3JYLA

Crystal structures of pseudomonas syringae pv. tomato dc3000 quinone oxidoreductase
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
325
structure length
325
Chain Sequence
MAKRIQFSTVGGPEVLEYVDFEPEAPGPQAVVVRNKAIGLNFIDTYYRSGLYPAPFLPSGLGAEGAGVVEAVGDEVTRFKVGDRVAYGTGPLGAYSEVHVLPEANLVKLADSVSFEQAAALMLKGLTVQYLLRQTYQVKPGEIILFHAAAGGVGSLACQWAKALGAKLIGTVSSPEKAAHAKALGAWETIDYSHEDVAKRVLELTDGKKCPVVYDGVGQDTWLTSLDSVAPRGLVVSFGNASGPVSGVNLGILAQKDSVYVTRPTLGSYANNAQNLQTMADELFDMLASGKLKVDGIEQYALKDAAKAQIELSARRTTGSTILIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of Pseudomonas syringae pv. tomato DC3000 quinone oxidoreductase and its complex with NADPH
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Oxidoreductase
molecule keywords Quinone oxidoreductase
total genus 100
structure length 325
sequence length 325
ec nomenclature ec 1.6.5.5: NADPH:quinone reductase.
pdb deposition date 2009-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3jylA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3jylA01
2BH9A 3FWZA 5G0WA 3ICPA 4YQYA 4BNMA 2IXBA 3S2IA 5BR7A 1P31A 2NQ8A 1YQXA 1L7EA 3GRKA 2WYVA 1I0ZA 1JN0A 1KETA 4OGWA 1FDUA 2CY0A 4D7AA 1DSSG 3DZGA 2OXIA 3U09A 3SC6A 4LVUA 6LDHA 4RF4A 4CV1A 4RDIA 1X13A 3F5SA 2PWZA 3K96A 4GX2A 5ENVA 2DT5A 3VH2A 4MVJP 1ADFA 2CNBA 4OSOA 1AHHA 4XIYA 3SJ7A 2O3JA 3LLVA 1Y8QB 1Z6ZA 3JQ8A 4EW6A 4CLRB 5DP2A 5TQVA 4AICA 4XGNA 4O1MA 2PLAA 1XA0A 2AEJA 3P2OA 1OC2A 2RHCA 1A5ZA 1LC0A 2JFHA 1LQTA 3ZNNA 4BNYA 1YS4A 4YVFA 3MJEA 1YB4A 2HMWA 5A5EA 1K5HA 3KXDA 4J9VA 2GYYA 3WWZA 3VH3A 4NK5A 1KIFA 3EUWA 3UN1A 5JW6A 1NAHA 4WCFB 2EW2A 2ZTVA 4PFJA 5JC8A 2C82A 4BNJA 3DAPA 3AFNA 1GFSA 1ISHA 4S3MA 3KUXA 5EIOA 2NV6A 2DBQA 3ORFA 4EYEA 4ZHSA 1NWCA 1PL8A 4IQ8A 3WMXA 1E7RA 1LDMA 2NM0A 3PGXA 1HSZA 1FF9A 1K2WA 1T2AA 2VYVA 2YHIB 4PLZA 5B37A 4E5NA 2HK9A 4K6FA 4HFMA 1VSVA 4HXYA 2QZZA 4CMEC 1R66A 5A04A 2OL4A 3RUDA 3LQFA 2HMSA 4R16A 1BW9A 2AQKA 4Y6RA 3RJ9A 4OOFA 2RIRA 1D4FA 2PV7A 3VC7A 3R6DA 5JY1A 3GFBA 4AJOA 1I8TA 1U3VA 1W8DA 5GMOA 4DPKA 4WLNA 4P4NA 1GYRA 1SZJG 4CLEA 1M67A 4BKUA 1O6ZA 1JU9A 4FSHA 3PI7A 4GSKA 3QWHA 5L7TA 1BDBA 1MA0A 1P74A 5I9LA 4WCFA 2C29D 2YHUA 3I83A 4P38A 3DQPA 4ITUA 3WYBA 1B2LA 4KTTE 3IIEA 1LC3A 1NBOA 1KERA 3PQEA 4RORA 3BMOB 5LDHA 2W2KA 3GVXA 3ONDA 2GCGA 4WOJA 5KJEA 3KEOA 1GZ3A 1FDSA 4GAEA 3ZHZA 1RWBA 1WP4A 1C14A 2ZB3A 4RF3A 4G5HA 2HU2A 1HDRA 5JCJD 3GR6A 5COBA 4JCOA 3ROQA 3AY3A 4J1QA 5CDYA 3NGLA 3JQ7B 2Q4BA 4D42A 3P2YA 2NWQA 4JBHA 1YGYA 4BO8A 2Y1DA 2RCYA 2Y66A 1PX0A 1R16A 4M89A 4ND4A 2GF2A 3LF2A 1C1DA 1HTBA 3RUIA 5JAMA 5IDWA 1MC4A 3QP9A 1QV7A 5J23A 2EEZA 1UZNA 1E1KA 3GZNB 4EUEA 1G1AA 5JY6A 1C0LA 4YDRA 1C1DB 2FR0A 3JD1A 3AUTA 1IHYA 1GQQA 4ZJUA 4BB5A 3DZBA 4HP8A 3B6ZA 3DHNA 1B3RA 1FXSA 3AJRA 4E21A 2VQ3A 1U1IA 2H5LA 4U6QA 4N18A 2GLXA 4HFRA 4IJVA 1YQDA 1E92A 4DWVA 1P44A 4FW8A 4YA6A 2B35A 2EGHA 2PK3A 4EUHA 4B4WA 5TLSA 4NH4A 1ULUA 1V9LA 4Q3EA 4BNXA 4BB6A 4B3HA 2TMGA 2NTVA 5IAAA 3S2EA 1RYEA 4RF2A 2O4CA 3EY4A 2Z1MA 2JHGA 2CDBA 3KETA 3WIDA 3ZU5A 4TZKA 1GTMA 5KCZA 1E3EA 4RVGA 5TSDA 3W6UA 4NFSA 4PLVA 2VHVA 3OIFA 1DJNA 4J49A 2WWRA 4Y6SA 1LUAA 7MDHA 2HK7A 1GPDG 1H93A 4A2CA 1MXHA 3H7AA 2GN9A 1NASA 3QE3A 1X7DA 1YKFA 1YB1A 3A4VA 4RPLA 3GUYA 2PY6A 3W4JA 4BKPA 4ZA2A 4QO8A 3WX0A 4MIEA 1F8FA 4IQGA 4EGFA 1LEHA 3K6JA 1NFQA 1DLIA 1F12A 3LC7O 5KJCA 5K0ZA 1XLTA 4GKBA 4GMGA 2B0JA 4J4BA 4NR0A 4JN6B 4XB2A 4FB5A 4LMRA 1JWBB 3CEAA 3UOGA 4XDYA 5A02A 2DLDA 3WG9A 3VZSA 5IG2A 3ZU2A 3AY7A 1IZ0A 2W2LD 4TRJA 1W6UA 3G17A 1QR6A 4FFMA 2JD2A 3GF4A 3PZRA 1JKJA 1LSUA 3L9XA 1NPDA 3F1LA 4J7CA 5ICSA 4GQAA 1HWYA 1YVEI 1TXGA 1Z75A 3AM3A 3NTRA 1GCUA 5TGDA 5CPFA 4BO1A 4DL9A 1SO8A 5COAA 5BSEA 2QW8A 3C8MA 1U5AA 2YV1A 3LLSA 2C54A 1YWGO 4G2NA 3ZN2A 3BMOA 3WGHA 2WD7A 5IDQA 9LDBA 1N1GA 2VHWA 1Q7CA 4W6ZA 2P9CA 5F1KA 3EC7A 1HYGA 2YV3A 1UP7A 1CIVA 4M86A 2JAHA 1DFGA 3PHJA 4G81A 4ID9A 1LDNA 1EVZA 3PXXA 3IAHA 4E2WA 1GZ6A 2Y0CA 1E1LA 3AUAA 2BRUA 3MWEB 3EK2A 3H65A 4R5HA 4XKJA 4CV2A 5T6BA 4AJNA 4DLLA 1M2WA 1BVRA 3M6IA 1HDOA 4RVHA 1WDLA 4FFPA 1C1XA 2PH3A 3O03A 4NBUA 2HAEA 1G6KA 1KC3A 4NPCA 3V2UA 1P0FA 1ZXLA 3WNQA 4K9DA 1T2EA 4GX1A 2BGKA 1EVIA 1ZXBA 3PDJA 1IYZA 5H83A 3VPFA 3BMQB 1KEUA 3U5TA 4ROSA 5TX7A 3WOHA 1ZSYA 4QFDA 1JAYA 4WCFC 4YAGA 2QZ9A 1U9JA 3GGGA 4ZQEA 5G4KB 4RJTA 3FHLA 4HV4A 1DC5A 1SB8A 1OFGA 5CP8A 2I76A 1D1TA 3WB9A 4R01A 1WMAA 3K2BA 2VHZA 3B1JA 2GSDA 4D3DA 4FIZA 4Z0HO 1PJTA 1YL6A 5TJHA 3EVTA 4OMUA 3PDUA 2D5CA 1E7MA 2ZQZA 2GGSA 4L74A 4FFOA 1S6YA 4BNLA 5JXWA 5DBGA 3B1FA 4WGGA 3IKTA 5A9SB 1H9BA 3DOOA 1FMCA 4D41A 4J7XA 3ITKA 2EGGA 3OJLA 4IM7A 1DEHA 2VZ8A 2JKVA 1U8XX 5EQFA 4J1SA 3U9LA 2JJYA 2Q1UA 1R4NA 2AG8A 4H16A 3WQQA 4AJ2A 1H6BA 3WBBA 1Q0LA 3DBHA 3K92A 1LDBA 4CQLA 1X15A 4CV3A 4CUKA 3H5RA 4NFYA 3BHIA 3H2SA 2GD1O 2GN4A 4BMVA 2EP5A 1HE3A 2EWMA 3MJTA 4GKVA 4N5MA 4URFA 2P2SA 5C7LO 4LVCA 1ENZA 5KOIA 4GWGA 4JP3A 3CZMA 3RASA 2AG5A 2GDZA 3BTOA 4C7KA 4CM5A 1CF2O 5IJZA 1UUFA 2ZTUA 5IZCA 4GX0A 3OFSA 3C7AA 2VHXA 4IPTA 4CR6A 5I8WA 2DPGA 1TVEA 2H1SA 4X54A 4AJKA 4QUKA 3KBOA 1AUPA 1EE9A 2NVBA 2O48X 1LU9A 2X86A 2I67A 3U4HA 2WM3A 4BKOA 3TF5A 5IZ4A 3EMKA 1I10A 4W82A 4EUFA 4YT2A 3KYBA 3DMTA 4MIOA 3LVFO 4GWKA 2VN8A 3M2TA 4PLWA 4OYRA 1CWUA 3BZUA 4QT0A 4XCVA 4XJSA 3UCFA 3BMCB 3VH4A 5HM8A 2HK8A 3BMQA 4L73A 3DONA 3BTSA 2OORA 1XQ1A 1V6AA 2DAPA 5I7VA 1O0SA 5T64A 3MCVA 1QSGA 4FOSA 1EE2A 1PL6A 2FSSA 3JYLA 3MJVA 1NVGA 5F5NA 5BNTA 3WSVA 5TIIA 1E7QA 3F5QA 4D43A 3EW7A 2DC1A 3KVOA 4Y9DA 1XYGA 5IF3A 5JDIC 3K73O 4J2HA 3KRTA 1FDVA 4WEQA 4L76A 3GN2A 3KM0A 3AM4A 2DVMA 2FR8A 1YOVA 3HN2A 4FQ8A 1M75A 2PD4A 2VHYA 4YXFA 1HDGO 2EIHA 4YJGB 3DOJA 3NDJA 4EJ0A 1E7YA 1QV6A 1HYHA 1E3IA 5DOZA 4DTIA 4BO0A 4TRRA 1ARZA 2BLLA 1LRLA 4E2ZA 1B0AA 1DRVA 1LSSA 4U5QA 3WFIA 2ZYDA 5A03A 1HLDA 1MG5A 3L0DA 1L1FA 1PZGA 4WLUA 3Q11A 1IB6A 1U28A 3RUHA 4IDFA 4WE3A 1T2DA 3G79A 1ZFNA 1NTOA 1DIRA 1SAYA 3QIVA 3ADPA 4HNHA 3PLRA 3F6YA 4DQXA 3V2GA 4R68A 2AQHA 4MVJE 3CSDA 4FFLA 1MUUA 4PLPA 2RHRA 5LDGA 2HCTA 1XWFA 3RJ5A 3VAZA 4OM8A 2P91A 3HDHA 3PYMA 3ZWXA 4ZQGA 3A1NA 3IDSA 4PG6A 2PH5A 2RAFA 3D1LA 3WYEA 4CODB 2BKAA 5LC1A 3RFTA 3TFOA 5FI5A 3U4CA 4GH5A 4XJTA 4FOOA 3TZHA 3I23A 3STHA 2WE7A 4NJOA 5JDIA 2V65A 1LRJA 4BGIA 1R4MA 1ZEMA 4C4OA 1GYPA 1ZW1A 3H8VA 5DT9A 1RM5A 3NAQA 3ANNA 2DFVA 4ZU3A 2D3TA 3WWYA 2AHRA 4FS3A 5C5IA 4MP8A 4NQZA 1ZZEA 4LISA 3DEYX 3OETA 2DBZA 3GZ4A 2R6JA 4ALLA 3OEWA 4A27A 1PIWA 3QWFA 2E6UX 2AQIA 1ZK3A 1IPFA 3S55A 3TN7A 1U7HA 3Q0EA 1IZ9A 2X5KO 1R6DA 4J9UE 3ZV5A 5A9SA 1UP6A 4IXTA 2RH4A 3OQBA 1EK5A 2D1YA 3DMTC 3T4XA 1T24A 4JJIA 2VOEA 4FN4A 1VL8A 2PR2A 4MP6A 3ZH2A 4ZVVA 1SEPA 2P9GA 3FF4A 4A10A 4DXHA 3BYZA 5TF4A 3OM9A 4KUHA 1SBYA 4CM9D 3FNGA 1TEHA 3T7EA 4NBWA 2JL1A 2VYNA 5JNLA 5F1PA 3IJPA 1LDYA 1ZVMA 2B4RO 4L8VA 4XR9A 1U4SA 1WDMA 3CH6A 1EUDA 2W90A 1ISJA 4PZEA 2GN8A 1DLJA 2IZ0A 5AQ1A 2X9GA 1ZMOA 2JD1A 3UUWA 4YB8A 3ZCXA 3FD8A 2J6IA 5U1PA 5DNAA 3VVBA 1LNQA 3EHEA 4GGOA 4XQ9A 5BSFA 1LJ8A 3DBRB 3JQAA 3RBZA 4BNIA 4ZQBA 1QYDA 4DPLA 5I7SA 4AJJA 4LN1A 1YO6A 4DIBA 3BXXA 4IDAA 1R37A 4EI2A 4TVOA 1GR0A 2BFOA 4LSMA 4TKLA 3JQAB 1U2GA 3EDMA 5I9NA 3TZQA 4BNNA 1KY5A 3HADA 4IMPA 1IULA 3ZW8A 3PHGA 1H6CA 5GZ1A 3DHEA 4J7UA 2EKPA 4EJMA 4RF5A 1TT5B 5B4VA 4BKRA 1ZK2A 5EN4A 1HDYA 1I2CA 3JQ6A 3B70A 3R3SA 5GZ3A 4YJFA 2C7GA 1UXKA 4CR8A 4M1QA 4WK6A 5EERA 4OO3A 4RPKA 3ZHYA 3F3SA 1PGJA 2D0IA 1A72A 2PGJA 3GQVA 3FR7A 4I5FA 2AEFA 2ZQYA 1NHWA 5A4DA 1R4MB 1G0NA 1RM4A 4QSMA 3PWKA 1BXKA 2ZTLA 1V3VA 4IUYA 3LYLA 5L3ZA 2Q1SA 2EERA 2H63A 1CERA 1OOEA 4AL4A 4RO0A 1XCBA 4XQCA 5JYDA 1QXSA 1K89A 3JQBA 4RVSA 4FR5A 1U3WA 3ZW9A 5A3JA 2IYOA 1PS8A 1Q0QA 5ADHA 1EUZA 3KYCA 4LW8A 2XOXA 3CMCO 3BTUA 2CSUA 4IJUA 1WWKA 4CM4A 2Q1TA 1GL3A 4YAJA 3B20A 1UDCA 3G3EA 4D0RA 3Q9UA 5BSGA 4CLOB 3GA0A 5BSHA 2OGUA 1XR3A 3LU1A 4S1VA 1A9ZA 1R15A 3DWFA 3FCOA 3DL2A 1MP0A 2Q99A 3U0BA 1PGNA 1EUCA 1UZLA 4GGPA 5A06A 2DQ4A 1MGOA 3QW2A 4PN3A 1LLQA 2NADA 1AN9A 4Z6KA 1KC1A 3HUDA 5JBIA 1I01A 1PGQA 1Y1PA 5EL0A 4A73A 1X1TA 3JYQA 3JQ7A 3LDHA 3CKYA 1I36A 3MOGA 3JD4A 3A06A 2PZLA 3UCEA 2VTEA 3HJAA 1ZJZA 4NK4A 5ER6A 1DRWA 1PJSA 1WLYA 4PLTA 2AW5A 2J3HA 1Y6JA 3WGTA 3GUCA 2NU8A 3JQAD 2FN7A 4BNHA 3PFFA 4AJLA 1X7HA 1UXIA 3KYCB 3VDRA 1U3TA 3H5NA 2BHLA 3E5RA 2C5EA 5I7FA 2G5CA 3CZRA 4UVIA 1W73A 4E13A 1CQJA 4EBFA 1SOWA 4L0QA 1C1XB 3ETGA 1DAPA 2Z1NA 1QORA 4W4TA 1QP8A 4W99A 4Z9YA 3AI1A 4EITA 1CDOA 1A7AA 2DPHA 5IN5A 4ND5A 1P9LA 3WGOA 1Q1NA 1E6UA 2J3KA 2B5WA 1IOLA 1E7WA 4Q39A 3ZNOA 3WDSA 4E3ZA 4RPJA 2O2SA 4M8SA 2NUAA 4WOKA 4BVAA 4P4LA 3T7CA 2UDPA 1B8UA 1JDJA 3H2ZA 1UDBA 4PG5A 1Z82A 3F9IA 4BO5A 2IEDA 3TJRA 5FWNA 3ZGYA 1D7OA 4Z3DA 3C24A 3PJDA 2Y1FA 4TZTA 3TFQA 2F1KA 5TC4A 3VTFA 3HDQA 1E6WA 1KVRA 1IE3A 4IXWA 4J6FA 4UUPA 2P5YA 4B8WA 4ESOA 4IGEA 3JV7A 4Z9XA 4OH1A 3LK7A 3NDRA 4DUPA 5FYDA 1JAXA 4B4OA 1EDOA 3VDQA 4CMEA 5JSFA 3IMFA 1NVMB 1LBEA 2AE2A 1N5DA 5ILOA 2GN6A 4CL8A 3TZCA 2OBNA 2R2GA 5B1YA 1JLLA 5A9TA 4RLSA 3D64A 4CLXA 4DQVA 3GDGA 1QYXA 2NVUB 4E6PA 3QVOA 1LRKA 2B5VA 2PNFA 3ETEA 3AWDA 3D3WA 3DDNA 2BFPA 4XYGA 3C1OA 3A14A 4M49A 3SBOA 3L9WA 3I52A 5CEJA 3IUSA 4TROA 4F46A 1J5PA 2IODA 2VT3A 4YR9A 1PEDA 1MFZA 1OZAA 4Y8VA 3UFXA 4FBGA 4IJKA 1DDOA 1JVBA 1MLDA 2ZCVA 3GZNA 1UXJA 2NVUA 5JPIA 2CDAA 4IZHA 4AJPA 4Z9FA 4IDCA 4BNUA 2WYWA 1LLCA 2W98A 3D0OA 3DBLA 1IL0A 2C20A 2HJRA 3FPLA 4FFNA 1VKOA 4H3VA 3AUUA 1A71A 3ZZNA 3ROMA 1PR3A 3NGXA 1U5CA 1P1IA 5EJ2A 1I30A 4FDAA 4I9UA 2QRKA 4I9HA 3H9UA 2J5KA 3D3WB 3I6QA 4CLOA 2FZWA 4MKZA 5AXDA 1HSOA 2ZKLA 4O63O 4ALKA 1YBMA 2VTDA 1O89A 4BHTA 3DO5A 2CVOA 4B7XA 1YRLA 1LA2A 2IYPA 1QLHA 4FC7A 4PZCA 4B4UA 3ZWCA 3ULKA 2FPIA 4TWRA 1K6IA 4J91A 5JO9A 3B1KA 1ZH8A 3DFZA 3BMNB 3DBVO 3E9NA 1EEHA 1R0KA 5THKA 1YE3A 3WIEA 5EQDA 4GLLA 3GVPA 3ANMA 4BIIA 4PVCA 5IDYA 5KIAA 4CV0A 1VI2A 1VE9A 2VZ0A 3TWOA 3HFGA 3ST7A 2P4QA 4DREA 3F4LA 4XDZA 1XDWA 4IDDA 1EFKA 4KQXA 3H9JA 3G1TA 3IUPA 4DIFA 2I6TA 1AXEA 1KEWA 1DIGA 5L45A 4OKIA 4QO7A 4A26A 4WLOA 1EZ4A 1X0VA 2HO5A 5T8KA 2IXAA 5TS3A 4CUZA 3SLKA 3U3XA 4DVJA 3O38A 4NMHA 4E5PA 2BMAA 4YAEA 4E0BA 1HF3A 2Q2WA 4NBRA 2W4QA 4DMLA 4JROA 5LCXA 3H5AA 1HE5A 1VRWA 5BT9A 2VWQA 3E82A 4NBVA 4E2YA 4MO2A 3LT4A 4Q3AA 4N54A 4DBVO 3HG7A 4CPDA 3PQDA 2D2IA 5DDIP 1O95A 4BNFA 3IJRA 5DF1A 5JFOA 1RJWA 3R0IA 4L75A 3L4BA 4GX5A 1PJ2A 4B7UA 3IL2A 5L51A 1A7KA 4C7JA 1EQUA 4CMBA 3VPSA 4I08A 2WTBA 3AOEC 1PTJA 5L40A 2ZIZA 2Y0DA 2IZ1A 4FJ2A 2QYTA 3K31A 5CDSA 4MKXA 5FF9A 1MB4A 2JCYA 1Y7TA 4ALNA 4YT8A 1B26A 1U2DA 3GVHA 3WGIA 3L6DA 4J4TA 1ADGA 3RUCA 2A92A 1LI4A 3QA9A 3RUFA 3JQFA 2Q3EA 3CPSA 1V3TA 2O3QA 4RL6A 4LSWA 2C59A 3N58A 3GRPA 1VJ1A 3L4BC 3ZWNA 3A28A 1YDWA 4CL3A 1P0CA 1VJ0A 2WYUA 4JK3A 2OFPA 4R1UA 2UYYA 4J16A 1R0SA 5F21A 1P3DA 3KZVA 4PRKA 4KWHA 5DCWA 2W2LA 5EINA 1R0LA 4A03A 5FEUA 2X22A 5KKAA 3DHYA 1DO8A 3RKUA 3KSUA 4IIUA 3OSUA 4QECA 4EZBA 4CQMD 2AXQA 3S1LA 1SCUA 5I9MA 3AUSA 3GVIA 3PYXA 3BHMA 4BNWA 3GNTA 4DYVA 1ADBA 3INRA 3Q2KA 3ZWAA 2HMVA 2NACA 1YH3A 4E31A 4CLRA 2FSVA 1LDGA 2XF8A 1PQWA 4IS2A 4HUJA 2HMUA 3OF2A 4D79A 1MXFA 4YACA 2QYSA 1QG6A 4MINA 3ANLA 4E5KA 2I3GA 1WNTA 3WJAA 1A27A 1VL0A 3WGQA 4KDFA 4E5MA 5IXSA 4JQCA 1PQUA 1Y5RA 3E03A 3I9NA 2OBYA 2O3TA 3TDKA 2V6MA 3OEYA 2X0JA 3E48A 4XYMA 3LT2A 4GSLA 3ONEA 4PLYA 5CDTA 3DZIA 2GZ2A 3HWRA 1UAGA 2IE0A 1DC3A 5EPOA 2DKNA 5A5FA 4F6CA 1Y9AA 4UUOA 1NP3A 2DBVO 4CMGA 4TMFA 1W0CA 1J49A 2D5AA 2HLPA 3N74A 2FP4A 2GASA 2D4AA 2CF5A 3HB5X 1NHGA 3KSDO 5A9RA 4YAKA 5DBIA 2BFAA 3GHHA 4IS3A 4YT4A 3H3JA 4WNIA 1B8PA 3K8ZA 1BDMA 1F06A 2X0NA 1J6UA 3BAZA 1NNUA 4K26A 3ZV3A 4I5GA 3NV9A 3RCBA 3VH1A 4AJ4A 4F6LA 4TKMA 4NBTA 2ZYGA 3JD3A 1PU2A 1NYTA 2Y93A 3RU7A 2HSDA 2YFQA 1Y81A 4KZPA 2EV9A 1PR9A 3F4BA 1I5RA 5KWEA 3TNLA 1Z7EA 4CM1A 3EZYA 4RDHA 2FHSA 4E30A 1H2BA 2X23A 4GLOA 3NJ8A 2I65A 4LRSB 5JAQA 3GNSA 4CMHA 1LLUA 1VM6A 3C1AA 3WGZA 1T26A 4KQWA 4EDFA 3MOIA 3KEQA 1I3MA 2BFMA 1T2FA 1YDEA 2QIOA 4OL9A 4UVDA 1IUKA 1WMBA 1MV8A 2EJWA 2VWPA 4XZ3A 2G1UA 3UCXA 2GUGA 1ISMA 1H0KA 4JLWA 3CIFA 2A94A 3FNFA 4FPXA 4XGIA 5B4TA 1Y8RA 3QVSA 4OOEA 1BRMA 1BTOA 5ITWA 1Z74A 4GI2A 3D4OA 2NQTA 5JO0A 1CEQA 2HMTA 3ZWWA 2VNSA 4IZIA 5DULA 2YZ7A 4RZHA 3QWIA 3OJ0A 3C7DB 4ALJA 1BSVA 2P68A 4R4JA 2ZTMA 1M6HA 2GZ3A 2X1HA 9LDTA 5HWSA 1ISIA 2EW8A 2W8ZA 4I1IA 4PG4A 1L7DA 1E7SA 2PD3A 2VUUA 4UUNA 4EJ6A 5IDXA 2NU9A 1A4IA 1W4ZA 1JA9A 3D5QA 4NJMA 5G2OA 1CRWG 1ZNQO 3JYNA 3HB4X 3TQHA 5JYEA 4AJHA 1E77A 4WLFA 4DQUA 1HZZA 3F46A 3WYCA 1GEGA 2VRBA 2UUPA 1KYQA 2YW9A 1X7GA 3C3XA 3ZWMA 4D46A 1JWAB 1HZJA 1N1EA 3KO8A 4YBZA 1KEPA 3I9JA 2Q4EA 3W1VA 2Q1WA 1ZUD1 2XPCA 5JDCA 3LF1A 2F00A 3P7MA 5K9ZA 2C7VA 2OP1A 4HBGA 3DAFA 1GY8A 3MTGA 4FGWA 3TOZA 4WLEA 4BV9A 5F5LA 4BO9A 1OAAA 4MVJI 4XRGA 4Q3CA 1NX6A 1E3JA 2J5QA 1JTVA 4RVFA 5DOVA 1ZIDA 1BW9B 2X8LA 5C37A 1SPXA 1WZEA 3I6IA 3R3JA 3UHAA 2POQX 4XYEA 3F47A 1JQBA 1YL5A 3QVXA 1AGNA 5KVCA 1T4BA 3BA1A 3RIHA 1M66A 3UW3A 1FJHA 1XU7A 2QHXA 4XR4A 1LLDA 1NPYA 3OIDA 2Y05A 3EAGA 2NTNA 4KMSA 1KVUA 2Y0EA 1JKIA 2DTXA 1M6WA 3KLMX 5HTOA 4XYLA 4N5LA 4JXKA 2AQ8A 4AJIA 2GO1A 1B16A 1JW9B 2JFFA 1IPEA 3RC9A 1T2CA 3GDFA 4GL4A 4UEKA 3JYOA 4YYZA 3PWSA 4NIMA 3ETDA 1I24A 4NU6A 2HUNA 5L4LA 3WLEA 1D3AA 4ZICA 3ICCA 3SVTA 3I3OA 3AI2A 3W8EA 1SB9A 1K3TA 3WBFA 2UAGA 4CM8A 5TT1A 4ZQFA 4OKNA 4TRNA 1ONOA 3V1TC 4HKTA 4IJWA 1C0IA 1ULSA 3KTDA 2I3AA 4GVXA 4RZIA 4TVBA 4ALMA 5DBFA 1KVSA 1WZIA 1PQPA 2J5RA 2P5UA 2SCUA 4KWIA 3HFSA 3PHHA 1H5QA 4ILKA 5C7OO 1IY8A 5G4LA 2X5OA 3AU9A 3IQDB 4BNGA 1BHSA 2CMDA 2I66A 1O8CA 3WICA 3NT2A 3RROA 3M1AA 1X0XA 4K1LA 4MPDA 2CZCA 2JD0A 4HY3A 3TOXA 3JQDA 4CM8B 5JE8A 4YJDA 5JMPA 3E5MA 3D4NA 4B3JA 3WSWA 2OOSA 2XXBA 1NVTA 3OH8A 4RGBA 1HDZA 5G0SA 3RBXA 1CETA 3ITDA 4Z3KA 1HETA 1TA4A 2NLOA 2Q45A 3BMNA 2RBEA 3WGGA 5KVVA 2YHIA 5EMHA 2GRAA 1ZK4A 3BHJA 5COQA 2WSBA 2V6BA 4E2XA 2EF1A 4LMPA 1D1SA 1RKXA 2AE1A 1GV0A 1GUZA 3DZKA 5ES3A 3RFVA 1WDKA 4L9RA 4P4GA 5KJ1A 3L6OO 4BS9A 2OP0A 4AG3A 4KUEA 1LDEA 2JCXA 3GN1A 1C0KA 1SC6A 3N7UA 3OECA 3CINA 3Q1LA 2YJZA 3JQGB 3INTA 1O5IA 1V35A 1YBVA 4CM6A 4BUCA 1BWSA 4D44A 1GDHA 1F17A 5G4KA 4E4YA 4MDHA 3RI3A 4BO2A 4FGSA 5ICMA 5DCYA 3DZJA 2ZYAA 2C0CA 2LDXA 3AFMA 4WNCA 2QX7A 4Q3BA 1WVGA 4L4XA 2CVQA 3RWBA 4IQ0A 5DN9A 4OSPA 4WEOA 3ON5A 2X4GA 5AXAA 3S2FA 5KJ6A 5TRTA 2FMUA 3ZI0A 4GBJA 1MFPA 2YUTA 1XELA 3MTJA 1H94A 2DFDA 3BMCA 4Q9NA 1ZSVA 1PJ4A 2EXXA 1ENYA 5CFZA 4IBOA 1X1EA 3FBTA 4ND1A 3WS7A 1GPJA 2VCYA 3FTPA 1NQOA 4CM3A 3QJ5A 4DLAA 4PIVA 5AOVA 2QRJA 2Y1CA 1RYDA 3HDYA 2TMDA 4QQRA 3NUGA 4YJHB 2EG9A 4XWYA 5DZSA 3FNHA 1R4NB 3VZRA 3NDIA 4W7IA 2UUOA 3UAGA 2Y67A 2O2YA 3RBVA 5CDUA 3S8MA 2FZEA 2V7PA 1X14A 1GUYA 2RH8A 3GPIA 1XIVA 2JHFA 3FPCA 4XEHA 4MVJG 4PG7A 3WQSB 4TSKA 4XRRA 4ZQHA 3RQSA 3TRIA 3KYDA 4YJGA 2PA3A 1J0XO 1CQIA 3MZ0A 1NQAO 2ZB7A 3DB2A 3RAJA 2B83A 1I3LA 3JTMA 3JQGA 5F1OA 3RC1A 1GV1A 4LK3A 1KEVA 3MJ4A 1ADCA 1I3NA 4U8GA 5FI3A 4BOYA 1ZSNA 3HZZA 4NHEA 3LC2O 4R3NA 1ZMTA 4N5NA 3I4FA 3PIDA 1RM0A 1Q7BA 1GCOA 1ZK1A 1BG6A 3P5SA 4RLHA 1LQUA 4UVHA 2O3SA 2HQ1A 3OIGA 4UEOA 4OJNA 4HWKA 5HS4A 3RSHA 1PSDA 1HLPA 2E37A 2Q2QA 2HRZA 3PQFA 1H2HA 3ZNQA 1P1HA 3GC6A 5CEEA 4M54A 5K6AC 3PIIA 4J2OA 4CMCA 4WECA 2X6TA 2PFGA 1N9GA 2FR1A 4R9SA 2PZJA 1PGPA 2YQ5A 4BNTA 4ZRNA 4H15A 3GVCA 4PLFA 4P8RA 3V5NA 1PL7A 3INGA 5TT0A 4Y67A 2ZJ1A 4I5EA 4II2A 2DBRA 3P19A 4P22A 2ZJ0A 3IP3A 3PJEA 4WKGA 3TZKA 2NU6A 4YT5A 5T67A 5CG2A 3DBRA 3DFUA 1U3UA 5JCXA 3DR3A 3HN7A 3HE3A 4ZN6A 3DBHB 3RU9A 4OXKA 2OHXA 1H6DA 3FSRA 1GYQA 3GGOA 1EFLA 2Q50A 4BMSA 5MDHA 2HDHA 3RC2A 1Q0HA 4BO3A 3VKVA 4NG5A 3D5TA 5I8ZA 1R12A 4CM7A 3D3EA 3I9KA 4LGVA 1VL6A 4N7RA 2HKIA 2YDXA 4JP2A 5F3RA 3K30A 3BTVA 3CE6A 1ZK0A 5G0VA 1DC6A 2I9PA 4OXNA 4MVJH 3UVEA 1XGKA 3PP8A 3JQCA 4BGEA 3OP4A 1ISGA 2E82A 5JS6A 2B69A 3PHIA 3JQ9A 4UVEA 4WLVA 2NNLD 3ZNPA 1YBAA 1OBFO 2YY7A 2QRLA 3JD2A 5THQA 4DIOA 3SX2A 2EKLA 4W9NC 4W7HA 3GT0A 3PEFA 4HX5A 3JQ9C 3PGJA 2A9FA 2D8AA 3O8QB 4L4RA 3SC4A 4B8ZA 5L7YA 1ORRA 1U8FO 3CUKA 3QVWA 3AW9A 5EESA 3UF0A 3ZWYA 4AJ1A 1GADO 3LC1O 4HFJA 1Y8QA 3UICA 4B4VA 1P77A 1TLTA 2R00C 3JSAA 3E1KA 3OA0A 1NAIA 3GAZA 4DA9A 1T4DA 3RUEA 1KVQA 2OO5A 3JD0A 4JBIA 5DP1A 1AHIA 3VOSA 4CMKA 4CQLB 1HE2A 1DRUA 5CHEA 5G0UA 3PJFA 1E0DA 5A1TA 3WTBA 4QEDA 1BVUA 1U7TA 3CTMA 3GHYA 4J3FA 3NT4A 1H6AA 4KP7A 1SOVA 4FC6A 3ASUA 5C3MA 1P33A 4Q3NA 4NZ9A 3IC5A 1ONNA 1JKFA 1XQ6A 2G82A 2PKQP 3LT0A 1QMGA 4PLCA 3FTNA 3RD5A 4DRYA 3D4PA 2NTJA 5ILGA 5T57A 2IEBA 1A9YA 2PGLA 2A35A 3HSKA 2Q2VA 4BO4A 2Y99A 3WGYA 4K6CA 4NFHA 1V3UA 3MJSA 3PFWO 4HNGA 3IOYA 4QX6A 3V1YA 4PCVA 4RQUA 4XQGA 5H82A 4R1SA 2IZZA 5DCUA 1I2ZA 1C0PA 1Y5MA 1YOVB 1DIAA 3H3FA 1BGVA 1PZFA 1E3WB 1HKUA 1DBVO 4ALIA 1GAEO 3GK3A 4ND3A 4XIJA 1J4AA 4MJLA 2D59A 1G0OA 4WPGA 4MP3A 1KBZA 3AI3A 2VRCD 1DOHA 1NWHA 1N7GA 3I9MA 2EJVA 4NDNE 4YRBA 3ZWPA 4CMIB 3KYDB 1XSEA 2LDBA 4BKQA 3G1UA 3I9OA 4R1TA 4B3IA 1Z73A 2O7QA 2W2KB 1A4UA 1ISFA 1HT0A 1BXZA 3GNQA 2PGDA 1NFFA 1O9BA 5T5QA 4LRTB 4EEXA 1YJQA 1MG0A 3AOEA 2JAPA 3L07A 4PG8A 3U4DA 2ZCUA 1AE1A 2PKRA 3E6AA 3AU8A 1OI7A 2WD8A 3UGKA 2O3UA 1PWXA 1FDTA 1QYVA 4PVDA 3V2HA 2YYYA 1MC5A 4PLGA 5AXCA 4XB1A 3M2PA 2IRWA 3GLQA 4DYDA 2B37A 2NU7A 4LCEA 4J43A 2H6EA 4IDGA 5IZCC 2BGMA 2CD9A 4UEJA 3ZU3A 2ZB4A 1N8KA 4OIMA 6ADHA 1ML3A 2I99A 5JMWA 5KNLA 4DC1A 1LSOA 1S7CA 2EHDA 2WE8A 3U4IA 4R9RA 2VWHA 3LZ6A 5MGBA 2UVDA 1EVYA 4ZD6A 3Q6IA 4CMIA 1O94A 3H4VA 3ZWVA 3QLJA 3GEGA 1YL7A 1N92A 4I5DA 3ONFA 1DB3A 3ASVA 1UR5A 1KY4A 1CJCA 3RKRA 4NNJA 1Y9EA 2VUSA 4WUVA 5G0TA 3ROKA 3G49A 5KVSA 4PGFA 3MJCA 2GR9A 4CMJA 2VWGA 2J8ZA 3O4RA 3QV1A 1KS9A 3RC7A 1PZEA 4BGUA 1PS0A 5K6AA 1GD1O 1I32A 1KVTA 5K1SA 3FBGA 4ZGWA 7ADHA 3O8QA 2G0TA 3VPHA 1PJ3A 1YQGA 1SNYA 5B4UA 5CEFA 1P1RA 4HADA 1JVSA 3C7CB 3OICA 3QWAA 4MVJF 4RV9A 8ADHA 3PVZA 3EYWA 3R1IA 4YJFB 4YEDA 3GPDG 3UKOA 3I9LA 5GY7A 1ZCJA 1E3WA 1YXMA 2Z95A 3HDJA 4NI5A 2DU8A 3ROPA 4A7PA 3TZ6A 1MX3A 2UV8A 5CPBA 3GG9A 3GG2A 1T1RA 3GY0A 4MVJM 5BNIA 4B79A 1P1FA 2VRCA 4J90A 4I9NA 4BQPA 3WJ7A 5KVQA 4OXYA 5L7WA 1T25A 2VOJA 4BMNA 3Q2IA 4XYBA 4CM4B 1UH5A 1E3SA 1Z45A 4G65A 4O6VA 5HBRA 5JCJA 4BNVA 4E33A 5HRUA 4MIYA 3MWDB 1UJMA 1XHLA 1N7HA 3EZLA 5ER9A 1YONA 1HL3A 4L4SA 4BNZA 5CDGA 2IDZA 4O59O 4BQRA 3W8DA 4IGFA 5KKCA 2C07A 4MVJD 1Q2XA 3PHLA 5A3VA 3TL3A 2Y68A 5ITVA 4YRDA 4IDEA 3WFJA 1HRDA 4FJ0A 4ONEA 3GEMA 1UXHA 3ZWOA 1ONPA 1DAOA 4CJXA 3L6EA 3RVDA 8LDHA 2Y1EA 4JBGA 2JFGA 2E4AA 1PGOA 2Q49A 2BD0A 5HA5A 1PJBA 2CFCA 3K9QO 1QRRA 1NQ5A 1GUFA 4Z0TA 1UZMA 4RPGA 4XX0A 1ZBQA 4GVLA 3NRCA 3DOCA 3WNVA 1RPNA 1P1KA 3RUAA 2B4TO 1UAYA 1EQ2A 2DTEA 1F8GA 1K6XA 3NTOA 1U4OA 3AM5A 5TJ9A 1QYCA 3W4KA 4UAGA 4DLBA 3KSZO 3GOHA 3OQ6A 1B14A 2J3IA 3K2EA 5I7EA 3H9QA 3NYWA 5BQFA 2BGLA 3PJGA 1DFIA 2G17A 3LT1A 3ENNA 4KTVE 1LX6A 3D7LA 1Z7BA 2AA3A 1E6EA 2HJSA 2VT2A 3QVTA 1EBFA 4A5OA 1DIBA 4D3SA 1QYWA 1VLLA 4UULA 5B12A 1DJQA 2PZMA 3KLPX 4BO7A 4R3WA 2G76A 5U9CA 3DZHA 3JQBC 2WMDA 4J1TA 3X2FA 4JNKA 5JDCC 4BO6A 3WMWA 4DPMA 4DGSA 4WASA 4R69A 3U62A 5L4NA 4JX8A 2DM6A 3E9QA 2DTDA 3L4SO 2B36A 2VUTA 5IFLA 2V6GA 4II3A 2X0IA 4R5MA 4CQMA 1PJCA 3F1KA 3KV3O 1LXCA 4I8XA 3VVCA 3ZDFA 3VKUA 3OBBA 4RVDA 2WEKA 1HDCA 4CQMB 4U7WA 5AYVA 2C2XA 2X7HA 3DBLB 1C3VA 1TT5A 3EGOA 4MOWA 1E5LA 5U4QA 2C2YA 4QTZA 2ZK7A 4UUMA 3VZQA 4U0JA 1B7GO 2WDZA 2PTGA 1XKQA 2AMFA 3ZV4A 3VPGA 1B15A 4R41A 5CG1A 1XEAA 2YDYA 2FOIA 3VPXA 1T1SA 3HNPA 4KDEA 3OA2A 3GMSA 5KTKA 2X0RA 3ENKA 4RCVA 3DTYA 2XAAA 3IS3A 4QFCA 4ZRMA 3WTCA 3DZFA 3GDOA 2O50A 4XGKA 1RM3A 3BIOA 1DC4A 1DHTA 1DIHA 3E9MA 3OQ1A 1K0UA 4FCCA 4DC0A 4HFNA 4TRMA 3SJUA 1OMOA 2O3RA 4NJMB 1SEVA 3ZV6A 4FD3A 4F45A 3PWZA 4J4HA 3I1JA 2H9IA 1BXGA 1V8BA 3H9GA 3DAGA 5CAEA 1FK8A 2BI7A 5IXYA 4IINA 1EK6A 2B4QA 4O0LA 3W8FA 3FI9A 3WQRA 5IN4A 3AY6A 1BXGB 1DXYA 3LSYA 2WD7B 1B8VA 3DTTA 1ZKMA 1DHRA 4IDBA 1NXQA 1LTHR 4F3YA 4BL5A 1TB4A 3KHUA 3NJ4A 4CR7A 4NU5A 5ENDA 4OQYA 3PPIA 4WJZA 3GMDA 4D0SA 3C85A 5HS6A 1EDZA 3FRJA 1LSJA 5BNFA 1NFRA 4R51A 5A05A 4E32A 1UP4A 2DUUA 1Q7GA 1VKNA 3HQ4O 3VZPA 1HDXA 3NX4A 4AFNA 2PD6A 1YB5A 3E18A 1B3BA 1I3KA 2EP7A 2O4UX 5AXBA 3CXRA 4QXMA 2PZKA 3FNEA 1PS9A 3AOGA 1F14A 2VNAA 3SEFA 1EMDA 1NM5A 3L77A 4UVGA 1WPQA 1WW8A 1XU9A 1I2BA 2VZ9A 2CUKA 1H9AA 3NKLA 4INAA 4Y6PA 4M55A 3GGPA 3ZU4A 4U0KA 3WXBA 3O9ZA 3I5MA 3Q3CA 1PJQA 2Q46A 2YFHA 4BGVA 1FDWA 1GZ4A 1ZEJA 3PRJA 4YQZA 4YAIA 4R1NA 4ND2A 4D45A 3OJOA 3QQPA 2FPPA 3M1LA 3PYLA 4PZDA 1UDAA 3X2EA 2FRDA 3V8BA 3DC2A 1GQ2A 3WR5A 3H9EO 3PTZA 3V1UA 2X58A 3AK4A 2GERA 4FFRA 4IMRA 5L53A 4CLDA 4XA8A 4XQEA 1D8AA 1NPTO 5TNXA 3ABIA 3OJFA 4IIVA 4JIGA 1PWZA 5GZ6A 1HXHA 3C1TA 2P4HX 4UREA 2FWMX 1ZO8A 4YCAA 3IKVA 5JAZA 4E5YA 2Y1OA 1DPGA 2A4KA 1I33A 2QQ5A 1HEUA 4R54A 2E49A 4K28A 3FR8A 4A0SA 5JC1A 2CVZA 2GNAA 1EBUA 2CDCA 3W6ZA 5JLAA 4BV8A 4KUGA 3H6KA 3MEQA 3JQFC 4H7PA 3RFXA 3GEDA 1BMDA 3CMMA 4EEZA 4AVYA 1VPDA 4JJGA 4Y98A 2CF6A 3OHSX 2OUIA 1SMKA 3JYPA 2HRBA 3TL2A 1OC4A 1TI7A 3NT5A 4GPD1 4J1NA 1UXGA 3QWBA 4PLHA 4CUJA 1GQYA 4XD2A 2JCVA 3QY9A 4U6SA 4MKRA 1E3LA 1ZJYA 4DBZA 4YTEA 3Q9NA 1YJ8A 4RQTA 1TT7A 2EKQA 2QG4A 3QRWA 1CYDA 3FN4A 3DXFA 3JQEA 5FFFA 3HHPA 3KB6A 4LCJA 3GAFA 4CLHA 2X5JO 3OMLA 1VJTA 3ZWBA 1NR1A 5JAIA 3QHAA 3T4EA 3TPCA 1Y8RB 4JGBA 4YRAA 4MVJA 2PKQO 2O23A 5L9AA 2AEMA 2V6FA 3QSGA 4M87A 3A9WA 1M76A 3K5PA 1WAMA 2O7SA 2X9NA 3KOUA 2P9EA 1VC2A 3OJEA 4TQGA 1QKIA 5AVOA 1PJLA 1IHXA 3PK0A 3UXYA 3U49A 3WLFA 1E5QA 3E8XA 1ENOA 2WJPA 3S2GA 4YPOA 2YQ4A 3G0OA 3ADOA 4Q3DA 4KOAA 5T8KC 4JJFA 3TSCA 5C7IO 4YWJA 2X9VA 1E1MA 2VYND 3I4CA 1HE4A 2FY8A 1GU7A 1P45A 3PLNA 4CM9A 1PZHA 1V0JA 1QLJA 2NVWA 3NEPX 3GFGA 4O5OA 4J0EA 1ENPA 2OMEA 4BNKA 3IP1A 3VHRA 3JQ8B 2YV2A 2C5AA 1P1JA 2ILTA 2XXJA 5KJFA 5L95A 2I5PO 4FJ1A 4GMFA 3SXPA 1EVJA 1GEEA 3DMYA 1VSUA 5H81A 4OHUA 1NQTA 2BELA 1N2SA 2GPTA 4J0FA 4OAQA 4OQZA 4PRLA 4YJHA 2OZPA 1NR7A 2ET6A 2R00A 1F0YA 3O26A 1K6JA 3EVNA 2GZ1A 2FPGA 3NTQA 4AJEA 2E48A 4E12A 3FWNA 3PZBA 2ZB8A 4B7CA 4CMAA 2VYVD 4IY1A 2NSDA 3W4IA 1AXGA 3COSA 4Z0PA 4D3FA 1WXDA 3ZHXA 3VTZA 1E1NA 1XG5A 3SLGA 1ID1A 1HYEA 1KOLA 2DUWA 3ZHBA 3UH1A 1DFHA 2BF7A 3JCZA 4WCDA 4RVUA 2Y1GA 4DMMA 4RPHA 5L4SA 1N9GB 2J3JA 3GH3A 2Z5LA 2ZATA 2BI8A 4W9NA
chains in the Genus database with same CATH superfamily
1I5EA 3H11B 1WRBA 1GPNA 3Q3GE 3ICPA 4U2KA 4Z51A 4FYHA 4MUJA 3VC2A 5JRZA 2H92A 5BR7A 4HMPA 3O90A 2VQSA 1L7EA 3VU9A 1I1NA 2X1LA 3TVDA 4Z4EA 1F60A 1PLKA 2FG5A 2QLFA 3HA5A 4OGWA 1ORTA 1UPTA 4D7AA 3DZGA 2F9MA 3D6JA 4M7OA 3SC6A 3U09A 6LDHA 4RF4A 1IQ0A 3FB4A 1SCQA 4CV1A 4PQRA 3ZDDA 1X13A 3AUFA 1S02A 1JLKA 4GX2A 1XMIA 3OCCA 1E63A 2ZB2A 4MVJP 3EIUA 2FEPA 2HQBA 2O3JA 4F04A 1EFPA 1P5FA 4UBOA 3DE6X 4F1KA 4UHJA 2XNHA 3CKMA 5GJWC 4UMFA 5K3AA 4FKBA 4NESA 5TQVA 3DE3X 5EZ6B 4M99A 5ESXA 3WB0A 2PLAA 3P2OA 2REQB 2CVPA 3QYPA 2PE5A 4NICA 4EPRA 2I6XA 4EA7A 1LC0A 4PIMA 3TE7A 3U9TA 5IK2D 1Q6ZA 1NE2A 1XJCA 5ENVA 2DFLA 2HMWA 4FN5A 5TPWA 4ZU6X 1F1BA 1WA5A 3T8YA 4J9VA 3UT5A 2WIKA 3R5HA 3VH3A 2HBZA 5KBYA 4KREA 2VNKA 2AN4A 4AF6A 4QKQA 1D2GA 3VHXB 2C82A 2RGBA 3DAPA 3DMDA 1M0SA 4TXJA 1NJ8A 4H0CA 4OHYA 1ISHA 1X1DA 3ETNA 4AUEA 3DDWA 5EIOA 3LA6A 1WCIB 4ZHSA 3ORFA 4TX1A 1N4AA 4PZUA 3P9KA 3ECSA 4DMHA 1CJKC 1OIVA 4HB2A 3WB2A 1DKNA 2NM0A 1HT3A 2EARA 3P9QA 3I9V1 4MPRA 3SF8B 3D6MA 4E5NA 3O8OB 4BVJA 4TOIA 1AY0A 4QTXA 4HXYA 1P2BA 1R66A 1ZIXA 3HP1A 4PEVA 4I55B 4R1LA 5IMSA 1BW9A 1QZUA 1AQUA 2NYUA 1SOAA 2O2GA 3G6WA 4HRAA 4Y6RA 3UJ8A 3VGPA 4EGSA 1D4FA 2BEJA 5DTQA 2PV7A 1ST2A 1W96A 3R6DA 1Y6FA 5JY1A 3DMGA 3EG9A 4KYIB 3RH0A 3COPA 4IP0A 2H16A 5SICE 2PV0A 1RJGA 1SUPA 4WLNA 2QTLA 1NJ5A 4UPDA 5ALJA 2GJ8A 3SHWA 3TI9A 5KOYA 1GTSA 3EAFA 3IEIA 1M67A 4PZYA 2VF4X 3T7JA 3FDZA 4R8RA 5AM0A 2R8XA 4BKUA 4D96A 1P7VA 1WMSA 2ONYA 4FSHA 3ND5A 3AIOA 3OM8A 5AR1A 1N2XA 5FEUA 5I9LA 1ZI9A 2P7IA 2IBMA 2YHUA 4ADSG 4Z1MD 1RQPA 5EE0A 2QAJA 1T91A 2QP9X 5B7QA 5FWYB 2NMVA 5KDLA 4C06A 2ZM6B 3KVRA 1AMUA 2IYNA 3CHYA 1YIOA 2ZSKA 2QTNA 3A31A 4LDNA 3BMOB 3WQHA 4RK0A 5DNCA 5LDHA 1TYEB 4WOJA 1I7NA 3HSYA 5EXPA 5BSUA 1ILWA 5KJEA 2FPMA 3ZHZA 1QG4A 4JLKA 4LVOA 4DG9A 1CUEA 1BFKA 3M70A 2ZB3A 4YMIA 1NIPA 5EIFA 5AK5A 2A0YA 1DT5A 2QSJA 2VQ6A 4GZMA 3HLKA 4OYLA 2V9PA 3M4NA 5JCJD 2VP5A 1MO2A 3ROQA 3FDXA 2B8WA 2QRPA 3CR7A 2HRQA 3IP7A 5CFNA 1L7NA 2ZRCA 4JYPA 2EFJA 4JBHA 1N25A 2RCYA 4HVCA 2DLCX 1KZYC 1OYVA 2P9YA 4M89A 4WKNA 5DBEX 4B6FA 4DLSA 1I1OA 2QX4A 1C1DA 1HTBA 2E5FA 4C6TA 4PS1A 2HF2A 5CXXA 4PN7A 5IDWA 1MC4A 5JADA 5BSMA 5AD1A 2YOGA 2LKDA 2EEZA 4X45A 1UZNA 1E1KA 2CL6X 4COOA 1Z16A 1G1AA 3DDOA 3A6GA 4YV1A 1GZ7A 5JY6A 4ZEWA 4JBWA 4KIFA 3PFGA 1GQQA 2HYIC 3B6ZA 3E2MA 1FXSA 3TR5A 3AJRA 4MUBA 1YDMA 2OZLB 4PBRA 5AIAA 4WIAA 3WAKA 1LS6A 2XUIA 3TQSA 4AJ9A 4EHAA 3SY8A 4G5GA 4ETIA 4BAZA 2GLXA 4DV2B 4JB2A 2Z2KA 3P71T 4EAQA 4BYGA 4TMZA 2B35A 1PNQA 1T0IA 3B9PA 1F0NA 5KAPA 1UC8A 4EUHA 2DXIA 1AKEA 1NVWQ 4NH4A 2C57A 4C30A 3I37X 3N2EA 5AHOA 1CQPA 4RL4A 3LHSA 2RAVA 3CURA 1XDZA 2WZQA 1RYZA 3S2EA 3DZCA 4FINA 4ZALA 4C4SA 2A7QA 3W5CA 4XUCA 3TLBA 3KETA 2NZWA 1U5BA 3A1FA 3DS8A 5GJVC 3WIDA 3FPAA 4TZKA 3ZVKA 2XITA 3IQXA 4RVGA 3Q8KA 2P3LA 4NFSA 3MQ4A 3OIFA 5DM60 3GXOA 5K8CA 2HK7A 4S05A 5IULC 1GPDG 3H8WA 1MXHA 1L9KA 1XL0A 2QT0A 3H7AA 3NC4A 3PXEA 4I3FA 3QE3A 2YCBA 3NHZA 3IKLA 3DZ8A 1QFJA 4GOOD 5BQPA 1E99A 1JIVA 1D5CA 1ESCA 1EQAA 4OX9Y 3RSGA 4FILA 1IMOA 3GUYA 1O54A 4MUAA 2PY6A 3LUAA 1Z2CA 3URMA 1UODA 4DIKA 4ZA2A 1QF6A 1S1CA 1RP7A 3WX0A 4IQGA 5JJKA 1X7YA 1RKBA 4OUDA 4CNBA 1LEHA 2BTQB 3T5MA 4DLUA 2P90A 2QRNA 4DMRA 2CSXA 1NVBA 1VA4A 3MGBA 4UNSA 3L46A 2ODTX 2OC9A 3RFUA 1O94D 1T0JB 5BRAA 5JNSA 5K0ZA 1O6FA 4G9EA 2D5LA 1B00A 4MCHA 3KKPA 3GRAA 4XB2A 2AN1A 4KI0A 1W5BA 3WZMA 3A1DA 2DLNA 3WG9A 3FOCA 3KTFA 3GWZA 3OX3A 1NXSA 4X63A 4KKVA 4R71A 4I3HA 2W6JA 3EEOA 4B9EA 3E9CA 2OBXA 3DJYA 1L4YA 3QVKA 5ETJA 4BWVA 2JD2A 4QDTA 3GF4A 4QGHA 4URWR 1XZNA 1H5NA 1VXRA 2ONJA 4PIPA 1G8MA 1XT6A 4FU0A 3OT5A 1L4KA 3THSA 1DXQA 1QANA 4ZKEA 4CF5A 5CFLA 4YWHA 1KJIA 3WA6A 2R47A 1YMUA 1TXGA 1S3GA 1GCUA 5TGDA 4BO1A 1JSXA 4O2AA 4DL9A 3SP1A 5EC8A 3U0VA 1U5AA 3LLSA 1RABA 2CKDA 4Q21A 3WLSA 4O4HB 2IYYA 2V7QA 3BMOA 4OGFA 5JNRA 3SVLA 3D6HA 3G2PA 4C14A 5ES4B 3EQ2A 3CF2A 5U4XA 4J0HA 2B92A 1DC7A 2BFDB 4L6AA 3F2VA 2EZUA 4KQGA 2PVPA 2ANBA 4NEHB 4RDXA 4M86A 4D0NA 1GN8A 2JAHA 2BC9A 4PTZA 1CVLA 1P2TA 2PGIA 4DARA 4UUQA 4A8JB 1EVZA 2HREA 4FGZA 3WK9A 1GZ6A 4NCXA 2Y0CA 3ZE1B 4HYYA 4QDUA 2ADOA 3I45A 1L5GB 3ZXIA 2UU9B 2LBPA 3ESQA 3H65A 5T6BA 1W87A 1W94A 4MR8A 3WK8A 1LNZA 2JEZA 1HDOA 2PEZA 4A91A 3S5UA 1DJOA 2JAUA 3AVWA 1R9NA 4HYEA 2ZWOA 1VHJA 1G6KA 2QP4A 2ONKA 3EXHC 1ZXLA 3JVDA 1RHQA 1PG0A 2A0WA 1T2EA 2PR7A 2IOFK 3L8MA 1N32B 1PKXA 2UYCA 1FQJA 2N0SA 3DEKA 4M7RA 4JYCA 4B6EA 3BRCA 2BKUA 3JAWB 4GFDA 1Y6ZA 2CHVA 1OBVA 1V26A 1Z6QA 1JMVA 3Q5DA 4X95A 3WLMA 1II8A 1SQSA 5JZ9A 3THRA 3RJZA 3PIRA 3U5TA 2PBLA 1JAYA 4QC2A 3AEQB 1TK2A 2QZ9A 2ZIEA 3CO0S 4G9GA 4DCCA 4RJTA 5CD1A 2UZ4A 2XUFA 2FQXA 4HV4A 1ZGZA 2F3RA 4XVQA 5BYAA 2RK4A 5M5BA 2DETA 1OFGA 2GXAA 4WWHA 1RAHA 2ZEJA 3WB9A 1Z8NA 3O4HA 4EM6A 4F6RB 3U4QA 3B1JA 1V8FA 3RARA 1UPAA 4O4LB 2WYHA 3E84A 2H3HA 1JILA 3B6KA 5J4KA 4B4KA 5E9WA 1SKAA 3RBAA 3AFGA 3T7KA 2Q5FA 1XFAA 2D5CA 3VJKA 4IFTA 2ZQZA 2ZRMA 1KWKA 3T1HB 4BEBA 1BA3A 3G8BA 1EYZA 5KTMA 5JXWA 1RCUA 3B1FA 4MR8B 2PQ2A 1W52X 3F97A 2JRCA 3NB0A 2CCGA 4UOEA 4KAFA 5A9SB 1NW5A 3E58A 4HDKA 3DOOA 3A1EA 3JYHA 4ZAGA 3CLKA 5BWNA 2PWYA 3H0CA 2BBOA 1DEHA 4PPYA 1JU4A 1RWXA 4RMHA 5IAJA 5HGXA 4I19A 1UINA 2YIMA 4KXVA 2C2GA 4CGYA 1J25A 1N2OA 2Q4RA 3UJBA 4J1SA 4LPSA 5EZQA 3U9LA 3KQPA 2ZSEA 1N77A 3UJ7A 1H3EA 4LRWA 3WQQA 3WBBA 2N3ZA 4BMXA 2Q1XA 1HBJA 2WIBA 2GRJA 4C7OA 2W00A 4XSVA 2ECPA 2ZZKA 3PEUA 4P54A 5DLDA 1LDBA 3SQDA 5K4HA 1RBZA 3UMJA 2DR2A 4M0MA 3VO9A 3QF7A 4NFYA 3H2SA 1ESNA 4O2BB 3V8NA 5A6SA 4QOGA 2GN4A 3QEJA 2EP5A 1HE3A 5DEIA 3MJTA 1TUEA 3P96A 1FDRA 4M0FA 5C7LO 2PBRA 4JP3A 4LHVA 1NLYA 2G72A 3FYHA 2AG5A 3BTOA 5EEGA 2QLLA 3ILXA 1MOPA 1UUFA 2ZTUA 3F7OA 4ND8B 1EFUA 4ITVA 4D9EA 3OFSA 2NUTA 4GPBA 4IUBS 3H8SA 1XZLA 3N2ZB 4IPTA 2H1SA 1KHTA 1Z88A 4X54A 4A1OA 1OU4A 4AJKA 5IUNC 3ESRA 4ISBA 4ICIA 3W77A 2GS9A 5IZ4A 1J97A 4W82A 1UJ4A 5BNZA 2M98A 2J7PD 4E1AA 2VH2A 5EEHA 1I4LD 4KXLA 4C2TA 3M2TA 1LBQA 3AR2A 3IALA 4PLWA 5IF9A 1XRPA 4FYPA 1IN4A 3RRMA 2JAQA 5D7BA 2XNDD 3MN1A 4KCGA 1YS7A 3ZE7A 3KOXA 1PWHA 4YO8A 4NE9A 1ZJ4A 3ZE8A 1YUBA 2V8OA 2CK3D 2HK8A 2RGNC 4L73A 4OQEA 1CUBA 2JEYA 4MV4A 4XXHA 3JRNA 2VSXA 3OZWA 2FSIA 2NZ8A 1WZNA 2NO1A 4YRQA 4BZQA 2WPNA 4INJA 1MABA 1UWCA 1QSGA 1G21A 5GAJA 1M1YA 4WNYA 1PL6A 1Q50A 2XLBA 3QLEA 3NYQA 5F5NA 2A5LA 5BNTA 2XMRA 2B1RA 2ZDGA 1JECA 3DEAA 3F5QA 1ZUNA 3KVOA 4QUAA 4W5RA 4HN9A 1F4VA 1XYGA 4JT2A 4AN1A 2ZT5A 1FSPA 4G4GA 3K73O 5ALNA 1YQEA 1WU8A 4BQIA 1ZOLA 2ID4A 2W2OA 5C51B 3EEIA 4N82A 3VR4A 4D0LB 4OL0A 1H0SA 2C58A 1YZ3A 3TOVA 2PD4A 3BDVA 3NH9A 3ZH9B 1G3RA 1L5YA 1YA4A 1HDGO 1YNOA 4FUQA 3UAYA 4YXFA 5FWYA 4YJGB 1FMJA 3QEOA 1E2DA 1QU2A 4NP6A 2OCBA 3E0QA 3OOWA 3DC7A 4XWWA 2C7RA 2LCIA 1YT5A 1DDGA 2ICAA 1QFSA 4KI7A 4PGMA 4U5QA 1LSSA 5J40A 3TJZA 7ABPA 1MG5A 4A6PA 3Q5EA 1L1FA 3AH8A 4OQNA 4OX9B 4IDFA 4MHSA 1K9SA 2I33A 5SZHB 5F78A 3G7SA 3RANA 1XVTA 4MW2A 4E4TA 4EEKA 1UJ5A 3PGMA 3G0DA 2H65A 3W8NA 3QX8A 2YY5A 2FP3A 3H16A 3NRJA 3TFWA 4ASUD 3IIIA 1ZOSA 2WAOA 16PKA 1G5QA 1Q7EA 3M4YA 4TLLB 1NKVA 1ZONA 2B8JA 3W9BA 3HXQA 3RJ5A 1ABBA 1XQ9A 3GNLA 2XYVA 3KKNA 4C3UA 4Z8XA 4ZCTA 4DDTA 5IUJC 1JG3A 3PYMA 3EF3A 2JPDA 2QEQA 2GWRA 4X1OA 2BKAA 1PT7A 3IT1A 1XEXB 2BFCB 3F6PA 5FI5A 3U4CA 3PITA 4GH5A 4NCAA 2WF7A 4OV6B 4FOOA 3TZHA 3STHA 4DIMA 2WE7A 1RAGA 4QGAA 3AR6A 2WJWA 4D8VA 2BFWA 5DT9A 2D1QA 4XPIA 5HIIA 3O21A 2ABWA 1JQ3A 2D3TA 4FS3A 4MCAA 1ILEA 1VQ1A 5LWHA 4QREA 1X9IA 1CG6A 3DEYX 2F3QA 3IBCA 2FFQA 1C9JA 5FI1B 2OCKA 3RIYA 2LPMA 3U9SA 3I9V6 3A10A 3NHMA 4JBYA 4ALLA 4BDSA 5IJWA 1NJ1A 1PIWA 4X6UA 1ODCA 1YASA 4XVRA 1SN7A 1K3UB 1OE0A 2AQIA 1KZ6A 1RPTA 1OD6A 1IZ9A 2ZUBA 1VPVA 1R6DA 3IAUA 4J9UE 4P6VF 1UP6A 4IXTA 5EI5A 2MCFA 3WIUA 3DMTC 5FB3A 1YK1A 3SEZA 5AVZA 2Y92A 4A0GA 2J33A 4I2NA 4QVGA 4A10A 1DO2A 1E9FA 1ZI8A 2XCTB 5F98A 1FDOA 2O2ZA 5TF4A 2QUJA 1KOJA 3OM9A 1GG9A 2ID9A 2XWJI 4MWGA 2EBWA 5AMXA 1I9GA 1B0PA 4YRTA 3SM9A 2VYNA 2DKFA 1M74A 1ZVMA 1Y98A 1F3OA 1MRNA 4L8VA 3UNXA 4D6XA 1DL5A 1YQ9A 1SD5A 1WDMA 3CH6A 3LRPA 4NYMR 1P4HA 3WBKA 1GO2A 1WV0A 2JF0A 4PZEA 5JQGF 1VJGA 2QD4A 5H4GA 3ZY6A 4N0EA 1ZMOA 3UUWA 3M9WA 4U3JA 4HDMA 4Y0VA 4LYDA 1OX4B 5U1PA 1RIIA 2Z3ZA 5A5DA 5E95A 3PC4A 1LNQA 2JZCA 2YWXA 4Q4JB 2X76A 4GGOA 3EARA 4UZFA 1FFAA 3RRNA 1SXJC 1YE8A 5HGJA 1LJ8A 2IV2X 2ONCA 5KYVA 3GLVA 3BK2A 1GJRA 2OT3B 1YKSA 1LZLA 2CNDA 4AJJA 3VM6A 1YO6A 2H1WA 2YWHA 3WVNA 4GXNA 3Q8WA 5FPPA 1GR0A 5KTTA 3DLHA 1RAEA 3U4GA 5A62A 5TMPA 3RVNA 4BNNA 2VVTA 1KY5A 2BDEA 3HADA 3ZC3A 5DYNA 3GUVA 3PE4A 5GZ1A 3LHKA 1MTZA 4J7UA 2EKPA 4MWZA 5B4VA 4LX0A 1E1RA 4J03A 3N3AC 5EN4A 4G5QA 2OV6A 3R3SA 3TLAA 3B70A 1RKVA 2ZJ5A 4BEJA 2C7GA 1RWVA 1SA0A 4DZRA 3I4LA 1QE5A 1WQ4A 2IEGA 3EASA 1PGJA 2PGJA 4QDKA 1GRRA 2M9MA 2E1RA 2R7NA 2OCLA 2O8BA 4DNFA 2IXGA 2GPAA 1NHWA 5L3SB 4ACAA 3BT7A 1JIUA 2QBYA 2IS4A 3I5XA 3A1VA 2P9BA 1R4MB 1RM4A 1THTA 3I28A 1XCMA 2RD2A 3RRFA 1X77A 4QSMA 5BY2A 1BXKA 2ZTLA 4IUYA 2FDRA 2J9RA 3PQ8A 2EERA 3VV2A 2QZSA 3ZDRA 1OSNA 3A8TA 3UV6A 1VOTA 5AW7A 1FMLA 4XQCA 5JYDA 2RHBA 2FX3A 2O07A 3JQBA 4KODA 1XDDA 3AZPA 1U3WA 1QJ4A 4HGZA 3ZW9A 1O58A 1N2JA 1X7XB 1XP5A 1JI0A 2OBMA 4G1BA 4P53A 4RTJA 3OZ7A 1VZ3A 2IYOA 1LY1A 1PS8A 1E5DA 3R7DA 3FCXA 2V4MA 5ADHA 2LWIA 3ZBTA 2XE4A 4KR6A 4RZSA 1GOTA 1HOXA 1YUMA 4FR0A 4MQUA 4R6XA 2CSUA 4IJUA 3B5EA 3RYIB 2Q1TA 4ZANA 3V55A 3W7VA 3EH2A 4C4PA 3I32A 3HXTA 2J0UA 4OFBA 2WUEA 4FFSA 4UBJA 3D7RA 5CB4B 4M1ZA 2VBIA 3FCOA 3GGSA 1KE2A 1AGRA 2JFWA 2O52A 3FETA 4EG5A 1MP0A 4EGQA 2PH7A 2BVNA 3Q1KA 2HLNA 5EXXA 3DQQA 1X39A 2WUDA 1EUCA 2MINA 3MLEA 1MD9A 3C7KA 3A4NA 1Q7TA 5JJ5A 1XEWX 1OT3A 1XTUA 3T1YB 1WB9A 2IF2A 3IEXA 2XA9A 3AIMA 3VA7A 3HUDA 2ONZA 4H7EA 1U0NA 1PGQA 5ELXA 1T2VA 1ZM3A 3MNFA 2WPDD 4DBLC 2GO7A 1SKYE 3HO1A 1U2QA 2KS6A 1I36A 3MLAA 4L8YA 2AFHE 3A06A 2PZLA 3ES9A 4FCWA 4BFZA 5AW6A 3LVBA 3FPEA 4NK4A 1DRWA 5ER6A 1FXWA 3TW4A 1VG0B 4REMA 1CIJA 4H0NA 1GRNA 4WOCA 4ENQA 4XWAA 5CIYA 3E27A 1I1HA 2QLBA 4MS3B 3WGTA 1WSWA 2QN3A 3WE7A 4BNHA 1G55A 4W8GA 4D9NA 4V3CA 1UXIA 1F48A 3KYCB 1ZJ5A 3H5NA 4JOBA 3SZRA 4TV9F 3R0JA 3RHSA 4E94A 2YXDA 1USUA 3R2JA 1X9HA 2WSMA 3CZRA 4UVIA 2BKLA 2VHTA 3O3MB 3QKRB 3UJDA 4D9KA 4D82A 4IRMA 2JDIA 5IBQA 1KAOA 4JFAA 3JZDA 4QWMA 1DAPA 3L0CA 1QORA 2AF4C 3HBFA 1T1GA 1QP8A 4Z9YA 3AI1A 5I4BA 1A9OA 3R3XA 2F48A 6Q21A 3RTAA 3QKRA 1O9GA 2QY9A 3FYUC 1P9LA 1L3IA 3MERA 4UBMA 3WGOA 5HQ3A 1RHJA 2J3KA 4UNQA 3MFQA 1COWD 1L3BA 5IW8A 3W04A 2GWHA 1EB8A 1YSCA 4MZXA 4C5BA 3HRHA 2A5YB 4I9FA 2UDPA 2C4WA 1B8UA 1JDJA 4MQFA 2GETA 1EG7A 2B7LA 4YRRA 2BTOA 1SC9A 1GPLA 1W6RA 3TJRA 1VSTA 3EC1A 3ZCVA 3ZGYA 5FWNA 1ZR2A 2P77A 1OXMA 3K9BA 1TF7A 3C6YA 2B78A 4Q4AB 1KAGA 5DT2A 1YQTA 2Q41A 1YUNA 1RU3A 1Y9DA 4HYQA 2AOWA 3HDQA 3VTFA 3HY3A 4CTOA 5IBPA 8GPBA 2WU4A 3LPNA 3MC1A 2CL0X 4UUPA 3PNBA 3HCRA 1A4XA 1UK9A 1Y1QA 2IU4A 3NOQA 1U63A 3YASA 3MM4A 3IOBA 1GCGA 4OH1A 4YUAA 2XNSA 4GE0A 4A3SA 4B4OA 3TD2A 1DUSA 2O9JA 1KIAA 2ATCA 4MR9B 1NVMB 4ACBA 3OZIA 1YI1A 2E9SA 2GN6A 2WJ4A 3AYZB 2OBNA 4IQFA 3TZCA 4J7AA 1HURA 4AWBA 4D1YA 1W93A 5LIPA 1E2MA 1EDBA 2IT1A 4RLSA 1EXMA 1HO3A 3D6VA 3UAWA 1QO0A 3AERA 1W4AA 1QYXA 4FSDA 3QUQA 4QRHA 3RVRA 4Q1AA 2ZR9A 4R7GA 2EATA 3K15A 1I4EB 3BB4A 2B5VA 3CH4B 4UM9D 3R7WA 5FWXB 1UDXA 2AEEA 3AWDA 3GCWA 3NAGA 1JKMA 4GYYA 2REQA 4TMKA 1WTAA 4BBPA 3C1OA 5ALXA 1AKRA 3I52A 4MX8A 3SD7A 5IYZB 1DQNA 1RZUA 3MWJA 4Y2GA 4UOZA 2PM8A 2CBGA 3H4TA 1TZKA 1NBEA 3U7QA 1XLWA 2IODA 4P2BA 1H4SA 2CXHA 2X5XA 2QT9A 1OZAA 4Y8VA 3DE7X 3IXQA 1JVBA 1MLDA 3GZNA 1JUDA 4GRIA 4J94A 3KEGA 3L6CA 4GIBA 5JPIA 4L9WA 1Z68A 3N2IA 3GLFB 1KFBB 4J76A 2ZUVA 1EKXA 3OT1A 3VUFA 3D0OA 2ZETA 3DBLA 1OH8A 2NPOA 1Z9BA 1IL0A 1KI1A 3EGWA 3KQNA 4TM8A 1RPZA 3FPLA 3EVZA 1SVNA 1H8HD 4K8OA 4RLQA 5FOTA 1IJKA 4EFKA 1UMKA 2BZSA 4H3VA 3F67A 3ZZNA 3DV0A 1O6CA 1USWA 4ZO6A 4ZT7A 4BEVA 1DAIA 1D2EA 3F5MA 3TZBA 3UWOA 2WU3A 4I9UA 5K3SA 3ZBPA 3I5YA 3FUCA 1NW9B 4EOGA 1L7AA 2C8JA 2J5KA 4C0SA 1RSZA 3FUTA 4N41A 3I6QA 2BMJA 1W47A 2IV7A 5C2JB 4HH3C 1XZIA 3CYFA 1VL2A 3U4AA 1V48A 3TRIA 4FM9A 3AB8A 2QRQA 4E7PA 1K6EA 4TKUB 1XJ0A 3SNKA 2CVOA 1P9OA 3Q3IA 1X87A 4IJ5A 3QK7A 1YRLA 3WHLA 1TAGA 1XPUA 2IYPA 3HRIA 4M0LA 1IBKB 4PZCA 4R2KA 4BQOA 3ZWCA 1S3SA 1V11A 2F1IA 3B82A 4DXAA 4DE5A 4YDQA 4MARA 3R4CA 4TLEA 3KVYA 3FDFA 4O25A 1RHKA 1K6IA 2XGGA 5EJ9A 2I6GA 4NJEB 3P0HA 1YR9A 4M1TA 3Q0TA 4FBLA 3NHJA 1YGPA 3B1KA 3FJYA 5EZ5A 3T3IA 3B36A 1CQJB 3LO8A 4EJSC 4ZDIA 4RD0A 5J2TB 2VSYA 1QHYA 1IMJA 3E9NA 1R0KA 1G8HA 5DLYA 4AIRA 1Y4SA 4BC0A 3NNSA 5EQDA 4QJ5A 4DB2A 4UCWA 2LE0A 2HIMA 4GW3A 4TL7A 2EU8A 4OFXA 2YXPX 3BE4A 2OCXA 2R8ZA 2W0SA 3P0FA 2Y4NA 4CF3A 5J58A 1K7XB 1UT8A 5K20A 2XBMA 1VE9A 2CE2X 2GK3A 3DMPA 3QYJA 3WYAA 5AVQA 1E59A 1IBCA 2IGBA 1OQAA 3ZK8A 4EL0A 4FONA 5DSTA 1TO2E 2P4QA 4MEJA 2PUTA 2A9QA 1EFKA 1SK8A 2RHGB 3G8AA 3H9JA 3CX6A 3G1TA 3P94A 3Q87B 4PGHA 2I6TA 5ULLA 1AXEA 2WQZA 4U7HA 1G64A 3R5SA 1X0VA 2HO5A 2FXVA 4NHOA 2AG0A 1P7CA 4N9QA 2QVLA 4GF5A 5D3ZA 5GGYA 2NZVG 4ZAVA 4BWGA 4MLCA 2QMEA 4OF4A 2BMAA 5F35A 4E0BA 2Q2WA 1JJFA 3TIIA 4DMLA 5EXEA 1E9VA 4QM7A 1JR2A 1GNPA 1E2NA 2D54A 1H85A 1OKKD 2OGTA 4GLFA 4MRNA 3EULA 4EP1A 5KYXA 1QGAA 1I6MA 1N7JA 4Q48A 4M1OA 1P0MA 3SDBA 4GZLA 4Q3AA 2ZIAA 4N54A 4MI6A 1EG2A 3VU3A 5MFPA 1RMQA 1DCMA 2D2IA 5DDIP 4BX0A 4RH1A 1C9MA 3BX1A 4AY4A 3D54D 3P97A 3KTAB 1VIMA 4KH0A 4UTVA 1H2WA 2AUNA 5I7WA 3HZOA 2ZI6A 2RC5A 2AI2A 3EIWA 3L4BA 4GX5A 1JLRA 4EUNA 4OXRA 1TQ2A 3D59A 5EE1A 1GL7A 4BFSA 3DE2X 1R5OA 1YZYA 1NUPA 4B7UA 3Q8XB 1YZQA 1KXJA 2VLIA 1VLHA 4FE7A 4KW7A 4V03A 4B3GA 4F8YA 2JVKA 3THXA 1EFDN 3KT8A 4FOTA 5DGTA 2E3JA 1D0SA 3IERA 2IDJA 4I08A 4LJ9A 1QMPA 3AVQA 4NSNA 4NYMQ 4BCDA 2WTBA 3DOHA 4Q1VA 4DB4A 4D6YA 3L0YA 1G41A 2WF9A 5L40A 2Y0DA 5F7XA 2QYTA 2GJKA 3QBDA 4BUZA 3COVA 3K8OE 2D6FA 3P9SA 2XHEA 2YWGA 3KCNA 3A1SA 1UEJA 2NV2B 3A3YA 1LBSA 2VDNB 4Y9RA 4MH0R 1IZZA 1Y7TA 4NJEA 5AI5A 4ALNA 4HOYA 2G07A 2JGMA 4ZJYA 3FBWA 2ZRLA 4V0ME 3TLCA 2OD2A 3L6DA 4AS3A 3D8TA 2UVPA 1W25A 2X1MA 3PC2A 3KVNA 1AG9A 3RUCA 3IA2A 2BHNA 2FMTA 2ZIVB 2ZWPA 4NYIR 3JQFA 3NS7A 3TGWA 1Q1ZA 5JI3E 3PR1A 2ZYRA 4A8TA 3R9IA 3ZI4A 4BY9E 3KD2A 4H1HA 1AGXA 2NV0A 1E1QD 3OZFA 1FE8A 1NXXA 2Z83A 3E2PA 3GAMA 5FTWA 1VJ1A 4NZPA 3MTQA 4QYIB 2JJ2A 1T8YA 1G8JA 1JH8A 5AKHA 1XRQA 1Y6QA 3QA3E 2C31A 1WXEA 2A0KA 2WHQA 2Q4TA 3UOWA 2B1GA 4G0QA 3ZVMA 2ZZMA 1C2TA 1XZFA 1N5JA 2AFHA 1P3DA 1FUIA 3AL3A 3KZVA 4PRKA 4F2HA 4GM0A 2ZAMA 3D81A 4Q7KA 1JLLB 3ZY5A 2GDJA 5JSZA 1Y3AA 3SSNA 3LRTA 5JNWA 1DO8A 3SYLA 1ZM2A 3B8HA 4IIUA 4EZBA 4MW9A 4QECA 5GM2A 3MT0A 1KARA 3P1JA 5ALUA 3S1LA 4U7FA 2ZROA 3ETCA 3HS3A 2EEPA 1OWLA 1SRQA 5IUKC 3U44A 3BD8A 3PYXA 4BNWA 4JP8A 2PBFA 4DYVA 1U2RA 3INRA 4MWBA 2NACA 4BLTA 1YH3A 5EPUA 3VMFA 1SBZA 2BGIA 4ZDWA 4QEZA 1HE1C 1Y3BE 4G1VA 3RC3A 4IS2A 5DX1A 3QFCA 1DC8A 4N3BA 3DCYA 2HZBA 2Z43A 5LQKA 3E3NA 1E62A 4YACA 4O4HA 1Q14A 5DM70 2ZZNA 5CT5A 3AESA 5K0CA 1WV1A 3ZOZA 1MV5A 2V45A 2OQRA 4L85A 1S4MA 4LJ4A 3BDAA 2ZW9A 3AETA 4OBWA 4C3VA 1O5OA 3EOZA 2BT4A 3R41A 4KDFA 1BN6A 1CR0A 4OJTA 1DTSA 1AD2A 2CB9A 3DVSX 4JSRA 3GP5A 2O3TA 1NXOA 4XJVA 1NYLA 4U2DA 2K7ZA 2X0JA 5HKAA 9GPBA 3U40A 3E5HA 3G68A 3KAJA 2HIAA 1WTCA 3OAAA 3K35A 1XZKA 3ONEA 3QFFA 2LVBA 1E6MA 4WQMA 3TW8B 4BAUA 4BC1A 5HIKA 1CS0B 1ORHA 1DC3A 1T9AA 1CJMA 1UAGA 1XALA 5D5PA 4A8HA 3QKUA 1PO7A 4BGDA 2VK2A 1BEEA 2QM7A 1D04A 1JB1A 5FO1A 1K66A 5IX8A 1J49A 1BD3A 2Y6UA 4IW3B 5FR2A 3OZCA 1QCYA 2FK7A 3UB2A 3UWMA 2D4AA 3K1YA 1JJBA 1LFAA 3HB5X 5CXSA 2HW8A 5A9RA 3DUFB 3N8KA 3B6EA 3CZAA 2C4UA 4U2BA 1N0UA 4BX2A 2HPZA 3JVEA 1XCOA 3LO5A 1TOAA 4YK7A 3F0TA 1JHUA 3JQQA 4OA8A 3NBAA 4BZXA 1IXKA 2LXNA 2GK7A 3E15A 1CPYA 3CE9A 1OB2A 3U3ZA 3IULA 4TTSA 4YLEA 5CAEB 5C53B 4ESHA 3EA4A 1PR0A 1ZHHA 4NBTA 1W9HA 2I4IA 4WESB 1PU2A 2X4LA 1G5TA 3HEBA 1KY2A 4PTLA 5DWVA 3RU7A 1XVUA 2FOXA 2FZKA 2OHOA 4JLJA 4KZPA 3FVWA 1X42A 3FDJA 3THYB 1E9EA 1JEEA 2C9DA 1YQUA 4WV3A 2VDJA 4EQZA 2HPVA 4GMDA 4GLJA 2XLCA 4UE2A 3WRYC 3GWGA 2NUPB 4JJEA 1EVLA 1UKYA 4KVGA 4QXPA 4RJIA 1YRAA 1UJ2A 2UUCB 4MGIR 1C8KA 1P4SA 1PV1A 4ENSA 4GR4A 1VM6A 5FPKA 4YJ3F 1ZPDA 2C5FA 4EDFA 2G5TA 4EK9A 4QUIA 3KEQA 2OO3A 4L3WA 3HU3A 4LXHA 5F3DA 1V16A 1EVKA 1SUIA 1DE0A 1Q1QA 1TVKB 1TPYA 1YDEA 2QIOA 2AN9A 4IKEA 4P9NA 2COEA 3K0AB 4M8LA 2PKXA 2R25B 5CW1A 2O2IA 3UCXA 5LZ4A 1ZD8A 3OEHA 3Q15C 2GUGA 3KEFA 5I9BA 2P9ZA 1NG1A 1NVVQ 3LXXA 3NFYA 1Y34E 4RA9A 5K03A 3AR4A 4E88A 3KL2A 4Q0MA 3DF9A 4Q3KA 3SOPA 1JHRA 3QVJA 3QVSA 4OOEA 5LLDA 4G63A 1WBDA 1BA2A 1ZESA 5DIZA 3C3DA 1T1IA 4LXUA 1BYIA 4RZHA 1AQIA 5DGIA 1Z0IA 1I9CA 5ESWA 4BLRA 2BMFA 4ALJA 3V4SA 4R4JA 5I9IA 1M6HA 2X1HA 2EIXA 2YMMA 3L2OB 4I1IA 5FPTA 5MN4A 5EIBC 3B2EA 1E7SA 2PD3A 3ZWKA 4EJ6A 5D6OA 4H4DA 4RNDB 4CWAA 1XAHA 4NBKA 3D5QA 3KE8A 4E5DA 1E2EA 1ZNQO 3JYNA 3CVVA 4CEIB 5IABA 3R7WB 4CBVA 2XMDA 1HZZA 3L82B 3SSMA 2YHAA 3WYCA 1F6WA 3C3XA 3ZWMA 4ER6A 4YLYA 4S0XA 1B43A 1YFKA 3C3PA 4TMYA 4QUGA 4YAWA 3KO8A 3UJHA 4AKSA 3KSBC 3KDPA 1F5NA 1KEPA 2GD6A 3H2HA 3I9JA 2Q4EA 1DEAA 5I3CA 2Q1WA 2HOQA 4NV3A 1YZLA 2XE7A 2HZ7A 4FWBA 4ABTA 1GGKA 2F3PA 2Q27A 2F00A 1BX1A 1GKUB 4CN8A 1OXBB 5GV8A 1KDTA 3BHNA 3F8SA 4J6EA 4OQMA 5K9ZA 1C5KA 3FYCA 3GJSA 2RAPA 3NETA 4HBGA 4FGWA 4O02B 2F4NA 2PN1A 4TQUS 5H3LA 3LCRA 4BV9A 2I6SA 1BS2A 3DP9A 4XRGA 2XOKD 2YXNA 3DYVA 3BRSA 3U3MA 1NX6A 1UOOA 1E3JA 1UT6A 1ZUNB 2J5QA 3L1HA 4JB8A 4JLDA 3U7IA 1ZIDA 4COKA 1NONA 3TW8A 3FUWA 3OFVA 1BW9B 2HXYA 4GL2A 3PNQA 3UHAA 5EUQB 4KQHA 2A7XA 2FAXA 3F47A 2AHOA 1JQBA 3QVXA 2MOKA 4OQLA 4JI1B 1K8YB 1YD7A 2CYCA 1T4BA 2GPYA 4HX2A 4MI1A 1M66A 3RIHA 4IV5A 3V8MA 4AROA 1ZJWA 1FLVA 3ECCA 3OIDA 3TRKA 2NTNA 1C30B 2QUKA 3PNMA 3KOWA 4KMSA 4X1KB 4YMUA 1MT0A 2DTXA 2XMGA 2Z8XA 5AI0A 1JNXX 5HTOA 4FDUA 4XYLA 4G0UA 3NM4A 5BV2P 1Z0UA 3BL6A 2AQ8A 1C29B 5JBQA 1JW9B 3KUCA 1E2PA 1W85B 1ZG3A 3PXBA 1IPEA 3VR6A 3H05A 3STXA 3QU2A 3JYOA 2PJRA 1B42A 3LY9A 3KXPA 2YXEA 3AEKA 3QEMB 1WL8A 4LC0A 3KK0A 1XF1A 2QJTA 4HUQB 4NU6A 5L4LA 1IBMB 1CUJA 1FLDA 2EFGA 1CQWA 3CZ5A 4JUBA 4Y0NA 3RM3A 1XXHA 4XDGA 5FLXA 2YFYA 1JQDA 3ICCA 3PDWA 1AF7A 3U37A 2CK3A 2L0XA 3AI2A 3SVTA 2QTBA 3EGEA 4N01A 3X2SA 4OKNA 1GQSA 3V1TC 4HKTA 1C0IA 4TVBA 4RZIA 1XQWA 4CIAA 1JALA 3TLJA 1PQPA 3P0IA 2J5RA 4KWIA 2VQFB 1SHJA 4ILKA 4D4MA 2AFHB 2WABA 4NE2A 5IS2A 1TPZA 5AVWA 3AU9A 1T1JA 4X7RA 2ZRDA 5AHKA 5IARA 3WZLA 5LIRA 1Z6YA 4QJBA 3IE1A 1O8CA 3CF4A 4CKXA 4UU7A 3E7WA 3RRZA 4LHXA 1KIMA 2ZG6A 4NE7A 4YALA 3IVRA 2JD0A 4K7JA 3JQDA 2TECE 5TPZD 4IZOA 2VQDA 3E5MA 3QG1A 1MF7A 2P0YA 1M8KA 2D3WA 2OFFA 1DZIA 3WK5A 2VJNA 2HL6A 3WSWA 1NVTA 5JQGA 621PA 2QI9C 1HDZA 2PKEA 1AK1A 4U00A 2YMQA 4NZOA 4MYRA 4TT8A 3T41A 3REFA 1HETA 3FKSD 2VG8A 1GP2A 2BV3A 4K88A 4HXGA 5J2UB 4XE5A 5EMHA 3JWJA 4G5YA 3BHJA 2V98A 2WSBA 5B6PA 1IC6A 2HNBA 2VRWA 4H1VA 4L5YA 3VR3D 4KXXA 4DZTA 3N1UA 1NVKA 4BQPA 4LOHA 1GUZA 5ES3A 3AG6A 4L9RA 4OQPA 4P4GA 4RFSB 1WQ3A 4S1TA 5FPQA 3PKJA 3W8RA 3TL6A 4C04A 4FK8A 3Q88A 1O97D 2XCOA 2PSJA 3OLWA 3LBNA 1SC6A 3N7UA 1NVXQ 1JJVA 3NW9A 3OECA 4CCSA 1GDTA 3Q1LA 1UMCA 5D1HA 4WNAB 3ELWA 1PWEA 3INTA 2AW3A 4BBJA 2IY9A 1PEKE 2L19A 1P3JA 1VIYA 4M6WB 2XJ4A 3CEMA 3VSDA 1BWSA 1N2HA 2XUJA 3VX3A 4BUCA 4D44A 1V71A 2Z5GA 3FTQA 3KLOA 3KQYA 4PSUA 4FGSA 5ICMA 2LIVA 2C0CA 4MW5A 4ILEA 1PVOA 3THOA 3SYRA 4DN6A 1VMEA 2FF7A 1WVGA 1EJ2A 2N42A 3JAWA 4L4XA 5AUPB 2XZLA 4KO3S 1ZU5A 2Z2YA 1U8UA 2P4UA 1WKVA 3M6WA 3S2FA 1X74A 4IR7A 3L43A 4Z9BA 4Z7NB 2BTEA 5G1NA 3ZI0A 3K70B 1JR3A 2ISCA 1VLZA 1MFPA 1UC4B 1D2NA 1QGOA 2W71A 3IB3A 3K8YA 1EP3B 1H94A 3BMCA