 3HB5X 4CL3A 3V2GA 3WXBA 4BB5A 1C0PA 3PJEA 1O5IA 4CV1A 1PZHA 4DVJA 3AUTA 1ONPA 3ADPA 1R12A 4ZQGA 2ZTUA 4J1QA 3KYCB 1EVIA 3H8VA 2XAAA 1AE1A 4LGVA 3ZWWA 2I66A 1H6CA 4NZ9A 1ZSVA 3LDHA 4NI5A 3LF2A 3IS3A 1LSOA 1KVSA 2X5JO 1W8DA 2I67A 4IQ8A 3UF0A 1GUYA 1RPNA 1XKQA 4JIGA 3SC4A 5K6AC 2X22A 2FOIA 3MZ0A 2VT3A 3FBTA 4M89A 4DTIA 4DIFA 1WPQA 2RHRA 3QLJA 1X15A 5DNAA 1TB4A 2VYVA 1Q7BA 4CLEA 3JQBA 2E6UX 3COSA 3U5TA 5ILGA 2W98A 1TI7A 1T1RA 2HKIA 1DOHA 4WCFA 1HF3A 2CVZA 4A03A 2UV8A 4YJGB 1UDAA 3OETA 3WICA 4C7KA 2ZTLA 2VRCD 3JQFC 2X0IA 2IXBA 4OKNA 4GGPA 3MCVA 2NQ8A 4YT5A 2W2LD 5A3JA 4RF3A 4MP6A 3B70A 3OJEA 2X1HA 2ZATA 4HFJA 4GWKA 4QT0A 3Q11A 3ZW9A 3JYPA 4NBWA 2H6EA 4QFDA 1ZXLA 4L4SA 5G0WA 3AOEA 3DZBA 2C07A 2CZCA 3WGZA 1PU2A 4LVCA 4JROA 3H9QA 5HTOA 3L4SO 3P7MA 2YHUA 4FSHA 1XQ6A 1HWYA 2F1KA 2OHXA 4TQGA 1B3BA 1E5LA 1VJ0A 4CM9A 4WECA 1LDGA 2EW2A 3RC7A 5L7WA 2ZYDA 2GN6A 2FPIA 3TF5A 3ANLA 3I9OA 2H5LA 3CIFA 3TZ6A 5TIIA 3WGOA 1E3WA 3T7CA 1X1TA 4IMPA 4BGUA 7MDHA 3JD4A 4BNUA 4HBGA 1R15A 1ZK4A 5KCZA 1QP8A 6ADHA 3WGIA 4CJXA 1PGPA 2WJPA 3LC7O 3VPGA 2EJWA 4MVJM 4O59O 4FGWA 4OQYA 2PK3A 2RH8A 2PGDA 2UYYA 3JQ7B 4AJJA 1L7DA 5IDQA 1NQTA 3W4KA 2V6BA 5DT9A 1LLUA 1YDEA 2P9EA 4MVJI 1N2SA 1VI2A 2A92A 2AE2A 4CUKA 1K3TA 3PZBA 3ZZNA 3LYLA 4LCEA 4OYRA 4XIJA 4JNKA 2NTJA 1LA2A 4Q3CA 4ZVVA 3ZV3A 2HSDA 2PZLA 4IS3A 1EVYA 2R00A 1QV6A 1MP0A 4CPDA 1X7DA 4BO0A 4IJWA 2NU8A 1Q0LA 3NYWA 3ANNA 4UUOA 4NR0A 3CTMA 5TS3A 3ZWOA 1NWCA 3ZGYA 3V1YA 1X0VA 2UUOA 4EZBA 2NVUB 5HRUA 1NTOA 1BRMA 3Q2KA 5F5LA 1SO8A 3IQDB 4WLVA 2JHFA 2DBVO 3NEPX 4IXTA 3DR3A 5H81A 2VQ3A 1U3VA 4RV9A 5L3ZA 3ONDA 1HRDA 4FC6A 2NU6A 4BGVA 4U5QA 4B4VA 1W73A 3DXFA 1A9ZA 4R54A 2DT5A 3FN4A 2AEFA 1JKFA 3ZWYA 1YH3A 3AU9A 3IKVA 1M75A 1E6WA 4CMEC 3DAGA 1NQ5A 4XJSA 4Z9FA 5JPIA 1GQQA 4YRAA 1MA0A 3LF1A 1J5PA 3KYDA 1AHHA 3IP1A 2AW5A 2JAPA 3VPSA 1S6YA 2FP4A 2C59A 1DLIA 2QYSA 2VHXA 1PSDA 1YVEI 4IDAA 3CZMA 3QSGA 5A5FA 1E5QA 1M6WA 3GAFA 4ALLA 4J4BA 3U4HA 5JCJA 1IOLA 3PLNA 1WNTA 2FR0A 3WOHA 3WMWA 1LNQA 1LJ8A 1UDBA 2YYYA 2I65A 4MVJA 4O0LA 2X58A 4WLNA 9LDBA 3ABIA 3PIDA 4EITA 3O8QB 3I9KA 4PLCA 2PA3A 5TNXA 3T4EA 5I9NA 1EBFA 1E3SA 4FFPA 1BSVA 3C1TA 4F6LA 3GZNB 1Y81A 1F8GA 3GHHA 2NVWA 2J6IA 4O5OA 2Y0DA 1GPDG 3DZIA 3C7CB 3D3WB 2HRZA 4LCJA 3TRIA 4DIOA 1T24A 1UXJA 3E82A 2EKQA 5EQFA 3QVXA 4DWVA 2O3RA 4L9RA 2C2YA 1VRWA 3ZV4A 2DFVA 2HMSA 3ZV5A 1C14A 4A2CA 2J3HA 2W90A 3I1JA 5T57A 3ROKA 4OOEA 1DBVO 3AM4A 5B1YA 3JYOA 3L4BA 4NU5A 4DRYA 4H3VA 5JO0A 1H0KA 3UN1A 1DC5A 3OIDA 2C54A 3D5QA 3B1JA 3RUFA 2I9PA 2EW8A 4L74A 3UFXA 2VWPA 1T2EA 3UVEA 1RM4A 4FFRA 3BTVA 1EUCA 4YVFA 1UAYA 2NSDA 5B4UA 2AG5A 4PLVA 3BZUA 3H9EO 4IDEA 4RPLA 2O23A 5CP8A 3CXRA 1R66A 4Q3DA 4RJTA 2PKQO 2X23A 6LDHA 1IZ0A 1U9JA 4FFNA 4BMVA 1YL7A 2X5KO 2O3QA 2B37A 2XXJA 3CINA 3MOGA 3FBGA 5KNLA 1KVTA 3GA0A 2BH9A 3HJAA 4E32A 3DMTA 4PIVA 4RLSA 4Y98A 4XQEA 4CMIB 1Y8QB 1JVBA 4TVOA 3ZNPA 3RSHA 3ZW8A 1YS4A 3GOHA 4LSMA 3DO5A 4GMGA 2AEJA 2AHRA 3KEQA 2IYOA 5B4VA 4ESOA 1PR3A 1NM5A 2OO5A 1E3EA 1TXGA 4PLYA 1BMDA 3GMSA 4XQCA 3SLKA 3EMKA 3EUWA 4FJ0A 5IG2A 4R68A 1NHGA 1J4AA 8LDHA 2JJYA 3BHJA 3PQFA 1H5QA 5K1SA 3ASUA 3AI2A 3BTOA 3GEGA 3H4VA 1N1EA 3KUXA 3QHAA 1U5AA 3KYBA 1EUZA 1NPTO 1O9BA 1WWKA 4JN6B 4II3A 3VH4A 4J7XA 5A3VA 2NLOA 3DDNA 4UVEA 3WJAA 2CF6A 1VL8A 3PGXA 4AJOA 1HDOA 3JQDA 3FF4A 3NGXA 4CQLA 4EUFA 1X14A 2PGLA 1QLJA 3BA1A 3GN2A 1P1FA 1VJ1A 2P4QA 2J3KA 5TGDA 3TFQA 4Z0TA 3MJVA 4CODB 4J1SA 4AJ1A 1BDMA 1GD1O 1SC6A 4S1VA 2HMWA 4YCAA 2FRDA 3DFUA 4N18A 5CHEA 1EK6A 2CDAA 3FD8A 1CETA 4NJMB 1NYTA 4BUCA 4RO0A 4DC1A 1ENOA 1ZNQO 3K73O 1VE9A 4PLPA 4DXHA 3ZHZA 3E5MA 3HDQA 1UP4A 4PLHA 2CDBA 4LRTB 4YTEA 4E2XA 1ZK3A 2WYWA 4BQRA 2GCGA 2B4QA 3HNPA 2O2YA 5G2OA 1V35A 4GLOA 2NM0A 4CQMA 4MKXA 2DBZA 4N7RA 4RPGA 4DBZA 3RC9A 1NQAO 3C1OA 3AM5A 1DC4A 4YJFA 1HSOA 1PQWA 1HYEA 3JQAA 4ZU3A 2PWZA 1KOLA 3Q1LA 4YBZA 1G0OA 1C1XA 3QV1A 3V2HA 4B79A 4ZQBA 3D4PA 1R16A 4YAKA 3DHYA 3DTYA 4PLGA 2O7SA 1CF2O 4RDHA 1JKJA 4MOWA 2CD9A 2PV7A 1V3VA 2DAPA 2P5YA 5A9RA 3TJRA 4GWGA 2I3GA 4D44A 4CLOB 1I2ZA 1P44A 3H9GA 5EJ2A 3SEFA 5L4LA 5A9SA 3E48A 2G82A 1KETA 1DRWA 1IE3A 1OI7A 1H2BA 3JD2A 3I6QA 1LXCA 4Y9DA 1N92A 3R0IA 3Q9NA 1ZZEA 3ZNNA 5IXYA 1HT0A 1XDWA 3A9WA 3NV9A 3GVIA 1IHYA 4BGEA 4MKZA 3S2FA 4QO7A 4RF4A 2FZWA 1EQUA 1EVJA 3AM3A 4YACA 4B4OA 5CDYA 3S55A 4EYEA 1B15A 3G1UA 4ZICA 3KEOA 4E2WA 2ET6A 1Y1PA 2IZZA 2ZB8A 3DZHA 3PDJA 1ISFA 1YL5A 4IY1A 1I8TA 1BXGA 1V0JA 4PCVA 4DYVA 1FJHA 3NDJA 1IPEA 3NT4A 4MVJH 4BMNA 1IZ9A 1KEPA 2E48A 4MIYA 3IUPA 2YV2A 5FWNA 1Z82A 2Q2QA 3H5RA 2JD0A 4WEQA 4NFHA 1QYDA 4WOKA 2FPPA 1SPXA 1Y9EA 5KVSA 4A5OA 3K2EA 2HMVA 1DC6A 1GYPA 4XRRA 2X4GA 5I9MA 4FIZA 1D1TA 4UVDA 3VZSA 4EW6A 5H83A 3RC1A 3OMLA 3G3EA 4LSWA 3HFSA 4F45A 2HUNA 2Y93A 2P2SA 2JD1A 1LUAA 3AI1A 3WYBA 3UGKA 4E5KA 1P74A 5FEUA 4IQ0A 2B83A 4PZEA 1QSGA 1WZIA 4GVXA 3DONA 3TZHA 4D42A 4I9UA 5L51A 3JCZA 4XGIA 3WX0A 5HS6A 2VYNA 4J4TA 3KZVA 1V8BA 4XR4A 1B8UA 2VNSA 1N7HA 3B20A 1EQ2A 4MVJP 1D7OA 5T8KC 4BO9A 3IAHA 5G0TA 4NHEA 3WGQA 4L76A 3NJ4A 4CLRB 2YQ5A 5JXWA 1HZZA 2C5EA 4YAJA 2CVOA 1B0AA 3H5NA 1RM0A 3WYCA 1HDYA 3DBHB 5CG2A 1QYVA 1HDCA 2G17A 4WOJA 3NUGA 1F0YA 2EERA 2CUKA 2O2SA 3G79A 4Z3KA 2D59A 3M1AA 4NFSA 4PVDA 3I5MA 5AVOA 3C1AA 5ICMA 4Q3EA 4OAQA 1PS9A 1ZH8A 4YT8A 2DBRA 5TF4A 1CRWG 2X6TA 1J0XO 4KOAA 1NNUA 1B16A 2I76A 2Q2VA 3AUAA 1C1DA 3RBZA 4M1QA 4MP3A 1YJQA 1XQ1A 2X0JA 3D5TA 3F5QA 1TT5A 4NK5A 2OP1A 4DREA 4D45A 2YW9A 2QRLA 2VCYA 1B8VA 3E9MA 1JW9B 2O7QA 2XXBA 3QWIA 1K5HA 1PJTA 4GX1A 4Y8VA 1H6BA 3BTSA 2UUPA 1NXQA 3SXPA 3GDOA 4GGOA 3GPDG 5L95A 2O50A 3ORFA 4WUVA 3P5SA 1KC1A 1U3TA 4XB2A 5CFZA 5TJHA 2NADA 3ETDA 5A04A 1QV7A 2X8LA 3UKOA 4UUPA 5EESA 1UDCA 1CERA 1CYDA 1YQXA 3K96A 4W6ZA 3RUDA 4H16A 5EQDA 4IBOA 1I0ZA 1C3VA 4GVLA 2PZJA 1T2DA 4BMSA 2ZB7A 1BGVA 2AMFA 3CMCO 4Q3NA 2E82A 1YONA 4AJLA 4KZPA 2PKQP 2WYVA 5C7IO 5ICSA 3F4BA 1NR7A 3ETEA 3CEAA 1GUFA 2OBNA 2ZIZA 3AU8A 4E6PA 4PG7A 2LDXA 1E3IA 4J9UE 2P4HX 2DTXA 4LISA 2Q99A 1VKNA 2ZKLA 1F14A 4IDCA 4BB6A 1EE2A 1IB6A 4BV8A 1E7QA 1NFRA 4IQGA 5IN5A 4ND4A 5IDXA 1TEHA 5DCUA 3GNQA 3KTDA 4IDGA 1VL6A 3FNGA 4R1UA 2IRWA 3E03A 4MIEA 4IJKA 2WMDA 4I8XA 3WG9A 5JDIC 4YT2A 2R6JA 1HDXA 4ID9A 1MXHA 3HB4X 3KYDB 2FPGA 1W4ZA 2X9NA 1XLTA 3M2PA 4OOFA 4TROA 3OIFA 4B8WA 3QA9A 1PJ3A 3PEFA 3SX2A 4AJNA 5HWSA 4EUEA 3I52A 4WK6A 2Y1DA 3E5RA 1LSUA 2W2LA 3GR6A 4PGFA 1UZLA 4PG5A 3FRJA 3W8EA 3M2TA 4TZTA 5JDCA 1R4NA 5JAQA 4CR6A 1OC4A 4ND1A 3ZU2A 1WLYA 3PYMA 3UXYA 4J4HA 3V8BA 5CPFA 1F8FA 5G4LA 4NBVA 1CDOA 1PGQA 1Z74A 4GKVA 4UEOA 5ITWA 5IF3A 2PLAA 3I4FA 3GC6A 2IXAA 1HZJA 3JYQA 3RCBA 1ADGA 1NVMB 4WNIA 3ZU4A 4KWHA 1U3WA 3GG9A 3O26A 1GR0A 1BW9A 4N5NA 4YJDA 1B7GO 3BMCA 1DB3A 4CM6A 4D79A 1D1SA 4D7AA 3H65A 1BHSA 3Q6IA 1ZJYA 1Y5MA 4BNMA 1O95A 3F6YA 1YXMA 3ZWVA 5L40A 1EFLA 1C0KA 1BDBA 2DFDA 3KHUA 2ZQYA 3NDRA 1BVUA 4R69A 4QQRA 3IUSA 3M6IA 1T2CA 2QX7A 2V7PA 5DCWA 3L4BC 2QRJA 1NP3A 3ZHXA 4B4WA 3RJ5A 2DTDA 1YOVA 3OJ0A 5LDGA 4ONEA 3HDJA 4IGFA 4R1TA 4BKOA 2GPTA 3HFGA 3OQBA 5DOZA 3ZU3A 1RJWA 3JQGB 1HYGA 1KC3A 1N9GA 4XJTA 4DLBA 1KEVA 4EDFA 1ID1A 1I3LA 3VZPA 1F06A 1Z75A 3UICA 4XYEA 2HK8A 1Q0HA 3DWFA 3GPIA 3OJOA 4L73A 2EV9A 1PEDA 2Q4EA 1U2GA 1ISMA 3U4IA 3U0BA 3WGYA 1KEWA 1GYQA 3GGOA 5GZ3A 4P22A 1RM5A 2C2XA 3FHLA 4HNHA 3PFWO 3UUWA 5BSFA 1PJQA 4BS9A 4AICA 5I8WA 3GMDA 2I99A 4WGGA 3IJRA 3NKLA 4OH1A 1HDRA 2PNFA 1PZEA 3DZGA 5A02A 4P8RA 2WM3A 2ZB4A 3HUDA 2PFGA 5T64A 1ML3A 3ZNOA 4NPCA 4PLFA 3VH2A 4D46A 3RU9A 3H9UA 4E30A 4XGKA 1XEAA 1V3TA 5BQFA 2Y0CA 4I9HA 4XB1A 1U4SA 2XOXA 4XZ3A 3HSKA 1PQPA 3RFVA 1B3RA 3PZRA 5JLAA 4EI2A 4YJHB 1GY8A 4UVGA 3WS7A 5B12A 4B4UA 5LDHA 3DFZA 2HO5A 4JXKA 3GVCA 4GAEA 1OMOA 4W7IA 3TZKA 4BKUA 4G5HA 2VN8A 4IJUA 1A7AA 4UREA 1O6ZA 1IHXA 1R4MA 2VHYA 1A4IA 3GZ4A 3PHLA 1T26A 3RAJA 2B4RO 4BKPA 3FTPA 1LQUA 2PH3A 4J7UA 4J1TA 3BMQA 1NASA 3C8MA 1GDHA 2P68A 3ANMA 3K8ZA 5THQA 1MFPA 4WCDA 4GX0A 5JBIA 1D8AA 4PRKA 5T67A 5JSFA 2BGKA 4DQUA 5JY6A 1R0KA 3PHGA 3BAZA 4BIIA 2QHXA 2OBYA 3LU1A 3R3JA 4FD3A 4K26A 4NMHA 4AJIA 1K89A 3EHEA 1U7HA 5JYDA 1LRKA 5KKCA 3ONEA 1S7CA 4IPTA 3INRA 3P2OA 4PVCA 1CJCA 4D41A 1CEQA 4KUGA 5KJEA 1WAMA 1VM6A 1ULSA 3NT2A 1O8CA 4O1MA 2JCYA 4BNKA 5BSEA 1VKOA 1ENZA 1M67A 1V6AA 4YJFB 2GD1O 1XU9A 4ALMA 3JQAB 4J91A 3I9JA 2B36A 1XR3A 3NDIA 5IAAA 3OA2A 1DJQA 3EDMA 1E77A 1P0FA 1YB5A 2IZ0A 2P91A 3LT4A 4BNIA 4QFCA 1KY4A 2W2KA 2YZ7A 2PR2A 1KERA 1LDMA 1N1GA 2EP5A 4KP7A 4QTZA 4K6FA 4P38A 3L0DA 2ZCVA 3D4NA 3QP9A 4W9NA 1ENYA 3TDKA 1LDYA 1I33A 1P1IA 1I3MA 5G0UA 1EUDA 3QVOA 1SCUA 5F1KA 3WFJA 2VYVD 5A9SB 2GO1A 1DAOA 4PN3A 2E37A 4UVIA 1DAPA 3VOSA 4OO3A 3EAGA 4TMFA 3DOJA 4CMKA 1Y8RB 4ND3A 4DMLA 2EJVA 1WMAA 4NK4A 1DIBA 2PD3A 4KWIA 2JHGA 1LI4A 1BXZA 4FPXA 2OMEA 3WQSB 5KTKA 4LK3A 2AG8A 4LMRA 3KXDA 2BI8A 1U7TA 2WD7A 3TL2A 4EEXA 5EERA 4INAA 4IZHA 5U9CA 5A5EA 3VPHA 5CAEA 4R3WA 3U9LA 3ZWXA 4I1IA 4XYLA 4JP3A 4HP8A 1PJBA 2WSBA 3QIVA 4DC0A 3FPLA 4Y6SA 3OSUA 2H63A 4OKIA 3BMOB 3L07A 4CR7A 2VRBA 3LT1A 3RU7A 1Y9AA 2OZPA 1RYEA 3GUYA 2AQ8A 3E8XA 4BQPA 5TT1A 3O03A 2RHCA 4I5FA 4CMHA 4IJVA 2GSDA 2BFAA 2Q50A 3ZDFA 3GEDA 3C7DB 3W6ZA 4B3HA 2Y1GA 3GGGA 1EFKA 4NH4A 5IDWA 4NU6A 3B1KA 1V9LA 2EP7A 3F9IA 4GPD1 3UOGA 3JQ8A 4XDYA 4R16A 3UAGA 1WVGA 4XYGA 3KM0A 1IUKA 3MJCA 2A4KA 2B4TO 1HXHA 4TRNA 3KBOA 3N74A 3JSAA 3B6ZA 1LC0A 4TSKA 3GUCA 5FF9A 4E2ZA 1PL6A 2BRUA 3NTQA 1NPYA 3E18A 5AXDA 3MJEA 5CG1A 1MC4A 1FDSA 2D2IA 3W6UA 5KOIA 3NTRA 1WDKA 1MV8A 3GHYA 3VKUA 2X9GA 4NQZA 4I9NA 2PZMA 3L77A 3SJUA 1H6DA 1J6UA 1AXGA 3AWDA 3LSYA 1Z7EA 1V3UA 3BMNB 5JO9A 2Y66A 4EJ0A 1NPDA 4YEDA 4HKTA 4FBGA 1YKFA 2IYPA 1ADCA 3QVTA 4CM4B 4JP2A 2Q46A 1HTBA 2WWRA 4EEZA 3IDSA 4DBVO 3EK2A 4U6SA 3AW9A 5COQA 4A27A 3PQEA 3HG7A 1DO8A 1U28A 2YJZA 3VVBA 2ZK7A 4IDDA 5IZCC 1C0IA 1QG6A 1G1AA 5I7FA 1PWZA 2EG9A 2VT2A 2Y1OA 3KVOA 3EVTA 3A1NA 3OEWA 4Y6PA 4BO6A 1EZ4A 3G49A 3Q0EA 3ICCA 1E1KA 3PFFA 1ZFNA 3RUCA 5KWEA 4XEHA 3DBRA 2FWMX 1E0DA 1IL0A 3CZRA 2YV3A 3PYXA 1R0LA 2JFGA 3JV7A 4M87A 2CVQA 4NDNE 4A7PA 4YJGA 3S1LA 3ZHBA 1JLLA 3MWDB 4QXMA 3TQHA 1GCUA 1JTVA 1MX3A 2QYTA 1F12A 4L8VA 1E3JA 1NVGA 2EXXA 3RUHA 1HSZA 3JQFA 5CPBA 2PY6A 1NWHA 4K28A 1SB8A 2OFPA 3FWZA 3TNLA 1K0UA 3D7LA 4HX5A 3MJ4A 2V6MA 5FFFA 3S8MA 4CLXA 4BNHA 1M76A 5JC1A 5DBFA 4CM3A 4MVJD 1BWSA 1SB9A 3FR7A 4U7WA 3O38A 5AXAA 3HQ4O 1EDOA 3R3SA 4CV2A 4DMMA 4PZDA 2BMAA 3ZHYA 3WNVA 3NAQA 3JQ9C 4HUJA 1DJNA 1EK5A 3U62A 1FMCA 3PHJA 1T2FA 4PLTA 4TRRA 2A9FA 3TOXA 2OORA 4Z9XA 3AFMA 4D43A 4CLHA 1HYHA 1I3NA 3ENKA 5JMPA 2Y1FA 3WYEA 3MEQA 3ICPA 3WNQA 1IY8A 1I2BA 5H82A 1AN9A 5K0ZA 2FMUA 1ISGA 3A4VA 3I9NA 3K30A 1K2WA 3GQVA 1WDLA 1X7GA 1H93A 3D1LA 2OOSA 4C4OA 1Q2XA 4O63O 4BO5A 3DB2A 3GVHA 5HBRA 4W4TA 2V6GA 3X2EA 1LU9A 4TZKA 3H7AA 3QY9A 4J3FA 3WR5A 1DSSG 5DF1A 4LMPA 3ZCXA 4ALNA 4BNXA 3RBXA 3ZWCA 4E5NA 2AXQA 4ZA2A 4BO7A 4JBIA 2PD6A 4OSOA 4E13A 1B2LA 4GH5A 1UR5A 5COAA 2DPGA 2ZB3A 3CH6A 4P4NA 4HY3A 2DU8A 4NG5A 1KY5A 4PG8A 2B5WA 1T1SA 4RCVA 1ZEJA 4URFA 4D0RA 1CIVA 1RYDA 1PGOA 2A94A 1XIVA 1DFHA 2YDXA 4ND5A 4MVJE 5A9TA 2YUTA 2YHIB 3I9MA 1TVEA 2YY7A 3PLRA 4YA6A 4IZIA 2O4UX 4J0FA 1O89A 1HLPA 4P4GA 3RBVA 4ALJA 4M54A 1OAAA 4XYMA 2ZJ0A 2NVUA 3GFGA 3I83A 3K92A 1I24A 4W7HA 3HN7A 3GT0A 1XELA 5G4KA 1HE3A 2OUIA 1ULUA 3G1TA 2C0CA 1EEHA 2Y67A 4NBUA 1PJ4A 1SAYA 3NRCA 5KVVA 4IXWA 1GQYA 3PHIA 3T7EA 2W4QA 5KJ6A 1VJTA 3VPFA 4TRMA 2IEDA 4LRSB 3RASA 1JKIA 1YGYA 1X1EA 2EGGA 2YFQA 4OXKA 4UULA 4ZN6A 4G81A 2PH5A 4J90A 4XKJA 3GFBA 1FDVA 5A4DA 5F1OA 2O3UA 1I30A 4J0EA 1AXEA 4DQXA 1MUUA 5FYDA 3LT0A 3RFXA 4YT4A 1DHRA 3H2SA 5KKAA 3GEMA 3RUAA 1YBVA 4WPGA 2GUGA 1ONNA 5DZSA 2D0IA 1N9GB 2NNLD 1GYRA 2VHVA 3DBVO 3H9JA 3JQBC 4U6QA 5I7SA 1LRJA 5EMHA 1JVSA 5BNTA 3NGLA 3QVSA 4OQZA 4RPHA 4WCFC 4QEDA 4FJ1A 3QJ5A 3F46A 4UUNA 4M55A 2CFCA 2RIRA 4RF2A 4WCFB 2O3JA 2DQ4A 3HDHA 3OH8A 4R1NA 4IIUA 3LC2O 4Z0HO 3ZH2A 3SJ7A 4I5DA 3WIEA 3ITDA 2ZQZA 2Y0EA 2VNAA 1MXFA 3PDUA 4XIYA 3GZNA 2QG4A 1KVQA 1UP6A 1T2AA 2NTVA 2Y1EA 1AGNA 2F00A 2DM6A 4L0QA 2GZ2A 5CDGA 3WGHA 2DVMA 2NACA 1GL3A 3JQAD 1UXKA 5EINA 1E6UA 4CL8A 1UXIA 2HU2A 3G17A 3JD1A 1CQJA 3AOEC 1DIGA 3DZKA 3L9XA 4R1SA 3NTOA 3UH1A 1OOEA 1GU7A 5CDSA 2BF7A 4XRGA 2WTBA 3GH3A 3RUIA 3HWRA 1NFFA 3IIEA 4RVGA 4IMRA 3L9WA 4FCCA 3EZLA 1D4FA 5DOVA 3EW7A 1YQDA 3IOYA 4HFMA 4OMUA 3U4DA 5JW6A 1XGKA 3H3FA 4E3ZA 2RCYA 2X0NA 5I7VA 4OM8A 2PKRA 4NBRA 2C7VA 5LCXA 2VOEA 1SOWA 4R4JA 3VH1A 1VC2A 3LQFA 1QR6A 4BO4A 1UP7A 1E3WB 4JK3A 1R4MB 2DKNA 1KIFA 3HDYA 4OHUA 1Z7BA 4R9SA 2UVDA 3W8FA 5MGBA 4EUHA 3BMQB 1P0CA 1HETA 2HCTA 2IE0A 1U2DA 2TMDA 2AEMA 3W4IA 1EBUA 3GRKA 4B7UA 4MVJF 3QWAA 5DCYA 1P1KA 3OF2A 1UXHA 4ILKA 2H9IA 4CMIA 1Y8QA 2BD0A 4QX6A 1B26A 3GK3A 3ZWBA 3OEYA 1PIWA 2WYUA 2HJRA 2R00C 2G5CA 5KVQA 4KUHA 2QW8A 1NBOA 3AUUA 1GFSA 1Y7TA 4BNGA 2I5PO 4DYDA 2ZYAA 4Q3AA 1U1IA 1D3AA 4NBTA 1FXSA 1X7HA 1U4OA 5L9AA 3EYWA 5L7TA 3KV3O 3OP4A 1U8FO 3NJ8A 4E31A 3KSUA 3IC5A 5A05A 3BTUA 2GZ1A 5G0SA 3TL3A 2VZ9A 3GGPA 4OSPA 2PZKA 3I3OA 1HE4A 1GZ4A 2JFHA 4ZGWA 3QQPA 4KTTE 4OXYA 4JJIA 2GR9A 2B5VA 3GVPA 4J43A 2VUTA 2FSVA 2NWQA 4R5MA 3ROPA 2BKAA 3TN7A 1DLJA 1WDMA 4NFYA 1BXKA 1GPJA 4XX0A 3ON5A 1NVTA 3D4OA 1LSSA 4BNNA 3GAZA 5U4QA 2VYND 4RVSA 2DTEA 3LLVA 4RVUA 3IL2A 1IPFA 4I5GA 2VRCA 2EHDA 4F46A 1P77A 1WMBA 4TVBA 4UUMA 1AUPA 1NX6A 4ZQHA 1YWGO 4ZRMA 5ES3A 3OM9A 2Q1WA 3KLPX 2X5OA 4KTVE 4J2HA 3JQ6A 1AHIA 4FJ2A 1ZO8A 3N7UA 4ZQFA 3K9QO 5BR7A 4RZHA 5DBIA 4DIBA 3HHPA 2BFOA 1GQ2A 1E1LA 2BGLA 4GMFA 1I36A 3CUKA 2OGUA 1LQTA 3AI3A 1FDWA 4NIMA 2D1YA 2AA3A 5AQ1A 4KQXA 3H6KA 2GF2A 4DA9A 4M86A 3IMFA 3T4XA 3O4RA 4HFRA 3RWBA 1SNYA 1ZSYA 4CM5A 3GNSA 1T4DA 1KVUA 3WFIA 3NX4A 4CLOA 1XHLA 1KBZA 3PGJA 1LDEA 1YJ8A 2QRKA 2OXIA 4J2OA 3PXXA 4AFNA 3MJTA 4R3NA 3TFOA 4HWKA 1B8PA 2TMGA 2D5CA 1SMKA 2C7GA 1LX6A 4F3YA 4IIVA 1CWUA 3PQDA 4PG6A 4Q9NA 4FQ8A 4R51A 3SVTA 5JY1A 2WD8A 4RPJA 2Q45A 2UDPA 2HLPA 1G0NA 4E2YA 3ITKA 4A0SA 2IEBA 2Q1TA 2B69A 3V2UA 4CMBA 2O3SA 2WE8A 4JLWA 4NNJA 2YDYA 1ZJZA 3AOGA 4Q39A 4GLLA 1ONOA 2WDZA 4E5PA 5CEEA 2BLLA 2YV1A 4IS2A 1IULA 4XQ9A 3VKVA 1QORA 2C20A 3RKRA 1JDJA 4MINA 2X0RA 4G2NA 4GSKA 1DPGA 4CM1A 2BFMA 3ST7A 4YWJA 1DEHA 2RBEA 5B4TA 1Q7CA 3IKTA 1ZMTA 9LDTA 1H94A 3EVNA 4MP8A 2JD2A 3VVCA 1VL0A 5ITVA 3JYNA 4A73A 5TLSA 3DMTC 5KIAA 1I32A 4PG4A 1GZ3A 3FTNA 3QW2A 1BG6A 2DPHA 4ALKA 1O94A 2V6FA 3KRTA 3DEYX 4RDIA 5F3RA 3DBRB 3D64A 2D3TA 5AXBA 1I5RA 2E49A 1Z6ZA 4AJPA 3U4CA 1GADO 3E9NA 1GAEO 1E7MA 1E7WA 1LSJA 4NJOA 5EIOA 4YRDA 2FY8A 3F3SA 4HNGA 4FOOA 1B14A 2GNAA 5EN4A 3GF4A 1TT7A 4TKLA 1LLDA 1T4BA 2VZ0A 1PGNA 2X86A 3H2ZA 3DAFA 5FI5A 4HADA 1GTMA 2EKLA 4CLRA 3WQRA 5T8KA 3ZWPA 1MG5A 3DC2A 1YO6A 4AJKA 4DUPA 4YYZA 3DBHA 4CQLB 3OBBA 3F47A 4RL6A 2UAGA 1VSUA 1JAYA 3KB6A 4FW8A 4JBHA 1TA4A 4E4YA 2GN4A 3UW3A 3WTCA 2C82A 3VH3A 2Q1UA 1ARZA 3A14A 4CM8A 3IJPA 3GY0A 3Q3CA 4BNWA 4YRBA 5C3MA 3PPIA 2NUAA 2VZ8A 2VHZA 2ZJ1A 4HXYA 4FS3A 1GEGA 2VTEA 4BV9A 1JA9A 3EY4A 3DHNA 4Z9YA 5AXCA 4IDFA 2IDZA 3GLQA 4BNYA 3WBFA 1JWAB 4ZHSA 3BYZA 4UVHA 4CQMB 1A27A 1NFQA 4MVJG 2GN9A 3DBLA 3AJRA 5ENVA 3F1LA 3L6EA 2Q3EA 3WIDA 3OIGA 1PJ2A 1PR9A 3HZZA 5IJZA 1Z73A 4I08A 4QUKA 2AQHA 1Z45A 3INGA 3MOIA 1C1XB 1OC2A 2JL1A 3VAZA 4BO2A 4U0JA 3AK4A 3B1FA 3DQPA 3GN1A 4BKRA 1P1RA 3RROA 4CUJA 1KVRA 5C37A 3HADA 4M8SA 1DXYA 3R6DA 4X54A 1ZW1A 2GASA 3RFTA 3OQ1A 4IM7A 2P9CA 4FDAA 4D0SA 2POQX 4YAIA 4JX8A 5C7OO 4WASA 5A03A 2G76A 3ONFA 5JYEA 2V65A 4YAGA 4JCOA 8ADHA 1UJMA 1Q0QA 3G0OA 3BXXA 5HM8A 2BGMA 3EGOA 2B35A 3UHAA 3VTZA 4C7JA 5C7LO 3DZFA 4P4LA 2CDCA 4EGFA 4BO1A 1ZSNA 2EWMA 3PK0A 1UH5A 2RH4A 3JD3A 1SEVA 4JJGA 5G4KB 1IYZA 3CPSA 3FNEA 3GVXA 1ZK1A 3I4CA 3INTA 2XF8A 4JJFA 1E7YA 1M6HA 1RM3A 2PTGA 3STHA 4AG3A 4DL9A 5I7EA 3U09A 1T25A 2EIHA 3UCFA 5JAZA 2Q2WA 5JNLA 2NV6A 1MC5A 3RJ9A 1QYCA 2Y1CA 1BXGB 1E7SA 1FDUA 2WEKA 4FGSA 4Z3DA 4LN1A 5TSDA 1MGOA 4ZJUA 3KOUA 1P1HA 2G1UA
chains in the Genus database with same CATH superfamily
1GPH1 4DNPA 1OBFO 4B9AA 2GN8A 4U9IS 4Q4HA 3FCOA 5JDIA 3K0SA 1LVHA 1POXA 2GFIA 4AJHA 4WINA 4JI2B 4BRWA 3VZQA 2Y6UA 4JQYA 1IM5A 2A5JA 3RI3A 2YMPA 1I3KA 2Z1MA 3OJXA 3PI7A 1UZAA 1V37A 1QQTA 4BTVA 1SC1A 5JS6A 3CW9A 3EQ7A 3I6IA 2OGWA 4WA8A 4MMYB 1JIJA 5JNSA 2DKFA 2MSWA 4ZCPA 5EJ6A 3X2FA 3T5CA 3QKRB 4MHSA 3CURA 4IDBA 4ZMSA 4FDLA 3MILA 4YP9A 4QVIA 2IZ1A 4KQMA 5IP5A 5HTKA 4R81A 4AG5A 1U8XX 4C08A 5LQRA 1T8TA 4OJTA 2QKYA 4IINA 5TXGA 2YVAA 1DWUA 4G41A 4L4ZA 2EZ9A 4XGNA 4UPDA 4O8CA 1DBRA 2M6KA 3PDIA 1SXJB 1WPGA 5CX1B 3GAAA 5C1IA 4RKRA 1I7NA 3K72B 3TQTA 1Z4IA 1WHTB 3UT5B 5BYJA 3G9XA 4FQ7A 5AKKA 3VYRB 3W7VA 5FWDA 4DG8A 4D8UA 3ZHCA 3D6UA 1QCZA 4YY3B 3ZHSA 4XVHA 5CLQA 2O48X 3GUUA 4V1CA 3MA0A 2JGJA 4QYXA 3ZZMA 2H0RA 2KLBA 5F21A 1A2BA 1I6WA 5T5QA 1R7RA 2HWWA 1JDBB 5FV4A 1USIA 3DGEC 3AHJA 2GDZA 3CE9A 1A95A 2Z95A 3HNRA 4C7VA 5LR6A 1UUFA 4HGOA 3QELA 3E22A 2HR1A 4R2JA 4OU4A 4RFSA 4DDKA 3I01A 4MYCA 3EFOB 1SBYA 3SX0A 3FZEA 5FTWA 3VDRA 4BFVA 1GWNA 1GTRA 1WCWA 4R9RA 5AVQA 1A9OA 1ZIPA 3FPCA 3PNVA 2HMYB 4J0QA 4RCZA 5HA5A 3SSAA 1OV6A 1MFZA 4QUEA 4BPBA 3PFNA 3UHJA 5J2UA 1O0SA 1DHTA 1FFHA 2VHUA 3OLVA 3QKUA 4JL5A 1I7LA 3Q7SA 3DE7X 4N7JA 3S2GA 5BP7A 3FMPB 1SVIA 5CEFA 1ODSA 4A0RA 3W5AA 3FSRA 3KZMA 3N8IA 4HWPA 4W5TA 1SZJG 1RC0A 2FHPA 2Q7DA 4CMJA 1YK1A 5E1BA 1W9MA 3GDFA 1RPZA 3R9XB 2I6GA 1W88A 3IXMA 4N5MA 3RVDA 3L7CA 2BFPA 1U2DC 3AW8A 1C1DB 2VG8A 2ZUVA 1CC1S 4TRJA 4B1FA 3GEHA 3ZOKA 1ISHA 4MMZB 5DN9A 2PYDA 3VPXA 3AY6A 1MLDA 4JBLA 3BCRA 3DYIA 3G7UA 4M60A 4P35A 2FZEA 3K9NA 1HEYA 3N76A 4TLAA 4DT1A 1J39A 5A5DA 3ZK7A 1KZGB 2OL4A 4BNTA 5IF9A 1Q83A 3JQRA 2BI7A 1LEHA 2I2DA 4HB2A 2B82A 3LC1O 4HD8A 1MW9X 1HL3A 3MMSA 4L8FA 4N7MA 1E5TA 3CLUD 3UO8B 4G1EB 2RHOA 4MKFA 3E7FA 1EE9A 1DFIA 3QUSA 5TC4A 1WZNA 3PC8C 3WYNA 4RV4A 3HYRA 3PJDA 4MYTA 2DYKA 3HXKA 3RADC 1P3DA 4P2BA 4RC9A 2VBFA 3F6RA 3W06A 4C6TA 1VI6A 2NU7A 1XWFA 1G3IA 1F0KA 5DHPA 3VPCA 3L1UA 1LW7A 2XD9A 4NAHA 2BFCB 2G0AA 4FZRA 1KDYA 4JSTA 4DCUA 4KWEA 2IE8A 3OCVA 4N9QA 4MCAA 3DE2X 2C4NA 2LW7A 4PICA 5HSGA 1ZRNA 1P2TA 1Z4JA 2YXNA 3IKMB 4PHGA 5ABPA 4D6YA 1OUMA 1YS2X 4DLXA 2P2CA 5CFMA 4HBZA 1ZIDA 4YJHA 3OWXA 3D6JA 3Q3GE 3VR5H 1G1MA 2AX3A 3IUJA 1AGRA 1U1CA 4CF5A 3KFXA 1G5FA 2AVDA 2ILTA 5FOWA 5JSZA 3KOOA 2DERA 3PEYA 2BELA 2GEUA 4B80A 3MINA 3DAYA 4P0PB 2ROQA 3WLFA 3U6BA 1OASA 4G5RA 4PZZA 4JEHA 4HV4A 5CA0B 2KB0A 4YRQA 3WYGA 3VR4D 3VX4A 4AJ2A 1SXGA 1VQ1A 2ZAGA 3OPYB 1SIOA 3ZXUB 4RQTA 1V7CA 1N2OA 3FWPA 2V7WA 1E1MA 4US1R 1SHJA 2I4RA 5JASA 1J49A 3AY0A 1WLSA 3INYA 2FFBA 3A3PA 1DC7A 3GXBA 3MCZA 1RXEA 4C03A 2FW6A 3K0CC 3L40A 3R7NA 2IYYA 1Z6QA 1VI5A 2O0MA 2G0TA 2GEJA 5SY9A 3VC2A 3N53A 4D3FA 3IPAA 1E2BA 3IQHX 3K2IA 3UMGA 4BNLA 3ZG6A 1ISIA 1M33A 1W75A 3TZQA 3NBUA 4FNGA 3PC7A 3MW8A 4X71A 3RRYA 2RIPA 3HCCA 3C3YA 3ELUA 1I80A 3M9WA 2QYOA 4FN4A 3EUFA 4C87A 1VGQA 4G8CA 4WLEA 4MDEA 1UXGA 4JB0A 4ZKEA 5L3SA 5DV9A 1CT9A 1X8KA 3K9FC 1BMFD 3OKAA 4Y6OA 4Q7QA 4XVUA 4A92A 1R4NB 1NN0A 3DYBA 4B3JA 2O8DB 2XZDA 3S5UA 2ZS8A 3IXLA 2AFHA 1QRRA 3PVSA 2BMDA 3NUQA 3OFND 2CCGA 2QL7A 2XGMA 3NI2A 4G2TA 1X94A 2OZVA 3HYLA 4JLKA 1E1YA 4YQYA 3TUJC 1DARA 2M6RA 3OEEA 1WCIB 4YO7A 1S9DA 3C24A 4QNRA 1LTHR 3LK7A 2EQAA 2FPWA 5HOQA 2JHAA 4CV3A 4R8RA 3KWLA 1XPUA 1RAGA 3CKYA 2JB9A 3WKCA 4AL4A 1YRYE 4E12A 4PZPA 3ABRB 3EVBA 3B9RA 1RLTA 3EASA 4I4CA 1BW9B 1U7XA 5DM0A 5HKKA 4RVFA 2R1UA 3BMCB 1SUEA 2BE7A 2OM2A 3DEJA 3UV3A 3HMKA 5JCXA 2V6IA 2G40A 2GPBA 1A96A 3ENNA 1TL7C 4LDQA 1XCPA 1YBMA 2ZUCA 3L6DA 4KITB 2G67A 3PGKA 3TW0A 1FZQA 2VYFA 4DY6A 5IX8A 5A06A 5HKOA 4LVUA 2W6IA 2C0PA 1U8YA 2X9VA 2PX6A 4UFNA 4KO4S 4EHDA 1RNLA 2XCRB 2NT4A 2AOXA 4DJAA 4YR9A 3ZCVA 1CQXA 2Q0QA 1XU7A 2HPAA 1YOVB 1BE6A 5K6TA 5JAPA 3NU1A 5E4JA 1XF9A 3HKDA 3DTTA 4YCJA 4WEOA 1AK9A 2C88A 3UXEA 2BHTA 4URUR 1HRKA 2XNKA 1VP3A 2Q6TA 3N9IA 5KTSA 4NPHA 1HT3A 2BFBB 1KS2A 1XDGA 1F2TB 2JDIA 4JLVA 3MWYW 3V1UA 4K5QA 1V71A 2ZR9A 3LA8A 3VZRA 1XCBA 5J2TA 2PRYA 1QFXA 2JAOA 2NAFA 3TRJA 3DDWA 3DMYA 2DWOA 2JJ2D 1CQIA 2QW1A 3PTZA 2C42A 2CNBA 2JEYA 2YJGA 1SOVA 4OIMA 3WAKA 1DJPA 3AF2A 2JLSA 2RHGB 4U2KA 2I2XB 1AMUA 3OX1A 3M70A 1EDBA 1I6MA 3PWSA 3P19A 3UANA 3VC3A 3LX5A 1RJ9A 3WLMA 5FP0A 3KLMX 4K9NA 3RT9A 2ORYA 1YMQA 1B00A 1X9HA 1YCDA 2P3QA 3SXUA 3ZN2A 2ZPUA 2H31A 3OZIA 5GMOA 2Q49A 3P0EA 1OH7A 4JDUA 1GZHB 1FVXA 3OQMA 2BH2A 4FT2A 1OVMA 1Q2UA 4AJEA 1KORA 4M3NA 4FFLA 4L57A 1Z2PX 3UOWA 1U02A 3SEAA 5EPOA 2QY9A 3FFTA 3MMXA 3MM4A 1WDWB 2DLDA 3QA3E 4JOQA 1L7MA 3QVWA 1NIJA 4OFWA 5LN1A 1P9RA 4X62B 4MGHA 5K4HA 1OZAA 3G85A 1GV0A 1P6UA 3VDQA 4WXHA 3LS2A 3EAQA 5EJ4A 5HKAA 5JANA 2EKBA 3GLHE 4I8IA 4CLDA 4X66B 1ACJA 3KSDO 4JCCA 4PX5A 1PZGA 4RL4A 1N2CB 3LZ6A 4PSDA 4OHKA 5BNFA 2WPDD 5EWJB 1XYVA 4PAQA 1GHTA 2ENWA 5DP1A 5H4HA 3FETA 3EIFA 1LBEA 4UTZA 2EKPA 1V11A 1VB3A 5ALMA 4NBKA 3VDXA 2F8TA 1MVOA 1L5SA 1QLHA 2ZRPA 1T3TA 3DDOA 3HA3A 3R5FA 2KQUA 4R9UC 1U90A 5G40A 4U7GA 3X2SA 4DJDC 4AROA 5BXQC 4Z4HA 5IHXA 4LPSA 5IN4A 1NLYA 3DOOA 1DAMA 1V7PC 3AFGA 3NBFA 5ENZA 5JEDA 4MGIR 3FE2A 1F8UA 5CDHA 1X0XA 1W59A 2D1SA 3KR1A 4D0GA 1E2DA 1K9VF 1NW8A 2VWQA 4AMYA 1TA0A 2C5AA 3WI7A 1PS8A 1WUYA 3D3EA 4QBIA 1ZKMA 3BS4A 1FTQA 2FSUA 3CRVA 3EY9A 5AK5A 5FHQA 1MB0A 1J25A 5E6RA 3WDKA 1SVWA 1P80A 1I4EB 3KAPA 3IHWA 1YR2A 2Y2VA 4AXBA 1WPXA 4FFMA 4PCAA 3IB3A 3V8EA 2MSLA 3WVNA 3KDPA 2YTZA 1NAHA 4O4IB 4ZI3A 3IAAA 2HAEA 3DUWA 3SR3A 2B0JA 2VR1A 3CNHA 3FMOB 4UMDA 5IZCA 3NNSA 1T3GA 1ELOA 3DBOB 3WL5A 4RZUA 4Y67A 1KDZA 5K0FA 3R8FA 4ZRNA 4BC1A 4EUNA 5TQVA 1N2IA 2B20A 3H9CA 4J1NA 5JV5A 1DI0A 4MJLA 1JAIA 2GYYA 1RBMA 2ZJ7A 1SVNA 2ZUSA 1ZI8A 1P0QA 4W99A 3L8HA 4GM1A 4HDKA 1DKNA 3NOVA 2DGDA 3MWDA 4G9BA 5ALYA 5KNBD 1ZLYA 2ODNA 3CE6A 1XSEA 2HCBA 3SLGA 2GRAA 2J4CA 4BZPA 2ZIFA 1E58A 4U8GA 3K31A 4P80A 3RS2A 1NC3A 2GBGA 2Z9DA 1Y3BE 3UQYS 2Y9PB 4EA8A 1NNLA 4WADA 3WWYA 4UTRA 2RARA 3F5FA 1RAFA 5EZYF 2WOJA 2ID9A 3QFCA 4QOHA 4D9HA 1V6SA 3IQWA 1EHIA 3OP1A 3AERB 1WKVA 1FUKA 5ALKA 5EXSA 5EJ5A 1SCUB 2PMFA 5AUNB 1WMSA 1RPJA 1HE2A 3VNAA 1RBZA 2IQIA 4N03A 3AR9A 2VJBA 5A5GA 4MUFA 1EWTA 3CO0S 1TW2A 2ZTVA 3A1WA 3Q9LA 3X1KA 1HEUA 3IIKA 3KSZO 4RK4A 3JQ9A 2MHCA 4FCWA 4K40A 3CB4A 1B0UA 4NJMA 5ED0A 3T54A 3W1VA 4B7XA 1IZZA 4KSYA 5J40A 4L15A 2GZRA 1JHVA 1O2DA 3Q87B 1K06A 1DIOB 2XDQB 3CLUC 5DBGA 3SJZA 5JNUA 4EKGA 5DPMA 1TD1A 1T5DX 3I8OA 2ZBQA 4MV9A 2YYAA 5DB4A 3VKGA 3D5EA 4L5JA 2WD7B 2UVPA 1HGXA 2CJYA 2J4FA 2BF4A 3DAPA 4ND2A 4HMOA 4XIIA 2DETA 4J16A 2SCUA 3FR8A 3CF2A 1FU4A 3ZI4A 2FR8A 3F8TA 3R77A 3FSGA 2V7TA 4JELA 1ZUD1 3IILA 4MXDA 3LD9A 1MU0A 3PR3A 3SF8A 5F2KA 1KFEB 2YASA 3BIOA 4DIDA 4JVNA 3W79A 1MJNA 3EC7A 1JH8A 1QO0A 1KH1A 2R87A 2W8ZA 2XZPA 1J8FA 3GDGA 5DHUA 1NV9A 4XEUA 5JARA 2WT4A 1J0AA 1GUBA 2P65A 1H1LA 3I6BA 3FTFA 2R2AA 2W6CX 4HK4A 3C8ZA 2WZCA 1QNFA 2NU9A 1P1JA 1K6JA 2O7RA 2JI9A 3DLTA 3GEIA 4H15A 4YX9A 4PRZA 4OXNA 5K9ZA 3V1TC 4E5MA 3NKFA 1GG8A 5KHAA 2IW1A 1E3QA 2CHVA 5KS2A 3BEDA 4LBVA 1M2WA 3F1KA 3I5UA 1PJ8A 5EZ5A 3JQ8B 5HF9A 4P7BA 2YHIA 2NTNA 4JQCA 5CDUA 1T9BA 1QVWA 2A86A 2YCLA 4MWTA 4PTZA 3W8NA 1YVUA 4TM7A 3UB4A 3L0PA 4PAMA 1A7KA 4J76A 3G68A 1E1DA 4DV2B 4Q1CA 1DRVA 3WB9A 4YXFA 3I92A 1RKXA 2WP8J 2A6PA 1E2LA 3JD0A 4A26A 4KVFA 1HKUA 5JD3A 5L53A 3K5WA 4BNVA 1A8IA 3ZVKA 1GPWB 1WEKA 4XSHA 1KQPA 2WWHA 3DLPX 2IKQA 2VAVA 4BB5A 2XH8A 5EKTA 13PKA 1O5IA 1SUFA 2IGBA 3HL0A 4IWYA 1TYCA 4C78A 3P96A 4XDGA 5AVXA 4N0MA 3MIIA 5CR9A 1G8YA 1OLUB 4B3SB 1SY7A 1C1YA 2VPWA 4PPYA 2HLDD 1E8NA 2I6FA 3TLGB 4JJKA 3UJDA 1IXRC 2V7BA 3CU5A 4LTMA 5HUQA 2H1OA 2HDWA 2I66A 2HSGA 4EF4A 3NKVA 1CY2A 3VVLA 1Z5NA 4L7QA 2J0VA 1DX4A 2R7AA 1P3Y1 4NI5A 4W5OA 1LF0A 1Z68A 3O90A 1CZHA 2VF5X 3BD8A 2C9BA 1TTQB 1LSOA 4QUHA 5TQJA 5CM8B 1GUYA 4YRTA 3SC4A 1X80A 1X38A 2C2GA 3KPJA 2NGRA 2X22A 1DO2A 3Q40A 3O3MB 3MZ0A 4GR4A 1Y1KE 2VT3A 3FBTA 3G5TA 3L6BA 3SZLA 4DAOA 5JJCA 1ADYA 1O0CA 2Z9CA 3RGGA 1G3MA 4AUNA 3DOHA 2RHRA 1Q57A 3NWBA 1W88B 2IK8A 1TB4A 1Q7BA 1DTEA 4XD7D 2FZLA 3T3PB 3I2KA 3GUHA 3JAKA 4IHJA 4XIGS 3OCYA 2VK8A 1T1RA 4FHFA 4B4KA 1E64A 3C8UA 5TQ0A 4LNAA 3VRHA 1UK8A 5CBPA 1QIHA 3WNDA 1B6TA 2Z2XA 4JUBA 2AWNA 1XVAA 1C9MA 4DMFA 4EP1A 1DTWA 3COYA 4OI0A 3VHXA 1EFUA 4C7KA 3SR0A 2WK1A 1BE0A 5AT1A 3JQFC 2J33A 2X0IA 4LF7B 3ZGXA 2CK3D 1P2SA 2X8AA 3KR9A 1AQJA 3MBKA 2XXAA 5JATA 1D2EA 3NASA 3S6JA 1RKVA 3WWEA 4DJTA 1W35A 1LF5A 1OGJA 2HCJB 2NTEA 3N2ZB 2W2LD 4JP8A 4UTXA 4TQAA 5A3JA 2MSNA 3KEMA 4F2PA 5G02A 2I1LA 3K15A 2AUMA 3G2JA 4HFJA 2P2DA 3Q11A 2DCMA 4ZYLA 3QMMA 3H17A 1QGZA 1B74A 1XEFA 2GCIA 2R66A 4JYPA 2E5LB 1QGDA 3ROEA 4D02A 5HZMA 2JG3A 2D7DA 1HO3A 2C07A 3WGZA 2W6JA 4GRDA 4JROA 2I8LA 3H9QA 2F1OA 4IXDA 3FDZA 1ZGZA 2YHUA 4FSHA 4N6NA 1AB6A 2CZQA 2F1KA 3MS7A 4LWQA 4TQGA 3RNLA 5LU9A 3IURA 3CJQA 4GICA 4ER5A 2HK6A 3RS5A 4UNRA 4ZO9A 4WECA 1JQEA 1LDGA 2EW2A 3RC7A 2ODAA 4RANA 3WGUA 2AFIA 2C03A 2Z4TA 3TF5A 1J8MF 1FP7A 2EEPA 4WJKB 2H51A 5KNCH 4YRSA 4IMPA 4BGUA 2FPLA 4B3MB 4HBGA 2J41A 1R15A 3HBNA 1G38A 2RK4A 2D2EA 3KV1A 1NVBA 1QP8A 2H1CA 5CT9A 1CR1A 4ZV9A 1EIZA 4Y9UA 2BDTA 5KREA 2RC5A 1XTVA 4B3FX 1PGPA 2WJPA 3HCBA 3LC7O 4K6MA 1QTQA 5HJEA 4O59O 3GYBA 1W1WA 1DBIA 2CD7A 2RH8A 4RZ2A 2BFWA 5IDQA 1CR6A 3QPDA 3TCKA 2G8LA 5L6MB 5DT9A 4DM7A 1LLUA 1YDEA 1W6RA 1GVNB 2P9EA 1JHRA 2XI4A 4JHXA 4MVJI 4UBMA 4UHBA 1DEOA 1MQSA 1QAQA 2AE2A 3DDSA 3LJKA 1IATA 4ZCRA 4JYCA 1LA2A 1NDUA 1N2ZA 4ZVVA 3CCBA 5FJJA 4W1PA 4HQOA 4IS3A 1Q92A 3SXJA 1CP3A 1BEUB 1EVYA 4CIWA 5ALSA 1QV6A 2BZGA 2IA5A 2YWHA 1EWKA 1SUDA 1G8KA 4IJWA 1Z36A 4UUOA 2AFHB 3QE9Y 4NR0A 4O4LB 3CTMA 3UGTA 1WTAA 4U7FA 4B6OA 1GQFA 5TS3A 3I8SA 1AG9A 3CN9A 5HVNA 3V1YA 2VPTA 3DP9A 4J6EA 2JVIA 2CXHA 4IOJA 3DDCA 1K27A 5B3AA 1W9HA 2C8LA 4YJ2B 2GPYA 1NP7A 5K3CA 5F5LA 1CB0A 2YS6A 5E2BA 3MHPA 4DOMA 2DBVO 4LF8B 1FFBA 4GNKA 6GPBA 4JU9A 3NWPA 1U3VA 4I1YA 1IBKB 2A0KA 1E89A 1ORIA 4OUKX 5L3ZA 3ONDA 3VKFA 3CUUA 1R6UA 4RE5A 3IJEB 4JJ4A 5LA6B 2CB0A 4U5QA 3CVWA 5CVJA 3JAWB 1J0DA 4FR0A 1AQNA 4B3BA 3GPLA 2AEFA 1JKFA 4IVQA 4ZKDA 1YH3A 3IKVA 4CMEC 1X1BA 4GOMD 1GKIA 3IV6A 3GJ0A 3Q5GA 4XJSA 2XB9A 4Z9FA 5JPIA 2FSIA 5FEMA 4N49A 3KLNA 3LF1A 1BE1A 1BYIA 2QE7A 1G20B 2R8YA 2JAPA 2IF2A 3HGTA 3FUVA 4OLAA 2FP4A 4PBSA 4F92B 2MSDB 2W22A 3N3AC 3PTAA 2PUFA 1WXGA 3GAFA 4ALLA 4J4BA 1J22A 1A5TA 1XTQA 4MCIA 2OT3B 5EQJB 3QOFA 4ETMA 1EGHA 1IOLA 5SICE 4Q7JB 1FRVA 5K4AA 2I65A 3CTPA 3I1IA 1J8VA 1JPVA 5FRDA 4E70A 1YD7A 3IQGX 4MW0A 4NENA 3VU1A 2I9KA 2PBLA 4YRPA 4YUAA 1DU4A 1YHYA 5D00A 2BEUA 3JATA 5I9NA 2A1IA 1E3SA 3FYCA 2RHDA 3BBLA 3RBAA 5TGTA 3TKYA 2BGIA 4INPA 4FFPA 3C3WA 5KTYA 1A1SA 5GGXA 2ZAIA 3L7BA 3OIVA 4O2BB 4BX3A 4BB9A 3R9XA 3WK8A 5KQSA 4F6LA 4AN1A 4LNUB 1B41A 1Y81A 2N75A 2AN3A 2YH2A 1RRGA 2R7NA 2QRGA 1IUPA 2Z09A 1F8GA 4FWIB 2GJ9A 4UARA 5AP9A 2Y0DA 3DZIA 4KQIA 1ZVJA 3NZEA 3C7CB 1WMEA 2CVPA 2YJ5A 4MUKA 4RE6A 4RJIA 1UXJA 2WWYA 2GM4A 4HRAA 4NS1A 1A4XA 5SY4A 2QN2A 4JS0A 4DWVA 3PDCA 4OA5A 3DM5A 1EFPA 4D74A 2GAAA 2P6RA 4U6NA 3F6CA 3Q6NA 4E4TA 1VJDA 2C2YA 3HS3A 3D59A 1Z5VA 2HMSA 4K9OA 4L9RA 1ECPA 1COZA 1EJ2A 1TVKB 1J2UA 3QMPA 3I64A 2OGTA 1N1DA 1DBVO 4K1XA 3JYOA 3L4BA 1SCAA 2A33A 1R1DA 2OOKA 5D3MB 4LJ9A 1G2PA 1T6XA 1GRQA 1EUYA 1IAQA 2XNDA 2PVPA 2RSLA 4CG2A 4O08A 3BD9A 1GSIA 3CLVA 4LYDA 2DFPA 2UZ1B 4O5AA 2MYTA 3QEMB 5KYVA 3B1JA 3RUFA 4IUDS 4I55F 3THXB 4N8DA 4F1KA 5EIHA 3CF6R 4XPZA 3L7MA 1RM4A 5BVGA 2IEYA 2QRPA 2H7YA 4CXMA 5AK3A 3R0XA 2AG5A 4PLVA 3H9EO 3ZY4A 1U0OC 2B4KA 2P2ZA 4ZGGA 1R66A 3ORHA 3A05A 5JJIA 1TQ8A 2QS9A 3H13A 6LDHA 3ZWDA 2A9RA 2VT7A 2EFHB 2H0QA 3MTEA 4M8NE 3L8GA 1DINA 3WLNA 4IRUB 2PJRA 4HZIA 4D96A 1F1JA 1NOJA 1YL7A 1EFTA 1ZA2A 3IELA 2R68A 1F3LA 2B37A 2O3QA 4Z7OB 1HH4A 3FLMA 4E32A 2WAOA 3AO0B 3IESA 1QM5A 4MS3B 3V8QA 5BOSB 1EVLA 4XQEA 1I3CA 1P9OA 1X7WB 1Y8QB 1ZCZA 3I73A 4TVOA 1Y5LA 1JX6A 4DLYA 2FWAA 3CX3A 2AHRA 3PCTA 4RK1A 2OHIA 3RNOA 1VP9A 1HM5A 1NM5A 4PLYA 4XQCA 5JFGA 1W36D 1NT2A 2HGSA 1J8YF 3L6CA 2H16A 3EUWA 2BKVA 1U0FA 5IG2A 2FVYA 4FGZA 5I4KA 1Z0SA 2B61A 1NMYA 3FZNA 3HL4A 1P19A 1J4AA 1SA0B 3R7FA 3H8JA 1Z0UA 3PQFA 4A8TA 1H5QA 2C98A 1NDHA 3IOCA 3ICWA 3FDIA 1NNSA 3TQIA 2F64A 4II3A 3JWPA 5LSAA 3VH4A 1WB5A 4D0LB 1BFKA 4CFSA 5A3VA 4G5FA 2PG3A 3DDNA 2F17A 3Q10A 4HQ6A 3OF3A 4Q05A 3PGXA 4EKYA 1ABFA 3W5VA 3JQDA 4U63A 4FK8A 1HEIA 3FF4A 4WY8A 3RIYA 2Q0SA 1U2TA 4C22A 1E1QA 1AUXA 3PFCA 5FI0B 1TYBE 1QLJA 6NULA 1SQSA 2YBEA 1P1FA 1VJ1A 1WW2A 3QH4A 4J1SA 1BDMA 3D6TB 4PO3X 4EVRA 2BM1A 1WD5A 3KCNA 4NYJQ 4OLFA 3O4VA 1JEQA 1TZJA 3JVVA 5CHEA 3B1WA 1NYTA 4NJMB 5IH3A 3CZCA 3EPKA 4PGHA 5JOQA 4QYIA 3BGDA 1HYBA 4DXHA 3ZHZA 4H6VA 1HOXA 3E5MA 1FYWA 4JP5A 2ZRKA 4HXEB 4YTEA 5E6SA 5ICEA 1JLRA 1YVDA 4AQYB 2H4JA 3WB2A 4TMTA 2B4QA 4KOEC 4L8GA 3O95A 3DOEA 4LZJA 5AR1A 4OVKA 1NMSA 1V35A 4CQMA 1LTKA 3SEZA 3ZZUA 3AVTA 4MKXA 3RDPA 5AI6A 1JDVA 3GLTA 4PY2A 3ICVA 1TUBB 2Y8EA 1NQAO 4X6YA 2KWIA 3AM5A 3RC9A 1NUPA 4QQNA 1DC4A 3X43A 2SCUB 3MFQA 1XTIA 2Q4TA 1QRAA 2ES4A 1HSOA 4TMWA 3VU9A 1PQWA 3KE8A 3BFJA 3D7KA 3KDSE 4KCGA 3AYXB 2DWUA 2XGSA 1MIOA 4YBZA 5GVSA 1G0OA 1N9KA 3G6WA 1YR6A 4B79A 4DDMA 2C9CA 1L3CA 1R16A 1XTZA 1E62A 4BMDA 4JI3B 1Z5GA 3QVGB 2F9MA 4PLGA 5AH0A 5M34A 1IN5A 4RVNA 4PNPA 1VPEA 2P5YA 3D3JA 3IO5A 3LX6A 3TSOA 4CKBA 1X92A 1A8HA 3NH9A 2I3GA 4GWGA 4JOBA 2ERXA 4CLOB 5JH7B 2C4HA 3NOXA 3H9GA 2AN9A 2G36A 3IV9A 5C5CA 1L5ZA 4Y2HA 5E3JA 1Z3IX 3FH0A 3CUEF 3EG9B 5BSVA 2IH5A 2FPXA 3Q72A 3O47A 2UUCB 1SG9A 1OI7A 1IE3A 1KU6A 1P0MA 5C32A 5KOYA 3JD2A 4LY9A 1LXCA 3LPMA 2CSXA 4AECA 4ZXPA 2B6NA 1N2BA 2WM2A 3BKXA 5BN5A 2ZJ6A 1N6OA 3ZC3A 4OB7A 4UQPA 2QAJA 3B13B 3M5WA 3NV9A 4MQBA 1U9IC 4LV5B 1LLFA 1XRSB 1Z0IA 4PCLA 1IHYA 5FBZA 1JEYA 2WSIA 4RF4A 2FW9A 2QTMA 3A4MA 5EEGA 1WUTA 2R1TA 4TWAA 1ZM9A 3SKYA 1ODKA 3GNLA 1ZG3A 2WW8A 4HRVA 1N6PA 1N3IA 2K2QB 4MYUA 1A8SA 1TM5E 2ATVA 4QOEA 2QZJA 3MMPA 5EJFA 1JFFB 2KI5A 2PX4A 1SH7A 4RCYA 3T3GA 2IZZA 2ZB8A 5C8YB 1ISFA 1REQB 4X0EA 1THZA 1OZ0A 2E85A 4XAQA 4XPIA 2ETXA 4A0QA 3O1JC 5KWJA 3V1NA 1C9KA 5ECYA 1UMCB 3NDJA 3NT4A 4MVJH 1R64A 3MLEA 1KEPA 1CLEA 2CUTA 2V3WA 4QARA 5CJJA 2AG0A 3EVGA 3KPYA 5CTAA 3A1SA 4FNOA 3M4JA 4HC4A 3NIBA 3EFBA 3PQ4A 3HB0A 2VDUE 2E3JA 3T9EA 3ADBA 1YHNA 1F48A 3AR5A 3FGOA 4NFHA 1UK7A 4PYIA 2PXCA 3DEHA 5PGMA 2HUPA 3MWEA 3UA4A 3FIUA 5KVSA 1ZX1A 4A5OA 1SHZA 2HMVA 1WR8A 1VPTA 1V4VA 1Q7TA 3EEIA 4HUQA 3GO4A 4ZIRB 5I9LA 4MAMA 2X4GA 3EZFA 3RLIA 5I4BA 2B2NA 3RC1A 3OMLA 3G3EA 1Y1QA 3QTTA 4C0WA 4CZ2A 2ZP1A 1ODCA 2HUNA 2P2SA 2ZI7A 3ZDEA 3A31A 1LUAA 2H4HA 2QUIA 3AI1A 3DFKA 3RH0A 1EP9A 3SY8A 1P74A 1KO4A 5K8CA 4IQ0A 2XRZA 2B83A 4PZEA 1TQHA 3TQQA 1DTWB 2FPOA 4FSDA 1BMTA 1OY1A 1YHZA 5DWQA 3SNKA 3TZHA 3ZCQA 3H4MA 3BXPA 4RHYA 2VYNA 2VQFB 3KZVA 3QU7A 4ZU1X 4XR4A 4R40A 2VNSA 1N7HA 1ZIYA 1D7OA 2GHRA 2JGAA 2QSZA 4FFDA 4OM7A 5G0TA 2WIGA 1XNQB 2QRHA 4JUIA 5KX5B 3IAFA 2BJHA 4LE2A 4YAJA 4DIMA 4NESA 5EEHA 3E4DA 2FPRA 5MHTA 3H5NA 5LXTF 3HKEA 3ABZA 1PR1A 5F77A 4MWBA 3W1WA 3WYCA 4EFNA 5EZ6B 1W4LA 1ZH4A 3PQ3A 4WOJA 3WK6A 2EERA 1O87A 4DJFC 1MMFB 2XQFA 4FIDA 5CT8A 4R7ZA 2O2SA 1RI4A 1TM7E 2YZGA 1C0EA 4NVRA 3G79A 4WZBB 3VO2A 1M6YA 4Z3KA 5K09A 3T7SA 4FMBB 2OHGA 3L49A 2ISQA 4QUJA 1RJEA 4NOLA 5AVOA 3U5ZB 3F6EX 3C1AA 2HI0A 1UMKA 2AL7A 2C78A 4CW7A 4BQOA 1ZD8A 1YS9A 4KN5A 5DTJA 3TTTA 3FCXA 4QAQA 1QRTA 3A4TA 1J0XO 2B7CA 4HYYA 4MUJA 3SU8A 4KOAA 4S24A 1KZ6A 1NNUA 1W2WB 4C0HA 2I76A 1RYZA 1GGFA 1VSBA 3PXBA 4WKBA 2IF0A 5H8WA 1G6OA 2GWRA 5DXJA 5JTUA 1SUPA 2B0CA 3K9BA 2BFEA 3WAGA 5D87A 3KQPA 2I34A 3RQIA 4WGFA 2GT1A 4DREA 3ZHVA 3DVSX 1O4WA 4AO6A 1SWVA 3E9MA 1L5WA 3FYSA 3OMWA 1K5HA 1PJTA 1Y1LA 4IJ6A 5E9AA 5TVGA 1TKBA 1WOMA 2P9TA 4GGOA 4FVTA 5L95A 5DHRA 1VCIA 3E8MA 3M33A 3U7IA 4R7TA 2JIMA 3RVBA 2PFKA 4KR6A 1RRPA 1TQDA 4MS1A 2OSVA 1KC1A 1U3TA 4MYRA 1YI1A 5CFZA 2A5YB 5TJHA 2G9RA 4Q9IA 4KGDA 1VLMA 2J46A 5KB3A 3PX3A 4DC9A 3PC8A 5KTNA 1L5GB 2RH5A 1UDCA 4MQ5A 5AW5A 2AC7A 2PX8A 2YV5A 1XZQA 1SD1A 1IQRA 5GWXA 2YN4A 4W6ZA 3RUDA 4YRJA 2IHYA 4R98A 2DFLA 4G0PA 4H1WA 2PZJA 4BMSA 2JAQA 3CMCO 2AMFA 4Q3NA 4IIGA 4K0RA 5KDOA 2O2JA 1GPUA 1DGQA 1JQKA 1DG9A 4KZPA 4AJLA 2WYVA 5E0KB 3ZW7A 1JWLA 3F4BA 5DYTA 3UC5A 5K0GA 3V4PB 1C7EA 1QE5A 2P78A 3RKSA 3B6JA 5KMGA 3A3NA 1XMPA 4JD5A 2A1UA 4HNSA 4TXLA 1E3IA 2F2TA 3HJFA 4J9UE 4EBBA 3HBLA 3W5IA 2Q99A 4HEJA 4MQMA 5T3UA 4D9BA 5BPHA 5J2UF 2D7CA 3MT9A 3CEHA 2ZKLA 4IYJA 1F14A 4W7SA 5J9FA 2UKDA 3G2MA 5HXAA 3GRAA 4GWLA 4KNVA 4BB6A 7YASA 2VI5A 3DL4A 1NFRA 3RARA 2PSEA 3KNZA 4IQGA 5IN5A 1KMNA 4ND4A 2GCOA 3GNQA 4Z0NA 1QHYA 3KJIA 4R1UA 1N33B 3QBDA 2VSYA 2JEOA 4MIEA 2QUAA 1P7YA 5TE9A 4I8XA 5JG7A 4M4SA 2PZEA 4YT2A 1YTLA 2P4SA 2Q4DA 1HDXA 2IS2A 3FNBA 2IV7A 3DL7A 3CLTD 3DOFA 4ABYA 3B48A 3IBGA 3K0CA 2FPGA 4IUCS 1W4ZA 2X9NA 5BUSA 1XLTA 3M2PA 4B3CA 1IY2A 1XO1A 2I22A 2HJ9A 3BULA 1PJ3A 4DUZB 1OB5A 4TS3A 1GOTA 1MKYA 1OIXA 3I52A 4EUEA 3SKXA 2VQEB 2Q9UA 2XMRA 1LSUA 3GRYA 4IOMA 1UZLA 5GV7A 3SYNA 2X5NA 3FRJA 1KEEB 2JS7A 3OAAA 4TZTA 5JCZA 2O2DA 3GJ7A 4J29A 2UU9B 3NJRA 1CZOA 5D5PA 1QTNA 4MLCA 4ND1A 4YBRA 3AXTA 2C1ZA 5T4BA 3PICA 5FTJA 4DKXA 4EW3A 4J4HA 1HTTA 1TYDE 1UBFA 4DMKA 1FSFA 2DLCX 4BTEA 2XX3A 3CEJA 5EOVA 5ITWA 2PJUA 2QM0A 4L0DA 1JTEA 2P0YA 4NY1A 4DV7B 3RCBA 4N40A 1CHNA 1C7RA 3X1DA 4MUEA 1NVMB 1VBMA 1KMCA 3KT6A 5FL7D 4L6CA 5EMLA 4K6GA 4QM6A 1W0KD 1H2WA 5AMXA 3BGIA 4C3UA 4KWHA 3ZYCA 3A26A 1P1CA 1QJ4A 2NAPA 2XVMA 3I2GA 4N5NA 3KJQA 4U2BA 4K9RA 2PRZA 4Q66C 2YY5A 3SICE 4Q7EA 1OA0A 1D1SA 3BVPA 2FUCA 2GKOA 1G5PA 1H2YA 1DAIA 4IIJB 2V6JA 4NYMQ 3ZWVA 2D06A 3TMKA 4AY5A 1IM2A 1YQTA 1BDBA 2DFDA 3NDRA 4P98A 2RCNA 1BVUA 4C0AC 1XQWA 4QQRA 1SUCA 2QAGC 3EARA 5DGCA 4PQYA 1K8XB 3OX2A 5EXPA 5JQWA 1RJGA 1QF6A 4FEYA 2HLNA 4Z54A 2TMYA 2EBFX 4NECA 3HDJA 1OAOC 1SUIA 4IGFA 2TRSB 4WW0A 3AUJB 2OQIA 3NC4A 1AA9A 1D0VA 1OX5A 4I66A 2B8EA 4UNQA 3WQBA 3C6KA 4D9GA 3C6YA 8AT1A 2H5EA 4MTLA 3DVRX 2AF3C 5DOZA 3A6DA 2YRFA 2P2YA 3JQGB 2A14A 1E4YA 3ORQA 3ZU3A 1TO6A 4DR4B 1E0KA 4JT9A 1N2HA 3R09A 4PBRA 4QULA 4X8LA 5AI8A 4EDFA 2OBMA 3GJXC 2RGBA 4ZOLA 1B0ZA 3DD5A 1IH8A 3QHQA 1I3LA 3VZPA 5GJWC 4FE3A 1AN0A 1RRVA 3ZH9B 3KAJA 1ATZA 1Z75A 1O5OA 2DPLA 4XYEA 1NYQA 1WG8A 1CW2B 3C5HA 1AGXA 2J3LA 2HIGA 2GEDA 3N0VA 2WTMA 1Y4DE 3GB9A 3OJOA 1WCYA 5EKSA 5H3HA 5J5AA 2VTKA 1MR3F 1TJNA 3HJBA 2E87A 2WU4A 5M04A 4JV5B 2C2XA 1SUAA 2YZNA 1E79A 3ZE7A 1IN1A 4I6GA 3PFWO 1W2GA 4XFDA 2JPDA 5I8WA 2H4ZA 5HTOA 4X60A 5B53A 2QXYA 4WGGA 3IJRA 4X8OA 4DQKA 1YFKA 2WVAA 3L7AA 4ZV4A 1XP8A 2ZE6A 3DZGA 4OBXA 3SR4A 8ABPA 2BSQA 2EAUA 4YJ2F 5EGNA 1OB2A 2WM3A 5CBKA 2IXGA 5CVVA 3U3ZA 2I3DA 1Z7WA 821PA 4JI7B 1BYUA 4C7OA 2XWSA 1PLJA 4D46A 3LKDA 4PGGA 2C57A 1H3EA 3CN7A 2QVLA 3QFTA 3L43A 4JC4A 4G01B 4F4FA 2AOTB 3GJ8A 4I9HA 5IVIA 4FI3C 1NBAA 2QN7A 1BD4A 2XOXA 4XZ3A 5IJ0B 5K0EA 2CUZA 4TX1A 3AQIA 1PQPA 2GJ8A 1XQVA 3QVVA 4EI2A 3WLIA 3STYA 3UENA 2WR8A 4MW6A 1EB9A 1XZBA 2Q4OA 1JEAA 4QUDA 4EB8A 3G89A 5JQGB 1V7ZA 2HC9A 3L01A 1EX1A 5EWLB 4D5GA 4MWGA 2WF6A 1OMOA 4W7IA 2HA2A 3TZKA 4FNAA 4Z49A 4BKUA 5LP6B 1Z33A 3Q5DA 2G8NA 4WX2B 4BFXA 4R2HA 5IJWA 5BUCA 3E8SA 2P9BA 1NF9A 1O6ZA 4IJUA 5AM0A 4MVXA 1KWGA 5ITZA 1N78A 1PTJC 4KXVA 2HF7A 4J7UA 1DCFA 1LQUA 2O5VA 2ZI6A 2J7PD 4OFXA 5C1BA 4LXTA 1NASA 3ASZA 4KLAA 4PZUA 5J2TF 4CEJB 1ZH2A 3OOEA 2PUEA 1JEQB 4GYWA 1G8MA 1EWQA 2P9YA 3CFYA 4GX0A 4GSYA 1WKCA 4FX5A 1WSWA 3PHCA 4PRKA 3DS8A 4WZAA 3AUYA 5T67A 4DQUA 2M32A 5JY6A 4R83A 1WE2A 2OBYA 3L1HA 4FYHA 3A2MA 3DMRA 4HDMB 4K26A 1YJBA 4C01A 3DBIA 2OYCA 1LRKA 1ATIA 1D1PA 2XSZD 2YC2C 3INRA 3ONEA 3P2OA 1KF0A 3LHIA 4FFBB 1PSWA 4IEEA 4B09A 3B2EA