4WE3A

Structure of the binary complex of a zingiber officinale double bond reductase in complex with nadp monoclinic crystal form
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
353
structure length
342
Chain Sequence
DVVVVNKQVLLKHFIPAPKETDMELVTTGTIRLRVPEGSNAVLLKNLYLSCDPYMRMRMTKHEEASYVDDFVPGAPITGFGVGKVVDSSHPDFKTGDYVWGLIGWEEYSLITKPQGLFKIHHTEIPLSYYTGILGMVGLTAYVGFYDICSPKKGERVFVSAAAGAVGQIVGQFAKQFGCYVVGSAGSDEKVNLLKTKFGFDEAFNYKKEPDLTKALKRYFPEGIDIYFENVGGPMLEAVLHNMRIKGRIAACGMIGVHNLFLIVGKRIRLEGFLVFDHYGSYPEFEEKVVQLIKEEKIKYLEDIVEGLENAPAALIGLFEGRNVGKQVVVVSREKGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Double Bond Reductase
publication title STRUCTURE OF ZINGIBER OFFICINALE DOUBLE BOND REDUCTASE
rcsb
source organism Zingiber officinale
molecule tags Oxidoreductase
total genus 109
structure length 342
sequence length 353
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF16884 ADH_N_2 N-terminal domain of oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4we3A02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4we3A01
5ITVA 4YA6A 3HHPA 2IXBA 4U6SA 4W82A 4E4YA 5I8ZA 4YBZA 2UYYA 2VQ3A 1SNYA 2JHGA 2X23A 5JAMA 1E1LA 1XA0A 1B8UA 2Q1WA 4CV2A 3KEQA 4BUCA 5T8KA 1Y8RB 2HLPA 1SOWA 3EZYA 4MIOA 1V35A 4GMGA 4Y8VA 4BMSA 4DTIA 5BSGA 4WLOA 2DFDA 1ZFNA 3MTJA 4YJHA 3GNQA 1BSVA 2VHWA 3QVWA 2PY6A 4GH5A 1FDWA 2O7SA 2VZ0A 4U0JA 4WECA 4YJHB 1LJ8A 4FFNA 3AU8A 3CIFA 5BSEA 4WGGA 5TSDA 4GGOA 4K1LA 2EW8A 3W1VA 2WE7A 1H5QA 1QRRA 3RUDA 2BLLA 1IB6A 3M2TA 4UVDA 4MVJD 3IQDB 4CR6A 4J1TA 2ZB4A 3RFXA 3ZHZA 4TKLA 4AJNA 4YAKA 2CY0A 4M86A 1M6WA 2CMDA 3OH8A 3C8MA 4BB5A 2VHVA 3V8BA 2Q3EA 3KHUA 1S6YA 4HX5A 5HWSA 3JYLA 9LDBA 3QWIA 4NH4A 1ADFA 3LSYA 2FPPA 3GN2A 1DO8A 1LC3A 1CIVA 1P0FA 2OGUA 1H6AA 4BNJA 1EBFA 3QQPA 3K6JA 4MVJA 4UVGA 5TS3A 5JDCA 3LLVA 4EUHA 2PD6A 4JNKA 4KUHA 1UXGA 2ZTMA 1DJQA 1DLIA 1N9GA 4FC6A 4ROSA 3D3EA 4TQGA 4GGPA 4WUVA 4IDBA 3RI3A 2NVUB 2IZZA 4PLHA 1DPGA 1I3MA 1XEAA 3VKUA 2GN4A 1H6CA 1PS9A 4UREA 3KUXA 4WNCA 4FFOA 1VL0A 2AA3A 2UVDA 4DWVA 1ZCJA 1HL3A 1NR7A 5CDUA 3WTBA 4B7UA 5HS4A 2C59A 1HDYA 4B7CA 4D46A 1UXHA 2V7PA 3QVXA 4KUEA 1CETA 3L77A 3PIIA 3HB4X 4S1VA 4YAGA 1HYEA 4J6FA 1CRWG 5B4TA 4HY3A 1DB3A 2VWHA 1L7DA 2C82A 3INGA 3VDQA 2ZYGA 1A7AA 2FP4A 1VJ1A 2O7QA 3ROQA 3ABIA 3TSCA 3GVPA 3K31A 2DC1A 1T1RA 4KZPA 2Z1NA 4CLRA 2EKLA 4CLXA 4XQCA 1F06A 3Q9NA 3BMOA 1JVSA 3H4VA 1LDGA 3KYCB 1X14A 3H9UA 2WWRA 3U4DA 4CLRB 5EL0A 5A3VA 5DF1A 2EEZA 3DOCA 3BMOB 2B4QA 2D4AA 1UDCA 2X0NA 1ZEMA 3KXDA 4DQXA 1I3LA 2CF6A 3CUKA 1MG5A 5DP2A 4BO3A 1ZVMA 1OZAA 3M1AA 4R3NA 4FJ0A 1XYGA 1NHGA 1MFPA 4Z9FA 1PIWA 2AG5A 5KVCA 5DCUA 1PTJA 3ZHYA 4DC0A 1SBYA 4I5GA 2PWZA 2I6TA 1O0SA 5DZSA 5JAQA 3TOXA 1M66A 3OHSX 2WM3A 2FSVA 2NACA 3UOGA 2PD3A 3OA0A 4NFHA 2Y1GA 1LLUA 3RBZA 5A1TA 1LLDA 1MLDA 4BV9A 2Y0DA 3DAGA 4J4HA 4QXMA 3NTQA 4CLDA 4FS3A 1TXGA 4YACA 5JXWA 1Z7EA 3WDSA 2C2YA 3NKLA 3RCBA 4UUNA 5MGBA 2Q1TA 4Z9YA 5JDIC 5GZ1A 4R51A 5DBGA 1I3NA 1VSUA 1EEHA 1B14A 5IJZA 5JAIA 2OXIA 4WLNA 4A2CA 1PJTA 3WWYA 1F17A 1LU9A 4WCDA 3DXFA 1GZ3A 3BTOA 1L1FA 4FBGA 4BQRA 4ZJUA 1WAMA 1ZKMA 5A05A 3IL2A 1YB4A 3QVOA 4YYZA 1PEDA 4MIYA 3S1LA 3TWOA 1WMAA 2OP0A 3FBTA 3I4FA 4DRYA 4IQ0A 4EDFA 2ZJ0A 1SZJG 3GNSA 3DZIA 1N5DA 4B4WA 2CVZA 1Q0HA 2Q99A 1EBUA 3QE3A 4XD2A 4RVDA 3NT5A 3QY9A 4KP7A 3RD5A 4Q3EA 3D4OA 2X9NA 4G5HA 1DRWA 3PJDA 1NQTA 3O26A 3JQBA 2EGGA 3ST7A 4BKRA 1K2WA 3QRWA 4I5FA 2Y1EA 3NJ4A 3OM9A 2J3HA 3HDJA 2AQ8A 3RIHA 1VM6A 3ZHBA 1M67A 1U1IA 3WQSB 1EFKA 1JWBB 2OOSA 4DBVO 3PK0A 2J6IA 4R69A 4IIUA 5JC1A 4EYEA 4RPLA 4GX1A 3WS7A 3CTMA 3NAQA 3QWFA 3I1JA 1XQ1A 3TL2A 2GZ1A 3NT4A 4PRKA 1GUYA 1YVEI 4J91A 1T25A 2ZATA 3FWZA 4KQWA 4BGEA 5L53A 4W4TA 1PZFA 2C29D 3PQFA 4WOKA 2IYPA 5DULA 3S8MA 1ISGA 4WLVA 1M76A 4NQZA 1DC6A 1GAEO 2J3IA 2NADA 3PP8A 4G2NA 3OIDA 4HP8A 4I9UA 1TT5A 1NFQA 2TMDA 3UH1A 1PZHA 1PGQA 4U7WA 3LF1A 4GAEA 2DAPA 1FXSA 3B70A 3DFUA 3EW7A 3VH3A 3PYLA 4P38A 2X9GA 4ZRNA 3TZ6A 4C7JA 4OMUA 1T26A 2Y68A 4KOAA 5KKAA 3ZHXA 1EE9A 5JYDA 2RH8A 2VZ9A 4E5PA 4LMRA 3RVDA 4DLLA 1YRLA 3PGXA 2X58A 2OUIA 2PNFA 2VWGA 2X0IA 2O3UA 2Y1CA 3IC5A 4J9UE 3RKUA 3QWBA 3TPCA 1W0CA 3I6IA 4E21A 3RBVA 1R6DA 3GMDA 1KVSA 3G1UA 1F8FA 2DPHA 4RO0A 1FF9A 5TX7A 1V8BA 2OBNA 4GVLA 3E1KA 3GZNA 5JO0A 1VPDA 4GL4A 5KVVA 4O63O 3VZSA 3VAZA 1ULUA 2QRJA 3GZNB 3ZU5A 3GDFA 3C1AA 4F3YA 4RVGA 3GHHA 3PJEA 4E12A 1I01A 3MOGA 3WGYA 3VZPA 2WE8A 2Y05A 5B4VA 4BS9A 1GQYA 1XCBA 3VPGA 3S2EA 4OXNA 4IDCA 3VZQA 4NJMA 2C07A 1WDKA 1I24A 2VWQA 4L8VA 2BD0A 4AJIA 1AHHA 3VHRA 5DCYA 2UUOA 1FMCA 1GFSA 1TLTA 2AE1A 4LRTB 4NJMB 5LDGA 2DT5A 2D3TA 3ORFA 3DAFA 2YZ7A 1C0LA 1XHLA 3L9XA 3IUPA 1ENOA 2W4QA 2AE2A 1VJTA 1O5IA 3GPDG 5U4QA 3RASA 4E32A 3OP4A 4FB5A 1DIHA 4PLZA 2X0RA 2ZCVA 3AOEC 1BGVA 2VTEA 1ZBQA 4XIJA 3ZV3A 1UXJA 2ZTLA 5I9NA 4ND1A 3K5PA 1AHIA 1PU2A 4RPHA 4GX5A 2A94A 3DONA 3HSKA 3H5NA 4M54A 4MKZA 1YWGO 3ZV4A 3WGHA 1EDZA 4II3A 1K6XA 4BVAA 4QQRA 2FPGA 1J49A 3WMWA 3JYOA 1ZXLA 2G82A 1EMDA 3MOIA 5DOZA 4CM4A 3WYCA 4DGSA 2JHFA 2ZQYA 3RC9A 5L4NA 3U3XA 5ICMA 4TKMA 4EJMA 1HWYA 1ADCA 1Y7TA 2ZYAA 1EDOA 2R6JA 1ENYA 1XU7A 3ONDA 3OBBA 1C1XA 2X22A 2Y1DA 5CEJA 3QJ5A 4ILKA 4U5QA 5IXYA 4ALMA 1I2BA 3DFZA 4IJKA 4J4TA 2I99A 1X13A 3H9GA 2W90A 4XWYA 4WK6A 5U1PA 1ZSVA 3NGXA 4WKGA 4OXKA 1CERA 1JAYA 3DL2A 1T2FA 1GU7A 2DQ4A 3ZWYA 4B7XA 1TEHA 5AYVA 2CSUA 3OSUA 2X7HA 1LSSA 1QV7A 2EJVA 3HE3A 2A92A 4OSPA 4EEZA 4PIVA 5K6AA 1SC6A 1QR6A 3NYWA 4WE3A 3FBGA 3OECA 4R54A 4YT2A 1GQ2A 1ZK0A 1RM3A 1XLTA 1DLJA 5H81A 3RJ5A 4AICA 4XRGA 4MVJG 3ETDA 2QYTA 2G76A 3P5SA 1C0KA 2GDZA 2D59A 4JX8A 4HFJA 4HBGA 3HNPA 1MGOA 1B3RA 1H0KA 2EG9A 4OSOA 1I8TA 4XQGA 1PZGA 1EK6A 5COBA 2FZEA 1BWSA 3GOHA 3K9QO 5BQFA 4IIVA 4Z0PA 1WMBA 1IPFA 3ZDFA 1ISMA 3DZFA 5JBIA 4MDHA 1SB8A 1KC1A 4Z0HO 1I2CA 1GTMA 2ZB7A 3JD0A 1S7CA 3RC7A 3L07A 2SCUA 2YDXA 3FNEA 1ZIDA 3OJFA 1B15A 2A9FA 3HN2A 2RIRA 4PZEA 3WGZA 1P45A 4DMMA 2Q2VA 3ZWOA 4AJPA 3TDKA 5BNTA 3CH6A 3UICA 2BRUA 3IMFA 4J2HA 3ZWCA 5KCZA 2NV6A 1WXDA 1T4DA 5TJ9A 3PYMA 5H83A 4FW8A 1KVTA 2AEFA 2EXXA 3KV3O 1UP4A 4B3JA 1IUKA 3NGLA 2ZKLA 4N18A 1CQJA 4WLFA 1W4ZA 2TMGA 3PHHA 2GUGA 1A27A 1WDMA 4F45A 5KIAA 4QEDA 3ITDA 5GZ3A 1NNUA 3BXXA 1JLLA 4Y6PA 3ZW9A 2DVMA 5KVQA 1LSJA 1QKIA 3H9JA 3MJTA 1PR9A 4A7PA 1ZK2A 4MKXA 3JQFA 2GO1A 3I6QA 4CV0A 3JD2A 1YB5A 4A27A 3WIDA 4URFA 2NVBA 3DB2A 2Q45A 1BVRA 1NPDA 3FR7A 4LK3A 3GK3A 1YE3A 3ONFA 3ZU4A 2O4UX 2XPCA 4BMVA 4P22A 1B26A 4NBRA 4RPJA 4UULA 4ZRMA 3PEFA 2DKNA 3WXBA 3ASUA 4K28A 3DMTA 3AM4A 4EUFA 3TQHA 2WYWA 1ZNQO 5L40A 1AN9A 4L4RA 1HF3A 4BO7A 2RAFA 3DR3A 5ICSA 1R0KA 1OBFO 3BTSA 4RGBA 2JFFA 3OMLA 2C20A 3I4CA 4UVIA 5ITWA 2CUKA 3DOOA 1QLHA 3IJRA 1SPXA 1LNQA 3HJAA 2WD8A 3WWZA 4YVFA 2PTGA 1Z74A 4XGNA 3OJLA 4QECA 1MUUA 5K0ZA 4QT0A 2BF7A 1HZJA 1ID1A 2VWPA 1YQDA 3U09A 3AUSA 3IKTA 2C54A 3QVTA 4EGFA 1XELA 2LDBA 4LCJA 4EI2A 5I7VA 1HSOA 1PS8A 1QMGA 4CMBA 1PGNA 4YJDA 4H15A 4BNKA 3EZLA 6LDHA 2VN8A 4QO7A 4ALJA 2ZTUA 3MTGA 4E3ZA 1SO8A 4YT4A 3AI3A 4WASA 4GSLA 2GSDA 3JQCA 1D8AA 1R12A 3PJGA 5L7WA 4N5MA 4IPTA 3NJ8A 2WYUA 1E6EA 2FY8A 4TRMA 3IAHA 1LRKA 1KEVA 4K6CA 2PGDA 2UAGA 3QSGA 3SJUA 2XF8A 3K2BA 2J8ZA 4Q3CA 4TVOA 1T24A 4R5HA 2P5UA 5TLSA 2WD7A 4J1SA 3GA0A 3ICCA 5TIIA 4CODB 3ASVA 4CL3A 2GRAA 2WD7B 2NLOA 2O50A 5L45A 2Q49A 2VYND 4JP3A 5ER6A 3I52A 3HWRA 4I8XA 1Z75A 3PFWO 1WZIA 1YL7A 3ZNOA 1U7TA 3TRIA 3QP9A 4JJGA 4E30A 1NWHA 2X9VA 5B4UA 3CKYA 4LW8A 4JBIA 1KVUA 4BL5A 3FPCA 1XWFA 4M89A 2PH3A 2HCTA 1GZ4A 1NM5A 1V3UA 1UXKA 2H5LA 2YV1A 3ROKA 2VYNA 1ZSYA 1HDCA 1GR0A 2DFVA 3LVFO 4XJTA 1LDYA 1PGPA 3NUGA 4XYMA 4W7IA 3T7CA 5IZCC 1VSVA 4MVJP 2QW8A 4AVYA 3GPIA 4NBWA 2V65A 4NK5A 4OM8A 1ZK3A 5BR7A 2UUPA 2D0IA 3ONEA 1NQOA 3H6KA 1HTBA 1F12A 5TT1A 3DHYA 2W2KA 4IBOA 1SAYA 5HA5A 1ADGA 4OQZA 2Q1SA 2VOJA 3ZZNA 3JD4A 1E7RA 1GADO 1XQ6A 3KLPX 4GLLA 3DZBA 2E82A 1SOVA 3C7DB 3PHIA 4BNIA 3DZKA 2IRWA 4U6QA 3PZRA 2BFPA 2Y1FA 4QUKA 1P1FA 1ZXBA 4ND4A 2X86A 2X6TA 3LQFA 4HFNA 1HRDA 4J1NA 4TWRA 4RCVA 2O23A 3G49A 3L4BC 4YQYA 5G0WA 4CQMD 3LC2O 2E37A 1QORA 4ALIA 2AEMA 4W7HA 1EQ2A 3DOJA 3IP3A 1E6WA 3KEOA 1YGYA 1SMKA 4ZQFA 4KUGA 3HQ4O 4XDZA 2EJWA 1NAHA 4L4SA 3ZI0A 2R2GA 4PZDA 4M8SA 1PQUA 1Q0LA 2GYYA 1EZ4A 4INAA 1LLQA 2CD9A 2E48A 2YQ4A 3LLSA 4CQMA 5LC1A 1PX0A 4O6VA 4H7PA 1Y5RA 4CQMB 4H16A 1JW9B 1P0CA 1XR3A 3HFGA 4ZGWA 4WCFA 2LDXA 3PTZA 3QLJA 1EVZA 4BNFA 3QV1A 4BO5A 1P3DA 2P5YA 3RU7A 1ZH8A 1GYPA 4WCFB 4IXTA 2I66A 2H6EA 3O9ZA 4OHUA 3SLKA 2BI7A 4Q3NA 3WGIA 2B35A 5EQDA 1ZSNA 2H1SA 1D7OA 1AXGA 1OMOA 1KERA 3WR5A 3D5TA 4CLOA 4Q39A 1BW9A 1KVRA 3SC4A 1N9GB 2GGSA 1LI4A 3G17A 4CQLA 1I32A 3KETA 1JDJA 4NFSA 4D41A 4D3SA 2G1UA 4TROA 2FMUA 4JROA 4CLOB 3D5QA 1BW9B 5IF3A 4NFYA 1N7GA 2CVOA 3D3WA 1MC5A 3FN4A 4CQLB 3Q9UA 2B4TO 1E1MA 3OIFA 4UEOA 2X5JO 4BIIA 3EMKA 3WB9A 1NYTA 4OJNA 3TNLA 4N7RA 2NVWA 1GV1A 2IEDA 1PWXA 1R0LA 3PGJA 4TZKA 5KWEA 4LVUA 3V2GA 2E6UX 1HEUA 2X8LA 3MJSA 4MP6A 3UUWA 1BMDA 4MPDA 4PG4A 5JYEA 4ZQBA 3PDJA 3ADOA 3V2HA 1DSSG 2HMVA 3CMMA 3IOYA 1PZEA 1NASA 4LVCA 3DAPA 4OKNA 3JQGA 4KQXA 1U28A 2Z5LA 4E2YA 4CLEA 4XA8A 2QRKA 3KYDA 2DUUA 2PZLA 3JQGB 2DPGA 3VVCA 4GWKA 3LF2A 4L76A 1GZ6A 1I10A 2YFQA 5J23A 2NTJA 3KYDB 3PI7A 3EK2A 3H3FA 3JQ6A 1BDMA 3K73O 3B20A 2C0CA 4IMRA 4ZQEA 3GHYA 3RUHA 1C0IA 3RSHA 5GMOA 4AJJA 1C1DA 5A06A 1P1HA 4KTVE 3HZZA 3UCFA 3IS3A 2FR1A 1GL3A 3E9NA 4MIEA 3GDGA 1PGOA 3EC7A 5JE8A 1C1DB 1QYCA 3C85A 3RBXA 2PLAA 1DFIA 2QYSA 3JV7A 1ZJZA 3CPSA 8ADHA 1JU9A 3QA9A 4CR8A 2AHRA 4EZBA 4BNWA 3ADPA 4PG6A 3L6OO 1KEWA 4HUJA 4PLWA 3JD3A 3UFXA 3MZ0A 5AOVA 3M1LA 1T2CA 4MVJM 5JY6A 2PK3A 3ANMA 3OJ0A 5JAZA 3EGOA 1Z7BA 3Q3CA 4U0KA 3L0DA 3D4PA 1IZ9A 4B4UA 3KVOA 4Y6SA 4B3HA 1LA2A 4JBHA 3U0BA 2FN7A 5IFLA 4XCVA 4IGEA 3G0OA 5L9AA 1HT0A 3RUIA 4EUEA 4LMPA 4DC1A 4XZ3A 2GZ3A 4I5EA 1WDLA 3MJCA 1NXQA 1YBAA 3K8ZA 3W6UA 1DFGA 4Q3AA 1DIRA 3DBLA 3CEAA 5FF9A 1W73A 5JC8A 3C24A 4RVHA 2PGLA 1NBOA 1G1AA 5K9ZA 1DC5A 2Q4EA 3D64A 2PZMA 3DBLB 3ENNA 3AUTA 3F1LA 3PJFA 5AQ1A 2B0JA 1DC3A 1LEHA 2V6BA 3S2GA 4M87A 4J7UA 4NBTA 3STHA 4XGIA 1V6AA 4CMCA 5B1YA 4CMGA 4CM5A 3OA2A 3ROMA 3LT0A 4KTTE 1BXZA 3LZ6A 1E5QA 1GD1O 4CMAA 5IZCA 3V1TC 3ULKA 1SCUA 4M1QA 3VPSA 2POQX 4RF3A 3VVBA 3HN7A 1HDRA 4E33A 4DA9A 3B6ZA 3B1FA 1RYDA 4YRAA 4BOYA 3VTFA 4EW6A 5F1OA 4MVJE 1TA4A 1GEEA 1EQUA 3AW9A 4GVXA 4CMHA 5L7TA 2EW2A 4YT5A 2Q2WA 1KOLA 1YDWA 4PLPA 5GZ6A 1UZMA 2NQ8A 3DWFA 3A4VA 5JCXA 2R00C 3UAGA 1C0PA 4PG7A 1D3AA 2GN9A 1T2AA 3WNVA 2GD1O 3B1KA 3KSZO 2WMDA 1X7DA 4GX2A 4NDNE 4J49A 2YW9A 1NTOA 1K0UA 1UZLA 4QTZA 3TJRA 4AJOA 2GERA 2PKRA 1RM0A 1YQXA 5CG2A 2BI8A 3ZWBA 3AI2A 2IZ1A 3OJOA 3AFNA 2P9GA 3K96A 1R66A 4CMIA 4RJTA 1P9LA 4XB1A 4MVJI 3EUWA 3I5MA 1PJQA 4TRRA 1C3VA 4FIZA 3S55A 4EJ6A 4IDDA 4RF2A 5DP1A 4EJ0A 4YJFA 2PFGA 4CMIB 1Q1NA 3G3EA 3UHAA 1UP7A 2PKQP 2RBEA 3LU1A 1B8PA 4BNUA 1GDHA 3BHMA 3RFVA 4LCEA 1ZW1A 3ZW8A 2NTNA 4YJFB 1NPTO 1Z45A 1TT5B 3H5AA 1QYWA 3JQDA 1XGKA 2GPTA 4NBUA 4PGFA 1CDOA 1YKFA 4N54A 3V1UA 1ARZA 4D0RA 5A9SA 4IZIA 3WNQA 2BFAA 3OICA 5KTKA 3COSA 1PJ3A 3F9IA 3GGOA 2AQKA 5ER9A 5A9SB 1DFHA 5I7FA 3INRA 4CM9D 1Z73A 1ZO8A 5KVSA 4L73A 4DLBA 1GUFA 2BKAA 1UR5A 4D7AA 2BH9A 3FTNA 3PZBA 4BNLA 4GWGA 4UEKA 1KETA 4NK4A 3F3SA 3GY0A 2C5EA 3DZGA 2D1YA 1U5CA 4IS3A 1DBVO 3EAGA 4XYGA 4DVJA 1FDTA 3E8XA 2I67A 3BMNA 3R3SA 2HJRA 1J6UA 4CM9A 3H7AA 4UAGA 4JCOA 5KKCA 1R4NA 3H9EO 3VC7A 2JKVA 5A3JA 4J0FA 2GLXA 4R68A 3WYEA 3C3XA 4Z3DA 3SXPA 3BMNB 4GBJA 3D7LA 5IDQA 4AJ2A 1DRVA 1E7WA 1E7YA 3U49A 2B36A 3ZWPA 3EY4A 3PQEA 3NDJA 5A03A 1XU9A 1DJNA 3D0OA 3V2UA 2O48X 1LDBA 2RHCA 1IULA 3QWAA 5DN9A 1OI7A 2OZPA 4OH1A 1QYDA 1YS4A 4RPKA 3ZNNA 5DBFA 1HE5A 2HAEA 5C7LO 2FSSA 1JVBA 1KS9A 3KZVA 2QX7A 3Q2IA 5THQA 4Q3BA 1K6IA 3R3JA 5A5FA 3MWEB 5CDTA 3ON5A 3GLQA 4RV9A 2GCGA 2Q1UA 1DAOA 4IGFA 5CEEA 2OBYA 4PG8A 1M75A 3GUCA 4BO0A 4W9NC 3WJAA 4R01A 1YONA 2V6GA 3L6DA 2O3QA 4D43A 3VDRA 4YB8A 1NHWA 4E2WA 1YBVA 2EWMA 2PR2A 5F21A 5IN5A 4BGUA 1U7HA 2QZ9A 5IAAA 2JCYA 2D5CA 5THKA 1DHTA 1LDEA 4CM4B 1GPDG 2P2SA 2BFOA 1YJ8A 2O3RA 3BZUA 3WYBA 3PWKA 5EQFA 4DQVA 3WX0A 3L9WA 4DPLA 3WJ7A 1C1XB 4PCVA 3H3JA 2C5AA 1YL5A 5IDYA 3GAFA 3TOZA 3ZCXA 1FDUA 2YYYA 1DAPA 5IZ4A 2EKQA 4HFMA 2VZ8A 4OL9A 5DDIP 5HRUA 4L0QA 3AFMA 3GG2A 3DBVO 5DBIA 3ZWAA 3E9MA 4YTEA 3VPXA 4DL9A 1K5HA 1UXIA 5I8WA 4DYDA 5ILGA 3R1IA 1IL0A 5BSFA 2C7VA 3VZRA 5JDIA 1E3JA 1PGJA 4R1UA 3ZU2A 1IPEA 4E2XA 1VKNA 4J9VA 3MJ4A 4RORA 2CVQA 3S2IA 2AEJA 3JQ9C 4QFCA 4K6FA 1ZUD1 3TZQA 4BNHA 4B3IA 3OQ6A 1QYXA 3FHLA 4EBFA 1B0AA 3LC7O 4OAQA 3ZWNA 2YHUA 1KBZA 3GVHA 3OETA 4FPXA 5EINA 4BO2A 3VH2A 1A5ZA 1E3WA 2WEKA 3GDOA 5F1PA 3D1LA 3WFIA 3LC1O 1CF2O 5IDWA 4R16A 1QXSA 4L75A 1WLYA 5CEFA 1U9JA 5T8KC 1E3WB 4BKPA 3RAJA 4YRBA 2VUUA 4W99A 1LLCA 2NUAA 3W4IA 4A03A 2D8AA 3H9QA 5G0TA 1Z6ZA 3OIGA 2C7GA 3DEYX 3TL3A 3DBHA 4LSWA 2PD4A 3P19A 3QHAA 1NFFA 4PRLA 1HETA 1PJ2A 4BNNA 4C4OA 1MXHA 5T64A 1SEVA 4A73A 5JCJD 1ENZA 2E49A 1V3TA 1H94A 3DBHB 3DZHA 3KRTA 1ZEJA 4FFPA 3KO8A 1EUCA 2JAPA 1QG6A 4BNMA 3F6YA 3GZ4A 5B12A 2V6MA 5IDXA 2VT2A 1W6UA 5EMHA 3RQSA 1KY5A 5KJEA 3N7UA 1HDOA 2DBQA 1LSUA 5DNAA 1QLJA 3KM0A 4BO4A 4YT8A 5JS6A 1WNTA 3E18A 5JMPA 1T1SA 5AXBA 3MCVA 2QHXA 5JCJA 1F14A 2ZB8A 4UUPA 1PWZA 4GKBA 1U4OA 5GY7A 4JIGA 1Y81A 4GPD1 4YDRA 3H5RA 5G4LA 4AL4A 4TRNA 2X5KO 3W6ZA 4R1NA 1BXGA 1YQGA 1T2DA 4KWHA 1HE4A 3PYXA 3FWNA 3GUYA 2ZK7A 3U4HA 4CLHA 1LDMA 3F47A 3E9QA 2QG4A 2OORA 3LT2A 3N58A 3DQPA 3L4SO 1D1TA 4C7KA 4PVDA 4CM6A 1UJMA 3I9MA 2NM0A 1X1EA 3PPIA 5EESA 2XXBA 4Z9XA 2HRZA 1J0XO 3ANNA 4XQEA 3PHJA 1K3TA 4MVJF 4F6CA 2F1KA 2FR8A 4WOJA 5L4SA 3DDNA 3BTVA 2FHSA 4WLUA 4ALLA 1LSOA 2HRBA 1RM5A 4CUKA 1WP4A 1XSEA 3C7AA 3DHNA 2VOEA 3G79A 2JL1A 3PVZA 2AQIA 1VLLA 1HE2A 1P1RA 3GVXA 4JJFA 2IE0A 4J43A 5KJCA 1UUFA 3P7MA 2B37A 2HK8A 1X7HA 3GAZA 4P8RA 3W4JA 4D3FA 5I9LA 1Q2XA 4AG3A 3RC1A 2P91A 3AY6A 1PL6A 3I23A 4UUOA 1P77A 1LRLA 3BHIA 4BKUA 1MG0A 3DBRA 1LRJA 4AJEA 4B8ZA 1Y9EA 2VHXA 4RVSA 4AJ1A 4ONEA 1DIBA 1KY4A 1DDOA 1OFGA 4HNHA 4BNXA 1DOHA 1RM4A 1TI7A 1Y1PA 3AM3A 1EUZA 1LQTA 3DBRB 1GPJA 1NAIA 1O9BA 5CHEA 2AXQA 1ORRA 4R1TA 4OO3A 3RUCA 1N1GA 4FJ2A 1LDNA 5FI5A 2JFHA 3FCOA 4KDEA 1G0NA 2ZQZA 1CQIA 1BXKA 3W4KA 3SEFA 4JJIA 4D44A 2DU8A 3O03A 4S3MA 4A0SA 4WLEA 4CJXA 3PWZA 1ISFA 1HZZA 1I30A 4FFMA 2V6FA 1TVEA 3BA1A 3JSAA 1WWKA 2UV8A 1Q7BA 2IZ0A 3M2PA 1EVJA 2RH4A 5BT9A 2NU8A 1BRMA 5CPFA 4WEOA 2H63A 3AOEA 4FR5A 1WVGA 2HK9A 4DIOA 2J5RA 4BO8A 1K89A 2OL4A 5FWNA 5L95A 5TC4A 2Z95A 3HDQA 2JD2A 4GX0A 3INTA 5TNXA 2RHRA 3T4EA 3PHGA 3OFSA 2PKQO 3IP1A 3WGQA 1I33A 5HTOA 2BGMA 3GFBA 4XYBA 2VUTA 2WJPA 5LDHA 2EIHA 1OC2A 1A4IA 3I9OA 1B7GO 1U4SA 2CDCA 3UKOA 3WQQA 8LDHA 2G17A 3CE6A 3ENKA 4LISA 1I0ZA 4IDGA 3IKVA 1H2BA 3GVIA 3FR8A 2Y66A 5HBRA 2VT3A 4Y6RA 4YAJA 4NPCA 4ZN6A 2DLDA 2HMUA 6ADHA 1MA0A 2BMAA 3KTDA 2W2KB 1U8FO 5JLAA 1JKJA 4FD3A 4E13A 4BGVA 5F1KA 3JQBC 3NRCA 5ILOA 2UDPA 4RLSA 2J3KA 4E5YA 4OQYA 2WDZA 4GSKA 4CUJA 2YQ5A 3AK4A 4DYVA 1UDBA 3F5QA 2B83A 4IZHA 4X54A 2ZJ1A 1YXMA 4BKOA 1MB4A 2IYOA 5FYDA 2FZWA 3R6DA 2DBZA 2I65A 1R16A 2P9EA 4O0LA 3X2FA 3QVSA 3I9NA 5L7YA 1E3EA 2O3TA 2Y93A 1P1KA 1BVUA 1G0OA 4PG5A 4XR4A 3VPFA 3UCEA 2VTDA 4E6PA 2C2XA 5U9CA 3DTYA 3F1KA 1T2EA 3I9JA 3BMCA 4GMFA 1KEUA 3RROA 4AJKA 3A9WA 4BO6A 4AFNA 3O4RA 3ZV5A 1Y8RA 4D3DA 5I7EA 4DIBA 3BMCB 3K2EA 5CDYA 1E7MA 3HFSA 5I9MA 4CL8A 2VRBA 4NI5A 4JBGA 3Q0EA 4E5KA 1ULSA 3GGGA 5JMWA 2O3JA 3F4BA 4KWIA 4ND3A 1MXFA 1OAAA 3A06A 3U5TA 5IN4A 2HDHA 1X7GA 4YRDA 3H65A 3R0IA 9LDTA 5ADHA 5COQA 4UVHA 1PJSA 4GI2A 4JP2A 1U5AA 1ONNA 3ITKA 4JQCA 1ZZEA 2YUTA 2PGJA 3C7CB 1XKQA 3JD1A 1FK8A 4YQZA 2X5OA 3Q1LA 4G65A 1H9BA 1CEQA 1NVTA 3GFGA 2ILTA 4ZVVA 3AJRA 3JQ7A 4MINA 4UEJA 1U2GA 5TGDA 2HSDA 2Y99A 4PLTA 4A26A 4WJZA 4LRSB 1ONPA 1AE1A 3JQ7B 3UCXA 3U4CA 3G1TA 2ET6A 1PSDA 2RCYA 1HSZA 4R4JA 2P9CA 3SJ7A 3GN1A 5IXSA 4R41A 4DPKA 1H6DA 4YXFA 2NVUA 1P1IA 1BTOA 4QO8A 2WSBA 4Q3DA 2NU7A 2PV7A 3KSDO 2I9PA 2ZTVA 3NDIA 4HKTA 3D3WB 1I36A 2EGHA 3LT1A 4ALNA 2FWMX 5A4DA 1IHXA 1N1EA 3P2OA 1NVGA 4NR0A 3S2FA 4FC7A 1I2ZA 1ADBA 4TRJA 2E4AA 3ZH2A 3E6AA 5G2OA 1O89A 1M2WA 4IXWA 5G0VA 2PZKA 5B37A 5CP8A 3OQBA 3HDYA 4HADA 3EVNA 3GEMA 4IJVA 3WGGA 3JYPA 4OIMA 3GRKA 3NTRA 4I08A 4P4GA 5COAA 5CG1A 1B16A 3WFJA 1JN0A 1HDXA 1LTHR 3QW2A 4ESOA 4BB6A 1J4AA 1YO6A 3V1YA 1TB4A 4NBVA 4TZTA 3KYCA 4BHTA 1GCOA 1D1SA 1DC4A 2VYVD 2I76A 1NR1A 3DMYA 4IY1A 1IHYA 3JQ8A 3BMQA 5DOVA 4A5OA 1P1JA 4HWKA 4R9RA 3UW3A 4RPGA 2Q50A 1VI2A 3AM5A 4B79A 2VRCD 4Y98A 1B2LA 2WYVA 3BMQB 1B3BA 3JQ8B 2YV2A 1NFRA 3BHJA 1UAGA 3ZWWA 4DREA 3SVTA 5JNLA 1DIGA 4FJ1A 5C7OO 4BNYA 4YAEA 3VKVA 5I7SA 1L7EA 4AJLA 3KB6A 3VTZA 4M49A 2VYVA 2Q4BA 2QRLA 2ZIZA 2EF1A 3LDHA 3W8DA 1N92A 2VRCA 5A02A 3WG9A 4TSKA 5JW6A 1EFLA 4FN4A 1V0JA 4B4VA 4H3VA 5A04A 2I3AA 1YH3A 1VL6A 5LCXA 2O2YA 3RWBA 3U9LA 4N5LA 4YWJA 4G81A 4O59O 4CMEC 3Q11A 4YJGA 5K6AC 5ENVA 1KEPA 2QIOA 3HUDA 1YB1A 1VKOA 1Y5MA 2VHZA 4NIMA 5AVOA 5L3ZA 4E2ZA 3HDHA 5JFOA 3E48A 2YV3A 4XEHA 4YJGB 4Q9NA 3E5MA 1ISJA 1UDAA 1GEGA 2J5QA 4JLWA 7MDHA 4D42A 2XOXA 3JQEA 3NT2A 5TT0A 3WBFA 3OQ1A 1HDGO 3F46A 2Q46A 2QZZA 4RQTA 5F5NA 3C1TA 2CNBA 1JKFA 3GNTA 3TN7A 4JN6B 3WGOA 1R0SA 1Z82A 2I5PO 1NPYA 1VC2A 3E82A 3MJVA 3ETGA 5TQVA 4PLFA 1X0VA 4DXHA 4WPGA 4HNGA 3AUAA 5F5LA 2YY7A 3P2YA 3O8QA 3A1NA 3BYZA 3FI9A 4L74A 1BG6A 2O2SA 1Y9AA 3GVCA 1QSGA 2NWQA 1HLPA 3IJPA 2JCVA 1EUDA 3WMXA 4PVCA 1PQPA 3AI1A 1U3UA 1GQQA 3RKRA 2HJSA 1R4MA 2FOIA 3O8QB 5CPBA 5JSFA 4RF4A 1WZEA 4KMSA 3SLGA 3CZMA 1OOEA 4PLGA 1R4MB 2IDZA 1HLDA 3MJEA 4BO1A 4OOFA 3PWSA 5ENDA 3OEYA 1E3IA 5TF4A 4Y9DA 5KJ1A 2NTVA 4ALKA 1JKIA 4FOSA 1MV8A 1Y6JA 4Z6KA 4UVEA 5L4LA 3L4BA 1DRUA 4GLOA 3D4NA 4IM7A 5EJ2A 1R37A 4NJOA 3RUEA 4FFRA 2BHLA 3SC6A 1GUZA 4IQGA 1U3TA 1J5PA 4BNGA 4YAIA 2OFPA 1MC4A 4IJWA 5A9RA 3OF2A 2NU6A 1FDVA 2WTBA 3JQFC 3PDUA 4IDFA 4TVBA 2GN6A 3CMCO 2PZJA 3FNFA 3UN1A 4F6LA 1HYHA 3WLEA 5EN4A 2YJZA 1ZK1A 4OOEA 5TJHA 4LGVA 3DMTC 4J90A 1PJLA 5JO9A 1YOVA 1F8GA 1YJQA 2O3SA 3DC2A 1PL8A 3NEPX 3W8EA 3I83A 2G0TA 4RZHA 1NX6A 1HKUA 3AY7A 4RVUA 1ZK4A 1YOVB 1E5LA 2D2IA 5KOIA 4R5MA 1K6JA 4O1MA 1E92A 1E1NA 1NVMB 3EDMA 4QX6A 2HK7A 4BNZA 5BNIA 5JY1A 2CF5A 2VNAA 2W98A 1ENPA 3RFTA 2B69A 3UXYA 1A4UA 4IINA 3WGTA 4DUPA 3OEWA 2EP7A 3GEDA 4N5NA 3HG7A 3Q2KA 1BHSA 3IIEA 2JFGA 2O4CA 3ZGYA 3GC6A 3WLFA 5A5EA 1IOLA 1JA9A 4ND5A 3RU9A 1HYGA 3AUUA 4YCAA 3E5RA 3ROPA 3NTOA 4U8GA 1H93A 3WSVA 2IODA 1P44A 1IZ0A 4XYLA 4FDAA 1A72A 1XG5A 1MP0A 3EVTA 3BAZA 2DM6A 1KYQA 1UH5A 1EVIA 1GV0A 1U3VA 2OMEA 1GY8A 1PQWA 4MO2A 1E1KA 4MP8A 4XQ9A 5EERA 3TFQA 4II2A 3ZNPA 1R4NB 4B8WA 3FNHA 1F0YA 3FF4A 3O38A 2EERA 2EHDA 3ICPA 1Q0QA 1LBEA 1ISIA 3H8VA 3U4IA 2HO5A 3PQDA 3N74A 1G6KA 3PHLA 2HUNA 4NMHA 2IEBA 5T6BA 2A4KA 2JD1A 3OJEA 1O6ZA 1IY8A 1JTVA 1AUPA 3CINA 4MKRA 4WNIA 1HE3A 4BNTA 2XXJA 3M6IA 5BNFA 4NZ9A 1A71A 1A9ZA 1GCUA 2DUWA 4JXKA 2F00A 3ZNQA 4NNJA 1ML3A 4TMFA 3KOUA 1O95A 2DTXA 5HM8A 4ND2A 4FQ8A 2BGLA 3F5SA 4YPOA 5A9TA 1CJCA 5CDGA 1UP6A 4J1QA 4BV8A 1PL7A 4ID9A 2Y1OA 4FCCA 1WW8A 1U3WA 3H2ZA 4XRRA 2Y67A 2Z1MA 4D0SA 1UAYA 5MDHA 4FGSA 5CDSA 3WSWA 2X4GA 2YFHA 4FOOA 1SEPA 2HKIA 4CM1A 4CV1A 4CM7A 4XKJA 1PJCA 1PJBA 3B1JA 4DQUA 4O5OA 2W8ZA 4D79A 2B5VA 5T5QA 4DIFA 4XR9A 4OGWA 1E3LA 4PLCA 1LQUA 1W8DA 4J4BA 4EEXA 2W2LD 3FSRA 2ZYDA 1X0XA 2J3JA 1XDWA 3BIOA 1RYEA 4OYRA 3T7EA 3ZWMA 3MEQA 5IG2A 5FEUA 4XIYA 5C5IA 2JJYA 2NU9A 2DTEA 4K26A 5AXDA 3TF5A 1CYDA 4OKIA 1V9LA 2YHIA 5CFZA 2HU2A 3L6EA 1YBMA 3KYBA 5AXCA 4ITUA 4P4NA 1U2DA 4CM8A 2DBVO 1WPQA 2FR0A 2YHIB 1I3KA 2W2LA 5AXAA 2GF2A 4PFJA 3ZWVA 4IMPA 2FRDA 1ZMOA 1JAXA 2NQTA 3SBOA 4CM8B 1M6HA 1IYZA 2Q2QA 2PH5A 3BTUA 3CZRA 3ZV6A 2YDYA 4Z0TA 3GEGA 4CMEA 2I3GA 2CFCA 3HB5X 1RWBA 2GASA 2ZB3A 2X0JA 4DLAA 3V5NA 3FD8A 3I9KA 3DHEA 1CWUA 4FGWA 2BELA 3E03A 4J7CA 2H9IA 3QIVA 5C37A 2B5WA 4HFRA 1E6UA 5EPOA 4PN3A 5G4KA 3W8FA 5KJ6A 5CAEA 1PR3A 3A28A 3AU9A 4QSMA 3GRPA 1SB9A 1EE2A 1NP3A 1HDZA 1OC4A 5C7IO 4IDEA 3ETEA 4XGKA 2Y0CA 3WTCA 4PLVA 1PS0A 4NG5A 5G4KB 1JWAB 5C3MA 2HQ1A 1KC3A 3WICA 2ZCUA 4I9NA 1HXHA 4LN1A 3A14A 4QFDA 2EKPA 3U62A 3CSDA 4MJLA 4K9DA 3PRJA 1TT7A 2NNLD 1QYVA 2XAAA 5FFFA 2Y0EA 1DXYA 1QP8A 2AW5A 3PLRA 3ZWXA 2R00A 3NX4A 2BFMA 4RLHA 4I5DA 4BNVA 4NHEA 3PXXA 4RDHA 4R9SA 4MVJH 3IUSA 4WCFC 4CR7A 3UGKA 1ZJYA 2NSDA 1E0DA 4ZQGA 4IQ8A 5T57A 2CDAA 3LYLA 1DHRA 3AY3A 1H9AA 2CDBA 4GQAA 2GR9A 1I5RA 2CZCA 2B4RO 1LC0A 5JDCC 2D5AA 3K30A 3GR6A 1BXGB 4Y67A 4A10A 3KBOA 4R3WA 3SX2A 1QV6A 2FPIA 5G0SA 1GYRA 4JK3A 1KIFA 3DZJA 4AJ4A 3PLNA 3Q6IA 2JCXA 1E7QA 3DO5A 2QQ5A 3JQAD 3QWHA 1Q7GA 1Q7CA 4GKVA 1O8CA 4LSMA 3EYWA 1EK5A 3FTPA 4RQUA 3RUFA 1T4BA 2GZ2A 2HMTA 3NV9A 4L4XA 1A7KA 3JCZA 3KSUA 4IJUA 5T67A 1ZMTA 1R15A 3WIEA 4J3FA 3H2SA 4RF5A 4ZICA 4IDAA 3FNGA 3PIDA 2OO5A 1RKXA 3FPLA 3MWDB 4UUMA 4XB2A 3GMSA 4EITA 4Z3KA 3ZU3A 1E3SA 3RJ9A 1PJ4A 1VL8A 3VOSA 5L51A 2VUSA 3ANLA 3JQAA 4BO9A 3TZCA 1LXCA 4I1IA 5DCWA 4HV4A 1D4FA 1N2SA 4XJSA 3EHEA 1U8XX 2EP5A 3JQAB 4F46A 4J16A 3UVEA 4ZQHA 1EVYA 1P74A 3NDRA 4L9RA 2HMSA 3LK7A 2DTDA 2J5KA 1RPNA 4XYEA 2BGKA 4RVFA 3CXRA 4HXYA 4DPMA 5KJFA 4KDFA 3VH1A 3RC2A 3VH4A 5EIOA 1BDBA 2AMFA 4BQPA 1YDEA 3WOHA 2IXAA 4E5NA 2DBRA 3AOGA 3DTTA 4W6ZA 1DEHA 1KVQA 3F4LA 4P4LA 1X15A 2JAHA 4ZD6A 3GF4A 1XIVA 4ZU3A 4CV3A 3GT0A 2P68A 1ISHA 2VNSA 2P4HX 4IS2A 1P31A 2JD0A 4NU5A 3UF0A 4D45A 2VCYA 4RDIA 5HS6A 2VHYA 5F3RA 4NU6A 4MP3A 4E0BA 1AXEA 4J2OA 1H6BA 5KNLA 4DMLA 3AWDA 2OHXA 4FFLA 1N7HA 5TRTA 3T4XA 1GYQA 4BMNA 4I9HA 3TZHA 3C1OA 2GNAA 4J0EA 4XX0A 1Y8QA 4OXYA 5FI3A 3GG9A 4W9NA 3GQVA 4DBZA 4AJHA 4CPDA 1NQAO 3I3OA 4PZCA 4CM3A 4FSHA 4ZA2A 2EV9A 4PLYA 1Y8QB 1C14A 1JQBA 3GGPA 4CMJA 4WEQA 1RJWA 4BKQA 3I9LA 1AGNA 3WQRA 1MFZA 2HMWA 3IDSA 5JPIA 1IE3A 3JYNA 4CMKA 1DIAA 1VJ0A 2P4QA 3LT4A 1A9YA 4XDYA 1P33A 1VE9A 4R1SA 5BSHA 1X1TA 2OP1A 2G5CA 4E31A 4RZIA 4MOWA 4B4OA 4JGBA 1B8VA 1NQ5A 1O94A 5H82A 3TZKA 4J7XA 3WBBA 3X2EA 1VRWA 1YL6A 1MX3A 3GH3A 3TFOA 1V3VA 2A35A 2GN8A 3K92A 4RL6A 1LX6A 1FJHA 1NWCA 5G0UA 4CUZA 1ONOA 3FRJA 3JYQA 2PA3A 5K1SA 1N8KA 5DT9A 4IUYA 3ZN2A 1UZNA 1E7SA 3PFFA 3VPHA 3RUAA 3JTMA 7ADHA 4BGIA 4ZHSA 2AQHA 1LUAA 5ES3A 4YR9A 4YEDA 3HADA 4M55A 1FDSA 1E77A 3JQ9A 4E5MA 1H2HA 2AG8A 2X1HA 3KLMX
chains in the Genus database with same CATH superfamily
1CEXA 4B9AA 3GT7A 2ODEA 1IBCA 5A4FS 5IP5A 4YA6A 3HHPA 2GFIA 4W82A 1QJ4A 2CBGA 5D1HA 2IYEA 2Q6IA 2IITA 3AF0A 3LDFA 2D5LA 4NECA 4Q3OA 4YBZA 1FMFA 4B4DA 4Z8YA 4B6FA 1UJ6A 5ALQA 1U2EA 2VQ3A 2ISQA 4D3YA 5K01A 1O77A 1P81A 1L4YA 2X9LA 1KHTA 2Q1WA 2RGXA 2XSZA 4BVFA 4E1VA 5JAMA 3SG0A 3VOBA 4UM9B 1V35A 3AW8A 5FBHA 3I01M 1G5PA 1E1DA 4QDUA 1OPRA 2GD0A 4BQSA 5GIOE 3ZX5A 2VHWA 5DLDA 1IG0A 2BTEA 4EA7A 3CR8A 3AESA 3QTBA 4N0PA 2NXEA 2Z3WA 2JZNA 1ATIA 2CE7A 3ZVNA 3AEUA 1B0UA 3GLRA 4WECA 1V8FA 3FRIA 1LJ8A 4LY9A 3CIFA 1HEYA 5FH9A 2PJUA 3ZE8A 4GGOA 1IBKB 3PJRA 3W1VA 1H5QA 1JT2A 1E2PA 4BC0A 4MWSA 5C32A 2P9QA 3AEUB 2BLLA 1U0LA 1IB6A 1Q44A 3UV6A 1ADJA 3M2TA 4WXHA 4MVJD 5K03A 3IQDB 1DKOA 1EFDN 1Z5OA 2OHOA 4J1TA 3RFXA 5FWYA 4YAKA 3D0KA 4WT7A 2CY0A 4F12A 4DNFA 2CMDA 4HS9A 4MSUA 1UFRA 3SR3A 1ZESA 3E27A 5BMOA 2IXFA 5H1YA 1S6YA 1T9DA 1UQRA 4X8OA 5HWSA 3AEQA 3QWIA 2XOKA 1N5MA 4NH4A 4Z9BA 4QG3A 1B76A 1RFLA 4RKRA 1DO8A 4OHZA 3U17A 5EZQA 1LC3A 4M76B 1CIVA 4US2R 1LK7A 1OXTA 4YRTA 1JVNA 1JJIA 1Q20A 1H6AA 1AB6A 2R96A 2WMYA 1U8AA 3AEQB 3HLTA 5T6MA 3QQPA 3ZHTA 2YCBA 3QI7A 3LLVA 1SC3A 1GIAA 3IV9A 1NV8A 4KUHA 1UXGA 2ZTMA 3PX2A 1UJ4A 3D3EA 5IASA 3WDKA 2P9JA 4J07A 4RLFA 1Z25A 1QVZA 3IRVA 4IDBA 2ZLBA 2NVUB 3RI3A 4AUNA 3RHTA 2XGMA 4RLQA 3SSAA 4URUR 3WBKA 3ELWA 4KXMA 1NVVR 3VKUA 4UREA 1QTRA 4EG3A 1ZGAA 1RI2A 2QY6A 1XZBA 3TRFA 2YYZA 2FN3A 3BJMA 3ABQB 4WBSA 1LKZA 3CX6A 2ANBA 4F86A 1VL0A 2UVDA 3DWEX 4J6EA 4FNOA 5D3KA 1EM6A 1PJAA 3AHDA 3EARA 1HL3A 2GXSA 3E9ZA 3FWHA 4I9GA 5HBGA 4I3HA 3TJZA 5CDUA 1DQNA 4YR7A 1RKQA 4D46A 1UXHA 4D57A 1M34E 2FETA 2XCRB 3PIIA 4FZJA 2CCKA 1SJ9A 4QPZA 4YAGA 1FU7A 3MLAA 3I8SA 5B4TA 2J6BA 1N1MA 3PR1A 2X15A 1V7QA 3A6LA 1L7DA 3INGA 3ZGOA 3VDQA 3OM0A 4UZFA 3RG2A 4J75A 4KH1A 2FP4A 4BX0A 1L9XA 3E2PA 1G8PA 4D9HA 3T4PA 4KAJA 5K3BA 1KEEA 2FX3A 2QD4A 2D62A 2JIOA 3R2JA 4IMIB 4B3FX 2FP4B 3Q9NA 4O25A 2BMJA 1PDWA 1JUDA 4F2WA 3KYCB 4BE7B 1IXZA 3NRBA 1KEEB 5EL0A 1AS3A 5A3VA 2B4QA 3GEBA 3H9CA 4L4UA 2X0NA 3PKJA 3UHOA 1AK2A 2HRDA 3KXDA 1RQRA 4MTLA 1MG5A 4UHJA 2QV0A 4HNTA 4HI0E 4GU5A 5JAOA 1RP1A 1KARA 3ZE7A 2R8EA 4R3UC 1KY3A 1LJLA 2CJPA 1ILWA 2HSZA 4OD0A 2JGEA 5ED0A 1K5DA 2Z5GA 3TINA 4JI3B 2H85A 3PXDA 3CCCA 2V1XA 5DCUA 5KVCA 1Z0JA 5LR6A 2VF5X 3M5WA 3V97A 4RHXA 1Z6GA 2ZSFA 2I6TA 2IDJA 3KD2A 3CX4A 1TW2A 2QSJA 5TXGA 1XAGA 1N6PA 2ZEJA 4LJ6A 2JGMA 4DCCA 3F9CA 2TMKA 4YYEA 5FWXB 2IP4A 1LLUA 2D0PB 1C1HA 2QA5A 3DBIA 5H02A 3SQMA 2P40A 4V1CA 1J5EB 2G1AA 1TA9A 4BV9A 4R8RA 4FM9A 1KNQA 3DAGA 1W2GA 4KAFA 3WSTA 4L9WA 3NOXA 3AUFA 3NTQA 4FS3A 1IK6A 1CBUA 1WBBA 4C2UA 1Q12A 3H04A 3V9AA 1KHHA 4V1CB 2C2BA 1Z7EA 4O2BA 1MX5A 5FIUA 3WDSA 1YU6A 1X8LA 5FUBA 1PYOA 3CA8A 3NKLA 1MT3A 4UUNA 4C0KA 4D98A 3PTLA 4LY3A 3TEJA 3OVMA 5JDIC 4KPFC 4MUXA 4O8ZA 4FDUA 1PT7A 5DBGA 1B14A 3MINA 4O2BB 2QVZX 4WLNA 1PJTA 1RYYA 4K87A 4OATA 3A32A 1K9SA 3QVMA 4LFAB 1GZ3A 2RG7A 3BTOA 3OX4A 4KLZA 4PBSA 1AV7A 1F38A 3MINB 4FBGA 4BQRA 4KLNA 1WAMA 4ZJUA 1FSSA 2ENUA 4DHEA 3QVOA 1TYZA 4I81A 4QL3A 2OKGA 4MIYA 3LYUA 5IKEA 2V9CA 3T7SA 2OP0A 3FZGA 4GGMX 4LDAA 4BAUA 4C7MA 4R2JA 4NE7A 4TS4A 2ZJ0A 3CWCA 4UNSA 1NNEA 3STXA 4FLEA 3C6BA 3TPFA 4UMFA 2CVZA 2V5AA 3B85A 4WK4B 1FNDA 3AV0B 3FG9A 1EQAA 2FMFA 4AMUA 4X64B 4E7PA 1VBNA 1U04A 2Z2KA 4Q3EA 3OQJA 5LQRA 3D4OA 4K9QA 1WKCA 5BN4A 2HU5A 2QTWB 1EWTA 1QVAA 3IX7A 3VISA 2O0LA 2O8BA 3ST7A 3IEMA 3QBJA 2VDKB 1EGMB 1K2WA 4BKRA 1L3IA 2Y1EA 5JARA 1GPUA 2J3HA 2XWSA 5BN4B 4C2AA 3L7KA 4F9GA 2O8BB 2AQ8A 5F35A 3RIHA 1DTEA 1DBIA 2H4XA 3ZHBA 2WKSA 1VGRA 1U1IA 4XM2A 3WQSB 2YXPX 2Z58A 1IDN1 2WJWA 1BEUB 1DX9A 3H1PA 3SYTA 1E32A 3NOQA 4IIUA 5CBPA 2QXUA 5JC1A 3D3NA 2EARA 4ZT4A 2E4ZA 4EG8A 3SAJA 4RPLA 1R5OA 5FQOA 3VKHA 1YZFA 1GAWA 1L5LA 1EFRD 3MGKA 1G9SA 1ECLA 4UUQA 1FFWA 3BWBA 3IUYA 4R9VA 3IDOA 5CBPB 4YALA 4CEIA 1IH8A 1X74A 4QJ4A 4P3YA 4AY5A 4HQNA 3OCZA 4TTSA 4HVCA 2ZATA 4GR4A 4HDQB 2XQJA 3FWZA 1J2EA 3KSMA 4V0OA 4B80A 2QGNA 2QMYA 3LYHA 3N0VA 1Z4PX 2C2KA 2R7AA 4E51A 4XWTA 4KV9A 2IYPA 1ST2A 4TV9F 1LBIA 3T1HB 2JIRA 1NW3A 2PR7A 1M76A 1DC6A 1M0WA 2XNDA 4NCHA 2NADA 3PP8A 4CCWA 2CNDA 4HP8A 4MEBA 4B2YA 4YQZA 1XAHA 1ZNYA 1RJDA 2TMDA 1PZHA 2VHJA 1YTLA 3HYNA 3LF1A 2H1FA 1LV7A 3LY5A 1IZ7A 4GAEA 1VHLA 1FXSA 3EW7A 3DFUA 4N8EA 3EBPA 4TLCA 4UARA 5K3CA 4E07A 2Q5QA 4LRWA 1N2EA 2AKYA 4N49A 2VTKA 3GZTB 4YGYA 1C30B 1R88A 3AJAA 4KOAA 5BURA 4KACA 1II9A 2R6GA 4UNRA 5EY5B 5JYDA 3FOCA 3K0AA 4B76A 2G6BA 3OLCX 2FPSA 3BGSA 4JJKA 2H2WA 5DU2A 1LF0A 3UV3A 3M9WA 4LQCA 4M0UA 1ULTA 1XZQA 3PNSA 1QOQB 1ZVKA 2O3UA 2X0IA 2OCDA 3FRHA 3K0AB 3T9FA 1SIBE 5AKXA 2HADA 3RS5A 3VX3A 1XC7A 1KH1A 1U7ZA 1W0CA 3I6IA 3UT5B 5L3SB 1R6DA 1ANKA 1P2SA 4RO0A 3SFTA 2A3RA 3QEBZ 3GLGA 1ZWLA 5F3WB 2JG3A 3KWFA 5BRAA 1C8KA 1S2IA 1CR0A 1BH6A 3EVZA 1P18A 4NEGA 1CQZA 3GJRA 3C74A 3PD1A 2OXFA 3GOQA 1THMA 4O63O 5BPFA 3GLGB 2QU8A 3A2KA 1B43A 2QRJA 3SC2A 2C5GA 2CVHA 4QZVA 5D01A 4OQNA 4F3YA 3PJEA 3UHPA 4E12A 1KZ1A 2W48A 9MHTA 4N8DA 4RZXA 4TMKA 3SC2B 3CV3A 2RCNA 3AM1A 4JB2A 1UC4B 1AKVA 1H8HA 3ML1A 1QWSA 2C07A 1I24A 3BM5A 4FEEA 2WJAA 1Y80A 1RHJA 3AIMA 4XDHA 4AJIA 1U0SY 2LCQA 4Q48A 4HMPA 1A98A 1Z2NX 4AY2A 2TMYA 1FMCA 5I45A 5LDGA 1SG6A 5BNWA 3IP8A 4I9FA 4OU4A 4B6EA 1XNGA 5JNSA 1QHHB 2E87A 4G84A 4PNPA 3SBXA 1ZWKA 2W6ID 2X5XA 4BVEA 2H54A 2JI9A 3FCUB 3RASA 1TECE 4Q5IA 3UW1A 1IJKA 1BYIA 3N2ZB 4NBKA 1L7OA 3AY0A 4MVWA 4RACA 1BGVA 4YCJA 3U48A 1G17A 4RENA 2VTEA 4TYPA 1K8XB 3FJYA 2PSJA 5K3SA 2OQVA 1T8UA 2BY4A 3EUFA 1T0UA 3I0MA 4FCVA 1MOPA 2ZTLA 4QDZA 2JFXA 4RPHA 3K5PA 1KSFX 1PU2A 1YNOA 3MJRA 5DSZA 2O8CA 4KX3A 3HSKA 4M54A 1J0BA 1E9EA 4YCCA 1APBA 1GNLA 2B8NA 1E1RA 3LS2A 1M5UA 5TB5A 3F6PA 2L17A 4FZ5A 1K6XA 4II3A 4TMYA 4L8GA 3VU9B 4XWWA 1RPZA 2YY6A 3OEHA 4QYMA 2VQFB 2CKDA 2V4ZA 2WJHA 5DOZA 3WYCA 5H0IA 4GI1A 2JHFA 4CM4A 1DT5A 4J0DA 1GRNA 2QVCA 3U3XA 4TKMA 1ZN8A 1DBQA 1HWYA 1Z4KA 3CEPB 3Q10A 2ZYAA 4R2LA 2V5UA 1EDOA 3FYCA 3ZHQA 3WV5A 5A3QA 3LX6A 1C1XA 2QIPA 2Y1DA 4I5IA 5ALEA 3KEMA 3QJ5A 3GL9A 3D8HA 4ILKA 1BD4A 4U5QA 2QUIA 3BB3A 5IXYA 4PC1A 2YOHA 2NU9B 3N6XA 4ZMRA 1Q3TA 5FOQA 1X13A 3H9GA 3LUHA 4X3OA 4BN0A 1IN5A 4WK6A 3WWEA 5U1PA 3I0ZA 1N2BA 4X45A 1CERA 2GEBA 2Z98A 3SSOA 1JAIA 1GU7A 4KR7A 3VI3B 2NX2A 1YA4A 1CY2A 3L6UA 3OSUA 3LL4A 3VSDA 1VIMA 4A16A 2O5EA 3W2TA 3I5UA 4EPWA 5K6AA 1U9CA 4NDZA 4LHZA 1QR6A 1XRNA 1PHRA 4YT2A 1QPGA 1ZK0A 2P41A 4MKGA 3K9GA 5DNCA 3L05A 4EABA 2UXCB 2H7XA 3MC1A 2H4ZA 4U7TB 2OCIA 5CD9A 1FC0A 1WUJS 4O8CA 4G97A 5EZYA 1G66A 1A9QA 1GPKA 3IUBA 3R5TA 4N3BA 1SVNA 4BX2A 4XQGA 2XMZA 5EPUA 3WKAA 1ZYUA 1MTZA 3CPJB 4FWBA 3K9QO 3LPAA 5D3ZA 4IIFA 4QBGB 4WZ6A 3BF7A 5JXHA 1XF1A 5DSXA 1G38A 1IPFA 3CLRC 4PYIA 3H1FA 2YC4C 1OYOA 3LE8A 2P8SA 4MDHA 4S04A 4LE1A 2ENWA 4X41A 1SKBA 3KDAA 3NVMB 3T7IA 3SFVA 3UY4A 3VV2A 1OAOA 1Z38A 2YWGA 1K8QA 5GJCA 2SCUA 3QI2A 1OX5A 3GW8A 3LZCA 3OJFA 4ICIA 1R0BA 3HN2A 3OU7A 5K3DA 1VKZA 2Q0XA 2C9CA 2RIRA 1W19A 1RJGA 2V54A 4D0NA 5LQJA 1DKUA 1E79D 1XMIA 2SCUB 3BH6A 4IDHA 1RCTE 1PR6A 3CH6A 1RHKA 2BRUA 3OHMA 2CLLB 2H4JA 1WHTB 2VH2A 2FUNB 3BQ9A 4KIGA 5TJ9A 4YN3A 4CG2A 3FPJA 3BH7A 4NULA 3PYMA 3CNEA 3M34A 3TE6A 3UIEA 4X62B 4P58A 1TEXA 4BP3A 3MTEA 3SHTA 4Q00A 2ZIEA 2YW2A 5KC9A 1H85A 4PCAA 2NPOA 2ZKLA 1YNSA 1CQJA 4XD7A 3M5PA 5AJHA 4B3BA 1VLJA 2XUIA 2ZUVA 2TMGA 1JIIA 2IPMA 4L5YA 4DDWA 3SQXA 1A27A 1WDMA 4D97A 4RS4A 1GG2A 2NXCA 3ITDA 5GZ3A 1VBFA 1E9BA 1NNUA 2QQEA 1U6JA 3EDRA 1KI1A 3ONNA 3LQ4A 3EASA 5JATA 1LSJA 3W5JA 1PR9A 5C31A 1KZ4A 3L6BA 4NFLA 5TE9A 3IAM1 4NE9A 1KO8A 3JQFA 2H7YA 1JSCA 3BSYA 4JC4A 2B5OA 4Y0VA 3WIDA 2NVBA 3GIDA 3FR7A 1QF9A 3ONFA 1YE3A 3F3KA 4YV1A 4HXFB 2AXNA 4BMVA 3U16A 3BXPA 4LV6A 2R8PA 3CCBA 3RTDA 3PEFA 3ZDZB 4KRFA 4OB6A 2VO1A 3WXBA 3DMTA 1SU4A 3HCPA 3LX8A 1E5VA 1HOXA 2P90A 3CX7A 4B3DA 4MPJA 2B3DA 3BCUA 2C7OA 4CI0B 3MB5A 3P0JA 2RAFA 3I3SR 5ICSA 1R0KA 3R9XA 1VSTA 3NC1C 2E0IA 3N0WA 3OMLA 5FTNA 3FYSA 1L1EA 2IIQA 2CUKA 1QLHA 1RKBA 1CB0A 3IJRA 1C1YA 2WD8A 3TOCA 5B5SA 5J3JA 4XGNA 3R9XB 3PENA 1YULA 3KUCA 3I5XA 1OGJA 4BRZA 3UK7A 2VWPA 2VP6A 4DYHA 3AUSA 4GSYA 4HNSA 1R74A 4PBTA 4LCJA 1TJNA 1XVTA 4LYJA 4Z1OA 2DGDA 3M6AA 3R0QA 3FOWA 2OUKA 2ZXEA 3PGA1 3QKIA 3MT0A 4X92A 1PS8A 1R9GA 4PAWA 1MH9A 3I8OA 1J06A 4U9IS 5EE1A 5BR1A 1CJUC 2AZDA 4KLCA 3TLZA 3EZLA 1JS1X 4GRDA 6LDHA 3CZ4A 3S2YA 1O03A 3I9FA 1SO8A 3AI3A 5ICCA 1C7EA 3K6RA 2ZZKA 5G1PA 2WIJA 3RS7A 1KOFA 2D0DA 4Z49A 3G2LA 5K0JA 1KQGA 3N7AA 1BJRE 1GO2A 4JP1A 3NJ8A 2WAMA 4ZVKA 3S68A 1NXSA 5JJKA 1LRKA 1KEVA 1ETUA 2DFNA 2PGDA 2UAGA 2Z9BA 5T4HA 3K2BA 4JZKA 4LF4B 4PYQA 4TVOA 3DT9A 3O1HB 1WQ3A 2P5UA 4R5HA 4ZP1A 3VDMA 2IS4A 4JKIA 2VQEB 2GJ4A 4RETA 5AI8A 3T3EA 3EHDA 4MA0A 2CLMB 4DWOA 4ETNA 1OH8A 5FWAA 4NTZA 3ASVA 5KSPA 2F8SA 2QM0A 3TNJA 2GPYA 4IICA 4CL3A 4EGFA 1NSTA 2GRAA 2AX4A 5KOIA 1NE2A 2AMVA 4JITA 5L45A 3OUZA 3AETA 2VYND 4ZEOA 3PC6A 2PT9A 3I52A 4UATA 3MAJA 2VK1A 4RGVA 3DV0A 1XCGB 2XYQA 3PFWO 1YL7A 3G0DA 1BC5A 5AJTA 5AKZA 5LBTA 3SS9X 2A0WA 1O8BA 3TRIA 2IEGA 1UMDB 3AETB 3ZNOA 1TKAA 1YB2A 2RKOA 3QP9A 2RJ3A 3K6KA 3CF2A 1NWHA 5G40A 3MIZA 4LG1A 1LLFA 3DV0B 4M9RA 3KLBA 3VR5H 4EMSA 4LWQA 4CU5A 3FPCA 4YRFA 1KI2A 4BE4A 1L4EA 4JR0A 2HCTA 5DYTA 1GZ4A 1QCCA 3O6VA 1PFQA 1UXKA 3BILA 1TVMA 3TXAA 1U8YA 5D00A 4EEKA 4G1BA 2WWXA 1ZSYA 3LMKA 4BZZA 3ET4A 3FMIA 3DL4A 3RT1A 4L0CA 1VMDA 3N76A 5BN1A 3K71B 1JSZA 1M2GA 1NTRA 1TVCA 1LDYA 2OFFA 3KOMA 2RHMA 5AUQA 3NUGA 5K6RA 1MX9A 1XZLA 3B8HA 4YAFA 4DA6A 4ARCA 2QW8A 2W0SA 4X9XA 2P3LA 4AVYA 2AW3A 1P9NA 1A7UA 2WB4A 5ALOA 5EAIA 4XVRA 1VXRA 2CHGA 2UUPA 5DN6D 3II6X 1TO6A 3BJEA 4Y2XA 2WSYB 1UOQA 1Y63A 3IV6A 5AP9A 3SP1A 3AQIA 4A6EA 3OPYI 1GCAA 2IYWA 4OHPA 5AI0A 3TZBA 4G86A 2W2KA 3X1XA 1YKGA 1SAYA 3BWDD 4D82A 1Y9DA 4OJKA 2Q21A 1XWIA 3W3ZB 2JJ1A 3ZZNA 5HJ5A 2XA9A 3A27A 1JF8A 2IOQA 1C2YA 4NBLA 4Z86A 1N2HA 3S5JA 4F93B 2XKBA 2C7QA 1NL3A 3LLMA 2Q9UA 1ZBDA 1Z62A 1E2JA 1SOVA 2QL7A 3C7DB 4HTAA 1T9GR 4XI9A 1JNXX 1QFXA 1TFRA 3NIDB 5C4IA 2RDMA 3ZHSA 1FRQA 1TEZA 1G5HA 2IYFA 4EKYA 1PBNA 2GARA 2Y1FA 3G88A 3PZRA 1P1FA 4G63A 4DCOA 2D7DA 1W4CA 2X86A 1WUKS 3WP0A 1Z4MA 2X6TA 5CT9A 2FOLA 5DNWA 3ANXA 3O5AA 3BJIC 4GE3A 2V8BA 1T0IA 1HRDA 4B6PA 3UYLA 4GOXA 4TWRA 3EZXA 3Q12A 1CJBA 5G0WA 3H84A 4D96A 4RE6A 3JW8A 1OX4A 2E37A 2PVSA 4UKDA 2OTCA 1JJBA 2AT1A 3S7TA 4KSCA 1WZ2A 4GIBA 5K20A 3IP3A 1C8VB 1E6WA 1KK0A 2E4UA 3HB1A 4KQ2A 4B87A 3A05A 1OX4B 4Q1AA 4L4SA 1Z2AA 2PFKA 3LAWA 1IWPB 1DRKA 2PUFA 2EOAA 4PZDA 4V0RA 2ZDHA 4RJ2A 3UAZA 4WXYB 5EIXA 5AUNB 1V4BA 4M8SA 2FUG6 1GDDA 1IG3A 1EZ4A 1RMTA 1RWOA 1PUXA 1X1SA 2JEOA 1CE8A 2WILA 2CD9A 1OJLA 2DCMA 1TUEA 3A6DA 3LLSA 4IFEA 3U9SA 5MFPA 2HLDD 1T9BA 2CHFA 3I28A 1MJNA 4B71A 3RTAA 3VNAA 3R7WA 3HZHA 5M34A 1OV4A 3Q5DA 1SUAA 4CIDA 1XROA 1CE8B 1BU5A 4I3GA 2FGJA 1UCFA 3MAGA 5HPYB 5JSHA 4EJSA 2YWXA 3TQSA 2HQBA 1Z47A 3ZDDA 1I3OA 2HCBA 3R7WB 1NGSA 3AR8A 4IMJB 1H1DA 4ZGWA 3O8CA 4JL5A 1AKWA 1XZNA 3PTZA 1U9ZA 3MWKA 3PU6A 1CS0A 2XYGA 3V46A 4EJSB 2Z2YA 2DULA 2X8BA 4G4SP 4PIPA 3VYWA 1ZH8A 2GF9A 1GYPA 2QP3A 1NIPA 3SLKA 3LQKA 5IC4A 2CKMA 4U7HA 5SZIA 4IQ4A 1N75A 4QRIA 1N5KA 2B35A 1LPBB 3O8NA 1X2BA 2H1SA 4H9GA 1Z26A 4X61A 1NVKA 1Z6PA 3R7SA 2DF8A 4CLOA 4ZC8A 3UKJA 2CNLA 4BYMA 4DY6A 3SC4A 1N9GB 2QLMA 4Y1EA 3O8BA 3QKSB 4DMKA 5JXGA 2B94A 4CQLA 3BT7A 4NFSA 4CLOB 1TL7C 3OQHA 4NFYA 2FLVA 4F38A 5J58A 3K94A 4K9MA 2EQ5A 1MC5A 3UC5A 2J9YB 4KU4A 4LNUA 3PXCX 4CQLB 3F73A 1NZFA 4HLUC 4EY8A 3EMKA 5KUTA 1NYTA 4KRGA 2WINI 4N7RA 3I62A 1X80A 5F51A 3E4DA 1TA0A 5KMGA 1R0LA 1USGA 1X1RA 3LSTA 5HG0A 5KWEA 3H4MA 1JDUA 1U2SA 1B4DA 1OV6A 2H1WA 2ZT7A 3MJSA 2YWHA 1V1JA 1X80B 3ADOA 3HEMA 5KMGB 2FMTA 1LB1B 1SCDA 1MNQA 3HEAA 1NASA 3N28A 2KJQA 2Z2JA 3PT5A 4YMUA 5JMOA 1U28A 5ULLA 3GAMA 1KAGA 2MR5A 3MPOA 2EDAA 2IUFA 2E4VA 4PHCA 3KYDA 2ONCA 4HN9A 2DUUA 4KO1S 4FI3F 3UMCA 1M10A 1NVVQ 1ZIOA 2IHTA 2XF2A 1O6CA 2IOFA 3EWNA 3LF2A 4OB7A 4WNAA 1GZ6A 4UPEA 1Q5PA 1W8IA 5IJAA 3TCNA 3KYDB 4JYBA 3EK2A 2RGBA 3V4VB 4AJJA 5LYJA 1C0IA 3RSHA 5GMOA 3U6BA 3SVLA 2HJVA 3LBIA 4EIWA 3WQRA 4CWAA 3IS3A 1EX9A 3CNHA 5HFJA 3NHWA 3UB2A 2PUVA 2WOOA 1KMHA 2PAFA 2A1TR 3MN1A 3C85A 3OLVA 1DFIA 5F33A 1KNXA 3E0XA 2QYSA 3TM5A 2I80A 3JV7A 2X7XA 1E59A 1ZJZA 1KYZA 3R7AA 4LF8B 3F7TA 4CR8A 4E2FA 2EU8A 4BDSA 4BMDA 1KMHB 3H0KA 2YASA 1PQYA 3E4CA 3L6OO 5IF9A 1KEWA 1EB8A 3BB1A 4HUJA 4HZIA 2YHBA 2BFCA 3TQFA 3WLHA 2FF5A 4JHLA 3M1LA 2XNJA 3EQ7A 2J7PA 4MVJM 4R7TA 4W8HA 1QH0A 5JAZA 3QG5A 2AZMA 4ZVTA 1Z7BA 4MI3A 2FWIA 1IK4A 3K4HA 2ZJOA 1TQ6A 3ZCVA 2W6JA 5CH5A 3LG2A 3KVOA 4Y6SA 3TLCA 1GU0A 5CFMA 3KV1A 4F85A 3SR0A 1QHNA 1QDLB 1K97A 2FN7A 1OE0A 4KI7A 1F0NA 1BNCA 2AIRA 3G0OA 3N8GA 4CF6A 4DC1A 1QE0A 1V8DA 2FDCA 3EMDA 5JNWA 2LP4Y 1M0TA 3S81A 1YBAA 2WKRA 3WFZA 4FE4A 5E8JA 3W6UA 2ZROA 4Q3AA 1EU1A 2L2QA 3EWIA 3VNUA 3AF5A 3FYUA 1W73A 5JC8A 4AYWA 2PGLA 2JVJA 4TX1A 4AJ9A 4HEA1 3O95A 4KXWA 1JNYA 5K9ZA 4DRXA 4WRRA 1VIVA 3B53X 3D64A 1G18A 2I91A 1GNRA 3AUTA 1SUIA 3ENNA 3ELYA 1CF9A 3FYUB 4FR2A 4IV5A 2ZI9A 4N6GA 4CDRA 2RK6A 2ZDQA 2HNBA 1WDTA 4QQKA 5K51A 4G0NA 3LHSA 4X65B 1WXWA 4DRXB 4YP6A 3D8TA 3G8YA 1S1MA 2ZAMA 4NBTA 3STHA 4XGIA 1V6AA 4ZVLA 2I7XA 4I2VA 1WM1A 3OA2A 4CMCA 4CM5A 4KTTE 3G5TA 1BXZA 1E5QA 4OIFA 1ZM4A 4G1VA 4KYUA 4M1QA 4Q93A 2XT9A 2P2ZA 2MMCA 3AGQA 3AJEA 3H8JA 3PPVA 3HN7A 1G5RA 1HDRA 3Q9SA 3BRWD 5T4EA 2ZIWB 3B6ZA 1ZCZA 1DOZA 1DXQA 1XD8A 1KY2A 1RYDA 2YHSA 4QYWA 4JX9A 3ZXYA 5M04A 1ZDMA 2GBPA 3E23A 3GLIA 3L7NA 4MVJE 3RLIA 1BMFA 1GG5A 2FQ1A 2HRCA 5C1OA 3UMYA 3MELA 1J25A 4TTTS 5CFNA 1J1UA 2YZMA 5HFAA 2IYTA 3HA2A 3L8CA 2R4UA 5GZ6A 1JFSA 3GLIB 3DWFA 3YASA 2DHRA 2R00C 4Y7DA 4YHBA 3UAGA 4CKYA 5JCXA 5FLXA 3GP5A 3CISA 2BIFA 2GN9A 5IHXA 3CH7A 4QHTA 3B1KA 2P6OA 3FLEA 1KEKA 4GX2A 1LZLA 1QPBA 2L19A 4RJKA 2IS2A 1DBWA 3C2QA 3W77A 1SWVA 1SC4A 4Z4QA 4G8DA 2J41A 4LA4A 3WC4A 1RAFA 1K0UA 5AKEA 3M49A 4Y2SA 2ZB2A 4B85A 3C45A 4AJOA 4NOKA 1ZD9A 5CT8A 1RAGA 4MLZA 2QU7A 5CG2A 3KB2A 4FGLA 4RXTA 1KYVA 4COOA 1W4LA 5JCOC 4WNYA 5LZ9A 4D2IA 5LWHA 4TRRA 3OZTA 4P83A 4IDDA 3ZDRA 4RF2A 5DP1A 5ALRA 2GZDA 2ZJ4A 1TM3E 4PC6A 2X77A 1V9SA 3BHMA 3L0YA 1M7HA 5B2FA 1A9RA 2R8RA 5IEBA 3GAAA 1QK3A 1TT5B 5CU7A 1A96A 1XGKA 1MJGA 1Q21A 2GPTA 4NBUA 5EKTA 3B9RA 3V1UA 2ZBQA 1Q6YA 3WNQA 3D7KA 5A0VA 1N1DA 2BFAA 2PX3A 3OICA 5KTKA 5JTTA 4MW2A 1KRXA 4TYNA 2QW0X 2OBLA 4MV1A 1F2DA 3G02A 4R1LA 4EARA 1QGZA 4CM9D 1A8UA 1Z73A 1ZO8A 4H3HB 1DAIA 1Q17A 4L73A 4UM5A 2BKAA 5FA8A 4F5ZA 5FBRB 4KWEA 2P77A 4G5FA 4LI3X 1QIDA 2BH9A 3PZBA 1T91A 2AD5A 3LPDA 2OGZA 2CLOB 4KYIB 4NH0A 4L28A 3ZDYB 4BNLA 4PO8A 2QE6A 1ZMBA 2AUMA 3P1JA 4US1R 3F3SA 4X8HA 2HXGA 4DLRA 3N5CA 4J2TA 4OFWA 4PYRA 4UMEA 3IPYA 5FOXA 4GKKB 4P7FA 1JHRA 3UFBA 1WUHS 3ASZA 3EAGA 4QBHA 1L4UA 4R8VA 4DVJA 1U8TA 1V47A 1QQBA 1K75A 3E8XA 5GJVC 3MCTA 1QK4A 1J6UA 2W6PA 2DQSA 4UAGA 3LKZA 4JCOA 5BUSA 1ZM7A 2JZCA 2JKVA 1BWQA 1MH1A 2GLXA 4E88A 3L82B 5BN5A 3OTQA 3R8XA 1DXOA 3CWQA 4HAUA 1DRVA 1E7YA 1KORA 2B36A 3QBVA 3EY4A 3PQEA 3NDJA 4EHLA 4YFYA 5FBLB 5A03A 3G7SA 4H60A 1PI3A 5DHFA 4BCBA 2FQYA 3H2IA 1LDBA 5BN5B 1AQJA 2R87A 1OVMA 5J2TA 2AFIE 1OI7A 1PDVA 2C3YA 1E2EA 1T3SA 1GT91 1QZTA 1YS4A 2YJ5A 2HSWA 2AC2A 2QLLA 4OGKA 1HE5A 2HAEA 4X71A 4WA7A 4L5IA 5C7LO 4OLBA 1GQOA 1KQFA 2IBMA 3I04M 3Q2IA 4OTZA 5J2TB 5DLYA 5THQA 1NJSA 4Q3BA 4ZJPA 3HS3A 4ENRA 5BQPA 1D0SA 5ALMA 3PXGA 1R0RE 3DCNA 3HZRA 3M3PA 4JLSA 4PZ0A 4BVHA 4C0JA 5KKNB 3AEKA 3ON5A 3PFGA 4LZJA 3V4RA 6Q21A 1PBTA 2Q1UA 1DAOA 4IGFA 1COWA 1JG7A 4JVLA 4JXJA 3W6PA 2FPMA 4DJAA 4EY4A 3GUCA 4GPEA 5IX8A 2ZBEA 3KIPA 4ZDJA 3M1YA 3GFVA 1GUDA 1L7AA 2AYZA 3AEKB 3DE4X 3ES9A 5FLKA 1REQA 4R01A 2QSUA 3WJAA 2V6GA 5DM2A 5ALLA 2BFBA 1W87A 3RKSA 3LGAA 3NUQA 4K0RA 5IM4F 1YI8A 5FUWA 4P53A 1NQVA 1XAJA 4MDFA 1REQB 4RHUA 2CE2X 2I1WA 5ENZA 3LW8A 2P0YA 4C7VA 2P4UA 1L2TA 2BZSA 2XTAA 2IS6A 3NORA 2AOTB 1KR5A 4KL8S 1ONBA 2XVZA 2KS6A 1HDEA 1EDEA 3HYRA 5A71A 1TRHA 5F5XA 4HATA 3O1JC 4K05A 5E9QA 1GKKA 3P5BA 1XX6A 2LD4A 4L6CA 4DV3B 3BZUA 5J59A 4TLEA 4D6PA 1FFBA 4FSXA 4Z4GA 3T95A 3ZS9A 4LDNA 4JUIA 3AVPA 4BCCA 3LL7A 5CT5A 3FVVA 2IELA 3QVVA 1HFWA 3TRDA 3WLLA 2C5AA 5FUXA 1Q77A 3L1IA 1EAMA 4WJKB 5DNUA 4RQAA 5DM70 1E2KA 1DZIA 3ZV7A 3B6JA 2O8DA 1DAPA 3E9CA 3G2KA 3IOMA 1U0JA 2PMCA 3D9QX 4HFMA 2QT1A 4OL9A 5EIBC 4BQIA 4EFLA 5HRUA 4TVKA 4L0QA 3W1EA 1CEEA 2W2MA 3IV7A 3GG2A 1KQNA 1UBTS 2HSEA 4BEBA 1D4OA 2B8WA 2VDRB 3DJYA 1BJKA 5DO9A 5DT2A 4HDOB 4MCHA 3S2SA 2IPOA 3SQNA 4BEJA 5AT1A 4V0NA 1IL0A 2JJMA 3VZRA 4CFYA 5JDIA 1MW8X 3UJCA 4EHBA 3T7TA 4H27A 4E2XA 5LZ2A 4ENSA 3IP7A 2QK4A 2XQKA 4ER5A 3N8IA 2A84A 3S2IA 1RQGA 1VPEA 3A3NA 2XNCA 4WY2A 3IQWA 4O0MA 4K6FA 3LCMA 1W48A 3LUFA 4C4YA 5KNBH 1ZUD1 4P98A 3TZQA 4AS3A 1AUQA 3DUFA 3DTNA 3CSUA 1SRQA 2CXXA 1KBZA 3OETA 2IYAA 4G1MB 4UCWA 2CHEA 3D1LA 2BPOA 3OFND 2MSWA 2DWCA 3LC1O 1CF2O 2OPHA 4R16A 3NBKA 1WZUA 3C6YA 3CB4A 3EBLA 4HUTA 1SUDA 3IQFA 1QG0A 1N6OA 4L75A 4MEAA 5CEFA 3D2CA 3CE9A 2AWNA 1D2AA 1XZMA 3PEEA 3R5XA 4PCLA 4EG1A 3W4IA 2IYXA 4QDJA 1AK9A 3FZEA 3PQ8A 1WMEA 4JQZA 3NPMA 4ZYYA 1K9VF 1RABA 5C5DA 3TL3A 3DBHA 4LSWA 2PD4A 3P19A 4M3NA 4TXLA 4PRLA 2B8JA 5HDQA 5K3FA 1M6EX 3ZI7A 1XYVA 3HI4A 4Z4CA 3X0DA 4ZTZB 2PSFA 2CXTA 5LJIA 2DXIA 2E49A 1RYFA 1H94A 3PEUA 1WXFA 4HGRA 3DBHB 3AO0B 3DZHA 4LGYA 4UM7A 3UV7A 2F90A 2ZYIA 4FFPA 4IHJA 3R0VA 1E0AA 3OPYA 1MIHA 1G291 2V9PA 1JL3A 4IFTA 3O93A 1SUSA 3F6YA 2P30A 4JL6A 5LWQA 1RLOA 3QG1A 1W6UA 4MPRA 3U40A 2YJ4A 4IHJB 4C0WA 1K0FA 1L1RA 3OPYB 4JLKA 4KWCA 1EFTA 5BW6B 3N7UA 2GKSA 2OCKA 2VAVA 3H6GA 4YT8A 2I4OA 4JU8A 2OM2A 2QUBA 1MDFA 3BH0A 3BD7A 3MCVA 4TTVA 4NAHA 4DCJA 2EFEB 1C7QA 1TZCA 4U00A 5HYVA 1TTTA 1F14A 1KKUA 1NNSA 4GPD1 5G4LA 1EP9A 1EGAA 4G5RA 4TRNA 1WMDA 3GRYA 1VL2A 1CY7A 3ZDAA 1T2DA 4EG7A 3AB3A 4OGFA 5FKJA 2JLVA 3GUYA 4CLHA 1L7RA 2HJWA 3CG4A 4YO7A 3X44A 3IA2A 4EL5A 3IEIA 2HT1A 2OGSA 3B51X 1NLFA 3L4SO 2GJ9A 4CM6A 1XKTA 1RIIA 2WYHA 3P27A 1JTEA 4QYXA 4BLVA 4AQDA 3OTOB 5EESA 3IP5A 1OWLA 2FUEA 2Q1XA 4XQEA 3IDFA 2ZBVA 5ALXA 1E2BA 4P82A 1SZPA 1A97A 3MGGA 2B7BA 3PHJA 4MVJF 4F6CA 2YMMA 1WRBA 2ZE5A 4WOJA 2MCFA 1ODFA 1IPHA 2LVBA 2XB9A 4D9MA 1OASA 3BTVA 3ZU6A 1IN6A 2QRUA 4Q24A 4RCYA 1RM5A 2AEEA 5K2MA 2Q9AA 3DHNA 4YMGA 1Z0UA 1B74A 2JL1A 3HWSA 4I7EA 4NABA 4RJLA 5DEIA 5EJGA 3RK4A 1P1RA 2FI1A 3C3BA 4Q4AA 3GRFA 2KQUA 2V4UA 4KRXA 3S27A 2B37A 4OQ4A 4C0QC 4EY3A 1ZCBA 1M8PA 2Z6AA 4AG3A 4DDVA 1U7PA 3HJNA 1SVWA 1OXSC 5BWNA 1GZDA 4Q4AB 3TCKA 3IYLW 4AS1A 1MVLA 3BHIA 3K32A 3DBRA 3PB3A 4HNQA 5EXEA 2ZE8A 2P6PA 2BGJA 1Z0FA 4OX9Y 3LUJA 2FZGA 4BNXA 3L49A 3JWHA 1DOHA 2KM1A 3LDGA 4FE3A 3U44B 4JGGA 1Y4UA 1LQTA 1XA3A 2FAXA 1GPJA 2ATVA 3AKCA 1S8OA 2J0EA 3DBRB 1NAIA 1CVLA 1NVWQ 4E14A 1SQSA 4CIVA 3F3YA 1Z06A 4NESA 1O9BA 2PVPA 4YNBA 2FVXA 3TQCA 3CUYA 2ZR8A 3P20A 3VJMA 4YUVA 1G2PA 1Q19A 3E15A 2ZUTA 1OWOA 4JWKA 5KHOC 3SOPA 1I2MA 3C5HA 3FCOA 3QBTA 4QPJC 3U31A 4E03A 3CLUD 3ZDCA 1VHJA 2DU8A 4S3MA 3KJNA 4LZWA 1PTJC 4WLEA 5CNJA 1QGYA 4M0EA 1QAQA 3TX2A 2VKTA 3ZDEA 4BN4A 2IIPA 3OZCA 3PWZA 3O74A 4M8KA 2N47A 1ISFA 3P9RA 1HZZA 4ZCRA 3H5LA 4FFMA 2V6FA 4B5LA 4Q9KA 4ZYZA 4D4MA 3W5HA 2VBIA 4LJSA 1KQPA 4P34A 5SZJA 1Q7BA 2YN0A 5BT9A 2H1LA 4H0NA 5CPFA 4ARZB 5L3QA 1T8RA 3UYKA 3BK1A 1I4EB 4HYQA 4FR5A 3VOAA 2HA3A 3SDBA 1TW3A 5ERGB 3ABSB 3T3OA 4C06A 1KO4A 3I8XA 4JUCA 2DSNA 2Z95A 3I01A 5EJ6A 3M3DA 3R8CA 5EXSA 2B4KA 1Y1QA 4DKXA 3CUSA 4L8WB 3C87A 1QC5A 4PNHA 4EQ6A 5I9IA 1TC2A 2RHRA 3O1IC 4WOCA 4MQ6A 1NVBA 3KZ1E 4US0R 1M34A 2JGRA 2PKQO 1QC5B 2R3SA 2WRZA 2ZXFA 3IP1A 3MFQA 5CTJA 4EQ6B 4DEYA 2BMFA 1KI7A 1CYEA 3GFBA