3S2EA

Crystal structure of furx nadh complex 1
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
340
structure length
340
Chain Sequence
AMMKAAVVRAFGAPLTIDEVPVPQPGPGQVQVKIEASGVCHTDLHAADGDWPVKPTLPFIPGHEGVGYVSAVGSGVSRVKEGDRVGVPWLYSACGYCEHCLQGWETLCEKQQNTGYSVNGGYGEYVVADPNYVGLLPDKVGFVEIAPILCAGVTVYKGLKVTDTRPGQWVVISGIGGLGHVAVQYARAMGLRVAAVDIDDAKLNLARRLGAEVAVNARDTDPAAWLQKEIGGAHGVLVTAVSPKAFSQAIGMVRRGGTIALNGLPPGDFGTPIFDVVLKGITIRGSIVGTRSDLQESLDFAAHGDVKATVSTAKLDDVNDVFGRLREGKVEGRVVLDFSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures and furfural reduction mechanism of a bacterial zinc-dependent alcohol dehydrogenase
rcsb
source organism Ralstonia eutropha
molecule tags Oxidoreductase
molecule keywords Zinc-containing alcohol dehydrogenase superfamily
total genus 110
structure length 340
sequence length 340
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3s2eA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3s2eA01
2X0JA 2Q4EA 4DVJA 3FTNA 2NVUB 4WCFB 1DIAA 4M89A 1QYVA 3FF4A 4NQZA 4GMFA 5IG2A 2DKNA 3JV7A 4JBHA 3FR7A 1I33A 4FR5A 1VL8A 1F14A 4D3SA 4E2WA 5TQVA 3NX4A 4BO4A 1JAXA 1LJ8A 4XRGA 1YL6A 4WKGA 3R3JA 3Q9NA 1PEDA 1ZK0A 3QVXA 4LRSB 1N92A 3EAGA 2X0NA 3OP4A 4CODB 4UAGA 5FI5A 1D7OA 5AOVA 1R0KA 1GDHA 3CUKA 4LMPA 2FPGA 4RCVA 1ZXBA 4BNKA 4CM3A 4GGPA 1NR7A 1HE2A 1MLDA 3I9KA 1SEPA 2J6IA 3COSA 4I1IA 4OAQA 5DP2A 3W8FA 4XB1A 1K6XA 3IMFA 4N5MA 3MJVA 5THQA 3IIEA 4TMFA 3D4PA 3RUCA 4YDRA 1LRJA 3W8EA 2O48X 4J43A 2J3IA 1PGQA 4ZICA 5BSGA 4HV4A 5DZSA 4JLWA 5C7IO 3K31A 2HQ1A 3JD0A 1CERA 3WJ7A 3VKVA 4QEDA 3KV3O 1GZ3A 5JAQA 3GOHA 3I6IA 3Q11A 3E18A 1HL3A 2GN9A 3RU9A 1HE5A 1W6UA 2NQTA 3ASVA 3ZN2A 1QORA 3B6ZA 1K6JA 1JVSA 3GVHA 4KDFA 4RORA 5A9TA 3P2YA 3WGQA 2CMDA 4PG8A 3DMYA 4D44A 2HMSA 5GZ3A 3GK3A 1BSVA 2Q1TA 5I9LA 1MX3A 3AOEC 4RPJA 5JBIA 3AFNA 1J5PA 3WWYA 2J5KA 4C7JA 3ZHZA 3U4DA 2WD7B 3ANNA 1ADGA 3RWBA 2Y93A 3DHYA 1R15A 4X54A 1OMOA 1R37A 4ZQFA 1RM0A 3EVTA 4BO7A 4DL9A 1EUCA 3PXXA 4QECA 1DDOA 4CMHA 4F6LA 3PFWO 4II2A 2QX7A 3JQ9A 1EFKA 1UZNA 3WGOA 1R4NB 4O59O 3GZNA 3EK2A 1P44A 3ROMA 1E92A 3IP1A 5JCJD 4XA8A 4RF4A 2B83A 2DFDA 3LVFO 3DTYA 3W4KA 1C1XA 5KVCA 4BNMA 3O26A 3RSHA 3GF4A 1A72A 4MP6A 5K6AA 1E7SA 2A94A 1S7CA 4BVAA 3RC7A 3TFQA 2OORA 3QVTA 1DC3A 2OP0A 2WYUA 1XG5A 5KJ1A 3ICPA 2Q2VA 4FGWA 1SO8A 4PG4A 1O5IA 5EESA 3S2FA 5AQ1A 4FJ2A 4YPOA 4LMRA 2X23A 3NUGA 2BFPA 1DXYA 3PDUA 2HMWA 1U3TA 1YB5A 2VCYA 3K2BA 5BSFA 5A4DA 3QVOA 3GUYA 5F5NA 1PZHA 3OFSA 3OJLA 3PHJA 4YCAA 2VTDA 4XYBA 2D5CA 5JPIA 4CMCA 3CKYA 3GN1A 4GVXA 5ICSA 3A4VA 2C5AA 1B2LA 1GV0A 3U4IA 2E4AA 4R54A 1F06A 4LRTB 4K1LA 3ZZNA 3DBHB 3JD1A 2NNLD 4AJHA 1OZAA 3ASUA 2Q1SA 2E37A 4DLAA 1NPTO 1Q1NA 3INRA 3LU1A 4HWKA 4NPCA 4Q39A 4UVDA 3LT4A 4ZU3A 1BVRA 3DWFA 3GHHA 1O0SA 4BKUA 1E0DA 2H6EA 3GFGA 4Z9XA 4IUYA 1DFHA 2VYVD 3WFJA 1ENZA 4U8GA 2NTVA 3CINA 3FI9A 1YE3A 4MP3A 2VHZA 5DCYA 3LF1A 3IL2A 4NBRA 5K0ZA 2EJWA 2R00C 1XSEA 2W4QA 1Y81A 1PTJA 5KJEA 1HE3A 3H2SA 2PFGA 2HJRA 3HDHA 3GH3A 5G0UA 4E4YA 2X5KO 3ABIA 3JD3A 4BNZA 1U2GA 1DRUA 3DZBA 3RKRA 3ZU4A 5LCXA 1BWSA 4QXMA 1CIVA 5KKCA 3BTVA 1ID1A 5DULA 3PP8A 5EIOA 1ISFA 5T6BA 1G0NA 4BKRA 4D41A 3I4CA 4TSKA 1A9ZA 4BMSA 3OIGA 2Y1EA 1UDBA 4UEOA 2W98A 3GMDA 1R4MB 3GN2A 4BO8A 3TNLA 5L7WA 4B7XA 3KO8A 1GQQA 1T26A 2X86A 2WYWA 3GDOA 3HUDA 4PLZA 1ZFNA 1ISMA 2G82A 1DHRA 2JAPA 4IBOA 4DYDA 4TRJA 4ND4A 1OAAA 2LDBA 1Y8RB 4OXNA 4EITA 2BF7A 2X0IA 1KC1A 1O9BA 1EDOA 3LT2A 2H5LA 2OO5A 4K6FA 1EVJA 4E5PA 3IKVA 3VDQA 3WJAA 1KVQA 1Z7EA 2QRJA 2YDYA 3MCVA 1GYQA 4BV9A 2X58A 3DQPA 4W99A 1Z74A 2A92A 4E33A 4R1SA 4RPHA 4AG3A 3WTCA 1Y8QA 5EJ2A 5FFFA 4CR7A 1UXKA 4P38A 2AQ8A 2YQ5A 5EERA 2EKPA 5EINA 1M2WA 3TOZA 1HE4A 2D4AA 4NIMA 4AJJA 2Z1NA 3PLNA 4BNNA 4IQGA 4WNCA 1UP7A 3S2EA 1I01A 1E1MA 3PGXA 1UXHA 1A4UA 2DTXA 5U9CA 1H2BA 3CMCO 1AGNA 5GZ1A 3RBVA 1FDVA 1FDTA 2G17A 3L6OO 3OJOA 4O1MA 1WNTA 4XR4A 5JDCA 1LA2A 1Y5MA 4EUHA 5I7EA 1MXFA 4Q3CA 5L4SA 2YZ7A 4CMIB 2Q46A 3A28A 3ETDA 4M54A 4FPXA 2F00A 4KQWA 1WDMA 4QT0A 2X5JO 3V2GA 1E1LA 4DLLA 3GPDG 4ZGWA 4FGSA 4PLPA 4R1UA 3DFUA 4UUPA 3GUCA 3ZWBA 5I7SA 2V6MA 4IDAA 4IJUA 1RPNA 4UUOA 2DTDA 4CM5A 3FBTA 1GUYA 5CEJA 1LU9A 5CDGA 1YH3A 2PLAA 5IDYA 3WR5A 1NP3A 4C7KA 1IYZA 4RVHA 1EUDA 5JYEA 1E7WA 3WGIA 2EGHA 3QWIA 1N2SA 1GY8A 1WDLA 3PQFA 2HJSA 4HFNA 3JQBA 1BVUA 4GSLA 4LK3A 2BKAA 3EYWA 3MWDB 5T64A 4UUNA 3H9EO 5CHEA 1K3TA 1IPEA 2PZMA 3AY3A 1U5CA 3IS3A 5A04A 4TRRA 1F8GA 3RQSA 1DPGA 3WSWA 4DC1A 4ND2A 1E3JA 1Q0LA 3DOOA 2C82A 3UCFA 1Q7CA 2W2LA 3VTZA 7MDHA 3H3FA 3WB9A 3V2UA 3DXFA 1HDRA 2FSSA 3E9MA 4N18A 3RKUA 2VHXA 4TZKA 3RROA 2YV2A 3PIIA 5DNAA 3FWZA 1GTMA 2V6FA 4JJGA 3GVPA 2IEDA 4RPLA 1JAYA 4AICA 2FRDA 3D1LA 4KWIA 3I9JA 2Y1FA 2GYYA 1V35A 4LCJA 4J1QA 3ZNNA 4BO3A 4J4HA 2ZYDA 1HDCA 3PYXA 4WLNA 3Q2KA 4IINA 1RM5A 4OM8A 4GWGA 1UH5A 1ZEJA 3C1AA 1PZGA 1QYCA 2OBYA 1CRWG 3A06A 3KOUA 3JSAA 3TOXA 3F4BA 5I7VA 1YGYA 2HO5A 1H9AA 1D1TA 4OOEA 1NWCA 1T2EA 4BUCA 3QWAA 1QKIA 1NFQA 1WZEA 2EW8A 2QHXA 2CF6A 4PLFA 3KYDA 3MOIA 4DIFA 4D42A 1C0KA 1VC2A 1DFGA 5L7TA 4RZIA 3GZNB 1PL8A 3U49A 1AXGA 5F21A 2AEMA 2WSBA 2C7GA 2C54A 3WWZA 4W82A 5G2OA 4BV8A 1EVIA 3B1JA 4PLYA 4YT2A 1SNYA 1XWFA 1LSUA 4FSHA 1LDNA 3MJSA 1DOHA 2RHCA 4GX1A 3L9WA 1MFPA 1ZJZA 1ML3A 3U9LA 1ISHA 4XWYA 1H94A 1U4SA 4RF2A 2QRKA 2P9EA 1NQAO 3GGOA 2GN4A 5MGBA 3MTGA 1GQYA 1Y8QB 3F4LA 3GG9A 2NWQA 3HDJA 1DJQA 3AM3A 1RYDA 4MVJP 2O2YA 3U4CA 5EQDA 4BKQA 1UUFA 5A9SA 2EXXA 3HSKA 2ZJ0A 2RIRA 2Z95A 4WE3A 3X2FA 3IUPA 1L7EA 2BELA 2I99A 1C14A 5THKA 3PIDA 4QO7A 2FZWA 5AXAA 4NJOA 2QRLA 1PJBA 2E48A 1ZK2A 4G2NA 4NU5A 5U4QA 4BIIA 2Q49A 4B7UA 4DXHA 3ZWCA 2ZTLA 1A71A 1LNQA 3FRJA 3MJEA 4D43A 1E5QA 3G49A 3O8QB 3BAZA 4JK3A 2JCVA 1GADO 3WBBA 1E1NA 4HX5A 1C1XB 1ZSVA 4II3A 4OJNA 3CZMA 5HTOA 3GG2A 4YT8A 4OKIA 3TZKA 2IXAA 2Y67A 1XU7A 1SOVA 1T2FA 1LDEA 4YJFA 4BNXA 4E5YA 1E7RA 3WBFA 4M49A 1HWYA 2YW9A 3OEYA 3Q9UA 1HEUA 1ONOA 3DZKA 5FF9A 2VWQA 3WNQA 3QA9A 4CM1A 1D3AA 3FD8A 2FN7A 4TZTA 2A35A 2EERA 3Q1LA 1YBAA 4YB8A 4AJOA 5KVQA 1GUZA 2CZCA 1QYWA 4EEZA 1QV6A 1A5ZA 1PQUA 3EGOA 1P1RA 3GDGA 4XIYA 2WE8A 3GNSA 4DLBA 5TT1A 1HF3A 5GY7A 3BMCB 1B14A 3MJ4A 5B4VA 2QIOA 4C4OA 4R41A 3V1YA 2R2GA 3AU8A 1ULUA 4NBTA 1O95A 3MJTA 1YVEI 4DIBA 1A27A 4GMGA 5FI3A 4N5LA 4BGUA 3PWSA 3F46A 3K2EA 4Q3AA 3DZGA 5BQFA 4MO2A 2CF5A 2PH5A 2DTEA 3IJPA 1JWAB 2FR1A 2JJYA 4WASA 5CDUA 4J4TA 1P1KA 4YJFB 1DC6A 3MZ0A 3SLGA 4CLRB 2O4UX 3HADA 3EZYA 2Y66A 1W8DA 3WOHA 2ZKLA 3KHUA 1UZMA 2H63A 3PTZA 5HBRA 3ZGYA 1YKFA 5L45A 4KTTE 1V3UA 3IUSA 2YHUA 2QG4A 8LDHA 4CLRA 3FR8A 2PZLA 3EUWA 5F1OA 1QG6A 4U5QA 4MVJF 4DMLA 3BMNA 3PHIA 5ICMA 1N9GA 3BIOA 3QWFA 2EGGA 2V7PA 4Y67A 3VZRA 3LZ6A 3H7AA 1KYQA 2D0IA 3I83A 2PKQP 3OSUA 4JCOA 4ALMA 3L4BA 1YBMA 3GC6A 3HDYA 3E5MA 3ORFA 4E13A 1TT5B 4IIVA 4J9UE 2BGKA 1EDZA 1HSOA 3PHLA 4BHTA 4MKZA 3KYDB 4E2ZA 2E82A 2EWMA 2BMAA 2FSVA 2G1UA 4CM9D 2XXJA 2GDZA 4L8VA 4JJFA 4UVGA 4QX6A 1BDBA 2GF2A 3DR3A 3G17A 1YJQA 3DMTA 4GKBA 3GPIA 1UZLA 3H3JA 4WCFC 4AJPA 2QZ9A 3FNEA 1JA9A 4N7RA 4KMSA 1GV1A 4ZD6A 4MVJA 5JY1A 4NDNE 2PKQO 4R9SA 3WIDA 1KBZA 3OJEA 2JFHA 1LDMA 2AQHA 2UVDA 4RQUA 1VL0A 1BW9B 5DBIA 5H82A 3GAZA 3SC4A 2ET6A 3NT5A 1AUPA 4D3FA 2B0JA 1LSOA 4IDBA 4A26A 5KWEA 4O6VA 1HYGA 1BGVA 4U6SA 1GEEA 4CMEA 1EBFA 2O7SA 2YDXA 2WM3A 1X7GA 3BHJA 4IM7A 4S1VA 5IJZA 3PWKA 1U8FO 3IC5A 4OH1A 2J3HA 4Z0TA 4BNTA 2ZJ1A 3CSDA 2AA3A 1JDJA 2DBZA 2IDZA 3FNFA 2PA3A 4A2CA 4ND3A 3UH1A 1WAMA 2PZKA 4AVYA 3BMQA 4TWRA 3O9ZA 3VKUA 5TNXA 1CF2O 9LDTA 4FS3A 5LDHA 3V1TC 4YAEA 2PR2A 3PRJA 4LVUA 1UAYA 5FWNA 4EUEA 5HWSA 2D2IA 4B7CA 4WEOA 4H7PA 3I3OA 4CLDA 2HLPA 1QV7A 4FJ1A 4XYEA 5JC1A 1WVGA 5KOIA 4GBJA 1P45A 5JAMA 3H9JA 4O5OA 5JO9A 1IOLA 4R3NA 4RZHA 5HA5A 4KDEA 4NK4A 4TVBA 1MG5A 1Y9EA 1UXGA 1P0FA 4ALJA 4R5HA 4J6FA 5TSDA 4TRMA 4WEQA 4D79A 3CH6A 5C7LO 2ILTA 2VZ9A 1PGNA 3DTTA 1SZJG 2NACA 4MJLA 5L95A 2FMUA 4S3MA 4ZQBA 1NPYA 3PHGA 3DBRB 4XR9A 4XGIA 1DSSG 3H5AA 3D0OA 2EV9A 3KBOA 3JQDA 1QMGA 2OZPA 4AJ1A 5TLSA 1UR5A 4MVJE 1TA4A 1NM5A 4Y6SA 4URFA 3ULKA 1B8VA 3IAHA 5AXDA 2ZTMA 3AI3A 4MP8A 1F17A 1Z82A 4M87A 3A1NA 2XF8A 4OHUA 1KVRA 2XPCA 3KEQA 3TZHA 2IRWA 4BNIA 2AEFA 4L4XA 4Q3EA 3HFSA 2C2XA 5L51A 5DBGA 4BNHA 5CG2A 1YQXA 3BTSA 4Z0PA 3D4NA 4JN6B 4MVJD 2GASA 2B5VA 4BNFA 3L77A 3WLFA 1SPXA 3NT2A 1N9GB 4RGBA 2VHVA 2JD2A 4RDIA 3DZJA 4GGOA 4PLHA 1HYHA 1N1EA 4J2OA 4DPMA 2OGUA 4J7CA 2ZQZA 3E48A 2P9GA 1FDSA 1WDKA 3MJCA 4YVFA 1E7YA 2DUUA 2VUUA 3I1JA 4UVEA 4CM8A 1BRMA 1H6DA 4J9VA 3M2PA 2PZJA 4R1NA 5T57A 4GVLA 2FR0A 3ITDA 2VRBA 1YOVA 4CM8B 3PPIA 4QO8A 5I8ZA 3DAGA 1UP6A 2X4GA 2X0RA 4KTVE 5KIAA 1GZ4A 3JQCA 4HNHA 3HQ4O 3MTJA 1MA0A 3P7MA 1MGOA 4RVDA 2HMUA 2AQKA 4HY3A 1LX6A 4P4LA 1WW8A 1YXMA 4TQGA 4M86A 4IXTA 1HRDA 3ZNQA 3DBVO 3UKOA 4CQLB 4PVCA 3RC1A 2GUGA 4JJIA 4CLEA 4CMGA 2GD1O 5KJFA 1X0VA 3H9GA 4EW6A 2FZEA 3BXXA 1E3LA 1ENPA 3H5NA 3Q3CA 4EI2A 1ENYA 3NJ4A 2QZZA 3LDHA 1VI2A 1XQ1A 4OSOA 1X0XA 3G3EA 3LYLA 2GNAA 3WQRA 1F0YA 1VPDA 4OQYA 4BKOA 2W90A 1E77A 4AFNA 4ID9A 3UHAA 4BKPA 4IDDA 3IKTA 3C3XA 4D0RA 4K9DA 1XDWA 3EY4A 1HKUA 3VHRA 2OP1A 4OYRA 4IZHA 1A9YA 3O8QA 1P9LA 4CQLA 4ITUA 2X9GA 4CM4A 4OGWA 1NAHA 4J1SA 5F1KA 4BNVA 4IIUA 2BGLA 4TRNA 3KVOA 2DBRA 2GO1A 3PGJA 5G4LA 3KSDO 3ZWYA 3QHAA 3C7DB 5TT0A 5DN9A 3WSVA 4AL4A 1B26A 1LC3A 3D4OA 1I32A 3UCEA 1E6UA 3RU7A 1SC6A 4LSWA 4Y9DA 1NFFA 4A7PA 1XCBA 2Y0EA 1ZSYA 4YT4A 1C1DA 1I3MA 1Y7TA 3LC2O 3OM9A 5BSHA 3WGYA 1BXGB 1I2CA 3OQ6A 1V3VA 1VJ1A 2CDBA 2BGMA 1PJ4A 3FNGA 5CFZA 2EIHA 2Y0DA 3GHYA 4JROA 3EDMA 2RHRA 2W2KA 1IPFA 2AXQA 3EVNA 4W7HA 3SVTA 3RCBA 3ZW9A 3DBHA 3NGLA 2Y1OA 1K0UA 3JQEA 3E9QA 1Y6JA 3ONDA 3ROQA 1GR0A 3HE3A 3U3XA 4FDAA 4CV3A 1ZK3A 1H93A 3VPFA 3C24A 5BT9A 3RUDA 1H6BA 1X14A 2PGJA 3WYBA 3L9XA 4XEHA 4CM9A 2TMGA 2BFOA 1ZMOA 3VPHA 1U3WA 3F3SA 3Q6IA 3TSCA 1E6WA 4P4NA 4J49A 4PG7A 3VH1A 4XQCA 2NVWA 5ITVA 5F1PA 4KQXA 2I66A 1R4NA 2G76A 4L75A 1RM4A 1ZVMA 4DYVA 3KB6A 2W2LD 1C3VA 1LLDA 3ZWWA 4K26A 4RDHA 1ZK1A 3T7CA 1NQTA 1W73A 1ZSNA 4WPGA 4YQZA 4YJGB 4B4UA 1GPDG 5CAEA 1U7TA 4WLUA 2V6BA 1BXZA 3PZBA 3CIFA 4W6ZA 1YOVB 3B1KA 1Y9AA 1X15A 3TDKA 2X1HA 4BMNA 3CEAA 3D64A 3WMXA 3ENKA 3VAZA 1OBFO 3ETGA 3K6JA 1NTOA 5IF3A 4R5MA 3GVXA 1ZEMA 4EBFA 1A7AA 3NGXA 3AFMA 2OL4A 3L4BC 3K9QO 4AJ2A 2P4QA 3HB5X 3H5RA 4GAEA 3AUSA 3BZUA 4NR0A 4XGNA 3ANMA 1WLYA 1ULSA 4DBVO 2O3QA 4K6CA 2VWHA 4H15A 4I8XA 1AHHA 1T2DA 1RWBA 2I3GA 5AXBA 1DC5A 4IMPA 2IZ1A 2GPTA 1ZCJA 1PJQA 1T1RA 2JFGA 3OICA 2B5WA 2TMDA 2ZQYA 2IE0A 4P8RA 4E0BA 4LW8A 5CEFA 4EJMA 5B4UA 2EHDA 2VT2A 4JIGA 1J49A 1D8AA 1H6AA 3RI3A 5IXSA 4B3JA 1SCUA 2Q2WA 1DEHA 1U9JA 1EQUA 3LT0A 4IGEA 4HFRA 4JP2A 3ZNOA 1V0JA 1VRWA 3ZNPA 5G0VA 3PFFA 4NU6A 1EEHA 1P31A 5H83A 2V65A 4Q3DA 4HKTA 1XHLA 3G1UA 3H8VA 4EEXA 1BW9A 2GSDA 3C1OA 3H9QA 1U7HA 3NDRA 3RJ5A 4KP7A 4RVSA 2GGSA 5L7YA 2WWRA 4QUKA 3R3SA 5A5EA 2GCGA 3OQ1A 3EC7A 2YUTA 3UW3A 2YV3A 4XYGA 1VL6A 1E3WB 2B35A 5IAAA 4IMRA 3KLPX 2EKLA 4PZEA 1M75A 3PVZA 2VHWA 1PJ2A 3LC7O 2WYVA 3RVDA 5KCZA 3E6AA 4E5KA 5IZ4A 3DOCA 3ST7A 5K9ZA 4YAJA 1I36A 2YY7A 1E3WA 1GAEO 1LTHR 1X1EA 3OH8A 1GZ6A 3G0OA 2Q2QA 4Y6RA 3I52A 3A14A 1TT7A 3EMKA 2C0CA 3V2HA 3W1VA 1U5AA 2VTEA 1L7DA 4UREA 3VH3A 3TPCA 1JKJA 4DUPA 2WMDA 2ZB8A 1NR1A 3KTDA 5ITWA 3ZU3A 3AJRA 1N5DA 4J0FA 4U7WA 2A9FA 4YRDA 1WP4A 5A06A 1PZEA 4HFMA 4YEDA 1P0CA 1I0ZA 3ZU2A 4Q3NA 5JSFA 2VYNA 1Y8RA 4RF5A 2G0TA 2RAFA 1Z73A 3HN2A 3OBBA 4QFDA 1EVYA 2C5EA 4E30A 2HSDA 2CVQA 4R68A 2UDPA 5GMOA 3N7UA 2AG8A 2WD7A 4RO0A 4N54A 2H9IA 3AUTA 4ZRNA 5L40A 1H2HA 4UEKA 4WNIA 5G0SA 5COAA 1GCUA 3QQPA 1TB4A 5IN4A 5U1PA 3FHLA 4I08A 3PYMA 2DAPA 1X1TA 2ZCUA 1PGPA 3OJFA 4PLWA 4YJGA 5CDSA 4KOAA 1PJCA 2XXBA 2BH9A 2Y1CA 3KYBA 5B37A 3F1KA 4IJKA 1QYDA 3B20A 1LSSA 1DIHA 3FWNA 3V1UA 3GLQA 4I9UA 3RASA 3ZDFA 5HRUA 5I8WA 5L9AA 4NHEA 4BNLA 3NRCA 1E7MA 1IZ0A 2PK3A 3F9IA 3L6EA 1R66A 4B4OA 1WPQA 3AY6A 3CE6A 4KWHA 2AEJA 2OOSA 1I10A 3MOGA 4PIVA 1P33A 1ZO8A 3ON5A 3VC7A 2R00A 4GLOA 3GY0A 3ZCXA 1DRWA 2HMVA 3UCXA 1SEVA 3C7AA 1HZJA 3OEWA 4DPKA 3RD5A 4K28A 2YFHA 3NKLA 3GQVA 4U0KA 5G0TA 2JFFA 3GNTA 3O4RA 3WDSA 2Q1WA 3S2IA 2HU2A 1HYEA 1YB1A 1KC3A 1I3NA 3O03A 1HLPA 4WECA 1LQTA 4LISA 3L4SO 4DIOA 1Z75A 2DT5A 1U1IA 2NU9A 3PDJA 4NJMB 2VWPA 4EYEA 3DFZA 4Z9YA 4FFMA 3C7CB 4PLCA 1PJ3A 4Z3DA 3D5QA 1Y5RA 3NAQA 1I2BA 1AE1A 3WGTA 1XLTA 2PY6A 3VZPA 4PCVA 4OL9A 1RKXA 3ZWNA 1E1KA 1ZH8A 1SAYA 2ZCVA 3W8DA 2C59A 2HDHA 3WLEA 1GYPA 4XZ3A 5CEEA 1C0PA 5F3RA 4PZDA 3U0BA 3VTFA 4J4BA 2Z1MA 1DB3A 4BS9A 2RCYA 3F47A 5A9SB 1I5RA 4ZRMA 4ND1A 3GGPA 4BNGA 3AI2A 4YA6A 1F12A 1HZZA 2O23A 3L6DA 3HWRA 5ILGA 2JKVA 3B1FA 3VVBA 3QVWA 4FOSA 4FQ8A 3JQ7B 1EVZA 2IZZA 2X6TA 5JCJA 1ONNA 1P1HA 4B8WA 2X9NA 5C7OO 2DFVA 4HNGA 1PR3A 4D45A 5JC8A 4PG6A 4MIOA 1LDYA 3EW7A 3JQGB 1PL6A 2HMTA 3GRKA 1MV8A 2CVOA 2PH3A 1GQ2A 2C7VA 2PGLA 5K6AC 1NX6A 3SJUA 2ZIZA 2I9PA 4L0QA 5EN4A 1E6EA 3DBLA 5JAZA 5I7FA 4FCCA 1TVEA 3GVIA 4HXYA 4NI5A 1ARZA 4YQYA 2NUAA 3GEDA 4J1TA 4MKRA 1P1IA 1JW9B 1TT5A 3BMCA 3AK4A 3RUHA 4IQ0A 1BG6A 1DFIA 4CMIA 1D4FA 4QTZA 1LEHA 3GEGA 4HP8A 4BOYA 3SJ7A 4I5DA 4B3HA 1HDOA 1N1GA 1X7HA 5TC4A 1PS0A 1OC2A 3K73O 2GN6A 4KUHA 3O38A 3G79A 4OQZA 1PU2A 4YR9A 2J5RA 3IJRA 1Z7BA 1PIWA 3D3WB 3W4IA 2GN8A 4D3DA 4XYLA 4E5NA 2GZ1A 3BHMA 1LDGA 1YONA 4O0LA 2VYVA 3BHIA 3DL2A 4L9RA 1ISGA 4TROA 2HKIA 3KSZO 1M76A 2UUOA 1KEWA 3JD4A 4IXWA 3FN4A 3QY9A 1VE9A 4P22A 5GZ6A 4Z9FA 1DJNA 4ND5A 1E3SA 2UAGA 2VQ3A 1B3BA 1NQOA 3HHPA 4PVDA 2JAHA 2CD9A 3AI1A 2O2SA 3E1KA 1IZ9A 4FFRA 5HS6A 5A3VA 1GU7A 4ILKA 1IHYA 2GERA 4G65A 4FC7A 2POQX 2YQ4A 2ZTVA 4BNWA 5JW6A 3I9MA 4CMKA 1KEVA 1WWKA 3PI7A 4GX0A 3WQQA 1FF9A 1QP8A 3S55A 2WEKA 3OJ0A 4CMAA 1OC4A 1V3TA 2DLDA 1Q7BA 4BO6A 4IDGA 4NFYA 3BYZA 1CWUA 1YQDA 4ZQEA 4CLHA 5CPFA 1H9BA 3UFXA 4YAIA 1K5HA 1ISIA 2F1KA 3SBOA 2B4TO 3L07A 4JXKA 3TZ6A 4CL8A 3DONA 3DHNA 3FTPA 4DC0A 1GPJA 5JYDA 3W6UA 4CMEC 2BFAA 1SB8A 5COBA 4MKXA 3SC6A 6ADHA 3TZQA 1ADBA 1JVBA 5ES3A 1AN9A 2DPHA 4OOFA 1VSUA 1EMDA 1PS9A 3LC1O 3PLRA 1E3EA 4J0EA 3K30A 4NBWA 5KVSA 1ZIDA 2VHYA 4B3IA 4OO3A 1PWXA 3VH2A 5TX7A 8ADHA 3STHA 2VRCD 3MEQA 4WCFA 3DMTC 4YJHA 5JS6A 1TLTA 2O3RA 3PWZA 3U5TA 4GQAA 3P19A 1EK5A 1N8KA 1LC0A 3KM0A 5TGDA 1I30A 3NDIA 3VZSA 4DWVA 2Q3EA 3IOYA 2PGDA 5L4LA 5J23A 4CMJA 2GZ3A 4OMUA 4R3WA 2I67A 4L4RA 2C20A 1IE3A 1XGKA 4OXKA 3NJ8A 4AJKA 3ICCA 4E2XA 1TXGA 4L73A 1ZXLA 4YACA 4CM4B 4MVJI 3VZQA 5ENDA 4CM6A 2BI7A 1JQBA 4J3FA 2Y1GA 2Z5LA 4Z0HO 4ZQHA 4BGEA 4J7XA 3VOSA 3H65A 5B1YA 4IQ8A 1WMAA 3C1TA 3DZFA 2OMEA 1NPDA 2RH8A 4P4GA 3OQBA 4AJIA 5JNLA 2HRBA 4NG5A 1S6YA 1KIFA 3RUEA 2J8ZA 1GYRA 3T7EA 2ZB7A 4BB6A 3DBRA 1DC4A 4RPKA 3T4XA 3QIVA 1M66A 5I9MA 1NFRA 1DLIA 2IODA 3PHHA 4ROSA 4CV1A 4BO1A 1KVUA 1U28A 1EK6A 2NQ8A 2I65A 5COQA 1JKFA 3UN1A 1KEUA 3IP3A 1JWBB 1B3RA 1R12A 2UUPA 3DAFA 3RBXA 3RC9A 3ZW8A 1K6IA 4YYZA 1O94A 1Y1PA 5B4TA 5IDQA 3GDFA 4GKVA 3ZI0A 1Q2XA 3L0DA 2I6TA 7ADHA 1XELA 4A0SA 4N5NA 4BO0A 2P5YA 4FIZA 4Y8VA 4JQCA 3BMNB 5T8KC 1O8CA 2O3UA 2OXIA 4BGIA 5JDIA 4E32A 1XYGA 2W2KB 4HBGA 1QR6A 3M1AA 4PRLA 4I9HA 2CVZA 2HAEA 4RV9A 3K96A 1G0OA 3QLJA 1LQUA 3JYNA 2FY8A 4JX8A 4CR6A 2SCUA 1W0CA 2DBQA 5DCUA 2HCTA 1B16A 1PGOA 3G1TA 3WXBA 2O3JA 4CR8A 2Q50A 3RBZA 2VWGA 2ZB4A 4RLSA 3OA2A 5TJHA 2NVBA 5DOVA 3ZV3A 4AJEA 1G1AA 1U8XX 1UDAA 4I5EA 3T4EA 5ILOA 5CG1A 2P4HX 1E7QA 4WLVA 1B15A 1T25A 1I24A 5G4KB 3VPGA 3JYLA 1YQGA 1NXQA 3GT0A 2FPIA 4NMHA 4GX2A 3AM4A 3I23A 4FC6A 3GRPA 5I9NA 3PJEA 2XAAA 1FDUA 4IY1A 1YL7A 1ZNQO 3ROKA 2P2SA 3WMWA 3I6QA 4H16A 3INGA 3ONFA 2PKRA 5KVVA 1NAIA 1ISJA 1HDXA 4E2YA 2IYOA 3NTQA 5AVOA 3JD2A 4XJSA 2J3JA 3UUWA 1DAPA 3FNHA 1UXJA 4R51A 3RJ9A 3GFBA 1EE9A 3LLSA 4XQGA 3DB2A 4YJDA 3WX0A 3VDRA 3PJGA 2VZ0A 1F8FA 4CQMD 3UICA 4B4VA 2DC1A 3RC2A 1DIRA 3S1LA 2B4RO 1IL0A 4KZPA 4WLEA 2JHGA 1HDZA 4LCEA 2Q1UA 1ONPA 4DQUA 9LDBA 1T4DA 1CDOA 1CJCA 4ZQGA 1VM6A 2O4CA 3MWEB 1OFGA 1W4ZA 2I3AA 4BO2A 5JMPA 4INAA 1Q0HA 4L4SA 1LRLA 4PLGA 2GR9A 5JE8A 1NNUA 3JQAB 4NBVA 3M1LA 4GL4A 4ZA2A 4DRYA 3ANLA 1PQPA 3SEFA 5TRTA 4Q3BA 4U0JA 3KEOA 2X5OA 1K89A 1ZMTA 4LVCA 4NK5A 3TQHA 3PQEA 4I5GA 4YTEA 4NH4A 1A7KA 1YWGO 3OIFA 1BXGA 1ZUD1 2PD4A 1R6DA 3JYQA 1O89A 1CETA 3TRIA 3DZIA 4DTIA 2VNAA 4PG5A 3OIDA 1PSDA 1QLHA 2QYTA 3JQFC 1QRRA 3DAPA 3E82A 4G5HA 1IB6A 1EE2A 5CDYA 4ESOA 3QV1A 3HN7A 2AE1A 2AMFA 5ER6A 2BRUA 1UP4A 4GLLA 1NHWA 2NLOA 2ZATA 3AWDA 3INTA 3QVSA 4DQVA 4IS3A 4PLTA 2EP7A 1YS4A 2X22A 3AU9A 4BO5A 4NNJA 4IDCA 4W7IA 3OETA 4B79A 2OBNA 4LN1A 3GGGA 3IDSA 2D8AA 3KZVA 3QSGA 1NASA 1TI7A 1C0IA 1R4MA 2PD3A 4IDEA 4Y6PA 3QP9A 2B69A 1HXHA 3V5NA 1J0XO 5A3JA 2HK7A 3JQBC 3TWOA 3D3WA 1I8TA 3ZWMA 2EG9A 1D1SA 3HNPA 4GWKA 4OXYA 3OECA 1LLQA 1T2CA 3JYPA 4OSPA 3WGZA 2JCYA 4L74A 4YRAA 3OMLA 3GMSA 2CY0A 4QSMA 3FBGA 5JMWA 5EQFA 1ADFA 1G6KA 4MIEA 2DBVO 1LDBA 4W9NC 3IQDB 4XDYA 1VKOA 3ZHXA 4NZ9A 3GZ4A 5JAIA 5KTKA 3DO5A 5T67A 4WCDA 1P1FA 4TKMA 4BNYA 4XRRA 3ZWAA 4WK6A 1BDMA 4CL3A 1LLCA 2GLXA 3GNQA 5AYVA 5JDCC 4XGKA 1I2ZA 2J3KA 2BFMA 3DZHA 4YT5A 6LDHA 2WD8A 1XA0A 1HDGO 3OF2A 2NM0A 3M6IA 3DOJA 3BMQB 1DO8A 1P1JA 4AJ4A 3AOGA 4HFJA 4RPGA 5ENVA 4DPLA 2W8ZA 3VPXA 4BQRA 2CFCA 1HTBA 1YDWA 5A02A 5T8KA 3AY7A 3WNVA 4GX5A 1XU9A 2YJZA 3KYCA 4DGSA 3QWHA 3JQAA 3ROPA 3H4VA 3P5SA 4R16A 4CV2A 4M8SA 3FSRA 1UXIA 4FBGA 3KYCB 5B12A 2PV7A 4IGFA 1WZIA 3PJDA 3WG9A 4Q9NA 2G5CA 2VT3A 3TJRA 2NTJA 3N58A 2X9VA 1SB9A 4BO9A 4M55A 2E6UX 3KXDA 2FOIA 2HUNA 3DBLB 1PS8A 3ADPA 1MXHA 1DAOA 4ALNA 3PYLA 4OKNA 4YAGA 1YBVA 1LXCA 3F5QA 3H2ZA 1U4OA 3C85A 4BB5A 2HK8A 3TF5A 1M6HA 2DPGA 2EKQA 3AUAA 1CQJA 1XQ6A 4YXFA 3PZRA 1PWZA 1IHXA 3VVCA 1B7GO 4KUEA 4CUKA 5L4NA 1EUZA 4EJ0A 3LQFA 2WJPA 3DC2A 1R16A 4R01A 1XKQA 1FJHA 1IY8A 1CEQA 1BTOA 4JBIA 1U3UA 3GAFA 2C2YA 3HZZA 4YWJA 4GI2A 1J6UA 2EF1A 1E5LA 1YB4A 2B4QA 1PGJA 2P5UA 5A1TA 4GPD1 3WTBA 3FCOA 5IN5A 3TL3A 1AXEA 2Y1DA 1VJ0A 2HK9A 1ORRA 3WQSB 4J1NA 3VPSA 4XYMA 4YRBA 2Y99A 4JNKA 4B4WA 4CUZA 3CMMA 4CUJA 4JP3A 5C3MA 5A9RA 1HDYA 4F46A 3UXYA 3H9UA 4EJ6A 4XX0A 1C0LA 3NTOA 1RYEA 3RUAA 4CPDA 1KVSA 4TVOA 3F5SA 3QRWA 4JGBA 1N7GA 1WXDA 1KEPA 2NV6A 3I9OA 2VNSA 5G4KA 1KETA 2WTBA 1YO6A 1QLJA 3AM5A 4PN3A 1ENOA 2Y0CA 1ZZEA 4BGVA 3U4HA 1P74A 5BNTA 3NV9A 4R4JA 4DA9A 3Q2IA 5L53A 1H0KA 3FPCA 1X13A 2EJVA 1J4AA 5EPOA 4NJMA 1VLLA 2ZYAA 3LSYA 1EFLA 2AHRA 1NVGA 3NYWA 4J7UA 1JLLA 1H5QA 2AQIA 3H6KA 3NT4A 4WLOA 5KJCA 2DUWA 3WIEA 3S8MA 3F1LA 2QQ5A 3KLMX 4IJVA 2YYYA 3JQGA 1EZ4A 2CDAA 3EHEA 3LF2A 4W4TA 2WDZA 5CPBA 4XDZA 5TIIA 2AE2A 2V6GA 3JTMA 4XQ9A 1HETA 1P77A 4XQEA 3WYCA 5DT9A 4D7AA 5IZCC 3RFTA 3CTMA 1CYDA 1XIVA 1LUAA 1RM3A 1FXSA 2AG5A 3CZRA 4MVJG 2DU8A 4XIJA 5T5QA 2YV1A 4A03A 3ZHBA 2Q4BA 4J16A 3ZWOA 3JYOA 3PJFA 2B37A 2OFPA 1KY5A 1M6WA 3ITKA 4DBZA 2PTGA 3JQ8A 1KY4A 2E49A 5C37A 3K8ZA 1XEAA 3JQ9C 2ZB3A 1SBYA 2FP4A 3WICA 5FEUA 1KVTA 4UULA 3VH4A 4FJ0A 3LK7A 1BHSA 1Z6ZA 4CLXA 4A27A 3JQ7A 2A4KA 4FW8A 5BSEA 4ZJUA 2NU7A 3AUUA 2OHXA 2FR8A 4IJWA 1PR9A 1OOEA 2D1YA 2YFQA 2ZYGA 4YJHB 3AOEA 3JQ6A 5JCXA 4BMVA 1DHTA 4PRKA 2GRAA 2CNBA 2FPPA 3NTRA 1DBVO 4ZHSA 3ONEA 5KNLA 4LGVA 2DQ4A 4RF3A 2Y05A 4WJZA 1HLDA 4PLVA 2PNFA 4PZCA 4CLOB 2IZ0A 3D7LA 4FD3A 4B8ZA 2J5QA 1QYXA 2ZK7A 2AW5A 4BQPA 4MVJH 1NBOA 4FN4A 4WGGA 4E6PA 1VKNA 3JQAD 1V6AA 3R0IA 2VZ8A 3RUFA 3PEFA 5LDGA 1NVTA 3WS7A 5FYDA 1MUUA 5IZCA 3K92A 4F3YA 3UF0A 4O63O 1A4IA 1QXSA 3SXPA 2X7HA 3RIHA 3OA0A 1B8PA 3QWBA 4UEJA 3E8XA 4Z6KA 4I5FA 1NHGA 2O3TA 1Q7GA 1ADCA 2JHFA 2P9CA 4FFNA 5BNFA 4CMBA 2I76A 3E5RA 3SLKA 5JY6A 5MDHA 2IEBA 2JD1A 1X7DA 5JO0A 2CDCA 1NQ5A 2QYSA 4CQMB 2BHLA 3M2TA 1TEHA 4HADA 1IUKA 4A5OA 5A05A 4NFHA 1LSJA 3ZV6A 3TL2A 5IXYA 5LC1A 2Q45A 4MPDA 2R6JA 4J90A 3Q0EA 1WMBA 5HS4A 4F6CA 1I3LA 1T24A 2NU6A 1O6ZA 1VSVA 3GA0A 2YHIA 3ZU5A 3RUIA 1PZFA 4RJTA 2QW8A 1BXKA 5C5IA 3DDNA 2BI8A 4MIYA 3OHSX 1OI7A 1U2DA 4DREA 5IDXA 4RL6A 5K1SA 1E3IA 5TF4A 4A73A 3E9NA 4EGFA 4WOKA 4RVUA 3ZWVA 4WOJA 1GEGA 2EW2A 4G81A 5AXCA 4E5MA 2P68A 1T2AA 1V9LA 3ZH2A 2BLLA 3U62A 3UOGA 2FWMX 3W6ZA 2JCXA 3ZWXA 4WLFA 3A9WA 4J2HA 3PK0A 1YJ8A 4IZIA 1JTVA 4CQMA 1R0SA 2NADA 1ZKMA 3TZCA 1DLJA 3HJAA 1GD1O 3S2GA 4NBUA 3TFOA 4E12A 5KKAA 4A10A 1VJTA 3ZWPA 1SMKA 2IXBA 3LT1A 1HSZA 1RJWA 4GH5A 4QFCA 3HDQA 4HUJA 3B70A 3EZLA 4CJXA 4ZN6A 2C07A 2VOJA 1LRKA 2CUKA 2EEZA 3C8MA 1UDCA 5DF1A 3PQDA 3NEPX 2FHSA 2D59A 2Y68A 4GSKA 4LSMA 4I9NA 5F5LA 1DIGA 1L1FA 3W4JA 1GCOA 2DM6A 5BR7A 4J91A 1KERA 1B0AA 1FMCA 2WE7A 2GZ2A 1PJTA 1QSGA 2H1SA 3D5TA 4XJTA 5H81A 1CQIA 4MVJM 1LLUA 4BNUA 3QW2A 4XCVA 4UVIA 5IDWA 1EQ2A 2D3TA 1NVMB 2O3SA 4FB5A 3R1IA 2NVUA 1P3DA 3E03A 2DVMA 2LDXA 2NSDA 2IYPA 3D3EA 3DHEA 3HB4X 4XB2A 1NYTA 5L3ZA 3V8BA 2UV8A 5ADHA 5DOZA 4DMMA 1MC4A 3KSUA 4TKLA 2Q99A 1DRVA 4RQTA 4UVHA 4IDFA 1MG0A 3I5MA 1JU9A 3N74A 2PWZA 3JCZA 3KUXA 3P2OA 2XOXA 1LBEA 5EMHA 1V8BA 3BMOA 3BTOA 3GEMA 4KUGA 5A03A 5JXWA 3CPSA 4XD2A 4CLOA 4FFOA 1B8UA 3I9LA 4ALLA 1UJMA 4DQXA 4Y98A 5CP8A 3ADOA 4ZVVA 4R9RA 1PJLA 3X2EA 4FOOA 3LLVA 3WYEA 3FPLA 3BMOB 5TJ9A 1BMDA 1MC5A 4ALKA 2NTNA 5JFOA 1MP0A 4IPTA 2EP5A 3UAGA 5DBFA 2B36A 3BTUA 1AHIA 4H3VA 1R0LA 4XKJA 4CV0A 4D46A 3ENNA 4E31A 4OIMA 5JDIC 1GFSA 1C1DB 5G0WA 5HM8A 4Z3KA 2JL1A 4CM7A 4EZBA 1K2WA 5CDTA 3AW9A 3R6DA 4ALIA 3SX2A 2PD6A 1NWHA 2CSUA 2P91A 4NFSA 2HRZA 3ZHYA 1EBUA 4BNJA 2RH4A 3HG7A 3HFGA 4M1QA 4U6QA 1ZJYA 5EL0A 4FFPA 5KJ6A 1PQWA 2O50A 2X8LA 1DIBA 3BA1A 3QE3A 1IULA 4RLHA 5BNIA 4W9NA 3ZV4A 3U09A 1ZW1A 2O7QA 2NU8A 4YAKA 3CXRA 1UAGA 1PL7A 2UYYA 3K5PA 3ETEA 4D0SA 1KS9A 3QJ5A 1JKIA 4MOWA 4WUVA 1YL5A 1U3VA 3RFVA 2VUSA 3WGGA 1SOWA 3UVEA 2D5AA 1LI4A 1MFZA 3KRTA 4FFLA 2ZTUA 4R69A 1GL3A 1ZBQA 2VYND 1GUFA 5TS3A 1KOLA 3UGKA 4UUMA 1T1SA 1PJSA 1I3KA 4QQRA 4E21A 3KETA 3RFXA 3I4FA 2I5PO 5DP1A 1HT0A 3ZV5A 3WGHA 2RBEA 4R1TA 2VOEA 2VN8A 4EUFA 2JD0A 4F45A 4MINA 4PGFA 5DCWA 2VRCA 2VUTA 4PFJA 4L76A 1YDEA 4MDHA 1H6CA 3JQ8B 4YBZA 1YRLA 3GVCA 3F6YA 4JBGA 1N7HA 2C29D 3RAJA 1PX0A 2OUIA 3GR6A 5JLAA 4AJNA 5ER9A 1FDWA 2BD0A 4EDFA 3TN7A 1ZK4A 3I9NA 1MB4A 2YHIB 3DEYX 1JN0A 4AJLA 3WFIA 1Z45A 1M67A 1XR3A 4RVGA 4E3ZA 5DDIP 3NDJA 5IFLA 1T4BA 4BL5A 4IS2A 3JQFA 4RVFA 4ONEA 1FK8A 1Q0QA 5A5FA
chains in the Genus database with same CATH superfamily
3SE0A 4WZAA 1E9RA 2Q4EA 3RV3A 1T9AA 1SHJA 3PFGA 5ALKA 1YZFA 5JYCA 1U8YA 1IZ7A 3NZEA 2G71A 3HGQA 5DMXA 1PTKA 3LX5A 4XTCS 5H68A 4A8PA 4F91B 2NSHA 2GWHA 5KTNA 4FR0A 4M99A 2CCJA 1G8KA 1Z6GA 4P7KA 3TGLA 4BY9E 4HMPA 1Z7YA 2PIAA 1LB1B 3LBNA 4WW0A 2PLWA 4FR5A 3EPHA 4C0HA 1KZGB 3IBYA 1IY9A 3L6RA 1QF9A 1W44A 2ALJA 2R25B 5CA1F 1CUXA 1CY6A 1H66A 2CCGA 1XVAA 3MLAA 1T1EA 4BJ1A 2YNMC 4XRGA 4WKGA 4YRQA 3R3JA 4CE6A 3HU5A 3EPKA 1TJ4A 1CB0A 3UC9A 5FWXB 1U0EA 3EAGA 2C77A 2QN8A 3OP4A 1NW4A 3QU2A 4A1OA 2X1MA 4BNKA 3GMTA 3CUKA 4LMPA 3G9QA 1JBEA 2PVCA 3NASA 3R9IA 4CM3A 4GGPA 5IASA 2PMKA 2W6IA 4AY2A 4V2UA 1MLDA 1SEPA 2J6IA 1BHQ1 3LOPA 3W8FA 3KOZA 4Q00A 2QSYA 5CNMA 1K6XA 2X7JA 1RC1A 4M37A 1YV9A 4YMIA 2X13A 3MPUA 4L51A 4TMFA 1P39A 4WZBE 5KYUA 4MO9A 2XMSA 2R5FA 1CEXA 1LRJA 1QVZA 4KO1S 3ZCTA 5JMOA 5KAMA 3LBIA 3OCZA 4BFTA 2J5BA 2XCUA 4R1MA 5JSHA 1Z07A 4KV9A 2X9LA 4JLWA 4F9FA 3BWXA 1T1JA 1E1QA 4WXYB 5CFPA 2QAJA 1CERA 2QTBA 5F2NA 3Q8WA 1CYEA 3I6IA 3L7CA 2I6SA 1JQLB 2GAJA 1K27A 4PAWA 4FHCA 2AX4A 2VVTA 4BLRA 5DBOA 1QORA 3LYUA 1EX9A 1SZDA 3K4QA 4QNMA 1JFLA 4PE5B 5A9TA 1H2RS 4C6SA 2YXNA 4MQ5A 5T4FA 2CMDA 2R8EA 1S8AA 2X19A 3QOXA 1A9XB 4RACA 1EGQA 4KVFA 4QGAA 3T9EA 3IODA 2HDOA 4CHTA 1LV7A 1MX3A 3CEHA 3EH1A 4NMWA 1R4ZA 3GRRA 3EDYA 3ZDAA 1FFSA 1OBVA 1XKLA 2IOQA 2RI1A 2XA9A 3AFNA 3NVKI 1OSNA 1MB9A 5HUQA 4FHGA 3SLRA 4BASA 4Y2RA 1ADGA 2WYIA 4RY0A 1D6SA 1NI5A 1W48A 2DQSA 2PX6A 3ANXA 3DEZA 1X1AA 2P1DA 1S2IA 2Q6OA 3EGDB 4X54A 1AKMA 3CRNA 5INTA 1QP0A 3TTTA 5JG7A 3HP4A 3MQ4A 4KXXA 1DBRA 3O8BA 1WQ3A 4JEIA 4QECA 4ZC1A 3SZLA 5TPZD 3KVNA 1UZNA 3WGOA 2A9KA 1VIMA 5FTWA 4O59O 1OLSA 1D2EA 4ZCTA 3REGA 1P44A 2O8CA 2VDRB 5JCJD 2I1VB 3D2LA 5JSKA 2DFDA 2V1XA 3DTYA 3V8VA 3U81A 4L0DA 3EIQA 3WIVA 3B5IA 4REMA 3BB3A 4B17A 1CY7A 1U0NA 3GF4A 1SVMA 2NUPB 1E7SA 2V7UA 4PQRA 4Z4GA 4Q9AA 3G8AA 4O08A 3A31A 3QVTA 4F1KA 3ZBQA 1N3LA 3F7OA 5YASA 1GNVA 1DC3A 1ZVQA 4EYGA 2H7YA 4LGMA 5A1JA 1X1SA 3IOMA 2J9RA 1QAOA 4UCXA 3GP3A 4G89A 4J7AA 2IVFA 4UPVA 2C9BA 5AQ1A 2I0FA 1JHYA 4LMRA 2GRUA 2X23A 3ZY5A 1UT8A 5J5AA 2PIDA 3C7KA 1YB5A 2LCFA 2Q5LA 3LNCA 4IGIA 4IJQA 2B3DA 4OI2A 3WDLA 1SA0B 2JA2A 1NKSA 3G2JA 3W2TA 1QQAA 4ODIA 2QT1A 1M0WA 4WH0A 3ZBTA 3L5OA 2WUFA 5B6PA 4UQLA 1JI0A 3RF7A 2B34A 1FFCA 3CKYA 3GN1A 3QEJA 2RGCA 3BX1A 3A1UA 4FOLA 2Z56A 2C7PA 5LMUB 1QO0A 2X8JA 1EU1A 5ICGA 4CCAA 3WMFA 1P3Y1 3KG2A 1SOUA 4G0XA 4KR3A 3L7IA 3RT7A 1V41E 2ZREA 2WJ4A 2NNLD 3H9CA 2I9KA 2CLHB 5KQGA 3DGEC 5DM0A 2RARA 2VKQA 4DLAA 4YYEA 1Q1NA 2QQ0A 3O2NA 2NU9B 4HWKA 1QHHA 3LT4A 1H5NA 1G21E 2IUTA 3DWFA 4JLDA 5AK5A 3CVYA 4P3YA 1XX6A 3GA5A 1DFHA 2VYVD 3WFJA 1BXRB 1LI5A 4U8GA 2Q2OA 1YE3A 2QPAA 3QF4B 4OF4A 1NV8A 1UF9A 4K3VA 4WKNA 3JALA 3OE5A 3QMWA 2CUTA 2OZKA 2EJWA 1XSEA 3WO0A 2JIZD 4R2JA 4FDLA 1PTJA 5KJEA 5EJ6A 4B7ZA 1FP6A 1HE3A 1M7GA 1Z8DA 1HFKA 2HBYA 2YZMA 5LA6A 2VJQA 3AKZA 2PFGA 2HJRA 5BVHB 2CNOA 3NTLA 4E4YA 1NUAA 1W2GA 3G5TA 2CUZA 4LDQA 4NVRA 2C3OA 4MMYB 1XD2A 1MHTA 5LCXA 2OC9A 3I8SA 3L0CA 5KKCA 4MV1A 3BTVA 1ZI8A 3JWPA 3LXMA 1KI2A 1E9VA 4RK1A 2I8AA 3S7TA 4KYTA 1V95A 1N7IA 2EQBA 1G0NA 1XYYA 5CFNA 4U9UA 4TSKA 4BMSA 2JJ1A 1T6BY 3OIGA 3T54A 1JB9A 3LHSA 4L22A 4QDTA 5EG5A 3H5OA 1WVMA 5BW4A 1I14A 2W98A 3H8SA 5LQMA 4KVZA 5DM4A 3USZA 3TNLA 2VDPB 4B7XA 3ISTA 5BV7A 1VSBA 1M1YB 1DCFA 3CWCA 5DTRA 2OOKA 3GDOA 1SWVA 3PVCA 1CUBA 2BMFA 2QAGB 5E0OA 5ECWA 4E88A 3HM2A 4ER7A 1YOBA 2DH5A 4NLLA 2DULA 3IE2A 3W5UA 4DYDA 4ND4A 2QZSA 3UWOA 1DKUA 5JR3A 1O9BA 1ZA2A 3E0XA 4MQEB 2Q21A 3KWMA 4X7MA 3ZHUA 4D9JA 1CUYA 2YXBA 4EKEA 2ZZNA 1EVJA 1T1IA 1KZ4A 3O4HA 3FDZA 5EIEA 4CDRA 4TS4A 1KVQA 2NVOA 3MCVA 3MNFA 4X6YA 5E9JA 5AW2A 4OYYA 3PNYA 2Q9CA 3M81A 3HB0A 2A92A 2QGFA 2ZU0C 1F5SA 1ORIA 4E33A 5A4MS 1WHTB 2O6HA 2QGNA 3ED1A 5B7NA 2Z4RA 2W2PA 3S99A 4F5DA 1W59A 2WFMA 1Y8QA 1S1CA 1P2VA 4K03A 5EERA 2YQ5A 3ZD7A 2EKPA 3A6LA 4KRFA 2FWRA 2ZBGA 2D4AA 4L5JA 3SFZA 3IELA 1GL7A 4B3RB 4AKGA 1UZUA 4BNNA 4MWOA 3VAYA 3S2EA 4MA4A 1Y1SA 2REXB 2E1PA 1K92A 3PGXA 4RDXA 4PO8A 1UXHA 1OASA 4OQXA 2DPMA 4COOA 3CMCO 2ONKA 1AGNA 4ZYZA 4G0UA 4HG2A 1RFGE 1FDVA 3HCRA 4TXHA 3RBVA 3L6OO 3OJOA 4Z7OB 3I2JA 1WNTA 5JDCA 2O06A 4KH0A 1CS0B 1X74A 2ZULA 4V39A 5KMGA 5I7EA 1V5WA 3FETA 4OD0A 5L4SA 3NALA 2YZ7A 5AD1A 2W22A 2Q46A 3CW8X 3A28A 3DUFB 1AKYA 1SQ0A 1GITA 3ETDA 3GRVA 4WZBA 3V3TA 4S04A 3LO8A 3V2GA 4RFLA 3RNLA 3QE9Y 1KYVA 3G2OA 4J1TC 5JQGB 1CQXA 2Z8YA 4IILA 3NBMA 4Z9BA 4DNPA 4IDAA 2E5LB 2CBXA 1KTVA 1IHDA 2JFPA 3N3AC 3PUWA 5JHHB 1XDBA 5B58C 1GSHA 2RCNA 2RHOA 4ZAWA 2JLYA 4MV6A 2HWUA 3WR5A 3DEKA 2NYUA 1N8NA 2J87A 2O1XA 1Y89A 3KJFA 4DMHA 1R88A 2PS0A 2V7GA 3WGIA 1TYDE 4HFNA 3PQFA 1FZTA 5T64A 4QULA 3H8JA 3R7SA 2GD0A 2PT7A 4EY6A 4Y1RA 1B6SA 3QKRA 4NENA 4TTRA 3ZE7A 1A5SB 1BIFA 5CVJA 3M1YA 4DC1A 3TXAA 2FF7A 1VRCA 4QKQA 3TRJA 2FPOA 3IDOA 1Q0LA 4NATA 3M9XA 1E63A 1RHQA 1D7AA 3GEHA 5BN3B 2ZWAA 3G59A 1Q7CA 3BREA 2VHTA 4IIJA 2W2LA 1TX4B 3NC4A 3VTZA 4CIDA 4QE3A 3H3FA 4KPUB 3V2UA 3WB9A 3AR7A 4Q19A 2E21A 1HDRA 2REBA 1MRSA 3SZUA 1B74A 3RKUA 1KO1A 2NG1A 4BQIA 1QTRA 3PIIA 2XMGA 3FWZA 4G4GA 5AVVA 2PWYA 1ZD9A 1KBOA 2V6FA 4I46A 5AVWA 1RT9A 3ZY2A 1JAYA 4B74A 1G291 1UC8A 3IRUA 1NF2A 4K7JA 3D1LA 1QTQA 2GYYA 5C51B 1V35A 3PGMA 2XMPA 2V7TA 3G7SA 3JQRA 2CL5A 3ZNNA 3KT8A 4RJ2A 2B1RA 1HDCA 3PYXA 4Y2GA 3MS7A 2B1JA 1NLMA 3HA5A 3TQSA 2N1MA 1RM5A 3PCRB 4XPIA 4MQUA 4E07A 3CNNA 1V96A 1ZEJA 1Y4ZA 4QOSA 4TXLA 1QC5B 5CLFA 3WL8A 5CCDA 3TOXA 3F4BA 4HX9A 2QTTA 4M6WA 4TV8B 3KPYA 5ITSA 3TS1A 1CULC 3NHJA 1GKUB 2RKBA 3EZXA 1U81A 1QKIA 3ELUA 3JARB 3UK6A 1TZ2A 1NY5A 1PF7E 4H77A 4K2AA 4OA8A 5DGIA 3T1OA 1L4NA 1YE5A 4TTSA 2V59A 5LP6C 1NYQA 2I4NA 4FCTA 1DFGA 1AO0A 3PTAA 3B6JA 1JB1A 1TRHA 16PKA 2PUEA 2HCFA 3GZNB 1JQ3A 2PZGA 5EP4A 2C8VA 2XVYA 4B34A 4ZYYA 1Q0SA 1AXGA 5TR9A 2EARA 2N47A 1P2DA 1TVKB 2W11A 5LQSA 2ZRKA 2C03A 5J40A 2WSBA 2KLBA 5HQJA 4EY5A 2CZQA 2VF2A 5FUBA 4W82A 1JHVA 3B1JA 1S2GA 3EWIA 4Q6WA 4YT2A 1SNYA 1PP4A 1XWFA 4L4YA 2W8BA 1UOQA 3R0JA 4RA9B 2QNIA 2WT4A 3WK8A 4DEYA 5FPKA 5BR8B 5H0IA 5C4GB 2O8NA 3KKLA 3U9LA 1ML3A 2NU7B 4XWYA 4WJLA 1FNDA 1U4SA 3MYRA 3R8FA 1VG9B 1LS6A 2I2CA 3GGOA 4N8EA 3MTGA 1Q0RA 1Y8QB 3TLAA 3LVBA 3GG9A 5CYOA 3E9RA 4CKZA 2V0GA 5KYYA 1RBQA 2O2YA 4KQ6A 5EQDA 3RRJA 4D3XA 1UUFA 3OUZA 4ZZIA 1G7TA 2ZJ0A 4QJ4A 4UUBA 5FTJA 3U60B 4WN3A 2XUHA 1Y6QA 2NO4A 2VIIA 3EQ6A 4QO7A 1SY7A 5AXAA 3DNPA 2QRLA 4ZK2A 4QTUB 3QVGB 4BIIA 5EKDA 4GL2A 5JNWA 4CZ2A 2FMXA 1LNQA 5EYPA 4CDMA 1K66A 4D43A 1M2EA 3V4VB 5ALSA 3L43A 4TWAA 1N2CB 3O8QB 1X2EA 1E1NA 4HX5A 4RVCA 1VLZA 4YCDA 4OJNA 3DUFA 3KT6A 3CZMA 4II3A 3TDMA 2OBMA 3ZGOA 3SIPA 2R8PA 3Q2OA 2XQGA 4YT8A 3TZKA 4DCTA 2Y67A 1PFGA 1XU7A 1SOVA 1T2FA 2ORWA 4YJFA 2X8WA 5EJGA 2QVZX 1GG9A 3G8DA 4QHTA 1J2UA 1RIFA 3ZZUA 2YW9A 3Q9UA 3ZDZB 1ONOA 3AB7A 2H7XA 3UJ9A 2VWQA 5DX8A 3FD8A 4FYIA 1Z33A 2XX3A 2QR2A 5KVQA 1GPNA 2LXNA 3FA2A 3OLZA 2H06A 3A36A 4MWCA 1E61A 1XU4A 1YVRA 5AUOB 1PQUA 2HYIC 4OHXA 3ACBA 3FPKA 4P2BA 4DLRA 4DLBA 2WE8A 3KQHA 3NO4A 1HF3A 5TT1A 3W7BA 4HWPA 1I6LA 5B4VA 2D2FA 1OTHA 2AC2A 4MWBA 4B76A 5FV4A 4C4OA 2EU8A 3L8GA 3AU8A 4FS8A 1ULUA 4R41A 5BW5A 5HHTA 1Y3IA 1YVEI 3HVHA 2C61A 1A27A 1W75A 2YIMA 3GX1A 5JJBA 2OGSA 1W0JA 3F46A 2V9PA 3KDPA 4Q3AA 3S2YA 9ATCA 3ADDA 4MO2A 2PH5A 4FGZA 5C46F 2DTEA 4U2KA 3SYMA 3TJZA 2PX4A 4PHFA 4CCYB 2HJVA 5EJ7A 2P27A 4WASA 5CDUA 1CS4C 2R5WA 4D9GA 4KMOA 4MQFB 3ZCQA 5JSZB 2ZBUA 3ASZA 3K8OE 3SLGA 3U7RA 5KNCH 3EZYA 3EDQA 4ER0A 5KWIA 1ADYA 2RHWA 4ZV4A 3RNOA 1UL1X 2IS6A 1M0TA 3RRYA 1GUDA 2ZE8A 3H5IA 2CDNA 1UZMA 3KHUA 3PTZA 3HMKA 5KAPA 3S2SA 3ZGYA 3MCUA 5CLGA 1ZRHA 5G53C 4L8LA 4CLRA 3AETB 1YZQA 5JXIA 3UAYA 1WHTA 5JSZA 1GP2A 1QS0B 1ZS9A 5AM5A 1IHPA 5A7GA 1VE5A 1Z47A 2DHRA 4G37A 3UUEA 4WJKB 4MVJF 2CNNA 3FH0A 3BMNA 3GLKA 3K05A 3PHIA 3I01A 1PUXA 3OEHA 3E1SA 3Q0TA 3M6VA 2XOKA 1TIPA 1V8ZA 4O29A 4BZWA 1FDRA 2J67A 5K4HA 4JVOA 3H7AA 1NJSA 2FETA 3D6NB 4I7EA 4Z2AA 2D0IA 3I83A 4G5XA 2G83A 4V3BA 2W2NA 4L6IA 5DH9A 3ELYA 4H27A 4C0KA 1YBMA 3B78A 2JFQA 3ORFA 3RTBA 2QXTA 3L01A 1HNNA 5CD9A 2H51A 1H0SA 1TT5B 5EHZA 4J9UE 5LSAA 3PHLA 1V25A 4BHTA 2IPLA 4MKZA 5C4IA 2J9ZB 5SZKB 2FSVA 2JI7A 2SCUB 3RV4A 2GDZA 2O52A 1A8UA 1KFBB 1M83A 1L5VA 3FKJA 5IYZF 3E9EA 4KLCA 5EVJA 3EVZA 4TL6A 4BQQA 1L5QA 4MS1B 2OCLA 2F3QA 2CHGA 3HYTA 4UVGA 4U63A 1LS1A 1VCOA 5A2GA 2AOTA 5LXTB 1VG0B 3HFJA 3QX9A 1QF6A 2M98A 4G0PA 1QK5A 1RTKA 2CLSA 3G0GA 4I50A 5C3UA 3VHXA 4XM2A 5FPTA 2WSYB 4KMSA 1GV1A 1P2FA 3P2IA 3M6FA 4MVJA 4UBJA 5J5VA 3ROTA 4M2LA 4I1VA 3ZXIA 1KBZA 3S8YA 2CJFA 2UVDA 1AMNA 3OIUA 2PBFA 4MLPA 1JQKA 2YHAA 2BDTA 3KOWA 3SC4A 4ZVMA 4AK9A 3KD3A 4WUTA 3OHMA 1AUPA 1G21A 1EIZA 1S3GA 4PNZA 1LSOA 3HXKA 3PNMA 4I1RA 4OHCA 4A26A 5KWEA 4ZEWA 5AUNB 3FOAA 1BGVA 1RWWA 4BZZA 1EBFA 2YDXA 2WM3A 3IIIA 3I72A 4P7GA 5C7IO 2JIPA 2XYPA 4R2LA 4EP1A 4JJ6A 3UFXB 3W5VA 4O3MA 3GL9A 3PWKA 3ZD8A 2IXFA 2OVBA 2QQGA 3LX6A 1HL7A 4YO7A 4YLGA 3VR0A 4KIWA 2XMBA 5DHUA 2AA3A 3IUMA 2QIPA 1R5BA 2IDZA 1W6RA 4GGMX 4ZI5A 2PA3A 2FG6C 1DZIA 2P3LA 2B8EA 2ZSIA 4ND3A 3CY6A 3UH1A 4AVYA 3NORA 2WFLB 4HWGA 2FZ4A 2PSEA 1CF2O 2UZIR 3GT7A 3KDSE 1W9HA 1CY2A 2VJYA 3PPXA 3V1TC 9LDTA 5LDHA 2ZJ8A 2PR2A 4LVUA 1EUDB 1UAYA 4MUFA 1W36D 4G1FA 4JVMA 4B7CA 4WEOA 4NCNA 4H7PA 4GDFA 2VLIA 3CO0S 1ZRMA 4N9WA 4XWGA 3VNRA 1FZQA 1H2FA 1WVGA 2GBFA 2Q0HA 4PTYA 5SZJA 3SIXA 1II0A 2G88A 5EFOA 5WRFA 5JAMA 3EVGA 1VYVA 2IPXA 3DVRX 3PL5A 3VM6A 4IKPA 4PYRA 5AM4A 1WSAA 4JI1B 1SFRA 4NK4A 1ZAKA 2OY0A 1L5ZA 4KXYA 4TVBA 2EAUA 1TZKA 3UB3A 2C58A 4QUAA 2JGIA 3G6KA 4R0VA 3IIKA 2IU0A 1E1QD 1UBTS 3PNKA 2I1LA 2V0NA 2I2FA 4MEBA 3KKQA 1OLUA 2IUSA 4DNQA 2VZ9A 3ETNA 3PEYA 4BP8A 4B35A 4CIWA 1K7EB 3VR6D 3T38A 2H2GA 3PQ4A 1C0EA 3D02A 4MJLA 4HVCA 1EWTA 3ANTA 3I2GA 4FGLA 4XEUA 1NPYA 5K4GA 4B6PA 2VNJA 4IHAA 3KP1A 2PL5A 1HFWA 1ANKA 4E09A 2JLUA 4HZUA 3IOEA 1OIWA 1YTLA 2NZ8A 4FZJA 5CX1A 3TW4A 5GIPE 1NM5A 3VGJA 3DEAA 1B8VA 1HQYE 2IF2A 3A1TA 4M7WA 3IAHA 5HQTA 2GBLC 2ZTMA 4MP8A 4V0ME 1OX6A 4RTJA 1DBWA 2QVGA 4V24A 1J25A 3A1NA 4DCNA 5J47A 4QQNA 1V37A 4F3NA 4BNIA 5C9ZA 1MGPA 4Q3EA 2QX6A 4F2DA 3PJRA 4UBKA 2NZ2A 1A1SA 1SXGA 3BWBA 1CZKA 8ATCA 2WFZA 4ZDJA 4MVJD 3PENA 1AGPA 1Q83A 5I9TA 2Y0PA 3RTAA 1JA1A 1C81A 1T8RA 3QENA 2B5VA 1L5RA 3P45A 1E4EB 3A37A 1SPXA 4NBLA 4RH3A 2BDUA 5IAKA 4CKBB 4D4LA 2BGRA 4GGOA 4HGOA 3KX2A 4KDRA 1L7MA 1HYHA 2P1ZA 4PLHA 2JFWA 2WB4A 5BW6B 4BRSA 4DPMA 3T5AA 3QOFA 4J7CA 1I94B 4HRXA 1WDKA 2V98A 3TD9A 1DL5A 3WVNA 3N87A 2HHLA 3VU3A 4R81A 2IOFA 1GGJA 4UE3S 5FB3A 1SELA 4J9VA 1ZHOA 4JBYA 1WG8A 4UHFA 4X62B 4R1NA 1L1RA 1NVVQ 3PEVA 1KQPA 4WZZA 5T57A 2V4UA 3ITDA 5DGXA 3Q88A 4FUTA 4OGKA 3STVA 2LV8A 4F97A 5KYNA 2BCEA 3DCJA 1X1RA 4KYUA 4KXWA 1PWEA 2G7MC 5LQKA 1WB5A 3KPVA 4QO8A 4FMDB 2XUGA 1JDNA 1UP6A 1WZNA 3DAGA 2X0RA 3I73A 2IV2X 4F86A 1H8HD 3IQIX 2NP7A 3JQCA 1CHDA 3B9PA 3HQ4O 1FMLA 2G67A 3BZWA 1FYVA 2HT1A 1TVKA 3EZ7A 1G5TA 2RG7A 1OHHD 5TVGA 2JKZA 5B57C 4MRNA 3NIFB 1AQNA 2XODA 2QAIA 2RGNA 4WV3A 2G3YA 1LVGA 5EJFA 3ZNQA 1AOXA 2FJPA 2IZOA 3DBVO 4YRIA 4MEAA 4H3KB 4JJIA 4UQOA 2J3LA 3VKFA 3KLBA 4I4CA 2J3DA 3BORA 1LK7A 4KN9S 5CDFA 4EW6A 3BXXA 1ENPA 4FWTA 4G01B 3T3IA 1K86A 4Q7MB 3DE2X 5I48A 3QXJA 1QE0A 2DYKA 3UMJA 3NS7A 4YI5A 3SC2B 5CVEA 1VI2A 5AVKA 3VR2A 2REQB 4RZSA 3KU1A 3U4QB 3UMCA 4EFLA 3KQWA 1F0YA 4KLAA 1LVUA 2G40A 3KQTA 4PYQA 3FZQA 7MHTA 4MI9A 4OQYA 2IYVA 2QD1A 1ZD2P 1SIWA 4BKPA 4HDRA 4IDDA 3OVMA 2JDID 2CXOA 4QM6A 4K9DA 2V7QA 1KMQA 4WBSA 2PN1A 5HBGA 4H4EA 4ZOQI 5CDFE 4HT3B 3FCUB 4ENSA 4RJKA 1RE0A 1SHKA 2R11A 4ZIRB 2H18A 4CQLA 1DDIA 1ZIYA 4CM4A 2XDAA 4OGWA 3RFCA 2C88A 4LZNA 4BGDA 1QH8A 2D7JA 3A6ZA 3LAWA 5C8DA 3E23A 5JHGB 5CLLA 2ROQA 3HL0A 3CEPB 3LCRA 4YREA 1YD7A 5M34A 1L5MA 2QM3A 4IYJA 1DX4A 1NRJB 1PW5A 2NXWA 1B26A 4WESA 3D4OA 3U1BA 3UCEA 3GJYA 1TNDA 3LPAA 2YS6A 1VB3A 4Q1DA 3CUTA 1S01A 3EMDA 1SC6A 1B93A 3AB8A 3DEFA 4FQ7A 4Y6LA 3MMPA 1ZSYA 2FPMA 1FP4A 4FYKA 2J7PA 3LA8A 2X1LA 2P6RA 1SULA 1FRQA 1ZOSA 4O4HA 1VJ1A 1T3SA 2XYGA 3CR7A 1ODFA 4N3BA 1B2RA 2BGMA 2BJVA 2AS0A 1PJ4A 3C3AA 3FNGA 3PUJA 2O14A 4GUDA 2EIHA 3QE0A 4KQCA 4RAQA 5JQWA 1AB6A 5IJAA 1DTWB 4CG0A 1SKMA 1RXEA 3FPFA 1XVTA 2A5JA 3MJRA 1IPFA 1OWMA 2AEEA 3EVNA 1YS2X 3I9V1 3KQLA 2R1TA 1U0HC 3AEKB 3HACA 1YVPA 3N2KB 3DBHA 4MUAA 2DERA 2Y1OA 2W58A 2FUEA 1Y6JA 2HNBA 3SWWA 1XALA 3ROQA 2WIAA 2YJ3A 1GGVA 4TM8A 4FDAA 2GM5A 1ESCA 4HAVA 5BUZA 3RUDA 3M82A 5BT9A 4BFWA 1X14A 1Q57A 1CCWA 2PGJA 4XEHA 4CM9A 3U7FB 3T3NA 2BFOA 2ODQA 3C3MA 4P3PA 1P62B 3GARA 3JS5A 1JEJA 1LBIA 3VPHA 4ETWA 3N2GA 5I5EA 5TQ2A 3SBEA 5DHAA 1OBHA 1PVDA 3DVQX 4A6EA 1W30A 3MBOA 4PG7A 5TQ0B 1QUEA 2WM9B 3HN6A 1GN9A 1PHRA 3RRFA 4ROTA 3VH1A 2VA8A 1P4JA 2O0JA 3FYCA 5LA6B 4CKEA 4E5SA 3BGIA 4KQXA 1OXXK 1EP9A 2G76A 3NHMA 4L75A 4TTTS 4DOMA 4D8VA 2FW8A 3KB6A 3GA7A 1QGUB 3N39C 4X66B 1LLDA 2JGJA 3ZD9A 3ZX5A 4RDHA 3ZWWA 2Q3CA 1ZPDA 1T15A 2RAUA 1ZK1A 1U0BB 3P26A 4RZ2A 4WPGA 4FP9A 5CAEA 1GPDG 4WLUA 1VBKA 3ZDDA 4TN1A 2IUUA 3A2NA 1BXZA 2ZR8A 1S8OA 3C5HA 3PHBE 4X45A 1RHJA 5LYYA 2HWKA 1EWQA 1QM5A 5KOYA 4TTPA 5LD2C 2DPYA 2X1HA 4MR7A 3CEAA 3D64A 3WMXA 4MYCA 3HJGA 1FUYB 4W1QA 2PNJA 2E1RA 3JPYA 2CZGA 2O8DA 2G28A 3PUVA 3HZRA 4A8TA 2O8CB 2C3MA 4GFDA 3CG4A 1NOIA 4FDTA 2JCGA 2R47A 3AJDA 1ZGHA 1C5KA 1HURA 1XZPA 3L4BC 1WMDA 4AJ2A 4AZ3A 4YLEA 1PT7A 2P4QA 2DUNA 3TLCA 2BKXA 4XWWA 1UBNA 3H5RA 4GAEA 5LLDA 3KSMA 1Q0UA 2OG1A 5KPDA 3A32A 1GAJA 1G2IA 1WLYA 3BJRA 2YTZA 1ULSA 1I6KA 3V9PA 1M8FA 2G9UA 1A88A 2O3QA 4K6CA 2O8BA 3L6CA 2ZCJA 2W2MA 3ET4A 2QZJA 3R9KA 4EENA 2HRRA 1NF9A 4JSTA 3OICA 3PFKA 4J0JA 4P8RA 4RA6A 4ZHQA 2IE0A 3BCUA 3OTGA 4XLLA 5LA6F 4GZLA 1RZRA 5IXSA 1KHTA 2ZI7A 4F4IA 4FFDA 4B7AA 4C76A 3HJUA 1ESMA 1RHMA 1CQIB 2B1QA 3LT0A 1NJ6A 3N05A 3AHFA 4JP2A 4MUHA 3L3BA 3UHOA 8OHMA 3SFVA 5CT6A 5D3MA 2Z2KA 4DRZA 2RC5A 3EJ6A 3PFFA 4AUKA 5G41A 2YN2A 5H83A 3D43A 3RSZA 4Q3DA 1WD7A 4C9BA 1PFWA 1H0RA 1E1DA 3CH4B 2A3RA 1SU7A 2L17A 2V03A 4GOND 4AKTA 2OHJA 4KP7A 2GGSA 4RVSA 2WWRA 4PHCA 3VJRA 1S02A 2GCGA 2YV3A 2AD5A 3CJQA 3FNBA 5IAAA 4RJIA 4IMRA 2QLTA 2GPYA 1MX9A 3HCNA 2VHWA 1T8WA 1PJ2A 2GTIA 2TSYB 3BRWD 3H6GA 3ZYCA 5ESDA 1J20A 3HYLA 1G5PA 2VF8A 3DOCA 4GI3A 1Z2OX 1Z16A 3MMXA 4FHZA 4YAJA 3PXDA 4EB3A 1K6MA 1GAEO 1X1EA 5BPHA 1GZ6A 1KR5A 2Q2QA 2RK6A 3G0OA 4C4SA 1R6TA 1LBHA 3I52A 1J2TA 4GPIB 1KARA 3UMFA 2VTEA 3V2HA 2VRNA 3K5HA 4QYIB 1L7DA 2HHAA 2W4IA 3H1BA 5JISA 3FVTA 3GAMA 3RRXA 1JKJA 4CTKA 4JJ8A 3QPUA 4F2PA 1ZOIA 1QH0A 3BVPA 1NR1A 3U7JA 5ITWA 1FU4A 4YUYA 1OU4A 1QIKA 4HN2A 4KO4S 1GQRA 3B6MA 4F8JA 5L3QA 2I54A 4U7WA 3PPYA 4WBXC 1K4MA 2QNRA 4D6YA 4Z7JA 1T6ZA 3PNLA 5K8TA 2ZAOA 1I0ZA 5JAUA 1NI4B 4DW8A 4F85A 5FAKA 1KGSA 1MZVA 1TKCA 3MWJA 4TSFA 2VYNA 3G0CA 4V2IA 1FVHA 2G0TA 1Y4DE 1Q1EA 1CT9A 3HN2A 4WDQA 5GWXA 3KAKA 1EVYA 3EF1A 4QFDA 2C5EA 4E30A 1CJTC 2HSDA 4R68A 2UDPA 3F3MA 2EQ5A 3G2IA 1DPFA 3ABRB 4K1XA 2WD7A 2BHNA 4P4SB 4BZPA 3IQXA 4RO0A 2H9IA 1P0IA 3K72B 4ZRNA 1XQXA 1EA7A 4B6RA 1G8PA 3X1DA 1GCUA 5IMSA 3UXMA 4PBRA 3BE4A 2AR0A 3FHLA 4I08A 3PYMA 1QK3A 3WL3A 3IB6A 4RM3A 4FNAA 2ZCUA 5JY6A 2JIRA 3B7PA 4DR5B 1MTZA 1ZQ9A 4KOAA 2BH9A 3NDPA 3IBFA 3GDHA 2J48A 1QYDA 3LX4A 4EIWA 3I5XA 1OIXA 1LSSA 3M8KA 4LWPA 5JH7A 3ZDFA 3V1UA 2B9VA 2EFCB 1LK0A 1PNQA 4ARUA 2OM6A 1MT0A 5LVAA 5DX0A 4NOMA 1B0PA 1RRVA 1CF4A 1E7MA 2DUMA 3GRCA 3L6EA 3OCYA 3OI7A 1LW7A 3HBFA 2ZAGA 4IX9A 2BFFA 4HUQA 1O54A 2WSSA 3DOFA 1FSFA 3R8CA 4O5AA 1XEXA 1YVDA 4UASA 5AVQA 3W90A 3ON5A 4N12A 3VC7A 2IKQA 2FMTA 2R00A 1Y7PA 2BJWA 1EM8B 4GLOA 4O4HF 1DRWA 4PC3A 3UCXA 3UMSA 4MK4A 1SEVA 3ZLVA 5DI3B 5IAOA 3IP8A 1RXUA 2PQ2A 2XBUA 4HB2A 4MUMA 3WLKX 3ZXYA 4BFYA 1J2JA 5FL7A 1S8FA 3C16C 2ZITA 3NHUA 4B81A 1CUCA 2C78A 4W5JA 3U16A 3IVMA 2HU2A 2FGJA 4I19A 3U26A 1D2GA 4ZTUB 2UZ3A 5DVZA 4H6VA 3W7AA 4ZRDA 3N8HA 1FS4A 1LQTA 4LISA 2ZR7A 3GCDA 3L4SO 2WT8A 2LZ0A 4RLFA 3VVMA 4DIOA 4YRZA 2PUGA 5JZMA 3Q85A 2DT5A 2NU9A 1JFFB 3PDJA 1VCHA 1VPEA 2VWPA 3DFZA 2QXUA 1Y9DA 2A0YA 3Q3JB 4FFMA 2XE8A 4MDFA 5BV2P 1JDUA 1O7JA 2GN0A 5JWRA 5IKXA 3UOWA 2DFKB 5DYYA 1GGKA 1Y5RA 5H4HA 1I2BA 1B8NA 5K3DA 1CEYA 2WJWA 3BJEA 1O77A 1IHOA 3LOQA 3W8DA 2YN0A 3MWFA 2HDHA 1VLJA 3JYHA 4D8XA 5D01A 1WNFA 1P4HA 1N6PA 1QFYA 4BLQA 5K45A 5AI5A 4QZVA 2B4KA 3SVLA 4J4BA 2GZMA 2Z1MA 3K70B 5IEBA 1G8AA 3Q7QA 3CUWA 1S5PA 5BSVA 3K09C 1UMDB 2ZUBA 4WK4B 4RTSA 2R6FA 3M33A 3NNSA 1QP7A 4BNGA 3G1WA 3L6DA 5ILGA 3B1FA 1T5DX 3L79A 3QVWA 2ZRIA 1VB5A 4FOSA 3JQ7B 4JKIA 1EVZA 1YUMA 4PIPA 2OT3B 3P9CA 3SS9X 4X00A 3QA3E 5LKRA 1P1HA 3KZOA 1UODA 1YR1A 1HY3A 4UUAA 2PHZA 3H0KA 2FOLA 4FIDA 3YASA 3TECE 1PR3A 2B25A 1NVBA 2UVPA 4PG6A 1BEUB 1J0DA 2WIBA 3EW7A 1PL6A 2CXPA 4F04A 3D7MA 4CQNA 3GFQA 3PNOA 3GRKA 1MV8A 2R62A 2WM2A 2PH3A 2WWXA 2C7VA 4CQJA 1XCLA 5K6AC 1NX6A 3Q7IA 4HUTA 4CN9A 2I9PA 3PFIA 2QRZA 3CT4A 1E60A 4KIFA 4TMWA 5JAZA 5AM3A 3M89A 1RQ7A 4FCCA 4ZVUA 3C39A 2QE7D 3GCXA 4NI5A 1ARZA 5C18A 2FWIA 2WKSA 2XT0A 3GFPA 3KKKA 4Q4DA 1Y6FA 1P1IA 3BMCA 3AK4A 4QYIA 2VAMA 4PV7A 5EIXA 3LK6A 1SOMA 3V1KA 1DFIA 3EOBI 2JLXA 4HX2A 4IHQA 3VUFA 4KQJA 4KO3S 3QNMA 4PF1A 4J8PA 4LJ9A 2JBAB 1KWKA 3OM0A 5TC4A 1E9SA 3SS8A 4BBAA 4M8NE 5MN6A 4G5RA 3N2KA 4UAJA 1OC2A 4E15A 4QELA 3EA0A 3BDAA 2GN6A 1ZIPA 3M5WA 1R74A 3NRBA 1FNBA 2H08A 3OT5A 3D6VA 4DB4A 4LFAB 4JFRA 4YASA 4PS1A 3K2IA 4XYLA 3M6AA 4E5NA 1EVQA 3CEJA 3WYDA 3BHMA 3GIWA 2DPLA 4FMPA 2D1QA 3CN7A 1B1AA 1DAEA 3LKVA 3H8WA 3TIFA 3T3MB 1WZ2A 1PYOA 4K9QA 2OGZA 3BSSA 3B82A 1JPVA 1P19A 1RBMA 2J7PD 3KSZO 4I50F 4Q9HA 5ABPA 1WMFA 2GZSA 1GVHA 1KEWA 3NG1A 2HRDA 4MITA 5SY9A 2JAWA 2IEGA 5GM2A 3H5TA 1N2OA 1E3SA 2UAGA 2VQ3A 1JRLA 1MN6A 3LW7A 4XLTA 3AI1A 3E1KA 2BY4A 4FFRA 5HS6A 1A50B 1L4BA 3EISA 1YZVA 5C53B 1SXJB 4G65A 2QPOA 1TW2A 2QSJA 4FC7A 4JP1A 3CQ9A 4MTCA 2NU6B 3RYTC 4GNRA 3GBPA 2AD1A 4OQFA 2ZTVA 1G8YA 3I9MA 1Q6YA 3AEQA 1WWKA 3ZBUA 3OZ7A 1MC1A 2XZLA 3ZXUB 1X8JA 3ZK9A 5K0GA 2I7CA 3ZS9A 3W78A 2WTXA 4BO6A 2X1VA 1P5HA 2XUJA 3BERA 2WAXA 2QTNA 3H11A 2FF5A 1ETUA 1Y6RA 3B13B 3I30X 4MQLA 1AD2A 1YQDA 1J09A 4ZQEA 2P6MA 4KDCA 3IEKA 3UFXA 1E2UA 3VYWA 4LY0A 1QQ5A 2ZRPA 3FKQA 4FNGA 2B4TO 3L07A 4H7JA 4YPFA 1GXSB 4OHWA 4C89A 5HP4A 3WZMA 2IH2A 1EI9A 5CGZA 3EWAA 3DHNA 1V9CA 3WGJA 3WK7A 2RGBA 3FTPA 3I76A 5CA1A 3H2JA 3U44A 1NULA 1WUHS 3L1VA 3W6UA 4ZYWA 3KPWA 2DE0X 5NULA 5TMDA 3I62A 3U61B 4GBGA 2BFAA 2QT9A 3INYA 4QU8A 5COBA 4L7VA 1Q11A 1KMHB 4X1YA 4JWTA 3HY3A 1ZRSA 6CHYA 1KO7A 4IXMA 5KNCD 1KHHA 1AN9A 1GPBA 3IAXA 1KQNA 3IE0A 2P69A 1ECGA 5CA0B 4K3UA 1VSUA 3EXFB 3IQEA 4ZARA 3BE5A 2QW1A 5FNZA 1WJGA 2ZUSA 5EZYA 4ZAYA 4ZOLB 1OHHA 3G9TA 2IQ5A 2P62A 3GD5A 2VBIA 1AQJA 4WCFA 2XH8A 3DMTC 4RS3A 2H1OA 1I4OA 2O3RA 2O2DA 1UC4B 3DCNA 3VOTA 3G9UA 4HDKB 3BMXA 3RHSA 4NS1A 1EK5A 1PR6A 3KM0A 2MSCB 1I30A 1VIDA 5G3YA 4CG3A 2Z6VA 1OXKB 5BSWA 3F97A 2Q3EA 2Q62A 3KSBC 1XMSA 2COKA 4F4UA 3BJMA 1R64A 2VHJA 5ILQA 2AYYA 1TYCA 1QG0A 5GONF 1Z0IA 1EB9A 1Q50A 5U4XA 4H9GA 3G2HA 4IH4A 4GQIA 4ZREA 3T9AA 4X6XA 3VTKA 2ZM6B 2O8EA 3MIIA 1KDTA 1IFXA 1ZCFA 2C20A 3N2EA 1XGKA 1MAWA 1PYDA 4B82A 3GJXC 1CRQA 4EHKA 5LUBA 3ACDA 4KBFA 3O82A 1C9NA 2IEZA 5BWCA 5LOVF 2FV8A 3AERA 4P2GA 4C04A 1C3JA 4IJ6A 3IKLA 1V2GA 3BWDD 1KPIA 3DXYA 3LUFA 5AO9A 4MVJI 5A3SA 3VZQA 4CM4B 1Z0SA 1KYTA 2BI7A 3ESDA 1UJ2A 1H1DA 1JQBA 2VJMA 1QNLA 4J3FA 4QPPA 4Z0HO 3Q7EA 1DUSA 2H1IA 1BMFA 2WHQA 3FFXA 4BGEA 3IBSA 4J7XA 5TMBA 5B1YA 3H65A 2ODBA 3QPBA 1O6GA 3QUBA 7REQB 5IKMA 3MT0A 2QY9A 4ED9A 5EMMA 3MJDA 4NDZA 3U7EB 5CA0F 2GBIA 3E2IA 3M3PA 4P4GA 5HSGA 1EFRD 2HRQA 2ZRGA 2XCOA 4TS3A 2XADA 4NG5A 2JKYA 1YQUA 4Z86A