4WE3A

Structure of the binary complex of a zingiber officinale double bond reductase in complex with nadp monoclinic crystal form
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
353
structure length
342
Chain Sequence
DVVVVNKQVLLKHFIPAPKETDMELVTTGTIRLRVPEGSNAVLLKNLYLSCDPYMRMRMTKHEEASYVDDFVPGAPITGFGVGKVVDSSHPDFKTGDYVWGLIGWEEYSLITKPQGLFKIHHTEIPLSYYTGILGMVGLTAYVGFYDICSPKKGERVFVSAAAGAVGQIVGQFAKQFGCYVVGSAGSDEKVNLLKTKFGFDEAFNYKKEPDLTKALKRYFPEGIDIYFENVGGPMLEAVLHNMRIKGRIAACGMIGVHNLFLIVGKRIRLEGFLVFDHYGSYPEFEEKVVQLIKEEKIKYLEDIVEGLENAPAALIGLFEGRNVGKQVVVVSREKGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Double Bond Reductase
publication title STRUCTURE OF ZINGIBER OFFICINALE DOUBLE BOND REDUCTASE
rcsb
source organism Zingiber officinale
molecule tags Oxidoreductase
total genus 109
structure length 342
sequence length 353
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF16884 ADH_N_2 N-terminal domain of oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4we3A02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4we3A01
1R0LA 3BMNA 2JFHA 4FIZA 1VM6A 1KC1A 4WLVA 4G2NA 3VZRA 1TEHA 4Q9NA 3ON5A 4LCEA 2JFFA 3LC2O 4BNXA 1K2WA 4U6SA 3K9QO 5KNLA 4FFMA 1NFRA 2WD7A 1GDHA 1MFZA 3IKVA 3FR8A 4FFPA 1YS4A 4NK4A 1AUPA 3D4OA 2G17A 4WLUA 1B0AA 4OJNA 2YDXA 1UXIA 3FI9A 5IXSA 4MDHA 3I4CA 3HWRA 4WE3A 3ZHZA 4LISA 1XR3A 4QSMA 3AI3A 4ALMA 2C20A 3KYDB 2PH3A 3VHRA 1E7QA 5C5IA 1VKNA 4D3FA 4JN6B 2PR2A 1LQUA 5U1PA 3JQAB 2HAEA 5G4LA 1XHLA 3I52A 1T1SA 4RO0A 3FR7A 2B83A 3HDQA 3PXXA 2ZTUA 1U7TA 4AJ2A 1XLTA 1S7CA 1PZHA 4GWGA 3W8EA 2WM3A 2O7QA 2OMEA 3PWKA 1WMAA 4I1IA 4ZQHA 2I67A 4E2YA 4F45A 1JTVA 1I2ZA 2QZ9A 3NDRA 4UVHA 1HEUA 3JQFA 1HF3A 2FR8A 1QKIA 5IFLA 4UUMA 3IKTA 1HYEA 1E3JA 4PLFA 4JROA 4E31A 4PZEA 1DC3A 1GZ3A 3EZLA 4YCAA 4YTEA 3CSDA 1GADO 4PG8A 1CIVA 4XYEA 3C1OA 4DQUA 5KJCA 1N5DA 4YR9A 2YY7A 1X0VA 4J1QA 5EPOA 2Y1GA 3RC7A 3U4CA 3WGTA 4CM4B 1NNUA 1Q7GA 2NQTA 3FSRA 5HRUA 1PWZA 4J0EA 1BWSA 4Z3DA 4CL8A 1DOHA 4DPKA 1GPJA 4IDCA 5TS3A 1B8VA 1H2BA 3TFQA 5ITWA 3D5QA 4CM3A 5KKCA 3E9NA 1S6YA 1P1RA 5ER6A 5I8WA 4YXFA 3WLEA 2A92A 3NJ8A 3JD4A 3Q2KA 1C3VA 3RC9A 2NVUB 1JA9A 2J5KA 4G65A 3TWOA 3TPCA 3JYOA 4XGIA 3UAGA 3ZV3A 2CSUA 3FD8A 3HHPA 5F5NA 1YBMA 4YJHB 4CQMA 4YJGB 3QVTA 1VSUA 1N92A 2IEBA 3M2TA 4BQPA 2ZATA 2X58A 2HMVA 4RVHA 1HRDA 3UGKA 3Q9NA 3H6KA 3DBLB 3L6DA 4OKNA 3QWAA 4K28A 1BTOA 4M89A 3D1LA 5F1OA 2DU8A 1A5ZA 4YB8A 5HM8A 3PEFA 1DAOA 4Y67A 1E7MA 2EP5A 2IODA 5T8KC 2OXIA 2X0RA 1D8AA 4R1TA 5KKAA 3BMCA 1DB3A 5LCXA 5C7OO 2JCVA 1DDOA 1E7RA 2H1SA 2VUSA 4R01A 1U3UA 1WMBA 2GDZA 3U5TA 2NUAA 3V2UA 5L4LA 1OZAA 4ND1A 2DAPA 3SJ7A 1YB5A 2PWZA 4W4TA 1B7GO 1B26A 3FNGA 4RLSA 1H9AA 1QMGA 1TVEA 3ANLA 3RBVA 4BKPA 3ETDA 2Z1NA 4L75A 1B16A 4TROA 3PRJA 3TL3A 1O8CA 2ZB3A 3COSA 3KYBA 3TL2A 3W4KA 4WNIA 3DL2A 1LEHA 5L45A 2AEFA 4B8ZA 4OXYA 1K0UA 5L7YA 3OJFA 1ARZA 4LVUA 1IPEA 5AVOA 3VZPA 1ZK4A 4YT4A 3RBZA 4FC6A 1PTJA 1NVTA 4AICA 2D8AA 4BB5A 4J1TA 4CUKA 3GRKA 1VL6A 4MVJD 4MVJE 4IDAA 1H6CA 1LUAA 1WDMA 3I9NA 1D1SA 4E0BA 5C7LO 4GX5A 1UP4A 1IZ9A 2VUTA 2Y1CA 3KO8A 3RUAA 4Q3NA 1QLHA 4XR4A 4RZIA 1GYQA 2ZQYA 3TOXA 3JYQA 1I3LA 1D3AA 1DIGA 4CM7A 4WLNA 4XQGA 3NT5A 3R3SA 1Y6JA 9LDBA 2YW9A 3PHLA 3QLJA 4CMCA 3WGZA 2FZEA 4JBGA 2CVOA 4CM9D 2YHIB 4M55A 1HDZA 2ZK7A 1PJCA 4GX1A 1VJ1A 4L9RA 3SBOA 3WQRA 4A73A 2XPCA 4B3IA 4RGBA 1Z74A 2NWQA 5DF1A 1ADFA 4FB5A 2DC1A 4GX2A 1PGQA 1D1TA 1ZJZA 2VWPA 3GG9A 1FDSA 4DIFA 3CPSA 3DXFA 4EDFA 1QSGA 3DBRA 3DR3A 1R4MA 5KOIA 2D0IA 1VKOA 4ZJUA 1H9BA 4CQLA 1PJLA 4A7PA 4BGVA 4IMRA 5JY6A 4DUPA 1OFGA 3QVSA 2HJSA 1R37A 4D45A 1DLJA 2A94A 4E13A 4IXWA 1OI7A 1PGNA 5I7SA 3RUCA 1LXCA 1QV7A 3DFUA 4BV9A 5T8KA 3WGOA 3ZHXA 4TZTA 2NV6A 1A4IA 2JD0A 2NSDA 3H5AA 3GUYA 1P77A 3KSDO 1FXSA 1A9ZA 1CERA 5A02A 4E30A 4R9SA 4JGBA 4Z9YA 1PZGA 2O3QA 4NPCA 2WTBA 3JQGA 2VWGA 1PQPA 3NT2A 4XJTA 2CDAA 4RCVA 4OMUA 4B4VA 5H81A 1E3LA 2AMFA 2IRWA 4UVGA 4XQEA 4YAIA 1NPDA 1XIVA 3M6IA 1NXQA 3OM9A 3WIDA 4PZCA 2Y1OA 2VCYA 1VL8A 4RQTA 3WWZA 3B6ZA 4HBGA 4NH4A 1P1KA 2IZZA 3OIGA 3NDIA 3Q3CA 3P7MA 3QJ5A 4AJIA 5ENVA 2BGLA 4JP2A 4N5MA 2FSSA 4YQZA 2ZKLA 1T2CA 3BIOA 1KS9A 2Q46A 4OSOA 3TFOA 1O0SA 1YQXA 3O26A 2JJYA 3AUAA 4HX5A 2XOXA 4DA9A 4J91A 3ZV6A 1KEUA 2OO5A 2H5LA 4Q3DA 3PIIA 4J9VA 4HP8A 2A4KA 3ROMA 3PJDA 2VZ8A 4YAGA 1KVQA 1XELA 3PI7A 3HQ4O 3U0BA 1HLDA 2PKRA 2QQ5A 2V7PA 2ZB4A 3L9XA 4IJWA 4QO8A 5F1KA 5TT1A 3AM4A 1NAIA 3MOIA 3E03A 1WWKA 4RVUA 4YWJA 4ILKA 5ICSA 3DMYA 3OQ1A 4RPHA 1CEQA 1PJBA 3CKYA 3ZWNA 5KVQA 3JQ8A 3L6OO 5CPBA 4MIEA 4IS3A 2Q1WA 3LT1A 2EV9A 2YYYA 1DFGA 4E5KA 5JYDA 3ICCA 3D64A 1W8DA 5L7TA 4LSMA 1RYDA 3PHJA 4ZN6A 1H6BA 3G0OA 1KYQA 4IGEA 3F47A 4L8VA 2EF1A 4A5OA 2PD6A 1U2GA 5AOVA 1GV1A 2D5AA 3WGQA 3RC2A 2VWQA 3DONA 1I3NA 2NVWA 2J6IA 3E18A 2DBQA 5IJZA 1M67A 3TDKA 4XQCA 1UZLA 2CVQA 3HDJA 2P9GA 4TMFA 5DP2A 2OBNA 2BMAA 3LC1O 1RWBA 1A72A 4BV8A 4QXMA 4XKJA 4R3WA 5A3VA 1DC6A 2BFOA 1NHGA 1PGOA 1LLQA 4IIUA 1AXEA 4XA8A 4GVXA 4ZRNA 2CF5A 2PLAA 2VRBA 3K96A 1N9GA 4DIOA 1Q0QA 3GRPA 1P44A 1UXHA 4G81A 5IZ4A 3RQSA 3K31A 3O4RA 3RU9A 4WUVA 4B79A 5I9LA 4TRNA 4RF5A 1B2LA 3WSVA 2GF2A 3AFMA 2JHFA 1QG6A 4DIBA 4FGWA 1XQ1A 4Y6RA 3S2FA 1VI2A 3RUEA 3UCXA 4BL5A 3EK2A 2Q50A 3VDQA 2FN7A 2DLDA 3AI2A 3S2EA 3WOHA 4CV2A 3T4EA 2O3SA 1PS0A 2W8ZA 3G17A 3SXPA 4BNIA 4NIMA 4PVCA 2C0CA 3A28A 5A06A 3GZNB 5B12A 3NTOA 3LVFO 4MIOA 1R4NB 1LLDA 5AXBA 4E5NA 1U3TA 2O3JA 5B37A 5TT0A 1LSSA 2V6FA 1WP4A 1T2FA 3KBOA 1NQ5A 2AQ8A 3C8MA 1R12A 4I08A 4DL9A 3WGGA 1SZJG 4D3DA 2FPPA 1PL6A 4NBUA 5EERA 1ENYA 3F5QA 4RJTA 3ADOA 1U8XX 3X2EA 1SEVA 1J5PA 2X9GA 1GYPA 4W7HA 2DFVA 4JJFA 3PZBA 3LSYA 3V2GA 2PZKA 4OYRA 3ZU5A 3CTMA 4WEQA 4N54A 3CMCO 1EE2A 2OFPA 5CG1A 2B0JA 1HT0A 3VPSA 5GZ3A 5JY1A 1EVIA 1BSVA 1J49A 3FNHA 1V6AA 4KTTE 3KYCB 5CDYA 1YQGA 4FOOA 3EDMA 3PIDA 4E5YA 3I4FA 1O94A 1DIRA 3F9IA 3TF5A 4URFA 3UN1A 3C7DB 3ETGA 3HJAA 4BNLA 1IOLA 1FDUA 4UUNA 3FTNA 1SB9A 2X23A 4IGFA 1E92A 1SB8A 5BNFA 4YAEA 1M2WA 1DC4A 2JFGA 1I3MA 3H9GA 1JN0A 4M8SA 2GSDA 3ZCXA 1U3WA 4U0JA 2X0NA 2P68A 1E1KA 2BHLA 2QRJA 1GQ2A 3NGLA 5COQA 3NKLA 1UUFA 5ER9A 3GH3A 2O50A 4AJOA 1VL0A 4BNJA 1BDBA 3I6IA 1OC4A 5DN9A 4ZICA 2HMSA 1A9YA 3RBXA 1XGKA 4ALJA 2V6GA 3WWYA 5TLSA 2YFHA 1BXGA 4XZ3A 3PDJA 5LC1A 3HDYA 5ITVA 1FK8A 3JQDA 2ZJ0A 3AWDA 3A14A 4WGGA 2Y05A 4WLEA 5CDGA 4L76A 2PH5A 4CQMD 5HBRA 3V5NA 1MG5A 5JS6A 4RF2A 3HNPA 1MXHA 3M1AA 2QZZA 1ZNQO 2H6EA 3K5PA 3GOHA 4GPD1 3PFFA 4Q3EA 3PWZA 3BYZA 4R1UA 5KJFA 3ITDA 4OXNA 3FCOA 4E2WA 4P8RA 4BGIA 4BNFA 4CM8B 5JW6A 3IAHA 3F4BA 1I24A 3ZHYA 4R68A 3DB2A 4RVSA 4PN3A 2WEKA 3JYLA 3E82A 4DGSA 6LDHA 3LT2A 2EGHA 1T25A 3W4JA 1Y5RA 4OQZA 1O95A 4E2XA 2QW8A 3Q9UA 1KVUA 1T2EA 4CUZA 4XIYA 1I10A 4MJLA 1PR9A 4INAA 3VH4A 1LSOA 1R16A 5EJ2A 3L6EA 4U0KA 3Q11A 3VZQA 3K92A 3IMFA 3RC1A 5TNXA 5BT9A 1G0NA 1P1HA 4PVDA 3BTUA 1CDOA 2J3HA 2EW2A 1NHWA 2NADA 2P2SA 1E7YA 4UEOA 3ZU4A 1PZFA 4UUOA 4BNNA 3HUDA 3RCBA 1E5QA 3FWZA 5L7WA 2ZYGA 4KQXA 2UUOA 2FOIA 1ENPA 1HXHA 2VHZA 4GLLA 2HU2A 4MP6A 3SLGA 3UVEA 4NBTA 1GZ4A 5JCJD 1ZMTA 4LRSB 4WEOA 2AW5A 4HNGA 3RVDA 1HZJA 4MP8A 1EUZA 4AJJA 4YYZA 3GLQA 1MA0A 4FSHA 5DBFA 5CEFA 5JAMA 3ZNQA 1UZNA 2NACA 5L53A 3PDUA 4BO2A 1T2DA 3KHUA 3VH2A 3VKUA 2W2KB 3DOCA 4HFMA 2EWMA 3DAPA 4J43A 4DLAA 5BR7A 3WXBA 3TZKA 3PWSA 3PP8A 1IY8A 3L77A 3MCVA 3PQDA 1U3VA 4LMPA 5T57A 1P1IA 3W6ZA 2HQ1A 4MVJM 4W7IA 2XXBA 3CIFA 4ZRMA 4HY3A 3F3SA 1EMDA 2E37A 1HDOA 1I32A 3ONDA 4LCJA 2X22A 2GYYA 4OHUA 3W8DA 4HFNA 1EEHA 2NM0A 2PZMA 4Z0HO 2FPIA 5CP8A 1PQWA 4ND4A 4OH1A 1PEDA 3NUGA 1X7HA 2G82A 1NASA 2NNLD 3R6DA 3WGYA 2VRCA 1IULA 4PG6A 5IAAA 4ZQGA 1JVSA 1ZSYA 2NTVA 2YUTA 4IDGA 4Y9DA 3WG9A 1ZH8A 4M1QA 4BKQA 3JQ7A 1YL7A 5KCZA 4WCFC 3GHYA 4NHEA 4ZQBA 5JSFA 2J5RA 3WBBA 4IQ0A 5LDHA 1QYVA 4NJMA 2OUIA 4E6PA 3OBBA 4KZPA 1UP7A 4GKBA 1YXMA 1Y8QA 1QP8A 3NGXA 1EBFA 2C59A 4XQ9A 3ZWXA 4UULA 1JQBA 3GHHA 4NMHA 1DAPA 2C2XA 3WJ7A 1SEPA 2PD4A 3WSWA 3EAGA 3UHAA 2YDYA 2PV7A 3R3JA 2WE8A 1DRUA 4EBFA 4NDNE 3RJ5A 5I7VA 1KY4A 4RV9A 4FPXA 5IN4A 4PRLA 3IIEA 1R0SA 4I9UA 2BGMA 2OZPA 3D3WA 1RKXA 3TJRA 1V3VA 3OQ6A 3ZW9A 1BVRA 4F3YA 3GA0A 5FFFA 3AU9A 3ZWOA 2W2LA 1M75A 4DC0A 3BMNB 4Z9XA 2QYTA 1QYXA 4XDYA 2VNSA 1P0CA 2WD7B 2NU7A 1Q7CA 1NR1A 3FF4A 5C3MA 4JLWA 2SCUA 3OJ0A 3OJOA 3QY9A 5G2OA 4ESOA 4YBZA 5DBIA 1LLCA 4CUJA 1GUFA 3HB5X 2Y99A 4GMFA 4P22A 2ET6A 4YEDA 3ITKA 1ISHA 5FEUA 3PFWO 4X54A 3EHEA 1SOWA 4NK5A 4BIIA 4CLDA 1C1XA 4E12A 4EEZA 3CE6A 3M1LA 1QRRA 4YJDA 4R5HA 5U4QA 4E4YA 4UREA 1T1RA 1RJWA 2HMUA 2JD2A 3ENKA 2DFDA 4QUKA 3VPHA 4BHTA 2EJVA 5A04A 5BSGA 3C7CB 3MJCA 1LRLA 4FJ1A 3H9UA 2YQ4A 1P31A 1LA2A 4BKOA 5IDXA 1L7DA 2O3TA 4CR6A 3D4PA 1GZ6A 2OL4A 3PJFA 1L7EA 4MVJP 4UEJA 1EDZA 5T5QA 2V65A 1LI4A 1DRWA 1ISMA 4B7CA 2R00C 3JQ6A 4BO4A 3PHHA 2YHUA 3BZUA 4I9NA 2RIRA 3DWFA 3ONEA 5JAZA 1SOVA 4FN4A 2I65A 4CMBA 4WCFA 1PJ4A 3H4VA 3L4BC 2VT3A 3O9ZA 4XX0A 4JBIA 1GYRA 3QWFA 5COAA 1YONA 1EVZA 1T4BA 3MJSA 3W1VA 3U62A 4K6CA 1XEAA 1E6EA 3GN2A 2G0TA 1P74A 2NU6A 4L0QA 3GUCA 3WB9A 3BHJA 3RFTA 5DOZA 3AY6A 1OAAA 3ZU3A 4M87A 4IDBA 3Q1LA 4LRTB 1E6WA 4J2HA 3V8BA 1HSZA 4RDIA 4OO3A 1YWGO 3H5NA 4BVAA 1EQUA 1IL0A 1XYGA 5JMPA 1E3SA 1LDMA 1ZIDA 3AK4A 4WPGA 3WNQA 4J4HA 4C7KA 4CLRA 1HYHA 1Z7EA 4YRAA 5EQDA 3IUPA 3IP1A 5JYEA 3EGOA 5GMOA 4CQMB 1OOEA 2X7HA 3R1IA 3LT4A 5GY7A 2O23A 3ZN2A 1E5LA 1IPFA 1JKFA 2QHXA 5CDUA 2VNAA 1WXDA 4KWIA 3B1FA 5AQ1A 2I5PO 4RPJA 1I3KA 3KB6A 2Q2VA 3ROQA 2FR1A 4YJGA 3OH8A 3STHA 3ZWMA 4JJGA 4ND5A 2EP7A 2HO5A 3BXXA 3RROA 1P45A 2GO1A 1FF9A 2GN9A 4D3SA 1K5HA 3BMCB 3U4HA 1DJNA 4YJFA 4CJXA 1X13A 4BKUA 5JBIA 5DDIP 3AW9A 5K9ZA 3P2OA 2P4QA 3VPGA 1I30A 3HSKA 3WQQA 3GVHA 2UVDA 3ANNA 1XWFA 2WYUA 1B3RA 1CYDA 2CMDA 3PJGA 4S3MA 1N1EA 3MJTA 2FWMX 2PKQO 1A71A 3LLVA 5KTKA 3MWEB 4DBVO 2TMDA 1AXGA 1LU9A 3U3XA 1U1IA 4PZDA 2LDBA 1KERA 1EBUA 1LC0A 5IDQA 4RPKA 4CMKA 1MP0A 2FRDA 4A0SA 4RPLA 1W0CA 2E6UX 4ROSA 1NR7A 2P9EA 2C7GA 3RUFA 1A7AA 4IPTA 4FD3A 1HDCA 2R00A 4AJEA 1FDVA 1Y7TA 5TX7A 1U2DA 1VJ0A 1ZSVA 3AI1A 1I2CA 3L4BA 4JJIA 4YT2A 2YV3A 3WDSA 1JW9B 2Z1MA 2I6TA 3ONFA 1WW8A 5JPIA 4W9NC 3JQEA 3ROKA 3AOGA 3H9QA 4XB2A 3LLSA 4BNYA 2UV8A 2OGUA 1LDGA 1G0OA 3PYLA 2PGJA 2O3RA 1Y9AA 3PYXA 5FF9A 4CMIA 5CEEA 4MKZA 3GZ4A 8LDHA 2I76A 1P1FA 2Y0CA 4Z0PA 1F17A 1WPQA 4IS2A 3ZWBA 4K26A 4R41A 5F1PA 1ZFNA 2PK3A 4FS3A 1B14A 2GASA 5EL0A 1B3BA 1GR0A 3ORFA 5DBGA 4XYGA 4QECA 3DBRB 3ZNNA 1DHRA 1R4MB 3BMQA 1Z75A 3DZIA 4OQYA 3K6JA 2PTGA 4PLPA 1Q2XA 1SMKA 4IQGA 3AY3A 4Y6PA 3D4NA 2F00A 2QRKA 4CQLB 3GFGA 5KJEA 4CLXA 4R1NA 1YOVA 4P4GA 4FJ2A 2Y1DA 1HLPA 1NP3A 4RL6A 3WYCA 5A9SA 4EW6A 3E5MA 4RORA 4FFNA 1YDEA 2BFMA 5A05A 3G79A 1PX0A 2Q1UA 4ZU3A 1U5AA 3CZRA 4KUGA 4CM6A 3IUSA 4IY1A 2C29D 3C24A 4GBJA 3FWNA 1NQOA 2EG9A 4A2CA 1KVSA 1ISGA 4PGFA 3RWBA 1I0ZA 2EKQA 2V6BA 2HLPA 3DBHA 1GV0A 3B1JA 4PLCA 3JQGB 1KIFA 3TQHA 3IP3A 2HJRA 2VOEA 3VZSA 1HE2A 3AY7A 1O89A 3VH3A 1BMDA 1PSDA 4IZIA 4ZQEA 4D79A 4J7UA 1X7DA 1C1DA 2CF6A 3OJEA 4O59O 4WK6A 2GNAA 3HN2A 3RJ9A 2UYYA 3ZNPA 4Z3KA 5CAEA 3QWBA 1GD1O 1ENZA 4IXTA 4FFLA 2BKAA 1ONNA 3AJRA 3JD2A 2A9FA 3ZI0A 2Y93A 4CPDA 2EIHA 3OA2A 4IUYA 3MJEA 3DHEA 1DEHA 1EUDA 4CV0A 2VYNA 2IZ1A 3WS7A 1UDAA 1R15A 1H6DA 1TXGA 1YDWA 4DQVA 4AJLA 1UR5A 3OHSX 4M86A 3GNQA 4XYMA 1ZO8A 4W9NA 5A3JA 4BO8A 2C7VA 3QP9A 1SNYA 1TA4A 3RUIA 4DLBA 1MXFA 1O6ZA 5JDCC 5B4TA 3VVBA 4IDEA 3BMOB 4Y98A 4AJ4A 1JKIA 1JAYA 5CEJA 1EFKA 2PA3A 1ZEMA 3JQ8B 4RF3A 4PG5A 3I9OA 4QX6A 4XGKA 1J4AA 3QV1A 4Q3AA 3EZYA 3GDGA 5U9CA 2X5KO 2AEMA 3U4IA 4FBGA 4HFJA 4DPMA 2CNBA 1UXKA 1O9BA 2WDZA 4YACA 3WR5A 4N7RA 5KVCA 1XCBA 3UICA 4GL4A 3E5RA 2VRCD 1WDLA 2C82A 4G5HA 5TJHA 3I1JA 4ZQFA 1D4FA 1Z82A 3INRA 1HYGA 5IDYA 4CLOA 3F4LA 3DAGA 4RZHA 5DCUA 1I01A 3SVTA 4XYLA 3TZ6A 1SO8A 4TZKA 3EY4A 4DMLA 4C4OA 1C0LA 5ILGA 4AJKA 1LSUA 2ZCVA 4KWHA 4BNVA 3NDJA 3WLFA 1DXYA 2OORA 1UXGA 5A5EA 4FCCA 2FZWA 3DZKA 5I8ZA 4D44A 3UXYA 1N9GB 3ST7A 3LDHA 3MZ0A 2VWHA 1EVJA 1VLLA 1YRLA 4Q3CA 4FC7A 3BTVA 1E1LA 1HE3A 1PS9A 3AUSA 4XD2A 3FRJA 5AYVA 3PHIA 3QSGA 4A03A 4RQUA 1YO6A 3GK3A 4H7PA 1Y5MA 4J4BA 1Y8RA 3RIHA 3A1NA 1H0KA 3S55A 3GEDA 2J3IA 2Y0EA 1G6KA 1OMOA 4DYVA 3HZZA 3QHAA 3KLPX 4YT5A 2Z95A 4H15A 1CETA 1RM0A 1A4UA 2DPHA 3JD3A 3SJUA 5CDTA 2ZTVA 2AG5A 1UJMA 4D0SA 5A9RA 3GQVA 4EUHA 3GT0A 3JD0A 3D5TA 1ISFA 4R54A 2HDHA 3GF4A 4H3VA 3C7AA 3N58A 2X0JA 3H65A 2B69A 5KVSA 1ZXLA 1ADBA 3UW3A 3ZNOA 3OICA 3SLKA 1MFPA 4HWKA 1PGPA 3PGXA 4NI5A 1PL7A 2Q4BA 1W6UA 1F14A 5K6AC 2X5JO 1LLUA 4XDZA 1ZK2A 5JDCA 2ZYDA 1YBVA 5C7IO 3I9KA 4FDAA 1W4ZA 5EN4A 4BO5A 1RM4A 3BTSA 2B5VA 2W90A 1BRMA 3ZDFA 4DYDA 5H83A 5L4SA 4EUEA 2J8ZA 4N5NA 1YGYA 1I5RA 3D0OA 4YA6A 4CMJA 4EJMA 4XYBA 4DMMA 2EGGA 5A9TA 4LSWA 1AHHA 5CDSA 3JYNA 5G4KA 2CZCA 2JD1A 3TNLA 3ZZNA 2XAAA 2ZJ1A 3O38A 4EZBA 2DTEA 3QWHA 5L95A 1CRWG 1M6WA 4O5OA 2I3AA 3MJVA 4YQYA 4M49A 1M6HA 1MB4A 2WSBA 3ROPA 3T4XA 4BO0A 3P5SA 3DC2A 2DM6A 4U5QA 4HXYA 5BNTA 2GZ3A 1ZK0A 4CV3A 4GGOA 4EITA 1F8FA 5JAQA 4BNZA 3H5RA 2VT2A 1LDYA 4DC1A 1KOLA 1LSJA 1KEWA 2R6JA 3GMSA 5IF3A 4N5LA 4OM8A 4TVBA 1GQYA 4TRMA 1U9JA 1EE9A 1QORA 5BNIA 5AXDA 4DLLA 2RAFA 1Q0HA 3NYWA 3HN7A 4NJOA 4XJSA 2RH4A 4E3ZA 4II3A 4W6ZA 1JKJA 4OXKA 2GN6A 3JSAA 3K73O 3ZWYA 4PCVA 2PGLA 4RVGA 1BXGB 1U7HA 3JV7A 3WYBA 3E8XA 4KOAA 5TGDA 4K1LA 4I5EA 5HS4A 1HE4A 3QE3A 4CM9A 4LW8A 3E1KA 4WKGA 2VHVA 2WD8A 4Y8VA 3HADA 2VZ0A 1N1GA 1HETA 1WLYA 2UUPA 1YH3A 3KVOA 5G0UA 1MV8A 2JAHA 3IC5A 4N18A 1NYTA 4NR0A 4K6FA 4E33A 1HKUA 1PJ3A 3FNFA 1I2BA 3KXDA 1JWBB 4ZVVA 4EYEA 1NBOA 2B37A 5IXYA 3U49A 4BNTA 1IHYA 5KJ1A 3E9QA 3H7AA 5ADHA 3GDFA 3HFGA 2PFGA 2E49A 1WVGA 3DO5A 1DC5A 4CM1A 4JBHA 3FBTA 5K6AA 1ZXBA 3F1KA 3O03A 1E3WA 4PLTA 4BMNA 1PJTA 2ZIZA 3RASA 3KM0A 3PGJA 4QT0A 3D3EA 5DP1A 4KQWA 1EUCA 5JO9A 1RYEA 2HRBA 3NJ4A 1ADCA 1FJHA 3CUKA 3H3FA 5JAIA 3NRCA 2OP0A 4BO1A 4XGNA 3RUDA 2AE2A 3VOSA 1GY8A 3B20A 3PPIA 3QVXA 4S1VA 1SC6A 3IJRA 3RD5A 3WMWA 3VAZA 1BW9A 1I36A 3GDOA 4J1SA 5DCWA 3GVPA 2I99A 3AM3A 3KUXA 3H3JA 1MX3A 1KVTA 2CFCA 5DZSA 4IINA 5FWNA 4RDHA 3PJEA 3HE3A 4DQXA 1XDWA 4KUHA 3ANMA 1EVYA 1Z6ZA 4B4WA 2WE7A 2FMUA 5CPFA 4OIMA 4OGWA 5HA5A 4D7AA 4WASA 1GUYA 1TT5A 5JFOA 1HE5A 5L9AA 3MTGA 1HDGO 4I5DA 2W4QA 5BSFA 4GI2A 3H9EO 4ALKA 1KEPA 4BNMA 3AU8A 4LN1A 2YQ5A 4PLYA 2IYOA 1DBVO 3UUWA 4PIVA 2YZ7A 1DSSG 4BMSA 5THKA 4AJ1A 2IXBA 1UZMA 5MGBA 4J9UE 2CD9A 3V2HA 3WICA 1E7WA 2UAGA 2X8LA 1PL8A 1ULUA 1YVEI 1U4OA 2AQHA 2Q1TA 2WYVA 1GL3A 3UCFA 2X9VA 2JCYA 1MC4A 4KDEA 1MG0A 1LBEA 4R16A 1T4DA 2BELA 1KEVA 4XIJA 4PLHA 3ZWWA 3ZW8A 3E6AA 1T24A 3I3OA 3FBGA 3N7UA 4GX0A 3SEFA 3UH1A 1XU7A 1YQDA 3QW2A 2VTDA 5JO0A 2P5UA 4MKRA 4NFSA 4J90A 3FTPA 2E48A 3JQ7B 4WLOA 4LVCA 1XQ6A 2JHGA 1YJ8A 2LDXA 4ZHSA 5JMWA 4RPGA 1V9LA 3EW7A 5B4VA 1UAYA 1YJQA 4NJMB 4ALIA 2BH9A 3JCZA 2VN8A 2GERA 4PLZA 1GU7A 1H94A 3ADPA 4JXKA 3O8QA 1IZ0A 1Y81A 1T2AA 1Y8QB 1F0YA 1VC2A 2AQIA 2G76A 4PLVA 1V35A 3TZQA 5JC1A 2VHXA 1U5CA 3FNEA 3K2EA 4LGVA 3TZHA 3RU7A 2PD3A 1K6IA 3H2SA 2VYVA 3AFNA 4J7XA 1FMCA 3ZGYA 5G0WA 1WDKA 4NFHA 1OC2A 3PVZA 3KV3O 5DNAA 4B4UA 3VH1A 4WLFA 2BI7A 3D3WB 1H2HA 1QYDA 3AOEC 3LF2A 2ILTA 5T6BA 4FQ8A 4J7CA 1K6JA 3IQDB 1DHTA 2DBZA 1ZCJA 2B5WA 3DOJA 1FDWA 2UDPA 1PU2A 3ZWCA 2EKLA 3U09A 1NPTO 1R6DA 3VKVA 5CG2A 3LT0A 1T26A 1UDBA 1VSVA 3AUTA 4IJKA 3G1UA 4AL4A 1F06A 4J6FA 4E32A 5L40A 1NVGA 2VTEA 3IS3A 4MVJF 2GRAA 4WCDA 2BD0A 2B35A 2DUWA 3MWDB 4CMHA 3LF1A 2Q49A 4D41A 1SPXA 1GEGA 3I23A 3VVCA 1B8UA 1JDJA 1C1XB 2E4AA 2HMWA 2PY6A 3F5SA 3LK7A 4P4NA 4BNWA 3P2YA 5JCXA 4ONEA 4J2OA 2AQKA 3CXRA 3KYDA 4BO6A 1X15A 4OL9A 1X1EA 5ENDA 2D2IA 2IE0A 4GLOA 4Z9FA 4BNGA 3QRWA 4NBRA 1HDRA 3JQAA 3KEOA 2ZQZA 1W73A 3WTBA 1JAXA 4DPLA 2HKIA 1XKQA 2NTNA 4YT8A 1P3DA 4XEHA 5T67A 3GAFA 4L4XA 3GR6A 7MDHA 3KETA 1QR6A 3UOGA 4ITUA 4YRDA 4WCFB 3OIDA 4LK3A 4YRBA 3CZMA 3OA0A 3EMKA 4CR7A 3BHIA 2B4RO 1AHIA 3KEQA 5GZ6A 2PNFA 1V0JA 4YAJA 1R66A 5H82A 4B8WA 3PQEA 1PJSA 4P38A 2PKQP 4WNCA 2PZJA 4IMPA 1U8FO 2QG4A 4FJ0A 2CDBA 2HK7A 4KUEA 2GCGA 4F6CA 5GZ1A 3Q0EA 1H6AA 4OSPA 1LRJA 4CM4A 2OBYA 1ZZEA 4U8GA 4EEXA 3OQBA 5EESA 4C7JA 3CMMA 1BG6A 3GY0A 2O7SA 3HB4X 3TSCA 4BUCA 1Z7BA 4IBOA 1E7SA 2EKPA 4CLRB 3K8ZA 3IJPA 2R2GA 1ADGA 2XF8A 1ISIA 2Q1SA 1TT7A 4ZD6A 3S2GA 3DHNA 2NVUA 3AOEA 2Y1EA 4A26A 1C0KA 3GVXA 4U7WA 2O3UA 4YJHA 4JP3A 2C2YA 3GGGA 1UDCA 2AA3A 2JCXA 2VUUA 2V6MA 4D42A 3HFSA 1HL3A 5I7FA 3UCEA 4FOSA 1EK5A 3BHMA 3DBLA 2OP1A 4F6LA 1LDEA 1HSOA 2O2SA 4JX8A 1O5IA 2GD1O 1UH5A 5L51A 3LU1A 2D59A 2IZ0A 3JQCA 4ALNA 3PLRA 5CHEA 3FPLA 1ONOA 4DXHA 2EJWA 3DEYX 4YJFB 4J1NA 1YB4A 4IDFA 4TRRA 2ZTLA 1ZUD1 3PZRA 3MJ4A 3DMTC 4B7XA 3QVWA 5HS6A 3A9WA 5FYDA 1P0FA 3KOUA 1PQUA 2D4AA 1IHXA 1NVMB 1V3UA 3W6UA 4CV1A 2AHRA 5TIIA 3DZBA 4JQCA 2Y66A 3INTA 1P33A 2B4TO 3Q2IA 2X9NA 3DOOA 2P9CA 4O6VA 3C85A 4NQZA 1E6UA 1MGOA 1N7HA 4R5MA 2GN8A 2ZB8A 1ZKMA 4YPOA 1GAEO 2D1YA 1A27A 3B70A 9LDTA 3NT4A 5EMHA 1P9LA 2AEJA 4W99A 4R4JA 2POQX 4QO7A 3I9JA 4NNJA 2BI8A 3S2IA 3GPIA 1GCUA 4BO9A 1LNQA 5F3RA 3HDHA 2BFPA 1J0XO 5EIOA 4H16A 4NBVA 1KBZA 4JIGA 2Q2QA 4FFOA 3GNSA 3GVIA 5DOVA 1E1MA 1IYZA 4BO7A 1JU9A 2I66A 4CMIB 5JCJA 8ADHA 5JNLA 2H9IA 3ASVA 4BNKA 3DAFA 5G0VA 4TKLA 5J23A 1KVRA 1U4SA 2QX7A 1B15A 2X6TA 2YHIA 1UXJA 1EDOA 1GUZA 5TF4A 1V8BA 4JK3A 4IZHA 2TMGA 1Z45A 3ZV5A 1DFHA 2C5EA 1FDTA 3GG2A 3OJLA 2GZ2A 2X1HA 3BMQB 2EXXA 3L9WA 4GVLA 2YJZA 2FSVA 4UVIA 5TJ9A 1E1NA 1PZEA 1K6XA 3ZU2A 4MOWA 4AJNA 4MVJI 3WNVA 1YOVB 3GNTA 1ONPA 3X2FA 4B4OA 2QYSA 1SBYA 4OOEA 2Z5LA 3LYLA 5A9SB 5KVVA 3OFSA 1R0KA 1EK6A 1CQIA 4OAQA 4D0RA 4GH5A 3ABIA 5THQA 4MPDA 1RM3A 2Y0DA 2BFAA 4QTZA 4I9HA 3ZWAA 4KMSA 1F12A 4UEKA 3IOYA 4LMRA 3OMLA 4EJ0A 5ICMA 3UF0A 4IM7A 1ZMOA 5TQVA 3U4DA 4UVDA 2C07A 2IEDA 3DFZA 3DMTA 4U6QA 5A4DA 1QYCA 1WZEA 1NPYA 4B3JA 3DBHB 1Z73A 4XR9A 2DVMA 3MEQA 1IB6A 4ND2A 5A03A 3IDSA 3JQ9C 3UFXA 1ZJYA 1JVBA 1AE1A 2I3GA 1WZIA 1F8GA 1C1DB 2O48X 3QQPA 4PG4A 3EC7A 2PGDA 5DT9A 1EZ4A 2W98A 1Y9EA 3MOGA 3GEMA 3PYMA 3WFJA 4AJPA 1YKFA 3G3EA 1ZBQA 4RLHA 1WAMA 2OHXA 2GR9A 1X1TA 2GZ1A 2FY8A 1NM5A 1TI7A 3L07A 2BRUA 1ORRA 4KTVE 2ZYAA 1QV6A 2WJPA 3GAZA 4HADA 4IJUA 1IUKA 1NAHA 2HK8A 3ASUA 4E2ZA 2AXQA 3A4VA 1TLTA 1QLJA 5BQFA 2G1UA 1ISJA 3A06A 4XCVA 2FPGA 3OF2A 1YB1A 4HV4A 4MKXA 1MUUA 3AUUA 4L74A 1NWHA 3RKUA 3I9LA 1BGVA 3KTDA 2O4UX 2J5QA 2AG8A 3JD1A 1K89A 2NVBA 4GKVA 4AVYA 1CF2O 4HNHA 5FI5A 3OEYA 5HWSA 5L4NA 2HK9A 5B1YA 3JQBC 1KC3A 4UUPA 3G1TA 4Q3BA 2CVZA 2E82A 4UVEA 4FFRA 3K30A 1D7OA 4O1MA 3BMOA 2O4CA 4CLHA 2AE1A 2O2YA 2I9PA 3PK0A 5COBA 5TC4A 3W4IA 5IZCC 2RHCA 3DTTA 4MVJG 6ADHA 4PFJA 2NQ8A 3WX0A 3NTQA 5K0ZA 4HFRA 4MO2A 3PQFA 4PLWA 5MDHA 4GGPA 5ILOA 3NEPX 2VHYA 3E48A 1M76A 2IXAA 3C1AA 2D3TA 4NU6A 2RHRA 2G5CA 1M66A 4CLOB 4OKIA 2Q99A 5JE8A 3OEWA 4BB6A 1RM5A 2GPTA 3TN7A 3WYEA 1Q1NA 4TRJA 1HDYA 5BSEA 1JWAB 4XRRA 1EQ2A 1ZK1A 3HG7A 3OP4A 2DUUA 1X14A 3RI3A 4FW8A 2EW8A 3CEAA 4R1SA 2FHSA 1WNTA 1E3EA 3AM5A 4ID9A 1CJCA 4DREA 4MP3A 4XWYA 4EGFA 2Y1FA 4FGSA 3JQ9A 1E3IA 5L3ZA 3ZWPA 4BQRA 3ICPA 4JCOA 1P1JA 2DTXA 2VYVD 1DFIA 3DHYA 3QIVA 4XRGA 2ZTMA 1H93A 1XSEA 1RPNA 2OOSA 4CR8A 1Y8RB 3KSUA 4TWRA 2W2LD 1KY5A 3GEGA 2X5OA 5EQFA 2Q2WA 2Y68A 5KWEA 5AXAA 3T7CA 1DRVA 4CMEC 3BAZA 3B1KA 3PLNA 2NLOA 4W82A 2J3JA 1HTBA 4O0LA 4YVFA 4B3HA 5CFZA 1Q7BA 4P4LA 5I9NA 1ZW1A 5AXCA 3F6YA 3GZNA 7ADHA 5K1SA 2HRZA 1R4NA 3WIEA 1HDXA 2HUNA 4J3FA 1I8TA 1QXSA 2ZB7A 5LDGA 2Q45A 1PGJA 2A35A 3KLMX 4NFYA 1DIHA 5A1TA 1DIBA 3SX2A 3V1TC 4HUJA 4YDRA 2CUKA 3WTCA 2BGKA 3RUHA 3SC6A 3JYPA 3WFIA 3DQPA 4IQ8A 4ZGWA 3EVNA 1YL6A 5HTOA 3JQBA 3V1YA 1NX6A 3FHLA 5B4UA 2P4HX 3H2ZA 3TOZA 1BDMA 2RBEA 4JNKA 1OBFO 1TB4A 4UAGA 5G0TA 4ZA2A 4QFCA 4PG7A 5G4KB 4CMGA 1PIWA 3JQAD 2C5AA 3GGPA 4E5PA 2WWRA 5IG2A 5I7EA 5IZCA 4DBZA 1PWXA 4A10A 3KYCA 5IN5A 4ALLA 3U9LA 1C0PA 5JDIC 1VRWA 1G1AA 2X86A 3OSUA 4CLEA 4PRKA 3RFXA 1ZVMA 4YAKA 4IJVA 1ZK3A 3LZ6A 4MVJA 4RVFA 3MTJA 2JKVA 3TZCA 4WOKA 3RFVA 1K3TA 3N74A 2D5CA 3NTRA 1MC5A 2H63A 1Y1PA 3TRIA 4EJ6A 4BS9A 3C1TA 2B4QA 1YBAA 3L0DA 3GN1A 1N8KA 3DBVO 3DDNA 3DZGA 2Q3EA 3M2PA 2JL1A 3VC7A 3ZHBA 5F21A 2HCTA 1LDNA 4AG3A 4Z6KA 4Y6SA 1B8PA 2YV2A 3GPDG 4II2A 3OIFA 4QEDA 3Q6IA 4BNUA 1DJQA 1A7KA 3D7LA 2WMDA 5A5FA 3H9JA 1NWCA 4NBWA 1HWYA 2VHWA 4E21A 1C14A 1E0DA 1MLDA 3H8VA 1SCUA 3INGA 5TSDA 5IDWA 2YV1A 2FR0A 5JLAA 3RAJA 4I5FA 4CMEA 2NU8A 1BXKA 1NQTA 2EHDA 2XXJA 2Y67A 5ES3A 3VPXA 1VE9A 4EI2A 3WBFA 3GC6A 2GLXA 4Q39A 4MIYA 3CINA 2C54A 4OOFA 2IYPA 3NAQA 2B36A 4L4RA 4D43A 1KETA 3DZJA 3L4SO 3NV9A 1E3WB 5T64A 1EFLA 3KZVA 5DULA 4GMGA 4AJHA 4BGUA 4CM8A 4CODB 4EUFA 4RVDA 3ETEA 3S1LA 1ZEJA 5F5LA 1YE3A 5BSHA 3GVCA 3T7EA 4F46A 1BVUA 2DPGA 3PTZA 4FR5A 2BLLA 1XG5A 1DPGA 4R51A 4Z0TA 4J16A 4A27A 4B7UA 3PHGA 3ENNA 3V1UA 1BW9B 1BXZA 4R9RA 2VZ9A 1LDBA 1BHSA 2CY0A 1X7GA 1V3TA 2EEZA 2JAPA 2P5YA 1AGNA 1ENOA 4KDFA 2BF7A 3QVOA 3VPFA 4CM5A 1U28A 1SAYA 1VJTA 1CWUA 5KIAA 3LQFA 2DQ4A 3S8MA 2Q4EA 5JDIA 4I8XA 1PR3A 4AFNA 1LC3A 1VPDA 2GGSA 4GWKA 2CDCA 2DBVO 3GFBA 1ML3A 3FN4A 2IDZA 2EERA 3ZH2A 2RH8A 1ULSA 1QYWA 3KRTA 1NTOA 3LC7O 3ZWVA 5JXWA 5JC8A 3I6QA 1AN9A 1TT5B 4GQAA 3RSHA 2P91A 4QFDA 3I83A 1XA0A 2GUGA 2DBRA 3BTOA 3EVTA 2DKNA 4BMVA 2W2KA 4XB1A 3I5MA 4TVOA 4BO3A 4O63O 2NTJA 4WJZA 1GEEA 1UP6A 2RCYA 4DVJA 1N7GA 2FP4A 4M54A 3BA1A 1DO8A 1GQQA 1LX6A 3QA9A 4MVJH 4WOJA 4R69A 2DTDA 1UAGA 4J4TA 4IDDA 1NQAO 4K9DA 4L4SA 3R0IA 1H5QA 1DLIA 3WQSB 2X0IA 1NFQA 3CH6A 2DT5A 4WECA 3WGHA 1ZSNA 4D46A 4L73A 2QIOA 3C3XA 3VTFA 1I33A 5G0SA 5DCYA 4CMAA 4BGEA 4DTIA 3DZHA 2WYWA 1LQTA 2X4GA 4HKTA 1GTMA 2ZCUA 2PZLA 5KJ6A 3IL2A 3EYWA 3F46A 3K2BA 4R3NA 1E77A 1CQJA 3F1LA 3JQFC 4MINA 4J49A 4BOYA 3OETA 1LJ8A 4PLGA 4NZ9A 1PJQA 4GAEA 3E9MA 3P19A 3WJAA 3ZV4A 3G49A 3DZFA 4TQGA 4NU5A 1LTHR 3O8QB 3JTMA 1PJ2A 3UKOA 3VTZA 3GMDA 3OECA 5EINA 1GFSA 1LRKA 2NU9A 4J0FA 1L1FA 2J3KA 3KSZO 3SC4A 3NX4A 1C0IA 1HZZA 5C37A 4GSKA 4KP7A 2VOJA 4I5GA 4TSKA 4ND3A 5TRTA 3GGOA 3DTYA 3FPCA 3WGIA 1JLLA 2F1KA 1PS8A 5I9MA 1J6UA 1ID1A 4DWVA 1DIAA 1XU9A 3VDRA 1YL5A 4IIVA 1IE3A 2HMTA 4DRYA 3WMXA 2VYND 2GN4A 3QWIA 4NG5A 5FI3A 2HSDA 4BKRA 1N2SA 3W8FA 3EUWA 1GCOA 1GPDG 4E5MA 2QRLA 3ULKA 4GSLA 4QQRA 4RF4A 1X0XA 1Q0LA 3RKRA 3I9MA 4CL3A 4TKMA 1NFFA 2YFQA 2VQ3A 4BNHA
chains in the Genus database with same CATH superfamily
2WWTA 4ZP1A 3W0LB 1R0LA 3G2IA 3KWMA 4ZCMA 3IQFA 1FU4A 1KC1A 4EI7A 4EIWA 1JFSA 2XDQB 4F9TA 3LRXA 1OVGA 5IBPA 3IKVA 3TOSA 2ST1A 1Z33A 3SYMA 3E0XA 2OXCA 4UW9A 5LB4A 3S40A 1EZZA 2QTFA 3HVUA 4NK4A 3KD2A 1VZ3A 2RHTA 3D4OA 3PPVA 4CT4B 4OK3A 1A3CA 1UXIA 5I6DA 2WUDA 4NS1A 1EFDN 1G21E 3LHIA 3FLAA 4R2IA 1ODFA 4BWFB 2BMEA 5LQMA 4LISA 1G4AE 2ETXA 2CCKA 2YINC 4IRUB 2HD4A 3RDPA 3QXCA 4ALMA 1JR3D 4HH3C 4A8HA 4MUMA 3DF7A 2XRMA 2PH1A 1NIJA 1VE6A 4NF2A 4YNBA 5U1PA 3JQAB 2HAEA 2QU7A 5KX5B 1KTIA 2JLZA 1UJ6A 3D7MA 1KFBB 2G1JA 1XVVA 3I52A 1W9HA 3L46A 4QARA 2V9PA 3H3XA 1Y6ZA 2B83A 2QSYA 3HDQA 4N6GA 2GKGA 2VDOB 1EA7A 3A4NA 2XE8A 3EBOA 3IDFA 2PE5A 4TSFD 3OC0A 2YYZA 1HFWA 3UATA 2C7RA 1OXUA 1RE0A 4BMDA 1SIOA 3IAS1 3DKKA 1NXWA 4P7KA 4OLHA 4RK6A 1LBHA 2GD6A 1E2LA 4WBXC 4UHKA 1ACJA 1WMAA 5DGHA 4E2YA 3HM9A 2VAPA 4J1TC 3RYIB 1Z39A 2ECOA 1XTUA 5DHPA 3KSAC 1HEUA 3H7IA 2C94A 1XV5A 3AGQA 2FEPA 2VYCA 3IEMA 5KEIA 2PUCA 4D57A 1NLZA 5IKPA 2G72A 1M34E 1S2DA 2Z2XA 4PZEA 3IDAA 4UATA 4Y6LA 3WAGA 2FSFA 1UDXA 1W19A 1WZUA 4QWMA 2JLYA 2R1ZA 1CVIA 4JJKA 1RYHA 2CLSA 1W0KD 2MHCA 1N5DA 4KNWA 4UM9D 1RMTA 4YR9A 1X0VA 3WGTA 2Y1GA 3U4CA 3A31A 3N86A 4HB3A 5AM0A 4CM4B 2ZW9A 3KP1A 2V45A 3FSRA 2HC9A 3DH0A 2Q3MA 4LK2A 5CURA 3O4GA 2QB5A 4PPQA 5EZ5A 3UENA 1DOHA 3DE5X 4I4TF 4QOEA 1L5GB 4R05A 4IDCA 4RH3A 3CRW1 1ZR2A 4QGSA 1TX4B 4CM3A 5BQ3A 3E1GA 4MRAA 1S6YA 1P1RA 5I8WA 4R7ZA 4PFQA 4UUAA 3TNYA 2NO7A 3NWPA 3RSOA 1UOOA 1M2GA 2Q8PA 3FDZB 3WL4A 2WZBA 4K6OA 5KNCA 5BQXA 1T8WA 3ZV3A 5FCDA 2O2GA 2H17A 1QGUB 4CQMA 5EGSA 4YJGB 4JI1B 1MRZA 4C76A 3C3DA 1CP2A 2PBFA 2PL3A 2ZATA 4BQPA 3EJWA 4C7MA 5BVGB 1SH7A 1SXJE 1UBCA 5CCXA 1HRDA 3TX6A 4NXMB 1IHUA 2GMWA 2PZBA 3L43A 1BTOA 4RQBA 1K7EB 1NMYA 3D1LA 3MK31 2JARA 2GLUA 4TLCA 5BOSA 4TTVA 4I55B 4EB6A 2WLSA 2WSIA 3T5CA 2IS2A 1MOQA 3DGFC 2YJ3A 1ZH4A 3KJEA 3NP7A 2IODA 4Y1EA 4BQFA 1W7AA 5C9ZA 2WQ6A 1GKYA 2FSUA 3N59A 2CD7A 4NWIA 1R8QA 4XUCA 2GYUA 3SHQA 2JCVA 1DDOA 2Q62A 4KGDA 1IXRC 2H1SA 4R01A 4R1QA 1WMBA 3CKKA 2GDZA 1Y1TA 2NT4A 1Z2PX 3PRYA 2IEYA 3U5TA 1GAWA 5CFRA 3DNMA 5L4LA 3GJ3A 4J3JA 4QUEA 1M74A 4R40A 2CLFB 4RLSA 1J0DA 1QCYA 1H9AA 3SP1A 4BFLA 4MNTA 4BC0A 3SXUB 4UNNA 1B16A 1SA0A 1QG0A 3DMPA 4LJKA 4G0UA 1ODIA 4HAOA 3GJTA 4QTXA 4DEYA 1LEHA 1LBTA 5L45A 3OCWA 4MW0A 2AEFA 3CCFA 1QDUA 4I3HA 1QRTA 4GM0A 4L8FA 621PA 3N8IA 1K0UA 4RM2A 5I01A 3OJFA 1QE3A 5AVOA 2R62A 4URYR 1PTJA 1YZTA 4M8NE 1DC7A 3K72B 3NR2A 3R7WB 4BB5A 1X42A 5CFLA 3KUDA 4K6GA 1YIDA 3EVZA 4MVJE 4WZAA 3V4ZA 5TQJA 1H6CA 2XGSA 1EX6A 1MRNA 2I4RA 3RK0A 1YQEA 4UM7A 5CK4A 3UJAA 4E0BA 5LQUA 2ZYRA 2YZMA 4KX5A 1YK1A 2B25A 3L7IA 3RUAA 4Q3NA 5CW2A 4K46A 3JYQA 4OMCA 1I3LA 1LK7A 4CM7A 2QVGA 4XQGA 2I54A 5B7PA 1Y6JA 3DT9A 3PHLA 5TE9A 2E4VA 3VHQA 2JGKA 3Q5DA 4M2LA 4M55A 1AKWA 4GX1A 2JH3A 4WTOA 1VJ1A 1CUYA 5KSPA 3DVQX 4LSGA 1XRQA 5DK6A 3VSBA 5CB4A 2SHKA 3TTSA 1EP1B 4FKZA 4WERA 2XCIA 5CLIA 1KO1A 4V38A 2B8WA 4DIFA 3CPSA 3DXFA 3L1IA 4RTKA 1PR1A 3L40A 3WL6A 2QBYB 3CVWA 2R96A 3L92A 1FMFA 2A7XA 1AVTA 1FNCA 2KE5A 2D0IA 2ZTHA 1VKOA 3EOAI 1V2HE 4ICIA 5EXTA 3BT7A 3L7KA 4BJ5A 1EAMA 1GU1A 4AN1A 4P31A 1PJLA 3HHEA 3TMAA 3KBBA 1UJ4A 4BGVA 3K70B 1YZVA 1CQIB 1OFGA 4M46A 4DUPA 3AEUB 1KZYC 2A94A 3R0XA 3JPWA 1T9GR 2IPAB 1P8JA 1QTNA 3KTAA 4TV8F 1V16B 1PGNA 5J40A 4FDMA 3U80A 3GZTB 5JD4A 4MS3A 4TZTA 1A4IA 1L1QA 1LNZA 2X9LA 2NSDA 3LV8A 1X9GA 4P5DA 4CDNA 1J5EB 4M3NA 1M33A 1FSSA 3BZBA 1D2GA 1JT9A 2C4MA 5AW3A 3MT8A 3OKCA 3RU2A 4JUIA 5A02A 5AQEA 2HI0A 3OQNA 4P0QB 1JU4A 2A1UB 2VBGA 3EUAA 5K99A 2WTBA 2O2JA 3EG9A 2NSJA 4OFBA 3OFND 1GL7A 2FSHA 5K0LA 3CT4A 3L1JA 4AKSA 5BYBA 4FE7A 2BGNA 4EFLA 4XJTA 1NC3A 1P5HA 3KPJA 4RCVA 3DNFA 2EBHX 3O95A 4IJ5A 2AMFA 2PM8A 5FTMA 4L08A 5H81A 4B4VA 5LZ2A 1WQ3A 2BF4A 5JMOA 3ROXA 1TMKA 4PZCA 4OQNA 4UHFA 5TMPA 4AY6A 2EJCA 4NC9A 4TTIA 1A97A 1F20A 3CZ5A 1RFLA 3QXXA 4LZWA 5GIOE 2GUWA 3Q3CA 4S1PA 1H3EA 1ZJ6A 1U90A 4DLPA 2QR3A 3QJ5A 3N2GA 2WJ4A 4YQZA 2FSSA 1UC9A 2HPAA 1ORTA 1KYTA 2WTNA 1DKNA 1MAUA 1PVVA 3H84A 1W29A 1T4MA 1BDJA 5JTUA 3SWWA 1OSNA 1YDGA 1KEUA 1KKMA 3QU2A 4EW2A 2FUNB 4DSTA 1OAOA 3K6SB 4H4EA 1YOBA 5FI0B 2E1PA 3TXAA 3QBDA 4EVQA 4ENPA 1LK5A 5BN3B 4UQOA 1WLSA 1N8SA 3QKRA 3B2QA 5HZMA 3T12A 2RHOA 2F3SA 2V7PA 2ZB4A 2WG1A 1RRPA 2X19A 2XQIA 3MIIA 4QO8A 1XQXA 5G41A 4C22A 4AI6A 2NP7A 3MOIA 1Y4SA 3E03A 3LG2A 2G9QA 1JG3A 4ILKA 5E8RA 5JJIA 3CYFA 1GKUB 1XZPA 3DMYA 3F7OA 3GJ5A 5FJIA 5DWQA 4RPHA 4V2IA 2DXIA 3FTFA 1ELOA 3CKYA 2KQUA 3DMGA 3IELA 2YN4A 5KVQA 2B4AA 1BD3A 1AXRA 2IK8A 4LWOA 3AKZA 2PBZA 4BCCA 1RJGA 4ZMBA 1JXAA 3T3NA 3M81A 3ZHCA 1N78A 4PS0A 4HHEA 5AFSA 1SUWA 4B2IA 3C6XA 3VC2A 1DFGA 4EUSA 4ZI7A 3ICCA 5KYYA 4M6WB 3D64A 4OLJA 3SSMA 1KYQA 2OYCA 5DM60 4K1XA 4OHMA 3CR3C 2PD6A 3OFKA 4EMUA 1M2NA 5LMCA 3KSBC 5AOVA 4BBJA 3OZXA 1D03A 3O7MA 4I3GA 1XCJA 2VWQA 1QDEA 1RLJA 3E18A 5K3AA 1B4DA 3ETLA 1NN5A 1AQUA 1TD9A 1KEKA 5EWMA 4LZZA 2IOHA 2JLWA 1M3SA 2A6PA 4TMFA 3E2PA 3GGJA 3DWGA 5ELMA 1D5CA 1NHGA 3DQQA 4JKIA 4KE9A 2G63A 4RZHA 4XA8A 1PLLA 4CFYA 5HNKA 1WU7A 1REQB 4LJYA 4Y2YA 2D1SA 1D5WA 4NMLA 1XZNA 3RW9A 4NCBA 3X1KA 1UXOA 1P44A 2ZRKA 4Q6WA 4KN6A 2JJ2A 4QQNA 3RQSA 2BEKA 1KE1A 5BQFA 1U0TA 3DFMA 4TRNA 2R8YA 1OYYA 5FI1B 3TM5A 3WSVA 2GF2A 1CIJA 1V8PA 1UPFA 2JHFA 2P65A 1OCEA 4LQCA 3V9PA 721PA 4FGWA 4GUDA 4J6EA 1E3TA 4TTJA 2R66A 2AN1A 2QRPA 3NXKA 3RUEA 1QWOA 2MIIA 3QPVA 4PV7A 1YRQA 1EP9A 3BQNB 4BL5A 1Q91A 1XNGA 4PONA 5AK5A 4ZYVA 3NBXX 3VDNB 3OTOB 3VDQA 3WRXA 2O0MA 1Z06A 1U2TA 1C50A 3PR3A 3CF4A 2WIKA 3N8HA 4PQEA 2O3SA 3WOHA 4C0QC 2PQMA 1ZN9A 3ELWA 3N0WA 1WW3A 1HC7A 5AM4A 5BN4A 1CJMA 4D9HA 5A06A 5B12A 1G66A 2RG7A 1MW9X 4IX1A 4TXLA 1L5WA 4HPJB 5AXBA 3RFCA 1SHLA 4AU1A 2O3JA 2B7LA 5TT0A 1NBWB 3UA3A 4YDQA 1FDOA 2V6FA 3B9RA 3KBOA 1T2FA 3K0FA 3RIMA 1GA6A 1UBLS 2AQ8A 3K2IA 4KWEA 3D59A 4LZLA 5EI5A 2BHNA 3HU2A 4UKDA 5EZ6B 1VYHA 2IHBA 5CDHA 2FLWA 2WHPA 4TWIA 2QJRA 3G0GA 1RAFA 3KV1A 3P4YA 5EERA 4YCSA 4MW6A 3C6YA 3DWIA 1BDIA 3F5QA 4X7RA 4RJTA 3ADOA 2QT0A 2AUNA 1GZVA 1M8KA 2IYAA 2VDPB 2O1XA 5AVZA 1TJYA 2XYHA 1P75A 1MH1A 4RMNA 4ZZIA 3CX3A 3FB4A 3PZBA 1SKAA 3LSYA 4ND7A 2NZWA 1PP4A 5TR9A 2EL9A 3V2GA 4DY6A 1N4AA 6NULA 4ISBA 4N1AA 1IEWA 2XXAA 4HAYA 1N2OA 3ZU5A 4JQYA 3VKGA 4DADA 4CE6A 1KAEA 3CMCO 4C3UA 2AN9A 3CN7A 4Q34A 1G5FA 1W581 4FHCA 3C7KA 2BFBA 3QELB 3CLTD 1DKPA 4PS1A 5FUWA 3UWOA 5CG1A 5JY1A 4J7AA 5DASA 4YMSA 2UVPB 2FPUA 2XE6A 2XOKD 4F72A 1BSVA 4KTTE 3AIKA 5IAGA 1SVMA 1OLSA 1M2KA 3VSCA 4EKDA 5H70A 3O92A 4A6DA 3EDMA 3PIDA 5EE5B 5ERYA 4AW9A 1QPZA 1HMPA 2FN8A 2QN3A 4EJ2A 2G67A 4C5BA 4RS4A 4V0NA 1MO6A 3F9IA 1IK6A 2H2DA 3WYFA 3TF5A 4L9AA 3KJIA 3UN1A 4EZIA 4B0OA 3C7DB 4G85A 1R8XA 3KELA 4KO4S 5DU2A 5BUSA 3R3WA 5G02A 1H2FA 1QH9A 1YR1A 2AR9A 2RKBA 4JB8A 4PC2A 1IOLA 1FDUA 1VHDA 1P7VA 2HMAA 4WACA 3QY0A 2GPJA 4PHCA 1AJEA 1SB9A 3IBGA 2VI5A 4F11A 4IGFA 4TQAA 1SB8A 3OX2A 4GI1A 2AZ4A 1X19A 3BXHA 3KKLA 4JLJA 4KXNA 4RKYA 4LTDA 1QIHA 2XCSB 2L19A 2ZIVB 4R0NA 1GTG1 4U0JA 1G7SA 1I1HA 5DHUA 2JZNA 4ACAA 2BHLA 1ZCBA 3RVNA 4LJ4A 5CH5A 2HA6A 2ERYA 1XEXB 1OXVA 1YGPA 4HYTA 4EY6A 2GEUA 1UUFA 2J0UB 4AJOA 2C2WA 3MRTA 3OZWA 1OC4A 4AX8A 1AO3A 3DOFA 3G7NA 5DN9A 5TPWA 1A9YA 3PEEA 1YZGA 3U6BA 1GPH1 1JJIA 1N77A 1XD2B 4HAZA 5HRAA 2BIFA 3IJ5A 1FK8A 5AKZA 4EKNB 4N48A 4KFRA 2X5NA 1SCUB 1J06A 3TSWA 4K9MA 4YMHA 2HBZA 4Y1GA 4L0MA 5CDGA 4K8OA 2J9GA 3G85A 5JS6A 1U0SY 4KYIB 5ALDA 2LWIA 3T9FA 2R97A 4RWZA 1US8A 3RH0A 2H1HA 2NZXA 4EG4A 4O08A 4U3JA 1FIUA 4GPD1 1O96B 1T8YA 2W48A 1JIUA 3WV4A 4EG1A 4IHJB 1VMAA 2PDAA 5F7OA 1W87A 3R4CA 5K51A 4KZKA 5KJFA 1KJWA 3ITDA 5E9QA 3H04A 4RVCA 4BXOB 4CM8B 4P1ZA 5EQJB 5CLFA 4W7SA 4R68A 4RVSA 4ECAA 4TZ6A 1PK9A 4KQHA 1YQWA 3LT2A 2EGHA 2ZUDA 5TQ0B 3GJQA 2Q9AA 4PO3X 3N0TA 4W5HA 1Y5RA 2RONA 3W4JA 4HQKA 4OQZA 2L82A 4E2XA 1P5FA 2VNJA 2V03A 4M88A 1KVUA 3QPDA 3S7TA 3U56A 3TPFA 4CUZA 3P2MA 4I4TA 4FI3F 4F5ZA 1OH8A 1S4QA 4PO8A 3MVEA 4INAA 2R7KA 3SM9A 1XVTA 2FE1A 5EP1A 4WFQA 4X3PA 2BJWA 1KTVA 2VPPA 5SYMA 3K92A 4OYLA 3RC1A 4MQEB 4XWKA 2ARKA 1IATA 3Q3EA 3SMVA 4BFWA 4OGGA 4AUKA 3CXUA 5K3BA 2F3PA 1BE8A 3BTUA 5E1BA 5FUBA 4JA2A 3P4XA 1PE0A 2EW2A 2HA4A 5AWFC 4BWGA 5BYAA 4TMZA 1PZFA 5MGNA 1RZUA 3OD1A 3HUDA 4Y0VA 2W7TA 1EFPB 2CUNA 2YVKA 2JGMA 2H4FA 2UUOA 2XA9A 1NR5A 4KQXA 2PBLA 1OKKA 3PC8C 2IUYA 2ZP1A 4PBRA 4DV7B 3A6DA 2AF3C 1RTKA 3E22B 4WZAE 4TKVA 1M2EA 4Y6GB 3B3QA 1KKUA 1ZMTA 2W6CX 4DKJA 1L0BA 5NLLA 3Q9LA 4L1KA 1DARA 1CUWA 2CNDA 3K0EA 1EUZA 4EHIA 4XIGS 3C8DA 1G17A 3DXZA 1TPZA 2QN9A 1OZ0A 3KHUA 2AHOA 1OTXA 3BE6A 4FZJA 1FXWA 1UINA 3VKUA 3DE6X 4O4IF 3WFJA 4C88A 5F7XA 1A8IA 2ZUEA 3Q5EA 4DLAA 1XU4A 4PGHA 3A1SA 1KIMA 3UUFA 3QE4A 3PWSA 5CGZA 1GGVA 3PP8A 3S44A 2GCOB 2FP4B 3MCVA 3K7EA 3QPAA 5T57A 1Q11A 4IIJF 3IP9A 5K2MA 1WMFA 2NN3C 3SCZA 3F8WA 4GLJA 4QJIA 2I2FA 2QPTA 4REQB 2EKDA 3TQQA 1EGMB 4DRXB 5EYPB 3DVLA 3RLFA 1XNQB 3KUUA 1HDOA 5EUQB 2YWJA 5BO5A 1K9VF 4AUEA 2GCEA 4LCJA 4G5RA 1RHKA 2WA2A 3LFHA 3W8DA 4Z0HO 2FPIA 3AJ8A 1PQWA 5CNIA 5C5CA 2IY7A 3M8KA 1PEDA 3NUGA 1YU9A 1XRJA 2JC3A 4XFKA 4Y7DA 3AR5A 2NNLD 5LJIA 1AQNA 3LZDA 4C6RA 1KFEB 4D4IA 2I62A 3HJNA 3NIBA 3C74A 5F1YA 4W5NA 5ALZA 3U40A 1XZMA 1Y3HA 3MERA 3JVEA 1KR5A 1TLLA 2GBIA 1Z4OA 4BCBA 1CQJB 2WA1A 2Y4NA 5KCZA 1Q1AA 3EPRA 2HDOA 3ZDAA 2GRJA 2KS6A 2V8BA 3ELUA 3CEJA 4L4UA 5B58T 5JRJA 5FORA 4ABYA 4OHZA 1M2FA 3K8OE 4YRIA 5LDHA 1NE2A 4AZSA 4E6PA 1JG7A 3I1YA 4INJA 3BB1A 2FQQA 3W5CA 2BFDB 4N0QA 3H19A 1SU8A 2NU9B 1MB2A 3T1YB 3B1XA 1JXOA 4XI9A 1KMMA 3OPMA 4RIGA 4OP3A 4QZVA 4HZGA 5KB3A 1EBFA 1PNQA 3FWHA 3ZWXA 4JI8B 4M4SA 1JLLB 2C0QA 2D74A 1VKZA 1E18A 3GLVA 2IIBA 4NMHA 2C2XA 3THRA 4E88A 5DX8A 5IDVA 2UUBB 3HNRA 3LCVB 3R3JA 2PV7A 2PR7A 3G2HA 1A9OA 3OPYA 5G53C 4E03A 3E8SA 2NUTA 4EBFA 2OWEA 2Z2IA 1Z7GA 3FPAA 2ZUWA 3L18A 2DGDA 3K9HA 4FPXA 5IN4A 5LU9A 3G8YA 3CNHA 3IIEA 1DELA 1R0SA 4HN2A 4LV6A 2RH9B 5T4HA 3T7RA 1G8HA 4R31A 3BSFA 3OQ6A 2MYPA 1A8SA 1BVRA 2D5IA 4MEAA 3VISA 4EP1A 2OB2A 3LWNA 3I8XA 4J0QA 4HVLA 3IAS6 3V8MA 1T5OA 3GLSA 2CWWA 1S3GA 3SMQA 2EFEB 1N6OA 4DUYB 4GRIA 4EY8A 2QYTA 2FOXA 1QYXA 4KMMA 5AHXA 1NW8A 3EC1A 2I22A 5K1ZA 2HBQA 3QEKA 4H4CA 4XDYA 5BVHA 2XGJA 1V5IA 2VNSA 4F0JA 2VTBA 2WD7B 1F48A 2NU7A 3QIAA 1I9GA 4ODIA 1ZM9A 5C3MA 1AQ6A 4JLWA 2SCUA 2MJLA 5G2OA 3GX1A 1N5JA 1NUPA 3LS2A 4MMYB 4E5SA 2Y99A 2F3RA 2O8FA 3A1UA 4BJHB 5FL7D 4YEDA 2HYIC 3KQOA 4WXEA 3TUJC 1UOPA 3PFWO 2P90A 1N3YA 5A0FA 3KQMA 1QKJA 2V59A 3OY2A 4IG9A 3U9SA 4V0SA 4DJDC 5K0JA 3KFLA 4NK5A 4BIIA 5HOEA 3KOOA 2UUAB 1CSEE 1C1XA 5K3FB 4E12A 4EEZA 3GCZA 4YJDA 1VKRA 1QRRA 5EPEA 1PR4A 2O2IA 4R5HA 5U4QA 3RTEA 2OPHA 3UB4A 4E4YA 1DBIA 1V5FA 5DM1A 1RJWA 1C8KA 3EIFA 2JD2A 5I4BA 4K40A 2CNOA 4MI9A 3VU0A 3AJAA 1K63A 2EJVA 4HI0E 5A04A 2IZOA 5BSGA 3FOBA 5FLYA 3SR0A 1MKYA 5DI3B 1L5RA 4HNAA 5FBZA 1KAOA 1S7GA 3O21A 4FUQA 5FHRA 1JV2B 1R5BA 3GLUA 3KT0A 1G8YA 4I14A 3UYKA 1O9GA 3FYUC 5JATA 4HF7A 4DM3A 2ZFUA 5JIBA 4HN9A 3SJBA 3EQ9A 1QNLA 5T5QA 1ULAA 1IY9A 2H8GA 1ISMA 4HGOA 4GPEA 2R00C 3TUZC 1P2DA 3IODA 4YRMA 4YMVA 1SOVA 1U2DC 2FCAA 2I65A 4FN4A 1PO7A 2XKJE 1NJGA 2AXEA 4M9QA 4R6XA 5D3KA 3T7SA 5COAA 1TAGA 3S27A 1DJPA 1E5DA 3BWVA 2YMPA 1T4BA 2DH6A 4HLQB 5LQSA 3K35A 2W2XA 4L57A 2GILA 5FBLB 3I58A 2QV7A 3TRKA 3HVHA 2G0TA 4OI1A 1P74A 1WY5A 3I5AA 2Z43A 4Y9RA 3GUCA 4B35A 4CTNA 1OASA 4QU0A 3BHJA 2BEVB 5DOZA 3ZWQA 3AY6A 4M9XA 4G67A 2BDEA 5EZYA 1OUMA 5GV7A 3GGDA 4LRTB 1E6WA 2AW3A 1IZ8A 1HSZA 1VLJA 3WHKA 2BEWB 4GUAA 3QKSB 1J24A 1EQUA 1IL0A 1AUOA 1XYGA 2GZSA 3HY6A 3AK4A 1C7ZA 2FX2A 4IHQA 4WPGA 4JOSA 4LRYA 4EMTA 4J4HA 4UTVA 1M2JA 3S2ZA 1UMCA 1PR2A 2KJQA 2W8BB 4XB6B 1X94A 2A1TS 3EGOA 1OOEA 1PI3A 2X7HA 3FGZA 4Q4CA 2Z9DA 5IT9A 4CHGA 4HEJA 2KB0A 1L5FA 5F2KA 2HCFA 3WP1B 1QHHB 1JKFA 2F55A 2OFOA 1WETA 1E1QD 2VNAA 1WXDA 5LXTF 4JYZA 2FU5C 5BUCA 2WT4A 2WWFA 3B1FA 3TTXA 4F91B 1Y3AA 1SOAA 1W8IA 3H1EA 4KQ2A 4F6RA 2QNIA 5K8LA 3ZVNA 1CE8B 1G3MA 2J85A 1UBUS 2EFCB 4RWEA 2C7BA 2HQBA 3IT3A 4JJGA 3BXXA 4GICA 4FD2A 2IHUA 2GO1A 5DHSA 2OVFA 2Z2JA 2GN9A 3KIPA 4ZXPA 3D2BA 4YJFA 2OFXA 1O87A 4KYTA 1X13A 2XVZA 2MYNA 3AF5A 3GFVA 3NBKA 4ZAZA 4I4CA 4Q05A 1KK1A 3AW9A 2WF8A 2Y77A 2XUFA 5DCLA 3QNWA 2PJRA 3P2OA 3B12A 3G2MA 2QMQA 3ROFA 3Q41A 2QLLA 3GVHA 1JHPA 4E09A 3ANNA 4TV9A 4F92B 3PJGA 1XL1A 1N1EA 3C7TA 1NZJA 3FSJX 3GCXA 3MJTA 2PRKA 1X74A 4N8SA 3S68A 2ZRMA 2X5XA 1A71A 3HXTA 1JVNA 3MWEB 1SC3A 4B3XA 1HQYE 4IGAA 4DBVO 2CMGA 3OZRA 4TTRA 1UZUA 2XD9A 1P4RA 5GGYA 2G9VA 1JEQA 3NALA 3U3XA 1U1IA 4P53A 4C9BA 1TW2A 2XTZA 3KVVA 3L4JA 4G0VA 1CJBA 1LC0A 2ZSDA 5HCNA 4OU4A 3W06A 4A0SA 5K03A 4AUMA 4RPLA 2TSYB 3K1ZA 4ZV9A 2O8DB 2QNRA 2P9EA 1NW9B 1NLFA 3ROTA 2MMGA 5HMLA 3UJ3X 1EHCA 2PLFA 1KEEA 5JFOA 3O93A 4JI7B 2YS7A 2DFNA 2YWDA 2DHCA 2O6HA 3IESA 2WUGA 5F52A 3B6MA 4IW3B 3HXKA 2GFQA 4JJIA 4R83A 4TZ0A 2IQ5A 2X4IA 4MYCA 1WW8A 2QXYA 2XB6A 4POAA 1E1DA 1RWPA 1FUKA 1B6SA 2O57A 2UV8A 1SD5A 2HH9A 4ISCA 1LDGA 4P84A 4EO9A 4KHPB 4JQSA 2BH2A 1Y9AA 3B6EA 5FF9A 1SXPA 3HMQA 3GZ4A 3KVYA 2EOAA 4GYWA 1H65A 1U11A 5F2NA 4JBYA 1H8HA 4E7OA 1NBMD 1P1FA 5ITZA 2C2GA 3I2IA 1CF4A 4HATA 3KALA 4Z0PA 5G3YA 3VNBA 5I8PA 3NC0C 1OBVA 3O8OB 5K09A 4Z9AA 4IS2A 5IWAB 3VJRA 2DUNA 5F1PA 3R76A 1XCLA 1ZFNA 2PK3A 2YXNA 3JXEA 1C7IA 3K0HA 4FS3A 4O4HB 2FNAA 4AKHA 1JQEA 5J4HA 5EL0A 1IBSA 4EHFA 5C8YF 3ORFA 5FYQA 3E35A 3ZNNA 2XSZA 3QX9A 4L95C 1OWMA 5ALOA 3UOWA 4ZKDA 2YXDA 5F9FA 4PLPA 3K6JA 1FVHA 1X6VA 4MV9A 1MABB 1OFIA 1SMKA 4Y6PA 3T3OA 2F00A 1BROA 1IZZA 2QRKA 5A4FS 2JGJA 2QRGA 4O2LA 2NSLA 4CLXA 1TL7C 4WY5A 2C9YA 1QVZA 4HMPA 4JXXA 5KMGB 5EOVA 2HHAA 1T6XA 4FJ2A 4YLGA 5BOVA 4F3YA 5J43A 2WAYA 4YASA 5AR1A 4MYSA 1PZMA 2E0IA 2M9MA 4M0PA 4DG8A 3IR5A 4X66B 4RORA 1FRFS 1MBZA 1YRWA 1XZEA 4TLDA 2BFMA 2D3WA 1FMJA 2XB8A 1SXIA 2GHRA 1PV2A 1KY3A 1H1LA 2BKLA 2CNNA 4B32A 3B85A 4KUGA 5BWNA 4UASA 1JPNA 2C29D 4RD2A 4YDHB 1XVAA 2QE7A 3C97A 4C0JA 2D62A 4XE5A 4C0SA 2YWFA 1NQOA 4OUDB 2CKMA 3S99A 3S1SA 3AIMA 1B0UA 3AERB 2EKQA 2FTKE 1XZHA 5CVEA 3VR5A 4C01A 3TNJA 2JHPA 2B34A 2HTFA 2Y1WA 2BBTA 1Z0JA 3JQGB 1KIFA 4L7QA 3BWEA 3ND9A 4IG4A 1N0HA 3TQHA 4CRWB 5K4HA 1XP8A 3RTDA 1NXTA 1PG2A 2HJRA 3EARA 4RHCA 3SK0A 4P0TA 1HE2A 1O89A 2Q27A 4ZQEA 2A5FA 3U7GA 4J7UA 2B1IA 2CF6A 4X85A 1ZA1A 2AT1A 3HN2A 1B1CA 3KK0A 4Y9SA 5LBIA 1KYIA 1T29A 2NXCA 5CB8A 2VQEB 1ENZA 2JGAA 4O02B 4ENWA 4ZK2A 4MYRA 3U7HB 1PDOA 2Y93A 1HYBA 3BN3A 1KSHA 1KFJB 3OCXA 3UTCA 4DNXA 5KX5F 2P9FA 4ZO6A 5KQLA 4M1TA 4G6ZA 3IQIX 1J90A 3W2TA 4BEWA 2VYNA 4ZYZA 3WS7A 2C4NA 3THSA 4CGYA 5KOYA 1H6DA 2AJTA 4QXOA 2IUSA 3FZEA 2G04A 1QKKA 3FOEC 2BMJA 3Q7SA 2M6LA 2X0EA 2C7VA 1X7WA 3QP9A 1KK0A 2TMKA 3CLRC 3LNCA 3MQFA 4PIPA 3DGEC 4WK2B 4CETA 1D4ZA 1UT5A 1PTKA 1MXFA 4IIGA 1CUJA 2ASVA 4RV5A 1M1YA 2QGNA 1J00A 3PUYA 3ES9A 4AJ4A 1JKIA 1G20A 1U2QA 1SHZA 5CEJA 5BMVB 1YE5A 1ZINA 4OLBA 4U9UA 2BFNA 4HUTA 2PXCA 3I9OA 4GOMD 1I7DA 3RPEA 1CNMA 1J4AA 1YJ5A 4GMHA 3SHFA 1GITA 4B73A 3EZYA 4KQGA 2BFCA 5CX1A 2O5RA 2ERXA 1QBGA 2XQKA 4CQNA 2AEMA 1JEYB 4OGLA 3NWJA 3E70C 2I8AA 4ARVA 4OB7A 4DT1A 3WVNA 1O9BA 1CJVC 4HRAA 1WB6A 4FSXA 3M33A 2HA7A 1P61B 1UJ5A 4YACA 2I4NA 2JNWA 4Q4AA 4Q4HA 4ED9A 5AVTA 2H9YA 4PG8A 3CTPA 1YI8A 2W0MA 1WDLA 1GTSA 2C82A 2QLJA 3EQ7A 4Y2XA 3T3IA 4DWJA 1CUHA 2F62A 4OGFA 3WV5A 4BJ3A 1XLVA 1D4FA 3E81A 1LJUA 1IAQA 2AN4A 2RI0A 3DAGA 3UOAB 1QFSA 4TSFA 1VCMA 3VHXB 5HQ3A 2RGWA 1BFDA 3RODA 4L5BA 1QFZA 3I1FA 3I37X 4I66A 4DMLA 4EL5A 2JVIA 3VKHA 1XVIA 3QVKA 4HGRA 2FUKA 2EC5A 2PG3A 5ILGA 2OV8A 4AJKA 4IVQA 4BVFA 4B3CA 4GPTA 1LSUA 1RKUA 2ZCVA 1SUDA 2J9ZB 3H99A 4KWHA 3VMFA 2GAIA 4TYQA 5DYYA 1DXYA 3RYHB 4C0HA 5JR3A 2OORA 2YCBA 5TVGA 5D3ZA 5I8ZA 1ULTA 1N2EA 3BX1A 1QH1B 3FROA 2BUBA 2D2VA 4C0AC 4ECEA 2QLBA 4PSUA 1VB3A 2ZPAA 4Q3CA 2BKVA 2ZEJA 4Q9IA 4B09A 3X1MA 4DA8A 1E1LA 3PCXA 1PS9A 3GJSA 1WJGA 3AFHA 3PKZA 4G0NA 1Z22A 3FRJA 3K32A 4TTTS 1KI7A 4RMGA 4X8LA 3V4OA 1XFDA 4ZYYA 3WGMA 3A2KA 1NQUA 2IF0A 4YP0A 3FGOA 3GV0A 3OUTA 4AF7A 5HKOA 2RE8A 3H5LA 3L7JA 4H7PA 4U2GA 2C4UA 4J4BA 4HDCA 4WKNA 2UYHA 1K98A 1QAMA 3L7AA 1JPJA 1U0RA 3VR5H 5A7HA 1A2BA 1CY0A 2P9YA 4I46A 1OMOA 3VOBA 1AA9A 4DYVA 3HZZA 3QFRA 1Z35A 1NW3A 1RM0A 2PV0A 4OQMA 2DPHA 2AOXA 3SJUA 5FUQA 2CL0X 3FRHA 4W5WA 5EKSA 4UAVA 3HJFA 2J3DA 5GPBA 2CLLB 3GQVA 3GT0A 4WBNB 3JD0A 3D5TA 4R54A 5E6UA 3LHSA 3ZTTA 3GF4A 1MENA 3QUAA 1ZAKA 3C7AA 3N58A 4EI9A 3H65A 5JI3E 1ZXLA 3ZNOA 3OICA 1AC5A 1MFPA 3L05A 1WD5A 5D3MB 1G64A 3PGXA 1Y6RA 3CH4B 1YR9A 3ELDA 2ZM5A 4IDPA 1YHYA 4GFDA 1CUGA 1QIGA 1LLUA 3CNBA 3IEUA 4UDYX 2RB5A 3PQ2A 4LDZA 1VHLA 1YBVA 4D3YA 3AHIA 1S1CA 1WHTA 2JFYA 4M0FA 5EN4A 2XX3A 5C7IO 5JSUA 2IDMA 4BO5A 4BE7B 1RM4A 5EWJA 1ABBA 2JGFA 3UB3A 3S5UA 3EX7C 2H3EA 3R3XA 2EZTA 2NSHA 4QM6A 1ECLA 4DYDA 5AI9A 1QWSA 5L4SA 1LFDB 3MWGA 3GROA 1M54A 4EJMA 1U6JA 4XYBA 5A9TA 4DMMA 5JH7A 4LSWA 1IOWA 4TS1A 1QHIA 1B42A 5HZGA 1U3FA 1EX9A 5G4KA 4BMZA 2JD1A 3N8GA 3TR0A 3TNLA 1SHUX 4EO4A 4Q15A 1P9NA 2XAAA 3C8UA 3DKVA 3QWHA 3PGA1 2PYDA 2IXGA 1PT9A 5JZBA 2KHZA 2LD4A 1GZ7A 4GP9A 1YFZA 3WLQA 3KNZA 3RHTA 4XW2A 1RYNA 3BWMA 3JZDA 2ISCA 1U8TA 2VJBA 1U8EA 4IZOA 1HQCA 3BK1A 3VX4A 5HUJA 3WA6A 3WSTA 1QQTA 3U61B 1J0AA 4L22A 3T4XA 1GVHA 1K4KA 3I6YA 1PJ8A 3MILA 3VFDA 4BO0A 3DC2A 3DJFA 3F7MA 3IIIA 1EZ1A 4MV8A 5BNTA 5BYKA 2CLEB 2HEIA 2WJVA 3VBEA 1VLHA 4GGOA 2X1MA 4EITA 1HNWB 5IULC 1F8FA 3H5RA 2VT2A 3UAWA 1RCUA 4DC1A 2JA1A 2R6JA 3GMSA 3LBNA 4L72A 1AO0A 3E2IA 4ZHQF 1KJ9A 3HABA 4IOLA 5HJ2A 1J2JA 1UWLA 5J1SB 4RACA 2YHSA 1N9KA 1Q7TA 4Q01A 1TCVA 2X0DA 1P1CA 1XZFA 3HUTA 2CUTA 4EGQA 2FZ5A 3ER9A 4ZC8A 5A3QA 2FMKA 1RQ2A 2OQRA 3TQOA 1NXVA 2WNSA 3R8CA 4E3ZA 3H9CA 3IB6A 4II3A 1JKJA 3JSAA 5WRFA 3FMVA 1AKUA 1UC5B 2AK3A 4PCVA 2PGLA 4LF6B 1U7HA 1UKVY 2AWNA 3E8XA 4JSYA 4Y18A 5HS4A 3PC6A 3QE3A 3QU5A 5AJVB 3MXTA 1OX6A 4OREX 1IB0A 4QBIA 2VFAA 1YZNA 4NOKA 4WKGA 1E0AA 2VHVA 1S3SA 2VZ0A 2JF0A 5LA6F 1JLMA 1CDEA 1KQGA 3AL3A 2F48A 3KVOA 1NW6A 3KYIB 5EVJA 5G0UA 3UWMA 3VR2D 4BKMA 1B1AA 1T3LA 1XEWY 1NYTA 3MJFA 5EC8A 1JILA 2O14A 2VL7A 1WSWA 2KLBA 3N2KB 1PJ3A 1BOFA 5EJ8A 2Y3IA 1I2BA 2H4JA 2NPOA 4XD7D 3GLFE 1VP9A 4ZVVA 2R6FA 1ZD5A 2I0FA 2P7IA 1GFWA 1PDVA 3N5KA 3AKYA 4B82A 5KJ1A 3H7AA 5BW6B 1R9NA 5ADHA 2QENA 3FNRA 3HFGA 2BJHA 1WVGA 4CM1A 2EZ8A 3KJHA 3BJZA 1ZXBA 3F1KA 4YXWD 1YCHA 3L6UA 3T3PB 5LSAA 2BMVA 5AKKA 2A5DA 2FRXA 5AK3A 4NV1A 2JBWA 4QT0A 5DX1A 4KO2S 1DJMA 2VCHA 3IPCA 4OATA 3E9EA 3KE8A 5JO9A 2ADMA 3KWFA 4W9RA 3QLVC 3LBFA 2Y2UA 5IYZB 3D3NA 4UDXX 4FFSA 4XGNA 4BJ1A 3VOSA 1I0IA 3PPIA 1KU0A 3KVNA 1XNHA 3QVXA 4NU0A 4E5DA 4QUDA 4ZT5A 1BW9A 3VTAA 5DCWA 3WO0A 4LG1A 4NYMQ 3DMFA 1LZKA 3HGTA 3GVPA 2ZTSA 1FBNA 1WCIB 1FQOA 3AQIA 3CWCA 4N6OA 3KUXA 3RJZA 2QSJA 2EP8A 3OFNA 2A0WA 2ZSBA 4MKFA 2DUJA 2IYYA 4AJ9A 5DZSA 3SR3A 5FBWB 3GT3A 3UK7A 3G9ZA 4C30A 5LXTA 1N5KA 3ORSA 2YUIA 4PSAA 2DPYA 1VLMA 3HE3A 2GBFA 4OJQA 3IAEA 4TPKA 1XDWA 1DEAA 1QIDA 4KUHA 1FX0B 4FYPA 5CPFA 2WIDA 3LQKA 3ZG6A 5EHQA 2QYHA 5HA5A 3AKDA 5IANA 3CO5A 3ILHA 4K9SA 5REQB 4LHWA 5C4IA 1C4WA 1HE5A 4URZR 3MTGA 3U6KA 4I5DA 1JL3A 4ALKA 3C4JA 1H2ZA 1KEPA 1JUDA 2YQ5A 4PLYA 2IYOA 1ISPA 1LVUA 2OCGA 2W6MA 3DMNA 4V0QA 4BQEA 2YZ7A 1AB6A 2XWPA 1I3OA 1BE1A 2CXNA 2PT6A 1UZMA 3DPSA 4OHKA 1K8RA 5H9VA 5TQ2A 3R7LA 4TWJA 2H7YA 3WL3A 4G0YA 1YS6A 3NANA 4E6EA 2X8LA 3H11B 3A26A 1SKQA 1N6NA 1ULUA 2C5BA 1YVEI 1U4OA 1GL3A 4AN0A 1P3JA 4ZEMA 3ZVRA 3B1YA 1Z4NA 4KDEA 3JRXA 1MG0A 4CIWA 2CHEA 2CNWD 4NOJA 4L8LA 2FDCA 1T4DA 3N87A 3ZWWA 4PGMA 4JC4A 3EVDA 3VR4D 1L2TA 2CB0A 3HL0A 2W6PA 2Q21A 1W76A 3CLUC 3E6AA 4MWOA 1P7ZA 3ZKWB 3B8HA