4WE3A

Structure of the binary complex of a zingiber officinale double bond reductase in complex with nadp monoclinic crystal form
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
353
structure length
342
Chain Sequence
b'DVVVVNKQVLLKHFIPAPKETDMELVTTGTIRLRVPEGSNAVLLKNLYLSCDPYMRMRMTKHEEASYVDDFVPGAPITGFGVGKVVDSSHPDFKTGDYVWGLIGWEEYSLITKPQGLFKIHHTEIPLSYYTGILGMVGLTAYVGFYDICSPKKGERVFVSAAAGAVGQIVGQFAKQFGCYVVGSAGSDEKVNLLKTKFGFDEAFNYKKEPDLTKALKRYFPEGIDIYFENVGGPMLEAVLHNMRIKGRIAACGMIGVHNLFLIVGKRIRLEGFLVFDHYGSYPEFEEKVVQLIKEEKIKYLEDIVEGLENAPAALIGLFEGRNVGKQVVVVSREKGHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Double Bond Reductase
publication title STRUCTURE OF ZINGIBER OFFICINALE DOUBLE BOND REDUCTASE
rcsb
source organism Zingiber officinale
molecule tags Oxidoreductase
total genus 109
structure length 342
sequence length 353
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF16884 ADH_N_2 N-terminal domain of oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4we3A02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4we3A01
4EEXA 2CSUA 3V1UA 1UZLA 3Q1LA 5H83A 2Z1NA 3C24A 3ZNPA 3DZKA 1Q7BA 3LC7O 3GVHA 4PZDA 1S7CA 5JDIC 1IZ9A 2YQ5A 3AOEA 4L4SA 4I1IA 2P9EA 3GGPA 3DBHA 2OZPA 3RBXA 3DBRA 3WLEA 3GUYA 3TWOA 3JYPA 4GSLA 4MVJM 3A06A 3TL2A 4IGFA 4U0JA 1IYZA 4CM7A 2IZ1A 2FY8A 3AWDA 2C5EA 3W8EA 1I3NA 5DBFA 2OUIA 4HNGA 4IIVA 2DTXA 1V35A 2PR2A 4BNJA 1EE2A 4Q3NA 3D0OA 3CZRA 3PIIA 1FF9A 5DCWA 4L4XA 4CUKA 1LSSA 1T2FA 2DTEA 2AEMA 3JSAA 1QG6A 2X0JA 3QV1A 4R4JA 1V3VA 2VTDA 1DJQA 3NYWA 2B4RO 4MVJI 5EQDA 1UP7A 1I2BA 4CMEC 3B1FA 4AG3A 1WZEA 2C59A 2PD6A 1DAOA 1HDCA 4BGEA 1HDGO 3KV3O 3ZWBA 1F06A 4N5NA 1N9GA 2Y66A 1GUZA 2Q2WA 1RPNA 5IDWA 3KYDA 1P1IA 1ZXBA 4XDYA 4B3JA 4DIFA 1F17A 4WJZA 4FC7A 2VWPA 5I7VA 1MXFA 1DEHA 5JXWA 2UAGA 3NGXA 5JY6A 2EW2A 4BGVA 3UCEA 1A7AA 1B14A 4KWHA 2BH9A 3F47A 1DBVO 5JCJD 1EUCA 3KOUA 3DZGA 4OL9A 4FFOA 3LVFO 4BNLA 1GTMA 5CEJA 3NTOA 2GD1O 4YJGB 2P2SA 1NXQA 4BMVA 3OECA 1Y8RA 1TT5A 3PYXA 1XA0A 1V9LA 1MV8A 1DIBA 4FJ1A 4CLOB 5IFLA 1P0CA 4TRMA 3WNQA 2EKLA 2VHZA 3GZ4A 3H3JA 3Q11A 3JYNA 5I8WA 1T26A 2VYNA 3G0OA 3I9LA 4TROA 2Y1OA 4HXYA 1HDZA 3UKOA 3PLRA 5DF1A 3CEAA 3T7CA 3FSRA 4DTIA 4NBRA 3W8DA 1FDTA 3BXXA 4MVJA 1HWYA 1H0KA 3KLPX 3RUHA 3H9GA 1H5QA 1IE3A 2VYVA 5CFZA 3CMMA 3PHGA 2NVUA 3OJ0A 4E5NA 1I8TA 4Q3BA 3W4JA 2Z5LA 1I0ZA 1UXKA 1Y8QB 3S2IA 3M1AA 4RF4A 4EJ0A 3IJRA 1PJTA 1GPDG 4R5MA 3JQDA 4WOKA 2NQTA 3ICCA 1ADBA 1E0DA 1Y1PA 4BNNA 2IDZA 3PPIA 4K6CA 3PDUA 1NWCA 1AE1A 3MJVA 4D3DA 4FQ8A 5G0UA 2Q50A 1C0IA 4UEJA 3I23A 1Q7GA 1EDOA 4GGPA 4HP8A 4KMSA 3AY3A 3IIEA 1A5ZA 4IDCA 3M2PA 4CMCA 1K6JA 4QX6A 2OOSA 3DMTC 2W2KA 4KDEA 3C3XA 1Y81A 1O89A 4GPD1 1QYCA 2YV2A 3HWRA 2YFHA 5IN5A 1RM0A 3L6DA 4BQPA 5ICMA 2EJVA 2PNFA 1PSDA 2XAAA 4CLDA 1MP0A 2DPHA 3AI1A 3OHSX 3B20A 5F3RA 4GGOA 2TMGA 4WNIA 3IMFA 4J9UE 3JV7A 3WXBA 3NUGA 5JO9A 1RM5A 2DC1A 4UVHA 4BKUA 3EZLA 3OIFA 2J5KA 3ANNA 5L7YA 5HM8A 3OQ1A 4KTVE 2RHRA 1Z45A 3GQVA 2ZCUA 3ASUA 4D0RA 2QYTA 5JFOA 2EWMA 5G4KB 1I3KA 3JQ6A 4IGEA 3ZV3A 2GN6A 4CMJA 3PRJA 1C1XB 4ZU3A 4A2CA 2AQHA 3R0IA 1CETA 4IZHA 4WCDA 3ZWYA 4OYRA 1G6KA 1LDYA 4D41A 1EQ2A 5JS6A 4XA8A 4GWKA 1M2WA 2C82A 1TVEA 1LSUA 2NM0A 1NM5A 3N74A 3E48A 2B69A 2X7HA 1T4DA 3U49A 8ADHA 5TGDA 1UDCA 2D4AA 3ZV5A 3AU8A 3FCOA 3ZCXA 3HN2A 1HZZA 3QJ5A 4DBZA 1SB8A 5B37A 4O63O 3GFGA 3R1IA 4R01A 1B0AA 5DZSA 1SOVA 3BTOA 1YKFA 3ZU2A 1KVTA 4Q39A 1GQ2A 2QG4A 4R9RA 5TX7A 4YJFA 4DIBA 3HQ4O 3Q3CA 3U4HA 3NX4A 4P38A 3PHHA 9LDBA 3FN4A 1ISFA 1KVRA 3JQ8A 3RC1A 2Q1SA 3C8MA 5ITVA 2I67A 4HUJA 3SLGA 2CVZA 3QVWA 2QQ5A 5T67A 4AJPA 1QYDA 3FTNA 3PVZA 3FNHA 1VJTA 2PKRA 4PG5A 4ZGWA 4U8GA 3JCZA 4XGKA 2O2SA 3V5NA 4YT4A 1CRWG 2AHRA 3GNTA 4B4OA 3FBGA 4YA6A 3VZPA 5KIAA 3WYBA 2OGUA 4ZQEA 2DM6A 1I3LA 2J5QA 3WFIA 3JQAA 3P2OA 4Q3EA 4F6CA 3P19A 3DOJA 1GFSA 1ZSYA 3UXYA 2IZZA 3JD3A 2B5VA 3BMOA 1ONPA 3JD0A 1HKUA 1D1SA 1DIRA 2FN7A 4DMLA 1SBYA 1Y9EA 1LBEA 4CQLA 1GV1A 1LQTA 3VDQA 2OXIA 4EITA 4Q9NA 1ZK3A 2Q2QA 2NVWA 1HETA 4ZQHA 5T6BA 5B1YA 1DIHA 1NAIA 3U4DA 3UFXA 4MIEA 2ZYGA 3GR6A 1LRLA 1HE5A 4CMHA 4L73A 1EQUA 3GG2A 3UW3A 2FZWA 2VWGA 1EVJA 3GHHA 4BV8A 4JQCA 1NPDA 4NU6A 4P22A 2DVMA 1UXIA 1TA4A 5EL0A 4EYEA 4CUZA 3NT2A 1AN9A 3I1JA 2QIOA 3OIGA 1T25A 2X4GA 2IRWA 4FSHA 1E7WA 5JO0A 4CPDA 4LCEA 2O3QA 1RJWA 1F14A 4JGBA 3WTBA 2Y67A 5G0TA 2PTGA 4YAKA 3NRCA 4YAJA 3A28A 3T4EA 1Z6ZA 1E7QA 7MDHA 1BGVA 1WDMA 2ZIZA 2JHGA 5EN4A 4M8SA 5CPBA 4FW8A 3U5TA 1WZIA 5K1SA 1AUPA 2NADA 4OQZA 2AQIA 3JQAD 5FYDA 4YBZA 1IPEA 3E82A 2YHUA 3FTPA 4NMHA 5JMWA 5HTOA 3OJLA 2V6GA 1U2GA 4WLVA 4YB8A 4DLBA 4OSPA 1Y6JA 3PTZA 3K92A 1EFLA 5C7OO 2D0IA 2J3HA 1RKXA 3IJPA 3RASA 1QYXA 3WB9A 3EK2A 1KVQA 5A5EA 4TVBA 2HK9A 1P9LA 3WFJA 1SEPA 2IEDA 1ISIA 2HU2A 3UICA 4YJGA 3NEPX 4UUOA 1QYWA 2W4QA 3ZWMA 4CLOA 3AUTA 2WYVA 3DTTA 2XPCA 2AE1A 4JROA 3VTZA 1QYVA 2EG9A 4BKPA 4BL5A 4FN4A 1U3TA 3PGXA 5AXAA 4D3SA 4YACA 4D45A 4TZTA 1EEHA 1ZK4A 1NBOA 2PZJA 3VKVA 1XQ6A 1I36A 3CTMA 4U0KA 2GN8A 3ANMA 3ANLA 3R6DA 2DFDA 1ZEJA 4C7KA 1PL7A 4XZ3A 5FEUA 2BI7A 4EZBA 1JKIA 1LNQA 5A9SB 4BNUA 1SPXA 4XJSA 1KC3A 1N7GA 1ONOA 4B79A 3GLQA 1UUFA 2PKQO 3F6YA 3IQDB 2Q2VA 4Z6KA 5MGBA 2QW8A 1XHLA 3H9QA 1ZEMA 2Q49A 5FF9A 1DC4A 3DR3A 4EW6A 2GSDA 1MLDA 5TNXA 4PG8A 5K0ZA 4XQGA 4P4GA 1JKFA 1NR1A 3OIDA 1ISMA 4RLSA 1WLYA 3EDMA 1HYHA 3IUPA 5CAEA 3QLJA 4YCAA 4CM1A 4FDAA 1KVUA 3JYQA 3D5QA 4NQZA 3ZW9A 3VDRA 5TT0A 3DOOA 4F3YA 4F45A 4E6PA 4PIVA 3Q9UA 4XYLA 1WDKA 3DO5A 3VVBA 3GRPA 1Q7CA 1WPQA 3NDJA 4XGIA 4FFPA 1C14A 3HADA 5JYEA 2PFGA 1AXEA 4W9NC 5ADHA 5KTKA 4XRRA 1U9JA 4W7HA 4IDFA 1GYPA 4K1LA 4CM9A 4CQMD 1I30A 2O4CA 2AQ8A 1PJ3A 3BMCA 1U2DA 1D4FA 5A3VA 2EKQA 3IC5A 3KYBA 3KSZO 5G4KA 1I5RA 4FGSA 5TC4A 4DPLA 4R1UA 4HX5A 3UGKA 5K6AC 1C1XA 4ALJA 1DFIA 3I52A 3LSYA 1U1IA 4UREA 1N1GA 3DBLB 3STHA 1SAYA 3K8ZA 3OM9A 4YXFA 4U6QA 1CDOA 3I6IA 5I7SA 5A05A 2UUOA 4QXMA 1L1FA 3RJ9A 5KJ6A 1EZ4A 1MFZA 1NP3A 1WMBA 2DQ4A 4IXTA 5ES3A 4NK5A 1UDAA 1B26A 4UVGA 1YXMA 4Z9XA 2Q4EA 3DFUA 3E5RA 3NJ8A 2QRKA 1KEUA 3ABIA 1P45A 1Y8RB 4WOJA 3MOIA 2Y05A 1E6UA 3VH1A 5GZ6A 3GHYA 4KQWA 4R1NA 3B6ZA 1XEAA 2FWMX 1ZMOA 3D1LA 1LA2A 3U9LA 3H4VA 2WM3A 4FJ0A 1QV6A 4CLHA 4R69A 2BD0A 3ETGA 3TPCA 4NBWA 3GT0A 5BQFA 1X15A 3S2EA 1NVMB 2P9CA 5KVVA 5K9ZA 1YBAA 1HE2A 2EP7A 1NNUA 1TLTA 3I9KA 4GSKA 3VPFA 4BNXA 4INAA 2NU8A 3F5SA 3ONDA 4WNCA 2EKPA 4UULA 4FJ2A 3HDHA 2RH8A 3KVOA 2J6IA 2Q1WA 3AOEC 4AJIA 1BXGB 3C7AA 4L76A 4NI5A 3W6UA 5JE8A 4QQRA 3EZYA 1YOVB 2EV9A 3ZHXA 4KQXA 4CM9D 4DMMA 3ZZNA 3QVSA 1ULUA 4RVFA 4BNFA 2ZYDA 4RQTA 1NPYA 2WTBA 4BO9A 2TMDA 3ENNA 4DIOA 4B8WA 1YO6A 2NLOA 1F12A 4XRGA 1H9AA 1Q0HA 1E7MA 1GY8A 1KOLA 3JD1A 3D4OA 4GVLA 4WUVA 3Q9NA 3WBBA 3VPXA 4FPXA 2W2KB 1B2LA 2OBYA 1X0VA 1VL0A 2EERA 3KRTA 4PRLA 2B4TO 1ZBQA 4E2ZA 3LQFA 2RCYA 4UEOA 3PQEA 1AHHA 1Z75A 2YFQA 3RWBA 3G3EA 1GYRA 5U4QA 2PD4A 2HMTA 4ONEA 4CUJA 4DVJA 3PI7A 1E3IA 1P33A 5JLAA 3CH6A 3WGGA 2FR0A 1ENPA 1O0SA 2WD7A 4B8ZA 5JDCA 2EF1A 3SEFA 1HLDA 1DC6A 2B37A 5ILOA 4ZICA 3I4FA 3V1YA 2PZLA 4L74A 2PA3A 1PJLA 4FS3A 1PJCA 3INGA 2IYOA 4AJ4A 2JCXA 1E77A 3PYMA 1VSVA 1UR5A 3PGJA 4IXWA 5G2OA 1C0KA 3E1KA 4K26A 1DAPA 4ND3A 4D79A 3QWAA 5T8KA 1OMOA 1H6BA 5TLSA 1WNTA 4YAIA 5HBRA 1GQQA 1MB4A 4AJ2A 5U9CA 1PZFA 3PIDA 4WCFA 1W0CA 2XXBA 5G0SA 1HT0A 4D43A 2X22A 3GRKA 3AW9A 1K2WA 2PLAA 3MTJA 3DL2A 4D42A 3G1UA 5DDIP 1N5DA 4J16A 2JD0A 4BO1A 5AXBA 4CMKA 1MGOA 1SC6A 2W2LA 3I3OA 1K0UA 1OFGA 3ADPA 2CFCA 1KYQA 3ZNOA 4RF2A 3PWSA 4FB5A 4MVJG 1Y7TA 1A9YA 1I33A 3PHJA 1PQPA 4J4HA 4E5YA 5A1TA 5AYVA 2PKQP 4BO5A 4BO3A 2VHVA 4H3VA 1DFHA 1P3DA 5I8ZA 1HXHA 3DMYA 4IDDA 2NU7A 4FOOA 4KZPA 3I9OA 1TEHA 2ZJ0A 3PLNA 4BO2A 1Z7BA 3DZHA 3OJEA 2JAHA 4Y98A 2A35A 4J7XA 3TF5A 4WLOA 4Y6RA 8LDHA 5L4LA 2PY6A 3OBBA 3MJ4A 4MP3A 1V8BA 3HDJA 1YWGO 2HAEA 3I9MA 1X7HA 4WEOA 3WMXA 1MG5A 1DHTA 4YRDA 2V6BA 1Y5MA 4IBOA 2GRAA 1O95A 2V6FA 4HFMA 4YQZA 1EK5A 1U5AA 1P74A 4KDFA 2Y1DA 4BHTA 1YB1A 2DBZA 3WMWA 4ZHSA 2PWZA 3HB4X 4RVUA 3IS3A 4IUYA 2POQX 2BFOA 3H2SA 3KB6A 4P4LA 4R1SA 4CQLB 1UAGA 5EQFA 4ZD6A 4CR7A 3LC2O 1E1MA 4TKLA 3TZKA 1I10A 2VUTA 4J4TA 3RFXA 1Z82A 1U5CA 1ADCA 1AHIA 3AFMA 3NT4A 3DC2A 1VC2A 3WICA 1S6YA 1SEVA 2EP5A 2QZ9A 2ZB8A 2IE0A 4LMRA 4LRSB 3LF1A 1ZFNA 3O4RA 5GMOA 3ZW8A 4BNKA 2HRBA 1ZK0A 1W8DA 4FOSA 5EJ2A 5HS6A 2ZTMA 1C0LA 4W99A 1PGPA 2IODA 5A9RA 3VC7A 3VPGA 4JBIA 3ZWVA 3ZDFA 2W90A 4IJUA 4GVXA 3OMLA 4I9HA 1J0XO 2Y1EA 3RI3A 1PGNA 4TRJA 2DBQA 3VPSA 2CF5A 3OEYA 3QIVA 3VH3A 2I66A 4BNMA 2X1HA 3PQDA 3KYCB 2VZ8A 5JAZA 3VZRA 3DZBA 4RF5A 2ZJ1A 1R0LA 1PZGA 1WDLA 3OETA 5TT1A 1RYEA 1KVSA 2C07A 2VT3A 2UV8A 4Z9FA 1B8VA 2CNBA 3WSVA 4MP8A 2AEJA 4RPJA 4IMRA 2VUUA 2Q4BA 4DPMA 3NGLA 4E2XA 3GG9A 1FMCA 3VAZA 5B4UA 1YONA 1HYEA 3DBLA 2XXJA 1ZCJA 3QWIA 2GNAA 1D3AA 3NT5A 2HJRA 4ND5A 2HSDA 1BWSA 1D8AA 1UXHA 2V65A 5JC1A 3PJGA 3SC6A 3GGOA 3HN7A 3AM4A 3CZMA 1PGJA 1AXGA 1ZKMA 1FDUA 1TT7A 4CM6A 3JQBC 2FOIA 4HADA 3UCXA 3OSUA 2I3AA 5BSFA 4JK3A 3DB2A 4GQAA 4J0EA 3WNVA 1IB6A 3TL3A 1CQJA 3HHPA 5CDYA 1IHYA 2P4QA 4NBUA 5DULA 1XIVA 4A10A 3N58A 5C5IA 4GX5A 2C54A 4A26A 4LRTB 2CDCA 1SO8A 2GF2A 3AJRA 2HDHA 4MKZA 4OM8A 1RYDA 1V6AA 3MZ0A 5FI3A 4D44A 5A3JA 2VTEA 5AQ1A 7ADHA 1BXGA 3LDHA 2FP4A 1BVUA 1ENYA 1R12A 4G65A 4QTZA 1YOVA 3MEQA 4RORA 2P91A 4RO0A 1D1TA 1QKIA 2D59A 4MVJE 1FDWA 1XCBA 3GC6A 4ALKA 3QWHA 3HJAA 5IDXA 1N92A 2WE7A 4N18A 1B8UA 1Q1NA 2DFVA 5ICSA 2AE2A 3ZU4A 4DPKA 3FF4A 2ZTVA 4LVCA 1E1KA 4MKRA 1ISGA 4MOWA 1NFFA 3L4BA 3S2FA 3F3SA 4W6ZA 1GYQA 4JBHA 1HZJA 2A4KA 2H6EA 5GZ3A 1BG6A 4N5MA 3QW2A 1R15A 3IKTA 3O38A 4I5EA 4MJLA 2GGSA 1YRLA 4BGIA 1EE9A 1U4OA 1PJ4A 1R4MA 2UYYA 2E37A 1PL8A 2VN8A 5KWEA 2GCGA 1HDXA 3IP3A 1YH3A 3CPSA 4TMFA 4UAGA 1VPDA 4AFNA 3AUUA 4RJTA 5CG1A 2QZZA 4U5QA 4OGWA 3BTVA 4WK6A 4B4WA 4TZKA 1LLDA 4TWRA 1WAMA 2O3RA 4IJKA 3H3FA 3KSUA 4IM7A 1Z74A 2BRUA 2A94A 4FFRA 2VYND 4IQ8A 2Q3EA 5H82A 3BMCB 2QYSA 1GUYA 1VM6A 2G0TA 1A9ZA 1PQWA 1H2BA 1KERA 3F1LA 2W8ZA 4LMPA 3D5TA 2HUNA 2B0JA 1DIAA 3OFSA 4I5DA 1DC5A 2FZEA 3BZUA 5L40A 4KOAA 5COBA 4MVJD 4BB6A 5JDIA 2VYVD 1GU7A 5HA5A 1A7KA 1R4NB 3WLFA 5A5FA 5COQA 1JDJA 1YBVA 2V6MA 2IXBA 3KUXA 2GPTA 5HWSA 5G0VA 5DNAA 4KUHA 3PHLA 1CF2O 1KEPA 1CEQA 1DRUA 4RGBA 4IDGA 1HSZA 1G0NA 5KCZA 3TZQA 4E2WA 1IZ0A 5LDHA 2B5WA 1UP4A 3WG9A 3SLKA 4XR4A 2VRCA 4PCVA 4G5HA 3EVNA 4DREA 2C7GA 4RVGA 1SCUA 3KM0A 4RDHA 1YL6A 2JAPA 2VWHA 2DTDA 5TF4A 3EVTA 2Y1FA 3CXRA 4EUEA 4QFCA 4QO7A 2FR8A 3Q2KA 2J5RA 1GQYA 1OBFO 3LZ6A 3GAZA 5A03A 2Q1TA 5L51A 1T24A 3JQFA 4A27A 4ZJUA 1HLPA 1NFQA 2JD1A 2E4AA 5EESA 2DBVO 3PJEA 4ND4A 3RUDA 3JD2A 4NIMA 1YB5A 1LTHR 3EMKA 3BTUA 1HF3A 2CY0A 3K2EA 3CINA 4D7AA 1KS9A 4Y6PA 4J1TA 3AY7A 3C85A 4I5GA 2O3SA 4Z0HO 5KKAA 4CMIB 4ZQBA 5DN9A 1E6EA 1BW9B 3JQ7A 3RROA 3QVOA 3I9JA 2A92A 4NJMB 4PVCA 1P31A 4BO7A 2X6TA 3UF0A 2I65A 3DHYA 1U28A 4A03A 2IZ0A 1VL8A 4AJEA 3OH8A 3OQ6A 4J9VA 2JFFA 1NHWA 3WGHA 1LC3A 1T2EA 3JYLA 2EEZA 4J3FA 1XELA 4D3FA 3BTSA 1MC5A 2YDXA 5IZ4A 1PGQA 3AUSA 1YS4A 3BHIA 1E7RA 1J49A 1Q2XA 2NNLD 4U6SA 4E4YA 3GPDG 3E8XA 4M86A 4WLEA 3ROQA 4RPHA 1ID1A 2GASA 1EMDA 3PQFA 1PZHA 5EERA 3FHLA 3NTRA 4YQYA 2O4UX 4XWYA 2WD7B 2XOXA 2VHXA 1GV0A 2PV7A 3H9JA 5CP8A 1C3VA 3AK4A 5DBIA 4RVDA 1EFKA 2I76A 2FSVA 5IG2A 3H8VA 4GMGA 2EGHA 2YUTA 4M54A 5BNFA 3TDKA 3TJRA 2HO5A 3KYCA 1F0YA 1KETA 4MIOA 5ITWA 4RZIA 2C5AA 1LDBA 4BNZA 4JNKA 1X1EA 4WCFB 1I24A 3KSDO 4ALMA 4J1QA 1PL6A 1T1SA 1PJSA 3AFNA 1E5QA 4KUGA 5ILGA 4MO2A 4BKQA 2HKIA 4HFJA 2E6UX 2O3TA 3DMTA 2FR1A 4L0QA 4OHUA 2WJPA 4BNYA 2GZ1A 1E3WA 4LISA 2CVOA 3RC2A 3KHUA 3SJ7A 3ZHZA 1PTJA 1WP4A 3NJ4A 1MFPA 3MOGA 4KP7A 4NU5A 1WWKA 4YAGA 3PP8A 2YY7A 2EXXA 2DT5A 4Z9YA 4KTTE 5CDTA 4BOYA 1QP8A 4WLNA 2ET6A 3DBVO 3P7MA 3WJAA 1V3TA 3HUDA 3WJ7A 1B3BA 1LI4A 2X58A 3T7EA 1P1JA 3QHAA 1DO8A 2O3UA 3AY6A 5ENDA 5FFFA 4BNWA 2CVQA 2X5KO 5F1PA 1M67A 1EVIA 2WSBA 4YPOA 1R37A 4XQ9A 3RUEA 5KOIA 3GVCA 1PX0A 3IUSA 4DGSA 2O48X 3BMQB 3IAHA 4FFMA 4YT2A 4LW8A 1E3LA 2IYPA 4XIJA 3U3XA 1XYGA 2I6TA 1JW9B 2ZQZA 1DLIA 4I9UA 1CQIA 4Y6SA 1JU9A 5T5QA 3I83A 4PG6A 1ZXLA 3I6QA 1ZSVA 3GVXA 2FHSA 1SB9A 2QRLA 1F8FA 3RFTA 5I7FA 3UH1A 3NDIA 3VH4A 1K3TA 3WS7A 3MJEA 5L53A 3WQQA 2NWQA 1GCOA 5KVQA 3E03A 3WSWA 4ZN6A 2DUWA 5JDCC 2SCUA 4B3IA 1DFGA 4AJJA 3RBZA 3ZH2A 1LU9A 4E5MA 4Y8VA 2CUKA 3VZSA 5IF3A 1E3EA 1LRJA 3FNGA 1NQ5A 4HV4A 4DBVO 2PGJA 2G5CA 2WE8A 2RHCA 3UUWA 1E6WA 2C7VA 5DCYA 5IDYA 4RF3A 3MJSA 3WDSA 5T8KC 1ORRA 4W4TA 4NJOA 1N7HA 2NACA 1H93A 2WMDA 1L7DA 2P5UA 4JP2A 3INTA 2CD9A 3CKYA 5A04A 4FFNA 3O8QB 4GKVA 4IJVA 3RU7A 3V8BA 1QMGA 3EGOA 3KO8A 1H94A 5EPOA 2EW8A 4IS3A 3WX0A 2DBRA 2JHFA 3A1NA 1LC0A 1E3JA 2G82A 4NH4A 3SC4A 1QV7A 5A06A 3WIDA 4NZ9A 4MPDA 3JD4A 4A0SA 1E3SA 3FWNA 4PLHA 1C1DB 1FJHA 1LRKA 3DHEA 1R4NA 3UAGA 2OBNA 5H81A 2D5CA 2VNAA 4OXNA 4CLRB 1B7GO 5L4NA 3E9MA 3W8FA 2O7SA 3GH3A 4GL4A 3QWBA 1PJBA 4XYMA 4Q3DA 4M1QA 2HLPA 4B7CA 2YYYA 1DOHA 5CPFA 5TSDA 4YYZA 3TFOA 1LUAA 2X9VA 4WASA 4FIZA 1A27A 1LEHA 1XWFA 4YT5A 3VKUA 4CR6A 5EIOA 3VPHA 2BFPA 1YDEA 4GH5A 4II2A 3ZV6A 3QY9A 1ZIDA 1X7DA 4RZHA 4L75A 3D4PA 2ZATA 5KNLA 4A73A 4NBVA 1J4AA 1QLHA 2R00A 2EHDA 3LU1A 2D5AA 1MA0A 3KTDA 4BNHA 4F46A 3QVXA 4JJFA 4GKBA 1PQUA 5JPIA 3QSGA 1GL3A 2F1KA 4XKJA 1E92A 4C7JA 2LDXA 3O26A 4J43A 1DHRA 3F46A 5TJ9A 1M75A 3RVDA 3KEQA 3NDRA 3DWFA 5JAIA 3JQGB 1XQ1A 4FR5A 1QLJA 3PWKA 2Q99A 4DC0A 3WOHA 3EW7A 4UUMA 1O5IA 1BRMA 1ZO8A 2AXQA 3DXFA 3GVIA 4N5LA 3GPIA 4E13A 2WYUA 3EYWA 3K2BA 3AI3A 4XIYA 3RAJA 1D7OA 2YV1A 3DOCA 1F8GA 4R41A 2JCYA 2ZTUA 4CMIA 2V7PA 3EUWA 1KIFA 1YGYA 2Z95A 1U7HA 4PLFA 4Q3AA 4RVSA 1BW9A 5JNLA 4E5PA 1A4UA 1JVSA 3FR7A 1L7EA 1YQXA 4NJMA 3ITDA 1VI2A 4X54A 4BV9A 3WIEA 3E5MA 4W82A 5BSGA 5KVCA 5JW6A 1DPGA 5KJ1A 4XEHA 3R3SA 3MWEB 4LSMA 3PJDA 3RUFA 1HYGA 1HL3A 2Y93A 4ZQFA 4QSMA 2GYYA 1LDGA 1HRDA 4MP6A 3G49A 2H63A 3ZWAA 3C7DB 3WGZA 3ZN2A 1BTOA 4MVJP 3RD5A 1ZNQO 3LT2A 4IIUA 2VRBA 1R4MB 5ENVA 2C2YA 4H7PA 3F4LA 4BUCA 3I4CA 1NTOA 1NR7A 1V0JA 1ENOA 2HK8A 3PEFA 2ZTLA 3TOXA 3V1TC 2FPGA 3HG7A 5CEEA 3ENKA 4MVJF 1RM3A 2PGDA 4GI2A 4B7UA 1ARZA 5BNIA 4B4VA 3RUIA 1ISHA 3DHNA 1NX6A 3C1TA 2PGLA 4IPTA 5F1KA 2FMUA 2YW9A 4AVYA 4AJOA 3GDFA 4L9RA 3GUCA 4E5KA 1JWAB 3WQSB 4DLAA 4UEKA 4A7PA 1B16A 5GZ1A 2W98A 1GR0A 3A14A 3SBOA 2J3JA 1PWXA 1YL5A 2ZQYA 4XQEA 2UVDA 2O50A 2B35A 4OSOA 3ZU5A 3V2UA 3PZBA 3B70A 4CV0A 4YJHB 4QEDA 3IOYA 4G81A 1K5HA 2QHXA 1B3RA 1PS8A 2BFAA 3CUKA 2RH4A 2VOEA 4BKRA 1O8CA 1U3VA 1EDZA 4J7UA 2BMAA 3GNQA 1A71A 4XB1A 4YDRA 4AJNA 3CMCO 4OOFA 3G1TA 4R1TA 4IMPA 4R16A 4CV2A 1OI7A 5JSFA 3E18A 4EEZA 4ILKA 4E33A 3FNFA 3L77A 9LDTA 3OF2A 5AXDA 1PU2A 1FXSA 4OXYA 1NVTA 3C7CB 3ITKA 2BELA 4J2OA 4EI2A 5C7LO 1JKJA 1LXCA 2XF8A 3WGQA 3BMQA 1P1KA 3JQ9A 2P5YA 4PGFA 3RKUA 2BLLA 3L4SO 1OC2A 3PXXA 2Y1GA 3L0DA 3GK3A 5JY1A 1T2DA 3CSDA 2OO5A 4H16A 1Y5RA 3RUCA 1M66A 4YR9A 3TNLA 5AVOA 5COAA 3RC7A 3K30A 2X86A 1BDMA 5JYDA 1ZJZA 3JQ7B 1PGOA 2R6JA 4J1NA 4RVHA 1K6XA 5LDGA 3ZGYA 3RSHA 1T1RA 3DTYA 3GEGA 2A9FA 3DQPA 4RPGA 5IZCA 5JBIA 4E12A 2B36A 2GR9A 3VVCA 4E32A 3PK0A 4M49A 3VZQA 3LT1A 2H9IA 3F1KA 3L07A 4LCJA 3QRWA 1DXYA 3K6JA 2W2LD 1B15A 1MUUA 2Y0DA 1Y9AA 1MX3A 2OHXA 3K5PA 3T4XA 1LLCA 4R68A 5JCJA 4AL4A 2AA3A 3K9QO 3RQSA 3NV9A 4D46A 3ZV4A 3JTMA 3PHIA 2HMSA 4OMUA 5I9MA 3HZZA 2DUUA 3IKVA 5L7WA 2X0RA 3ROKA 3QWFA 4HNHA 5L95A 5CEFA 3ON5A 2C29D 1HDYA 4L4RA 3OJFA 4A5OA 4ZQGA 1LQUA 3MTGA 1RWBA 4YRBA 3O8QA 4I8XA 2CF6A 4ALNA 4E3ZA 3GGGA 4BB5A 3F5QA 3X2EA 4ZRNA 1QXSA 5CG2A 3LC1O 1CIVA 4OXKA 2I9PA 5TJHA 4J6FA 1VKNA 2HRZA 4O1MA 4FGWA 1C1DA 4I9NA 5TS3A 3GOHA 1YJQA 3IDSA 3PYLA 4R3WA 3TRIA 2YHIB 2ZB7A 1UZNA 1ULSA 4ND1A 2YDYA 1E3WB 4CR8A 4UUPA 3E6AA 4XGNA 2G17A 4CLRA 2VQ3A 4XYBA 4O0LA 3S1LA 3ORFA 3JQFC 2HQ1A 3GA0A 3WQRA 4NFHA 4PLZA 4YJDA 1ADFA 2DAPA 3GDGA 1TB4A 3K31A 4FD3A 4PZCA 4CM8B 2B83A 5U1PA 1P0FA 3B1KA 4J49A 3GDOA 3TN7A 4Q3CA 4DYVA 3QE3A 4XX0A 1PZEA 3IP1A 4M55A 3HDYA 1SMKA 3JQEA 4HFRA 2E48A 1E7SA 3PWZA 4WEQA 4OOEA 4DRYA 3EY4A 1ZH8A 1R0SA 4N7RA 4HWKA 2EJWA 3ICPA 4WLFA 3MJTA 4GX2A 3DDNA 4D0SA 1R6DA 1YVEI 3JQCA 3H5RA 2GDZA 3AM3A 3MWDB 4CV1A 2X8LA 1A72A 2UUPA 1P44A 2D1YA 5T64A 1GCUA 4CM5A 4B4UA 3JQGA 2J3KA 1EVZA 2DU8A 2E49A 1QRRA 2PH3A 5BSEA 4PG7A 4J4BA 4CQMB 4BMSA 3BHMA 3ETEA 3WBFA 4OIMA 3GEDA 1BXZA 1NQAO 1PR9A 1GZ3A 4RDIA 4UVEA 3INRA 1P77A 3M2TA 2HMUA 3S8MA 4DQXA 1DRWA 4N54A 4UVDA 1YQGA 5DCUA 1WXDA 1VJ0A 1BVRA 5LC1A 2HCTA 1E1LA 3O03A 4RPLA 4TQGA 4BO8A 3RUAA 3U09A 2C20A 3WWZA 5G4LA 4OAQA 2CMDA 5AOVA 5JC8A 3DAFA 2IEBA 1N2SA 2PK3A 3ZWXA 1BMDA 1R16A 3OP4A 2BKAA 5AXCA 4RPKA 4BO0A 4LSWA 1IULA 1NQTA 4FFLA 5FWNA 4XJTA 4E30A 2NUAA 4IS2A 3ZWCA 1H6DA 4IJWA 3RIHA 3DAGA 4KWIA 4CJXA 3V2GA 4BVAA 1PS9A 4QECA 1GADO 3UVEA 3GVPA 1X1TA 3ZHYA 3X2FA 1MC4A 4K9DA 4GAEA 4IY1A 1JWBB 3G17A 3KZVA 1HEUA 4Z0TA 3RBVA 3WGYA 1I01A 3DZFA 5MDHA 4C4OA 1H9BA 1NHGA 1XG5A 3ONFA 6ADHA 1T4BA 1ZK2A 4GX0A 4BNGA 5THKA 1SZJG 4CODB 1IUKA 1TI7A 3GZNB 2GERA 1NVGA 2I99A 4ND2A 4P4NA 4YJHA 4ALIA 2ZB3A 1FDVA 1EVYA 2VWQA 1LDNA 2GZ3A 5EMHA 5BNTA 3ZNQA 5HRUA 1GZ6A 2CZCA 3C1OA 2OORA 3FWZA 4NFSA 3ULKA 2Q1UA 4YT8A 4TRNA 4ALLA 4K28A 4XB2A 4YVFA 1J5PA 3RKRA 4OKIA 2O7QA 4LVUA 4ZA2A 1GUFA 3L9WA 2JL1A 4J90A 4QO8A 4RV9A 1XR3A 3HFGA 1EUDA 4YWJA 1T2CA 1JA9A 1M6WA 4CMEA 2BGLA 3RCBA 4RLHA 4OJNA 2FRDA 2DLDA 4LK3A 1DB3A 2WWRA 3D7LA 1MXHA 1ISJA 3W1VA 1GZ4A 3ZWPA 1UH5A 3OEWA 1JTVA 4DL9A 4U7WA 3KEOA 1FDSA 3RU9A 2BI8A 3E9QA 4AJLA 2UDPA 4YRAA 1E5LA 2WEKA 3GMSA 4BS9A 3PFFA 3ZHBA 3GN1A 5C37A 1BDBA 2X5OA 3H5NA 3L6EA 3DEYX 4CM4A 4DQUA 4DYDA 1UXGA 1IY8A 3G79A 1XU9A 1QSGA 3JYOA 3JQBA 2OP1A 1R66A 4TKMA 2HJSA 1UXJA 2VZ0A 4XDZA 5T57A 3NKLA 3H5AA 3L9XA 4JLWA 5L3ZA 1FK8A 2JJYA 1IL0A 1DLJA 4PLCA 5ER9A 3TOZA 4BGUA 3U0BA 5IXSA 5B12A 5JCXA 4CV3A 1IPFA 1GD1O 4L8VA 2RAFA 3GMDA 4B7XA 3WYEA 4B3HA 2H5LA 2J8ZA 3BIOA 2CDBA 2VHWA 1VL6A 5TQVA 3EC7A 3P5SA 3LT4A 4BKOA 2YJZA 3W4KA 2EGGA 4HY3A 3F4BA 2YQ4A 3EHEA 4PLVA 5JMPA 4PLTA 1B8PA 1GPJA 1X0XA 3WYCA 5L4SA 1EBUA 2VRCD 3ASVA 3PJFA 2Y0CA 1I3MA 5ER6A 5F5NA 5KKCA 4PZEA 3AU9A 2O3JA 4NBTA 1U3WA 4PFJA 2I3GA 3I5MA 3D3WB 5LCXA 1ADGA 4KUEA 1PJQA 2Q45A 1DJNA 2Z1MA 3ADOA 4R54A 2Y1CA 3M1LA 4PLGA 4M89A 4XCVA 4CLXA 4TRRA 4JXKA 2VUSA 2OP0A 1GAEO 1ZK1A 3FNEA 1H2HA 4ROSA 4NPCA 1CWUA 4EDFA 4TVOA 2Y99A 2C2XA 1YL7A 1NFRA 5A9TA 1MG0A 1BSVA 1NYTA 1OOEA 5I9LA 2PD3A 2R00C 2YHIA 4OH1A 2FPIA 4TSKA 1W4ZA 5FI5A 2GN4A 2YV3A 3LLVA 2X9GA 5GY7A 3AOGA 2ZB4A 1J6UA 1OAAA 2X5JO 4W7IA 4BO4A 1P1FA 4QT0A 5IN4A 3W4IA 1ZW1A 5HS4A 4XR9A 5DBGA 3VOSA 4JP3A 2WYWA 1SOWA 1YJ8A 2JFGA 3LLSA 4YTEA 2X0IA 3H9UA 4CM8A 4OO3A 2LDBA 3VTFA 4K6FA 4BIIA 1I2CA 4ESOA 1KEWA 3VHRA 5IJZA 3ZWNA 2PH5A 1UAYA 2E82A 2C0CA 3OQBA 1UP6A 2G1UA 3KETA 4AJ1A 4MDHA 1UZMA 4EJMA 1JVBA 1O6ZA 2D8AA 4RQUA 3UOGA 2VT2A 1NAHA 2X23A 2Y68A 4WKGA 3BAZA 5IDQA 1ZUD1 1HDRA 1EUZA 2J3IA 4EUHA 1PEDA 1VE9A 4Y67A 3W6ZA 4HFNA 2VZ9A 1Q0QA 1ZJYA 2X9NA 3KBOA 3ETDA 4DXHA 1BHSA 4G2NA 4I08A 1JLLA 3R3JA 1VJ1A 2ZKLA 3BMNB 3P2YA 4EGFA 2DPGA 3FR8A 4IQ0A 4CL8A 4NDNE 4PG4A 4O6VA 3Q2IA 5CDUA 2O23A 1O94A 4CQMA 1HE4A 1O9BA 1XGKA 4JX8A 3ONEA 5F21A 2OL4A 1ML3A 2PZKA 5DP1A 3WTCA 3V2HA 3HNPA 5CHEA 1GEGA 1XKQA 1VKOA 1C0PA 2JD2A 4IZIA 4XD2A 3ZNNA 5KJCA 5KVSA 1HE3A 3UN1A 4GMFA 5KJFA 3C1AA 4JBGA 5EINA 5BT9A 3KLMX 4J7CA 3FBTA 3PZRA 2H1SA 3LK7A 4NNJA 1Y8QA 3RFVA 4URFA 3MJCA 3HB5X 4GLOA 1YE3A 1DSSG 2JKVA 4R5HA 1K6IA 3HE3A 1YBMA 4EUFA 4Z3KA 5I7EA 1BXKA 3FI9A 3KXDA 4WCFC 1PR3A 4FCCA 1X7GA 1CYDA 1NPTO 3DBHB 4IDAA 1QR6A 3DBRB 2WDZA 4IDEA 2WD8A 1N1EA 1VSUA 3QVTA 5L45A 4Z3DA 2I5PO 4R9SA 5DOVA 3FPCA 1SNYA 2QRJA 3NAQA 1IHXA 3H65A 1PJ2A 3H2ZA 3AUAA 3BHJA 1LLUA 3U4IA 3H9EO 2RBEA 2FPPA 2O2YA 1G0OA 3Q6IA 4JJGA 4WPGA 1JQBA 1DIGA 3CE6A 4ITUA 4UUNA 1HDOA 2ZYAA 1UJMA 4XYEA 2OFPA 3SXPA 2D3TA 4E31A 2BGKA 2BHLA 1DC3A 5JAMA 3GZNA 5TIIA 2FSSA 1W6UA 3H6KA 3ROMA 4AJHA 4QFDA 3WGTA 3SJUA 4BNIA 3WGOA 5F1OA 2F00A 3DONA 4IDBA 2AG8A 4UVIA 1N8KA 1X13A 1JAYA 1DRVA 1N9GB 4MKXA 4FC6A 3KYDB 1WMAA 4QUKA 3JQ9C 4MINA 4OKNA 1VLLA 3GEMA 4CM3A 4AICA 4PVDA 3TZCA 3OICA 2D2IA 3EAGA 3FPLA 1LLQA 3GY0A 4GLLA 4HBGA 2GUGA 3Q0EA 5L7TA 1WW8A 2AW5A 3OA2A 4JN6B 3S2GA 1K89A 4CMGA 3HSKA 1KBZA 4WECA 1KC1A 4NR0A 4OQYA 2BFMA 2VHYA 2P9GA 1TT5B 4GBJA 2P68A 1U3UA 2VNSA 5I9NA 5IZCC 3U62A 4PLPA 1QORA 4JJIA 1RM4A 3WWYA 1X14A 4EBFA 1YQDA 2DKNA 3TZHA 1XLTA 3ZWOA 3SX2A 3F9IA 3LYLA 2VOJA 5G0WA 1W73A 3GNSA 1V3UA 4J91A 1GDHA 4RCVA 4Y9DA 3DZJA 3FRJA 3D3EA 3QP9A 4PN3A 1ZVMA 1ENZA 4S1VA 3PDJA 1OC4A 4LGVA 4PLYA 5IAAA 3E9NA 2NVUB 2HMWA 3SVTA 4XYGA 1NWHA 2NSDA 3FD8A 5BSHA 3GN2A 1U8XX 5L9AA 2NV6A 4DA9A 3B1JA 5C3MA 4R3NA 2NTJA 2NTVA 1JAXA 1I32A 5KJEA 3ZU3A 3K73O 2AMFA 4BNTA 2CDAA 2ILTA 3I9NA 2HK7A 5A02A 3ROPA 2IXAA 4AJKA 2G76A 1HSOA 3GF4A 5J23A 3ZI0A 4F6LA 3MCVA 3M6IA 3D4NA 1Z7EA 4CMBA 4YAEA 3CIFA 4CL3A 1U8FO 4I5FA 4JCOA 1CERA 4XQCA 4DWVA 2NTNA 1IOLA 1M6HA 3AM5A 3D3WA 4M87A 4GWGA 3BYZA 2AEFA 3H7AA 5C7IO 1TXGA 3DAPA 1PS0A 1H6CA 3DFZA 4O59O 3U4CA 1EBFA 1ZSNA 2VCYA 3PFWO 4S3MA 3COSA 1AGNA 1G1AA 2Q46A 4MIYA 5BR7A 2BGMA 1XDWA 5THQA 4LN1A 3HFSA 2JFHA 3A9WA 4RL6A 2ZCVA 4NHEA 3ST7A 5DP2A 1DDOA 1ONNA 4MVJH 4II3A 1PIWA 1UDBA 2HMVA 3TSCA 3WR5A 1YDWA 3IL2A 3GFBA 1U4SA 4WGGA 2PZMA 5DOZA 3VH2A 4E21A 1XSEA 3S55A 4O5OA 3D64A 4ZRMA 1LJ8A 1CJCA 3LT0A 4J0FA 1E7YA 1KY5A 2R2GA 1H6AA 3O9ZA 4ID9A 1XU7A 4JIGA 1P1RA 3A4VA 5JAQA 5B4TA 2GZ2A 2BF7A 2B4QA 4W9NA 4E2YA 1ZZEA 4NK4A 3RJ5A 4DUPA 4YEDA 3RC9A 4CLEA 3DZIA 5B4VA 1GEEA 2AG5A 2NQ8A 1E1NA 1Z73A 4WLUA 1NQOA 3L6OO 2GO1A 4DLLA 2GN9A 1KEVA 1Q0LA 1LDMA 2NU9A 2JCVA 6LDHA 3LF2A 4IQGA 5A4DA 5CDSA 3QA9A 3GAFA 5DT9A 3N7UA 4J1SA 4WE3A 1ZMTA 3WGIA 4YJFB 1LSOA 2OMEA 5K6AA 5F5LA 4NFYA 1VRWA 2EIHA 4BMNA 3JQ8B 1EK6A 4FBGA 4NG5A 1LDEA 1I2ZA 2GLXA 4BO6A 4Z0PA 2NU6A 4EJ6A 2RIRA 3TZ6A 3L4BC 1OZAA 1JN0A 3BMNA 3UCFA 5IXYA 3ZWWA 2P4HX 4CM4B 3UHAA 2AQKA 4CMAA 1HTBA 3NTQA 2ZK7A 2QX7A 3OJOA 1NASA 2Y0EA 4BQRA 4P8RA 3TFQA 1LX6A 1M76A 4J2HA 4PLWA 1YB4A 4BNVA 3QQPA 4GX1A 1A4IA 4H15A 2X0NA 4E0BA 4PRKA 2YZ7A 4R51A 3K96A 3JQAB 1P1HA 3AI2A 3OA0A 4IINA 4ZVVA 5CDGA 1KY4A 4DQVA 1WVGA 2NVBA 3HDQA 3BMOB 1PWZA 1U7TA 3BA1A 1R0KA 4HKTA 1T2AA 3TQHA 5A9SA 4DC1A 1LSJA 5TRTA
chains in the Genus database with same CATH superfamily
1OYVA 3V1UA 1UZLA 3R7WA 4JT8A 3ZS9A 2AD5A 4O8CA 4E1BA 1LF0A 1MBZA 1VDZA 3C24A 3OCCA 4FZJA 5CTJA 2F3RA 3NHAA 4X6UA 1ZGGA 1Q7BA 3CF6R 3P2EA 1H85A 4Y1FA 1YFJA 2ACEA 2GXSA 1GN8A 1R18A 3G1WA 3WWEA 4EG4A 4RSGA 3A27A 2QX8A 1ORHA 2PANA 3HBFA 4WRRA 3W5AA 3C4VA 2I2WA 2P9EA 4HI0E 3JYPA 4GSLA 2IEIA 3TL2A 5LQUA 3U2QA 4CM7A 1IYZA 5KU1A 3DL7A 1F2UA 3LKZA 2A59A 4AF7A 3AWDA 1UC4B 4EI9A 4NFLA 4IRMA 4HNGA 2L17A 4ILEA 2AWNA 5BN4B 2IGTA 2J4CA 1OXTA 1RXEA 1V35A 2HTEA 2ZYTX 4OUDA 5GONA 2GCIA 1FTNA 5L3VA 3GFOA 2PJZA 2H0AA 2BFBB 3V8QA 3IAEA 1B4DA 2XRFA 2ZDQA 4EO7A 3ZX4A 4PHHA 121PA 3CX3A 5DCWA 1E20A 1JXMA 2Y1KA 1JDZA 1WKCA 3DMFA 2FPIB 1GU1A 4L4XA 1LSSA 1AUQA 1T2FA 4R2XA 2DTEA 3G5LA 2XXAB 5K3BA 1DJQA 10MHA 2PGXA 3G7UA 3NXSA 3PI6A 5BR8B 1Y33E 5LFAA 1QH1A 2IOYA 4MVJI 2EFHB 5U4XA 1I2BA 3B1FA 1JLRA 2BLNA 2C59A 2PD6A 3ESZA 4W5TA 3KAKA 1F06A 3BL6A 3L3BA 4N5NA 3T35A 1Z28A 2Y66A 4Z0NA 1GUZA 3T3DA 2LXNA 3OWXA 5FNZA 4XDYA 4DIFA 3SQDA 2CB9A 4WJZA 1MHTA 1EDEA 5I7VA 1KZ1A 1YQQA 4QJBA 2FN9A 3SWWA 1MXFA 1TQ6A 3BILA 4MWGA 2UAGA 4J1TC 5CH3A 3K9CA 4P3NA 1V1RA 4HB0A 2VLIA 3R44A 3F9CA 4MRPA 2NVOA 2BH9A 3F47A 5CCXA 3DE5X 1MJGA 5IAGA 3KOUA 1QQ5A 3DZGA 3LVFO 2V9PA 5B3JC 5IEJA 1IEQA 2YN4A 2OXRA 4RABA 4WNAA 2AG0A 3RVJA 3SS7X 1FNCA 1YJAA 2P11A 1RRKA 3GP5A 4HAXA 1Y8RA 1TT5A 2XGOA 4US1R 2MCFA 2P79A 1JE0A 3W2FA 2QTCA 5DTRA 4JT9A 5FP0A 3ERCA 2PZBA 4BUZA 4BQNA 3DWGA 3F7NA 4P7FA 1RI2A 2AL7A 4MUBA 1YA8A 3GZ4A 3H3JA 2EEPA 4P31A 2WFLA 5CGZA 4ZVOA 2PLRA 4RMNA 2KX7A 4TROA 2H5JA 5L3QB 1IEXA 1HDZA 4HXYA 1ZI9A 3MTAA 4YRFA 5AW6A 4ERXA 3T7CA 2VHEA 2LKDA 1MIOB 3L7LA 1ZLXA 2BKEA 3FSRA 4NBRA 1U4NA 1VMAA 1Z0ZA 2A9JA 3O1LA 1HWYA 1H5QA 5M04A 1IE3A 1U0BB 1GTVA 3PHGA 4OHCA 4PGMA 4IVNA 2IH2A 4E5NA 2G0NA 1JKMA 4GLBA 1B42A 3MJDA 1UXKA 3HYCA 2Z5FA 1UKCA 1J22A 3C4JA 3IJRA 2O2XA 1KDOA 2IUEA 2GJ8A 4DB4A 1UKAA 2YWBA 3E9RA 3CX8A 3I8SA 1Y1PA 2IYZA 4V0NA 2JPDA 2YCBA 3PDUA 3AUYA 1NWCA 3TG8A 2A9OA 4B4DA 2XVYA 5JZBA 1CNFA 2PKXA 2WHEA 2FGJA 4MLPA 2XTAA 1BQ4A 5G0UA 4BE9A 5LUAA 5MHTA 2XVZA 2QZ4A 3W3ZB 4Y0NA 4UEJA 1WULS 3EEFA 1G63A 2FXVA 2GX6A 3KOOA 4GGPA 4KMSA 3D02A 1NJ8A 1KK1A 2YXLA 3AY3A 4O1IA 1A5ZA 1X2BA 1IUPA 4BRSA 2ZS9A 2IP1A 3QU4A 1YHNA 4OQFA 2QTNA 2OOSA 4JP8A 5CAEB 4KDEA 2CVHA 1XU4A 3C3XA 1Y81A 1ZJ4A 1W87A 3ZX5A 1UBMS 1E9CA 1AMUA 2QTAA 5HP4A 3CSUA 1RM0A 5IN5A 4I6GA 1TKCA 2XAAA 2PNFA 1ECCA 3LHSA 4DWWA 5ICMA 4KQ1A 3Q88A 1MP0A 2DPHA 2GM3A 3AI1A 3B20A 5JG7A 5GOZA 4EG5A 2OCKA 3IHWA 4EVRA 5CLGA 3DXYA 1W2HA 3R9XA 4J9UE 3ZY3A 1C3JA 1C3OB 3JV7A 3LWNA 4EFMA 1JEAA 1PTKA 2V1UA 2WFMA 1NL3A 3EIUA 5FR1A 3GRZA 3NBQA 5JO9A 2DC1A 2RGRA 3LX5A 4LPSA 1C9MA 3AEKA 4FB4A 4F6RB 3ANNA 3H4TA 5L7YA 3RVLA 1AV6A 3JW8A 4AWAA 5TPWA 3OQ1A 4KTVE 5ALTA 2H06A 2QR5A 1DXOA 3GDWA 5FQOA 3RIYA 2RHRA 1J1UA 1EP1B 2PT9A 3GQVA 2ZCUA 4DLRA 2G63A 4QTXA 3QBVA 4U39A 1CS0B 1I3KA 3JQ6A 2J6CA 4DLUA 3TNJA 3I2JA 5LKAA 2H4WA 5CVCA 3ZWYA 2BHRA 2IOHA 2R7NA 4IIFA 2B99A 2HYIC 3LPCA 4D41A 5E6UA 2BEKA 5JS6A 1PT9A 2GK3A 1E9VA 3D7RA 4B7ZA 3WIUA 2B1QA 3HP4A 3PPVA 3V2IA 1E3MA 4X1OA 2VJMA 3V48A 4EMBA 5INTA 1T4DA 1HORA 2ATXA 3V34A 4CFYA 4QASA 1UDCA 4PF1A 3V8PA 3FCOA 3ZCXA 1VHTA 3HN2A 1E32A 1HZZA 2GD6A 1QGUB 1IHPA 1VCMA 4O63O 5ULLA 3QF4B 4BFYA 4DBZA 3D6AA 2I7CA 5D6OA 2WK1A 4M9ZA 2NZWA 5EIHA 1GPYA 1KVTA 4PYQA 1VCOA 1YUNA 1ABBA 3THWA 1GAQA 4E6EA 1HX7A 4G1VA 4Q15A 4R2MA 4BLRA 1GKUB 4QM7A 3SQWA 2QD5A 2VBGA 2YV5A 3L7MA 9LDBA 1QIDA 2P6RA 1KORA 2R8OA 2V5VA 4INZA 4Y2UA 3RC1A 2OAEA 2Q1SA 3C8MA 4Y2GA 4UBOA 2CCKA 2I67A 4HUJA 2PA0A 4F9GA 3QVWA 4B82A 1IAVA 1MAWA 1BOOA 3B1YA 4BMZA 3LY7A 1SVSA 2CV0A 4JR0A 1KPHA 3F5FA 4AJPA 4OD0A 1YRQA 3FTNA 4CKBA 3CEJA 5JAOA 3MGBA 3DCYA 1PEKE 1NLFA 4ZGWA 1N2EA 2VDLB 3TCXB 3JCZA 1JLMA 3R3WA 4HGRA 3W5BA 2ZULA 3QLTA 2C78A 2IL1A 1C0EA 3V5NA 4YT4A 4B4OA 1H42A 3FBGA 3FOCA 3ZQ4A 3II6X 2CNKA 1S3SA 2OGUA 4Y9TA 3T7SA 3VC3A 4ZTZB 1TVKA 1Y6FA 5JD4A 4RANA 3IMGA 3OT4A 2MINA 3WFIA 4KKVA 2A1UB 3FZEA 1G18A 3P19A 1P7VA 3VSAA 4PGGA 3UBMA 2B4AA 1PT8A 4RTJA 2CXSA 2YRWA 3F2VA 5EJAA 3TLGB 4LNUA 3TJZA 1HKUA 4MA0A 2BSXA 3T7AA 2FP3A 1MD9A 1SBYA 3OKCA 1UEIA 2CFTA 1VHWA 3CLSD 4FTWA 3U16A 3UPDA 4X24A 5AKIA 4ZGBA 2P9YA 2PH1A 1JALA 5K0LA 3T15A 5JYBA 1USIA 2WP0A 2WABA 2ZRNA 3D7NA 1R0CA 2P9FA 4R8RA 2JIOA 1ZK3A 1LBQA 2D3WA 1NNLA 4UQPA 5D84A 5HF6A 2NVWA 5KWJA 5HGJA 2VTBB 3U4QB 1NAIA 3ND8A 2RB4A 4MV9A 5EJMA 3O8OB 5SZHB 4AKHA 3T5TA 2ZYGA 1V47A 4RLFA 2RHLA 1JPJA 3BH0A 5K3AA 2ZUVA 3V4ZA 1EQUA 2QBYA 1I4EB 5DIFA 2OHJA 4CI0B 3FPGA 4FUTA 2FZWA 3V80A 3I6ZA 4Z1MD 4FDUA 4RKQA 5BWOA 4QRHA 4FBMA 4ZVUA 1G9SA 1NN5A 3FETA 3MHPA 4ZOEA 1SVWA 2DVMA 2GBLA 4NXMB 1TAUA 3NT2A 4F0JA 5K4HA 3MC1A 3WQHA 2QIOA 1C8KA 3OIGA 4FHDA 1E0JA 5CT8A 5KTRA 4FSHA 2IH4A 2KM1A 3AUXA 4MSUA 4NEHB 3BF7A 4N39A 3X2SA 4D8YA 1H4QA 2FMTA 1IG3A 3L0CA 3GFTA 5LN1A 1U63A 2AZTA 4C08A 3WHIA 1NMYA 1RJWA 3OO0A 2AFHB 1S0UA 3MCAA 4YAKA 4EJ2A 5J2TB 3NRCA 3A28A 4QU9A 2XIQA 1K68A 1BYUA 1WDMA 7MDHA 1G6HA 3A6GA 4IJ5A 4M8SA 4LXHA 5LWQA 2V6JA 5A7HA 1A5AB 1V71A 1WZIA 2PSDA 2IZ6A 3PRYA 4UU0A 2MMCA 3U81A 3T5AA 1JEYA 4HNUA 3M70A 3EQ8A 2AX4A 4NMHA 3HXKA 1NBIA 4D4LA 3FHOA 3AEUA 3AHIA 2FOLA 2V6GA 3COJA 1U2GA 4RK0A 1CSEE 1Y80A 1G8PA 3L8YA 1NVKA 3K70C 4OSPA 3WIOA 4X66B 5J4YA 4GQBA 1XPOA 1UFOA 2D0IA 5KWIA 3RASA 2PUVA 1KVQA 3EK2A 3I01M 2CV1A 4TVBA 1P9LA 5LJIA 2Z5GA 3MM4A 1TL7C 4AT1A 4JNCA 1RI1A 5ALPA 1H4VB 3VV2A 4WVLA 3PEUA 3RJTA 3TLCA 3USCS 2ENUA 3LRXA 4EQ6A 4UUOA 3FNQA 1VPTA 3CGWA 5AVRA 4V2UA 4ZZ0A 4ZIRB 2HSEA 4FI3F 1I7PA 1ZD8A 2WYVA 4IV8A 2NMVA 1NJGA 2AE1A 4JROA 4JJEA 4G5GA 3PRHA 1P0QA 5SYMA 1DTWA 4K9KA 3ESAA 1G20E 1QYVA 1LV7A 2EG9A 1BS9A 3EGIA 4GBED 4FN4A 1U3TA 1V2GA 3I9FA 3PGXA 4NBLA 2ACVA 3DBOB 5MN4A 1DPFA 2FPOA 1P2GA 2HK6A 5EE0A 4C4SA 5IYZA 2JFZA 4X90A 3D3NA 1QFXA 5JAPA 5IX8A 2DFDA 4P84A 1ZEJA 2OLEA 2PMBA 3MW8A 3R0VA 1PL7A 4ZVPA 4C7KA 1JEQA 4DB2A 2WA2A 1MO5A 1XMXA 4G1MB 3IBTA 4XZ3A 4Z4CA 4N3AA 3CG4A 3HRKA 1TYEB 1ACJA 2R8YA 2OV3A 2R4UA 5EIBD 5TR9A 1XALA 5A9SB 2LP4Y 4XJSA 2IS6A 1KC3A 2HIAA 4ZCMA 4AMVA 4JVSB 3GLQA 3BD9A 2PKQO 1W96A 3ZXSA 1DAHA 1F5SA 1SUPA 1SA0B 2HGSA 5EYPB 1RBYA 1UBCA 2Q2VA 3W5VA 4UNSA 5BQ3A 5HKKD 2H2FA 3OAAD 3FSGD 5HCUA 4Z6KA 1XHLA 2REOA 3IXLA 5FF9A 3UWSA 4BZQA 4ZHQB 1JIJA 5FDFA 2GSDA 2BHNA 4QAJA 3RT7A 2AFRA 4C78A 5EA2A 4Y2JA 1JKFA 3U7IA 3JQQA 1TRKA 2XMQA 4FI3C 1ESDA 5B2EA 5B57C 1XBTA 1SD5A 5EKDA 3SHTA 4J0JA 3HH8A 3VNQA 1JDPA 4FDAA 3JYQA 3BD8A 1QOZA 2IHKA 1G3IA 1XTPA 4C0HA 4I1OA 4F3YA 4E6PA 3Q9UA 3DO5A 4U9HS 2G1JA 4JC4A 5DRTA 5JXGA 3GRPA 2H11A 4AMUA 1TJ3A 4TGLA 4LWOA 2P9ZA 3VU1A 4WFKA 2X6RA 5FUMA 4M9RA 3QHQA 2XMGA 1FU7A 2ZI4A 3SFZA 1JUDA 2ZJAA 1U9JA 1RXCA 4JU8A 2GTPA 3DOFA 5K03A 4IDFA 3M82A 2A3NA 2R1UA 4YCNA 1QH1B 4KFTA 2PO5A 1O94D 4J0HA 1E6LA 3SZLA 1I30A 4CEJA 4EMUA 3SQMA 1YNOA 1PJ3A 1U2DA 2DFPA 2VJNA 3N76A 4KO2S 2E4XA 2EKQA 3UAYA 3IC5A 1Y3FE 3ZHOA 2ZBUA 3R0ZA 4FGSA 3MTQA 4R1UA 1AOXA 4JYZA 3I52A 3AILA 1U1IA 3LSYA 3T3GA 3K8ZA 4HQRA 4OQQA 3PUYA 3L93A 4UFOA 4BTVA 3DVAA 4U6QA 4CU5A 2RI0A 5C5CA 3I6IA 1V1RB 1DAEA 4KX3A 3LLCA 1Z6TA 4B9AA 3IVRA 1UKYA 2QQEA 3WL5A 5FJJA 2Q5FA 4L7VA 2BM8A 4RM2A 2OXEA 2R0QC 4ZODA 4OMCA 4PAGA 2QXYA 3FIUA 1EK0A 2AXPA 4HDKB 4PO3X 4O4HF 1UC5B 2IYXA 5TY0A 4QODA 1B26A 2N47A 1YXMA 3KAQA 1MQ8B 4MV3A 4JVMA 3L7AA 4TQUS 1Y8RB 4BP9A 3VH1A 3GHYA 5CYOA 5BVGB 4LJAA 1CUHA 2PZGA 5LP6F 1XEAA 4OREX 1WSAA 4DCVA 1LVUA 3DLPX 3HJFA 2QVZX 4C2BA 5KYTA 1QV6A 1KKUA 3H6GA 3V33A 1CQJB 2YXPX 1QHGA 4NNOA 3L6UA 4YFVA 1ZR4A 2ATCA 4GF5A 4D4MA 1OH5A 4Q9LA 3A1CA 1HE2A 2EP7A 1N6IA 1TLTA 3I9KA 3VPFA 4X64B 4BZPA 5JH7F 4TXLA 3WNCA 1YR8A 1R9GA 3ZE0B 1FBTA 1J1ZA 1R0ZA 3DW1X 3L6RA 3QKSA 2BGWA 3PNPA 3A3NA 3K09A 5B58T 4K9PA 2Q1WA 3J80A 1BXGB 2BE7A 1QH9A 3OIUA 4V0RA 3VR2D 4F8YA 2EP8A 4BY9E 1DAGA 2DBYA 2G8LA 4N3NA 4OMFG 3ZHXA 2JEZA 4K05A 1VBFA 4KQXA 5EZSA 3QVSA 4ISBA 3ZZNA 3GLIE 1IQ0A 1W47A 4RQTA 2WTBA 2X7XA 1KBOA 3R6WA 4X61A 4B8WA 1YO6A 3PNMA 4W5JA 3T3NA 2EZ8A 3VPDA 3Q15C 4XRGA 1NN3A 3MERA 3I04M 4KAFA 1BMTA 2IQIA 3ADKA 3OJXA 5KI6A 4K9RA 2FMHA 1DO2A 1ZA1A 3BHNA 2EW1A 3CE9A 1KOLA 4GVLA 2PTHA 4BDTA 3DE0X 3NBUA 4LXGA 1GGEA 5FOWA 3ECCA 1Q3KA 4Y1RA 4Y3UA 3V7UA 4AZSA 4CKCA 4N6GA 3VPXA 3I2FA 1G42A 1ESEA 1YR2A 3H0CA 4OCZA 4BEWA 1ZBDA 1UC9A 1VL0A 5FRDA 1KQNA 3WAKA 1YZGA 3AIMA 4KQCA 4E2ZA 1I6KA 1GCIA 1E1RD 5G53C 1ZIXA 5SYNA 4QJ3A 1WPGA 1UBJS 4OI1A 2Y77A 5JJBA 1I7DA 2IEGA 1BFUA 3IH5A 1J0DA 3RWBA 3RAEC 3G3EA 4EPWA 2D0PB 5KMGA 1BAPA 3GLKA 3H5WA 4I50F 4GEKA 4ONEA 4DVJA 3ZHSA 3PI7A 1U0HC 3PUHA 4Z4FA 1E3IA 1FX1A 3AC0A 3MRSA 5KTNA 1TJNA 1WB5A 2ZWMA 3HKDB 2J87A 4RGQA 3R7AA 4H35A 1DBSA 3SDSA 3SSOA 1ENPA 5JDCA 1AQIA 3L7CA 2EF1A 2I6FA 4JXXA 2QNIA 2AG6A 4FBLA 1YS2X 2ZROA 5REQA 3I4FA 5A4FS 4D8XA 3GLGB 2PZLA 1WZUA 5K45A 2WTUA 2CL7X 4RHYA 1E77A 1VSVA 2XADA 3LBAA 3LH5A 4D6YA 3G82C 3E1KA 4J07A 1RCUA 1EA7A 4H4CA 1XN1A 4D79A 3B5IA 5HTKA 1KFKB 1B00A 1H6BA 1OMOA 1W0KA 1SXJB 1XDUA 1N78A 3U6BA 1GQQA 4RHFA 1BDHA 4GT1A 2BM1A 5HZKA 4R3UC 3PIDA 4WCFA 3WRXC 1VLJA 5BV2P 1G41A 1HT0A 4Q4AB 2X22A 3GRKA 3EVDA 3D8NA 1HH4A 1SUWA 1ZM4A 2VDMB 2VJMB 3G1UA 1N5DA 2R66A 1W75A 1TW2A 2OCLA 5DDIP 5HFNA 2A9VA 3HEBA 4EY4A 3I9V6 4DARA 1C29B 1SC6A 3AHFA 1K0UA 2IDJA 3ADPA 1KYQA 3PTAA 1R4ZA 3TTVA 1U02A 1WEHA 4HDMA 5J59A 1YZFA 1DIOB 3JZAA 4EVSA 3U7QA 1Y7TA 5DLYA 1QH8B 4D6XA 1V7ZA 3PHJA 4ZU1X 4QOEA 3L4EA 4YN3A 5KX5F 3CWCA 4BO5A 2HW8A 2C8KA 3EEIA 1AS3A 1C9DB 2N1MA 1XXHE 3DMYA 3IEPA 5F7XA 3HRIA 1LVHA 1NBWB 1XNGA 4TLDA 3RS2A 1SCUB 3KBBA 1TEHA 3PXUA 1IJBA 3N6VA 1Z7BA 2ZQ5A 4IXDA 4BO2A 2C9BA 4DMRA 3DZHA 3Q7TA 4Y98A 1Z08A 4J7XA 6CHYA 3TF5A 4FKMA 4Q6BA 1TYCA 4Y6RA 4CKBB 4PM4A 5L4LA 2NUPA 3VV3A 1V8BA 1XDSA 4ND8A 4N8DA 1KEZA 5LD2B 3IE2A 2C04A 4FUQA 4MEBA 5F4BA 2QJWA 3MSCA 1JHPA 4W6QA 4WEOA 3OQNA 2J0EA 2G77B 2A5YB 3KT3A 3OCYA 5JRZA 1GG8A 3M6VA 3TLXA 1D6MA 4PSUA 4ARZA 1TVKB 4CHTA 1X7ZA 1GJRA 3L7KA 4QKQA 2YN2A 3RTGA 4HFMA 3B1VA 4YQZA 2YYZA 3GRYA 1RWVA 1EK5A 2IPOA 4DXAA 3U7FB 4MS1A 1WOYA 1P74A 4CCYB 4BBAA 3M7IA 2Y1DA 1VKJA 4O2BF 4C6TA 3LECA 4BIMA 2OC9A 2DLNA 1R0WA 1VLZA 3EMDA 4IUYA 2POQX 4RVUA 5IK2A 2GCOA 3H2SA 3OTIA 4R1SA 2BHSA 5EQFA 1BC5A 5I48A 4HAYA 1E1MA 4DMKA 1QQ6A 1RFLA 1HG1A 5DLPA 4KXYA 2YQZA 2L2QA 3NOXA 4E46A 2RGYA 4G4SO 5K8CA 4GYYA 2GPNA 1SCIA 3MJRA 2B6HA 4WX2B 1NQXA 1RJDA 3KUKA 4DTCA 4DR4B 1YZUA 3WICA 1SEVA 2EP5A 1MB0A 2IE0A 1KARA 1ZX1A 3DP7A 3PGLA 4IIJF 5LA6A 4XAQA 1YBHA 2A0UA 1XRMA 1ORVA 3UB4A 4YHBA 4OK5A 1BD3A 1W8DA 1BWRA 4UMFA 2XVXA 1DKLA 1PW7A 3LE8A 5EJ2A 5T4BA 5JPDA 5I5GA 3WLAA 4OP3A 1M1NA 2F8MA 1KY2A 5AKYA 4BX9A 5JVDA 1TZBA 3ZD9A 5ITZA 3ABZA 4HN2A 2C4WA 4JBIA 4ZVLA 4Q4HB 3QPCA 2VNKA 1E3DA 3OMLA 4GVXA 4IJUA 1I13A 4MV6A 3IKMB 3ZGXA 2H7YA 4HTAA 1MNAA 4QQ8A 4TRJA 4E88A 1A8HA 1C9EA 1JQEA 3OWOA 3QIVA 3G8YA 1J8QA 3U1TA 4EUKA 1UPXA 4R7TA 4BNMA 4KWCA 3FFAA 1XC7A 1FE8A 3QXXA 3R75A 4ECAA 3QLEA 1AO3A 2IHUA 1KFCB 2I7DA 3OT1B 4Y2TA 3RS9A 4EW1A 4ZEXA 2QS9A 5KOHA 1TZKA 1W5BA 3BK2A 4H3SA 5CGQB 1CF4A 5AQEA 1NLYA 4MW5A 3N87A 2C07A 1LB1B 3DQZA 4HWSA 2EG5A 2WI8A 1N5KA 5C32A 4PFSA 5A5VA 4JCCA 3KKPA 2VUUA 4JEUA 3UANA 3DDUA 1KAHA 4M8LA 1OB5A 1EGMB 3P94A 2XRZA 5AK3A 5B4UA 3OQOA 2QSJA 1P72A 2BFFB 3QX8A 3LBIA 5EUCA 3E61A 2IPMA 3UV7A 3JZFA 4EJSA 2N3ZA 4Y2XA 1W5SA 4L22A 4CIYA 2E4WA 3E7FA 5DB4A 1QO7A 4L2IA 5EHGA 4HSEA 5FBKA 1L5VA 3IHLA 3PVSA 3BSWA 2ZEJA 3HN7A 2DPLA 3AM4A 1I6MA 1AXGA 1Z88A 3BWYA 5HQTA 1TT7A 3KD3A 2B8NA 2E89A 3JQBC 3K9LA 1IB0A 1UOQA 2FOIA 1MPXA 1OHHA 5FA5A 4IL5A 3W9SA 4YV0A 3RV3A 4BMOB 2Y6UA 2PRYA 3OSUA 4JK3A 2EFGA 3H84A 1KZGB 3DB2A 1XD9A 1HT3A 3QI2A 1NDHA 1FFDA 2JI4A 4HAIA 3IDAA 1D07A 1N2IA 4BVEA 1QYRA 2OENG 4RDCA 1XMQB 2O57A 3KC2A 3TL3A 5KYXB 1GSOA 2XKKA 4BASA 2V1XA 1P4GA 1EFUA 4U2KA 3F73A 2PX6A 3GT7A 2WV7A 1D2NA 1DT3A 5D7BA 1AA6A 2QRQA 3U4AA 4KR6A 4B2YA 3G8BA 2GF2A 3AJRA 1AZWA 2FSIA 1EIWA 3K4HA 1M2FA 1SJ9A 1T34A 1ZICA 4L1KA 4BPBA 2R7AA 1EGAA 1SKAA 4OYYA 1L5YA 4HZUB 3VR5A 5A3JA 3ZK7A 5ALVA 1P8JA 2AF3C 1L4FA 1BJTA 1DQZA 4HG2A 1BMFD 1JFVA 4K7JA 1BVUA 3IXMA 1ENYA 3HO1A 5ARCA 1DUSA 2AOTA 5BSTA 1Z8FA 4QTZA 4TLMB 5AVKA 4CRWB 5ALEA 3TOVA 3MG9A 1BNCA 5AW9A 2LVBA 3EGDB 1D1TA 2IBMA 2VH1A 4MVJE 3NNSA 1NA5A 4LYFA 2O1EA 4UTPA 3HJAA 1DBRA 5IDXA 4MQUA 2DFVA 5ICSA 1L0BA 2F1RA 1YULA 4I3FA 1ESNA 4MKRA 1L8QA 1ZJ5A 4LVCA 4LVNA 3L4BA 4IFEA 3HJUA 4UTRA 1HZJA 2A4KA 1Z5UA 2H5IA 4I4LA 4EG1A 3QW2A 5EIBC 2IGBA 4EABA 4TUYA 5EMNA 4RK7A 1PSZA 4PYKA 4HLDA 5JNTA 3EXHB 2QV0A 2XGGA 4R2JA 2OBBA 4R8VA 3X1JA 1R4MA 5LLDA 2UYYA 4NEQA 1Z0SA 5A71A 1FW6A 3CPSA 3MMZA 4UAGA 1ZL2A 4AFNA 5CG1A 2JC3A 3FVRA 1R9MA 5JSYA 3KOMA 2QZZA 3BTVA 3D59A 4B4WA 4DW8A 4MUMA 1CY2A 2I4RA 1LLDA 5HZGA 3ZLTA 5CCDA 4FMBB 1B1CA 1T2NA 4DCPA 5MGNA 1OH7A 4JUIA 5JBQA 4IM7A 4BFZA 4ZT6A 3EUAA 1V2HE 4WOPA 3P9KA 4Q03A 3PUWA 4NESA 1D0SA 5H82A 2W6QA 1F2TB 3A4MA 3JARB 4R9VA 4UTNA 1A9ZA 1Z4QA 3D6HA 3F1LA 1RHJA 3H18A 5DHSA 5FTLA 4JJ7A 4JP5A 2TYSB 1U7PA 3TKLA 2GVZC 3R5JA 3DO8A 2IYVA 4KOAA 1FFSA 4TYQA 4MUEA 1THTA 1FFAA 1YU9A 1GU7A 3QSYA 2G72A 5HA5A 1A7KA 1ATIA 3NH6A 2G70A 3DVAB 1QHYA 4FD2A 4IVQA 4RMIA 2KW5A 4OQ4A 5COQA 2KSQA 4PSDA 5CX1B 2C9MA 3PPXA 5HWSA 1NY5A 4HWOA 2E0IA 5G0VA 5DNAA 4Z7JA 3PNLA 5KNCA 4CHGA 2AS0A 1T8YA 1OXUA 1U0LA 1D7AA 2JFQA 3NALA 5JSQA 4TKUA 3G0DA 5LVAA 4V1CI 1WL8A 4LI3X 3P9CA 1O94C 4YALA 1BS2A 4IRXA 4B43A 2JBHA 3OPVA 4QHTA 4E2WA 4Z8XA 5LDHA 2ZXEA 1CJMA 1EDDA 4OP2A 4IOLA 5GOTA 4FYHA 1CZOA 1POXA 2CK3A 4HUQB 4XR4A 1FFXA 1X38A 1ZVJA 3SLKA 2H51A 2YMLA 1Z62A 3TD6A 1G5QA 2R1ZA 4W7SA 3U39A 3HK2A 2XMRA 2QRHA 1W5TA 1MOSA 4RDHA 4UXIA 1VMIA 2C0PA 1H1DA 2Y1FA 3CXRA 4MB0A 4UBNA 3IFSA 2VPWA 4KE9A 3EZNA 1OBFO 5IJ9A 3TTTA 1G1MA 2NXJA 3UB2A 5L51A 1Z2DA 3S2SA 4QVGA 3SHWA 2CNDA 3LNCA 4ZJUA 1WUIS 1A9OA 2HJVA 5AI4A 2XBMA 3KYIB 1F2DA 3HCFA 4ITVA 4FGUA 3R0QA 4W8OA 5D2CA 1ND6A 3HZHA 2XY4A 1P2TA 2A30A 4WY2A 1YVRA 4D4JA 3BA6A 2DERA 4ZCSA 2E7ZA 2QP3A 3LHIA 2NO4A 3K2EA 2LR0A 4D7AA 4TMKA 1KS9A 3CCCA 1NI3A 2GFQA 2LW7A 2ZIXB 3HDVA 3HLTA 1Z18A 4J1TA 4ZT3A 1JA0A 3V3TA 4NS4A 3ET5A 1OV6A 3AY7A 3C85A 1RZRD 1PO7A 2C9OA 2X1LA 4P82A 5KKAA 5JYCA 2CHFA 1J7JA 3TQSA 1BW9B 2LRHA 3JQ7A 4N82A 4RCYA 3I9JA 4G4JA 5HDQA 1V16A 2F6RA 2G09A 4G1FA 3R7FA 3SM3A 4A8JC 3RLIA 3SIWA 3TQOA 4BRZA 4HH0A 2F7SA 2SHKA 2L18A 5F3WB 1U28A 4Y1RB 2IZ0A 1QVVA 4UQOA 3HA2A 5F7JA 5IBCA 4ZREA 4EKYA 4YXWA 1FTGA 3WGHA 1JDUA 4U3JB 5HFAA 3WMEA 4CIWA 2V74B 4G2TA 4GR5A 5IVDA 3JYLA 3A26A 2QJFA 2R84A 3DPIA 4PR0A 3BTSA 1T5IA 2Z8YA 1Z47A 2YDXA 4Q16A 3AUSA 1ZUNB 3BHIA 1E7RA 1ONSA 1Q2XA 3AINA 2X9LA 4M9XA 3TX6A 3UAXA 1E9RA 3ROQA 1T91A 5FQNA 4F9FA 1EMDA 4ZU6X 4A0GA 2M6SA 1NNI1 2O8EA 5EERA 3KE8A 3VSBA 3LWBA 3EUEA 4DAEA 1OZGA 2V3CC 1AGRA 2O4UX 4HBZA 4XWYA 3ZVRA 1VSTA 1WVMA 1R10A 2VHXA 3DZCA 1SY7A 2PV7A 1C3VA 3JATA 4EO4A 3V7NA 3CO5A 3EOZA 1EFKA 1XV5A 3LC0A 4KLZA 2FSVA 3KU1A 3H8VA 4GMGA 3IUNA 2YUTA 4NDAA 2OQVA 4M54A 2FETA 2W2VA 4TWBA 4P4TA 3LS2A 3OCZA 1I2AA 3UUGA 1RYYA 1CJUC 1L7XA 3N53A 1O4WA 3PC4A 5D5QA 2I87A 1P17A 2PUCA 4UOZA 2V6IA 3WMGA 2GZRA 1LDBA 4JI1B 2AOWA 1SQ6A 2CJYA 4JNKA 1KGSA 5DWQA 4WCFB 2PUFA 1LPNA 3KSDO 4KSBA 3S1AA 2CL5A 4J1QA 2XWJI 5EE3A 3F7TA 4KUGA 5LNK1 4GXRA 4G5OA 3S5JA 4U2BA 5J4KA 3BB4A 5EPEA 3U80A 2FR1A 3UATA 3ROXA 1NXSA 1QG0A 5EOVA 1VSQA 2W6JD 1Z8DA 4I66A 1XRNA 4PC2A 4GOLD 2CJPA 3IVGA 1QAMA 1D2MA 2XUGA 3QNUA 4RFLA 2H4HA 2V4ZA 1RAEA 1WWKA 2P2CA 3PP8A 1U8TA 3DHVA 1GAWA 1Q83A 3LUFA 4LF8B 2CXQA 2EXXA 3OZAA 1CUVA 3B9PA 2PLFA 4HZGA 4C9BA 5CDTA 1QP8A 2X5XA 2ET6A 4TXNA 4KI7A 3QG1A 2IXGA 1V3TA 1L5LA 4RFSB 2G8NA 1A50B 1B3BA 2VJLA 2A1TS 3CR3C 5KHOC 2O3UA 5GVSA 4M9UA 2JA1A 3QFTA 4O4LA 2JAUA 2JW5A 1UWKA 2ODBA 1V5GA 2WNSA 4G8JA 4H4DA 2EX4A 5TMDA 4ND8B 3SZ3A 3QGMA 2C1XA 1A2QA 1O08A 1ZIYA 3ANXA 5F1PA 4A6EA 4EK9A 4LOHA 5KEIA 1IIRA 5JV5A 1JKJB 1PX0A 1WD7A 1L8XA 3GVCA 2VA8A 3OUZA 1P7WA 4HQLA 4MUYA 4QXRA 5DH9A 3TYXA 4ARZB 1S1CA 4GPEA 1EFAA 1QUFA 2AOUB 3KLBA 3U3XA 1K7XB 2XE8A 3B2EA 1M8FA 5HUJA 3EVGA 3NWEA 2O7NA 3PENA 5JAUA 1IQRA 1DLIA 1OU4A 1JU9A 1WUHS 3NBXX 5C8VA 3LUJA 1FRZA 5SICE 4WBNF 1Q95A 1DEXA 4S05A 4P2BA 4WQMA 1M8KA 2G4VA 4KU4A 3O5AA 2QAIA 2QRLA 3CLUC 4GYJA 2IIQA 2ZBVA 3F71A 1Y7IA 3RFTA 5I7FA 1AZTA 2VJBA 1K3TA 1W36B 3MJEA 3DTNA 3WQQA 4KE8A 4XVUA 4MPPA 2JFWA 5FIUA 4H60A 3DD5A 3E03A 4S1TA 1X7WB 1JZQA 2NT3A 4D26A 4MW4A 4AMBA 1G21B 1BE8A 1AKYA 2SCUA 3IUBA 4QYWA 4WI1A 3KQUA 4AJJA 1MT0A 2F62A 3H11A 4C0AC 2GK7A 1TMOA 1LU9A 3NPAA 4Y8VA 3CB2A 4WAUA 1E3EA 1KYWA 1LRJA 2GPWA 4MZDA 4EPVA 1TADA 2AWOA 1Y1LA 2P0EA 3H5TA 1Y4SA 1YT5A 2QVGA 3UUWA 2I91A 3EF0A 3L79A 2RC6A 1CEEA 1AKEA 4RF3A 3MJSA 3SKVA 3WDSA 1XTQA 3IQEA 4B7AA 2Z2KA 3GIDA 3B82A 4W4TA 4MK4A 4NJOA 2NACA 1GTG1 4M4SA 4MYRA 4I46A 1FP7A 1H93A 2WMDA 3LVRE 2WWVD 2HA6A 4FYJA 4UM9B 1YZTA 2HIHA 2J0VA 2JIZD 4HN4B 3UK1A 3COVA 3P2IA 5A04A 2CHQA 4RCZA 2ZR8A 1NBAA 1D4OA 2EAUA 2ZIWB 3IAUA 1VMEA 2WHPB 5DNEA 3RU7A 3W90A 4HH4A 3V8BA 1QMGA 3GCDA 5K2OA 1CFJA 1H94A 4DNFA 3MTDA 2W58A 3CJQA 3HCOA 3WX0A 1OZFA 2EZ4A 3FCXA 1ISSA 4GICA 3KR2A 2MHCA 1QV7A 2HPAA 3HJCA 4XTCS 4QC2A 2EGUA 2WU8A 3O0TA 1T9GS 5K0EA 1ZWLA 1V25A 3Q7PA 2ANBA 2IIBA 1E3SA 1W4LA 1IN5A 4ND6A 2J85A 5HKBA 4BQSA 4JUCA 2QENA 2GKOA 1T4CB 1NKSA 4JI2B 4P7GA 1VCHA 1KJJA 3DHEA 3VTAA 3FHJA 2AKAB 2ZJ7A 4KN8A 4O4IF 4UAVA 3UAGA 4AN1A 1E1DA 4D92A 1ADYA 2D5CA 5L4NA 4CLRB 4LQCA 1B7GO 2NZUG 3INNA 1ODKA 3TW0A 2VSYA 1ZH0A 4BVBA 1Z0KA 3GH3A 4GL4A 2CFIA 1JR3D 1MMFB 3V4OA 1DOHA 1E2FA 5TSDA 1V48A 1UT6A 3WYDA 4YMHA 5C2JB 1LTKA 3GGSA 1XWFA 3X1YA 4KK4A 4M7WA 4F4FA 3DXXA 1XWWA 4II2A 1YDEA 3SSAA 1KJWA 3DTVA 3UY4A 1ZIDA 1MAAA 4FCWA 4IHAA 3ZV6A 1CHNA 4DJJA 4EOGA 1TM4E 2IUYA 4XX0B 1GUDA 1IUOA 4LA4A 2YVUA 2J3QA 5EMKA 5ALZA 1C7IA 1QLHA 3EGCA 3TUZC 4F2WA 1QBGA 1Q6YA 2IV2X 4I6JA 3K1YA 3N5CA 1X8KA 2UYGA 2B4YA 3AH8A 1Y1KE 3AIKA 3LWZA 1GL3A 4C3VA 3UM9A 1E92A 1TF7A 4QPJC 4QFBA 4LX8A 4IQ4A 1WO8A 2GVNA 4O4LF 4O0MA 1DHRA 2X4IA 3F46A 5SZJA 2JFBA 4CIDA 2XVAA 4D5EA 4YJ3F 3RVDA 2YH2A 2AGVA 4MA4A 4C0BA 5LOVF 1XQ1A 3TQTA 4UASA 3PWKA 2Q99A 1ZOIA 4DC0A 2QM3A 1KXZA 4UUMA 1ZO8A 3SKYA 5AJZA 4D74A 1ZZGA 3T7RA 1GPLA 2QN3A 3C6QA 3LO5A 2WYUA 3A3KA 4GPIB 5ERGB 2YV1A 1RC0A 3P2KA 4BJ5A 5CEJA 1RQGA 2H29A 3N7AA 1JQLB 2JCYA 2J41A 2VVTA 2ZTUA 1NW3A 1YGYA 3FKSD 4PLFA 5JNLA 1JAIA 4RMHA 3S81A 4BLUA 1OXKB 4E22A 1XCGB 1YQXA 1TX4B 1VZ3A 1EXWA 3KKNA 4GSYA 3ONVA 4A23A 1JJFA 4X54A 3RARA 4BV9A 5HKAA 5JW6A 2QMEA 2WTXA 4OAOA 5D85A 2HV9A 2J9RA 2Z3ZA 1KPIA 1F0PA 1HL3A 3V1NA 4ZQFA 4QSMA 3WKAA 2OO7A 1S9DA 3C5WP 2WWYA 4IX1A 3HBMA 4G89A 3FMOB 4MO9A 4MMXB 1TM7E 2PV0A 3C7DB 4OV6B 1BTOA 4LOAA 4XSHA 2JLAA 3T5MA 5EJ6A 2JHPA 6ABPA 2JHAA 1POWA 1EI9A 2OECA 4EHBA 3S2YA 2BP7B 3DD1A 2VRBA 1R4MB 3WV4A 4H7PA 4UZSA 4DCCA 4FU0A 1NF2A 4BUCA 3AF6A 4XWWA 1NTOA 2VJYA 3KOYA 1ZY2A 3MWGA 3RYHB 4O08A 1GU0A 1RRGA 2IXDA 2ZAYA 3PEFA 1ADJA 1YDHA 4MH0R 5HCIA 3M9XA 3TOXA 5UKDA 3HG7A 1EX6A 1XJ0A 4Y18A 1RM3A 2PGDA 3UAOA 1Y3IA 6REQA 4B7UA 2HZ7A 1EU1A 1ARZA 1GPUA 3B5JA 3RUIA 3ELDA 1ISHA 5BNIA 2GF9A 5IVIA 1NX6A 2MIIA 3C1TA 1O97D 4TXJA 1B93A 1RJ9A 4LGCA 2VT7A 4HDNA 5I9TA 5SZIA 4LTDA 4QUEA 1P2BA 2ZYRA 1EK1A 3Q8MA 3DYIA 2GPJA 2QKYA 1FU4A 3WADA 3OLVA 1J33A 1TMGE 1L4LA 3TW6A 3LPLA 3EXEA 1B16A 2FDCA 2GLUA 3KYJB 5GZ1A 3RV4A 5K0FA 2DLCX 3G0GA 5CFOA 4DZTA 2GWRA 3D0KA 5FWXB 3A14A 1O8BA 2VJAA 3N2KB 1L8AA 3HA5A 1YS6A 5JADA 2GM5A 2B98A 4URWR 3S40A 2QL6A 5KHAA 1ZOLA 4TKUB 1RKUA 5I7AA 1AQUA 2Z08A 4UAJA 4Z7OB 1GSHA 2BMDA 2EBFX 2QHXA 5BURA 3ABOB 3BXGA 1B3RA 1ZHOA 2BFAA