4WE3A

Structure of the binary complex of a zingiber officinale double bond reductase in complex with nadp monoclinic crystal form
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
353
structure length
342
Chain Sequence
DVVVVNKQVLLKHFIPAPKETDMELVTTGTIRLRVPEGSNAVLLKNLYLSCDPYMRMRMTKHEEASYVDDFVPGAPITGFGVGKVVDSSHPDFKTGDYVWGLIGWEEYSLITKPQGLFKIHHTEIPLSYYTGILGMVGLTAYVGFYDICSPKKGERVFVSAAAGAVGQIVGQFAKQFGCYVVGSAGSDEKVNLLKTKFGFDEAFNYKKEPDLTKALKRYFPEGIDIYFENVGGPMLEAVLHNMRIKGRIAACGMIGVHNLFLIVGKRIRLEGFLVFDHYGSYPEFEEKVVQLIKEEKIKYLEDIVEGLENAPAALIGLFEGRNVGKQVVVVSREKGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Double Bond Reductase
publication title STRUCTURE OF ZINGIBER OFFICINALE DOUBLE BOND REDUCTASE
rcsb
source organism Zingiber officinale
total genus 109
structure length 342
sequence length 353
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF16884 ADH_N_2 N-terminal domain of oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4we3A02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4we3A01
1YDWA 4GGPA 1M66A 3BMCA 4F6CA 2PH3A 4KUHA 5EESA 1IB6A 1E6UA 3AI1A 3PDJA 4LMPA 4TZTA 1IZ9A 4ZVVA 3H5AA 1I3NA 3S2FA 3ZU5A 3TL3A 1QYDA 1GYPA 3KXDA 3PI7A 3X2FA 3PQDA 5B1YA 5T5QA 4EUEA 1E3LA 1U7HA 4CM7A 3PJDA 4GWGA 4J4HA 1E3WA 2HRZA 3WYCA 1FDSA 3VKUA 4IMPA 3QWBA 1BDBA 3OQ1A 2B5WA 5KJEA 1DFIA 4EW6A 3OJEA 4QO7A 3V1YA 5DBFA 3FNHA 3M2TA 3KYCB 1BW9A 4Z9XA 4BO2A 4FFMA 1SO8A 1WWKA 3D0OA 4DQXA 2BKAA 4MKXA 1LJ8A 5GMOA 2CZCA 3CZMA 5DOVA 1WMBA 2BD0A 5BR7A 1DC3A 2IEBA 5BSFA 5JY6A 4H16A 3WX0A 1UP7A 4E12A 4R1UA 3IP3A 1ZXBA 3GY0A 3LU1A 4OL9A 2Q50A 4ALMA 4MKRA 1NTOA 1TA4A 3FRJA 3S8MA 3I1JA 1JAYA 5F21A 3S2GA 3VPFA 4NK5A 2IDZA 4NU5A 3EK2A 5DZSA 4E2YA 3A14A 4EYEA 1B3RA 3DZGA 4XDZA 1J4AA 1R12A 1XKQA 4NJOA 4EGFA 4FOSA 5JCXA 3H3FA 5T6BA 5L3ZA 2Q2VA 3SLGA 2YQ4A 2J8ZA 4CMHA 2NSDA 4QQRA 1I10A 1DFGA 1JTVA 3OF2A 1ZKMA 3AJRA 4OQYA 3E9QA 1RWBA 3QIVA 2P9EA 1GPJA 2AG5A 3VVCA 1IYZA 3AFMA 3G1UA 5CDTA 4II3A 1LXCA 3H9QA 4CMKA 3L4BA 3PFFA 4WOJA 1PU2A 3BTUA 2OL4A 4D0RA 2IZZA 2ZB7A 1G6KA 4IJKA 4R9RA 4CQMA 4XYLA 1W6UA 4L4SA 2FR8A 1IPFA 1W8DA 3MWDB 4EITA 3GNTA 3PYMA 1E3JA 1W0CA 4YRAA 3TZCA 1UXHA 1O8CA 3I9NA 4WUVA 4ZRMA 1SEPA 4NFYA 3CIFA 4AJKA 1KERA 1PJLA 3NT2A 3K92A 4PG6A 3SJ7A 5U4QA 3JQAB 3KHUA 2FP4A 5CEEA 1HYEA 1HDYA 2RAFA 3L4SO 1T1RA 4UUOA 1LDMA 2PD4A 1MC4A 3L07A 1QLHA 2AQIA 2G0TA 1TT5A 2HJRA 1ONOA 5I8ZA 3JQ8A 5GZ6A 2LDXA 2J3JA 3COSA 1VSVA 1ISGA 3F47A 4PRKA 1ZK3A 5G0WA 3ZU4A 4WKGA 3RI3A 4XQEA 5TQVA 3KETA 1F8GA 3ETGA 3RUEA 1LQTA 1LDEA 3ASUA 5A3VA 4BKQA 2PLAA 2PZKA 3C7DB 3RSHA 5JYEA 3HZZA 1QSGA 3DZIA 3WTBA 1CYDA 1KVUA 3GVPA 3S2IA 5JDIA 2JJYA 5TNXA 3GF4A 3WSWA 1J5PA 2I6TA 4R3NA 4EDFA 3BXXA 3QY9A 3GDGA 1QKIA 3F46A 2HO5A 5B4TA 1TB4A 4BNHA 1M67A 4FB5A 4GVLA 4BB5A 3F9IA 1XU7A 4RJTA 3I4CA 4QEDA 1Q7GA 3OETA 3Q3CA 3HNPA 3W6UA 5KVCA 4G2NA 3L4BC 1AUPA 1O0SA 4NFSA 5I7SA 1WDKA 3MCVA 4C4OA 2X0NA 4QFDA 1DB3A 2FPPA 4O1MA 4OJNA 3GH3A 2I66A 3H9EO 4G81A 4KUGA 1XQ6A 1YWGO 1C0LA 3T4EA 2NNLD 1E77A 1BHSA 3FHLA 1N1GA 2SCUA 2VN8A 4LCEA 4PZCA 2GZ3A 3F1LA 3ORFA 1NASA 3ZNOA 3MOGA 5L4LA 4BGEA 1BTOA 1N7GA 1X7GA 2GZ2A 5A04A 1M2WA 1FMCA 1D1SA 1GUZA 1R16A 1IHXA 3FNFA 3GK3A 4D46A 2QIOA 1DPGA 4N54A 5FWNA 4LVUA 2VHXA 2ZQYA 1K5HA 1H2BA 1HL3A 1K2WA 1YB4A 3V5NA 1UXJA 3GVXA 2Y1OA 3VZRA 3GRPA 2QZZA 2X9NA 1B0AA 2FRDA 1QV6A 3L77A 4PLTA 4B4VA 1F0YA 5DDIP 3H5NA 3I9KA 5G4KA 4ZGWA 4CQLA 3BMNB 2A4KA 2HDHA 3B1KA 2EV9A 1I8TA 4R54A 3VC7A 4IIVA 4GAEA 1D7OA 3RBZA 3V2UA 4LSMA 4ZU3A 2Q99A 4M54A 1AXGA 4I5GA 4F46A 4A2CA 3IQDB 1YOVA 1E7RA 4DC0A 4A5OA 4OO3A 1B26A 4OYRA 1X0VA 3JQGB 3KLMX 1LLQA 2C54A 2PR2A 2JD1A 1C14A 2GPTA 3WJ7A 3DOJA 4FN4A 2X22A 4FOOA 4CLDA 1NHGA 1DO8A 1GZ3A 5HS6A 1MC5A 2BI8A 3JD4A 3FBTA 3U4CA 3QWIA 1NFFA 3EYWA 5A1TA 1U3WA 5IZCA 3ITDA 4AJJA 1LSJA 1RM0A 4UVIA 3IUPA 3GR6A 4I9HA 1EBUA 1XHLA 3MZ0A 3G3EA 4YB8A 5LCXA 4WLNA 1MP0A 5BNIA 2NQ8A 1ZCJA 1P44A 4XQ9A 3R0IA 4TVOA 2H9IA 3HJAA 4R68A 2E37A 4NG5A 2UV8A 4TZKA 3NTRA 5JCJD 1RM4A 1OFGA 1CQJA 4K9DA 1U1IA 4W99A 3ONFA 4R16A 3OIFA 9LDTA 1NHWA 1X14A 3OSUA 2NVUB 4XQCA 1U2DA 3U49A 4H15A 4CR6A 3UXYA 3C85A 5HS4A 3W6ZA 4E21A 3OQBA 3EHEA 1EFKA 5EQDA 1T2EA 2YV2A 2VOJA 5DBIA 4UVHA 3GQVA 4XX0A 3DQPA 3VTZA 5IAAA 3PK0A 1ZEJA 1FJHA 1HKUA 1MA0A 1UDCA 2YHIA 3BMQA 3PXXA 4J2OA 2P4HX 1H9BA 3DBRA 4E0BA 3GPDG 5T8KC 4PCVA 4W82A 3ZWMA 4IJUA 5GY7A 3ZV3A 2CY0A 5ILOA 3AY3A 2OP1A 1BXGB 1WZEA 2PZLA 3PIIA 3EW7A 2B4RO 1Y8RB 3DTYA 4XGNA 4ALNA 1U5AA 4E5YA 4BNGA 2WTBA 1PJBA 1HLPA 4U6SA 2X9VA 2JFHA 5EIOA 3I6QA 4XRGA 1AHHA 4BO8A 1FF9A 4IJWA 5CG1A 2QYSA 4ND2A 2NADA 2R6JA 4BQRA 4P8RA 1O95A 1GU7A 4YJFA 5KVVA 2P91A 3JQ7B 1ISIA 1JDJA 3RC7A 4RVGA 3VAZA 3KM0A 1X7DA 5AXCA 4U8GA 4TRJA 1KETA 3AM3A 3JQAD 2Y66A 1YQXA 4ZA2A 5BSHA 2Q1WA 3MJ4A 4Y98A 2ZTMA 1NP3A 1BDMA 2W90A 4YAGA 1QYWA 4L8VA 3GNQA 4K28A 4MKZA 5COAA 2CVZA 2J6IA 4CV2A 2I76A 4M89A 5TSDA 3TSCA 2HMVA 3FPCA 2EGHA 3D1LA 3NV9A 4CMCA 1C1DA 4D79A 3L6OO 5EN4A 1VSUA 1K3TA 2O3JA 4OSPA 3C7AA 3KSUA 2NM0A 3DOCA 2O2YA 2QQ5A 1ZK4A 3D3EA 1LX6A 4YAJA 1I01A 1WVGA 4FQ8A 1VC2A 1AN9A 4WLOA 3WDSA 4BNMA 2CMDA 5BSEA 3V8BA 1P31A 4D0SA 4JQCA 4JLWA 4Z0PA 4B7CA 2VHWA 3JD0A 3QP9A 4XA8A 1N9GA 3ST7A 2D2IA 3BMCB 1U9JA 1UDBA 2VRBA 4R1NA 2PZMA 2WD7A 3BMOA 5GZ1A 1PGJA 3U62A 5DCYA 1GYRA 3OICA 3TN7A 3R3JA 4J90A 4Z0HO 4RVDA 2ZTLA 1DJNA 4M87A 3RUCA 5FEUA 4BO5A 3PYLA 2EERA 3PVZA 1ORRA 8ADHA 4EUHA 1DIAA 5C7LO 2YZ7A 3ZNQA 1VL8A 3EZLA 3H65A 5FFFA 1KVRA 1B7GO 4KMSA 4W7HA 3LT4A 2DU8A 3FF4A 1ZVMA 4A73A 3HDQA 1RYEA 3WGZA 3PQEA 4K6CA 3KLPX 5KIAA 2VRCD 1KIFA 1BGVA 3WNQA 3HFSA 1P3DA 1Y6JA 3JCZA 4XR9A 3Q9NA 3ROQA 1NQTA 2RHRA 3GDFA 3HG7A 4RF4A 3FI9A 3HB5X 4NIMA 3D3WA 2VHYA 3H3JA 4U5QA 2WYVA 3IKTA 2VT2A 4M49A 4MP3A 4MVJM 3IUSA 2NACA 4J3FA 5EPOA 4D44A 1SB8A 4BV9A 1VL6A 3I9MA 4MVJF 1YBAA 2G76A 2AXQA 3ZW8A 4S1VA 2P2SA 1FDVA 1HEUA 3UVEA 1R37A 4LISA 3PDUA 3R3SA 2C7VA 3OJLA 2HLPA 1PIWA 4PZEA 5HA5A 1HDRA 2FHSA 4BMSA 1ZJYA 2O7QA 4RPGA 4CM9D 1M6WA 4JNKA 2QX7A 3LT2A 3NX4A 1LLUA 3AW9A 3CE6A 1ARZA 2P9CA 4CLRA 3S2EA 1N1EA 2B83A 2O3TA 4J2HA 2FSSA 5CPBA 1U5CA 3BTVA 3G1TA 3F4LA 4CJXA 3QHAA 1CEQA 3ZWVA 1Z7EA 2PD3A 2OHXA 4IS3A 3GZNB 3V1UA 1XU9A 1QR6A 3EUWA 2HK8A 5DCUA 3LK7A 4CQMB 1T24A 4KDFA 3GNSA 3RKRA 3PFWO 5A4DA 4G65A 5F1PA 1V3TA 1A4UA 1LLCA 5IJZA 1HF3A 2DPHA 1JQBA 2NQTA 4CL8A 3ONEA 1YQGA 5EQFA 2VYND 2GN8A 4HNGA 1XR3A 1HT0A 5JMWA 4WNCA 1UZMA 2BI7A 1L7EA 3E9NA 3KYBA 4MVJH 4PIVA 2FR0A 2Q4EA 2V7PA 1LDYA 3VPSA 3SVTA 3ZU3A 2RH4A 1P9LA 1TT5B 1SOVA 2EF1A 1L7DA 3JQ8B 1H9AA 2WE7A 2OO5A 5IN4A 1ZUD1 2HJSA 4UVDA 5C7OO 1HETA 1YL5A 1QP8A 4L9RA 1MX3A 1LEHA 4RF2A 1ZMOA 2Q1TA 3CTMA 5AXDA 1P1IA 4UVEA 1X13A 1F8FA 1FDUA 2XOXA 4I1IA 1Y8QA 3R6DA 1EMDA 4BNUA 2PKRA 3QVWA 4I8XA 3ENNA 2A9FA 4KWIA 5A9TA 1DBVO 1R4MA 2C29D 4FIZA 5JYDA 1I2ZA 4MP8A 5FF9A 1PQWA 3DAGA 4LK3A 4OIMA 4R01A 3WTCA 3TNLA 1P1KA 2HK7A 3Q2IA 4IQ8A 2Q46A 2B69A 4E5MA 1ZH8A 4RVFA 1KEUA 5ES3A 4QX6A 2G17A 4FBGA 1E92A 4YTEA 4CM8B 4XYMA 3K2BA 4D3DA 3W4KA 4A27A 2VT3A 3IS3A 4MVJD 1WW8A 3FPLA 4ESOA 5I7VA 2X7HA 4IINA 3PWKA 4UEKA 1T2CA 2X5KO 1YJ8A 1UP6A 3I9LA 1L1FA 3GHHA 1SBYA 4Q39A 3WGTA 4YAEA 3OJ0A 4KUEA 3WBFA 2FMUA 3GUCA 2WEKA 3UFXA 2EIHA 1X1EA 2IXAA 3QV1A 3HSKA 4J43A 3ZWXA 2C59A 3CXRA 2TMDA 2JFFA 4I5EA 4ND3A 1ZXLA 3ABIA 3DR3A 3ZDFA 3CMCO 4BMNA 1GFSA 4GWKA 1X0XA 3AK4A 3G79A 1YONA 4J9VA 4RVUA 2HMTA 1E7WA 3FBGA 2F1KA 3DBLB 4XDYA 3LC2O 5G0VA 5TT1A 2DVMA 3UN1A 4GLLA 3HQ4O 5FYDA 5DBGA 3V2GA 5I7FA 2WM3A 3AY6A 2A94A 2QZ9A 3KB6A 2EJVA 4XCVA 3WGGA 3MOIA 4U7WA 2VNSA 1SCUA 4YJHA 3L9XA 2JCVA 5G4KB 4X54A 2VYVA 4K1LA 4CQLB 3L6EA 4CM5A 2Y1FA 3BHMA 1DIRA 2BFAA 1E1MA 1YQDA 3HDYA 2BF7A 3DZBA 4ALLA 4LCJA 3WQSB 2PA3A 1QRRA 3KYDB 1V35A 4RV9A 1MGOA 3LDHA 3WQQA 2YV1A 1UZNA 2B37A 3DL2A 1YOVB 4HWKA 4KWHA 3TFQA 2PFGA 4C7KA 1PS9A 2IE0A 3A9WA 5JXWA 5KJCA 2VZ8A 3P5SA 3UCEA 3NTOA 4J7UA 4XYBA 2PWZA 4BNTA 1E3EA 4FS3A 5KJFA 4NMHA 3ZWAA 2RH8A 2VCYA 4OGWA 1N5DA 4XIJA 3SEFA 5K6AA 1ZJZA 4IBOA 3O8QB 1RM5A 3OBBA 1VI2A 4Q3BA 1O5IA 1QG6A 3FN4A 4AICA 2DFVA 3GUYA 3MTJA 1A9ZA 4P38A 3A1NA 5JE8A 1IL0A 4GLOA 2EGGA 1E7YA 3C1AA 3WNVA 4RGBA 2QRLA 4DA9A 3E1KA 1MXHA 3HUDA 2X0JA 4IZIA 4CUKA 1C1XA 3BHJA 3K30A 5L40A 3CH6A 3LC1O 4FGSA 1Q0LA 4RVSA 4UUPA 1A9YA 1CF2O 4BNJA 4DPMA 2GDZA 1EDOA 3LZ6A 2YFQA 1NVMB 2W98A 3FCOA 5DP1A 4BNZA 3K6JA 5L9AA 3GGPA 2JHFA 2PKQP 2ZIZA 4BS9A 1MFPA 2CDAA 1EUCA 1G1AA 1J6UA 3I5MA 3K5PA 5KTKA 1LC0A 1R4NA 1MB4A 2FPGA 3TDKA 2R00C 4IY1A 2ZJ1A 5DOZA 4CM1A 3OIGA 4W4TA 4NBTA 4J1TA 4YAIA 1GAEO 1DAOA 3DEYX 5BT9A 4CR8A 4QECA 4YT2A 1F06A 3D4OA 1ZFNA 2OBNA 2PY6A 3QRWA 4L73A 4WOKA 2ZCVA 3ON5A 4XZ3A 2YHIB 4Y6PA 2OORA 3PHGA 3ZI0A 3BMQB 3C7CB 2IEDA 3DBRB 1YGYA 3ZWBA 3IAHA 1ZK1A 2Y0CA 3SC4A 1KVQA 4B4OA 3ZZNA 4PG8A 1DLJA 3DO5A 1PWZA 1WP4A 4CMEA 3WQRA 5K6AC 1NX6A 5ITVA 1DC6A 2J5QA 3CUKA 4OM8A 4RQUA 4NZ9A 3UF0A 4D42A 1H94A 3U3XA 4ZQFA 1ZO8A 4ALJA 4CQMD 1B14A 1LDNA 2A35A 3VHRA 2D5CA 4BNLA 5LDHA 3OJFA 4XYEA 3TZ6A 2BLLA 1RJWA 4IPTA 4YJFB 3VZSA 1ML3A 1MG0A 2GUGA 4U6QA 3RD5A 1KY4A 4J1QA 4PLHA 5THQA 3RUHA 4IGEA 5A9SB 3NUGA 3NRCA 3M2PA 4GSKA 4TRRA 3PWSA 3D4PA 1GQ2A 1LDBA 1ZK0A 1B8UA 1TVEA 2DUWA 2I67A 1ISFA 4DPKA 5JO0A 3GEGA 2PZJA 2X0RA 4CR7A 3VH3A 3QWFA 3DB2A 5KCZA 1YBVA 3TRIA 2TMGA 1AHIA 3F4BA 3GVCA 4WECA 3B1FA 4CPDA 1LSSA 3EVTA 2DKNA 4XKJA 1VKOA 4R41A 5IN5A 1GUFA 3V2HA 2GR9A 1OI7A 1P1RA 1R0SA 1PJ2A 1EUZA 1C1DB 1JKIA 1E1LA 2NVBA 4NFHA 4BGUA 4BNIA 2EP5A 4JBHA 1JAXA 3NKLA 1GEGA 1XG5A 1BG6A 1ZBQA 4RZIA 3M6IA 3MEQA 4FCCA 4AG3A 4E4YA 1GADO 3N74A 3ROKA 3PJFA 4F45A 4H3VA 4Z6KA 4WLUA 1N9GB 1EUDA 1T4DA 4HFNA 4R5MA 3GAFA 2AE2A 3WYEA 3KUXA 3BMOB 4BKOA 4O0LA 3WGOA 1QORA 3NDIA 1Y9EA 1VM6A 1N2SA 3PEFA 1T4BA 4NDNE 1DSSG 3ADOA 1M76A 3DZJA 3OMLA 1A71A 1I2CA 1NQOA 2XAAA 3CZRA 5IF3A 3PQFA 1UH5A 1YL7A 3TPCA 1N8KA 1T2AA 1JVBA 3DWFA 4RQTA 1QXSA 2BH9A 1ONNA 2B35A 3PP8A 1LQUA 2EEZA 4P4GA 4CV3A 2J3IA 2C5EA 1RYDA 3WFIA 4GSLA 3MJVA 4YACA 1HLDA 1DIHA 5L7WA 4GH5A 3KTDA 5ICSA 3U4DA 3W8FA 4TSKA 5JC1A 5A9RA 1JKJA 2DC1A 3OECA 2UAGA 3HN7A 3AWDA 2JFGA 5JFOA 4BHTA 2FSVA 3JD1A 4J7XA 4FGWA 4DWVA 4JCOA 1U3VA 5ENVA 1TEHA 1GCUA 1NR1A 2FZEA 3OHSX 4CV0A 2UUPA 4IZHA 4NJMB 2B5VA 3GEDA 2VNAA 3H9UA 1TXGA 2I3AA 4R9SA 3LVFO 3QSGA 5G0UA 3A28A 5KJ6A 2PH5A 2HK9A 1CIVA 4XR4A 3H5RA 4A03A 1ULSA 2D5AA 3RASA 1LDGA 3GMDA 4AJ2A 2P4QA 3BHIA 5A05A 1UZLA 1AE1A 3NGLA 2DTDA 1Z75A 3DTTA 4KP7A 1HYGA 4EJMA 2WD8A 4CMGA 1GCOA 3W8DA 1P33A 1SOWA 1V8BA 1F12A 3GDOA 4CLRB 1HE4A 5F1KA 4WEQA 1UAYA 4LN1A 2V6BA 3IMFA 1EE9A 1WNTA 3DZHA 3W8EA 4OXNA 1UDAA 4AJOA 4BNFA 2ZK7A 2X9GA 1UP4A 3IJPA 3EAGA 3LF1A 3KEQA 4O63O 5JDIC 5L45A 3I9OA 4WNIA 2XPCA 2NTVA 1IPEA 1PWXA 5TF4A 4E30A 4QT0A 4QO8A 1SB9A 4N7RA 4AFNA 4FFPA 3DHYA 4UVGA 5B37A 2GN9A 4C7JA 3IJRA 3GHYA 2AQ8A 3UKOA 4N18A 3ROPA 1KVSA 1EVIA 2GF2A 2NTJA 1HDOA 4MINA 3FNEA 1ZK2A 2H6EA 4DGSA 4EBFA 4E13A 4PRLA 1IE3A 1R66A 2V65A 3DFUA 5KKAA 3WFJA 4R1TA 2NVWA 5KVSA 4A10A 1I24A 1KY5A 4O6VA 1JLLA 4DLBA 4NBVA 1I5RA 1E0DA 2F00A 2YW9A 4ZJUA 4ZQHA 3B20A 4YVFA 1NVGA 4U0JA 5JO9A 1SEVA 1HZJA 3GN2A 4S3MA 4RL6A 1C3VA 3WGYA 3ETEA 6LDHA 1K0UA 1XEAA 3H7AA 4DIFA 3M1LA 4Q3AA 3ONDA 1SMKA 2HUNA 3AM4A 2Y99A 4AJLA 1YRLA 1ZNQO 1U7TA 3RFXA 2GO1A 1M6HA 3L9WA 1R4MB 4Q3DA 3RJ5A 4Q3EA 2GD1O 4ND1A 2Z1NA 5H83A 2E4AA 3CMMA 1PQPA 5IFLA 1P74A 3H9JA 3UOGA 3I52A 4J4BA 5ER9A 1ZSNA 4NU6A 5CP8A 4XGKA 2QHXA 2DBVO 1W73A 2Y0EA 2O3UA 3K96A 4FPXA 3DMTA 4RPJA 2EW8A 2YUTA 3T4XA 1D4FA 2Y05A 3WR5A 5HTOA 1E3IA 4FSHA 1Z73A 4QSMA 1X1TA 1RPNA 2AMFA 4CMIA 3M1AA 1UUFA 3KV3O 1LRJA 5IG2A 1PX0A 4M86A 2VTEA 2VWQA 4ND4A 3UGKA 4IGFA 1PJSA 3IOYA 2VZ9A 5ENDA 2DFDA 3OH8A 3DBHB 2VQ3A 1XYGA 3MJCA 3HDJA 3AUTA 5HM8A 2BHLA 1DC4A 4YBZA 3E18A 5F5LA 3H8VA 4AJ4A 4GX0A 3DFZA 4B79A 4CLOA 3PHJA 4FC6A 1PGNA 3JD3A 3DXFA 3TOXA 5IZCC 3LQFA 1O9BA 1DRWA 1DOHA 5IDYA 4L4XA 3PZBA 1O89A 4FJ2A 4YT4A 2CF6A 3I4FA 2VHVA 3TZQA 1N7HA 3CEAA 1T2DA 1PGOA 2DTXA 1JU9A 4XIYA 4YJHB 4MVJP 4AVYA 1KYQA 2W2LA 5I9LA 4NBUA 2YDYA 3NGXA 4BO7A 3RKUA 3GN1A 5ILGA 4HFMA 3FTNA 4PLYA 3E48A 2CDBA 5DN9A 3AUSA 1P1HA 1QYVA 2Q4BA 4TRNA 3D4NA 2BGKA 4BNYA 1JN0A 4D3SA 3O03A 2FOIA 5CDUA 5FI5A 2A92A 5EERA 4QUKA 1KVTA 1DHRA 1GUYA 5G0TA 3UAGA 2JD0A 5EMHA 3S55A 2W2KB 2O2SA 3T7CA 1YDEA 3IIEA 4TROA 5JBIA 4GX2A 3ADPA 3EGOA 2C5AA 1KC3A 4WCFA 4MVJI 5AXBA 2GGSA 5T64A 3ANNA 1GYQA 3ZWYA 3V1TC 1J0XO 4LGVA 3WXBA 4B8ZA 2PV7A 1XELA 2BFMA 5KKCA 1ENYA 2JD2A 3D7LA 3CPSA 2Y68A 1VPDA 1MFZA 1LSUA 1X7HA 1Z74A 3B6ZA 5CHEA 1C1XB 3JQEA 4RPKA 2AQHA 2ZYAA 3PIDA 4RF3A 5EJ2A 5CDYA 1Z82A 4Q3CA 4B8WA 5L53A 4CM4A 5F3RA 2EKQA 1PZHA 2EJWA 2W4QA 3HWRA 4DQVA 4G5HA 5CAEA 3I9JA 1CETA 4GX1A 1E3WB 3LLSA 4WCDA 1EK5A 1B2LA 1A27A 4HNHA 4KQWA 1PL7A 5H81A 2WMDA 2RHCA 1VRWA 1EZ4A 1ZSVA 3FR8A 3MJTA 4CLXA 1R4NB 3VPGA 3GGGA 1IUKA 1OC4A 2FR1A 4ONEA 4PG5A 5TLSA 1BW9B 1DJQA 3FR7A 5L4SA 2PNFA 4J7CA 4YQZA 4E2ZA 4JJGA 4XB2A 4PLGA 4NR0A 4CMAA 4TKLA 3PYXA 1PSDA 4R51A 4ITUA 3WWYA 3ZHXA 2YQ5A 1JW9B 1LI4A 1IZ0A 3F6YA 4BNWA 2I3GA 4FFNA 3TJRA 3U5TA 3GEMA 1D8AA 2PTGA 4BO6A 4ALKA 1K6JA 2VUSA 3QWAA 1PJQA 4WCFC 4BO1A 4OXKA 3JYQA 2ZTUA 3QVOA 1JWBB 3ZWPA 4GMGA 3H6KA 1WAMA 4AJEA 3G0OA 4IM7A 4LRTB 1MV8A 1HZZA 3L0DA 3D5QA 3EMKA 1EQ2A 2Y1EA 3GLQA 3GVHA 4GX5A 2WJPA 3DOOA 2X86A 3DBVO 3IC5A 3VH1A 4IQGA 1I30A 4MIEA 2O50A 4BB6A 3DHNA 5HRUA 1FDWA 4J4TA 1K89A 4YJDA 3P7MA 2AW5A 3JSAA 2ZYGA 1GDHA 3BMNA 1I32A 5T57A 2DBQA 4ID9A 3C24A 1C0IA 4NHEA 1ADCA 2X58A 4OSOA 3G17A 1NAIA 3JV7A 4MIOA 2NV6A 3RVDA 4J6FA 4JP2A 4L0QA 2Y1GA 5DNAA 3ENKA 3DDNA 4CL3A 4FFRA 3INRA 2XXJA 4W9NA 4EEZA 4FJ0A 4N5NA 1E5QA 1P45A 1V3UA 3JQDA 3KO8A 1NNUA 4IDFA 2NU8A 1E1NA 1YH3A 1PGPA 4HY3A 2GASA 4A7PA 3HHPA 1ZW1A 4CV1A 2JKVA 5CDSA 3IKVA 3E9MA 1B16A 5U9CA 4JP3A 2EHDA 2YV3A 2P5YA 2V6GA 1LC3A 3U09A 2HKIA 2J5RA 2Y93A 4OAQA 4BO3A 3INGA 3E5RA 4J1SA 4LRSB 4DUPA 1AGNA 4YT8A 4JIGA 3GRKA 4B4UA 9LDBA 2VYNA 1YB5A 1DC5A 4GBJA 4ZD6A 2QW8A 3KVOA 2YHUA 1VE9A 3HE3A 1U8FO 2Z1MA 5I8WA 1W4ZA 3E8XA 4P4LA 4IQ0A 3OP4A 5JAIA 1QYCA 2JL1A 4OKIA 4JJFA 4CMBA 4XRRA 2Y67A 4W7IA 2FZWA 4HFRA 5IDXA 1A4IA 1VKNA 2CDCA 3I23A 5AQ1A 1TLTA 4IS2A 1NQAO 3RIHA 1EVYA 1EQUA 3NEPX 4DBZA 4ND5A 5LDGA 1IHYA 4I9NA 3GGOA 5KNLA 1A5ZA 1EEHA 1KEWA 1DFHA 3U4IA 4DMLA 1EVJA 3QVSA 3ZHYA 2PK3A 4GL4A 3FTPA 2HMUA 3C8MA 4PZDA 2Z5LA 3RROA 4CM6A 4IDBA 3OA0A 5JY1A 2XF8A 1E7SA 1H6CA 2Y1DA 1CDOA 4HUJA 4Z0TA 2ZYDA 4DXHA 2GRAA 2H1SA 4JBGA 1CQIA 4W9NC 4CMJA 2B0JA 3STHA 1ZEMA 3VKVA 5G4LA 5A3JA 1B15A 5A02A 2E49A 4O59O 4URFA 1I33A 4M55A 4I9UA 3VTFA 1LU9A 3JYOA 3FSRA 4FW8A 5DF1A 1Y8RA 3UCXA 4A26A 5ITWA 1E5LA 1U3UA 4FJ1A 2DPGA 3AFNA 3EC7A 3QVTA 4K26A 1LA2A 4GKVA 1J49A 5BNTA 1NBOA 2JCXA 1GZ6A 1E1KA 4UEOA 4HBGA 4RORA 1ISMA 2JAPA 3AU9A 3LYLA 4MOWA 3VH2A 4MPDA 1P0FA 4NPCA 3TFOA 4RPLA 5KOIA 2E6UX 5A06A 5I7EA 3HADA 5DCWA 5JS6A 1DRUA 3PHHA 2OGUA 2H5LA 2YY7A 2AEMA 1KS9A 2O7SA 3AOGA 3BTOA 2DT5A 4WPGA 3CINA 4R69A 4WGGA 1SNYA 4GMFA 3ANLA 5JW6A 1Y1PA 1PZEA 2FN7A 3PHLA 5ICMA 3VVBA 3WMWA 4L75A 3LC7O 1P1JA 1WDLA 3PLNA 3GT0A 3EY4A 4DPLA 1PQUA 2VWGA 2J3KA 4TKMA 3LT1A 3RAJA 1DEHA 4OOFA 3L6DA 3OEYA 3SLKA 4MIYA 1H0KA 1GL3A 2D0IA 5L4NA 4RCVA 4BIIA 1NVTA 3GOHA 4BO0A 4D7AA 3RQSA 4QXMA 3ICPA 5CPFA 3OA2A 3P2OA 3QJ5A 4OQZA 4FFLA 1Y9AA 2OMEA 1LUAA 4MDHA 1GR0A 1PJ4A 5TGDA 2C20A 3OJOA 4OKNA 2I5PO 1ZMTA 2UYYA 1PR9A 4EJ0A 1JVSA 2DTEA 4I5FA 3A4VA 4EJ6A 4RO0A 3I83A 3QQPA 3FNGA 2D1YA 1NPTO 3OEWA 4IJVA 5GZ3A 4F3YA 2ZB3A 6ADHA 8LDHA 1H6DA 1MXFA 2BFOA 2G1UA 4JROA 2NU7A 2O4UX 2DAPA 4E5PA 2ZATA 4E2WA 1P77A 3IP1A 4HP8A 3AUAA 4J49A 2Y1CA 2CSUA 1S7CA 1XQ1A 5KWEA 4CMIB 3C3XA 2CF5A 4Y9DA 4BQPA 5IXSA 4GI2A 3ROMA 2GN6A 3PLRA 3G49A 4ZRNA 2UUOA 3UW3A 1KEPA 1PJCA 1H2HA 1NR7A 2UVDA 2DBZA 4BMVA 5IZ4A 3NDJA 4CUZA 3WLFA 1ISHA 2HAEA 4PLFA 3LLVA 2CFCA 4NQZA 3RC9A 4Q9NA 1KEVA 4ALIA 5B4VA 4DREA 2D59A 3PPIA 3Q11A 1I2BA 4PLCA 3JYNA 3Q9UA 5L7YA 2IZ0A 3PRJA 1OMOA 4CLOB 3MJSA 4DLLA 4UUNA 4D41A 4YPOA 3TWOA 1YBMA 4OHUA 4LVCA 4E6PA 1IULA 3DZKA 4MJLA 3GFBA 3RBVA 4AJ1A 4INAA 1JKFA 5A03A 1GQQA 4UULA 1YKFA 1NQ5A 2DQ4A 4XJSA 1BVUA 1Q0QA 4HXYA 2PGDA 1PTJA 2C2YA 4BVAA 3WGQA 2VOEA 2B4QA 4I5DA 1V6AA 1WPQA 1K6IA 1Y7TA 2C0CA 4R5HA 4ROSA 2Q2WA 2OZPA 3E6AA 4H7PA 1Z45A 1GV1A 2X1HA 4AJNA 3KSZO 1HE5A 2POQX 1X15A 4J91A 3GZNA 2AE1A 1EBFA 5CG2A 4R3WA 5C3MA 1O6ZA 1GZ4A 4J9UE 1O94A 2LDBA 4YJGA 3RBXA 4BGIA 1EK6A 3H2SA 3WB9A 3RFTA 1EFLA 4WCFB 3RUIA 1ENPA 2C7GA 1T1SA 1DHTA 2EWMA 2OOSA 2HQ1A 4GGOA 1Y5MA 2DBRA 3HDHA 2D4AA 4XGIA 3WS7A 3UH1A 3N58A 3DAPA 3KBOA 4JBIA 3NDRA 1ZSYA 4HX5A 3TZHA 3H9GA 2WD7B 1VL0A 3N7UA 4CMEC 2RIRA 2WSBA 1D3AA 4FDAA 5HWSA 1A72A 4CM4B 4DVJA 4M1QA 1XLTA 3BIOA 3AOEA 3F3SA 4NBWA 4W6ZA 1HRDA 4WASA 2NU6A 2IYPA 2O3QA 1DLIA 1LSOA 4BKPA 4TWRA 1B3BA 1V3VA 2Q1UA 3AY7A 5TJHA 4B3JA 5J23A 2CVQA 2VUTA 3RUDA 1EDZA 5DULA 2J3HA 3QW2A 4DC1A 4YQYA 4MO2A 1PJTA 3K9QO 3MTGA 4IIUA 4IDAA 3WWZA 1LLDA 3ZNPA 2DUUA 2VZ0A 4J0FA 3VDRA 2X6TA 1PZGA 4DIBA 3D3WB 1PL6A 3DC2A 3VPHA 5L7TA 2VTDA 4CM8A 1I3LA 3O26A 4QTZA 1UAGA 4I08A 4UAGA 4BKRA 1K6XA 3ZW9A 1I0ZA 4YT5A 4B4WA 5TX7A 3S1LA 2BFPA 2OP0A 5DP2A 3DHEA 1FK8A 3U4HA 4U0KA 4YRBA 5F1OA 2GN4A 3PGJA 1DRVA 4OXYA 3NYWA 4P22A 1QLJA 4P4NA 1NFQA 4PN3A 1VLLA 3ZNNA 3ZV6A 3TOZA 4J0EA 2NUAA 5TIIA 1HXHA 3VPXA 2BGLA 4BNVA 4YWJA 1H5QA 5K1SA 3HN2A 3PGXA 1NWCA 3PZRA 4CODB 5AVOA 3QWHA 1H6AA 1T2FA 2VUUA 1ADFA 1MLDA 1R0LA 3WYBA 4ZQGA 1F14A 5F5NA 2AHRA 3DBLA 3RUAA 1NWHA 1VJ1A 3WOHA 1E6EA 3AOEC 4MP6A 4JK3A 4RPHA 1PEDA 2EW2A 2JCYA 2P9GA 4LSWA 4BNKA 2X5JO 4RLSA 3DMYA 1PJ3A 3AM5A 3O9ZA 3WIEA 3PJEA 4DQUA 4L74A 2ZCUA 1G0NA 3KYDA 2IXBA 4EEXA 3PHIA 5ADHA 5BNFA 4F6LA 5K0ZA 4E3ZA 3WMXA 1H6BA 2P5UA 4RDIA 4ZQBA 3WGHA 4EZBA 5T8KA 2AA3A 4D43A 1I3KA 2PD6A 4JGBA 4FFOA 2C07A 2V6FA 3VH4A 2BRUA 1HDZA 4E5KA 3HFGA 2FPIA 4XYGA 4IXTA 4ILKA 3VDQA 2ZB4A 2GSDA 4QFCA 5EINA 5DT9A 3O8QA 4FR5A 2X8LA 1XA0A 2Q2QA 1NFRA 3BYZA 4RF5A 3KZVA 1HE2A 5JPIA 4BV8A 1R6DA 1DIBA 2DM6A 1LBEA 2ZTVA 1VJTA 3X2EA 4WLEA 1Y8QB 2X0IA 4M8SA 3UCFA 4Z9YA 1ID1A 2NTNA 4Y67A 2VHZA 5L51A 4PG7A 3GA0A 4DIOA 1P0CA 2Q45A 2YDXA 2GZ1A 5B12A 1T25A 4RVHA 1LNQA 3FD8A 3TL2A 5A5EA 1ENOA 5JC8A 2C2XA 2CD9A 3ULKA 1BSVA 2X5OA 3NJ8A 1UXGA 4B3HA 4RDHA 2X4GA 3GG9A 4DL9A 4AJPA 3C1TA 1U2GA 3ZHBA 3JQ6A 4GQAA 3ZN2A 2EKPA 3I6IA 2IRWA 4E32A 1E7QA 1UJMA 2Q1SA 3IL2A 3DONA 4DLAA 1Z7BA 3C1OA 5THKA 3AI3A 4DMMA 3KEOA 3E03A 3E5MA 1CRWG 5TRTA 2I65A 3JQFA 4UREA 5JCJA 1FXSA 3KYCA 4ZN6A 4ZQEA 5BQFA 1DDOA 1T26A 2GNAA 2HU2A 1PL8A 3R1IA 3ICCA 4HKTA 4NI5A 1YJQA 4CUJA 4XJTA 1S6YA 3NTQA 1BMDA 3U9LA 4ZICA 1H93A 4UEJA 1U8XX 1Q7CA 2W2LD 4JN6B 1WDMA 4E5NA 3FWZA 2E82A 2Q3EA 4JX8A 4BGVA 4YA6A 2OFPA 1MG5A 3NT4A 1U4OA 3EDMA 2YFHA 4WJZA 2O48X 2V6MA 4GVXA 3WBBA 1PR3A 4L4RA 2CVOA 3AUUA 4N5LA 4YDRA 4BNNA 3RU7A 4D45A 3H2ZA 1F17A 1I3MA 1RM3A 1U3TA 2WYWA 2GERA 2BELA 2IODA 1ADGA 4E2XA 7MDHA 2EXXA 2B36A 4WK6A 3JTMA 1E6WA 1BWSA 1SZJG 4R1SA 1YS4A 1NPDA 4HADA 4XQGA 1TT7A 1XDWA 2AG8A 4IDCA 5A9SA 4EI2A 4PFJA 3IDSA 1CJCA 2Z95A 3DMTC 1GEEA 1Q7BA 1XWFA 3TZKA 2Q49A 1VJ0A 3BZUA 2E48A 4KTTE 2AEJA 4XB1A 2EKLA 1UXKA 2XXBA 4YXFA 2I99A 5JNLA 3JQAA 4Y8VA 5EL0A 3WJAA 1GPDG 1UR5A 4NH4A 2WDZA 3BA1A 3JQFC 3CSDA 4HFJA 3O38A 3Q0EA 1HYHA 3ZCXA 1XCBA 5L95A 2PKQO 3KRTA 2PGJA 2IYOA 4TRMA 4PG4A 3W4JA 1RKXA 4OMUA 3RC1A 3OIDA 4Y6SA 5COQA 4B7XA 3LF2A 3LT0A 1M75A 3NAQA 4NK4A 4DYVA 1BRMA 1DXYA 1R15A 2G82A 2HCTA 3JQ9A 7ADHA 4HV4A 3NT5A 5CFZA 2QRKA 1ZIDA 1PGQA 1YL6A 1GQYA 2BMAA 5MGBA 2QYTA 5T67A 1HSZA 1V9LA 1Y81A 2YJZA 3ZHZA 2NLOA 3LSYA 3SX2A 3GMSA 1SC6A 4E31A 5G2OA 4YR9A 1XGKA 2HMSA 4WLVA 3OFSA 2NWQA 1OAAA 3QLJA 3K31A 3MWEB 1LRLA 1LRKA 1E3SA 1P1FA 1NYTA 1QV7A 2WYUA 4Y6RA 2J5KA 3W1VA 4IMRA 1JWAB 3RC2A 1Z6ZA 2HMWA 1Q1NA 2ZJ0A 3Q1LA 4K6FA 1GV0A 5TS3A 3JD2A 3SJUA 2QG4A 4KDEA 5AXAA 1BVRA 3U0BA 5C5IA 3JQBA 3Q6IA 5TJ9A 1HTBA 1MUUA 5MDHA 1PS0A 3GZ4A 2ILTA 4OOEA 3FWNA 4YEDA 3ZWWA 3ITKA 2D8AA 3K73O 1HDGO 3ZWCA 4JJIA 3WGIA 4OH1A 3NJ4A 2NU9A 3EZYA 1D1TA 3ZH2A 1HSOA 2VRCA 4L76A 5AOVA 3ASVA 1WZIA 4NJMA 2O3RA 1ADBA 1YE3A 2PGLA 3WLEA 2VWHA 4II2A 4PVCA 1CWUA 1WMAA 2AEFA 5I9NA 3HB4X 4IXWA 1GD1O 1SAYA 3TQHA 4R4JA 2W8ZA 4JXKA 1A7KA 4Z9FA 4J1NA 3F5QA 1NXQA 4PLZA 1HE3A 1NM5A 3PTZA 2HSDA 1WXDA 2CNBA 1PZFA 3JQ9C 3SXPA 5C7IO 1NAHA 3GC6A 3KOUA 1YB1A 4PLWA 1Y5RA 4BOYA 2HRBA 3QA9A 4IDDA 4CM9A 2WWRA 1N92A 4WE3A 5JSFA 2WE8A 4XWYA 4NBRA 5JAMA 5JAQA 4FD3A 5TT0A 4DTIA 4AJIA 3OQ6A 5C37A 2YYYA 4TMFA 4BO4A 3F1KA 2IZ1A 4KZPA 1U4SA 4CLHA 1HWYA 4PLVA 1C0KA 4YJGB 1AXEA 3B70A 3JQGA 2JAHA 3DZFA 2R2GA 1ONPA 1EVZA 3WG9A 4YYZA 3MJEA 1KBZA 3W4IA 2ZQZA 4ZHSA 1ZZEA 5CEJA 3JQBC 1KOLA 2GLXA 3DAFA 1GTMA 2H63A 4BL5A 5IDWA 2BGMA 4TQGA 1A7AA 2UDPA 1KC1A 1FDTA 1E7MA 4FC7A 1C0PA 3H4VA 1OOEA 1HDXA 5CEFA 4XD2A 1V0JA 4MVJG 4MVJE 1LTHR 1DIGA 4AJHA 4LW8A 1UXIA 5H82A 1XIVA 2GYYA 1BXKA 1U28A 2I9PA 3RUFA 5LC1A 2JHGA 4UUMA 4KQXA 5G0SA 4IDEA 4AL4A 5A5FA 1JA9A 4YRDA 1ULUA 1GY8A 4IUYA 3SC6A 1ISJA 3CKYA 3JYPA 3P19A 3P2YA 3E82A 3ZV5A 1HDCA 2EP7A 4B3IA 2ET6A 1B8PA 3D64A 3UHAA 1CERA 5COBA 4J16A 4WEOA 4A0SA 5IXYA 2NVUA 3Q2KA 3JYLA 1YVEI 4CM3A 4BKUA 3EVNA 2ZB8A 5U1PA 4BO9A 5B4UA 3ZWOA 1XSEA 3ANMA 1G0OA 5FI3A 3RCBA 2GCGA 1SPXA 4LMRA 1BXZA 3O4RA 5BSGA 4E33A 4RLHA 5ER6A 1YO6A 2AQKA 1IY8A 3GAZA 3BTSA 3ETDA 3WSVA 5JDCA 5HBRA 4D3FA 2O3SA 2VWPA 4BNXA 3ZGYA 3INTA 3AI2A 2VYVD 2P68A 3ZU2A 3ZWNA 4O5OA 5JLAA 3VOSA 4GPD1 2OXIA 2CUKA 4CLEA 4BUCA 3ZV4A 4MVJA 3GVIA 1BXGA 4PGFA 2O23A 3DBHA 4DBVO 2RBEA 2G5CA 2Y0DA 5JMPA 3RWBA 3TF5A 4EUFA 1YXMA 3WIDA 5IDQA 1QMGA 3KSDO 1EE2A 4RZHA 3GG2A 5TC4A 3RFVA 2RCYA 3K8ZA 1B8VA 4N5MA 4Q3NA 4GKBA 3JQ7A 3UICA 2X23A 3PJGA 3K2EA 3QE3A 2D3TA 5AYVA 3JQCA 3GPIA 4IDGA 1TI7A 2QRJA 2R00A 3QVXA 4WLFA 1PS8A 1R0KA 3A06A 5K9ZA 2DLDA 1NPYA 1QYXA 3GFGA 4YCAA 2O4CA 1WLYA 2EG9A 1I36A 2FY8A 3VZQA 3OM9A 3RJ9A 3PWZA 4DRYA 1OC2A 2C82A 3B1JA 3RU9A 3T7EA 1Q2XA 4B7UA 1IOLA 2OBYA 4PVDA 3AU8A 4PLPA 4TVBA 3UUWA 3VZPA 4DYDA 1OZAA 4XEHA 2OUIA 3I3OA 5KVQA 4YAKA 4Z3KA 3SBOA 2W2KA 1ENZA 3WICA 5I9MA 4Z3DA 2B4TO 3D5TA 1DAPA 3F5SA 5KJ1A 1OBFO 3BAZA 5JDCC 5CDGA 2ZKLA 4NNJA 4KTVE 2FWMX 4KOAA 1Q0HA 5JAZA
chains in the Genus database with same CATH superfamily
2LD4A 1PKEA 2IWRA 1WZCA 4IVRA 1SURA 2ZJAA 2VJNA 5JRJA 2H8KA 2B3TA 2JGKA 3BMCA 4US1R 4B76A 5J2UF 4KUHA 2BTQB 1TM2A 1MB3A 3B1VA 3FRHA 5DLPA 3TK1A 3OZWA 3RT7A 1JP7A 1XZKA 3KJFA 3H5AA 3KB1A 1YFJA 1V16B 2IEGA 1O4VA 5CB4F 1W8IA 4Q12A 1UBSB 4F4DA 4BE4A 4NATA 2VH1A 3C6YA 1N3YA 5F9HA 1ZNXA 4EUEA 2CLSA 3GLGE 3QTLA 2Z3ZA 1UM9B 3CVJA 4C4YA 4Z7QB 3ESZA 2X77A 3RT9A 5FAXA 1YUMA 1FDSA 1SQ5A 3U7IA 2BDEA 2J4CA 3JWJA 3JATA 4IMPA 4YDQA 1BDBA 2IYAA 2NTYC 3DL4A 3VR4A 1DFIA 1GSOA 3B6KA 1QHHA 1QHYA 3N8HA 3OJEA 4NOLA 3T1VA 4EW6A 3TUJC 2JFWA 2QMEA 1FSZA 2AG1A 2WHPA 3NVAA 5DBFA 3ZZ0A 6PFKA 2Z2ZA 4GNRA 4Z9XA 5LL6P 1J1IA 3OZDA 4W9MC 1VXOA 1SO8A 1A69A 2CZGA 2RONA 3U1TA 5IK2A 2PO7A 3GGCA 1LJ8A 2PQMA 1ACJA 3MWGA 1LK5A 5F78A 2BD0A 3K1JA 1G8KA 2Z6UA 2PT7A 3BFKA 4I4NA 1DC3A 5FADA 1XF9A 4RTPA 5JY6A 1XDBA 1UP7A 4E12A 2WKWA 3GY0A 4OL9A 4OVKA 1F48A 1SKYE 3KNZA 1VPTA 2PXHA 4FHGA 3BIJA 3UJDA 2YWEA 3BGVA 1TA4A 1L8OA 3I1JA 4ADSG 5IXJA 4JCCA 3MMXA 3LBIA 4JJZA 3VPFA 3SHVA 4NU5A 2KPOA 2Z04A 2HA2A 1VMDA 2J0UB 4IIHA 1RIIA 4EYEA 1SKAA 1J4AA 1R12A 2IJGX 4JT4A 3QPDA 4LPSA 4EZEA 4F85A 5HUQA 1J70A 1W9HA 1T5SA 1YZGA 3H3FA 5T6BA 5JCXA 2ZBEA 2H52A 2YQ4A 3SLGA 2B8TA 4CMHA 1T8PA 4RGQA 1D0VA 1JTVA 5GM1A 3VAAA 3H42B 3E9QA 3S81A 1O94D 4NS1A 3R7WA 1VYTA 4V38A 4PO1A 1CVIA 4QC2A 3VVCA 2PDAA 4LNAA 4XIGS 4NECA 4Q1BA 3H9QA 2ZPTX 2FSFA 3Q8XB 5LIRA 2IZZA 1YMUA 2ZB7A 3KT0A 4BQEA 1MO4A 2IP1A 4F9TA 2G9VA 3HR8A 4FDVA 4O3FA 5BO5A 5AH0A 2HA4A 1U6KA 2CLIB 3HXQA 4UOEA 1Y6QA 1G60A 3TZCA 2QPAA 4L7VA 3NC1C 1W44A 2FW1A 4ER7A 1SEPA 3FYTA 4JUDX 3CIFA 4AJKA 1KERA 2WIGA 3LVRE 1JKXA 5U4QA 5ARBA 3TXAA 3UGTA 1Z0KA 5CEEA 1FQKA 2XLCA 4AUMA 1DC7A 2RAFA 3ZC3A 2BL4A 3HR7A 1KPHA 3L4SO 1CG6A 4G0XA 4OGLA 4UUOA 4QFBA 5F4ZA 4KQFA 1J25A 1MGPA 3KTAA 3L07A 2JFBA 4XM2A 2X8JB 1Q1AA 3HYNA 3KHTA 3EPJA 5I8ZA 4TYWA 5GZ6A 4ED9A 3ZK7A 1NC1A 2ZYHA 3F47A 5D5HA 1YZFA 4IUCS 1D0SA 1DKNA 1G8PA 4OJQA 1ZK3A 5G0WA 1LBQA 2DFLA 2YYAA 1Y3FE 3HCNA 1SVNA 1N78A 1UKZA 1X80B 5TQVA 3T7AA 5EJ5A 3SX0A 1NQWA 4Y2YA 3V4PB 2P8SA 5DTRA 1NXOA 4EG8A 4PSAA 5HNKA 4WZAA 2QRGA 1CYDA 3LWNA 2AJBA 5BSTA 4K9LA 4OK6A 4R2MA 1BCRB 1L7QA 4H6PA 2RG7A 4MEAA 2GI4A 4Q5IA 4R3NA 4LRQA 2ZVQX 2RBKA 1I1QB 1R3UA 3LOQA 5IAGA 3FOFC 2H1HA 3EY9A 3OWOA 4V1CA 1QKIA 5LN1A 2FEMA 1R9JA 1M67A 1XVUA 2IVZA 2PZGA 5HEKA 2XCTB 1ODSA 4BB5A 1W4BA 1XU7A 2I54A 2YTZA 3MERA 4PTYA 4RJTA 1G2IA 3I4CA 1EG2A 1RJGA 4QEDA 4KODA 5KCMA 2SKEA 5FX2A 3OETA 1XRQA 2GVZC 3HNPA 3Q3CA 4U63A 5KVCA 3QSYA 2XYPA 3DOIA 2P4UA 5I7SA 2JEYA 3R77A 4H7KA 3SZOA 1PYDA 1GFZA 4C4OA 4QFDA 1DB3A 2IIQA 4EHBA 2FPPA 2FR8C 4OJNA 1XPRA 3GH3A 1CLEA 4BRWA 1YWGO 3LPMA 4MRVA 3AJAA 1P3JA 5CJJA 2Z56A 3T4EA 3PEYA 1TAGA 2AD5A 5PGMA 1N1GA 1ZD1A 2VN8A 2RJNA 2V1XA 2OCIA 2VJBA 2XT0A 5ECYA 1UFQA 5K8LA 5K3BA 1DEKA 2HUPA 2OFXA 3F1LA 2NP6A 1L5VA 3TQCA 3MOGA 1VZ3A 1KZ1A 3VO2A 4ZI7F 2VA9A 1RYHA 3SBEA 5A04A 4PN7A 1FMCA 1D1SA 1SVUA 3FDFA 3FNFA 1K8XB 4Q24A 2QIOA 4KW7A 3O8CA 1KE1A 4BX8A 2WK1A 2WUWE 4LVUA 2ZPUA 4HC4A 4HOYA 2Q3MA 4G84A 2OQIA 1UXJA 3SZGA 3UMVA 5M29A 2FDCA 2E5WA 2Y1OA 3VZRA 1XLTC 3GRPA 1B0AA 3HN6A 1BO6A 1F0YA 5LZ8A 5CYPA 4CQLA 1FU8A 2HDHA 2EL7A 4PW0A 1DQPA 2AF3C 1XAJA 1RHMA 2EV9A 1AMUA 1FP1D 3ROTA 3UXMA 1VMEA 5E3JA 4JT8A 5KYWB 2DETA 2QN9A 5TE9A 1AXGA 3ZCTA 3IQDB 1YOVA 2WP0A 4UDNA 4AC9A 4DA0A 1SQFA 2A78A 3A9SA 3LY8A 4QFMA 1CP2A 4F7WA 3WVNA 4A5OA 3H1BA 4RIFA 1O6GA 5BSWA 5EUBA 1PN3A 1TC2A 2HRQA 1W48A 2PX2A 3DE6X 3JQGB 2YYSA 3IR5A 2PYIA 2C54A 1BCSB 2QAIA 1C14A 2GPTA 9ATCA 4CKWA 3LKDA 5CD1A 3BEDA 1C9NA 4D8XA 1E64A 4BN4A 3VX4A 5HS6A 2YVKA 3DMFA 4G5QA 4MRMB 3QXCA 3E8SA 3JD4A 3TTYA 1OJ7A 2WTEA 5EMKA 4YMLA 5A1TA 1XD8A 3EAQA 1J97A 3T61A 4LRWA 4AJJA 1RM0A 2H16A 3K9HA 3GR6A 3TNJA 4L5AA 4MYTA 5LCXA 5E4YA 3P8ZA 4BP8A 1QIFA 1J20A 2NQ8A 1FJGB 3DCJA 1ZCJA 3W5AA 2IGTA 1P44A 1BWRA 3WWCA 2PLNA 3B78A 4KXQA 4TVOA 4YROA 5EFZA 4B6QA 4CDRA 4LHVA 3AUFA 2R85A 2OCGA 2AFRA 1ZN2A 5F52A 1LX7A 4NG5A 2OC9A 4DJDC 1Z18A 3DT9A 3RVNA 3K1ZA 1RM4A 3TE6A 1OSNA 2R8RA 2WPNA 3BGWA 3LUKA 1NW7A 4W99A 1UQUA 1ZWKA 4R16A 1LVGA 1D4OA 4J3JA 1NHWA 1NZFA 2PO5A 3EZ6A 4MS3A 2BFDA 2OYSA 3V46A 3MD0A 1RC8A 3JAKA 4M1YA 5HKLA 3AESA 4GKKB 4LF5B 3UXYA 1FFXB 4GQBA 4R2JA 1P2BA 4QPZA 1Y6FA 4AUKA 3PC3A 3GQVA 4AF7A 1D2NA 4K81B 2VRWA 1TQ8A 3VTZA 5K51A 1HKUA 1DKMA 1MA0A 2BFFB 2FE4A 2GXUA 4OMFG 3O4VA 2AJCA 3U2QA 4QGGA 4YLYA 3IBYA 3TI7A 1Q0TA 4F9FA 2BFCB 1QTRA 1A50B 1F1BA 3TM4A 4B6OA 1OWPA 4YAWA 4QBHA 1AUXA 2GN0A 3PFIA 4WKCA 3QVJA 1KI6A 3Q3HA 5F35A 1V5GA 7REQA 4C0HA 3UYKA 2OP1A 1BXGB 1XTZA 1WZEA 3ZG6A 1NV8A 4LVNA 4KQKA 3U80A 3BGOS 1HEYA 1ZR4A 1P2SA 2UZAA 2XHEA 3CS3A 4BNGA 2WTBA 1QH9A 3G8CA 1HQDA 4U6SA 3AP3A 1XKTA 1NW4A 5CDFA 3OQOA 1U3FA 3I6QA 1JF8A 2ZYUX 2O2ZA 3TLEA 4BO8A 4A4DA 1FF9A 3DD1A 1GPNA 3K3PA 4IJWA 1K7EB 4CDGA 3SHWA 3I9FA 2YVLA 5EJIA 2XMPA 2QYSA 2NXEA 4ND2A 5EE9A 5FPTA 4ZYXA 5JRDS 4BQRA 3LDUA 4YJFA 1O95A 1GU7A 3OOEA 5I51A 4PNZA 3BD7A 3DWEX 1K75A 3P71T 4G4SO 1QPZA 1H9CA 1ISIA 4D0GA 1XPUA 4RVGA 1TEXA 1NIJA 3TTSA 5AXCA 3LYHA 2XTNA 2V7WA 3S8YA 3OFJA 3HJGA 4JENA 2IOFK 4LJRA 1N2OA 3OLXA 1U2GC 2FZ5A 4Q3OA 4CIXA 1EPUA 2Q1WA 1L7XA 2JIZD 3MHTA 4BLVA 1Z4QA 2P35A 4C6TB 5F2NA 3LUJA 3T9DA 1WXGA 4B5KA 2MYPA 1QYWA 2WIDA 2LKDA 4L0CA 4L8VA 4K28A 3A70A 3NWJA 3PXEA 2IYVA 2J6IA 2ETVA 3C87A 4H1UA 5DASA 5TSDA 1GR1A 1XZHA 3OUUA 2OHIA 1Y4SA 2P6UA 1FQWA 2HMVA 1I4EB 4XUGB 4DE5A 2EGHA 3IHTA 3S99A 3T34A 5JATA 2BC9A 3L6OO 3PXUA 4RM2A 4BDSA 2O3JA 5GVSA 3OQIB 4FYXA 3IIMA 2XQVA 2QQ5A 1ZK4A 5FFNA 3D3EA 4KMMA 5BOSA 1N1MA 2OK8A 1A2QA 3DDHA 4URYR 4YAJA 4EI8A 2B7BA 3R6GA 5ALLA 3WDSA 4E7OA 2C5SA 4F38A 1FYVA 2GJAA 4Z0PA 3QP9A 4OQPA 4S35A 4DJEC 3KSAC 1OREA 3HJUA 4R3UC 3ASZA 3B5IA 4LMBA 4EABA 4R1NA 2WD7A 3BMOA 5GZ1A 4I2NA 3BT7A 5IASA 5DCYA 5FA8A 1KU6A 4ZGGA 2WTXA 4KX3A 3KDAA 4LZJA 3R3JA 4ZDIA 4RVDA 4YLEA 1G17A 2Y2UA 5JSKA 1XXHA 3GJ7A 1KK3A 4U39A 3QEMB 3GIDA 2J7PD 3RS4A 5FEUA 5ISMA 3JPYA 1RKUA 3BPSA 3EXHA 4BFVA 3CVOA 3IUQA 3EA5A 4BUJA 1N9KA 1QB8A 1U9IC 3PC8C 3ZXIA 3LUBA 4ZQCB 1CZKA 3H65A 4KMSA 4ZIRA 2D62A 3BRSA 3OZBA 3GPLA 4HMOA 2XBLA 3COZA 4RGVA 2YWJA 2W6CX 4A73A 1RYEA 5HZMA 1WUJS 3PQEA 2BJHA 4RMJA 1NA5A 3NHZA 5J5AA 4H3SA 3DT6A 1RPAA 2OV3A 2VRCD 1KIFA 3R9KA 3WLLA 3ZIAA 1VSTA 3KL4A 4QYWA 3JCZA 3MF4A 2O8CB 3ROQA 3TRFA 2GTPA 2FN8A 2BSAA 1U7WA 1KA9H 3ELDA 3QOFA 2BPOA 3NWBA 3CBGA 4FZVA 3PUVA 3ZEAA 4D4JA 1L5FA 5TVKA 3TB6A 2XCOA 2WYVA 3E1GA 1AHPA 1NYRA 3VC1A 3PUZA 3THXB 4MVJM 4C4SA 3D31A 3MQ4A 2SBTA 1RE1A 1D4ZA 1G8YA 3LXUX 5CB6A 1N2CA 1AGRA 4NYJR 1QRDA 3UUGA 5F9MA 4ENVA 2VR1A 1FDVA 1N0UA 1P19A 1Y80A 1E62A 1HEIA 4XD7A 3KZOA 4G24A 3UVEA 3R3XA 5EP4A 3TL6A 1MO3A 5MGNA 4Z49A 3OJLA 2HLPA 4G26A 2XMRA 3UGJA 1VJRA 2R7LA 1P5HA 1ORTA 1ZJYA 5C8YA 1QHIA 1RQ7A 2FSHA 1U5BB 1E61A 4OQLA 2XMGA 3AJEA 2IE8A 3LT2A 3AW9A 3NX4A 3R6LA 4M6WA 3UJHA 1TCCA 2IVFA 3QMMA 1JMYA 1G8HA 5LQDA 2B83A 4LJKA 4RTMA 5CJ2A 3GLGB 1U5CA 2OGTA 1G20A 3F4LA 4MQBA 5E7JA 5ENZA 4AF8A 1VYVA 4BVHA 4Y1FA 4IKOA 3FCUB 1GKLA 1AU9A 3RVLA 3C5WP 3UJCA 5LQMA 1GCAA 2ATCA 2XQGA 2IU3A 3K35A 3RKSA 5KYXB 3O2JA 3DGFC 3GP3A 1XU9A 3HWWA 1QR6A 2AUTA 4QDOA 3EUWA 2HK8A 5MDHA 5EXTA 1LZLA 4CQMB 4CKBA 4IOJA 3KDSE 3GNSA 1K2VN 1DP4A 1KBQA 1BFKA 5F1PA 4K9QA 4U4AA 4NCBA 1J8QA 4GKAA 1OFIA 1K86A 1A5TA 1IK4A 4FK8A 1LY1A 4CL8A 3ONEA 3OU7A 2XEXA 2HBZA 2AR7A 2VPZA 1K7SN 2LCQA 2LIPA 3RTCA 1XRRA 1SKYB 2WM8A 3HM9A 4WNCA 1L7VC 3E9NA 4MVJH 5AJVB 1RXYA 2HA5A 5ERYA 5J2TA 4JY7A 3W5SA 3ADKA 3LHDA 3KKEA 1P9LA 1TT5B 1W4RA 2EF1A 5KAPA 2CHGA 2XUIA 1ILWA 4WK0B 3JQ8B 3IAM1 1T0BA 5T4BA 3R2JA 4EY7A 3A7DA 1PJRA 5IN4A 3TD6A 4AY5A 3K5WA 4UVDA 1QP8A 4L9RA 3PVCA 1SUIA 4NV3A 5HSGA 3N2EA 1RMTA 4Z1OA 1E1QA 3AB8A 5EJ8A 2EGUA 4QGSA 2VIIA 1F8FA 5I5GA 3AEYA 3A6FA 4JQZA 2XOXA 3L82B 5J5CA 4I1IA 1UT6A 5ESDA 4BNUA 3R6DA 1EMDA 5KYYA 3I61A 1EP9A 3N7AA 1HA3A 2XUGA 1Q83A 4TWIA 1MQ8B 2K87A 2VCEA 5GIOE 1H69A 1BFDA 2ZUSA 1R4MA 3KQMA 4F9GA 1Y1KE 1E20A 1UFKA 2DRIA 2HB6A 1X42A 3Q4GA 5FF9A 5JNLA 1US8A 3BQMB 2O2CA 5MF6A 4HEA1 2HK7A 4UUQA 5ALTA 5GTDA 4IQ8A 4HGRA 2AEEA 4KSCA 2B69A 3A9UA 4KO3S 1TTHA 4OFWA 1W5EA 3JZAA 4BFUA 1ATIA 5TQ2B 2JLVA 1WTAA 4FBGA 4CM8B 4I55B 4HDSB 4W1QA 1X94A 3W4KA 2E5LB 1IATA 2ARKA 1PJZA 2HNBA 2VT3A 4XGQA 2PWAA 1DEXA 4CF7A 3FRIA 5FL7A 1XMSA 3HMKA 4P0TA 4ZAXA 2H85A 3GA7A 4ESOA 1U94A 5JAHA 4UEKA 4EY6A 4F93B 1UP6A 3D3QA 2GBGA 2XUZA 1L1FA 5ALXA 5JTUA 1SBYA 4DQKA 1TTPB 3WK6A 3IVGA 4D80A 1PHPA 2O2GA 4F3CA 1LGYA 3OJ0A 5JWHA 2WEKA 1N0WA 3BILA 4C2AA 3OTGA 1OTYA 2FJUA 1NRJB 3LUHA 2TMDA 4Y3UA 4ND3A 4BLWA 1TM4E 3M5PA 4D82A 3RARA 3LHFA 5HXAA 5YASA 1GFSA 1IBKB 1X0XA 4TMTA 3AK4A 3L05A 1C9MA 3GJ8A 4M8LA 4C6RA 4RVUA 4TVKA 5LP6F 2Q3LA 1A1SA 3IODA 3MWJA 2PRKA 1W0KD 2F1KA 2YXBA 1NURA 4GECA 3F6CA 1S2NA 3U7QB 3IKMB 1YZ3A 1VB3A 4GLLA 3HQ4O 2WWFA 1Z16A 5EE3A 1OW3B 2QZ9A 2EJVA 2JI7A 2YXEA 3A1WA 4LYYA 4CTKA 4UTPA 1YE5A 2VSQA 1XJQA 4QELA 1Z33A 2F17A 5BORA 5HUHA 4NZZA 5G4KB 3C2QA 3VHXB 2VYVA 4N39A 3L6EA 2WJYA 4CM5A 2Z08A 4HK4A 1U98A 1UBJS 1E1MA 3ELWA 2X8BA 2BF7A 1TAQA 3G59A 5A6SA 3AFHA 3CF0A 4Q1DA 1TIKA 1N25A 4LCJA 2KLHA 1T4CA 3R5KA 1HFJA 1QRRA 1S8AA 1P2GA 1V35A 3I6BA 1YHYA 2OR3A 3LDHA 4J16C 4RV9A 5IC6A 4X3CA 4KWHA 2FU5C 4OTZA 1GT91 5JT1A 2AOTB 1PS9A 2IE0A 4Q01A 1LS6A 2HFKA 4R84A 1XB2A 4TN5A 3U31A 4JA0A 4D02A 3L02A 4P4TA 4F72A 4NYIR 4PEVA 1NYLA 3SF0A 4AS2A 4IXNA 4IV5A 2QIPA 1ZUWA 1SM4A 2H54A 3AVTA 4U6NA 3VPAA 3HWX1 4OX9B 2IEYA 1N5DA 4XIJA 4UBKA 3SEFA 2JIQA 1VI2A 2FSPA 4Q3BA 1TGVA 2BUCA 3R4VA 4TV9B 5IJ9A 5AM0A 4RD3A 4YJ2B 5C51B 4I4TA 5BV7A 4LC9A 5JE8A 1A9ZA 3CN9A 2BKXA 2RHGB 4NESA 1IL0A 4GLOA 1RTKA 4M36A 4UOZA 2QV0A 1K7CA 3P9ZA 1NG9A 4EW2A 1UBCA 1ADJA 1R0XA 2VP0A 3C1AA 4K9NA 4ZAZA 4DA9A 3OIUA 5CXUA 4JHXA 4HH4A 2X0JA 5FUBA 1E4EA 4PQEA 1GDDA 2GXSA 5F33A 3IEIA 5KWJA 4WBSA 1C1XA 5E2IA 2HA3A 3FKSD 1OLUA 3K30A 4POAA 4CNBA 3CUEF 3PEWA 2ZZMA 3CH6A 3LC1O 3I2GA 4RFVA 4L07A 2CUZA 4RVSA 1C30A 4LI0A 5KPDA 3OO1A 2VJQA 3BFJA 4ZZ2A 3FHCB 4UUPA 1CF2O 3MWFA 2PA0A 2BR3A 3CUUA 2OLJA 3PA6A 4DPMA 3RANA 2HRDA 2CDNA 3DXYA 1N4DA 2Y77A 2PUWA 3GI1A 4BNZA 3K6JA 3BSSA 2VF4X 3IR6A 2DHCA 5K4GA 3J80A 4AY6A 3U7JA 3DE0X 2ACEA 2PKQP 3ED1A 1NP7A 3FTDA 3I5MA 1R4NA 1MB4A 2FPGA 4IEFB 3TDKA 2XMZA 1NXTA 2YW2A 2C96A 4HATA 5IBQA 1AO0A 5BN5B 4CM1A 1SBHA 3IP6A 4NBTA 3TB4A 1IN8A 4EHIA 1G21A 1MO2A 5BT9A 2ZWPA 4RGYA 2ZIWB 4YT2A 5T3YA 3CO0S 3IDAA 5T41A 2WIKA 1P0QA 3E9DA 4JXXA 1PWEA 3MRXA 3QRWA 1VIMA 3GIWA 2PX3A 2RBGA 2Z8ZA 3HJRA 1ULAA 4WOKA 2FGKA 3HBNA 3FDJA 4YV0A 5GINE 1KIAA 2NO4A 1NJ1A 2YHIB 2OORA 3ANTA 3PQ3A 4J7AA 4Y6PA 3ZI0A 3C7CB 3FNQA 1I4TD 2RSLA 4MWDA 4ANFA 2DBYA 1SCKA 3OE7D 3DCIA 2ZIAA 3FLBA 3NS7A 1KVQA 3NHLA 1VYHA 3F6BX 4MW0A 3SC4A 1XVAA 2EJUA 4DCCA 4LRXA 1B73A 3DO5A 2W6ID 2BFBA 1QVWA 4DNPA 1T3TA 3HA3A 4N65A 2BMWA 1WP4A 3I1YA 1Y3CE 3WQRA 1NX6A 4LFAB 4RPIA 3L8DA 3M6FA 3H9BA 5G3YA 2I29A 4RQUA 3BWXA 4NZ9A 3TAXA 2EFHB 3AIMA 3KUKA 5BR1A 3UF0A 1A95A 3SR3A 3OE5A 2V4ZA 4LY9A 1H94A 1NLZA 4RZSA 4ZPJA 1NLYA 3WRWA 2UZ4A 3EXEB 1BDIA 2Q3JA 4ALJA 5DN6D 2FA9A 3Q8WA 1LDNA 2D5CA 1P4JA 4UZSA 3TZ6A 3KVYA 1RJWA 3A4YA 1RI3A 2JLXA 1MG0A 1A96A 4COOA 2P67A 1YJ5A 1Q1ZA 3RD5A 1GGVA 4IGEA 3L7DA 4QDZA 2BN4A 2R8YA 4UCWA 3QMPA 2AKAB 1L8LA 4WBNA 1RYYA 2WSLA 1ZK0A 3FMIA 1B8UA 1XNGA 4Q4AB 3WKCA 4MQLA 5IU6A 2I67A 3S5JA 3VR5D 1F9EA 3DYVA 4D9JA 3Q41A 1E2DA 3QA3E 1PT6A 3NP7A 3OOWA 5JH7B 4P7KA 1S0UA 3D8SA 5KCZA 5G40A 3TRIA 1CEEA 2TMGA 2X4LA 1AHIA 3RS7A 3T5GA 1GHTA 4ARZB 2CVPA 3BFXA 3DAYA 4IHKA 3TQFA 5IBCA 3HGQA 5IN5A 3V2HA 2GR9A 3BRWD 3KG2A 1L6RA 3AF0A 3ILXA 1P7WA 1PJ2A 1EUZA 1E1LA 1JZTA 2WT8A 2OXEA 4J1TC 3I64A 2O05A 4NFHA 4MI6A 1JAXA 3A1VA 4BGUA 1SXPA 3RREA 3FH0A 1YCFA 5KNBA 1TIBA 1LTKA 2FEXA 3QLUA 3W2TA 1IRXA 4PF1A 2MTBA 2QJRA 3CF4A 1EXMA 5AQEA 1QG2A 2J9YB 2WJ4A 3BGDA 3FFTA 4PR3A 3OPXA 3R3HA 1TZ2A 1QAMA 1SC1A 3CR8A 1KJZA 2VPWA 4BFSA 5KNDA 1N9GB 1EUDA 1T4DA 2WQZA 4M0KA 4IIJB 4R5MA 5SZHB 1MW8X 3ZDDA 4O4IA 3KUXA 1XZPA 3N6RA 3SF8B 3S8EA 1G5IA 1L5HA 3OCXA 1VM6A 2DFNA 4V39A 4JI6B 3PEFA 1JDTA 3TEJA 4AZ3A 3DV0B 5LP6C 1T3SA 3GLFA 4MHTA 2CCJA 3ADOA 4AXBA 1R6TA 1M76A 2VYCA 3KPYA 4RHUA 3PU6A 2XAAA 1PFUA 3L18A 4TLDA 4DY6A 3PQFA 4MUIA 1UH5A 1YL7A 4UU0A 3TPCA 1XMOB 4QUIA 2QZJA 5IJ0B 1NXSA 4YCSA 4RQTA 1QXSA 1LFAA 1PK9A 2OO7A 4X1IA 1ZOLA 2R87A 2JS7A 2J3IA 1RYDA 1HBJA 4R0NA 1A77A 3GDWA 4GUAA 5FOWA 2WHEA 1AV7A 1E5TA 3RFCA 1T6BY 4UEQA 2A1UA 3SFZA 1A9XA 1B8NA 1T9ZA 2ZTSA 1E94E 2ORIA 3DJFA 4KOEC 2IPOA 2CKDA 3HN7A 4G41A 1TZMA 4ER5A 1AA9A 3E3LA 3L1VA 4MQ4A 2O1WA 3JD1A 4J7XA 1CUVA 4JHLA 1TM7E 5T4FA 3LQRA 2CNWA 2FPUA 1OFUA 2R6FA 1H5NA 1NMEA 1T0UA 5EY5B 2FF7A 2IYTA 2VPYA 4IZHA 4ECEA 1D2HA 1GGHA 5JRZA 3D8TA 3QOYA 2JFOA 2W6JD 3OX4A 4COKA 2OB2A 1SXJC 4I50A 2CMFA 5C52B 3CRRA 3A28A 2JGMA 3SEAA 2A0YA 3QOXA 2HK9A 5D5QA 5BWBA 2HPZA 4AJ2A 2P4QA 3BHIA 1ESEA 1EGQA 4TLAA 2WD8A 1V8BA 2JGJA 3BE8A 5E9WA 4CLRB 3H5IA 4B2YA 4KQHA 4ZEMA 4UHFA 2PUCA 1GXSA 2BM0A 5LPNA 4K5QA 4KFRA 2IYYA 1TPZA 5C1DA 3NASA 4J8PA 1MEJA 3VR6D 4OXNA 3W8EA 2YXLA 2ZRIA 1XVVA 2X9GA 2OBMA 3IQZA 4IHJB 1AVTA 1T8YA 2QTBA 4YPFA 1NNEA 1G3MA 1GZDA 4M1ZA 4H2DA 4WNIA 1OH6A 2DEUA 4JYMA 4N7RA 4EHNA 1MU0A 1KI8A 1P18A 2C99A 2IQ5A 3BG5A 3K1TA 3NOQA 4FFPA 4C7JA 1Y3DE 2FHPA 1W4AA 4N18A 1E9BA 1E2KA 3JYHA 5CTJA 3SHQA 4ZV7A 2ZWIA 1E96A 1XTKA 2YJTD 1MO5A 4IX1A 1Z37A 4R9NA 4UPVA 5T4EA 4N12A 2Q3DA 1LPMA 3DYIA 4KPFC 3T6KA 1XP8A 3DXZA 4YV7A 3N0XA 2V65A 7ABPA 1W1IA 3M89A 4GMHA 2NVWA 2CE2X 1I24A 4A10A 4R81A 2IOFA 4TTRA 1I2AA 2XUDA 4HN4B 3T3DA 4ZJUA 3Q8KA 4M8KA 3B8HA 3T4PA 5FV4A 4OEHA 3L4EA 4KIUA 3EGDA 4YVFA 1J99A 3AETB 3D1VA 2M2IA 4DFDA 1SEVA 2O7RA 4US2R 4JI2B 1CUSA 3DWGA 3GN2A 3OM1A 1P73A 3PX3A 5CVEA 3LBHA 1DL5A 1YZLA 3P0FA 4RL6A 1WA5A 1BYUA 4LQLA 5AUOB 5JWRA 3EDCA 1I7DA 4NZYA 3BL5A 6LDHA 5DBEX 2HF7A 2X1VA 2ZW9A 3ONDA 1Z5UA 2Y99A 3QBEA 3N8DA 3W2GA 1YRLA 3WLNA 1F3OA 3BL8A 2H4HA 4ZCSA 2O0LA 4BWVA 4F3NA 4UU7A 4PINA 1AG9A 3B9PA 3SBXA 1M6HA 4R40A 1IJEA 3ET4A 5FHQA 2H18A 1DNPA 4UTVA 1FLVA 5B3LA 3IP7A 3KZ1E 1VSQA 4ND1A 2Q0HA 2NZ8A 4QQKA 4O02B 1P74A 2N3ZA 1W4LA 4DLWA 4R9UC 1CEYA 1ZSNA 1NUUA 2Q62A 3R6TA 4IIXA 2DBVO 2CFOA 3OEHA 3RG2A 5E38A 2OKCA 1G3UA 2O3UA 4FPXA 2PAAA 2QE6A 4FFWA 4I4LA 4YJ3B 4B47A 4DCTA 1UM9A 1QYRA 2FH5B 1D4FA 2IKSA 3ILVA 4UE2A 5HTOA 4FSHA 1DJPA 5K8UA 1UJ5A 2JJ2A 3CX4A 3K32A 2WSMA 4XWGA 1V6CA 5IG2A 1KI1A 4BASA 1DU4A 1QOQB 4WADA 1P5ZB 2PVPA 2PMFA 1X3SA 4PC1A 3R8CA 3UGKA 1P0IA 2VZ9A 1W5FA 4OUDA 2PWBA 1EK0A 2DFDA 3NTVA 3OO0A 4R83A 4RD0A 2D5BA 3DBHB 1XYGA 5K2MA 3SK0A 4U2KA 4P3PA 3BUSA 1CUHA 1ZJ4A 2JAWA 3E18A 3QX9A 3H8VA 3QG1A 3A8TA 3K4HA 3LNCA 4ON9A 1GCGA 3QIAA 4QUGA 2P78A 1ZXXA 2AOWA 2QLMA 2Y4NA 1PGNA 3PHJA 4FC6A 3SQOA 4B3DA 5B3JC 5C8YF 3RSLA 4FYIA 5K6RA 3UXEA 5KO2A 2WZBA 3DXFA 5LQSA 4EB6B 5ADVA 3PZBA 2GAJA 4EHLA 2WJAA 3Q88A 2PMDA 2OCLA 4FJ2A 1DVRA 1FU7A 1TVKB 5DI3A 1UPFA 5FO0A 3WIUA 4HWSA 1T2DA 3ZWKA 3NHWA 3PQ8A 1R50A 1SCUB 2C1EA 2WAOA 3DBOB 4L5JA 4MB6A 4A6XA 4XWWA 4MVJP 4PPYA 1XZEA 3PDWA 4OX9Y 2QM3A 3R7LA 1N2EA 4X85A 3H83A 5ILGA 4HFMA 3FTNA 3ETNA 3NI2A 5G1NA 3F0TA 1XMPA 1LNSA 1ZUHA 3MVEA 4MV4A 3AUSA 1P1HA 5LQCA 3IQFA 3C0KA 1VKZA 4G0WA 3M5CA 2TYSB 2BGKA 3EVDA 4LUCA 4O29A 4OCZA 4F2HA 5KSWB 2YHAA 2P3LA 5CDUA 1G291 3IT2A 3QFHA 2OV8A 5HVNA 4QRHA 1QH1A 3EBOA 4J0QA 5KYUA 5SZIA 3EPHA 2GBFA 2SKDA 3CH7A 3N2YA 3C45A 1P3Y1 5EMHA 1A88A 1JTEA 1VFPA 2BMDA 3DW1X 4S0XA 4WTOA 1XQWA 4KQ1A 4ZODA 2RHTA 4EPWA 2I1QA 2XB9A 3OQPA 1YDEA 1KYWA 5JBIA 4NBLA 5A5DA 1KYZA 2VC2B 3SQXA 4IG9A 5JIBA 2XVZA 2BGNA 1S2LA 3PG5A 5KHAA 1PDVA 4NICA 5F2KA 4JYAB 2HDOA 2DOKA 1OVMA 5ARDA 3KFLA 2Q6IA 2Y1WA 3TECE 1N5OX 2A9KA 1U81A 3WXBA 1IIRA 5DX0A 1KR5A 1ENYA 1J8YF 2QTWB 4M1KA 4EQ6B 2Y68A 5FKJA 4BEWA 2J6HA 4L4ZA 3NAMA 5EC8A 1MFZA 1FFWA 2W22A 2X8JA 1NVFA 1GQRA 1ODKA 1GKYA 2QRQA 4LOIA 4QXOA 4WXMA 3CNNA 3JQEA 4CF6A 4Z1MD 4RF3A 1B76A 3PITA 3OD5A 4X45A 3NYQA 1Z82A 2QL7A 4Q3CA 2P5TB 3IP5A 4ZO9A 1LPOA 4B8WA 1QIHA 5JVDF 1T5OA 2ZI4A 2EJWA 2H11A 2QR5A 3H1PA 4PYNA 5FLYA 3GCGA 4RKEA 2OO3A 4IO1A 1OLXA 1X80A 4G5HA 5GVRA 3I9JA 2W70A 1W88B 2AJTA 3CB2A 1CETA 4XIIA 1E3WB 5LB2A 4JB2A 4WCDA 3UMFA 3LW8A 1A27A 2J0VA 4QTXA 1FFSA 3LPAA 4F6RA 1V4NA 2GJ8A 1SCQA 1ZSVA 1V96A 1NLUA 2RHCA 3E7PA 3MJTA 2PX6A 3LAWA 3VPGA 1E79D 2FR1A 3HEAA 1MIOB 5TLSA 5KAMA 5L4SA 1AKQA 1ILEA 2AC7A 2DUJA 4BVEA 1JR3A 3SE0A 1SA0B 3G0DA 3UMCA 4A2WA 4PNEA 3N2GA 1T2VA 3PYXA 3LDAA 3WXMA 4C3OB 3OT1B 1CJMA 3WWYA 1E4OA 4TKUB 2WIAA 1ZU5A 3OZUA 2ZBQA 5DYNA 1NF8A 1JW9B 1QVAA 4RMIA 4MSUA 1GPMA 2BZSA 2O2IA 2PYDA 1P4RA 2RGDA 1TQ4A 3T1NA 3PNKA 3TJRA 2DXIA 1GZVA 2IXTA 2XSZD 3ZD8A 1Z47A 3SZLA 4BO6A 3BREA 5NULA 4RA9A 4ALKA 3GU3A 3TJMA 2P30A 4BJ5A 1J21A 1W29A 3DCNA 4WRRA 3GGDA 3RVSA 5SYAA 1QK3A 5B7QA 3JYQA 2ZTUA 5FBZA 1Z7YA 4PQYA 2W2MA 1PK8A 4O0MA 2P9TA 4RNCA 3H6KA 4ZOQI 4J2TA 2R48A 2ECQA 4KK3A 1WAMA 4AJEA 5FLKA 1JEOA 3BEOA 1RT9A 3G0OA 1LF5A 4IM7A 3K7EA 3UT6A 3X1WA 2XECA 3L0DA 1NSTA 1NW8A 1ZICA 2XQFA 3EMKA 1KEZA 1NW5A 3GVHA 4GX5A 5EHGA 4QU0A 4QG3A 2YCLA 2NN3C 4LFBB 2VK2A 2QQEA 2AFIA 3IC5A 4Y0AA 3VH1A 1YFLA 1BKYA 1YS7A 4BB6A 2QT9A 3RLFA 1DGQA 3I2HA 5KDLA 3DHNA 3EXHC 2O2DA 5HRUA 1FDWA 3MIIA 1DAGA 2JHCA 2H2AA 3SMVA 3OUTA 3C24A 1C0IA 4OMCA 2IITA 1NAIA 3T94A 5KYWA 1X1DA 3CKKA 2YZKA 1P29A 2OZVA 2C9DA 1U7DA 3OD1A 3OKFA 4J6FA 2C1XA 4MAAA 1ZX1A 1NF9A 2MYTA 2VDVE 3DQZA 3H2KA 4HAYA 3ENKA 3DDNA 5DNAA 1L7RA 1FBTA 4IMJB 5HCIA 3CVVA 2IYUA 3LPLA 2G09A 1YJXA 2REQB 3EWAA 4C9BA 4EEZA 1ZOOA 2IZ7A 4XGRA 3UT5B 4N5IX 1E5QA 4IDFA 1V3UA 3JQDA 1NNUA 4O4HB 4C6SA 1BCSA 2GPJA 1YH3A 3NNDA 3QH4A 2E4XA 1RHRA 4I3HA 4A7PA 4TXJA 1MOQA 3HHPA 3EIWA 4P4UA 4IGKA 2CYBA 2JKVA 4LCBA 4O4LF 4R1OA 1QQ7A 3O95A 5J40A 3NXSA 1O0BA 2V6GA 1HQKA 1LC3A 5BUCA 5LIPA 1VHDA 3NH6A 2NPIA 3NOXA 3RV3A 1KFCB 2J5RA 5IC4A 1CCWA 1QOZA 1ZJJA 5B6PA 1ZLYA 3INGA 1PRYA 1I80A 1PFVA 4J1SA 4DUPA 2JI4A 3GRKA 4JIGA 3RV4A 5BMVB 9LDBA 4TSRA 3DL7A 2BEVA 1YB5A 4ZD6A 2QW8A 2BM9A 4JODA 5H7XA 2YHUA 1VE9A 1JIIA 1NC3A 3C8HA 2I4TA 2Z1MA 2WYOA 4TUYB 4UD6A 5I8WA 5JFTA 3W8NA 4P4LA 1DQRA 2HADA 4IQ0A 3RVPA 3ZY4A 1ZCZA 4RXTA 3WQBA 1AKTA 4ENQA 4OKIA 1YZNA 4JJFA 4XRRA 1GT6A 1K7XB 3KSRA 3LHSA 4W7IA 3TIVA 2IYEA 4UHHA 5MFZA 3B52X 3U4QA 2XUKA 4CIVA 5J1SB 2WIJA 1EVYA 4N49A 4D6YA 3HCFA 4DUZB 1LVHA 1EHIA 4DBZA 5LDGA 5AHXA 5JJKA 2GUWA 3HB0A 4DEYA 3GGOA 1PR5A 1EEHA 4KL8S 1KEWA 2ZQ5A 4OGFA 1ESNA 3MT9A 4M3NA 2MSWA 4C7OB 1S1CA 4HEQA 4KIWA 2FWAA 1AQLA 1FFXA 2PK3A 4Q9DA 3EBPA 3CLSC 4LJ6A 3C8MA 4O4JA 2Z5LA 3UIEA 1PLJA 3RROA 4ZT7A 4B32A 4D8TA 5EP1A 4MQEB 1REQB 2YS7A 2BFFA 3TO5A 4X1YA 5ABPA 1NXXA 2ZYDA 1OZ0A 5BYBA 2GRAA 3A9CA 3D0RA 1L5QA 2Y9MB 3N05A 4CMJA 3OF3A 1KMHB 2IOHA 3ZZMA 4MKHA 1NMYA 2DZDA 1AQJA 4BKMA 3QKWA 1RZUA 4MB2A 2R6ZA 1JU3A 4WK2B 1B15A 1JMKC 2HHCA 1BGWA 2ZYSA 4O59O 4I1RA 3NFYA 4M55A 4I9UA 2OPHA 3VDMA 1N75A 1J23A 3PQ7A 1PQ4A 4EVIA 3CRMA 1V8DA 2H1OA 1TECE 1U3UA 3Q7QA 4HWRA 2DPGA 1PF7E 2QT0A 3AFNA 1EFRD 5JWOA 1T1IA 2JGDA 2PSEA 1O2DA 3BDIA 4GKVA 4NENA 3D7SA 5B53A 1NBOA 4V1CI 1PLKA 2BBOA 4KH1A 4UEOA 3BB3A 3C6MA 3ZBUA 3T15A 1EXNA 1M6NA 1TF2A 4WBNF 4OXQA 1SBQA 3IV6A 3PXBA 5AO9A 1WZ2A 2PUTA 3AU9A 4E46A 2I33A 1IVSA 1P0FA 4MROA 5FPKA 1BXRB 5KOIA 4F3TA 3HADA 2O19A 4TLMB 1DRUA 4EK9A 1V4BA 3V32A 4MTLA 2P0AA 1ZY2A 1TU3A 1KS9A 2O7SA 4EF4A 1K8YB 4WPGA 2QRVB 4YDHB 2C2WA 1V7ZA 4TKVA 4WGGA 3QE2A 4GMFA 4ZOBA 1H5UA 3ANLA 4KI0A 4RVOA 1HT2E 2FN7A 2QRUA 3GGSA 5DW0A 4DIKA 1WUIS 3CX3A 4DLPA 4O1HA 3EWNA 2V03A 4CCAA 1M1NB 2ATXA