3S2EA

Crystal structure of furx nadh complex 1
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
340
structure length
340
Chain Sequence
AMMKAAVVRAFGAPLTIDEVPVPQPGPGQVQVKIEASGVCHTDLHAADGDWPVKPTLPFIPGHEGVGYVSAVGSGVSRVKEGDRVGVPWLYSACGYCEHCLQGWETLCEKQQNTGYSVNGGYGEYVVADPNYVGLLPDKVGFVEIAPILCAGVTVYKGLKVTDTRPGQWVVISGIGGLGHVAVQYARAMGLRVAAVDIDDAKLNLARRLGAEVAVNARDTDPAAWLQKEIGGAHGVLVTAVSPKAFSQAIGMVRRGGTIALNGLPPGDFGTPIFDVVLKGITIRGSIVGTRSDLQESLDFAAHGDVKATVSTAKLDDVNDVFGRLREGKVEGRVVLDFSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc-containing alcohol dehydrogenase superfamily
publication title Crystal Structures and furfural reduction mechanism of a bacterial zinc-dependent alcohol dehydrogenase
rcsb
source organism Ralstonia eutropha
molecule tags Oxidoreductase
total genus 110
structure length 340
sequence length 340
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3s2eA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3s2eA01
1GUYA 1UDBA 1EQUA 1IHYA 1P33A 3KO8A 3G17A 5EQDA 4FDAA 1FJHA 3TWOA 3QP9A 1YB4A 5LCXA 3PYLA 2C7VA 2BD0A 3U5TA 1B8VA 1MFZA 2DVMA 4IGEA 3KEQA 1VLLA 4BQPA 4WLOA 5A3VA 1FDUA 3KSUA 2O3SA 1O89A 4CPDA 3OMLA 1BHSA 4XA8A 3ANMA 5JBIA 4ROSA 1YB1A 4I9UA 2Q2VA 3WQRA 4C7KA 3CTMA 1ZZEA 1IOLA 4I08A 5C3MA 3TZHA 3UXYA 1BRMA 3MCVA 2NVUB 1VI2A 1XDWA 2QW8A 5L7TA 3WSWA 1QP8A 3X2EA 2X23A 3GGGA 3MZ0A 3CZMA 5J23A 1CERA 2G0TA 3E1KA 3NUGA 2I9PA 2NU6A 2O4UX 4W82A 1QG6A 2AMFA 1UP4A 5KJCA 5JDIC 1KETA 4H15A 4CMIB 1NFQA 2W2KB 5I8ZA 1BXKA 5EN4A 1YONA 2R6JA 5G2OA 1PL8A 2WYVA 3JD4A 4NFYA 2CF5A 3OJ0A 3D64A 2VHXA 2NTJA 5A4DA 5KVSA 4U6QA 3L07A 4R5HA 1PJBA 2O3TA 2FP4A 2C0CA 4XYEA 3KVOA 1I24A 3VC7A 3DZIA 4UAGA 1UAYA 1JTVA 3SJ7A 1MFPA 5GY7A 4J0EA 3E82A 3HN2A 4BO6A 3P19A 2D1YA 1XKQA 3OJFA 4I5GA 5CAEA 1QYXA 2WYWA 3WGTA 3G1TA 1JA9A 3KXDA 5G0UA 2BFOA 5KVQA 5KNLA 4MPDA 3DBLA 5DF1A 3V1UA 1C1DA 4PIVA 1I2ZA 1PGQA 3ZV6A 2PH3A 3GT0A 4ZJUA 1DLJA 3U9LA 2Q4EA 5BSHA 1E0DA 1PU2A 3QJ5A 1ZEJA 2P4QA 4NJMA 1ZMOA 2VYND 1QKIA 4E31A 1E6WA 5DOVA 3HDYA 1L7DA 4P4LA 2AEJA 2G17A 3DONA 4RVGA 4BNZA 4EZBA 2OL4A 1UAGA 4OO3A 2ZIZA 4YEDA 4MVJD 3I83A 1P44A 4PLFA 4C7JA 2HU2A 3CMCO 2DM6A 3ROPA 2XXBA 4BS9A 1T2FA 1UUFA 3WOHA 4EEXA 4W9NA 5BNIA 5G0WA 4EGFA 1IULA 1PJQA 1EDZA 4FN4A 3V8BA 4ND3A 4JBIA 4DVJA 1IB6A 3ST7A 4FGSA 3ADPA 3A9WA 4KWIA 2PNFA 3TDKA 4B3HA 5C7IO 1NNUA 1NHGA 1PR3A 2EGHA 3WIEA 4DYDA 4R3NA 4NK5A 5EINA 3TPCA 1HL3A 1P0FA 1H6DA 1PJTA 1R4NA 1WAMA 1T4BA 3T4EA 4LK3A 1HDXA 4JIGA 2GRAA 3F1LA 4M49A 3C7DB 3RCBA 4GLOA 3IAHA 1KVQA 3VZPA 2JFFA 1HLDA 3TNLA 3I6QA 4N7RA 4BMSA 4E30A 5CDGA 1RYDA 4AJ4A 4ND4A 4WGGA 2GO1A 1YWGO 3ZV5A 4I9HA 1U5CA 3PHHA 4J4BA 2QG4A 5DCYA 2Y1DA 3TL2A 1QV7A 2W90A 5ICMA 1E92A 4RPHA 3MWEB 3ZDFA 1Q7CA 1DJQA 4CQMD 4DLLA 1Q0QA 4M1QA 1D3AA 4JROA 4CLHA 1E5LA 1E1KA 4OIMA 4NZ9A 3D1LA 3G1UA 3E8XA 5JYDA 2RHRA 1BVRA 2GN6A 4AJOA 2AQ8A 3WGGA 3WLFA 3O9ZA 4J4TA 1C14A 1X0VA 2C5EA 2EP5A 4PN3A 1TT5A 4PVDA 4RF3A 1N7HA 2HSDA 3OF2A 3FWNA 1C0LA 4MKZA 1HEUA 4RGBA 2ZQZA 3BMNA 1NQAO 5JAMA 4E12A 4P4NA 5FWNA 2IXBA 1ML3A 1XA0A 2I3GA 3A28A 4D3FA 2YV3A 5HRUA 1DC5A 3KZVA 4UUPA 4BV8A 2GSDA 1Y5RA 4YR9A 2JFHA 3HSKA 1ONPA 2E37A 3E5RA 3KSZO 1WP4A 5IDXA 3VKVA 2B4RO 3LT2A 4HXYA 4U8GA 1U8XX 4DUPA 3EY4A 4MOWA 1EUZA 3WSVA 5IZCA 1B3BA 4HY3A 1GEGA 1GV0A 2RBEA 4GMGA 2C7GA 4KZPA 1OBFO 4M86A 3CE6A 4NJOA 1BSVA 5TX7A 3QVWA 4NPCA 2Z95A 3GVHA 3QVOA 3PJEA 4WOJA 1E3IA 4MVJE 1YJQA 3ZNPA 2X9GA 4XR9A 2GNAA 1BMDA 2HK9A 3JQ7B 2J5QA 4OXYA 5G4KA 1JDJA 3C1OA 2AG8A 2EHDA 4C4OA 1Y8RB 2YHUA 3VOSA 1MA0A 4YTEA 1NPYA 3QA9A 1KVSA 1YGYA 4KQXA 2A92A 3BTUA 4K6FA 1E7WA 4BGEA 3I9KA 3ZCXA 4IS3A 2OOSA 5C5IA 5TF4A 2RH4A 2GCGA 3IIEA 3CPSA 4I9NA 5JAZA 4E5MA 4I5FA 4ALMA 5JMPA 3PQDA 1ZK3A 2UAGA 1T2CA 2X5KO 3S8MA 2DAPA 2HLPA 3WBBA 1NR1A 1HKUA 5FYDA 3BXXA 4XKJA 1GAEO 4ZQEA 2BFMA 4AJKA 3DZFA 4L8VA 4BNUA 3NDIA 4UVIA 1H93A 3GRPA 2YUTA 3FR7A 4P38A 4Q3NA 5GZ6A 4QSMA 2B36A 4GWGA 2PKQO 1JAYA 3GMSA 1YS4A 1ZW1A 3AM4A 4E21A 3K30A 3NT5A 3K73O 4YYZA 5GZ1A 3WTCA 4NG5A 3DBRA 1BW9A 3DZHA 1P31A 2VNAA 1F14A 3LC7O 4ZRNA 3O26A 1QRRA 4Y6SA 3ASUA 5JXWA 2QX7A 1HDRA 4YVFA 1WLYA 3U3XA 3T7EA 1NPTO 3GHHA 1PWXA 1Z6ZA 1N7GA 1SPXA 4JP3A 2TMGA 1U28A 5JAIA 4EEZA 4MIYA 3G0OA 1UXJA 2O4CA 4O1MA 3U4DA 3WGZA 5BQFA 9LDTA 1U4SA 2D4AA 4YWJA 4GX0A 2AA3A 4BNNA 4RL6A 2Q99A 3RC7A 3G3EA 4Y67A 3OIDA 4RV9A 3PP8A 1ZXBA 1S7CA 3FN4A 5BNTA 2VHWA 3D4OA 3AUSA 3E9MA 4NBWA 1PSDA 5IXYA 5BT9A 3K96A 3OQ6A 4CM4B 2A9FA 2BELA 3ZV3A 2ZB4A 4XQGA 2UDPA 2JCYA 1HDCA 1LLUA 2YV2A 1KC3A 1B3RA 4OMUA 3RC9A 2V6BA 1UDCA 5I7VA 1ZK2A 3H7AA 1SCUA 2VQ3A 2DC1A 3WLEA 2CVOA 1BXGA 2CSUA 1ZK0A 4A27A 1RM0A 4N18A 1JVBA 3VH3A 3PI7A 1ZSVA 3N58A 4ND2A 2IXAA 2GD1O 1EFLA 1KIFA 2P68A 4W7HA 2ZB3A 1P77A 4YA6A 1GYRA 1LSJA 2FMUA 1LQUA 4II2A 2VYNA 1EMDA 3A1NA 4BUCA 4RPGA 1DIHA 2OUIA 2YQ4A 4OQZA 1WDKA 2IZ1A 3GOHA 3WYEA 1DC4A 1PJCA 2B69A 5AOVA 3WBFA 1GTMA 3EVNA 1I36A 4MVJA 4Q3EA 4OOFA 2V6GA 1ZK1A 2BLLA 2C20A 2EJWA 3DBHB 4Q3CA 1U8FO 2EKPA 3DDNA 3CSDA 3AU9A 4OXNA 2EW8A 2EP7A 1FDTA 2DUUA 4HADA 4MP3A 5JDIA 4AVYA 3KLPX 1NQ5A 2WD7B 5T8KC 4F3YA 1SZJG 4GKBA 1DBVO 1Z7EA 3N7UA 1OOEA 4WCDA 2OZPA 3G49A 4YAIA 5IN5A 5A9SB 3HB5X 3GZNB 1KEUA 1M76A 3DHYA 2AG5A 1GZ6A 4NK4A 3SC6A 4A10A 5T6BA 5JCJD 1PGJA 5HWSA 3D5QA 5L95A 2PA3A 2O3QA 3QWFA 2YDXA 3M1LA 2YW9A 4CV3A 5JYEA 4XGNA 2LDBA 4RO0A 3VTFA 1HSOA 4CL3A 2VT3A 1EQ2A 3R0IA 2D5AA 3GNTA 4XIYA 4DYVA 3PWKA 1JW9B 1ZEMA 3EZYA 1ISMA 1W8DA 4YJHB 2VTEA 3GZ4A 1G0NA 4UULA 3ROKA 2PFGA 1HRDA 4BMVA 5KIAA 3F6YA 4CQMA 1LRJA 3KSDO 4KTTE 5JO9A 4D7AA 1UXKA 3HZZA 4CR8A 2ZYAA 1PJ2A 5G0TA 2HK8A 4XYGA 3NT4A 4IXTA 3DB2A 1Y8QA 4DRYA 1EE2A 2HUNA 4L75A 1XSEA 1C1XA 3PTZA 4PG6A 3M2TA 4L76A 3PGJA 2Y1OA 3AOGA 5CP8A 2CDCA 4ZA2A 3RKRA 6ADHA 3JYPA 1P9LA 1MXHA 1PZFA 4CR7A 3QSGA 3FTNA 4FR5A 1OC4A 4CLRA 3PK0A 4GGOA 2BGLA 3INTA 2IZZA 4O5OA 1NXQA 1I8TA 1QSGA 4E5NA 5L4NA 1NBOA 4FGWA 4GKVA 1T1RA 2HMSA 3JD0A 1N9GA 4WLUA 4QUKA 3ZWOA 2VCYA 2FPGA 4ZQBA 2OFPA 1DC6A 5BSFA 3GGOA 5KVCA 3DZJA 3ZU5A 2Z5LA 4K26A 1NFRA 1HE3A 3NTQA 4UEJA 3PVZA 4WLVA 1VL8A 4R1NA 4BNMA 4Y8VA 3ZWCA 3U09A 3AU8A 4LRTB 4TRMA 2GN4A 4R51A 3IJRA 3I5MA 3AFMA 3AI2A 4CMHA 3W4IA 2UVDA 1KYQA 1O8CA 3GDGA 4G81A 1LXCA 5I7EA 3VVBA 3ZNQA 4NHEA 1HE2A 1ADCA 3MJTA 5CDTA 3DFZA 4CM6A 4AJJA 5DT9A 2I5PO 3CZRA 4BNWA 1U7HA 1K6XA 3ZN2A 4F45A 1E7RA 1DC3A 2AHRA 5BSEA 3VPGA 4XGIA 4BKUA 2AE2A 2DBZA 4DLBA 5A06A 5TQVA 3I6IA 4ID9A 2WJPA 3RUIA 5CDUA 2EKLA 4CM8B 3I9OA 1A72A 2AEFA 4Z0TA 3RKUA 3JQ8B 2DU8A 1X7DA 3QWBA 4TKLA 1L7EA 2VWHA 5ILOA 4NBTA 1Q0LA 3WJ7A 1B2LA 4IINA 1K0UA 4PRKA 4YACA 2YHIB 3SC4A 2ZTUA 3VKUA 4PZCA 3KYDA 1PL7A 3JSAA 1X0XA 2VTDA 1I32A 4N5LA 4QO7A 3EGOA 2GN9A 5TRTA 3WIDA 2PGJA 4IDFA 4IXWA 3ULKA 4BIIA 3RU9A 5L7YA 3ZWPA 5ADHA 1U3UA 1UZLA 4HKTA 5B1YA 4YJFA 3WJAA 4JK3A 3V1YA 3GNQA 5I8WA 4R1UA 1GYPA 4PG5A 1Q2XA 2VN8A 1P0CA 5CDYA 4JP2A 5KWEA 2J5RA 1Y5MA 3S2GA 4Q3AA 3UHAA 1OAAA 1RM4A 1ZNQO 3EK2A 1XU7A 1ZJZA 1XYGA 2ET6A 1ISIA 1C0KA 2HRZA 4KMSA 1GU7A 1FK8A 3ANNA 3CKYA 3DHNA 5DOZA 3GDFA 3ZH2A 4IDEA 3B1FA 1Z75A 2ILTA 2GUGA 1XGKA 1U3VA 3LYLA 4RVDA 3MWDB 1DXYA 5COBA 2HMUA 1PJLA 3D4NA 2NADA 5G4LA 4RVUA 1C3VA 3RBXA 3E9QA 3I52A 5LDGA 3NJ4A 1ORRA 2PTGA 1T4DA 3BMQA 3F4BA 4AG3A 1E3JA 1PJSA 4NU5A 4CLOA 5EIOA 1DB3A 1P1JA 3H9UA 5A05A 2E4AA 1KVRA 4CMEC 1XU9A 4NQZA 3WNQA 3FPCA 1HXHA 4E32A 1OC2A 1XG5A 3HUDA 1HDYA 1MV8A 1VM6A 4CLEA 2R00C 2EF1A 4N5NA 4E6PA 3GFGA 3PFWO 2NVBA 3W6ZA 4DIFA 1SOWA 3K2BA 4R9SA 1KEWA 4P4GA 1MGOA 4ALJA 2C07A 3AM5A 5L4SA 4JNKA 4M54A 1BVUA 1M6WA 1WXDA 3PQEA 3WMXA 4B4OA 3ICCA 3TZKA 4BO1A 2FSVA 2YY7A 4BNXA 1DIAA 1LUAA 5JW6A 4CQLA 2VT2A 5KOIA 1PEDA 3PHLA 4NDNE 3NAQA 3VAZA 4RVSA 2WTBA 3D4PA 1HE5A 4NFSA 3DAFA 1W73A 2H6EA 1EVIA 4BB6A 1AHHA 2F1KA 3L4SO 2D5CA 2PD6A 4E33A 3RBVA 1ADGA 2D59A 4EJ6A 4FB5A 2BF7A 3UICA 4DXHA 2POQX 5KJEA 1T1SA 4GSLA 3L6DA 3FNGA 4LSMA 5JCJA 2X5OA 3DHEA 1ZVMA 5L4LA 4JJIA 1DFGA 1CQIA 3H2ZA 3WWZA 5DZSA 3IOYA 3C7CB 4BMNA 5AVOA 3PYXA 2C29D 1Y9AA 4L4XA 1V35A 2PD4A 1JVSA 5CEEA 4CMCA 4J2OA 2X22A 5CDSA 3KUXA 3NTOA 4W7IA 5MGBA 4OL9A 1HZJA 3WGIA 3I4FA 4H7PA 3MJ4A 4J1TA 1DO8A 4MKXA 1JKIA 1JN0A 3Q6IA 1VL6A 3FCOA 4LVUA 3K5PA 3ZGYA 4EDFA 4XCVA 3PWSA 1D1TA 3OJLA 3JQGB 1U4OA 4IJUA 4JLWA 4IIVA 4BGVA 3LF1A 2AEMA 4I8XA 1QR6A 3ONEA 1YVEI 2J3JA 1E7QA 4NU6A 3GAZA 5TSDA 3KETA 3ZWNA 2I6TA 1R6DA 1WMBA 1YJ8A 4Z9FA 3JV7A 1SEVA 2WMDA 4J3FA 1M6HA 4R68A 3IUPA 3AY3A 3PGXA 3D3WA 1JKFA 3HN7A 2V65A 3IMFA 3DO5A 2JJYA 1X1TA 3WNVA 3DMTC 3VH1A 4EITA 3DMYA 1E7YA 4D79A 3VTZA 4E13A 5KCZA 4ESOA 2OORA 5T8KA 3RUEA 3I9LA 3F47A 3SLKA 3WQSB 3WGQA 1VPDA 1J4AA 4E4YA 3H5AA 4YJGB 4ZN6A 1ISJA 1P74A 3WGHA 3AUUA 4BNKA 4OKIA 2H1SA 1ZCJA 3RI3A 2JAHA 1KC1A 3HJAA 4BB5A 3RAJA 4XRGA 1NYTA 3DAGA 3PHJA 4DQUA 3GQVA 3CMMA 5COAA 4N54A 2AQHA 4B7CA 5DP2A 3GPDG 4J7CA 4ZGWA 4GX1A 2OBNA 3DZBA 3UN1A 4PLZA 1Z74A 2GGSA 4J49A 2O3UA 4J4HA 2H63A 3FBGA 4GX5A 1CEQA 1YBVA 4WE3A 2PWZA 1RJWA 2V6FA 3E5MA 4Q3BA 4TQGA 4J7XA 2Y1GA 1GUFA 1XEAA 3GHYA 4BO9A 3MOGA 4OOEA 1MB4A 4S3MA 4KDEA 3DZGA 2PV7A 1JAXA 1DAPA 1J0XO 4NBVA 3H9JA 5CPBA 4PLPA 2OGUA 1LJ8A 3TFQA 4CMIA 4PG7A 3UKOA 1NTOA 3S1LA 4KDFA 1A5ZA 3GVXA 4A26A 4XD2A 1NWHA 4JXKA 4CV1A 2HDHA 2GF2A 2FN7A 2ZCVA 3IDSA 3GVIA 3KV3O 5DBIA 5F1KA 5ILGA 4CLXA 1YQGA 5BNFA 4B3IA 1NX6A 4AL4A 4XGKA 3GN2A 1EVYA 4YQZA 2ZYGA 2WM3A 3E18A 4U0JA 2FSSA 2CD9A 1YKFA 2QZ9A 3A06A 3FD8A 3WB9A 5AXAA 4RF2A 3WR5A 2DBRA 2EEZA 4WLNA 5G0SA 1DJNA 4BVAA 4BHTA 5A9RA 1WWKA 2J5KA 2WD8A 1OZAA 1M75A 3AI3A 4RVHA 5JS6A 1EK5A 3K31A 4RPKA 1PQUA 5KJ6A 1A71A 4FOOA 4MVJM 4DMMA 1KY4A 2QQ5A 5L7WA 1Y1PA 2VRCD 4MVJH 3OEWA 2I76A 4LW8A 3JQEA 4J2HA 1HE4A 2GZ1A 2DPHA 2H9IA 4I5DA 3PHIA 4RJTA 1PS0A 5A3JA 3OECA 3B6ZA 3P2YA 3R3SA 4WOKA 4WNIA 4E2YA 1KEVA 3AUTA 3WGOA 3JQCA 5TJ9A 1RWBA 1QXSA 2AE1A 3L9XA 4KOAA 4OSPA 3ZW9A 1Y9EA 3C7AA 3TJRA 2RCYA 4OKNA 1LU9A 4AJPA 1PS9A 3PYMA 1VJ0A 3E48A 3LQFA 1SBYA 2JAPA 1VE9A 2X0NA 4FW8A 2Q1UA 4TVBA 2Y0EA 2Q46A 3ONDA 3SX2A 4AFNA 1I10A 2B83A 3HB4X 3M2PA 4OM8A 3S2EA 3ZHZA 1DIGA 1Y7TA 4DPLA 4IDGA 3G79A 5G4KB 4CM9A 1EBUA 3TSCA 1K3TA 2OO5A 1J49A 1HT0A 1GEEA 2G76A 5I9MA 4IDAA 1HETA 1O94A 2GR9A 3JQBC 4CMKA 3CEAA 4K9DA 5IF3A 4B79A 4FFLA 3WS7A 4ZQFA 3DTTA 1LEHA 1BTOA 1JWBB 1NHWA 3COSA 2VWQA 1ZKMA 2AQIA 4UVDA 4CODB 1I33A 2XXJA 4Y98A 1XIVA 3LDHA 4OH1A 4BNYA 4IDBA 1FDVA 2VOJA 4M8SA 4CM3A 3H5NA 4PLYA 4RF4A 4XZ3A 2HO5A 4QFDA 3K92A 1H6CA 3EYWA 3KB6A 4FOSA 1EE9A 3H9EO 5IAAA 1DPGA 3FR8A 3WX0A 1Q7GA 2XF8A 4FJ1A 4LGVA 4MIEA 4ZVVA 4BNIA 4PLWA 4XRRA 4GMFA 4YT2A 1GYQA 1OMOA 1EBFA 2YYYA 1WPQA 1YH3A 2QYSA 3GGPA 3TQHA 3SEFA 1U5AA 4MKRA 1H6BA 1T2AA 1R12A 3IKTA 5MDHA 1QYWA 4FFPA 2W4QA 4IBOA 5G0VA 4F46A 4MP6A 3MJVA 1QYDA 3HDHA 1LNQA 4BKQA 2C2XA 4ONEA 4RCVA 3W6UA 2O50A 3H3FA 4CMEA 5B12A 5EJ2A 1ZBQA 4BO5A 2DBVO 3HG7A 2PZLA 5KVVA 3AUAA 3LZ6A 2YJZA 3KRTA 3MTJA 4QT0A 5CG2A 3RJ9A 2CF6A 1LRLA 3ZWWA 5F5LA 4JCOA 1YE3A 3U0BA 3H2SA 2R00A 2FPPA 2LDXA 2ZJ1A 4CM1A 3LC2O 3JQAB 1FMCA 1U1IA 4BNGA 3GEDA 2ZATA 2IEBA 3HE3A 3JQ9C 4GBJA 3H3JA 3UCFA 1GQQA 3OA0A 4GH5A 1E6EA 1T2DA 4KP7A 1U2DA 3KYCB 1N5DA 4NIMA 1EEHA 1IPEA 3I3OA 3JQ7A 4IMPA 4HFNA 2IODA 1GQ2A 1E3SA 3EZLA 3JTMA 4FFRA 3ENKA 4X54A 1E7MA 2NVWA 5K1SA 1VJTA 2UUPA 1X1EA 1X15A 2HMVA 4B4WA 1A4IA 3ZU3A 2HAEA 2X86A 5BSGA 3MJCA 3RVDA 5KJFA 3GEGA 3TF5A 2FZEA 2NWQA 2I65A 4GVLA 4IMRA 4PFJA 1Z7BA 1C0IA 1XWFA 4A03A 2GZ2A 1V3VA 2ZKLA 4HUJA 4XJSA 3ZW8A 3TZQA 4CMGA 4GGPA 3SVTA 4IGFA 3L9WA 5B37A 5L9AA 2VZ9A 4EI2A 5JDCC 4M89A 2I3AA 4J1SA 1LSOA 1A7KA 5IN4A 3LLVA 1LBEA 3F3SA 3HFGA 2ZB8A 4BNLA 4YPOA 3UCXA 2VUTA 1GCUA 3DZKA 3F5SA 4CLDA 1HDZA 1V6AA 1ENYA 3AM3A 1NP3A 3PDUA 3QIVA 5ES3A 4BO4A 1IY8A 1NVMB 2WYUA 2X0RA 3QRWA 5IDWA 3AY7A 3OICA 4AJ2A 3QLJA 2GASA 4PCVA 2EIHA 5C37A 4WCFB 3WICA 3Q0EA 2PZKA 3JYOA 1GCOA 3AI1A 3RIHA 1X14A 1Z82A 4D46A 3KBOA 4Z3KA 4L73A 3HADA 2HJRA 3O4RA 1V3TA 3EW7A 3KOUA 3OQBA 1Y6JA 2XPCA 1PJ3A 5DDIP 4BNJA 3JYNA 3OQ1A 4J91A 3V1TC 1GZ4A 1HDGO 5F3RA 1T24A 4IUYA 5JAQA 1H2HA 1P3DA 3TZ6A 2F00A 3O8QA 4O63O 4YQYA 1H6AA 4D41A 3DMTA 4WJZA 1N1EA 1GY8A 1T26A 4EJ0A 4CQMB 2D0IA 1EDOA 4JJGA 1Z73A 1DEHA 3QWHA 4PLTA 4CM4A 1KVTA 4L0QA 3BTVA 3U4IA 1BXZA 4GQAA 1SMKA 4MVJF 1MXFA 2C54A 1UDAA 3MEQA 3PJDA 4TKMA 5JY1A 3OETA 5A9TA 1UR5A 1D7OA 4TSKA 4WECA 4W99A 4QECA 1Y8QB 1YOVB 2VRCA 3MTGA 1A7AA 1DSSG 1NM5A 3GDOA 3QVXA 4JQCA 2NM0A 2VYVD 4IY1A 4ALLA 2JHFA 1NVTA 3DAPA 4ZQHA 5HS6A 4WLEA 3UF0A 4MJLA 3DXFA 4BNFA 4U7WA 4R5MA 4E2WA 5ER6A 2Y1CA 1U3TA 4J43A 1CETA 3PEFA 3WGYA 3E9NA 2P5YA 3BHIA 2NV6A 3PHGA 2B4TO 3DBHA 1GZ3A 1V3UA 4PG8A 1PJ4A 4RF5A 4YT8A 4BGUA 1P1HA 2JKVA 2CFCA 1N9GB 1V0JA 3ZV4A 4XB2A 1E3WB 1SNYA 3L6OO 1I0ZA 2G5CA 3DWFA 4TMFA 4LMPA 4NI5A 2DKNA 5AYVA 5TJHA 3B1JA 4DQVA 3ETEA 1V8BA 2O3RA 3NDRA 4GVXA 3C1AA 2NQTA 4IQGA 1I2CA 3Q9NA 3QV1A 1LDBA 1F8FA 1U3WA 2PKRA 4HWKA 4II3A 3WFIA 1HYEA 5A9SA 2G1UA 3GZNA 3LC1O 4I1IA 3PRJA 4A7PA 1ENOA 1D4FA 1WMAA 5A03A 4M87A 4IQ8A 1O9BA 3RFVA 1MG0A 1J5PA 2JCXA 2PKQP 2DTEA 4L4SA 4LRSB 4E2XA 1GUZA 2O7QA 4IJKA 1VRWA 1Q1NA 3ZU4A 1LDYA 3BMOB 3QWIA 1O5IA 4QX6A 1PZEA 3TZCA 1IHXA 3MJSA 4H3VA 1KOLA 2EKQA 4MDHA 3P5SA 1GV1A 4YJHA 2X6TA 1I2BA 5IZ4A 4QTZA 5TIIA 3KM0A 3OFSA 2ZJ0A 4QXMA 4K1LA 5IG2A 5KTKA 9LDBA 4MINA 3DFUA 5TS3A 1CJCA 4XQ9A 1YL7A 2BHLA 3GN1A 4Z6KA 4ALIA 3GVPA 4OJNA 4BO7A 2C5AA 2RIRA 2Y1FA 1ONOA 3INGA 3NX4A 3OIFA 4O59O 3RC2A 3ZWAA 3D5TA 2QRLA 3LSYA 2EGGA 3OP4A 3WDSA 3RJ5A 5IJZA 3ZZNA 4CUJA 4YCAA 4WNCA 4LCEA 3PDJA 1HYHA 1ZMTA 1X7GA 3QHAA 3A14A 4IZHA 4YJFB 4WEQA 3SXPA 1ENZA 3GK3A 3PXXA 4GLLA 3P7MA 1YL6A 1EFKA 1QV6A 3LT1A 5FI5A 5JE8A 1HWYA 5A04A 1WZEA 2IEDA 3W8DA 1AHIA 4RDHA 2PLAA 3BMCA 1EUDA 3NEPX 4UUNA 5JC1A 1QLJA 4D0RA 1X7HA 3UH1A 2H5LA 2GLXA 3DQPA 4R1SA 3VDQA 3WQQA 3I9NA 1AUPA 1CRWG 1NR7A 1PR9A 5DNAA 3JQBA 3WG9A 3FNEA 4NH4A 3AY6A 1DOHA 4A2CA 1Y81A 2EERA 3LK7A 4LMRA 3IQDB 3PWZA 1GQYA 4D44A 3C85A 4CLOB 2G82A 2BI8A 1XHLA 1AXGA 4J16A 4R16A 4ALNA 3V2GA 3ETDA 3GRKA 5EESA 2ZYDA 4GAEA 3ZU2A 3V5NA 4FIZA 1RPNA 2FR0A 4ZD6A 2JHGA 2HJSA 5K6AC 2A4KA 3ZHYA 1LDGA 4RVFA 2CVQA 2FR8A 1BDMA 3GG9A 4G5HA 4UVHA 4TZTA 4MP8A 3ZWYA 1T2EA 1KS9A 5T5QA 1UXHA 8LDHA 1DHRA 1I3KA 3ROQA 3H9GA 3JQFC 3RROA 3TL3A 4RLSA 4DGSA 5JNLA 3AW9A 4ND5A 2BH9A 2FY8A 2E48A 4AJNA 1UXIA 1W4ZA 2EXXA 1CQJA 1R0LA 4CM8A 2J3IA 1ARZA 2NU9A 3JQ8A 2J6IA 3Q2IA 4WLFA 4GL4A 5EERA 4PLGA 2P2SA 3CH6A 5THQA 4XDYA 3Q1LA 1N1GA 3FI9A 1YRLA 2B5VA 1LQTA 2HCTA 2YHIA 3ZWMA 2WWRA 3EUWA 3N74A 4JX8A 5ER9A 2GPTA 1HYGA 5A5EA 1I3LA 2O2YA 2X58A 3WYCA 2QZZA 1LC3A 1R4MB 1HF3A 5A02A 3ZNOA 1D8AA 4WPGA 3R1IA 2A35A 1ONNA 3QY9A 1O0SA 4OXKA 3S55A 3ZWXA 1FDSA 4XQEA 1AXEA 3RWBA 1IZ0A 1GD1O 1GPDG 2Y0CA 3FNFA 3K8ZA 1VKOA 5IXSA 3PIIA 4P8RA 4DIBA 1EVZA 1WVGA 3JD1A 3BHMA 3JQ9A 3HHPA 1YDEA 2JFGA 4L4RA 3LT4A 1ULUA 5L3ZA 2Q50A 4GX2A 5U1PA 4FS3A 4ITUA 2CMDA 2VUUA 2AW5A 3ZWVA 4BGIA 3TN7A 1VKNA 4IIUA 4FFOA 3RD5A 1X13A 1R16A 4FJ0A 2WDZA 4RQUA 4PZDA 2FHSA 4WASA 3K6JA 4DBVO 2YQ5A 1K2WA 5B4VA 1ZH8A 3I9MA 2Q49A 1YBAA 3EHEA 4D45A 1HZZA 3NYWA 1ISHA 3ANLA 3X2FA 5FF9A 1M66A 3RUHA 2FWMX 8ADHA 3PPIA 1E3LA 1DRWA 3C3XA 4W4TA 2VYVA 4GSKA 2B5WA 2GZ3A 2EW2A 1ZFNA 4RPLA 5JDCA 4HV4A 3D3WB 4M55A 2X0JA 4ND1A 1CDOA 2GDZA 2J8ZA 3O03A 4J9VA 1GDHA 5TGDA 1SAYA 5ITVA 4KUHA 1E5QA 4LVCA 3OJOA 2CUKA 4BO3A 4YRAA 4R54A 4UREA 1TB4A 3IKVA 4R9RA 4IJWA 4E2ZA 5ENDA 1LSSA 1HLPA 1YO6A 3LVFO 2BMAA 4IQ0A 1I5RA 5IDYA 1ZXLA 2Y0DA 3GFBA 2A94A 3AFNA 1VSUA 5JC8A 2DT5A 3PFFA 3V2UA 2GN8A 2W2LD 4DA9A 5GZ3A 3DBLB 3DOJA 5DN9A 3AK4A 1P1RA 1C1DB 3A4VA 7ADHA 5HTOA 4R69A 5ENVA 3FSRA 3QVTA 3INRA 4P22A 2X9NA 3EDMA 4NJMB 4R01A 4WEOA 3ITDA 4D3SA 2Q45A 3EMKA 5F21A 3PZRA 4DPMA 4QO8A 1PX0A 3ZNNA 4YAEA 4XWYA 3GR6A 5KKAA 1B16A 5L53A 5DP1A 5H83A 1NQOA 3OM9A 1EUCA 3VZSA 3ZHBA 4FC7A 3KLMX 4RPJA 4XYMA 1SB9A 4BNTA 1C0PA 3VH4A 5I7SA 3BYZA 1LI4A 4UEOA 4RORA 3ROMA 3K2EA 1XCBA 5EL0A 1JLLA 5JMWA 2E6UX 2VZ0A 4XYLA 1SC6A 2O23A 4RZIA 4BL5A 4WCFC 1BDBA 4FQ8A 1ZJYA 3RFXA 4A73A 2QIOA 4D43A 4ZQGA 3C8MA 3JQGA 3ZWBA 4DREA 4R4JA 1MC4A 2OP1A 1PS8A 4L9RA 2B0JA 3JQAD 2NVUA 4FD3A 2QRJA 2DBQA 4J1NA 1JQBA 1P1FA 1BWSA 5COQA 4XB1A 1R4NB 1IE3A 1N2SA 4K6CA 3WMWA 3IP3A 1GL3A 3K9QO 3D0OA 2ZTMA 1IYZA 3ABIA 3IS3A 2W2KA 5IFLA 4TWRA 3M1AA 2IRWA 3U4HA 3TFOA 2VUSA 3QE3A 1IZ9A 2YV1A 4Q39A 1KBZA 1EZ4A 2ZB7A 2Q1SA 3VDRA 4A0SA 2Q4BA 4BO2A 4Z3DA 4AJLA 3H4VA 1XR3A 3CINA 5JSFA 4YJGA 4BO8A 4ILKA 3JD3A 5JO0A 2P5UA 2QHXA 4UUMA 1IUKA 1YDWA 2X5JO 1WDLA 3OH8A 3PJFA 3PJGA 1DIBA 1T25A 4G2NA 2NQ8A 4EW6A 1ZUD1 3ZHXA 4LSWA 1KVUA 2DTXA 1BGVA 5BR7A 2FR1A 4F6LA 1TT5B 3BA1A 1NAHA 2PY6A 2O48X 4R1TA 2CVZA 1H94A 1NFFA 2CY0A 4PLCA 4DQXA 3GMDA 1LDEA 5C7OO 3BMNB 4ZRMA 1H0KA 1B8UA 1AGNA 1KERA 5I9NA 2IZ0A 4Q3DA 1F8GA 1QORA 1K5HA 1F0YA 1GADO 3C1TA 4YRBA 1YXMA 2VHYA 2PD3A 4NR0A 4BKRA 1LLCA 1B0AA 2D2IA 3C24A 2R2GA 2AXQA 4GI2A 4FJ2A 3LLSA 3LU1A 5L40A 3AOEC 3RUCA 2PGLA 3Q9UA 2NU7A 4EUFA 4UEKA 1HDOA 1TXGA 2BI7A 2EV9A 2Z1NA 1I3MA 3F46A 5HM8A 5ITWA 5U4QA 3NGXA 4Z9YA 3NRCA 5FEUA 2I66A 4TRJA 1E1LA 1PTJA 4XIJA 3UW3A 4EBFA 1DLIA 5DBFA 2V7PA 5HBRA 2DFDA 3DTYA 4F6CA 3O38A 2RAFA 4FC6A 3PZBA 3VPFA 4XX0A 3PLRA 3NGLA 2PK3A 3ICPA 1OFGA 4PVCA 2EJVA 5AXCA 3VPXA 5EPOA 4RDIA 4B4VA 3STHA 2QYTA 1A4UA 1DHTA 2QRKA 3FHLA 1PGOA 3B1KA 3L4BA 3L77A 3ORFA 3W4JA 3I23A 4FCCA 1XQ6A 1SB8A 2X0IA 1GFSA 3BTOA 4UUOA 1H5QA 4N5MA 1UZNA 2GERA 4HFRA 3RUFA 4J9UE 1E1NA 1MP0A 2RHCA 4JBHA 1A27A 3BIOA 3HDQA 2WSBA 3EAGA 4HBGA 5K0ZA 5K6AA 2P9GA 4ZHSA 1XQ1A 1CIVA 1EK6A 1MUUA 2D8AA 3KTDA 3LT0A 2Y05A 4NMHA 3QWAA 4B7XA 4R3WA 4XYBA 3DC2A 5T64A 5FFFA 1PL6A 1WW8A 4D42A 1E7SA 2NTVA 4E3ZA 3DBRB 1BW9B 4MO2A 5TC4A 5C7LO 1B15A 3FNHA 3LF2A 3JQFA 4KQWA 4WK6A 1F17A 2VWGA 3PLNA 1G1AA 3DOOA 4HNGA 5I7FA 2NUAA 4B8ZA 1NAIA 2Q1TA 4YXFA 2XAAA 3L6EA 1E77A 3CIFA 5F1OA 4RLHA 2HK7A 4OAQA 4J0FA 4QQRA 4U5QA 1CYDA 4CL8A 1LX6A 3CXRA 2PGDA 4CUZA 2YFHA 4IDCA 5B4UA 3DR3A 4OYRA 3BHJA 1ZIDA 5B4TA 1UP6A 2IYOA 3GUCA 2Q3EA 4E5KA 3U62A 3R3JA 3GEMA 3FWZA 4GWKA 3FPLA 4JN6B 1J6UA 1MLDA 1LA2A 3QW2A 2JCVA 3HDJA 3FF4A 1D1SA 2PZJA 4EYEA 2W98A 3CUKA 4DIOA 5T57A 4BQRA 2VRBA 3DBVO 5DBGA 3SJUA 4MVJP 3VHRA 2NNLD 2I99A 2RH8A 2W2LA 4DL9A 4FFNA 4DPKA 1BXGB 4EUHA 2DUWA 3OBBA 3ETGA 1Y8RA 4OGWA 3HNPA 4BNVA 1QLHA 1ID1A 5EMHA 3GLQA 3Q11A 4CMAA 1TA4A 3OJEA 2HKIA 1DRVA 3RFTA 2B35A 4FBGA 3VZQA 1RM3A 2VHVA 1B26A 1DFHA 2BGMA 1LRKA 4O0LA 1DRUA 1E1MA 2BGKA 4NFHA 4HFJA 4IDDA 2Y67A 1VC2A 3I1JA 3ASVA 3U4CA 2HMTA 1YQXA 3RU7A 3GUYA 1FXSA 1AE1A 3PQFA 5TT1A 3WTBA 2SCUA 3NJ8A 1ULSA 4A5OA 4CM7A 4FSHA 2DLDA 3O8QB 5TLSA 3W1VA 4AJEA 1DFIA 2EWMA 1M67A 1QMGA 5HA5A 1DDOA 2B4QA 3JQAA 3KYBA 3SBOA 4CR6A 2WE7A 4PRLA 4J7UA 3W4KA 1LC0A 5ICSA 3KYCA 4Z0HO 1O6ZA 2B37A 2YZ7A 1I01A 1A9ZA 2DQ4A 4Z9XA 4Y6PA 5TNXA 1PQWA 2BKAA 5JPIA 3E6AA 1P1KA 1H2BA 4EUEA 4YAKA 4B3JA 4YB8A 4DBZA 4U0KA 4NBUA 2CZCA 4I5EA 4JBGA 4BOYA 4HFMA 1Q7BA 3NDJA 4KUGA 1YL5A 5JCXA 3B20A 2BFPA 4DMLA 1U9JA 1MX3A 3WWYA 3L0DA 4YT5A 3H65A 1IPFA 3IUSA 1DAOA 4YRDA 2PH5A 1NASA 3GPIA 3NV9A 3V2HA 3GA0A 1N8KA 2YDYA 3OSUA 4K28A 4Q9NA 4YT4A 4OHUA 2Q2QA 1R15A 4O6VA 2Z1MA 2PZMA 7MDHA 4W6ZA 1HTBA 3RUDA 1C1XB 3DOCA 1PGPA 2EG9A 4CMJA 1UZMA 5A5FA 1VL0A 3F9IA 3H6KA 3GC6A 3GNSA 4CLRB 5H81A 2VOEA 3F1KA 3JYQA 4OSOA 5DCWA 5F5NA 5HS4A 3IC5A 4Y6RA 1B8PA 4WCFA 3UVEA 4ZICA 1TEHA 1PZGA 3NT2A 4ALKA 1G0OA 3PIDA 1K6JA 4EJMA 4KWHA 4U6SA 3VH2A 1WNTA 3ZI0A 3B70A 2VWPA 3TOZA 5L45A 1FF9A 2NLOA 1EVJA 2GYYA 3OIGA 1B14A 1WDMA 4IJVA 2W8ZA 2ZK7A 4AICA 1AN9A 1NPDA 4OQYA 1ZO8A 2FPIA 1TVEA 2WD7A 2X9VA 1QYCA 1ZSNA 2OMEA 1KY5A 1LDNA 5GMOA 4Y9DA 4KTVE 3EVTA 3KEOA 4UVEA 5F1PA 3FBTA 1W6UA 5K9ZA 4MIOA 1H9BA 3QVSA 2Y68A 3GY0A 5JFOA 5DULA 1P1IA 4CM5A 2P9CA 3WFJA 3UOGA 4AJIA 4YAGA 1P45A 5AQ1A 2HQ1A 2Q2WA 4ZU3A 2ZQYA 1F12A 2D3TA 3Q2KA 4TVOA 1XELA 1MG5A 2X8LA 1YOVA 2DTDA 3BTSA 4UVGA 1N92A 5I9LA 1MC5A 2AQKA 4WKGA 4W9NC 5CEJA 3TOXA 4NBRA 2ZTVA 1U7TA 3OA2A 3GH3A 3DEYX 2NACA 4LCJA 4BKPA 3MOIA 2X4GA 3I9JA 4J1QA 5LC1A 1QYVA 1TLTA 1I30A 1JU9A 5EQFA 2E82A 3BMCB 1ISFA 1YB5A 2V6MA 4XR4A 3RASA 3DL2A 1LLDA 3HQ4O 1GR0A 4E5PA 4XJTA 1PWZA 5CFZA 1IL0A 2PR2A 3ENNA 3IJPA 3QQPA 1E3WA 4DTIA 5KKCA 3KYDB 2VZ8A 3P2OA 3F5QA 1E6UA 4TRNA 4YJDA 2NU8A 2Y93A 3T4XA 1PGNA 1XLTA 2I67A 1G6KA 4RQTA 2TMDA 2E49A 3WYBA 4TZKA 4IZIA 2P4HX 1H9AA 1LTHR 1ZK4A 1L1FA 1RM5A 4DWVA 6LDHA 5CHEA 5T67A 4TROA 3JQDA 4H16A 3UGKA 3AOEA 4D0SA 4JJFA 3H5RA 4DC0A 1UJMA 3W8EA 4BKOA 4XQCA 2VHZA 3RQSA 2XOXA 4CJXA 3JD2A 1E3EA 4CUKA 1UH5A 4JGBA 2UV8A 1K6IA 5KJ1A 1W0CA 2JD2A 2OXIA 3BMOA 2CDAA 2CDBA 4MVJG 4J90A 4HNHA 2Q1WA 2IYPA 3UUWA 3L4BC 3S2FA 1ZSYA 4IPTA 3TRIA 3BMQB 5THKA 3UFXA 3ITKA 5H82A 1ADFA 4R41A 1ISGA 4IM7A 3RBZA 1WZIA 3BZUA 1K89A 2IDZA 2WE8A 3GVCA 3NTRA 2DPGA 2ZCUA 4PG4A 4CMBA 3R6DA 1RKXA 1NWCA 3EC7A 5A1TA 3VPHA 3KHUA 1VSVA 2UYYA 1O95A 1GPJA 3JCZA 5FI3A 1SO8A 2BFAA 3AWDA 2O2SA 5IZCC 2FRDA 1KEPA 2BRUA 2JD0A 3RC1A 4YAJA 3M6IA 4CV0A 1A9YA 3S2IA 2CNBA 3OHSX 4AJ1A 1R37A 3RUAA 3U49A 2O7SA 2P9EA 3I4CA 3ON5A 4LN1A 4XDZA 1ENPA 3JQ6A 4B7UA 1B7GO 2Y66A 4CQLB 1S6YA 1HSZA 2OHXA 3H9QA 4QFCA 4BO0A 3IP1A 1PIWA 5JLAA 2FZWA 1VJ1A 2HRBA 2HMWA 4GPD1 2C2YA 4J6FA 3Q3CA 4FPXA 4BV9A 3FTPA 2NSDA 4TRRA 3UCEA 4XEHA 2P91A 1I3NA 2NTNA 4MVJI 3ONFA 1TT7A 5AXBA 1UXGA 1TI7A 1YQDA 2ZTLA 3AJRA 1U2GA 4S1VA 4CV2A 4L74A 1BG6A 1R0SA 1PQPA 3D7LA 1RYEA 2Y1EA 3VZRA 4G65A 3T7CA 1R0KA 3IL2A 3UAGA 2X7HA 1UP7A 4NNJA 4WUVA 3NKLA 3GF4A 2WEKA 4Z0PA 5CG1A 2O3JA 3VVCA 1SOVA 3MJEA 5U9CA 4AJHA 2FOIA 3HFSA 2OBYA 1V9LA 1DIRA 4CM9D 3VPSA 4PLHA 2DFVA 1R66A 3OEYA 4URFA 4E0BA 3JYLA 2J3HA 3GAFA 4PGFA 1CF2O 1CWUA 1Q0HA 5JY6A 2IE0A 1PZHA 5DCUA 1LDMA 2J3KA 1JKJA 4PLVA 1ADBA 3D3EA 4QEDA 4E5YA 3H8VA 1OI7A 3SLGA 4YBZA 3RSHA 5AXDA 4HP8A 5CEFA 1M2WA 2VNSA 2Y99A 3BAZA 4RZHA 4B8WA 4HX5A 5L51A 4D3DA 4IS2A 5IDQA 5LDHA 4B4UA 3WXBA 3HWRA 4LISA 4YDRA 1Z45A 5CPFA 3W8FA 1NVGA 1R4MA 4BNHA 3F4LA 2YFQA 4DC1A 1NQTA 2JL1A 4INAA 5TT0A 1LLQA 3GG2A 2C82A 1LSUA 4DLAA 1F06A 4FFMA 1JWAB 1SEPA 2OP0A 1FDWA 2X1HA 2C59A 4KUEA 2JD1A 4PZEA 1YBMA 3FRJA 3ADOA 2UUOA 3E03A
chains in the Genus database with same CATH superfamily
4LYJA 1GUYA 1NVXQ 1UDBA 1X77A 2OB1A 3K72B 1L9XA 2HYDA 1PR6A 3QNUA 2CJWA 2NZYA 1F8UA 1GZHB 4M1EA 1G5FA 1QIIA 5F98A 1J8YF 3ZTWA 3VSBA 3PYLA 2C7VA 1E63A 2BD0A 2I1LA 4WH0A 5GJVC 4ZZ0A 4Z1MD 2BFWA 4YASA 3EJ6A 4NICA 1J8MF 3U2QA 1G66A 3AV3A 4Q6BA 3F98A 3ELYA 5K45A 4EHJA 4FT2A 1R18A 3Q8MA 1O89A 1VIAA 1XZHA 2IYUA 4CPDA 4WRRA 5EG5A 5ICFA 5JBIA 2X9LA 4MWBA 4J0GA 2JGLA 4I9UA 2HEIA 2NSJA 3WQRA 1IOLA 2QN3A 3RSSA 2QTCA 5F78A 2NVUB 3R7NA 4M99A 3VKHA 1VI2A 2WUWE 5DISB 1QP8A 1UBCA 5JCZA 2IZ7A 2QGNA 2B99A 3HCWA 2BHSA 3CZMA 2I7CA 2J5XA 2DWUA 2CEKA 3E1KA 2I9PA 2C00A 1RI2A 3RNOA 4LC0A 2O4UX 4QTXA 1SXJE 3O3CA 3V4LA 1JDZA 3NORA 3ELWA 1KETA 1S89A 1N75A 3ZCRA 1ESNA 4TTIA 5JDIC 1NFQA 1C9EA 1TTQB 2C97A 2Q4OA 4XWGA 5EGSA 5J47A 2PRJA 1NUUA 2OG2A 2R6JA 3NWBA 1CR1A 2XUJA 3PICA 3QTLA 4JWTA 3MHPA 4KN9S 5ALIA 4NFYA 5D6OA 3RRMA 4EL5A 5DGTA 2NTJA 3OX1A 4P3KA 3ZXUB 1TC2A 2N1BA 2A5FA 4KJZA 5B7GA 4RU1A 2IYEA 4RVOA 1UJBA 2WU4A 4H1VA 3IV6A 1S9DA 2VNJA 4L8YA 5BXQC 3VR4D 1N36B 1N2HA 1A2KC 2RI6A 3K3PA 3NIGB 1T0BA 5TGZA 3P19A 4BV3A 4D0LB 3B1XA 4DQ0A 1V1MB 3ZVMA 2VK4A 1QR2A 5AVSA 2WYWA 4M0CA 5G0UA 2WPDA 5KVQA 5AICA 1RBYA 5HP4A 2HU8A 2ZTHA 2HRCA 3RSQA 3PFGA 5DF1A 3LUGA 3P9NA 3F6SA 2VQEB 1ZKDA 2SHKA 1I2ZA 1OXXK 2FLWA 4JX9A 1FVHA 5G40A 1KK1A 4TPKA 4GI7A 3GT0A 4TSFD 1U7WA 4YUAA 4FNGA 3QJ5A 3B2EA 2XXAA 1UFKA 3QOXA 3KG2A 5FWYB 1VG1A 2PT6A 4NJMA 4MH0R 1WEHA 4D92A 1E6LA 3B12A 2E21A 2ZEJA 3D02A 3IDOA 2R60A 3QXJA 1E6WA 4HYTA 5DOVA 3UK0A 3T7DA 2AEJA 4KR7A 2EF0A 1AGRA 3DONA 5EVJA 3JATA 1EYZA 1BCRB 3S3TA 3SYMA 1CS0B 1L2TA 2R6CA 3AL3A 2ZIZA 3WK8A 2FEOA 1E4EA 1BFDA 4S1WA 1GG2A 4B80A 1PJAA 3JVUA 3GLHB 1KJ8A 2JAQA 3HWSA 5C8VA 1GARA 4G97A 2XXBA 4B6FA 1T2FA 1IXRC 4IR7A 1J21A 2GBLC 3T12A 2P6RA 5D84A 1TO1E 3TKYA 5BNIA 5G0WA 4EGFA 3HR4A 3Q7EA 4FN4A 4ND3A 2XTZA 4HAVA 4JBIA 4DVJA 4L51A 1KEEB 2QG6A 4P6VF 5HIKA 1V71A 1JPNA 2PNFA 4B3HA 1JEYA 3EIFA 2JRLA 1NHGA 3WIEA 2DQKA 3JALB 3C6YA 3SBEA 4UBJA 4JSTA 2IIVA 3N2NA 1HL3A 4MYSA 3A6GA 1PJTA 3UYLA 5LUBA 1WPRA 1XLTC 2IZOA 2V7QD 5M5BA 3EFOA 1QU3A 1RYFA 1S8AA 1ORIA 3HPQA 4AY5A 4JLJA 3BK1A 3IVMA 5EEGA 1JHRA 1KJQA 4GYWA 4F9FA 4H4EA 2R4QA 3AYXB 3PGMA 2WY2D 3FYUC 1PZNA 3FYTA 3VZPA 3HBMA 3RGGA 4AD8A 2RK3A 1ND5A 1NVUQ 1YZQA 3AKZA 3L7NA 2O8FB 3I6QA 2F4VB 4BMSA 3BE5A 1B73A 4AJ4A 1PSZA 2PUCA 3QOYA 2FK8A 2GO1A 3NTXA 3RSZA 1WXFA 2R1TB 3HCRA 2PVCA 3AR6A 1JR3D 2Y1DA 3E9DA 2WQ6A 2O0LA 3C8UA 2TSYB 1M33A 1YD7A 5ICMA 1PKXA 3MWEB 1LK5A 2R8YA 3ZDFA 1EJ6A 3P9CA 4DLLA 1XZLA 1S2MA 1Q0QA 3KXPA 4IDPA 5IM4F 2B2CA 3UGTA 3UK6A 1D3AA 4JROA 3SLRA 4PC6A 1NURA 1ZIYA 4CLHA 4IWNA 2C3OA 1E1KA 1UKZA 2YOGA 4C4TA 1WXEA 2ZJZA 4NZ9A 4DLWA 5CBPB 3RM3A 2DFTA 3R9IA 3RAPR 5JYDA 3B6IA 2QLLA 4QOHA 2GN6A 4DLTA 5LYJF 1CYEA 2V7EA 2AHOA 4UMDA 3WLFA 1SHLA 2BKXA 4GOLD 2BT4A 1PK8A 2XJ4A 4PN3A 4PVDA 3WDMA 1GVHA 5DNEA 3RIEA 4Y2RA 4G0XA 3FWNA 3THRA 1YFJA 4U7PB 3EA4A 3LZDA 1HEUA 4RGBA 5BYAA 1IATA 2ZQZA 2QD2A 1NQAO 4RUKA 2ERXA 1PKEA 3PKIA 4CCYA 4IVQA 1RWKA 2IXBA 3AF1A 1XA0A 5FWNA 5KHOC 2I3GA 3A28A 4D3FA 3KSBC 2YV3A 1Y8AA 1DC5A 3KZVA 4TMTA 4UUPA 1FNCA 1Y5RA 4YMWA 2JFHA 1X8KA 2R62A 3HSKA 4C0SA 2E37A 3KSZO 4MULA 4O08A 4RENA 1ZCAA 3TTUA 1U0SY 4OQDA 5IDXA 1Y42X 3VKVA 1EZ1A 2B4RO 3P94A 2Y8EA 1U8XX 3RVOA 1P4JA 4DUPA 4PFSA 4ZEOA 1I4OA 1EUZA 3B6KA 3KXIA 1FQKA 1W5AA 3WSVA 1WBJB 4WBNB 1GV0A 2RAVA 5T4HA 1NYRA 1GSIA 4KZPA 1OBFO 3V8RA 3CE6A 4DRXA 5TMPA 2WTEA 5CVJA 5EJAA 4NPCA 4U7TB 3F3YA 4N0QA 1XZDA 2QIPA 4KW7A 4X7PA 4FKZA 3ZNPA 1GAXA 1N5OX 2BEUB 2RHWA 5JZSA 2X9GA 4XR9A 3O8LA 5K03A 3ZE0B 4DA7A 1BMDA 1C8BA 3GW8A 4CEIA 3TLBA 1MJFA 5I7OA 4HQ0A 3C1OA 1TVCA 3ND7A 4M1ZA 4NQRA 3W90A 3LCJA 2EHDA 3PUYA 3AZQA 4YAOA 3VR0A 4C4OA 6CHYA 1Q21A 1ZH6A 1NPYA 1KVSA 5HJ7A 2AZDA 3LBNA 5K3CA 1EFTA 2PPLA 3I2JA 1YR1A 1Y8ZA 3IB6A 2CMHA 2QQFA 3I9KA 3ZCXA 2DEUA 1TJ3A 1F2VA 3V7UA 2GCGA 1XZPA 4I9NA 4C0AC 1H2WA 4YDSA 4ZO6A 2VF7A 3RS0A 2UAGA 4D25A 3S8MA 2DAPA 3CW9A 3ENWA 4CYMA 1WZ2A 1ZGGA 1HKUA 4K87A 3BXXA 4HZGA 4EAQA 4MHOA 5CNIA 4ZQEA 3LUHA 2VP9A 4UTPA 3BWCA 5I4BA 2ZUDA 3DEJA 4L8VA 4UVIA 4B40A 4X1YA 2YUTA 1ZM2A 1KJ9A 2XOKA 3BH7A 4Q3NA 2CJXA 3F71A 3AUKA 1I4LD 1Q83A 1E5VA 2SECE 4I3GA 3RYTC 3AHEA 4QSMA 1CLUA 4NBLA 1PVVA 2Z08A 4GWGA 4BNHA 3VISA 2PKQO 3GRAA 5DKFA 2E4XA 3FUCA 4K9QA 5I45A 3FDIA 2R8EA 3KB2A 4FD2A 5DNUA 1AZWA 1YVDA 1DMSA 1JR3E 3GFQA 3OEHD 3HBJA 1RT9A 1AB5A 4LE0A 2L2QA 3IDFA 4YREA 1HE8B 3DBRA 2Q8NA 4TS4A 4UQPA 4RESA 2X0FA 5DEOA 1A3CA 1P31A 3CFYA 2J85A 4ZRNA 4QOSA 1A8QA 2QM7A 3O26A 3RRYA 2JJ1A 1LJLA 1QRRA 2MSCB 3E7FA 3ASUA 1BFUA 3OPQA 4I4CA 3JWJA 4TTTS 4Y6SA 2C96A 4EENA 5AK0A 4DDUA 3BGSA 1LI5A 1WLYA 2B1QA 2OQ2A 4DR5B 3RTDA 1NL3A 1E9FA 4NONA 4LDJA 1SKYB 5FPPA 2VYCA 1U28A 3VMFA 1RSZA 3PPWA 5HG0A 3OAAD 3WGZA 5B3JA 1U4SA 3CJQA 2D4AA 1E32A 2AA3A 4KHPB 2CJFA 2LV8A 4ITVA 3RC7A 3G3EA 1TE2A 5EP3A 4D9GA 1UBRS 5C4MA 4UHEA 1W35A 4FILA 4KCGA 4WNAA 3RS7A 1S7CA 2R751 5BNTA 1OJLA 1EFVB 3AUSA 2JHCA 4NBWA 5GGYA 1PSDA 4BVLA 4AWBA 5AW1A 4LMAA 3L8YA 3G2HA 4G85A 2BELA 1SC9A 2YV2A 1KC3A 4QBGB 5JJBA 4Q9JA 1C7EA 1C8LA 1NV8A 1R8XA 2ICAA 1MD9A 2Y77A 2BKUA 4N5IX 2H7VA 4MQBA 3GT4A 2CVOA 4FDUA 4IVNA 3RH0A 1N2OA 3WLEA 4O4JB 3E70C 2C9OA 4ZARA 2UXDB 1J7KA 2X5XA 1GQRA 3P4UA 4N18A 3V97A 3VH3A 4RLFA 4KQ2A 2REQB 3PXDA 1A5AB 1KI1A 2LVBA 2F43B 1OX4B 3CCCA 4FZVA 1U2QA 2NZUG 2IXAA 4ND2A 4J1TC 3U3MA 5LP6B 4W7HA 1KZGB 3W79A 4IKOA 1C30B 4NOKA 3OTOB 1T15A 1J1IA 1M1YB 1XP5A 3BUSA 1KQFA 3GZTB 3LPNA 1K97A 2ATXA 3SC2A 2YQ4A 3AHCA 2IZ1A 4O8ZA 4JBYA 1FU7A 3IVGA 3WBFA 1ZI6A 3AR8A 2X14A 4NCXA 2DWOA 2Z1DA 4AMZA 3O75A 1XF1A 1Y5IA 1SUWA 4Q3CA 3CC8A 2BTQA 5C8YA 2BGTA 2W2PA 3ZXYA 2LIVA 4K5QA 4YYEA 3SBXA 4UJ5A 1Z12A 4F38A 2DUMA 2QENA 1HA3A 2J3DA 1SU7A 5H02A 2EP7A 2H17A 5FI0B 5CD9A 2ZFUA 4MP3A 5JDIA 2HTEA 3E23A 3TGLA 4TV8B 4X7BA 1Y5NA 2FPIB 4LWZA 1NQ5A 4ARAA 1OFUA 4J0CA 4DAEA 3L1UA 3IKMB 1DBVO 1GZ7A 2RK6A 4KO4S 3EPPA 4MEAA 1QFZA 5CURA 5CA0B 5K0BA 4D26A 3WKBA 2OZPA 5DI9A 3G49A 3K6SB 3HB5X 4Z99A 4ZAZA 1MAHA 3KKEA 4G0ZA 2C9BA 3BRQA 3K15A 3K9WA 1VL1A 4H6XA 4ZCSA 3SC6A 3U37A 5JCJD 1PGJA 1Z5UA 2BAGA 5HWSA 3EZXA 1HQYE 3NNNA 2YW9A 4Z4CA 4CV3A 5JYEA 1BGXT 2WNHA 2LDBA 5D51S 3VTFA 1HSOA 5DM1A 4LTMA 3SAJA 4ER3A 2HA6A 2N0SA 2XCUA 1DIOB 4O2BB 4WXYB 2D5AA 1DAHA 2CLOB 2HO4A 2VF4X 3DT9A 8MHTA 1YRQA 1SU6A 3ETCA 4PGGA 2CNWA 2FUKA 1DKUA 3EIQA 5LM3A 1OW3B 1Y3DE 3GZ4A 4HH1A 4UULA 1WJGA 3EGDB 1HRDA 2E0IA 2ODNA 2INGX 4LC1A 2H4XA 5MF6A 3K5IA 5KIAA 1EX6A 3C41J 4Y2UA 5CIWA 5E6SB 3KSDO 3FDZA 4YI5A 2IZ6A 3OF5A 5JO9A 1IN6A 1L4KA 1UXKA 3RFUA 4KXUA 1Z2OX 4KFRA 3L82B 4HGQA 1OZHA 3PD1A 2HK8A 1JA1A 4XYGA 4BX0A 1JH9A 4QWWA 3EAQA 4MV6A 4A1OA 4N49A 1ZJWA 1GUAA 4TUYA 1Q0ZA 2P30A 3TB6A 3K71B 3VNAA 1EB9A 4QUJA 3CF4A 3PTZA 4IH9A 2I2AA 4JOCA 4L76A 2Y1OA 3AOGA 1O57A 5CP8A 4YRIA 3AIKA 3RKRA 2C2KA 2EU8A 1P9LA 1NMYA 4DLYA 1MXHA 3JPYA 4JSRA 4U02A 3MS2A 5DK4A 3PK0A 1F1BA 2GBLA 3SJAA 2AFHE 4MUAA 4HRXA 4AO6A 5CFOA 1ACMA 2GZRA 4N7MA 4ZCQA 1VOTA 3UJPA 2R84A 1YC5A 5LPNA 2I4TA 3INTA 3R7FA 3I9FA 1Q0PA 4E5NA 3JPWA 1BS9A 4OQEA 3U1BA 1WO8A 5F2OA 3VVLA 2HA0A 1MU0A 1T1RA 4FNOA 1N9GA 1ATIA 4NDAA 4OMCA 5J4LA 4JP8A 2EARA 3ISVA 4LC9A 5BSFA 3VI4B 3DZJA 1FX0A 2C9CA 1GPAA 2O6LA 2Z5LA 1KE2A 3ZU5A 2P1DA 3UB2A 1NVBA 3NTQA 4UEJA 3WAKA 2GHRA 4IEIA 1K8YB 1U6KA 3N2YA 5FI1B 1Z0KA 4OBXA 2DFLA 2W6QA 4Y8VA 4IYRA 4YRMA 3AU8A 5IJ9B 3FYUA 4RY8A 4R51A 4XDHA 3IJRA 1IN7A 2NUPA 2WVAA 4F6RB 1WETA 1Z5ZA 2XBUA 3IEKA 3ITEA 3P26A 3DKIA 1FMLA 4AZ3A 2COKA 3O8BA 3DGFC 3H4TA 3N05A 1ESMA 3GDGA 3ODPA 2V9PA 3L5KA 1LXCA 2XWJI 3PC8C 3P9RA 3VVBA 1ADCA 3UG7A 4CM6A 5B7NA 4HCJA 1PEKE 2GHTA 5E8JA 2ADMA 4MQ5A 9GPBA 1ZH4A 3LBHA 2K7FA 4NEHB 3R20A 1TLFA 4XVRA 5KNCD 2BUCA 5FBLB 5J5AA 1M1XB 4MI3A 3RAEC 2HNBA 3FCAA 5BSEA 3DTVD 3ZCVA 5FOXA 5JZVA 3A1CA 4E2FA 2DBZA 3THWB 2PS3A 3O0TA 1XD9A 4MYTA 3ZIUA 5TQVA 4X24A 5EXEA 1Q0RA 3HVIA 3KSAC 2ZR8A 4KXXA 1C9NA 2AEFA 2IU4A 2DU8A 4YI3A 4RXMA 1FEZA 1OLXB 5LXTF 2MINA 3QVUA 3MGCA 3BZBA 3PGLA 4M2LA 1V8DA 1VIMA 2X2EA 1H1LB 3IDZA 5A71A 3CLSD 3OC6A 3UK2A 3OOEA 2WM9B 2ZTUA 4LJ8A 2ZIUB 4YO7A 5I8PA 4FONA 4PZCA 1T5IA 3N8DA 2W42A 4O33A 1U0BB 3HXLA 4LOAA 1X0XA 1I32A 4N5LA 3MVEA 2GN9A 2PGJA 2A8YA 4KQFA 3SG0A 1Z3IX 2WMYA 3U40A 2P2NA 1NW9B 2JVKA 3IIMA 3RU9A 3T5PA 3ZWPA 4H7JA 2PLRA 1VBMA 2O2ZA 4HKTA 1M8FA 4NP6A 4XPIA 4XWOA 2EFYA 2HT1A 3FMGA 2LWIA 2PSSA 3GNQA 4MUXA 3WSTA 5KSPA 2OXEA 4Q5IA 2PSJA 1GYPA 1GZDA 4MW9A 4ZT3A 2VN8A 3CR7A 4MITA 1P0CA 5CDYA 4M1TA 5FJIA 5BOVA 4Z53A 2J5RA 4X6YA 1Q19A 4RQAA 1SZCA 4EHHA 2IUEA 2ZSBA 3F7MA 4J76A 3DD1A 4U2KA 1M3SA 2J9ZB 3EK2A 3DDSA 1ZJZA 2O54A 3DMDA 1ISIA 2R44A 5AKXA 2OC9A 1T9KA 3BFJA 3DHNA 5DOZA 3FMPB 4JIMA 5I7WA 5KYXA 1Z75A 2XYVA 3FA2A 2XNHA 2H54A 1U3VA 1SHUX 3HFRA 3V80A 1EX7A 1BIFA 2XUHA 3BCRA 3NIDB 4RKFA 4Q3KA 1DBWA 2QN9A 1VP3A 3D4NA 2QRGA 4DV7B 1KHHA 1NUPA 1XLUA 3I52A 5LDGA 5K4HA 3L06A 1JKJB 3JVEA 4V0NA 2JB9A 3H84A 1T3SA 2AJCA 5HTKA 1RCFA 3AT1A 1UZUA 4NU5A 4CLOA 5EIOA 5D1HA 1TK2A 2M2IA 3A4IA 3ANXA 2EGUA 4DR4B 1PR5A 4N41A 2JG3A 5KVAA 4C0HA 1QWSA 4RYDA 4CMEC 4ETWA 4S2EA 2J0EA 5M3BA 3BSYA 5JBQA 3R0ZA 1CRPA 1NYQA 3F8SA 4UZSA 4EMBA 2JGDB 3SJZA 1XG5A 3MB8A 3LQ2A 4MX8A 1HDYA 1D4OA 4K9LA 3R0QA 4IO1A 4WN9A 4CLEA 4MV3A 1YB6A 1PN3A 2JGIA 4ZEVA 2EF1A 5FPYA 5SV2A 2H8GA 1EFPA 3GFGA 3F2IA 3M81A 3FJ1A 4DTCA 3TR0A 2EX4A 4L95C 2H8KA 4LJ7A 1WXWA 2J4DA 3OZBA 2C07A 3S8EA 1M34B 3LLUA 1WXDA 1V6SA 2B7BA 2GCOA 4G1BA 4B4OA 3ICCA 3TZKA 3E8SA 2YY7A 4MARA 4XQ0A 1LUAA 1YU9A 3QLEA 1V95A 4BNXA 4ASUA 2ZUEA 3ONWA 5I4CA 2VT2A 5E9QA 3EBLA 3OE1A 3PNBA 4Q4LA 4FCWA 4WMLA 5D01A 3ZLUA 1EESA 5CJJA 4A8TA 2CLCX 3NAQA 4M22A 1N1DA 1NT2A 4I1SA 1XX6A 2C99A 1HE5A 4NFSA 4QUDA 3DAFA 4QJBA 2IL1A 4MLZA 2AYXA 2D2VA 4DWWA 4IRUB 2F1KA 2G80A 3L4SO 2D5CA 2PD6A 2FOXA 1ES9A 2X0KA 1RZVA 3BWDD 4M0FA 2ODAA 2ZROA 1TL7C 5EWMA 3C0KA 2F1HA 2BF7A 3KJGA 4CFSA 1NDHA 3W5UA 1VE7A 4FB5A 2POQX 1XDUA 2GB4A 2FI1A 1T1SA 2VSXA 2W2NA 1GCAA 3ID6C 3FNGA 3L6DA 2GYWA 4AN0A 3BQNB 4FT4A 3DHEA 4KAAA 3MWGA 4Q6WA 4J3NA 3UJBA 4JJIA 5FUBA 4D9MA 3EEIA 1NI3A 3E1GA 3H2ZA 4XOUA 2B4KA 4FHZA 4YRLA 3R8XA 3S2ZA 3GZJA 3FROA 4ZT2A 5KMGA 4L8FA 4QKQA 5AVOA 5F12A 3TZLA 2HYIC 3STYA 4I3HA 1G5RA 4E88A 2PD4A 2CCKA 2H9AA 5ALNA 1UC4B 2BKEA 4UD6A 1OXBB 2HWXA 2PSHA 3OUTA 1JKXA 3TXXA 1F5SA 2NZ8A 4WOPA 2FSIA 4J2OA 2X22A 3DV0A 1J0CA 2CT8A 721PA 3L6CA 1DARA 1UBHS 1ZC3A 2RB5A 3ZGVA 5MGBA 4BBZA 1HZJA 4DUGA 4M9UA 4ARCA 1P0MA 1XMJA 4J1TA 4IHJB 4BUZA 3SHOA 4K6GA 1BA2A 2HUPA 2HDNB 1JN0A 2JHAA 3LKBA 3Q6IA 3REGA 4BVJA 1RWWA 4F2GA 3HBFA 3OJLA 5GJBA 2GN0A 1V5FA 4EHFA 1Q0UA 1S1CA 1U4OA 2CZQA 2IY7A 1FPMA 3RVLA 3LF1A 4YCJA 3T99A 1H1TA 2AEMA 3PVCA 1QR6A 3PEEA 5CYOA 5EI5A 2XNCA 3KOZA 3NTLA 2IWRA 1XK7A 4F11A 1QPBA 4HC4A 2VDRB 3MCZA 4YMHA 3KETA 1QS0B 2I6TA 1H9CA 1WMBA 3DM9B 1YJ8A 1F4LA 2C4NA 3KHSA 4J3FA 2WMDA 1Y9JA 2FW6A 4H59A 2XADA 4ZDIA 3D3WA 1JKFA 3FUTA 2V65A 1RXYA 3ED1A 3IMFA 4Z4HA 1ZIXA 4PXAA 1OROA 3GRYA 1KBOA 5DXAA 4ZEWA 3ZHRA 5JMTA 3DMTC 1IBKB 2XDQB 4WZBA 3Q3JB 3ILXA 1XQYA 3NWOA 2ETVA 5KCZA 4RJ2A 4ESOA 2JBAA 2AJDA 4MV0A 4WV3A 5HKLA 1Y6RA 3RUEA 5KTTA 5IRCD 3SLKA 1KYWA 2CNNA 3WQSB 1AY0A 2PFKA 1J4AA 4E4YA 1GRCA 1CVLA 4YJGB 2W6PA 3STVA 4ZN6A 1P74A 3WGHA 1Q15A 4NE7A 3VNVA 1TDJA 3T1QA 1Z28A 3IE2A 2SKCA 1ZCJA 1ODLA 2JAHA 5EIWA 1KC1A 4IZ6A 3FHJA 4PZLA 5E7JA 1FYVA 2O7RA 4OAPA 2OYRA 4B6SA 2EBHX 5KCMA 5EMJA 4OL0A 4INZA 4YWHA 1XI2A 4LZNA 3T3EA 1XFDA 4DQUA 4F5ZA 4WZAE 1KMNA 3E3OA 1ZAYA 3HA3A 3GPDG 3IUBA 4DXDA 1XZKA 4ZYYA 3CZPA 3S99A 4RH1A 4P82A 2J4FA 4FSDA 4E11A 1Z74A 2VHEA 3OKAA 4GX5A 1SY7A 1CEQA 1YBVA 2RI1A 3EQZA 1OVGA 2R97A 4WE3A 3H04A 4JLBA 3UT5B 4TQGA 3THXA 2I78A 1XEAA 3J81k 4BO9A 4P98A 1L5LA 5JANA 2VTBA 3EWAA 3SWWA 1EUQA 3AINA 1MB4A 4D96A 2EFHB 4KDEA 4EZIA 2PV7A 1RADA 1U11A 1X94A 2RGXA 1J0XO 4DUZB 2ZUVA 2X2PA 1X6VA 3H9JA 5BSUA 2QRZA 3BQMB 5CPBA 4PLPA 3K0CC 2OGUA 3OZFA 1HEYA 1U1FA 2UYOA 3CO5A 3PA8A 3QOWA 1B6SA 5L3RA 4ZOQI 4KDFA 4CF4A 3GVXA 3HUTA 4CIVA 4MAMA 4C3VA 1RMTA 5J2TB 2GF2A 2E1PA 2FN7A 4Q1BA 4Q02A 3HABA 1YASA 4WFQA 2HSWA 4KXVA 3WLLA 1LPMA 1ZUIA 3AEKA 1AMUA 2NU7B 2OWDA 4JMLA 4AL4A 3GN2A 4BNDB 1OHHA 2PS1A 1O4VA 4HNAB 2UVQA 2ZYGA 3F96A 1LB1B 2FPRA 3QF7A 4FFSA 5GP1A 5EFZA 2FSSA 2G6BA 3AEUA 4J07A 4QC2A 1BVYF 2FF7A 3A06A 3WB9A 4ZIRA 2Y4OA 3L3BA 5GONA 2EEZA 1FFBA 4WLNA 1DJNA 4FTWA 3DE1X 2VI5A 1ORWA 5E4TA 4BVAA 1Z08A 2JLCA 2W2QA 1I9GA 3SS9X 2XF2A 2BMVA 3ZJVA 5JS6A 3K31A 4I2VA 4K86A 1LBHA 1PQUA 1SXJB 3LQ4A 3BREA 3BFVA 5BSTA 4XX0B 2QQ5A 5HNKA 2XMDA 4JOBA 4DILA 2PT9A 4UNSA 4MVJH 3RU3A 3H9CA 5FDFA 4CF7A 2I76A 1SQ6A 1HE4A 1FFHA 3DEIA 3L0CA 4P4UA 1C3OB 4C7XA 2QDKA 4I5DA 1X1QA 3MBOA 2OHFA 2O8NA 3BE8A 1I4WA 3P2YA 2QJWA 4TN1A 4Z2YA 3KR2A 3RVPA 3BFPA 3E84A 3DCNA 3GLIA 1NC3A 3F2VA 4QBHA 4KSCA 4TVKA 4WNIA 5E2AA 4E2YA 1BEEA 1KO5A 1R74A 3JQCA 5CVCA 3RHTA 3GCGA 1QXSA 3ZIAD 4PYQA 2DF8A 2ZJ3A 2JZNA 4JYAB 1UODA 2FK7A 4ZVUA 1U80A 3S2SA 3P9YA 4OKNA 4I19A 2C5GA 5J5VA 4G4IA 5DW3A 2QL7A 3E48A 3BRWD 2JAPA 3NHPA 2QXUA 3I6MA 4FW8A 4UAUA 5BVGB 3DXYA 3I6ZA 4TVBA 2RGDA 4MPRA 1Z7WA 5JHGB 5CB6A 5IVKA 4URHA 3ONDA 1TQ2A 1DAGA 2B6NA 4O2AF 4QBIA 3HB4X 3O47A 4S1OA 4ZAXA 4AFNA 3QKSB 3OOJA 4B0OA 3GPLA 1W19A 3QLVC 4NKRA 2PRKA 4LBWA 3ZZMA 1Y7TA 2HV9A 4IDGA 3I53A 2XTAA 4N82A 5ALOA 1RAEA 5G4KB 5GAJA 1EBUA 1UMCB 3WBJA 4JYMA 3IAS1 4R9NA 1J49A 2ANCA 3SQXA 1PVOA 1NJ8A 2G76A 3R4CA 4IDAA 5I9MA 3RFCA 1VCHA 1OXMA 3O90A 4IRMA 2F2TA 3NWJA 2GOYA 4K9DA 4OUDA 5KAPA 4KE7A 2OV8A 4J75A 3TNFA 5IF3A 5LD2B 1KTIA 3WDKA 1F60A 1JLRA 2PVPA 3RADC 3VPDA 3VR5H 3W77A 2UZ0A 5C9ZA 4EPVA 3ECCA 4GYJA 3SOZA 3GEHA 4MJ7A 4E22A 2XXJA 4Y98A 1SKAA 2CBZA 4BNYA 2YOHA 3E9EA 2NG1A 4OH1A 5JEEA 5BSWA 4REMA 4M8SA 3BT7A 3ZZTA 2TECE 2XMGA 2Z9BA 3SM9A 4RF4A 2BN4A 4EECA 4X92A 3G7SA 4XZ3A 1XDZA 1K98A 4QFDA 4AZVA 2QE7D 5ITZB 1NE2A 3CEHA 3EYWA 4FOSA 1EE9A 3H9EO 4G8JA 5EIBC 4RMHA 2PDAA 3FR8A 1MEOA 1W0JA 1NBHA 3U9SA 2WQ7A 4KVAA 1G60A 4MIEA 3EULA 5TMDA 3G8BA 1Z39A 2QSJA 2QNBA 1NV9A 3O3MB 3PEVA 5FLYA 4BUJA 3O7WA 4GMFA 4YT2A 3EUAA 1DCKA 1GYQA 2UVPB 3AR4A 4JEUA 1MA3A 4UATA 4EJ2A 1GCGA 3SZUA 2GX6A 3L6BA 1VSBA 2GUWA 4QODA 1WPQA 3FYDA 5CDFA 1MQ9A 4F3CA 2QT9A 3KBBA 5MDHA 3I39X 4FFPA 3MSCA 4W5RA 2I3DA 1N5MA 4MP6A 3TUZC 3MJVA 1QYDA 5DHTA 4IIHA 1LNQA 3KOXA 4BKQA 3SIWA 1IY9A 4ONEA 3WLTA 4C07A 3HLYA 4CMEA 2HPZA 4X62B 3RIMA 2CWWA 2KBFA 2DKFA 3KQOA 1ISRA 1ONBA 1ZBQA 2DBVO 4BO5A 4UOZA 1W75A 1W5BA 4G9GA 3LZ6A 2YJZA 4K2HA 2X1LA 1CW2B 3PUHA 4RS4A 1FTGA 3NBXX 3ICVA 3ZWWA 4Y2JA 2PMEA 4B2YA 4TMWA 1XVUA 1MH1A 1LNSA 2CYCA 2WNIA 5JFTA 1FJGB 2VDKB 4RTNA 4CM1A 3BE6A 1IK6A 1QZXA 3LC2O 5HCNA 2D6FA 1OFVA 1U1IA 1VPVA 4R7GA 2ZATA 3JZAA 4UNPA 1NQWA 3H3JA 1ABBA 2DCMA 4GH5A 4KP7A 4P7JA 5E6RA 5FEMA 4D3XA 4EA9A 4KWEA 4NIMA 3T9EA 1ZINA 5C1BA 2Q5QA 1IPEA 2XB8A 1SQ5A 3DC7A 2GCIA 5BV0A 5KNDD 1SUCA 1XJQA 2BBWA 2Q4TA 3AB3A 1UJ2A 1X39A 1YQTA 1DPFA 1RE1A 3FVWA 1H8ED 5MN4A 2HMVA 2WFLA 3KLNA 3U60B 1A4IA 3ZU3A 1A98A 2YYZA 3CH5A 3EA5A 4HLUC 4Y0VA 4YRFA 2CLLB 5EKUA 5C1DA 3QE9Y 2ZE7A 4RY0A 2NWQA 4W5HA 4N3GA 1G98A 4PFJA 3JWHA 1BQEA 1W25A 4JC0A 4EP1A 4S04A 3OE5A 1HZZC 1SXIA 3NAZA 1YJXA 4XJSA 1CY6A 4G0YA 1FYWA 1JHUA 2AOTA 2PX3A 3OOHA 4GGPA 2CXXA 1NR5A 3L9WA 4IGFA 1DXOA 1PFQA 2AV6A 4EI2A 3EGXA 2PUEA 2I7VA 1Z16A 1OV6A 4WWHA 4AZ0A 1V2GA 4KBFA 1CDDA 4HNRA 1L7MA 2FZVA 3DF7A 3HFGA 4JA2A 4OAOA 4YPOA 2P2LA 2W00A 2OXRA 2VUTA 1USIA 2JKYA 3LUBA 3F5SA 3DZKA 4XLZA 1IBMB 3HJUA 3F6EX 5HKOA 1VRVA 5JH7F 4CBVA 2OHVA 3PDUA 1LLFA 2PX5A 4G01B 1NVMB 3NIBA 1NZFA 3BL8A 1ECPA 3QRWA 4ANFA 4KQ1A 3AY7A 3QLJA 2HGZA 2ACEA 1QB7A 2D1FA 2EIHA 4OMDA 1U9ZA 1BAPA 4KXQA 4PCVA 4TKUA 5IUKC 2PMCA 1JQLB 2ZI3A 3AERA 3Q0EA 3WK5A 4US2R 1I6LA 3MRTA 1KNQA 2FW7A 2C42A 4Z3KA 2VJCA 3DE3X 3HADA 3ZWQA 3O4RA 1XZNA 5HCUA 1Z38A 5IKPA 5DDIP 3NC4A 3T61A 4BNJA 3PFIA 1FP1D 3ESYA 4MW7A 3OQ1A 3FSGA 1O03A 1QVWA 1NMQA 2R1ZA 1GZ4A 5F3RA 2F4NA 2PUAA 3K0AA 5JD5A 4MA4A 3TCXB 2G07A 4NOJA 2RARA 3HM2A 4P93A 4W5JA 3G9QA 2F00A 3O8QA 3C1UA 2VL7A 2GJ9A 2VBGA 2Z9DA 4O63O 3TZ6A 1PCXA 3BXFA 4REOA 5IUJC 3OT4A 4D41A 3DMTA 4DR7B 4MV7A 4WJZA 4MK4A 1QHGA 1T1IA 1GY8A 1Z5OA 1UMDB 1ULAA 3LFUA 4PLTA 5JJLA 2FOLA 3JAWB 4L0QA 1EGQA 1N4DA 3BTVA 1BXZA 3HU1A 1SMKA 1ZNYA 2ODTX 4L9AA 3CLUD 4MVJF 3OKFA 2IXTA 5KREA 4L22A 3TKAA 3MEQA 3L4EA 5JY1A 2C2MA 4JGGA 2BLNA 4WECA 2B8EA 3SZMA 4LQDA 2WJ3A 1Y8QB 1YOVB 3MTGA 2GQ0A 1P2DA 2QV7A 1R0WA 2VYFA 1UKCA 1A7AA 1DSSG 5TS2A 3WK4A 4LCBA 5SZKB 4OREX 4JQCA 4LYHA 5JLJA 4IY1A 1T4CA 2GZDA 5H3HA 1JIXA 4EWLA 4ZQHA 4EVIA 2ZRLA 4WLEA 2AOVA 4MJLA 4BDSA 2FCRA 3DV2A 4E2WA 3CHYA 4RZ3A 2Y1CA 2R4UA 3EIHA 4H7IA 5TPZA 2DHQA 1C1HA 4J43A 5EUMA 3V42A 5BT8A 1I7SB 4UMVA 4AO7A 3NDPA 4DWJA 5FO1A 3G2PA 2IYXA 4IW3B 3SHFA 4EIWA 5JQWA 2AOWA 2YXEA 2M6SA 5AI8A 2NV6A 1TK3A 1HQCA 4ZCMA 4Q7LA 1V3UA 2IY9A 4M1YA 4MW2A 2XAUA 4RF5A 4YRCA 1V1RB 1RCTE 1TZMA 3EXFB 2XGGA 4FOTA 1KZ7B 1WHSA 3HJRA 3SJCA 2FPGB 4OQNA 2NU8B 3L6OO 1M8KA 1WZNA 2CMKA 3DWFA 4EHAA 3B53X 4LMPA 2XIJA 3ONVA 1WQ1R 1KFKB 2GH1A 1DMRA 5GOZA 4AW9A 3IXMA 3TSYA 3CSUA 5HSGA 3IAS6 2VFAA 4GXNA 5BN3A 2SKDA 3PE6A 2DECA 3C1AA 3QBJA 5GOTA 1GDDA 1K6EA 1YR2A 3IE1A 4GDFA 3F9RA 3AHFA 3OD5A 3S5UA 4NU0A 1M5TA 1I2CA 4FHCA 3K1AA 1U3DA 3R3ZA 3WFIA 4HWKA 1L5GB 1HYEA 1TZCA 3IVRA 1W29A 3GZNA 1HFWA 4I1IA 5FUQA 1C9JA 2WLSA 1I5OA 3A1SA 2XVXA 3AILA 5DBEX 5IJ0B 2P27A 1U2PA 1K2VN 1O9BA 1J5PA 2J0UA 2JCXA 1HKHA 4L4SA 5TQ2B 1TCUA 1DTSA 4B47A 4LK2A 4AZSA 3BJEA 3HP7A 4XD7A 3ZU4A 4WBSA 5LMUB 1Z6YA 3QWIA 3SKYA 1O5IA 3TZCA 1IHXA 5WRFA 1D9ZA 3G13A 2EKQA 3IR7A 4FNAA 2REBA 2VJAA 4YJHA 5HGJA 2X6TA 1CRQA 2IYLD 5ED4A 4V0KA 4LF7B 3KM0A 4WKCA 5IBQA 2NPIA 5SZIA 3B85A 5IG2A 3L7CA 5KTKA 9LDBA 1CY1A 3DFUA 4MQUA 4J2TA 4PNZA 4XQ9A 3ESCA 3GN1A 4AYTA 4J0HA 3QKRA 1UDWA 1CY8A 1Z8HA 2FZLA 4LOJA 3LDUA 4FEAA 4OK6A 4P92A 3PC2A 4R1OA 4ZMSA 2CNOA 3ZWAA 4CRWB 4O4LB 3M5CA 4ZAGA 5A3QA 3U1TA 2FPXA 3RJ5A 3QPBA 3PRHA 4CW7A 1DX4A 3PDJA 4Z4FA 2BEKA 2CXTA 1KPHA 5H9VA 4OJQA 4F2PA 4YJFB 2QVYX 3CWCA 4WEQA 4G0PA 4GM0A 1QO0D 3OZSA 3PF8A 4KE9A 1PLJA 5AUPB 1N6RA 1U3FA 2AEEA 2ZSIA 3FUVA 3GK3A 3PXXA 3P7MA 1YL6A 4IO0A 1EFKA 1XTJA 3PUZA 3G5TA 4MQLA 1YFLA 1HY3A 1S4QA 1R8SA 5A04A 1JV2B 1WZEA 5CX1B 4PTYA 5IAKA 2C92A 1AHIA 1SCBA 3R7WB 5AW5A 1PTJC 1T91A 1JQAA 1TYCA 2PLAA 3BGWA 3BMCA 1EUDA 4V0RA 5F73A 1JUDA 4G84A 4TQUS 3V4ZA 5HOEA 2HR1A 5FULA 4DKJA 3UBTA 2J7PD 4D0RA 1B00A 1QB8A 3WDLA 1L4UA 3K0BA 4PPNA 4M6WB 3S7ZA 4FP9A 3D8RA 3CRVA 1JHOA 3DQPA 2GEVA 4B73A 3KQKA 2QT0A 3I9NA 1PR9A 5JTTA 3BB3A 5DNAA 3FNEA 4G67A 4NH4A 4KVFA 1AGYA 1L3CA 3LK7A 3RSCA 4UM7A 1Y7PA 3O6VA 4BLQA 4N3CA 4RHUA 1T0IA 3ZDBA 1B8NA 1H4SA 4YLEA 1XHLA 3QJGA 5ERXA 4OYYA 1LW7A 4ALNA 5IK2A 1LZLA 3V2GA 5LIPA 1SBIA 4GAEA 3T7RA 3V5NA 3T7JA 1NKTA 3BGOS 3PPVA 4FIZA 4YMIA 1PV1A 4A0GA 5ALZA 3H83A 5K6AC 1BA3A 1MKYA 1U8EA 2A4KA 3JVDA 4MWZA 3ZHYA 2Q27A 4KN6A 2CVQA 2VDWA 2FR8A 3OC0A 1UBNA 2EZ4A 3G68A 2O8EB 3FUUA 1BDMA 2ZAOA 2JBHA 3NOQA 1DOZA 1RAIA 1ZY2A 3M4ZA 3L7KA 1L4MA 2ZBEA 5K8JB 2H5JA 3IVXA 3LMKA 4M98A 4H7FA 3UUFA 5IAGA 1DHRA 4YIKA 3ROQA 3IV9A 3OZEA 2FMIA 2OV1A 4RD4A 2E48A 3E61A 1UXIA 2X5NA 5DB4A 3L8GA 4ENTA 2P90A 3JQ8A 4ZGBA 4KIWA 4AN1A 4PLGA 2P2SA 4Z8YA 1NW5A 3B6JA 3CH6A 2XCSB 1LK0A 2XVZA 4XDYA 4EG1A 5JHHB 2JGEA 1YRLA 2B5VA 2QXTA 1V39A 2HCTA 2XB6A 3O9MA 3PFBA 3AHIA 3E0QA 2C7RA 4CKBB 4DV0B 2Q9UA 3SQDA 4JX8A 5BVHB 5ER9A 1R9NA 1I3LA 1XZBA 1TQDA 5FJJA 2X58A 3RRJA 3W05A 3WYCA 4V02A 3ZCTA 5A02A 3G2IA 5KOHB 2WWFA 3ADBA 1RJDA 3LBYA 3R1IA