3S2EA

Crystal structure of furx nadh complex 1
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
340
structure length
340
Chain Sequence
AMMKAAVVRAFGAPLTIDEVPVPQPGPGQVQVKIEASGVCHTDLHAADGDWPVKPTLPFIPGHEGVGYVSAVGSGVSRVKEGDRVGVPWLYSACGYCEHCLQGWETLCEKQQNTGYSVNGGYGEYVVADPNYVGLLPDKVGFVEIAPILCAGVTVYKGLKVTDTRPGQWVVISGIGGLGHVAVQYARAMGLRVAAVDIDDAKLNLARRLGAEVAVNARDTDPAAWLQKEIGGAHGVLVTAVSPKAFSQAIGMVRRGGTIALNGLPPGDFGTPIFDVVLKGITIRGSIVGTRSDLQESLDFAAHGDVKATVSTAKLDDVNDVFGRLREGKVEGRVVLDFSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Zinc-containing alcohol dehydrogenase superfamily
publication title Crystal Structures and furfural reduction mechanism of a bacterial zinc-dependent alcohol dehydrogenase
rcsb
source organism Ralstonia eutropha
total genus 110
structure length 340
sequence length 340
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3s2eA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3s2eA01
3U0BA 3OP4A 2ZIZA 1UXKA 1T4BA 3MOIA 4TKMA 1JAYA 4J4BA 1HLDA 3ETDA 3JQEA 2EGGA 1ADGA 1HF3A 2CSUA 1FF9A 3FNHA 4UVIA 2GN4A 1P1KA 1ZMTA 2JAPA 3DBRA 3F1KA 4GX1A 4HFRA 4HNGA 4PZCA 5K6AA 5THKA 3WXBA 2EIHA 2Y05A 3CXRA 3KYCB 3E9QA 1QYXA 1OAAA 1H94A 4RDHA 4UVDA 1V3UA 2OMEA 3GDOA 1YS4A 1HE5A 1T25A 3DC2A 4BQRA 1M66A 2B0JA 3QLJA 4IBOA 3ONDA 4RF5A 1PJLA 1EVIA 3MCVA 5ICSA 3DHYA 2WWRA 1IY8A 2ZB7A 1HDOA 4UEOA 5EIOA 3WGIA 1ZUD1 2B4TO 1WWKA 3GN1A 1JN0A 1FMCA 3IS3A 4PLPA 5TS3A 4CR8A 1B3RA 3I6IA 3UCXA 2OHXA 3VKVA 4CMEA 3SC6A 4NI5A 2O3JA 1A7KA 2TMGA 4K1LA 4PIVA 1Q0LA 1T2AA 3FWNA 4RLHA 3I83A 5T5QA 3WS7A 3WJAA 1DO8A 4ND3A 3TL2A 3T7CA 4CODB 1R4NB 2CVZA 1YOVB 3RUDA 3H3FA 4H15A 3DBHB 4Z3KA 3BMNA 1NXQA 2QQ5A 4DA9A 4LGVA 3ROQA 2QG4A 5AVOA 1L7EA 2QZZA 3C7AA 4EITA 4OM8A 5FYDA 2EERA 3D3WB 1O95A 4CM4A 1H9BA 3AI2A 3JQ7B 2PY6A 2PA3A 3Q6IA 2PZJA 3UKOA 1GFSA 3CZMA 5JAMA 3P7MA 1V0JA 1QG6A 3OIGA 5TJHA 3ADOA 1L1FA 1NWCA 1LUAA 1E3SA 3OF2A 2NTVA 4NMHA 2RAFA 3X2FA 1ADCA 1GYPA 1OOEA 3B1FA 4NQZA 4NFSA 4PCVA 4FB5A 2CD9A 1MUUA 1JLLA 1RPNA 4PLCA 5IG2A 1I32A 2DU8A 3OSUA 3NTOA 3ULKA 1GQ2A 1AE1A 3F6YA 1GUZA 1U28A 3KZVA 1GDHA 1TB4A 4D45A 5DCYA 3RI3A 1RM4A 2P68A 3TNLA 3P2OA 3HE3A 1SEPA 3NDRA 2GSDA 1LDYA 3Q9NA 2Z5LA 2E48A 2DUWA 5CEFA 1J5PA 1QORA 3EZLA 4Y9DA 3C1AA 1W0CA 1IHYA 4YAIA 4CQMA 4XRGA 2R00A 3WSWA 4B8WA 4BO4A 4FOSA 2GPTA 3MJ4A 1ZK4A 4Q9NA 5DDIP 3VPXA 1PGPA 2J3KA 2VN8A 3RIHA 5A9SA 2EW2A 4XQCA 3HB5X 4MKXA 3PYMA 2CF5A 3ROPA 5KJFA 1PZEA 3DZHA 1X7DA 3VH1A 5JCJA 1V3VA 4N5MA 4EUHA 3FR7A 1Q1NA 4TMFA 2EJWA 3M2PA 3BHIA 4Q3EA 3WMWA 1LLUA 4ND4A 4ALMA 3RASA 5A4DA 3BMOA 3V1TC 1HYEA 1RM0A 4B4UA 5DNAA 4D46A 3KSDO 2GUGA 2BFOA 2DVMA 1BVUA 3PGJA 4CMIA 2W98A 2I76A 4H3VA 5A06A 1BSVA 3PVZA 1G6KA 3NRCA 1MB4A 1SNYA 4L75A 5AOVA 1AUPA 3W6UA 1GU7A 5IDWA 1T1RA 1YWGO 3LLVA 1DIAA 2P91A 4WE3A 3PHHA 2XOXA 5ITWA 1NR1A 1V9LA 1ZZEA 1E7SA 2IODA 3MEQA 3ENNA 4PG4A 2V6BA 3H5AA 1PJ3A 1YH3A 4JP3A 1ZK2A 1CJCA 1X0XA 3IP3A 2WE7A 4KQWA 4XA8A 1XSEA 4FD3A 4L74A 1PGOA 1PWZA 2Y1DA 3KYDA 1DFHA 4E21A 1CF2O 1JVSA 1LBEA 1GV1A 2YV2A 1A4IA 5EINA 3BHMA 1DHTA 1H6CA 3Q1LA 1OC2A 4XYEA 4I8XA 3UCEA 1B0AA 4LISA 3EC7A 4XKJA 1KVUA 3I5MA 3WQRA 5K0ZA 4C7JA 2HMUA 4WNIA 2ET6A 1VI2A 2O48X 4EEZA 3W4KA 3VZSA 1L7DA 1VPDA 1DFIA 1F12A 3GN2A 1B3BA 5JSFA 4DQXA 1H6BA 1I24A 4YAGA 1GCOA 3HWRA 3O38A 2WYWA 3Q3CA 3T7EA 3F5SA 2XXJA 3H9UA 3QVOA 1BW9B 3D4NA 1U3UA 2P2SA 4EDFA 2OFPA 1SO8A 4GI2A 4IMRA 1R12A 4PLYA 1EBFA 5A02A 3L6OO 4PLGA 4JROA 4N7RA 3CZRA 2O3SA 5JE8A 1YVEI 2AG8A 2O4CA 3PQDA 4II2A 5HBRA 4HV4A 3JYOA 4ID9A 1DIGA 4FPXA 3L0DA 1P1HA 2Z95A 1YB4A 4FFMA 2Y1CA 3GPIA 1KEPA 3ANMA 3ICPA 4DTIA 3F3SA 1UDAA 4J2HA 3PYLA 1RM5A 3NX4A 1UXIA 2Y0DA 3I23A 3U4CA 3DQPA 4WKGA 4ROSA 2IEDA 1PU2A 3PIDA 3P19A 1T2CA 2BELA 1HRDA 2A92A 5CDGA 2FY8A 2I3GA 1B8PA 1N5DA 4HFMA 4U7WA 3PWSA 2HKIA 4O59O 4R68A 3VKUA 3WGYA 5C5IA 3MJEA 1R0SA 4NIMA 4UVHA 4IS2A 5L51A 2EKQA 2GZ3A 3AUAA 3UUWA 4W7IA 4GMFA 3L9WA 5DCWA 4GH5A 2JCXA 2C82A 2FPGA 4E5PA 3H2SA 1JAXA 3CUKA 4YR9A 4BNMA 3RROA 4JN6B 1QLHA 3I4CA 5DULA 1C1DA 1PJBA 1BXGB 4RVDA 4CQLA 4HP8A 3DZBA 2AQHA 4WUVA 1H5QA 4CMHA 3WYCA 1SOVA 3GF4A 1Y9EA 4XR9A 4YXFA 4CM9A 1J49A 3PI7A 4XX0A 4YRAA 4RORA 4UUMA 8ADHA 2B4RO 3SVTA 1E6EA 4MIOA 1NHGA 4YPOA 2OOSA 1KBZA 3MTGA 5U9CA 1KVTA 1IPFA 5AXCA 5FEUA 1HSOA 4ZRMA 1ULUA 1JKFA 2EP5A 5JO9A 3ROMA 4P4GA 2E6UX 2EWMA 3COSA 2E82A 1NVGA 3C1OA 4J1NA 3FSRA 5L4LA 1V3TA 4Z0TA 4PLHA 2ZKLA 3E1KA 4E5YA 2DKNA 4I5DA 4CUJA 4IDCA 4HNHA 3HDYA 3ZU5A 2G17A 5CEJA 2X8LA 5TLSA 2ZTVA 3ON5A 4TRMA 2EKLA 4OQZA 4CMJA 3LF1A 3INGA 4RZHA 4DUPA 4XIJA 1YBMA 3AI3A 4RVGA 5H82A 2ILTA 3L07A 1ONOA 4BKQA 1NPYA 3LQFA 3OH8A 2G5CA 2C59A 1XDWA 1C0KA 3OJEA 4PGFA 3UFXA 5JAZA 4O0LA 3BAZA 4Z6KA 5H81A 1Q0HA 4EUEA 4Q3DA 3ZDFA 3A9WA 5KOIA 3K5PA 3LLSA 2Z1NA 3ONEA 3E6AA 3K31A 2DC1A 2CDCA 5KNLA 3Q0EA 1NASA 5KJ6A 1HZJA 1SB9A 2GZ1A 4FJ0A 2JFHA 3FBGA 4P38A 3UGKA 4HXYA 1C0PA 2P4HX 2Y67A 4IDBA 3AOGA 4I9HA 3G17A 1V8BA 3WQQA 1YDWA 3TFOA 1P74A 2RCYA 2W2LA 4OJNA 5HRUA 4WECA 1Y8RB 1NFFA 4BGUA 2NVUA 3ZWOA 5TT0A 3OHSX 4H16A 3PJGA 4NBWA 2VRCD 4N5LA 4J0EA 1YDEA 5JFOA 1I10A 2Y99A 5ES3A 4IDDA 4J6FA 2BHLA 2J3IA 2W2KA 3OQBA 3WGGA 4PRLA 5KKCA 2HU2A 2XAAA 1LC0A 4CJXA 4GVLA 3O8QA 1P33A 1E7WA 1PS8A 3JQAA 1H6DA 3LZ6A 3KM0A 4TSKA 1HYHA 3VHRA 4AICA 1I3NA 1KY5A 1IB6A 4ZJUA 4PZDA 4KDEA 1NWHA 2PZMA 3GGPA 3GLQA 4YJFA 3S2IA 2JHGA 1Z82A 1JKIA 1W6UA 1AXGA 4CM7A 3KEQA 4FFRA 4U6SA 3PDUA 2VHZA 1NNUA 5JMPA 4WEOA 3AK4A 5T57A 2P5UA 1BRMA 4BL5A 5EPOA 4YJHA 1QLJA 3GA0A 1XR3A 4UAGA 1NBOA 4CLDA 2EW8A 1SBYA 3PJEA 2PZLA 2DBVO 1ZSVA 4ZGWA 1HDGO 3PHJA 3DBVO 3S55A 3VPSA 1ARZA 1LU9A 3RUIA 1SB8A 3PWZA 4PG5A 4FC7A 3UICA 3HZZA 2Q2WA 2POQX 3ZV4A 3WFJA 4U0JA 1ISMA 1NTOA 1PR3A 2O7QA 4BNGA 2ZYAA 3ZN2A 1DAPA 2VNAA 1JWBB 1E7MA 2BKAA 5FWNA 4OKNA 3I9NA 3BMCA 4YA6A 3N74A 4CM6A 5TSDA 3ASVA 3LT0A 1V6AA 2CDBA 1ZIDA 5GZ6A 2OP1A 2YYYA 1OBFO 4PN3A 4N54A 3WLFA 3ICCA 5ITVA 5A04A 1ZK3A 2O2YA 1Q2XA 1WLYA 5ER6A 5DP2A 5JYEA 1E3WB 1P1IA 5DZSA 4BNJA 4MDHA 1CQIA 2IYPA 3ZWWA 1MFPA 1PL7A 3QE3A 1VJTA 3IUPA 1FXSA 1YKFA 5FI5A 4GQAA 1IOLA 5G0UA 4D42A 2D2IA 3OM9A 4KUEA 3MTJA 4NPCA 4A10A 5EQDA 4NZ9A 3VOSA 4XIYA 4B3HA 4YRDA 1R37A 3JCZA 3HG7A 1ISHA 3I6QA 2P9CA 4XYLA 3LT4A 1E6UA 4BO0A 4MIYA 1R4MA 3C24A 3CEAA 1A9ZA 3CTMA 3NYWA 3NUGA 4L4XA 5KJCA 4M87A 1ISIA 4XCVA 2X9NA 4RF3A 2Q1SA 1YL6A 4GLOA 3IMFA 4LMRA 3KXDA 4WLUA 2VZ0A 1F06A 1QR6A 5I7VA 3HB4X 4FGSA 7ADHA 2PV7A 2VYVD 4YACA 4E2YA 5HA5A 1HL3A 1ONPA 1BXZA 3GRPA 4DXHA 2ZB8A 1AGNA 3JQ9C 2B5VA 1X7HA 3NDIA 1ZMOA 2Q1TA 4DPLA 1ENOA 5L7YA 1ENPA 1ZNQO 2DAPA 4ONEA 2YUTA 1T2FA 4XEHA 4A2CA 5B4VA 4BB6A 2YDYA 4R9RA 2F1KA 1DHRA 2Y1GA 1EE2A 4OIMA 1PGNA 5CP8A 2DPGA 1GV0A 5HS6A 3G1TA 3GY0A 2D8AA 5C7OO 5JCXA 1GYQA 2GYYA 3AM4A 3D1LA 3GC6A 1ZVMA 4XJSA 1C1XA 4DC0A 4TROA 3B70A 5G4KB 4UEJA 2O2SA 2I99A 3V1UA 3D3EA 3PZBA 3KUXA 4JX8A 1TT7A 4MVJA 3KO8A 3DOOA 4OXNA 1CEQA 1UZNA 1QYWA 4JQCA 1ID1A 3DBLA 3W8DA 1P45A 4E31A 1Q7BA 5A5EA 5JY6A 4I08A 1U2GA 3NGXA 5JNLA 5CPBA 1VLLA 2X23A 5MDHA 2O4UX 2UVDA 3ZHZA 2NM0A 4R16A 4G5HA 3BTVA 4GSKA 3TL3A 3KYBA 3WWZA 4GGOA 3RUAA 3LF2A 3GZ4A 4QXMA 1J4AA 1P0CA 4JJFA 4BNYA 5DT9A 1HZZA 1M6HA 3E03A 1IZ9A 4OL9A 4BV8A 1EE9A 1EUDA 1XIVA 5B4TA 2FZEA 1LSOA 1NQOA 1PIWA 4TVBA 1LLDA 1ONNA 1Q7GA 4Y6PA 4DLBA 5F21A 5HTOA 1H2BA 4M49A 4UVGA 2WJPA 4BNHA 5BSFA 2NU9A 4DBVO 2NWQA 4MIEA 3H65A 3OIDA 1CIVA 1ZH8A 4XB2A 1BVRA 6ADHA 1A9YA 2X22A 2ZB4A 3K73O 5TNXA 4F45A 4LW8A 4R1TA 3PPIA 1EVJA 2BRUA 2IYOA 3AUTA 3DFZA 4EBFA 1N9GB 3FBTA 2G76A 3ITDA 2AMFA 1H9AA 4M55A 4PLVA 5EESA 2C29D 4XGKA 1QV7A 5ILGA 4YT8A 1XU9A 1VRWA 2H9IA 1WMBA 4FSHA 1PX0A 2QHXA 4R5HA 4WPGA 4XZ3A 2DFVA 3EDMA 3IDSA 3OBBA 3R6DA 2C7VA 3OJ0A 1ZK1A 3UCFA 1HKUA 3WB9A 1BG6A 2J6IA 4NR0A 2OXIA 3MJSA 3OETA 3V2HA 1EQUA 4D7AA 4J9UE 3CPSA 2BH9A 3X2EA 2JCYA 4AJ1A 3QVTA 4IZHA 5C3MA 1N92A 3A28A 3WNVA 4Q3CA 1DRVA 3LYLA 1P0FA 2IE0A 3K6JA 3AJRA 4MINA 3BMQB 2A9FA 2X9GA 3WYBA 4QECA 4BNWA 4RV9A 2AA3A 4MVJM 4MVJI 1SZJG 2X0NA 4WLFA 1WXDA 1A71A 1EUCA 1JQBA 2HQ1A 3INRA 3NJ4A 1ZSNA 3QVXA 3W4IA 2VHWA 4I1IA 5JCJD 5JXWA 3OA2A 2OUIA 2QRKA 4IJKA 4TVOA 1GZ3A 4EJMA 2VUUA 5JO0A 1LLCA 2X5OA 5A9TA 2OO5A 4IJVA 1HDYA 5CEEA 4LRTB 5LC1A 4UUPA 4WLVA 1GADO 2CNBA 3GNSA 2EF1A 1U4SA 5MGBA 2PZKA 2ZYGA 3JQ9A 1S6YA 4AJIA 4BNVA 4MVJP 5ER9A 3LVFO 1PJSA 2VYNA 2H5LA 4Y67A 3GAZA 1PZHA 2H63A 1EMDA 3GZNB 3GVPA 3ZW8A 2FWMX 4CMBA 3OQ1A 5L45A 1VC2A 3DBHA 3VH3A 4B7CA 4JLWA 4IGFA 3I4FA 2X7HA 1PL6A 2C2XA 2EEZA 2J5RA 4ND5A 5CG1A 3DDNA 4IY1A 2W90A 4KZPA 1KEVA 3D3WA 4XR4A 4E4YA 1R16A 3LC7O 2IZ1A 4NBRA 4QSMA 3JQ7A 4BO7A 4YYZA 3SEFA 4RQTA 3TSCA 1A4UA 1D7OA 1CYDA 2GERA 1QSGA 3JD3A 4GX2A 3DMYA 4ITUA 4BV9A 3B20A 3WSVA 4F6CA 3BYZA 1HSZA 4UUOA 5JC1A 3HFSA 2BI8A 3WX0A 4BNTA 2A4KA 4P8RA 2B4QA 3DOCA 2UUPA 1YQXA 3GDFA 4J16A 4ZQGA 2OBYA 5L7WA 1GUYA 1DXYA 1U5CA 4RO0A 3ONFA 2FP4A 1ZEMA 4IS3A 3K2EA 3WIEA 4AL4A 2FMUA 3E5MA 1TA4A 1H2HA 1QKIA 4FW8A 1B7GO 3WBFA 3ASUA 1UZLA 4YT5A 2HSDA 5H83A 3H9EO 4RVSA 4EYEA 3AU8A 2OL4A 3PJFA 3WGTA 1D1TA 3SX2A 1EFKA 4ALLA 2QYSA 3GG2A 4F6LA 2VTEA 1UZMA 2PGLA 4YB8A 3CINA 1NAIA 4OAQA 4RDIA 3DAPA 2DBZA 3T4EA 2I5PO 5COBA 4Z3DA 4URFA 3G3EA 4B4VA 4NK4A 2YQ4A 5K1SA 1IYZA 1CQJA 3H9GA 1EUZA 4JGBA 1QXSA 3FD8A 3B6ZA 2X86A 3GUYA 4CPDA 1SAYA 5F1PA 3DMTC 4DIBA 1IULA 3K2BA 4FFOA 3GHYA 1KVRA 1U7HA 2HMSA 1A27A 2Y1EA 2VOJA 5J23A 3WMXA 1GQYA 4Z9XA 5F3RA 3O4RA 4DRYA 4R41A 1XCBA 1Y8QA 3PK0A 5CAEA 2BD0A 3DEYX 1FJHA 4Z0HO 2FR0A 2AE1A 3AOEC 5FF9A 4KWHA 4FFNA 5TF4A 4E5KA 3IUSA 2A35A 1SCUA 2VCYA 5A3JA 3LSYA 4BVAA 4UULA 5KVCA 5TQVA 1MA0A 1MLDA 4JIGA 4B8ZA 5A5FA 1XGKA 4YAJA 3ZWAA 1CERA 3S2FA 8LDHA 3H8VA 4AJ2A 4WOJA 3F5QA 4NJMB 3ZWVA 2VOEA 5A9RA 3IKTA 3VH4A 4B7XA 2ZJ1A 3HN7A 4WCFC 1LSJA 1D3AA 4ALNA 1RM3A 1HDCA 1JW9B 4J7UA 4CLHA 1PJTA 1NR7A 2RHRA 3RSHA 4CMCA 3EHEA 3BMOB 1O6ZA 3PXXA 3QVSA 4MP8A 4CM1A 4E6PA 4NFYA 2W4QA 4KTVE 4QO8A 5B1YA 2BFAA 1A7AA 2IEBA 1LRLA 5C37A 2H6EA 4BNUA 4E2WA 3ETEA 4Z9FA 4J4TA 2QZ9A 5KJEA 3CMMA 2G82A 3V8BA 5I9NA 3RKUA 4NFHA 3WOHA 1N8KA 1UDBA 1KEWA 4XGNA 1XKQA 3RJ9A 1XLTA 5BQFA 4J2OA 3PHGA 1DJNA 1DJQA 3U4DA 4IZIA 3EAGA 3VVBA 3NV9A 1DC6A 2DUUA 4DREA 3RC2A 2GRAA 4YRBA 3WGHA 1JA9A 4P4LA 4BO1A 4MJLA 1C14A 5BSEA 1FDSA 1W4ZA 3JQGB 4KTTE 1XEAA 4YBZA 5IZ4A 2V6MA 4IXTA 4W9NC 4P4NA 1B26A 1EBUA 4YAEA 2JAHA 2VHVA 3WFIA 1PJQA 4B4OA 3DZFA 3QVWA 3V5NA 3G0OA 3ZGYA 1GD1O 3IIEA 1B14A 3W1VA 3GAFA 3GMSA 1UUFA 2Q1UA 2Q46A 4RF2A 3H4VA 1I3MA 4R69A 2D1YA 4XQGA 3RJ5A 4XYGA 2X58A 3GEDA 5IZCC 2SCUA 2W2LD 3AU9A 4QO7A 2D59A 5L3ZA 3RC9A 4DMMA 4RPGA 1I33A 4GLLA 3BTSA 1IL0A 4XJTA 4CLRB 2YHUA 4HBGA 1LDBA 5IDXA 4DYVA 3EUWA 2FSVA 3GEGA 3C85A 1O89A 1G0OA 4J7XA 3HNPA 1PQUA 3QP9A 5IF3A 2UAGA 2GZ2A 2V6GA 1WZEA 3DZKA 1BXGA 1TT5A 3JQAD 2GGSA 2B5WA 3DMTA 1Z7BA 1U8FO 3L6EA 4EJ0A 3QWBA 1LA2A 4Q3NA 3N58A 4W6ZA 2PD4A 4WASA 4MKRA 1U1IA 1ADFA 4BNFA 3HUDA 4R9SA 5KCZA 1I0ZA 5CDSA 2VHYA 1TVEA 3FF4A 1IZ0A 3AOEA 3TOZA 3D5QA 3FTNA 1MXFA 4AJNA 3F47A 5JLAA 3EGOA 3UOGA 3QJ5A 4R51A 4LK3A 2NTNA 3BA1A 5JBIA 1VKNA 1PS0A 2IXAA 2JKVA 4CV0A 4D44A 2RH4A 3PFWO 4R3NA 2AEFA 2NQ8A 4QFDA 3BTUA 1T24A 4QTZA 1W8DA 1DOHA 3DWFA 4ZA2A 4WCFA 4BMNA 1FDTA 5TIIA 5KTKA 1GPDG 1U3WA 1DB3A 2EKPA 2CVQA 2FSSA 2DTXA 2J8ZA 4N5NA 2LDXA 4OSPA 2WTBA 3NDJA 5TRTA 2UUOA 1I01A 3VTFA 2IDZA 1SMKA 3G79A 3GDGA 3ZWYA 4AJKA 2PGDA 3GQVA 3TOXA 3BHJA 3HN2A 3JYNA 1HLPA 5A3VA 1EK5A 2CF6A 4DBZA 4D3FA 1KC1A 4QT0A 4W4TA 4FIZA 2FZWA 3RUEA 1YL5A 4AJ4A 1F8FA 4TWRA 1U3VA 4BUCA 2HJSA 5TJ9A 1JU9A 3SJUA 2FR8A 3RU9A 4AG3A 4ILKA 4AFNA 3KV3O 2VNSA 4B3JA 3OJOA 4EW6A 1WDMA 1VJ1A 3CH6A 4J9VA 1TLTA 1Y9AA 3IJRA 3Q2KA 1DC4A 4YT4A 3JTMA 3ANNA 2XPCA 2ZK7A 5C7LO 4IINA 1IHXA 1GUFA 1AHIA 3STHA 4W9NA 2GN8A 2HCTA 4XYBA 4UEKA 2O23A 5ENDA 4EJ6A 3ZU3A 4E12A 5C7IO 4A03A 4R1SA 1GTMA 3NT5A 4U8GA 3QQPA 4IM7A 3RUHA 2GR9A 3HFGA 4MO2A 3TZKA 3VTZA 4J1SA 2IZ0A 3QWAA 4IDGA 1QV6A 1ZKMA 3H7AA 3ZNNA 1K5HA 4HY3A 1ADBA 3SC4A 1YBAA 5BNTA 2D0IA 2O50A 3R0IA 1HTBA 5L40A 2NADA 1RYDA 3ZWCA 2Q2VA 1SC6A 4M54A 5IZCA 4OKIA 1T4DA 3KRTA 2VWGA 2I67A 3E9MA 4BO5A 3INTA 4TRJA 2Q4EA 4TRRA 3ZW9A 1HDRA 2RBEA 3QA9A 4NK5A 4R4JA 4NBTA 4UVEA 2JD1A 4ZD6A 4E32A 4JBGA 1SOWA 3AFMA 3NTRA 1NQTA 3TZCA 2D5AA 5DF1A 3GVXA 4FCCA 3F4LA 4DLLA 1SEVA 1Z7EA 2W2KB 3ZWBA 1GR0A 1NFRA 3HJAA 5AQ1A 1D8AA 5BNFA 3O8QB 1MFZA 4JK3A 2YFQA 3DZJA 2CZCA 3JQAB 3TFQA 4PVDA 3L77A 4MVJH 4XD2A 3PRJA 3S2EA 4PFJA 3OA0A 2BFMA 1K6XA 3QWFA 4LMPA 3IP1A 2HMWA 1TXGA 3HDHA 4GVXA 1KVQA 4YDRA 3TZQA 1MX3A 1E3JA 1RJWA 5AXBA 3C7CB 4MVJD 4A5OA 1R6DA 2P5YA 3AWDA 3UHAA 5U1PA 4DL9A 2WDZA 5T8KC 1P1FA 2JL1A 4EGFA 2ZTLA 4YJHB 3HQ4O 2YHIB 2JFFA 2ZCUA 3IL2A 2GO1A 1CETA 3GGOA 5BR7A 3FNGA 3IJPA 3VZQA 2Q1WA 3I9KA 4O5OA 4CUKA 1LSSA 2BMAA 4GAEA 3O03A 3IQDB 3NAQA 1ZJYA 2FN7A 4HX5A 2PWZA 3SLGA 1E1NA 3GUCA 3KSZO 4FQ8A 5L53A 5IN5A 1K0UA 1NP3A 1HT0A 2F00A 4HFNA 1BTOA 2PD3A 3MWDB 2BI7A 2WD8A 3H6KA 1VL0A 1GZ6A 4WLEA 3SLKA 3EK2A 4WLNA 1CRWG 3DHEA 4CM5A 1LQUA 1XG5A 2NV6A 3BMCB 1QRRA 1DSSG 3U62A 4FC6A 2DBRA 3A4VA 4HKTA 4K26A 3C8MA 3NGLA 1HWYA 3I1JA 1U2DA 2FHSA 1I8TA 1I2BA 4TQGA 3QWHA 5BSGA 2DBQA 3DAGA 1RKXA 4MP3A 3VDQA 3ZWPA 1LDNA 3IAHA 1NVTA 4YJGB 2X0RA 1XELA 3AY7A 3JD4A 4GX5A 3I3OA 6LDHA 4IPTA 4CR6A 3M1LA 1QYCA 4BHTA 4W99A 1ZK0A 3QY9A 2AQIA 4PVCA 4NH4A 2PH3A 3C7DB 1M6WA 1DRUA 4FFPA 4L0QA 3RFTA 1EDZA 2TMDA 3M6IA 3I9MA 1Q7CA 3CSDA 2WM3A 3H9JA 1WMAA 2H1SA 2QW8A 4G65A 4JNKA 1P44A 2NSDA 1PQPA 1ISGA 2B35A 3HDJA 4FN4A 4DVJA 2PLAA 4MKZA 1Z45A 3O26A 4Y6SA 5DBIA 4XQEA 2V65A 5BNIA 1R4MB 2HMVA 4RPJA 5DN9A 2EGHA 3KLMX 4M89A 4Q3AA 4BKRA 5F5LA 4KUHA 1Y7TA 3ENKA 1E5QA 3GMDA 2AXQA 3AY3A 4QX6A 5T67A 3VPGA 4CLOA 1BXKA 5JDIA 5F1OA 9LDBA 2X1HA 3D7LA 1UDCA 4AJPA 5ILOA 2UDPA 2Y1OA 4XGIA 3PQFA 4BNZA 5IFLA 1T2DA 4A0SA 1YB1A 4LN1A 4CM8B 4E33A 4WCDA 3TWOA 2GF2A 1F14A 1NAHA 4WLOA 4IQ0A 4D41A 2AHRA 3MZ0A 4MVJF 1GEGA 2FPPA 3NTQA 3D4PA 4E3ZA 1HDXA 4G2NA 3L9XA 4BB5A 3DFUA 1I5RA 2YV3A 2ZQYA 4E5NA 5HWSA 1A5ZA 3LC2O 4DC1A 4NU6A 3U9LA 1O9BA 1XQ6A 3JQ8B 4OXYA 3AI1A 3WDSA 5TC4A 3NT2A 3D0OA 4GX0A 1EEHA 4OYRA 3ZNOA 1MV8A 5I7EA 4LSWA 3ZWXA 3W6ZA 4WOKA 5JAQA 3GOHA 3W8FA 2EHDA 4MOWA 4G81A 2GNAA 3UW3A 3RWBA 4RVFA 4FR5A 4BO6A 2HJRA 5T8KA 3A14A 3FTPA 3DBLB 1N9GA 4AJOA 2DPHA 5L95A 2UYYA 2GDZA 4NNJA 4O1MA 2G0TA 5KJ1A 3JD0A 5U4QA 4RQUA 1VM6A 1Z75A 1P31A 4ZQEA 3ZV3A 3JQFC 1E0DA 3JQCA 3OFSA 2RHCA 3R3SA 1Z74A 1EK6A 1ORRA 3ZNQA 1HEUA 1KIFA 2GN6A 1LX6A 1OI7A 3K30A 3NT4A 4MVJG 1YB5A 3TDKA 3ZNPA 4R1UA 4PG7A 4BO9A 1MC5A 3PIIA 3OICA 1T26A 3A1NA 3KOUA 1W73A 3TPCA 5A03A 1XU7A 3RCBA 1Y5RA 1F0YA 3AFNA 1FDUA 3I9OA 1RWBA 1IPEA 2YDXA 4BIIA 4Y98A 4LVCA 1YO6A 2HRZA 5GMOA 1C0LA 1E92A 3WGOA 1GCUA 4EI2A 1DRWA 4CQMD 2QX7A 1YQGA 4QFCA 3QSGA 5JC8A 2YY7A 4BNLA 1WDLA 1PTJA 2I6TA 2ZQZA 3M1AA 3KYCA 3MWEB 5AXDA 3PWKA 1K3TA 4J43A 4I5EA 1Z73A 3FI9A 1GYRA 1KS9A 2X6TA 2PGJA 3WBBA 3L4BA 4BS9A 2D5CA 1YGYA 2YZ7A 4GSLA 1OC4A 3OJFA 4GWKA 3SJ7A 2NU8A 2EV9A 4DIOA 4IJWA 1RYEA 2WE8A 4YCAA 1H6AA 3W4JA 2WD7B 3E5RA 2VYVA 3ETGA 1ISFA 2ZB3A 4IDEA 2NVWA 2EJVA 3ANLA 1WAMA 3U4IA 4KWIA 3KEOA 3GZNA 3PHIA 2OORA 5TX7A 3ZU4A 1PJCA 5IDYA 4LCEA 4UUNA 5I8WA 3LDHA 5JDCC 1M2WA 1R4NA 3DBRB 3VH2A 1AHHA 1YOVA 4RPKA 1WPQA 4CV2A 5JS6A 2NACA 2HK9A 2WMDA 2ZTMA 4R3WA 4PG8A 2VRBA 3E9NA 4E2XA 1LTHR 2PKQP 3FR8A 3PDJA 2VQ3A 3SXPA 1JDJA 4DPMA 1JVBA 3V2UA 3WJ7A 2C07A 4BGIA 5L4SA 1BDBA 3JYLA 3K8ZA 4QUKA 2C7GA 3ZWNA 1N1EA 4BNIA 4GMGA 2Y68A 3KHUA 4MPDA 3VC7A 2DTEA 4NG5A 1X7GA 4XB1A 5EL0A 4L73A 4B4WA 3KBOA 4ALJA 1WW8A 1I30A 1S7CA 4OGWA 2AG5A 1ML3A 3P5SA 2PK3A 2I65A 4HFJA 4DYDA 4PLTA 4RL6A 4EEXA 4B79A 3GR6A 5CDYA 4AJJA 3JQ6A 3ZV6A 4E0BA 1GZ4A 3ZHXA 4RJTA 4R01A 2Y0CA 3VDRA 3KSUA 1DAOA 3BMNB 3GEMA 2YV1A 1KY4A 5I9MA 1X1EA 3EY4A 4U6QA 1ZXBA 4ALKA 5G2OA 4CV3A 4ZN6A 4ZRNA 1ENYA 3GRKA 1HE4A 3GNTA 5FI3A 4CM4B 5JAIA 3I9JA 3FN4A 1KETA 4KP7A 4NBUA 3VPHA 1GY8A 1PQWA 3H5NA 2D4AA 4D0RA 2DFDA 5K9ZA 1ENZA 3GPDG 2B37A 3EW7A 3EVTA 4B3IA 3S2GA 3JQFA 4J49A 4OMUA 2E49A 2FRDA 4BGVA 9LDTA 3AUSA 2VHXA 2Y0EA 2R6JA 2X5JO 1ZJZA 1PJ2A 3UVEA 4WEQA 3FHLA 3ZI0A 4YT2A 1MG0A 2Y66A 4TRNA 3D64A 1O8CA 3WGQA 4FFLA 4K9DA 4S1VA 5I9LA 1GQQA 2VUTA 4A7PA 3KETA 4CMKA 1DIHA 4KOAA 3KVOA 4IIUA 3TN7A 3BZUA 2JFGA 3DONA 5IN4A 4CR7A 3PFFA 3FPCA 1KOLA 3V1YA 4R5MA 4K6FA 3QWIA 2D3TA 4ZQHA 4CQMB 4RVUA 1D1SA 1X1TA 4Y8VA 3UXYA 3FNFA 3MJTA 2Q3EA 1E7YA 2XXBA 5A9SB 1N2SA 1P3DA 2ZYDA 4NJMA 1LJ8A 1O94A 4INAA 4RPLA 2NQTA 2JCVA 1MGOA 2BFPA 1J0XO 1E5LA 1PS9A 2AE2A 1O0SA 1ZXLA 4DLAA 3BIOA 5BSHA 2BGKA 1ZO8A 3GVIA 3I9LA 2X4GA 4YWJA 3DAFA 1HE2A 3ZCXA 2PKQO 4F3YA 4CM9D 2WYVA 3RFVA 1Y8QB 5CFZA 1I3LA 1E1KA 4I9UA 4DQVA 3GVHA 3CIFA 4BKOA 1OZAA 5TT1A 3PQEA 4JP2A 2NVBA 3AM3A 3KB6A 2Y93A 7MDHA 5JDCA 4PG6A 4M8SA 4CMIB 1X0VA 1N1GA 1UP6A 1N7GA 5IJZA 4JBHA 2R2GA 3SBOA 1EZ4A 4XRRA 1QYVA 3EVNA 3TQHA 5EERA 3IC5A 3FWZA 4Z0PA 3ZU2A 1VKOA 2DM6A 1YL7A 3U49A 3I52A 4HUJA 1U8XX 4XDZA 1I2ZA 5KVSA 1CWUA 2B83A 4NDNE 1UR5A 3JQGA 2OP0A 2HK7A 4PRKA 1BW9A 2OBNA 2X0JA 1UXGA 3DTYA 2Q2QA 3H9QA 4S3MA 1P1RA 4D79A 4YTEA 1PL8A 1PGJA 4D43A 3JYPA 3RU7A 3UF0A 2FPIA 3F4BA 4LVUA 3KYDB 4I9NA 2LDBA 1XQ1A 4YEDA 3PHLA 2B69A 2CY0A 2ZJ0A 4IQGA 3RD5A 3ST7A 4BKPA 4Q3BA 5IXSA 3ABIA 5B4UA 2G1UA 3Q11A 2O3UA 1E6WA 1PEDA 1E1LA 3H5RA 3LU1A 2VWHA 3G49A 4YQZA 3BTOA 4BNKA 1DIBA 4IUYA 3OIFA 1VE9A 4J4HA 1Y5MA 4U5QA 2CDAA 5COQA 1ULSA 4IXWA 4ND1A 4LRSB 4XYMA 3WR5A 4CLRA 1BWSA 3JD1A 4NJOA 4OSOA 5I8ZA 3CE6A 3F1LA 4I5GA 2O3TA 3L6DA 3RKRA 3F9IA 4WJZA 2Q49A 1H0KA 1LDEA 4EUFA 2NUAA 1HETA 1LRKA 1U4OA 2XF8A 3A06A 3GVCA 3LT1A 3L4SO 3HHPA 4ZU3A 2HUNA 4L4SA 1UP7A 4OOFA 3QIVA 3GHHA 1JKJA 1DFGA 2W8ZA 2X9VA 4BO3A 3VZPA 3RQSA 3FCOA 1AN9A 2QRJA 3LC1O 5EJ2A 3UAGA 2YJZA 1DEHA 2VT3A 4RF4A 4OOEA 4BMSA 4CM3A 2P9EA 1M67A 4A26A 3MOGA 3K96A 4YQYA 1KERA 4AJLA 1PZFA 3S1LA 3WG9A 3JQBC 4O63O 4J1QA 4DPKA 2JHFA 4DWVA 3DR3A 4PLWA 3QW2A 4FS3A 2Z1MA 1E3EA 2PFGA 2C54A 1KEUA 1YONA 2HMTA 3GT0A 3PLNA 4ND2A 4TZKA 3FNEA 3FPLA 5FFFA 3HADA 4MVJE 2I9PA 3WTCA 4D3DA 2AEJA 1NQAO 3RC7A 4IDAA 5JPIA 3GH3A 4FGWA 3OECA 1U3TA 3B1KA 1PSDA 3PP8A 1NQ5A 4NBVA 1TT5B 5JY1A 1DC5A 4XWYA 2A94A 1LI4A 1NPTO 3ZWMA 5IDQA 3ORFA 1C1DB 1NFQA 1EFLA 4GWGA 1FDWA 2AQ8A 1PZGA 1F8GA 1VJ0A 4CQLB 1UAYA 5IXYA 1BMDA 3H3JA 4J91A 4B7UA 4GGPA 3QHAA 2NLOA 3CKYA 4BKUA 4Y6RA 1AXEA 5G0WA 5CDUA 5F1KA 2ZATA 5COAA 3HDQA 4FJ1A 3T4XA 1H93A 1G0NA 5GZ1A 4CL8A 2J5QA 2DTDA 2GLXA 3ADPA 1I2CA 1LLQA 5G0TA 4ZHSA 3AUUA 3JYQA 1YQDA 5JYDA 1PWXA 1MXHA 2FOIA 3PLRA 4M1QA 4O6VA 3UH1A 3WICA 3PJDA 5B12A 4C4OA 3U09A 1I3KA 4YAKA 1E7QA 1FK8A 4RCVA 3RUFA 3PEFA 5G4LA 4RGBA 1PJ4A 1J6UA 1ZBQA 2CUKA 2J3JA 3NJ8A 1NYTA 1OMOA 5CPFA 4WCFB 4TZTA 4BMVA 2V7PA 3F46A 4J3FA 1R0LA 2CFCA 1T1SA 2BGMA 3LT2A 1F17A 3AW9A 3GG9A 2NTJA 3PGXA 1Y8RA 2YFHA 4GBJA 2RH8A 4OXKA 4RPHA 4M86A 5JW6A 3K9QO 1GL3A 2O3QA 4RLSA 3DTTA 2PH5A 4AVYA 2ZTUA 1O5IA 4KDFA 2CMDA 1QP8A 3RBZA 4BO8A 4CV1A 1JTVA 5HS4A 3P2YA 5EMHA 3R1IA 3ZZNA 1E3LA 5AXAA 1X15A 2HDHA 2B36A 4XDYA 5LCXA 4IIVA 2X0IA 2BGLA 1WNTA 4J0FA 4AJHA 4EZBA 5ICMA 2IXBA 4ZVVA 2ZCVA 3AY6A 4ZICA 3M2TA 4U0KA 3VZRA 3TF5A 2EXXA 3WWYA 3B1JA 3OEWA 1NPDA 3GFGA 2PR2A 3VAZA 1E7RA 3IKVA 4L76A 1P9LA 1LXCA 4E13A 3EMKA 1C0IA 4FDAA 3RC1A 2AQKA 4JCOA 2HLPA 2GN9A 1ZCJA 3DXFA 3PZRA 2RIRA 5GY7A 5JDIC 1M76A 4L8VA 5THQA 4J1TA 2NVUB 2GD1O 1NHWA 2WYUA 1WZIA 4I5FA 4KMSA 1P1JA 3RVDA 1UAGA 1EVYA 5GZ3A 5I7SA 5KVQA 1NVMB 1B2LA 2OGUA 1BDMA 4PLZA 5CHEA 4UREA 2I66A 3ZHYA 4K28A 2Q99A 5AYVA 3TRIA 4RZIA 3DB2A 4DIFA 3DOJA 1DLJA 1UXJA 5T6BA 5JMWA 1VL8A 5CG2A 4TKLA 1CDOA 4PZEA 1V35A 1Y81A 3JQDA 1JWAB 3LK7A 1I36A 1N7HA 1PGQA 1K2WA 1K89A 3OQ6A 2O7SA 3JQBA 3MJVA 1SPXA 3QRWA 2Q45A 4E30A 1LQTA 3BXXA 1UXHA 3WLEA 2AW5A 4GPD1 4YJFB 1Y6JA 1HXHA 4XQ9A 4OHUA 4ESOA 2WEKA 1VSUA 2YHIA 2QRLA 3VVCA 2FR1A 2PD6A 3S8MA 3OMLA 1BHSA 2NNLD 3NEPX 1EDOA 2J5KA 2P4QA 4J7CA 4NHEA 3DHNA 2NU7A 1BGVA 4K6CA 1E3WA 1DIRA 4L9RA 1LSUA 1UP4A 3U4HA 1Q0QA 5TGDA 4C7KA 4D3SA 2DT5A 1KVSA 3OEYA 4FJ2A 4Q39A 3EZYA 4CMAA 4JBIA 3KLPX 3WIDA 1DPGA 1DBVO 2C20A 3WGZA 1LRJA 5B37A 4E2ZA 2DQ4A 2Y1FA 4WGGA 1Z6ZA 3DZGA 1LEHA 2UV8A 2I3AA 1TI7A 4DGSA 3QV1A 5L7TA 5G0SA 1UH5A 2VWQA 5LDHA 1B8VA 3H2ZA 3ZV5A 4IJUA 2NU6A 1EQ2A 1YJQA 2QIOA 3HSKA 3NKLA 4KQXA 1MP0A 4YJGA 1QYDA 4ZQFA 3IOYA 3RAJA 1IE3A 1ZSYA 2C0CA 3ROKA 2BLLA 5KVVA 1HE3A 3DZIA 5ENVA 1R15A 2EP7A 2YW9A 1WDKA 4R54A 1ZFNA 5EN4A 3U3XA 4OQYA 2GCGA 3L4BC 5HM8A 4YVFA 3TZ6A 1B8UA 2DLDA 3OJLA 4N18A 3R3JA 4KUGA 2C2YA 1M75A 5CDTA 2HRBA 2E4AA 4FOOA 2HAEA 3GNQA 3RBXA 4J90A 2VRCA 1FDVA 4NU5A 5ADHA 3PYXA 4GL4A 2VZ9A 3E82A 3WQSB 1C3VA 1Y1PA 2YQ5A 3Q2IA 3GK3A 4IMPA 4LCJA 5L4NA 1DDOA 2O3RA 1K6JA 1G1AA 4BQPA 3E18A 5K6AC 4JJGA 4JXKA 1XHLA 3C1TA 4QEDA 5IAAA 4Z9YA 1KC3A 4CLEA 4HWKA 1GAEO 5KKAA 4DQUA 4PLFA 1DLIA 1E77A 1TEHA 2V6FA 4FBGA 4OH1A 2JD2A 5KWEA 2P9GA 5DOVA 2HK8A 1VL6A 4DMLA 3E8XA 3C3XA 3EYWA 5G4KA 5G0VA 1R0KA 1HDZA 3AM5A 3WNQA 3CMCO 4CM8A 1UJMA 3RUCA 3W8EA 3O9ZA 1LDMA 2IRWA 4WK6A 1D4FA 1A72A 2VUSA 2VYND 3D4OA 4CMEC 3JD2A 4CL3A 2Q50A 1NX6A 5KIAA 2J3HA 1P77A 3GFBA 4R1NA 5L9AA 4A27A 1YJ8A 1E3IA 4L4RA 3UN1A 1DC3A 3JQ8A 4IQ8A 2EG9A 4BGEA 1XYGA 2CVOA 1OFGA 5F5NA 2JJYA 1U7TA 3G1UA 4MP6A 3JV7A 2C5AA 3KTDA 5A05A 4CLOB 1YBVA 1U5AA 1HYGA 1XWFA 1C1XB 4QQRA 2VZ8A 2Q4BA 4F46A 3N7UA 4X54A 2OZPA 2VTDA 1GPJA 3WTBA 4A73A 3TZHA 5I7FA 1MG5A 1K6IA 4JJIA 3JSAA 4IGEA 4H7PA 2HO5A 1R66A 1X14A 4BNXA 1ISJA 3DO5A 3K92A 2PTGA 2C5EA 1MC4A 2VT2A 1B16A 4RVHA 2BF7A 1ZEJA 2QYTA 1U9JA 2WSBA 5EQFA 4ALIA 4CMGA 3GGGA 4E5MA 3PTZA 1YXMA 4HADA 1ZW1A 2PKRA 3VPFA 4BNNA 5T64A 3TJRA 4ZQBA 3V2GA 4BO2A 4LSMA 1VSVA 5DBGA 3ITKA 4D0SA 1T2EA 1YRLA 3Q9UA 1WP4A 1KYQA 3E48A 3RFXA 1E1MA 1LC3A 4GKBA 4BOYA 3BMQA 4OO3A 1XA0A 3ZHBA 2E37A 4YJDA 1GEEA 2GASA 2PNFA 2R00C 4W82A 5DBFA 3RBVA 1X13A 3D5TA 3ZH2A 3FRJA 5DCUA 2VWPA 1WVGA 1QMGA 5LDGA 4AJEA 2AEMA 4IDFA 5BT9A 1NM5A 4WNCA 3U5TA 4II3A 1LNQA 2IZZA 2X5KO 3WYEA 4GKVA 2JD0A 1YE3A 5DOZA 5DP1A 4CUZA 1EVZA 2WD7A 5A1TA 4CLXA 1B15A 4W7HA 1PR9A 3DL2A 1LDGA 3MJCA 1IUKA 4P22A
chains in the Genus database with same CATH superfamily
1YZ3A 2NZVG 2ODAA 2OLEA 3SEAA 3OP4A 2Z2KA 2C9BA 1FRQA 4TKMA 1JAYA 1SKAA 2QF7A 4J4BA 1HLDA 3ETDA 4DLWA 2CXNA 3KQUA 3JQEA 4NECA 4CN8A 5ED4A 1ADGA 2OT3B 2FN9A 2CSUA 1ORVA 2I4RA 2QD3A 2RGCA 3A27A 3FNHA 1ST3A 1TTHA 1J22A 2ZVPX 3HV0A 2JAPA 3DBRA 3JWIA 4HFRA 4NHOA 3IEPA 4ZYUA 2WUVA 1W46A 3VMFA 2EDAA 3R7LA 3E9QA 4JQSA 3K05A 2D5LA 3C48A 2ZITA 3FYUC 3ZHSA 2PLRA 4BLPA 5BSKA 3HVRA 5DNUA 1J5EB 2FU5C 5IFKA 3UQYS 2PBLA 4EARA 5J5AA 4BQRA 1VCHA 1G59A 5EPUA 4AYXA 4DLXA 1RWQA 2NSLA 2HX1A 2R3SA 4P7GA 5ERXA 2NU8B 3DA8A 1RXSA 5D85A 4ER3A 2ZTSA 1I5OA 1IZ7A 1EWKA 4RTPA 3EH2A 4UEOA 3AUKA 5EIOA 4MWCA 3ZE6A 2HZ7A 4OQLA 5AW4A 4R2KA 2B4TO 2XZDA 3DD5A 3FF1A 3C3MA 3GN1A 2R751 3EJWA 3IS3A 3LGAA 3CZ9A 4K3UA 4NF2A 4PYNA 5TS3A 2RHBA 4GBGA 4CR8A 3R5HA 1RD4A 1EFCA 4MV4A 1NNI1 1I0LA 3EPRA 4YWHA 4EPVA 4RLHA 3FWNA 1O1YA 4RIGA 3AR3A 3AHFA 1Q50A 3C7TA 1ZISA 1MR3F 3KKKA 3TL2A 3QTLA 5C4GB 3QKRA 1R4NB 5AR1A 1YOVB 4HLNA 3RUDA 3H3FA 3R74A 9GPBA 2CKDA 1JDUA 2D6FA 1N2GA 1QJ4A 2A88A 2LCFA 3IHWA 3LNCA 1XRPA 4A0FA 1MB2A 3G68A 4LGVA 3ROQA 3SZLA 5AQEA 1MJHA 1NLMA 4M36A 2ADFA 5F51A 4EITA 4OM8A 2CXTA 2H4FA 3Q6NA 1KXZA 1O95A 1WHTB 2XY4A 4KBGA 4KXVA 2HRDA 3ZEIA 3Q0IA 3AI2A 2PY6A 5JW6A 2M6RA 3V1NA 4N03A 3MC1A 3UK2A 5KSYA 2ZIAA 3E0XA 2HJWA 2BIFA 1V0JA 2GILA 4YN3A 2VJQA 5ECYA 1AK9A 2IL1A 3RK0A 1CUWA 1TEVA 5FBRB 5LR6A 1C9YA 4NMHA 5DM60 3WNZA 4GUDA 2UZ1A 4LHXA 3ABOB 4NFSA 3RHZA 4A8PA 1KNQA 1CU1A 4FP9A 3U60B 3M5PA 3AVTA 3R5SA 3NC1C 3PV0A 4OEHA 3SX4A 3GEBA 1BFKA 4MCIA 2OCDA 1RXWA 1KBQA 3LSTA 3NTOA 3L43A 4H6WA 2NXNA 8MHTA 3D3QA 1KAOA 4AMUA 4UHFA 1Q2UA 4FHZA 2GAIA 4FZVA 5DCYA 4AN0A 3MWKA 1U7OA 1N3IA 3A7EA 2P68A 3RI3A 3TNLA 2FP4B 1Q22A 2WU0A 3UAVA 3P2OA 3HE3A 1UJ6A 5D51S 3ND7A 3Q3GE 3VNUA 5JXGA 1L8LA 2HZBA 2Z5LA 2B98A 4Y18A 3QUCA 3C5EA 3W5BA 1BYIA 3TYXA 4L8FA 1JHQA 4L6CA 2SNIE 4B35A 3L6RA 2JGFA 3EW9A 4PSUA 4Q1VA 4D0GA 1IH8A 2XUKA 1W0CA 1CUIA 4CQMA 2C9OA 3O8OA 1N5KA 3WI7A 2V97A 2IQIA 4B8WA 4BO4A 3A6LA 1G63A 4I36A 1GTRA 3W1WA 1PGPA 2J3KA 1PAUA 2VN8A 1SXIA 1RAEA 2C97A 1NUAA 3GEPA 1SVWA 4Q1BA 4TSFD 4LYJA 3PYMA 2H1LA 4P08A 4C1BA 4L78A 4BYMA 1LJUA 1WW2A 2XQGA 2YN2A 3AR5A 3DZHA 1ESMA 4ZMBA 3HNOA 4JJ7A 3PXUA 4RFVA 5JCJA 1SG0A 3BWDD 4RSGA 4Z49A 2EJWA 1CJTC 3BHIA 3UM9A 4LSZA 4N9QA 4C7MA 3MPOA 2I7DA 2JAWA 4G37A 4YJKA 3RTDA 4BVFA 1PNRA 2GHTA 4ZCMA 5A4DA 3TW6A 3FKQA 3MWFA 3CEPB 5C8YA 4YV1A 5GIPE 4DWOA 4F12A 3UMVA 2B1GA 2ON6A 3KELA 3OPXA 5JYCA 5K45A 3QTTA 1T9ZA 4YGYA 3KSDO 5LMNB 4DIUA 1P8JA 1XJWA 2GUGA 1WQ1R 1RZUA 4MK4A 4YP1A 1QRUA 3RREA 3MBIA 4TTAA 5HZKA 2CNNA 2XD4A 2NZYA 2DVMA 2PS3A 3DV2A 1BVUA 3LKBA 3PGJA 5CYPA 1Z63A 1TA0A 4YP5A 4K8OA 5CCBA 2W98A 3KZNA 3N7AA 2ZW9A 4G8BA 4H3VA 3T0IA 3DDSA 1EFHA 2CW5A 3NRCA 1MB4A 1DINA 1SNYA 4DQLA 4L75A 4EPWA 5AOVA 1V3QE 1F4PA 3C98A 1YWGO 3P2JA 5FB3A 5FA8A 2FA9A 3AJ8A 4P86A 3NXSA 1ECFA 2QM3A 5EMJA 1GU0A 4FLEA 1EVKA 4G86A 3WL8A 1XTZA 4DCJA 4LJLA 2OV2A 1VCMA 3MEQA 4PG4A 4S1PA 1NP7A 4EIWA 6REQA 4P3YA 3RTEA 4G4SO 4JB8A 1D4ZA 3C6KA 1CJCA 3X1DA 3B53X 4M0PA 4Q12A 1X0XA 1M1UA 2VDWA 4O4LF 1BAPA 4ZK6A 1FFHA 3F5MA 3KXPA 4RTLA 4M1TA 1NN1A 3R3HA 3CNEA 1XSEA 4FD3A 2H7YA 1PDOA 1ZESA 3JVEA 4L74A 1PWZA 5B57C 4AMVA 1JQKA 3C3PA 5I4BA 3P4XA 3EIHA 4J2TA 1CF2O 4CU5A 4S1OA 5KYTA 1MBZA 1JB1A 2HUPA 2X1VA 2YV2A 3VX3A 1DV1A 1R27A 1E3QA 2IYLD 4LF8B 3Q1LA 1OC2A 4HWTA 1RW4A 4TTTS 5J9FA 1B0AA 2OCIA 2PLWA 4LISA 4O8CA 4HVLA 3OAAA 2F8MA 1KVUA 3FDXA 3I5MA 4XKJA 4YJ3F 2ONJA 4WNIA 3TSWA 3BF7A 1NBMA 5IKEA 1QM5A 5C1BA 4LTMA 1L7DA 1VPDA 1TRKA 2QTBA 3OIYA 3VU9A 1IHPA 3VSAA 3GN2A 4BE4A 1KPGA 3CF4G 1P2VA 5JSFA 4AMYA 3B1ZA 3ENVA 4RNDB 2R4UA 4IDQA 2XRYA 2G9VA 2WYWA 4HDAA 3T7EA 2ZM5A 3R9XB 4KNWA 3U26A 3X1KA 1BQ3A 2ZLBA 1P7YA 3AHEA 4P5DA 1BW9B 5FIUA 3WYGA 2WHQA 3D4NA 3PL5A 1M72A 1U3UA 5HDQA 4F21A 1MNAA 4EDFA 4HNUA 1SO8A 2Z9DA 3LZDA 4KPYA 4PLYA 2VP6A 4PLGA 3EZ7A 3KLNA 5CT4A 2IQ5A 2O3SA 4DV6B 4FYMA 3RYHB 2AG8A 3AETB 2YWBA 4II2A 3JYOA 2CUTA 2VBGA 5M7EA 1Z4MA 4ENQA 1W4AA 1Z5GA 2PIDA 3BWXA 4XUDA 2W6ID 5LZ4A 4D9JA 2XNSA 1C9KA 5EY5B 4WBNA 1H8ED 1HPLA 1YB4A 1QDUA 1WZUA 1QANA 2Y1CA 3ANMA 3MIZA 4QAJA 1V16B 6GPBA 3PYLA 4Q19A 1RM5A 3NAMA 4BLQA 3TQCA 1CR2A 4Y1FA 1UXIA 1JBQA 2W2VA 2Y0DA 3I23A 2W93A 4RH1A 1RZRD 5FV7A 2XEDA 2JA2A 3MINB 3DQPA 4WKGA 1YRHA 1SVIA 2GN2A 2IEDA 1DMSA 3PIDA 4LECA 4ROSA 5ES4B 1HRDA 1X7YA 3BDIA 2H4WA 4AZ3A 5BNZA 2I3GA 5CDGA 2ETXA 1N78A 3L06A 3VKUA 1BWQA 5C5IA 3HJFA 1DG1G 2ZDGA 2A0UA 1R0SA 4GBED 4YDHB 5CMLA 2QLFA 4MWSA 4E1AA 4OFXA 5MN5A 2AVNA 2NO5A 2GEJA 3AUAA 3N2EA 4MWDA 1XCJA 4RIHA 2Y77A 3LL7A 4RYDA 4JI4B 1SVSA 3AJEA 4GH5A 2JCXA 4PX3A 4DABA 4A1OA 1OWMA 3CUKA 5DASA 4MQFB 1JKJB 3GJTA 5DULA 2H9AA 2XVMA 3MGCA 1C1DA 3N0WA 4ZI7B 1HGXA 2I9KA 2Y1LA 4FWBA 4CQLA 5CFRA 2QV0A 3DZBA 2AQHA 3OUUA 4CETA 4ND8B 1R3UA 3GF4A 1TQDA 4XR9A 4BTVA 4CM9A 1J49A 3PI7A 1ZLXA 2HIGA 4RJJA 3E22A 1NSFA 3OO1A 4PC3A 3O3CA 1VSQA 2VH5R 4RORA 8ADHA 3SVTA 1IQ0A 5JASA 2ZJZA 3L4KA 1KBZA 5IAOA 2HCBA 1KVTA 3KC2A 5FEUA 4PZZA 3CO0S 1CY6A 1J07A 4PHTA 4QA9A 4ZRMA 1ULUA 1JKFA 3A3KA 5FTNA 2EP5A 3H1EA 5DTIA 1BCSB 5K3FB 2I6SA 4PRZA 4YRRA 2UVPA 5T4HA 3ROMA 4ZJPA 4KQJA 3JPYA 2FSIA 4IV0A 4QASA 4AIRA 4DV4B 3OLXA 5EJ6A 2PKYX 4LS3A 4X92A 3VAAA 5K20A 3CV3A 4HNHA 5F23A 3HDYA 2G17A 2HI0A 3ECCA 3VJRA 5H68A 1PR4A 4A6XA 3ON5A 5FR1A 2VPZA 5L3SB 5IVPA 1TJ4A 4IJMA 1US8B 1RXYA 3QXXA 4RZHA 4R98A 2V1XA 3OD5A 5SICE 4A6PA 4F4JA 4MLPA 2QMHA 3RRYA 1L5YA 3EDRA 3WHLA 5KOHA 4PC2A 5TARA 1QQBA 3L0SA 1I0IA 4G8JA 3D54D 4E6EA 4I1RA 2H1OA 3QXCA 4OGLA 1YE8A 3EC2A 4RJIA 3QENA 1NW9B 2X4LA 1XDWA 4RZ2A 5C3UA 2HU5A 3LM8A 1JJBA 5JNRA 5HMLA 2OO7A 1LD3A 4N0PA 4E1VA 4ENRA 2R65A 3SS8A 5ECGC 1RHMA 4K9OA 1YA4A 3EPLA 2IU3A 3BAZA 3IKJA 3FPGA 1KSGA 1H3NA 1MC1A 1Q0HA 2AI1A 4ARVA 3OY7A 4DRZA 4GP9A 4B80A 1G9TA 1KF0A 2Y1WA 3ZKAA 2PUBA 1L3BA 4XXHA 2CDCA 3G5UA 1KBOA 2D0OB 3Q0EA 4RACA 5KNLA 2EL7A 1KTVA 2C3PA 4FJ0A 2JFHA 2Z8YM 4J8PA 4ENSA 1BH2A 4HXYA 4RXUA 2G04A 3RF7A 3QYFA 2QUZA 3HLTA 2ISQA 4RQAA 1C0PA 3J81k 2CLOB 4Z2YA 3T5GA 2VDPB 3V33A 4IDBA 1ICIA 2AMJA 3G17A 1U9CA 5BUZA 3IVXA 3PF9A 1YDWA 3BWEA 3QPBA 5FUMA 5KWSA 1Q20A 1P7WA 3SVLA 3CLTC 3TR5A 2QU7A 1NFFA 3PQ7A 3NNDA 2G7MC 5KX5B 1NVFA 1YS9A 3ZWOA 4XIGS 2W4IA 3OHSX 3UY4A 4C03A 4DW8A 4Y6OA 4YV0A 1J8VA 2FZ4A 3PJGA 5KWVA 5LIPA 2AG6A 3G0DA 5DM70 1QF6A 1NC3A 1G2IA 4O8ZA 1Z0ZA 4P34A 4A2PA 2BFCA 4WBXC 5DGDA 1OTYA 1YDEA 1CUHA 2AFIA 4KIFA 5JFOA 1PG5A 5I7OA 1JHXA 3OQBA 1SG9A 2NTEA 2IVFA 4YO7A 5FTJA 3UJ8A 3WGGA 1Z5WA 3HY4A 3ZWKA 2IHUA 4D5EA 5AM4A 1P33A 1E7WA 1M6NA 1PS8A 3JQAA 5K0EA 3MHPA 4WDRA 3VBCA 5K09A 1UAAA 2QTZA 1C3OB 1GA6A 1HYHA 1LI7A 2WAXA 3A25A 1H1DA 1Z8HA 2PXXA 3DR5A 4KIGA 5CM8B 4ZAZA 4AICA 1IB6A 4DR3B 5JNTA 1UL1X 4UE6A 5JD6A 3GQBA 5BO5A 2Q9CA 2CCJA 4TMKA 1GILA 1A9RA 1HE1C 3HUUA 4I6GA 2WKSA 4FKZA 2ZUTA 2PZMA 4R8MA 4B4WA 1JAZA 4EJSA 3DT9A 4DLNA 4WJLA 3S2IA 2HMAA 5ALYA 1WNFA 2F59A 3EDCA 1JKIA 3KFLA 2PUWA 2JZCA 3PFCA 1AXGA 4M8IA 1MPXA 1XMOB 2BSQA 3I9V1 4YAWA 1W6RA 3JAKA 2VSNA 1ORIA 2P5UA 2WG0A 2Z3WA 3VYTB 5EPOA 4BL5A 1KI6A 1DP4A 1E8NA 1QLJA 5E4JA 1QDLB 1XR3A 4UAGA 5EYPB 1A82A 3G9ZA 4RMGA 4QOEA 3P0FA 5DYGA 1WF3A 4NAVA 5C34B 5LWQA 3SQWA 5E4TA 3UV7A 2DBVO 1DAKA 1ZSVA 1HDGO 2C77A 2G3YA 4ZGWA 3DBVO 4KXFB 2GEVA 2F9LA 4RNCA 4MICA 1CDEA 1R0BA 1JPJA 2E4YA 1QPBA 3P9CA 4TYWA 2JVJA 1FX0A 4N76A 5FA6A 3QFCA 4QOIA 2W58A 9ATCA 2Q2WA 3NATA 3TXAA 2REOA 1FTQA 3MWDA 4G67A 2PLFA 4BNGA 3ENZA 1F6WA 1RAGA 1RQPA 3KFVA 4HB0A 2BGJA 4L8YA 3BMCA 3LYUA 1J7JA 2HJGA 5EAIA 2OHVA 2P5TB 3LL4A 3I28A 2H3EA 3LT0A 1V6AA 1J8DA 2POCA 2V3WA 5EZ5A 1YB6A 2RE8A 5T3UA 2OXFA 3EQ7A 5GZ6A 2OP1A 3ZBTA 1CUDA 4PAWA 2WFAA 2CVFA 1D1PA 1ZQ9A 1GG9A 5EJIA 3H1PA 4L2IB 4B71A 4N54A 3OFNA 3WLFA 3ICCA 1DOAA 1CLEA 4MITA 1WXQA 3R6WA 4ZCSA 1ZK3A 2FPLA 2O2YA 2R1UA 2WAAA 4H6VA 4N0DA 1AX9A 2QRMA 4XVRA 3Q9SA 5D6NA 5E7IA 1KE2A 2O8DA 4A8JB 3LFHA 4BNJA 1JHVA 2OAGA 5ALVA 1B4DA 3D7NA 2A14A 4MDEA 4X85A 2PVCA 4NYIQ 4HG2A 1D6NA 4YP9A 3ZWWA 1P5ZB 4GECA 1VJTA 4EGCB 1NDUA 4NTZA 4CDNA 3IUPA 3A2MA 3GRYA 5FI5A 1J0BA 1LPAB 1RBZA 1XVAA 4GQAA 5G0UA 4O5AA 2FG7C 3P20A 3VZCA 3IRUA 1W87A 3MTJA 1EAYA 2A57A 2XSZA 3LLUA 3DV0A 1YC5A 3L1VA 4QFBA 3ZE8A 1VMDA 3HVUA 1ISHA 3B9BA 2AMYA 4RHTA 3VC3A 4MIYA 3K70B 1R4MA 1X2EA 1VJGA 1UDXA 1OF1A 2AKYA 2ZBGA 3C24A 1G7CA 3H4TA 4RA6B 4RXMA 4DWWA 4KJXA 2IELA 1U2QA 3CTMA 5EKUA 3NUGA 4UTZA 4IDPA 4Z8XA 1V9SA 4HJXA 4MJXA 5D3MA 1GQFA 4RF3A 1BN7A 1IDN1 2VJAA 2XQFA 3CBQA 3FB1A 2XMBA 1YL6A 2AYYA 1CUVA 1QZUA 4GLOA 4R1QA 4TM7A 2GEBA 3QU7A 4LEIA 3OM1A 1K98A 2XUDA 3IMFA 4B6OA 4EGFA 3OMWA 4MQLA 3HB4X 3OQIB 4Q15A 3CRNA 1CUUA 4OLJA 1HL3A 3EY9A 4NU8X 1RPJA 3EF0A 2OCYC 1JILA 3MT7A 3P97A 1D4OA 3RYIB 1O97D 4S04A 1K9SA 3F0TA 5AKIA 2OV3A 3FHOA 1V2GA 1LTQA 1THGA 2VCEA 3G6WA 4WAUA 5AJZA 5L7YA 1RNLA 3AFHA 1JG7A 2RGEA 1Q3KA 2DAPA 2QTFA 2YUTA 1C3EA 1GQOA 1TIPA 5BW6B 2HQBA 1DHRA 3JSXA 1EE2A 3HZRA 1SU7A 1X1RA 4BX9A 4GG1A 2PE5A 1LK5A 1GV0A 2RB4A 1A5BB 5DEIA 4NBNA 1E2KA 4MMZB 4WZAE 4XSGA 3D1LA 1E9DA 3GC6A 5KYXB 1LPMA 3MWYW 1JHAA 2PFSA 4XB6B 4EG4A 1BE1A 5IVKA 2QTWB 3LOUA 4UDNA 3SOZA 3CT4A 5G4KB 4UEJA 4LHWA 2HRRA 1M2VA 4B81A 1O95C 4Z4HA 2I99A 3HJGA 4KXMA 2PXCA 3KQPA 1CEQA 4YUVA 1JDBC 2GDJA 1YMVA 2IPOA 1WY5A 2VG8A 1IMJA 3IAFA 1Z36A 1P45A 1QGOA 2QRVA 1XTIA 1FBTA 1Q7BA 2W37A 2I22A 3L0BA 1IEVA 5CPBA 2KBEA 2X23A 4M1EA 3IELA 4G07A 5MDHA 4TYQA 1YFLA 5AH0A 1GT91 1RAAA 3ZHZA 1NXVA 1ZICA 3S68A 2JGDA 4FGUA 1T9BA 1XLVA 3FG9A 2I4NA 3RR2A 3KYBA 3H2IA 2EQ5A 3WWZA 3BORA 4PF1A 3QVGA 1QHEA 2G80A 1UJ5A 5BQ3A 1J4AA 3VR2A 5LB4A 1GPLA 4HDOB 1JSXA 5DT9A 1VXOA 3E03A 3RU3A 3X0DA 3IEMA 2DG2A 2FZEA 1LSOA 2IY9A 1L0BA 4LHYA 2VHUA 1Q7GA 1QH1A 3I12A 2NO9A 3HB1A 4G84A 3GLFB 1XD9A 4DCTA 4URWR 1NXPA 5P8WA 1TVMA 4OGFA 4QYIA 3SZGA 5BSFA 2WTMA 4KGDA 2XH8A 3NHBA 2RGWA 5EHZA 3OIDA 1RXUA 4Q34A 1KJYA 1UBHS 2IDKA 5FNVF 4LW8A 4TL9A 2G6TA 5BOSA 1EVJA 2IYOA 3S1AA 3HCBA 4QDKA 3L8GA 1ZQ1A 2FW9A 5H59A 1H0HA 5I7RA 3FBTA 2G76A 4PLVA 1H9AA 1NRIA 4QDUA 3O4GA 5ILGA 4YT8A 1ETUA 4F6RB 5L6LB 4QGSA 3DLHA 2YN0A 4HS9A 1PX0A 3HCPA 1D2CA 2PGAA 5CLQA 4OK6A 2OCGA 4YI3A 3H2BA 2PSDA 2RHHA 1Q3HA 1Q74A 4HNAA 3PNOA 2FX2A 3BQNB 3KQMA 3RADC 1DKQA 3IEKA 2YW2A 3HR8A 4UM5A 4J94A 5F2EA 4DN6A 8GPBA 3CGWA 4D7AA 4J9UE 3W1EA 2FOLA 4CG0A 2JCYA 3QVTA 4HI0E 3HGQA 1N92A 2O8FB 1VRCA 2I8AA 3BDVA 1FA9A 4XOUA 3UWOA 3WQBA 3K6JA 1E1RD 3AJRA 1U8YA 3ZI7A 4ZO7A 2CXHA 1P2SA 3BMQB 4TLMB 1QU3A 2OYCA 4C01A 3SEZA 1PNOA 2AA3A 4M60A 4L9SA 3T7DA 1VKHA 3ZUGA 4MGEA 2C2GA 5BORA 3X1JA 4US1R 2C7OA 1P7CA 2ORIA 3BCHA 4HTFB 3T99A 2HQ1A 5JAUA 1FEZA 4BFCA 3AR4A 3QQ5A 1YUBA 1K4KA 3W4IA 2VHWA 5JXWA 3CR8A 4Y1RA 1O94D 4EJMA 2IDMA 4UOQA 7REQB 1IVYA 1LLCA 1I1NA 2WJGA 3BS4A 2YNMD 1W5TA 3CC8A 5C0OE 5A9TA 1UEXC 2O8VA 5K6RA 3HY3A 2GO7A 3AEQA 4C6TA 3KJQA 4M9CA 1TJ3A 2CNBA 3SJCA 2HT1A 2ZRPA 5IMSA 2FJPA 1RMTA 2M2IA 3CVJA 3LT5A 5FH9A 1L5GB 3JQ9A 5MGBA 1S6YA 1PV2A 4KE8A 1JLRA 3NHUA 1KK3A 2TMYA 1QVRA 1PJSA 3IVCA 3UO8B 4GOXA 3AZPA 3BGVA 3CUYA 2RH5A 2H63A 3E7XA 3LX8A 4JJ4A 1V39A 4HMPA 4J0QA 4DG5A 3FETA 2OKCA 2G9NA 3ZW8A 1H4VB 3HA7A 4CMBA 3N53A 2DPXA 4EG3A 2O7NA 4Q5IA 4M22A 5TGTA 3GA7A 1Z37A 2ID8A 4C76A 4IGFA 2FYTA 2KHZA 1ODSA 4EGAA 2C2XA 5KAPA 2I7XA 2TYSB 1XLTC 4EJ2A 5ALJA 1JSZA 1X77A 1HURA 2HWYA 2W90A 1YA8A 2BE7A 4R2XA 4ZPJA 3A3YA 5KYYA 4QSMA 5KQGA 1Z2PX 3JQ7A 4BO7A 2QMZA 1JX6A 3SEFA 2ZJ5A 3EGXA 3UKDA 2FK7A 1XK6A 1Z4OA 1TTPB 3ZGXA 1RVDA 1XJ5A 4EA7A 3E15A 5HHTA 1N33B 1N9KA 4ZV4A 3O4VA 1NOJA 3RS2A 4KR7A 3WSVA 1WOMA 5CVTA 3X1WA 5DM2A 1V4VA 4WXPA 5EKTA 1SUCA 1Z4KA 3MUEA 1W44A 3FY4A 4BNTA 1QGDA 1A4XA 2W2PA 3NORA 4M46A 4P8RA 5CVVA 2UUPA 2EYUA 1YQXA 3WDMA 1S3GA 3FUTA 3GDFA 5E3JA 2JIZA 1TF2A 4JODA 4J16A 5F76A 1U0FA 2G7ZA 1DWPA 5AT1A 1W1UA 5CLHA 1ACMA 1G55A 4IVQA 5FBVB 5I9IA 2BEWA 1EJ0A 4RO0A 5L7WA 2A67A 3ZIUA 3AVYA 3ONFA 4WNAB 1FTNA 5ISMA 3M89A 1LNSA 4LZAA 2FEAA 3SXUA 3RARA 3KHKA 4HCJA 4NMWA 1PFKA 2X77A 2QU8A 2YYSA 4AL4A 3E5MA 3I6MA 1TA4A 1U81A 3MIIA 2D1TA 3GEHA 3QUBA 4FW8A 3QNUA 4QUGA 4Q4HA 4AS3A 4BXOB 1J09A 1QAQA 3O7WA 3U3KA 5FI1B 4QXAA 1X1CA 1TW2A 1JALA 1JDVA 1TYBE 1OYOA 3PJFA 2OL4A 2HRCA 3I1FA 3SX2A 4HOYA 4ALLA 2QYSA 2ZU6A 4FZJA 3WWOA 5I7HA 4F6LA 4NZPA 3NHKA 2ZT6A 4JMLA 3R7SA 4YB8A 5CB4F 1Q3TA 4G09A 2FLKA 4OAQA 5H4GA 2P2ZA 3IUBA 3NGMA 4MGHA 5EJMA 5LP6F 4U7JA 1PE0A 5CA1B 2I5PO 3HZHA 3ETJA 4KXXA 4FYWA 3NH6A 2LXNA 3FD8A 3B6ZA 4B2YA 2UUAB 4TT8A 1SAYA 4ARCA 1IB0A 1TU0A 3OHPA 5IKPA 3JR3A 1JEOA 3DMTC 1S3SA 2XA2A 4OHKA 4B6QA 4KFUA 4JC0A 2NO4A 3K2BA 2O59A 3ZV7A 1G7RA 2R48A 2VKTA 4FFOA 1U7HA 2HMSA 4C7OB 2Y1EA 4DEYA 5GTDA 1I9GA 3AO0B 3NRBA 1GQYA 2PG3A 3JQRA 4QXPA 4G2TA 4DRYA 1JXAA 1MO5A 4R41A 1XCBA 2BZ0A 1EFVB 1AKWA 1U0LA 2X14A 2XAUA 5CAEA 5M3BA 2Q3FA 4FYVA 1N32B 2KE5A 1JG6A 1R6VA 1VMIA 2AE1A 3AOEC 5FF9A 3T7TA 2NQ2C 4PSKA 4TMTA 2XMPA 4DF3A 4HDNB 3LIIA 4E5KA 5C8YF 3IUSA 2A35A 3CUSA 3KQYA 4BE9A 3Q4GA 1J0EA 3ICEA 3LSYA 4J76A 4BVAA 1LWOA 1S5PA 1EJ2A 1Y34E 3BJRA 4BWYA 5TQVA 3EXEB 3U40A 4ZANA 2PSJA 2IYVA 4QBHA 4RESA 3S2FA 4YUZA 3IOBA 1A3CA 2P78A 4XX1A 2DMRA 3E27A 3HN7A 2WZBA 3QA3E 4WCFC 4GR4A 4ZC1A 3T3PB 1D3AA 4H3KB 1OIWA 5EGNA 4LJRA 1HDCA 4CLHA 2B5OA 4HEHA 721PA 1PJTA 1NR7A 1X39A 2G5GX 1GNLA 1CQXA 2IYXA 2RHRA 3EVGA 4IJ6A 4Q47A 4ZCQA 4TN1A 1ZGJA 1VP3A 3H87A 1O6ZA 2FKNA 2FK8A 1C4KA 2GTIA 2Z43A 4K87A 4CM1A 4E6PA 4ZCIA 4KFCA 2W4QA 3TRHA 4QO8A 3MMSA 4EB0A 2FZKA 2Q1XA 3KOOA 2H6EA 2QUHA 3QNMA 2EBUA 4E2WA 3ZG6A 5CDFE 3ETEA 4YYEA 2OHOA 2VHEA 5ECDA 4Z9FA 4QU0A 4J4TA 5KJEA 2JI8A 3QX9A 5D86A 1HG1A 4PIPA 2G82A 4QT4A 1OFUA 1AXRA 2ZJFA 3NP7A 1KEWA 4HH4A 3FYUB 1IPHA 1VJCA 2ZETA 1TM2A 3AF4A 1D6MA 4KE7A 5BMVB 4B4KA 3U4DA 2RC5A 1PT5A 3G2KA 4QRHA 2HQRA 1MJGA 3EAGA 1IN8A 4LA4A 4RV5A 4HAXA 3M6LA 4N0MA 4CGYA 2Y4OA 3QELB 4TTPA 1DC6A 1IBLB 1N2ZA 4YRBA 5K0TA 3OC0A 3WGHA 4GPTA 5BSEA 1CE8B 1XYYA 2R2AA 2FZVA 1K5GA 1CJUC 1P0QA 1QHHB 1WCXA 1JMVA 4JA2A 3S28A 1TQHA 3EULA 4J6EA 4YBZA 4BTEA 3OMXA 4DDHA 1XA3A 2GXAA 4JQOA 1DKLA 3GJ0A 3M49A 3F7NA 3PFGA 5J40A 1IG3A 1B26A 2Q0SA 1DU4A 5GVSA 2BFBB 2X8JB 3IB3A 4IF6A 2XDQB 3ZK8A 1DCKA 5JNWA 2C98A 5JJBA 2DPYA 1C8BA 5DI3A 3DZFA 3O3OB 4TUYB 3THOA 3W5HA 5E95A 3G0OA 2V4UA 1NATA 4P6VF 3CUUA 4I81A 3A2KA 2P90A 3GAFA 2WSMA 3MMNA 3SJBA 2C84A 2XVXA 2AMVA 1FJ2A 1RPZA 2ZXFA 2FRXA 1FYFA 1TM5E 3CUEF 1GNPA 3IBGA 3W7BA 2YKGA 3IVGA 1NU8A 4POOA 1E1CB 3VKWA 2F43A 3TMKA 4WBNF 1OR8A 3PC8A 2VJLA 2BBTA 1NZFA 3W8NA 3NPMA 3RC9A 1QF7A 4RPGA 5CH5A 2IYRA 3QXHA 2DR0A 2N42A 3GU3A 3IBFA 4X44A 1WVMA 3KPVA 1NE7A 3BJZA 3GP3A 1LDBA 4BVBA 4EKNB 1GVNB 5B6PA 3EUWA 1UEIA 2FSVA 5EMKA 4E08A 1KMMA 3K7EA 3C85A 2J0VA 5H3CA 4TLAA 2A1TR 1KFBB 4BWGA 2QJWA 2AN5A 3NHMA 2YJTD 3SKXA 4EO9A 2LW7A 3QEMA 4GPZA 3GJQA 2V6GA 1WZEA 2CFIA 4AECA 5AVUA 1C50A 1U6KA 3PCTA 5HG0A 3TKAA 1BXGA 3M5CA 4B3XA 1KZ4A 2VYCA 1VHQA 2YWDA 4TWIA 5JCOC 1QFJA 4LJ4A 3PDCA 4FB4A 2A30A 1Z7BA 3S5UA 3GFPA 2IXTA 1N0HA 3IAM6 3O74A 3Q3EA 3QWBA 5EE9A 5EJFA 3TQTA 3NVDA 1N34B 2BAGA 4QU9A 2PM8A 3OEED 2PD4A 4HZGA 1RSZA 2XQJA 4UMVA 5ESDA 2QBYA 2PQ6A 2JIMA 5K05A 2COEA 4XPZA 5KCZA 5CDSA 1JHDA 4JC8A 5DGIA 3QVUA 4FI3C 1X8JA 4KB5A 4AX8A 5K2OA 3UMMA 1EBBA 3BL8A 3T15A 3TOZA 1M33A 4ZODA 3U4MA 3GLSA 3CJQA 1PT6A 3FTNA 4YP0A 3WYNA 4DV7B 3T0FA 3F47A 3D2LA 3EGOA 1XL0A 4PX9A 3V1KA 3VPBA 1RTTA 1NMZA 3KSRA 4KSBA 3RO7A 3DYVA 2NX2A 4B4DA 4CE6A 5TDHA 4MV6A 3BA1A 4Y2RA 1A9SA 5B2EA 5JBIA 1W1IA 5HPYB 1OQAA 1P4RA 2JKVA 4B87A 4CV0A 2AYXA 4D9FA 4AMGA 4D44A 1E2LA 2V4ZA 1T15A 1N6RA 1AS3A 2RH4A 1B41A 3AUJB 5B6IA 4QUBA 4ZEWA 1DKMA 3BTUA 3K9HA 1W8DA 1DOHA 4QAQA 3IJEB 4A1FA 1UKBA 1XEWX 4OHWA 2MU1A 1VHDA 1K7SN 2H85A 3SX0A 5KTKA 4DB4A 1GPDG 3PD1A 5JDCA 3D6FA 3G0BA 4C9BA 2A5YB 3S99A 2QSZA 2J8ZA 2Q3DA 5CLGA 3VR6D 2WTBA 1II8B 2BMWA 5F5LA 3ZHUA 2H51A 4EVQA 1U04A 4EHAA 1SMKA 1D6SA 2IDZA 3UJCA 4AJKA 5G1NA 1CVRA 1SPBS 2PGDA 3SNHA 4ZI3A 3GQVA 4OHYA 4ZGGA 2D2FA 3BHJA 4GDFA 4UTXA 5BSMA 1VE3A 1EIZA 2E5FA 5A3VA 4TYMA 4AJ9A 4C87A 1EK5A 4F3NA 2CF6A 1UBRS 4LJ8A 2AJTA 2YJ3A 4DBZA 1NKTA 4QT0A 1RBMA 1XDSA 1PHPA 3RUEA 1YL5A 2W0SA 2Z5GA 1F8FA 2PXHA 3E81A 4NS1A 1UCFA 2FPSA 4JJKA 5K4GA 1PL0A 4M2LA 1MN6A 2O5RA 1I2AA 2FPRA 1T36B 1XTTA 1KH3A 1QHSA 5PNTA 3KL2A 4OY3A 2O8EA 5B7NA 3T54A 3HMQA 2DLCX 2PQ2A 1Y9DA 4ZT3A 5DEOA 4J9VA 2QP9X 2H1CA 5ESWA 4TLDA 4J0KA 1P29A 2XTMA 3EBPA 5G41A 4ZCPA 4BLOA 3Q2KA 4B5KA 1G3QA 4ER5A 1QRTA 3SYLA 3TGWA 4IZ6A 2ZIFA 1WUHS 1GLVA 3DPIA 4IKEA 2HCTA 3KJZA 2OFOA 3ZXXA 4UEKA 5A7FA 2OVFA 2SBTA 4W5WA 4Y9UA 5ENDA 3REGA 2DKFA 2B2CA 3TUJC 4E12A 3NHSA 4QGBA 2IYTA 2P11A 4IM7A 1NQVA 4IIDA 3REOA 3FOZA 2F7SA 2GR9A 1H8EA 1O96B 1P7VA 4DA6A 4OX9B 4D4MA 3IVRA 3OE7D 2RH9B 5L8VA 1L7QA 4MB0A 4PGMA 1W9MA 1AGRA 5JATA 3ZNNA 2AVDA 3O2QB 2GM4A 1RZRA 5K7SA 3JRWA 2CXXA 3DOEA 4HXFB 2JAQA 3RIEA 1Y3AA 2X41A 1QHIA 2NADA 4OHVA 2DEUA 1K8ZB 5IZCA 3OZCA 2WWGA 4ARZA 2EAUA 3A4TA 1JJVA 4I2VA 5KHAA 3B82A 1JG1A 4RSMA 2I67A 3E9MA 1G291 5JTTA 3INTA 4HL6A 2VJYA 4TRJA 2Z30A 4EHLA 1JP7A 4B73A 2O0KA 3FGPA 2C5SA 3NHZA 2QAGB 3SYRA 4BV2A 3ZW9A 4X20A 3QA9A 4K40A 4NK5A 4UVEA 2JD1A 4LYAA 3IUJA 5K3SA 3DO8A 5FL7A 1Z15A 4XWOA 4OCZA 4Q4JB 3VU0A 1TEZA 4FCCA 1TYEB 1TYZA 3K0CC 1SEVA 1JAHA 1L7XA 2W2KB 1F8XA 3SSAA 4ZVLA 5IF9A 1ZIXA 1TVCA 1V7ZA 3AJAA 1RQXA 3K0EA 5IK2D 3NHYA 5AQ1A 1G7TA 4ERXA 5JQGB 2XIQA 1E8MA 1VMAA 4HRVA 4QDTA 3FZGA 1I2DA 2Z4TA 4MS1B 3WA7A 2CL6X 1T5SA 5BNWA 3OA0A 2E1PA 2BFMA 4C3ZA 4NNOA 3OVMA 1YHNA 4FDUA 3S2SA 2XF2A 5TMBA 2NAFA 3BGWA 1KVQA 4RTRA 4J3JA 4RADA 2IUEA 1MX3A 2J6CA 4MVJD 4X8LA 1R6DA 3ZHVA 2IHJA 1M2KA 1OXBB 3A1FA 5U1PA 1AZSC 3UHOA 1AHNA 4ZMRA 1ZD8A 3HKEA 3AJ9A 5A5GA 4YJHB 4EKIA 1KAHA 2JFFA 3DGFC 1X86B 1I7DA 5HSGA 3DEZA 2GO1A 3M6AA 3ZHOA 3KR0A 5BV1A 2PUTA 3IJPA 1JE1A 2FSGA 3CNLA 1RU3A 3ZHTA 5DSTA 4AU1A 1G8YA 3I04A 5CIWA 1KTIA 1GZUA 1W0JD 3IA2A 3NAQA 1VJ5A 1ZJYA 2FN7A 4XGRA 1Z2NX 2WPDD 4HX5A 1L5MA 1NBHA 3CWZA 3JY6A 1KFJB 2CHVA 1M1YA 1MQ8B 4FQ8A 4TYPA 2P79A 4AMBA 3G82C 3AIOA 1DAGA 1HT0A 5ALSA 3RKSA 1E99A 3RYCA 1GGEA 5IBQA 4DT1B 4DMFA 3OOJA 1VL0A 1GZ6A 3EXHC 4WLEA 3TSOA 3WZ2A 3ZBQA 1QZTA 4E88A 3EK2A 4WLNA 3VI3B 1ODTC 5HJ7A 2IXGA 1CRWG 3UZUA 4CM5A 1HL7A 2KLHA 1QRRA 1DSSG 1FNCA 2XYVA 5IKXA 2P0AA 3A70A 4K26A 4IGKA 4UUBA 5BN5A 3D4BA 1YT5A 2CK3A 2CZQA 4FEGA 1U2DA 4M0UA 1I2BA 4PSVA 1IVNA 1KFKB 2JGRA 5BSGA 1PTJC 1RMQA 3F6SA 4OFWA 1RJ9A 4MW6A 1XB2A 4OI1A 3F7TA 4JYMA 4MP3A 3ZWPA 4IDNA 1P5HA 1LDNA 2OCLA 5EFOA 3CVXA 2X0RA 1XELA 1TIBA 3C45A 2MSKA 3I3OA 4EKEA 4LRYA 4KLRA 4N8DA 3HYNA 2AQIA 5B58T 3TLYA 2PMEA 4Y6LA 3HPRA 2G1PA 1XFDA 1U90A 2R4TA 3DJFA 4C0KA 2MSEB 1NW7A 3CRRA 3LUKA 4DDKA 1RKVA 1Y33E 2P9HA 4RTQA 5BV2P 1WBDA 4OM7A 3T34A 2IUYA 2HNKA 1QS0B 2TMDA 3C74A 3EIFA 3M6IA 4ISCA 3TUIC 4D3XA 4CIBA 4DR1B 2QW8A 1NONA 2GEKA 1L7AA 5A4MS 1KI7A 1Y1KE 4D02A 1VE1A 5KQSA 3T6KA 2IXDA 2WW8A 4EBBA 3EFOB 4EX6A 3IXQA 2B78A 1CY8A 2PKXA 4K9MA 3O26A 4KMMA 3CNHA 4XWTA 4M6WB 5FADA 1CZNA 4MKHA 4C3UA 3DMNA 4EFKA 4Q9JA 4BKRA 5I45A 3UAOA 3V7UA 1QTIA 3QBVA 3SU8A 3FCUB 1E5QA 4QVKA 4ARAA 4JI5B 3THXA 2R6R1 4O4HB 5T67A 5LQDA 3W3AH 2Q3MA 2R96A 2PDAA 5IYZB 1TZJA 4H18A 3Q8KA 4NCBA 1WKVA 4CTMA 3EXIA 3BL5A 3CKKA 3W5VA 1J21A 2BKLA 2UDPA 3NOQA 1FNMA 3GCWA 2G6BA 1R0ZA 3P9QA 5AM2A 3IPXA 3BA6A 3OI7A 5CCXA 4E33A 4KQCA 2YJ6A 3TWOA 3W9BA 4BU0A 5B3JC 1I14A 3W9YA 4M7PA 5CD9A 3EX7C 4PYMA 4BE7B 4D41A 6CHYA 4PFSA 3ER9A 3MNFA 2VQFB 1OJ7A 4IAOA 4ZDKA 5BSTA 3VHQA 3NTQA 3L1UA 1Y7IA 1OB5A 3D6MA 4GXQA 4KI0A 3E5NA 5LYJF 3ZD7A 2YJ4A 2VBIA 4AF8A 4DMCA 2I29A 1QC5A