3JYNA

Crystal structures of pseudomonas syringae pv. tomato dc3000 quinone oxidoreductase complexed with nadph
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
325
structure length
325
Chain Sequence
MAKRIQFSTVGGPEVLEYVDFEPEAPGPQAVVVRNKAIGLNFIDTYYRSGLYPAPFLPSGLGAEGAGVVEAVGDEVTRFKVGDRVAYGTGPLGAYSEVHVLPEANLVKLADSVSFEQAAALMLKGLTVQYLLRQTYQVKPGEIILFHAAAGGVGSLACQWAKALGAKLIGTVSSPEKAAHAKALGAWETIDYSHEDVAKRVLELTDGKKCPVVYDGVGQDTWLTSLDSVAPRGLVVSFGNASGPVSGVNLGILAQKDSVYVTRPTLGSYANNAQNLQTMADELFDMLASGKLKVDGIEQYALKDAAKAQIELSARRTTGSTILIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of Pseudomonas syringae pv. tomato DC3000 quinone oxidoreductase and its complex with NADPH
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Oxidoreductase
molecule keywords Quinone oxidoreductase
total genus 104
structure length 325
sequence length 325
ec nomenclature ec 1.6.5.5: NADPH:quinone reductase.
pdb deposition date 2009-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3jynA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3jynA01
1YWGO 4UVDA 5U1PA 3NUGA 1BVUA 2DPHA 5F1KA 2HCTA 3W1VA 2JCXA 5L4LA 1H0KA 1NBOA 1IZ0A 1T24A 1K2WA 2P9GA 1X13A 1QYXA 4WE3A 2O4CA 1Z75A 1XHLA 1PQPA 2NWQA 3FWZA 3TPCA 4NNJA 3RVDA 4ZVVA 4WEQA 3WX0A 4CQMA 2LDBA 1YL5A 3OIFA 3IMFA 3PLNA 3BTSA 1SCUA 2CDAA 3QVSA 1CIVA 3GDGA 4HBGA 3B1JA 4CQMD 2I65A 4WCFA 1MXFA 3GFBA 4IS3A 3IDSA 1IYZA 5DDIP 2WTBA 5GY7A 3D5QA 3QRWA 4YEDA 1OFGA 3PI7A 4IDGA 1RWBA 4FFNA 4FDAA 3ST7A 2AG5A 4UVHA 1N1GA 3ENNA 4XEHA 2AQ8A 1N2SA 3W6ZA 1E3WB 3L6OO 4CV2A 5IDXA 4GH5A 5FF9A 3RU9A 4OXYA 3UXYA 2DT5A 1I2ZA 1Z45A 2C7GA 3GVPA 3B6ZA 2PFGA 2UYYA 3G1TA 3WSVA 1XWFA 1BXGA 1T2EA 5LC1A 3E8XA 2RBEA 4IPTA 3BHJA 1SOWA 1Y9EA 1KY5A 5IZCC 4M87A 4YJFA 1RM3A 4Z9YA 1EBFA 4BVAA 3OJOA 1K0UA 3DBRB 1VM6A 4ZD6A 4B3JA 3QY9A 3ROQA 4GGOA 4FD3A 4U7WA 1E1LA 3F1KA 5L45A 4TKLA 2Q50A 3SJ7A 3LZ6A 4TRNA 3I9KA 5L53A 3OA0A 3VH4A 4BNXA 1W4ZA 3UUWA 3KETA 2BI7A 4IQ0A 3OIDA 2HKIA 4OQZA 4RLHA 1PJ3A 4GPD1 1C0KA 1K6JA 2J5KA 3OEWA 2SCUA 2W8ZA 3K5PA 5L7YA 2JHGA 4HFRA 4RVGA 4MKXA 5GMOA 5GZ3A 4MO2A 1OMOA 1K6IA 4A5OA 4YAKA 2H6EA 2PGJA 4QECA 3H8VA 5JE8A 4ZQFA 4UVEA 4UUNA 4QUKA 1LX6A 4MVJF 4BUCA 1AXGA 1QRRA 1RJWA 5G0WA 3KRTA 1LA2A 3O9ZA 5FI5A 5B12A 4FC6A 4OM8A 1NHWA 4FIZA 2OFPA 1F8GA 2CVZA 5AQ1A 3C3XA 4QEDA 2IEBA 4P4LA 3LQFA 1ZSNA 4R1NA 1Z6ZA 1VJ0A 1NNUA 2D0IA 4RZIA 5AXDA 2FSVA 1B15A 4B4OA 4B4VA 4Q3DA 4EJ0A 1YQGA 2WYUA 3NTQA 1WP4A 3GMDA 3RUFA 3OP4A 3PQDA 1PZFA 4FW8A 4B7XA 4R4JA 1DIHA 3UCFA 3ETGA 5JLAA 4Z6KA 1NWCA 4PRKA 3WSWA 4IBOA 2PTGA 3WLEA 1DOHA 1DPGA 4FJ2A 3JQ7B 4AJHA 4OSPA 3RQSA 1MLDA 2GO1A 2Q2VA 2X0NA 3WGIA 3ZNQA 3CEAA 4N5NA 3AUTA 2O48X 3CMMA 3S2EA 1UR5A 2R6JA 4DIBA 3KZVA 2WMDA 5TIIA 2YFHA 3PIDA 2B0JA 2VTEA 1BG6A 5EERA 3VZRA 2Q1UA 1Q1NA 4S1VA 1MC4A 4CR6A 3AFNA 3ZWYA 1MX3A 1V35A 5IDYA 4GMFA 4BNNA 3H4VA 1HDRA 4A27A 3BMQA 4D43A 1N7GA 1QG6A 2Y0EA 1LXCA 2BGMA 1GEEA 5A06A 3NGLA 1NR7A 4Y6PA 3ZHXA 2X0JA 5C7OO 2VT3A 5A05A 5TF4A 1GFSA 4KUHA 3ONDA 4PLWA 3CSDA 1I2BA 1YBAA 3GY0A 3ULKA 4ND4A 3P2YA 4ND1A 3LK7A 2W2KB 4L73A 1UDAA 4Z9XA 3TSCA 2YZ7A 1O8CA 3H2ZA 5U9CA 4YAIA 3TFOA 4YVFA 2O3SA 1LLCA 5KWEA 4MVJH 1ENPA 4QTZA 4BGEA 1LC0A 1K5HA 2PA3A 4J9UE 5DULA 3VDQA 3LC7O 3NJ4A 4JX8A 1WMAA 3W8FA 3L4BA 1PZHA 2EP5A 4Z3KA 1FDVA 3JQAD 1GCUA 3WG9A 1FF9A 4YJHB 4NBWA 1UAGA 4HUJA 1IHYA 1Y8RA 4B7UA 3E5MA 2ZCVA 3B1FA 3H9EO 3AOGA 3MWEB 1O9BA 3QVXA 5DBFA 1LNQA 3ETEA 3M1AA 1D8AA 3I23A 2IZZA 3JQEA 3Q11A 1AXEA 2DFVA 4NFYA 3ZDFA 5G4KB 1KEWA 1GYRA 2CVOA 1WWKA 3QWIA 3V5NA 3DAPA 2DBZA 5IDQA 3VPFA 4DC0A 3UKOA 2IZ0A 4WLUA 4EI2A 3Q9NA 4WLFA 4DLBA 4ZN6A 4BOYA 4TZTA 1Q7GA 4QO7A 1P1RA 4ZU3A 4DC1A 1JKJA 3DL2A 3U9LA 1I5RA 3M2PA 4Z0HO 1GU7A 3INRA 1QKIA 4DA9A 3N7UA 4IZIA 1ID1A 2X23A 5U4QA 5JW6A 3EDMA 4OYRA 4IDDA 2X58A 3ICPA 2BD0A 1KVSA 2VWQA 2WD7A 4WK6A 2P4HX 1E3IA 1G0NA 1LDGA 1NFFA 2YV2A 3D3WB 2FSSA 4KWHA 1SAYA 1BXZA 1ZMOA 1X7HA 2YJZA 3QLJA 4UEKA 3JYPA 4DYDA 4OL9A 2ZYGA 3VOSA 3BMOB 1Y1PA 5T8KC 2OXIA 1ULUA 1VE9A 3AY7A 2OGUA 2ZKLA 4OIMA 2CSUA 1E5LA 3HHPA 3GH3A 3DXFA 2P2SA 4OKNA 4U6SA 3U09A 2P4QA 4PN3A 4R51A 3L77A 1UDBA 4MVJA 3GG9A 1ZW1A 3LC2O 2B69A 1MXHA 4R69A 1WAMA 1KEPA 3QW2A 3V1UA 4MVJE 5I9LA 1MFZA 2NU6A 4AJEA 4BNUA 4CL3A 5ENDA 4LRSB 2D59A 1QORA 5AYVA 3DTYA 1C0IA 2A35A 3JQ7A 1CQIA 4KUEA 4TZKA 2HSDA 1DRWA 2CZCA 1W8DA 3D3EA 3AJRA 3JQAB 1VI2A 2EG9A 4BO1A 5JDIC 2Y05A 4BGIA 4J4HA 3GNQA 2PNFA 3EUWA 3R6DA 4I9HA 5IXSA 2JHFA 5CHEA 4FFRA 1TVEA 3RUAA 3BYZA 4II2A 3WWYA 4HNGA 4I9NA 4R9RA 3CINA 1BW9A 1CERA 3CXRA 1XR3A 2GRAA 3WYCA 1XCBA 4IM7A 3OA2A 4ZHSA 3QA9A 1ZJYA 3DO5A 3PTZA 4J7UA 2JAPA 1VPDA 2DBQA 1PZEA 5KJFA 5A9RA 3WYEA 1LDBA 1PSDA 3WFJA 2GN8A 1YQDA 4GVXA 1ONPA 3BA1A 3H9UA 4RVHA 2NACA 2W90A 3ZWNA 1J4AA 4A0SA 1IPFA 2GN9A 3OQ6A 2VCYA 4J4BA 1YE3A 2GSDA 4RVSA 2EHDA 2D3TA 3C1TA 5DCWA 2GR9A 2WYVA 3DC2A 3I4CA 4N5LA 4PZEA 3C7DB 4ALKA 2QZ9A 1JKIA 2GDZA 3ZWWA 2UDPA 5ICMA 4BQRA 1ZNQO 4RPGA 2HAEA 2PZMA 1XSEA 1B7GO 1LI4A 4O1MA 2C5EA 3MJVA 3D5TA 3JD4A 2VUUA 1DB3A 2Z1NA 1QP8A 3E18A 4KP7A 3GNTA 1VJ1A 1I8TA 2BLLA 1IHXA 1TEHA 1NQTA 1HL3A 2C7VA 3S8MA 1PJQA 3AUAA 4WEOA 1SEVA 2HMTA 1ISJA 1AE1A 1BGVA 4Y6SA 1JKFA 3GPDG 4UAGA 4XRRA 3ZWMA 1EFLA 1YGYA 5JNLA 2HJSA 2HMWA 1KC1A 1WZIA 2DTXA 4JXKA 3RUEA 3WJAA 3TL3A 2EV9A 2YYYA 3RC7A 2WM3A 2R2GA 1HZZA 2NVUB 4JBHA 5TRTA 3JD1A 5A02A 4MVJD 4B3IA 1OOEA 2NU7A 1KERA 1EUCA 4IJKA 3DBLA 1YVEI 3FR8A 2YV1A 4LCEA 4EW6A 2RIRA 1PGNA 2NUAA 3KVOA 2RH4A 4AJ1A 1UXKA 1CEQA 2EJVA 4R1UA 3BMCB 2IYOA 2FHSA 1IPEA 1FXSA 4Q3EA 1P31A 1U8XX 2IXBA 2W2LA 4CMHA 5CFZA 4RPLA 1H2BA 4YB8A 4D46A 5C7IO 1E7WA 4FN4A 1R4NB 3I6IA 1PJSA 2B4RO 4GSKA 1YDEA 4W9NA 3WFIA 2HMUA 1ZK1A 4BNVA 4NBTA 3FRJA 3E9QA 3BTVA 3VH2A 3ZNNA 3GHHA 4IZHA 4PG8A 2Y1GA 1LSSA 1XLTA 4AICA 2XAAA 2BFMA 3L4SO 4I5FA 2B35A 4ZQBA 2PH3A 5JDCA 5JAIA 4L0QA 5BNTA 3NTOA 4ZGWA 5JDIA 4ALJA 1T1RA 2NLOA 2AMFA 1H9AA 3JQGB 3WGTA 5BQFA 5KKCA 5CG1A 5JY1A 4O6VA 4BO8A 4ZA2A 3D4NA 3CKYA 3OH8A 4QXMA 3BMCA 5JBIA 3PHLA 1ZXLA 5JO0A 2ZQYA 4PLZA 5MGBA 4XKJA 3AM4A 4YQYA 4CLEA 1U2GA 2Q1SA 3WGQA 3GPIA 3FTPA 3RJ5A 1DSSG 4FJ1A 3G1UA 4KQWA 3UCEA 4YAGA 2J3KA 1ZO8A 5BSEA 4C7JA 1ADBA 2PGDA 3WBFA 5TX7A 3ZU5A 4CLOA 4J1QA 3UGKA 4J1NA 4FGWA 3I5MA 3RCBA 1PR3A 3EW7A 3UFXA 1RM5A 5L7TA 3L6DA 1GD1O 1A4IA 4J9VA 3I9NA 3Q9UA 4B4WA 1PJ2A 1WXDA 3ZWBA 4RO0A 2C59A 1B8UA 1Y6JA 1P1FA 2PKRA 2VYNA 4RVUA 4GX1A 1VSVA 5A4DA 1XA0A 3BAZA 2VWGA 3SLGA 3I9JA 4ZQEA 4EBFA 1ZBQA 4IMRA 3NEPX 3WMWA 2WSBA 1DIGA 1GUZA 2P91A 1PJ4A 1JU9A 4QFDA 1XEAA 4R16A 3DAGA 3PJDA 4L4SA 1E3JA 1KVUA 4GBJA 4YT2A 2I76A 3KO8A 1GV1A 2GCGA 4DTIA 1PQUA 1EUDA 4JP3A 1E7QA 3T7EA 4NBRA 4IDFA 2WDZA 3ANNA 5ITVA 1ZEMA 3JQ8B 1E92A 4Q3CA 4BNGA 3G49A 3ROKA 5EESA 4CMIB 4L4RA 4RVDA 2G5CA 4M8SA 4OO3A 5IAAA 3GEGA 2XPCA 1GPJA 4BIIA 3GFGA 4K1LA 3C7CB 4A2CA 4AVYA 4R9SA 5IG2A 2E49A 4YTEA 3PVZA 4JBGA 1DIBA 2HUNA 5F5NA 1C3VA 3ZU3A 2CMDA 2J6IA 3K2BA 5FYDA 4B79A 5T57A 4GGPA 1I10A 1CWUA 3MTGA 3RSHA 3AOEC 1V8BA 4F3YA 2VYVD 1YONA 2POQX 1ISIA 1C0LA 7ADHA 2O4UX 5DP2A 3ITKA 3ICCA 4XIJA 2E37A 5A5EA 1P0FA 4B8ZA 1CQJA 4N7RA 4EUEA 3N74A 4XR9A 5BR7A 3E03A 3FPCA 4K28A 2YQ5A 1EDOA 2EW2A 3H5AA 1DHRA 3JQBC 4JK3A 1MV8A 4BO5A 1E6UA 2P9EA 3LVFO 3AFMA 5IN5A 3ZV3A 2H5LA 5CG2A 1NVGA 4IJWA 4XQ9A 3WIDA 1J49A 3PRJA 4J0EA 1HYHA 2EKQA 4CM8B 4C7KA 3U49A 2WD7B 1V3TA 1K89A 1Y5RA 4J16A 4MIEA 4O0LA 1BHSA 1GZ3A 4E5MA 2IXAA 3PDJA 3FBTA 5TLSA 4F6LA 1DFGA 1OI7A 1E1NA 4DPMA 1OC4A 2X9GA 4NIMA 4E4YA 1DRUA 4XDZA 4MIOA 4E21A 3C7AA 4WCFB 3EZYA 2JAHA 4J90A 1IY8A 5DF1A 3VAZA 3OETA 1X0VA 1Y8RB 4J43A 4TRJA 2QX7A 3F46A 1YXMA 5EQDA 4Z0TA 3PLRA 4XZ3A 3GVHA 2CY0A 1UZLA 2BH9A 3Q0EA 3OIGA 4ZICA 3S2IA 4YT4A 4X54A 4JJIA 1NXQA 4IINA 1P77A 2YHIB 3ANLA 4F6CA 3COSA 4N54A 4MOWA 1F12A 4HX5A 1U2DA 3OQBA 3O38A 5AXBA 1R15A 2W98A 1GZ6A 3PJFA 2CF5A 4FPXA 5KJ6A 2YUTA 2F00A 1I24A 4Q39A 1EZ4A 1Z74A 2Q99A 4CQLB 4PZCA 1KEUA 2H9IA 4YACA 5FWNA 3EGOA 1CJCA 4CLRA 1JQBA 1UP4A 4JJGA 2NTJA 1FDSA 4D42A 2O2SA 4WLOA 2OO5A 3L9WA 3OJLA 4D41A 4TKMA 1KOLA 4U0JA 4BNZA 1QYWA 1KVRA 2ZCUA 2HRBA 4KOAA 5KKAA 1DIRA 3S2GA 2O2YA 4UUOA 4B3HA 4ZJUA 3K96A 5JSFA 3GZNB 3L07A 4E31A 5HTOA 4NFHA 4GLOA 2OORA 1ZFNA 4WOKA 3K31A 1Q0HA 4U6QA 1P1HA 4BO7A 3WNVA 2AXQA 1GR0A 3AWDA 1ENOA 2B5VA 3FF4A 3QVWA 2J3IA 4DMLA 5TT1A 2ZB4A 3WGOA 1EVJA 3EYWA 1ZUD1 3O8QA 4MDHA 1QMGA 2EP7A 1ZJZA 1ZCJA 1PGQA 1U3UA 1MB4A 1T25A 3GGGA 4R54A 2PLAA 1UXJA 3SEFA 2EF1A 3MWDB 5EINA 4GKVA 3E5RA 1ZK2A 3H5NA 4RGBA 2WYWA 2OBNA 3I3OA 4YR9A 2EKPA 4MP8A 1B8VA 1R4MB 4E2XA 3MJ4A 1TT7A 4YDRA 3RU7A 4BL5A 5JCXA 3JQAA 3SC6A 1VJTA 3OJFA 4IQ8A 2EIHA 4CUZA 4XGKA 4CV1A 2IYPA 3VPHA 1LLQA 5I7EA 5KVCA 4YWJA 1BDBA 4JNKA 2FPIA 1BW9B 1B26A 3Q3CA 1VLLA 2HJRA 3F5QA 5I9MA 3IOYA 4DQVA 1PIWA 4UULA 2NVUA 2Q1WA 1HE3A 1B14A 1M2WA 1F14A 2OMEA 3TNLA 2XF8A 4BKOA 4BNLA 1U8FO 1PL8A 2GZ1A 4AJNA 2P5YA 3QP9A 4WLNA 4PG6A 4AFNA 3KLPX 4D79A 2B4TO 3IJPA 4ZRMA 4B4UA 3V1YA 4OXNA 1A7AA 1R4MA 2E4AA 1U5CA 1NQAO 4YXFA 1PJLA 4YRBA 3LF2A 3WIEA 5A03A 1YB4A 3CH6A 5KTKA 4D0RA 2Q3EA 3PQFA 1YQXA 2Y1FA 4QO8A 2GPTA 4D44A 3CUKA 3KM0A 5EQFA 1PJCA 4AJIA 3GF4A 4MVJP 2NM0A 4CMEA 3AU9A 2BI8A 2WJPA 4IXTA 2Y1DA 1XGKA 5C7LO 1LSOA 3AI1A 4D3SA 3FTNA 5EL0A 3ANMA 3TWOA 4XJTA 4GVLA 2IODA 2VUTA 5JCJA 1LDNA 2Q45A 3V2UA 4IDBA 4QX6A 2JFFA 4GWGA 3FNFA 3HB5X 3N58A 4E5YA 4XCVA 1PJBA 3SX2A 4I1IA 5JYDA 1V9LA 1D1TA 2V6GA 2CNBA 4A10A 3NT5A 2E48A 2ZIZA 3FBGA 1LLUA 1I2CA 1EE9A 1P44A 1RM4A 1YOVA 2QHXA 4PVDA 4ALIA 2Y1OA 3INGA 2VHXA 4EJ6A 1EEHA 1R66A 1O0SA 1LQTA 2ZTUA 1QR6A 2EJWA 3H7AA 4H15A 4CM3A 2OP1A 4RQUA 2VN8A 3ZV4A 4CM9D 5DCYA 6ADHA 1HT0A 1M66A 3WNQA 2Z1MA 1YL6A 3JQFA 2HRZA 2NVBA 4PCVA 4EGFA 3VHRA 3T4XA 2VRCD 1XU9A 2VWHA 1NR1A 5DP1A 4DIFA 1KEVA 5CAEA 2Y1EA 5DOVA 2XXBA 5KVQA 2YHUA 4R5HA 1T4BA 4N5MA 1DFHA 3U5TA 1CRWG 1GAEO 4DQXA 2D4AA 3PHGA 3VVBA 4S3MA 4IY1A 1Z7EA 4TWRA 3TF5A 3D1LA 5JMPA 1EFKA 3MTJA 3DBLB 1EVZA 2DTDA 2C0CA 2ZYDA 3RFXA 3H2SA 1U28A 4J0FA 4M1QA 4EEXA 4BNWA 3FNGA 1HXHA 1U5AA 3OJ0A 4QFCA 1B3BA 3DWFA 3KYCB 4CMAA 4L8VA 1X15A 4K26A 3JD2A 3R3JA 3G0OA 3DMYA 1T2DA 4WASA 4XJSA 3GEMA 4FB5A 5DOZA 3KHUA 2HLPA 1FMCA 2EERA 3NDJA 3Q1LA 1PWZA 1HSOA 4GKBA 1ZVMA 1NPTO 2VNSA 1NP3A 2PY6A 5GZ1A 3E82A 1M76A 4XB2A 2DBRA 3EHEA 3PQEA 2Y66A 2OHXA 3K73O 4NH4A 3TDKA 4KMSA 1QSGA 4FGSA 3M6IA 2HK7A 1GTMA 4JQCA 1F0YA 3GUCA 5EPOA 2D1YA 2D2IA 3RFTA 1YO6A 3DTTA 4XYLA 3RAJA 2FR0A 3KUXA 4PIVA 5ITWA 4OH1A 3HDJA 2BFOA 3GVCA 1ZKMA 4PLYA 5ILOA 1C1DB 2I5PO 4OJNA 4AJ4A 1PGJA 1JVSA 2VYND 3F5SA 1P33A 2QRLA 4J7CA 4PLFA 1PL6A 1T26A 5EMHA 3QHAA 5THQA 1A9ZA 1DBVO 3ZGYA 2PGLA 4CM7A 1FJHA 5I8WA 1EBUA 1LLDA 3IP1A 4CM4B 4KDEA 3ITDA 4L74A 1QYDA 2C5AA 4IIVA 3DDNA 3FSRA 1IL0A 4BNJA 4CJXA 4RORA 4CODB 3KXDA 5A04A 2B5WA 3V1TC 3VPSA 2FR8A 1E3SA 3A28A 1LRKA 3HDYA 4OSOA 4DPLA 1T1SA 3FWNA 1XELA 4FFPA 4WKGA 5KVVA 5KOIA 5IZ4A 1BTOA 1LDMA 2J3JA 4MJLA 5IN4A 1DC5A 3H65A 2GASA 3LT2A 3E9NA 3GAZA 3KYBA 3U3XA 2CDCA 3QE3A 3WGGA 4URFA 5BSGA 3VKVA 1YKFA 3BIOA 4B7CA 4NJOA 4YAJA 3F1LA 3KEQA 2W4QA 1ADCA 4RF3A 1TT5B 1EK5A 1UXIA 2RAFA 3U4CA 2Y68A 1DC4A 1JAXA 2GERA 2GNAA 4UVIA 4W6ZA 2Q1TA 3RC2A 4E30A 3H3JA 1HETA 3PWZA 1Z7BA 4LGVA 1H6DA 3ZZNA 3NAQA 1B16A 3RUCA 3EZLA 3MOGA 5JXWA 1NPYA 2HK8A 4YJFB 5B4UA 3KV3O 3MZ0A 1P3DA 3DZBA 4IIUA 3VZQA 3W8EA 1NYTA 1J0XO 1A5ZA 4EUFA 4MKRA 4W7HA 1F17A 2JFHA 5T5QA 4FOSA 1Q0QA 3VKUA 1V6AA 3TZHA 1KS9A 3O26A 4OHUA 3ZNOA 3W6UA 1LRJA 4BO3A 4UVGA 1IZ9A 1E7YA 2W2KA 2O3RA 1HE5A 1OC2A 4CMJA 1YBVA 3IP3A 4Q9NA 3FR7A 3AW9A 2V6FA 1R16A 2ET6A 3QJ5A 4LW8A 4CLXA 5BSHA 5I8ZA 2X86A 4HXYA 3INTA 2B4QA 4W9NC 1LU9A 5CPBA 4IUYA 3K8ZA 4XYGA 5COBA 4CLRB 4RF2A 4XD2A 5JYEA 3D7LA 3GDFA 4FS3A 4RL6A 2AE2A 4D3FA 3GUYA 1PWXA 2FWMX 1MC5A 5L3ZA 1FDTA 2AHRA 2I66A 4XGIA 3A06A 5EN4A 3LSYA 3Q2IA 3PZBA 4AJLA 1R0SA 5DNAA 3C8MA 1MUUA 2DLDA 1YS4A 1V0JA 1JN0A 2HMSA 3DFZA 3RBZA 1E3EA 1ZIDA 1D7OA 1RYDA 1ZEJA 3MJTA 4OMUA 1HWYA 2RHRA 3W8DA 1EQUA 4LVUA 1N7HA 3OFSA 2GD1O 4KUGA 2V65A 3RBVA 4JIGA 5A3JA 4TROA 3JD0A 5A3VA 4BO9A 4R68A 3O8QB 4ONEA 3M1LA 2J5RA 1S6YA 3DMTA 1XYGA 1NM5A 1K3TA 4WJZA 4BGUA 1EVYA 3I6QA 2P5UA 3VC7A 5CEJA 3K9QO 4BO2A 3RC1A 1B0AA 3STHA 1R6DA 2ZYAA 3QV1A 3EC7A 4TRMA 1O95A 4CMCA 3KSZO 3HNPA 4PLHA 3GMSA 3MCVA 1ZZEA 4LN1A 4MP6A 3D3WA 3DOJA 1JLLA 4FR5A 4L75A 3GDOA 3JD3A 1Q0LA 4I9UA 4NBUA 4JP2A 1I32A 2YFQA 3GEDA 1Z82A 4LISA 4MINA 2GN4A 5ILGA 5CDYA 1H5QA 4E33A 3L4BC 3V2GA 3RIHA 2IDZA 2H1SA 4O5OA 3PEFA 2XXJA 5CDSA 5KVSA 3KYDA 1WVGA 3IQDB 1FDUA 3JQGA 4IMPA 4H16A 1HYGA 4M49A 5JDCC 3U62A 1YJ8A 4YJGA 1NQ5A 5A9SB 3VZPA 2X0IA 3EMKA 4CUKA 4DBVO 4EJMA 3DHYA 3AI2A 3GG2A 3LT1A 4F45A 1G0OA 4RLSA 3PPIA 2Z5LA 3E48A 3TZKA 1QYCA 3H6KA 3D4OA 3HADA 1A72A 2NQTA 4BV8A 2RH8A 4RF4A 4AJJA 2AE1A 1JAYA 2A9FA 1HDOA 5H81A 5FFFA 1EUZA 3DMTC 4I5GA 3C85A 4JGBA 3ZWOA 1TT5A 1U1IA 2AA3A 4GLLA 3DBHA 2BGLA 3JQDA 4RVFA 3KSUA 2G1UA 4WLEA 4II3A 5F21A 5TQVA 5TGDA 3SVTA 2CVQA 5K0ZA 4YT5A 3EVTA 1NAHA 1ZK4A 4R01A 4XQEA 4CUJA 4HV4A 1GDHA 4P8RA 4CLDA 4EYEA 3IS3A 4J49A 1HDYA 2JL1A 4E5KA 2PH5A 3RUHA 3VTZA 1IUKA 1ISMA 1HLPA 3MJCA 1NASA 4EEZA 1O94A 3KOUA 4NK5A 2ZTVA 1NQOA 4WUVA 1RM0A 3CZMA 3ABIA 1PTJA 3UVEA 3NDRA 2W2LD 5KIAA 1NWHA 1J6UA 3MJEA 3JQBA 4K9DA 4LCJA 2X6TA 4FCCA 2FOIA 3WBBA 3UF0A 8LDHA 5G4KA 3IL2A 1A7KA 1H6BA 4AJKA 2B83A 4LVCA 4TSKA 3PHIA 1DC3A 2GYYA 4FFLA 5HBRA 3FNEA 3JQ8A 5L4SA 4J91A 3LF1A 5JY6A 1DAPA 1BMDA 1SC6A 3ZV5A 1Q7CA 3JQ9A 5JPIA 2D5CA 1Y7TA 1GCOA 1ZH8A 4XQCA 1K6XA 1L1FA 2UUPA 4RV9A 2GF2A 3ZU4A 1PX0A 5HS6A 1IE3A 1WMBA 3DR3A 4RDHA 5AOVA 5KJEA 3W4JA 1DAOA 3A1NA 1R12A 3B1KA 3PJGA 5TT0A 1BSVA 2A4KA 5K6AC 4DQUA 4HKTA 2TMDA 3CPSA 3DEYX 1WZEA 3OHSX 2O3QA 4TMFA 2I9PA 3IUPA 1VSUA 1I33A 3GGOA 3WQQA 1LUAA 2PD3A 3VPGA 3GAFA 1AHIA 2JKVA 4HY3A 5F1PA 1BDMA 1YH3A 2ZTMA 1SB9A 3KYCA 4CR8A 1BRMA 3MJSA 2Q2QA 4XR4A 2CD9A 4BNYA 1WPQA 4RPJA 4DL9A 1ZSYA 1DC6A 3PFFA 5L40A 3LT0A 3ZHYA 1LDYA 2BGKA 3LT4A 3RWBA 1SZJG 1N8KA 4MKZA 4E13A 4NPCA 2O3UA 2X0RA 2NTNA 4E2ZA 1UAYA 4XDYA 1UP6A 4DREA 2YDYA 5LDHA 1NFRA 3RKUA 2IE0A 3DFUA 2GLXA 3PJEA 1RYEA 1P45A 4M54A 1DRVA 1N9GA 1LDEA 2QRKA 1KYQA 1GUFA 1QV7A 2PR2A 5JAQA 2G0TA 5CEEA 1LEHA 1I3NA 3QVTA 3OEYA 4Y98A 1F06A 1ISHA 2VWPA 3BMNB 4GX0A 3RUIA 4I5EA 2YHIA 4ROSA 4WPGA 4IDEA 2PD6A 4YBZA 3K6JA 1U4SA 4C4OA 1DJQA 1X0XA 4BKPA 2C2YA 1SMKA 1TA4A 1E1MA 1NVTA 1ISFA 3U4DA 3VZSA 2ZATA 2BMAA 3DBRA 4OXKA 3F4BA 3ZV6A 2PD4A 3NDIA 2OZPA 3NGXA 3ZCXA 2JCYA 3O4RA 1GQQA 3NYWA 1P1IA 3WDSA 3WWZA 3BTUA 3PFWO 1PZGA 1AGNA 2DC1A 2FP4A 4J2HA 4XYEA 4CMIA 3V8BA 5EIOA 5BNIA 4H3VA 1C14A 1UP7A 1ADFA 2NQ8A 3O03A 4FFMA 3VH3A 3WB9A 4PZDA 2A92A 1H94A 1HDGO 3S2FA 3AOEA 4P4GA 2WE8A 4ESOA 1U9JA 1W6UA 4BO0A 3KBOA 2PZKA 1OBFO 1WW8A 4FSHA 4NQZA 2VZ0A 3H5RA 3UCXA 2JJYA 2WEKA 1Q2XA 9LDTA 2X22A 3WJ7A 1O5IA 3FN4A 1C0PA 4RDIA 4CV0A 6LDHA 4W4TA 1P74A 3GT0A 2IRWA 2O7QA 5TNXA 4JJFA 5B4TA 3DAFA 4OQYA 1CDOA 2V6BA 2VHZA 3JYQA 2HQ1A 2BFPA 4XB1A 4ZQGA 1U3VA 3B20A 1HDXA 1HDCA 3QSGA 5FEUA 1E7MA 3NJ8A 1P1KA 4E2YA 1T2AA 2O3TA 1C1DA 4CV3A 2DUUA 3ASVA 3WXBA 1AHHA 2IZ1A 3EY4A 3H3FA 1OZAA 4OOFA 1C1XA 4U0KA 2DVMA 3PDUA 3P7MA 3F4LA 4QQRA 4GAEA 3QIVA 3TRIA 5F1OA 3LU1A 3X2EA 4JLWA 1Z73A 2JCVA 3IKVA 4NFSA 4XQGA 3SBOA 3U4IA 4BO4A 4RZHA 1DEHA 2EXXA 2VRCA 3DOOA 4R5MA 4BMNA 1P9LA 4NHEA 4J1TA 4PLCA 4PLPA 4UUMA 2B36A 4YJDA 3WTCA 3R1IA 5HWSA 2EEZA 4LK3A 3WICA 2NTVA 3BHIA 1GYQA 5FI3A 2BKAA 3AUSA 1LC3A 5L4NA 4GWKA 1ULSA 4W82A 5THKA 3UN1A 4AL4A 1R0KA 3HB4X 3L6EA 4MP3A 3VPXA 4CR7A 5A1TA 1OAAA 4IJVA 5JAZA 1CYDA 2E82A 4BB5A 4Y67A 1MFPA 1V3UA 4KQXA 3ZWPA 1I30A 5C3MA 2OUIA 2DBVO 2PWZA 5J23A 4NK4A 3WS7A 1GV0A 3CZRA 2C20A 4A03A 1N1EA 5TJHA 4YRDA 3KTDA 3WYBA 2JD1A 3X2FA 4MVJI 5LCXA 4E0BA 3GN2A 4WCFC 1R37A 1JW9B 4R41A 2NSDA 4CPDA 3PGJA 1T4DA 3UHAA 1I3MA 1H6CA 1GEGA 2EW8A 3ZWVA 1M6WA 4K6CA 4XGNA 2BHLA 3HSKA 4F46A 4RF5A 3NRCA 3RBXA 4PG4A 1P0CA 3BMNA 5K9ZA 3I9OA 2H63A 4NR0A 3ZNPA 1L7DA 2QG4A 5DT9A 1DDOA 4NZ9A 2DAPA 3ROMA 3AUUA 4BGVA 5KJCA 2BRUA 4RQTA 1BXGB 1LBEA 2X7HA 4J3FA 5T67A 4CMEC 4WNCA 4YAEA 4D45A 1ADGA 1XDWA 4DRYA 4KZPA 3FPLA 2EKLA 4P4NA 2VRBA 4B8WA 3AM5A 3VVCA 5HRUA 1PS8A 3CE6A 3KSDO 4RCVA 2OOSA 1XQ6A 1LRLA 5TSDA 1GL3A 1M75A 2VOJA 2Y0DA 3LLSA 4IGFA 4XRGA 1ONOA 5AXCA 3ENKA 1DJNA 3HFSA 1PS9A 4YQZA 2E6UX 3TN7A 1E6EA 3EVNA 4E5NA 2Y1CA 1KC3A 2NU8A 2J5QA 4U5QA 1E7SA 1HE2A 1XKQA 1UJMA 2QQ5A 1Y8QB 1EMDA 3HWRA 3HQ4O 4DPKA 4CQLA 4RJTA 2FPPA 1LSJA 4J1SA 3JV7A 4PFJA 5I9NA 3JSAA 1GPDG 4Q3AA 3RJ9A 1X7GA 1H2HA 3RFVA 1A4UA 2ZTLA 1O89A 1SPXA 4O59O 5C5IA 1YJQA 3SJUA 3GVXA 1HLDA 1HEUA 1C1XB 2V6MA 3HFGA 5JC8A 1B2LA 4G81A 3LDHA 1FK8A 3C1AA 4TVBA 5JMWA 2ZK7A 4AJOA 2VT2A 2EGGA 3OECA 3QWFA 5AVOA 4XA8A 3PXXA 1NFQA 5DN9A 1LSUA 1I3LA 1ZSVA 3U0BA 2FRDA 1NTOA 3TZCA 3HN7A 3NTRA 3A9WA 1MP0A 1E0DA 3P5SA 1ZK0A 3HDQA 4J7XA 4CM6A 4WCDA 3SLKA 4NI5A 5DBGA 3FHLA 4ID9A 3U4HA 1MG0A 2CUKA 1HYEA 3AK4A 1YL7A 1XQ1A 1ORRA 2AQKA 4BNHA 3K2EA 4OKIA 5F3RA 4XWYA 1GQ2A 3LC1O 4Y8VA 3JYNA 1GYPA 2EGHA 2VNAA 2FN7A 3W4IA 4DIOA 3HN2A 2JD0A 4IS2A 3VH1A 4JCOA 2ILTA 4E3ZA 5L51A 2X5OA 4E2WA 3OMLA 4GL4A 2FMUA 4GX2A 2J3HA 3UW3A 3DBHB 1SOVA 5B1YA 3BZUA 3GRKA 4EZBA 1RPNA 2PV7A 4AJ2A 4GQAA 4TVOA 1EE2A 3KB6A 3T7CA 1I0ZA 3GHYA 4DUPA 2OL4A 2R00A 2VHWA 1QYVA 1B3RA 4NU6A 2TMGA 3D0OA 1ZK3A 4JROA 4Y9DA 3WMXA 1KBZA 4UEJA 1WDKA 3C1OA 2UV8A 1PL7A 1GUYA 2HO5A 4WLVA 3UAGA 3WGHA 1E1KA 3TJRA 1YB1A 2G76A 3OSUA 1A27A 1FDWA 2X4GA 5T64A 2C54A 5K6AA 4WGGA 2X5JO 1E5QA 3DQPA 1DXYA 3MEQA 5JS6A 1GQYA 1PJTA 1JTVA 2GZ3A 3LYLA 3PK0A 1GY8A 1BXKA 2BELA 1HF3A 3WTBA 3ZU2A 3PWSA 1ARZA 3BMQB 3IC5A 1HTBA 4RPKA 2Y67A 3DZGA 4E5PA 1Y9AA 3GVIA 3EK2A 2QRJA 4DWVA 3AI3A 3R0IA 4LSMA 1BWSA 2NU9A 2UUOA 3QVOA 1TB4A 3IJRA 2AQIA 1J5PA 3G17A 2YY7A 4NJMB 1VL6A 2GUGA 2ZB3A 3KEOA 1DFIA 3G79A 2PKQO 4UREA 1KY4A 1JWAB 3G3EA 3E6AA 3GNSA 4NDNE 4W7IA 5DCUA 2P68A 4DLLA 1VL8A 2DPGA 3QWHA 4AJPA 4EUHA 2WE7A 3HDHA 1W0CA 2GN6A 4L9RA 1EQ2A 4HWKA 3TZQA 1LTHR 3DZHA 3S55A 1WDLA 1VRWA 4KTTE 4I5DA 5L95A 4IQGA 2O7SA 4P22A 1QLJA 2AEJA 5CP8A 4CM9A 3RUDA 2CF6A 2RHCA 2VZ9A 5T8KA 3PZRA 1KETA 2WD8A 1E7RA 3TOXA 3ZW9A 3ZWAA 4YJHA 4OAQA 5CPFA 1EVIA 3JQFC 1U3TA 2HK9A 1YBMA 2QYTA 4M55A 3NKLA 3RASA 4GSLA 3B70A 1QLHA 3ZWCA 3AY6A 4PLVA 1PGPA 1PEDA 4G2NA 4BNIA 2HU2A 4J2OA 2Y0CA 3A14A 3OF2A 4OOEA 4YYZA 4XX0A 1WNTA 4PLGA 1UDCA 1PS0A 5KNLA 1LQUA 2C07A 3R3SA 3OICA 5I7FA 4IJUA 3WGZA 4BMSA 4BV9A 3ZW8A 1V3VA 3I1JA 3T4EA 3K30A 5IFLA 5I7SA 3D64A 2Y99A 4G65A 2FY8A 3GQVA 1EK6A 3OJEA 2NNLD 4MVJM 1TXGA 2V7PA 1Y81A 2YW9A 3BTOA 1HDZA 1GZ4A 3DZFA 2YDXA 4M86A 2RCYA 4NU5A 4CQMB 1IB6A 5I7VA 1VL0A 1HKUA 2D8AA 3PYXA 4D3DA 3I4FA 2Q2WA 3NX4A 3WLFA 1BVRA 3HZZA 5H83A 3TL2A 4BKQA 4YT8A 1QXSA 2D5AA 1E6WA 4NMHA 2DUWA 4BKUA 4XYMA 2VYVA 2AEFA 1L7EA 1D1SA 2EWMA 4YPOA 4BKRA 4YJGB 1UZMA 4RPHA 5H82A 1JA9A 1VKOA 4IXWA 5JCJD 4BNMA 2AW5A 3KYDB 4D7AA 3VDRA 3F3SA 5AXAA 2WWRA 2X9VA 3QWBA 2I99A 1YRLA 1H93A 3F47A 1SEPA 4PG5A 5GZ6A 1ML3A 1SBYA 3FCOA 5B4VA 2B37A 3A4VA 1HZJA 3PWKA 5G4LA 2VTDA 5L9AA 3Q2KA 5CDTA 5G2OA 3F6YA 4DVJA 1N5DA 5A9SA 1S7CA 3NT2A 2DM6A 2C29D 4BNFA 4BHTA 3I9MA 3BXXA 3IIEA 1Y5MA 1T2CA 4A7PA 2DKNA 5IDWA 1G6KA 4EDFA 1U3WA 3ADOA 3ONEA 4OGWA 3WQSB 3SXPA 1Q7BA 3Q6IA 1X14A 2BF7A 2I6TA 2UVDA 4CLHA 5A5FA 5L7WA 1A9YA 1O6ZA 1U4OA 3WR5A 2I3AA 3SC4A 4XYBA 2PZJA 3PYMA 5HS4A 4DBZA 3GK3A 4IDAA 8ADHA 3HE3A 2F1KA 3HJAA 3DHNA 4KTVE 3DB2A 4NBVA 4MPDA 4NJMA 1W73A 4LRTB 2BFAA 5ER9A 1B8PA 3RI3A 5BT9A 3I83A 3PHJA 4CM4A 3NV9A 1IOLA 5EJ2A 1F8FA 3VTFA 4YRAA 2QYSA 4ALMA 2VOEA 2I3GA 5DZSA 4Z0PA 1P1JA 3D4PA 1HE4A 4XIYA 4BS9A 3JYOA 3H9JA 1XU7A 3BHMA 4CL8A 1DLIA 1CF2O 3F9IA 1ENYA 3GOHA 3QWAA 4QT0A 4YCAA 5IXYA 5A9TA 2I67A 1I36A 2ZQZA 3FD8A 3NT4A 5JC1A 4HADA 4BNTA 1R0LA 2AEMA 3TOZA 4Q3NA 3ZHBA 3GZ4A 2FZWA 3GZNA 4R1SA 1A71A 4FBGA 2JD2A 2JFGA 9LDBA 4FJ0A 4PLTA 5TS3A 1DIAA 3PP8A 4BQPA 5HM8A 4BMVA 3L9XA 4ZRNA 4M89A 2Q46A 2CFCA 4CM8A 1PGOA 3QQPA 5ADHA 1EDZA 1PR9A 3JCZA 2DFDA 1TI7A 4MIYA 3WGYA 1MGOA 3TZ6A 2G17A 4HFNA 4JN6B 2ZB8A 1D4FA 2Q4EA 3PGXA 4CM5A 5COAA 1XG5A 3I52A 4INAA 3ADPA 1H9BA 5F5LA 3JTMA 3GLQA 1HSZA 4HFMA 1NPDA 2X5KO 5IZCA 2X9NA 3P19A 3AY3A 1KVTA 1GADO 3LLVA 5BNFA 2C82A 1E77A 4KDFA 2Q49A 3JQ9C 1MG5A 3ZHZA 4GI2A 2QW8A 5LDGA 1UXGA 2YV3A 3UICA 5K1SA 5CDUA 5ENVA 2PK3A 1UXHA 4ND3A 1XIVA 3GN1A 1N92A 4LMPA 5JAMA 3H9GA 4FOOA 1NX6A 1KVQA 4GX5A 4HFJA 3PIIA 3E9MA 4WOJA 4EITA 1R4NA 2AG8A 1NHGA 4CMKA 4JBIA 1MA0A 5G0VA 1NVMB 2Q4BA 1KIFA 5JO9A 2GGSA 2QZZA 1JWBB 2VHVA 2FZEA 4BO6A 3IAHA 3WQRA 3OBBA 4I8XA 3ORFA 5BSFA 5G0TA 1QV6A 1N9GB 3ZN2A 3RC9A 1M67A 4WECA 3MOIA 2J8ZA 2HDHA 3JQCA 2O50A 2X1HA 5C37A 4GMGA 3W4KA 5HA5A 1LJ8A 1Y8QA 2CDBA 2FR1A 1YDWA 3TFQA 1VKNA 4NG5A 4HNHA 5ER6A 3M2TA 4H7PA 4ALNA 2DQ4A 1E3WA 3DOCA 3GRPA 4N18A 2ZJ0A 4W99A 4WNIA 5ICSA 2AQHA 4P38A 3CIFA 3BMOA 2GZ2A 4J4TA 4TRRA 5G0UA 2NVWA 1WDMA 1DHTA 1ZXBA 3GC6A 4R3NA 5IF3A 3HUDA 4PG7A 4BNKA 3KLMX 1SNYA 2VHYA 2PKQP 4Q3BA 2Z95A 5DBIA 1JDJA 1IULA 1VC2A 1AN9A 1TLTA 1UZNA 2FPGA 1UUFA 3IUSA 2IEDA 1I3KA 2PZLA 4YA6A 5ES3A 3DZIA 4PVCA 2G82A 4BB6A 4D0SA 3ZI0A 3IKTA 1PU2A 5G0SA 3TQHA 5CDGA 4CLOB 1AUPA 3S1LA 1ISGA 3DHEA 4FQ8A 4G5HA 3ZH2A 1YOVB 5IJZA 3ZWXA 5TJ9A 4MVJG 2UAGA 4E12A 3GGPA 5T6BA 2HMVA 1JVBA 2VUSA 2O23A 3WOHA 4ALLA 4FFOA 5B37A 3I9LA 2NADA 2DU8A 2P9CA 5COQA 4DMMA 5TC4A 4IGEA 1UH5A 3PYLA 4QSMA 4A73A 2OP0A 5KJ1A 4R3WA 3E1KA 4LSWA 4A26A 3DONA 3GR6A 4CM1A 3UOGA 4Z3DA 4UUPA 4HP8A 1D3AA 4O63O 5CEFA 1X7DA 4ND5A 4PGFA 4LMRA 3FI9A 3PHHA 4ZQHA 1X1TA 1DLJA 5MDHA 1H6AA 4DYVA 3RROA 4J6FA 3AM3A 1YB5A 3ETDA 4U8GA 1NAIA 1X1EA 3JYLA 3RKRA 1ZMTA 3JQ6A 4Y6RA 3OQ1A 4I08A 5JFOA 2Y93A 2C2XA 2QIOA 2OBYA 2X8LA 3AU8A 3K92A 3DZKA 3UH1A 1RKXA 3CMCO 2DTEA 4DLAA 2O3JA 4PRLA 3C24A 1SB8A 4R1TA 2XOXA 3ON5A 4IDCA 4DGSA 1CETA 1G1AA 4L76A 3L0DA 2ZB7A 1T2FA 3GA0A 4E32A 4E6PA 7MDHA 3CTMA 2VQ3A 4FC7A 4UEOA 1ENZA 2NV6A 4TQGA 4K6FA 1ONNA 3DBVO 3V2HA 3ONFA 3OM9A 3RD5A 2ZJ1A 4L4XA 1PQWA 4CMBA 1HRDA 2LDXA 1U7HA 3ROPA 3ASUA 3H9QA 1DO8A 4ITUA 2YQ4A 4DXHA 2A94A 5KCZA 4ILKA 4AG3A 3DZJA 3EAGA 1U7TA 3FNHA 1WLYA 1E3LA 2VZ8A 4CMGA 1SO8A 2R00C 4KWIA 4Z9FA 1M6HA 3HG7A 3P2OA 1I01A 4ND2A
chains in the Genus database with same CATH superfamily
2BUCA 2KE5A 2RGNA 4ZREA 4DLZA 5LIPA 1GAXA 1A9XA 4UARA 2DPHA 2HLHA 3HCFA 4N5HX 2HCTA 3W1VA 2JJ1D 3OOSA 2JCXA 5L4LA 2AUNA 2H59A 5NLLA 4QXPA 5IYZF 1T24A 2VNJA 3PGKA 2K7FA 4BZWA 2FJPA 3OZCA 1TIBA 2BEVA 2BI4A 1DAHA 1C50A 3GRVA 2NWQA 3LE8A 3R0JA 5D1HA 4KI7A 3E7PA 3PUWA 4X7BA 4ZVVA 3KPUA 2RI6A 2RIPA 1BCSB 2LDBA 1KYXA 1NXXA 3P2JA 3IBGA 4BMNA 4KPUA 1SCUA 1XZAA 3QVSA 3GDGA 4HBGA 4NF2A 2FXIA 4AURA 5C46F 3LWNA 3RVBA 4F4JA 1EFRA 2DKFA 3T52A 1N3BA 3KK0A 3IDSA 5GWXA 3VPCA 1BA3A 1KU6A 2WUDA 3LXMA 4PSKA 3I2HA 2JPDA 1J0BA 4AI6A 1CUDA 4A1FA 2MSCB 2AOTB 3L79A 4DSZA 4MQ4A 1RWBA 2WBLC 4KQ9A 5A4IS 4V03A 1N5RA 2NTYC 5DHUA 4AY6A 4MWGA 1CB7A 2XZOA 1N1GA 3ENNA 3TNJA 2EZ9A 4AG6A 4U2FA 1E3WB 3QXSA 3TVYA 1GZVA 1OHHA 2O1EA 1KZ4A 4X3CA 5IDXA 3AEKB 3B7GA 4OXYA 1FNCA 1Z45A 2Z2ZA 3JX9A 1CP2A 1HYBA 2I2FA 3C48A 3G1TA 3PEUA 2FDCA 2RKBA 4EEKA 1OXVA 3IVXA 4IFEA 1YVRA 4ZAXA 5FUVA 4IIHA 3SYKA 3VMMA 1UXOA 4QOJA 1KTIA 4Y0VA 5LC1A 1VCOA 4NBLA 4IPTA 3LWDA 3SQXA 3VAYA 4Q9IA 2F1OA 2EJBA 2PL9A 3ZIDA 1EKXA 3JW8A 4RTLA 1DXQA 1W8IA 3UMVA 1ZGBA 4BVAA 3OJOA 1K0UA 1U8EA 4AT1A 1YRHA 4CBVA 2C9MA 1IY9A 1C9NA 3ROQA 1WUIS 4HWSA 1I1QB 4WK4B 3P94A 1DBIA 5DX1A 4N01A 3ZLJA 4N49A 4ZAWA 2NO7A 3I9KA 3HCWA 2YBEA 3OA0A 3PVSA 4WY8A 4CKZA 2NSLA 3ACBA 3UUWA 2BI7A 1MAHA 3EPHA 4MPPA 1P2UA 2JA1A 1U4NA 3IPCA 3OIDA 1KDYA 1PJ3A 4FI3F 1C0KA 3MMZA 2O6LA 1K6JA 2QL6A 3KZMA 3X2SA 4CNQA 1EXVA 5HKKA 2FUG6 3U3JA 2ZS8A 4B3BA 1ZRMA 4IOKA 1K68A 2IZ6A 3BHNA 2PX8A 4MKXA 4ID3A 2CLDX 3CGGA 3HCNA 2H29A 1XTTA 1OMOA 1JLMA 1QH8A 2GSWA 1LZLA 2R44A 4AO6A 4NCAA 1K6IA 2X19A 2ZI9A 5HCIA 4KITB 3AF3A 3KAJA 5JRZA 3H0CA 4PQYA 4QECA 3A26A 2QR5A 5J4KA 4UVEA 4FONA 1HBJA 2NV2B 4IIJF 4QUKA 5H9WA 1J2EA 1N2EA 3GLFE 3WLTA 2OR3A 4D4JA 3UMMA 2PX4A 3NKVA 3O9ZA 1L4LA 4UBJA 3EIWA 1H0RA 2ZSJA 2YWDA 2JFQA 2Y6VA 4FC6A 1ONSA 3OCJA 5F2OA 2ZZNA 4OM8A 1EXWA 3CLHA 3WK7A 1F8GA 2CVZA 5E4FA 1AM4D 4LFCB 3C3XA 3SXJA 3OFVA 4QXRA 1IQPA 3ES9A 3EBOA 4TN1A 4KVZA 1Z6ZA 1VJ0A 2HCRA 2D0IA 3AJAA 3MSXA 3TOCA 2FSVA 4M7OA 3I2GA 3SQWA 4Q3DA 4EPVA 6REQB 3HKEA 4BMDA 3CVVA 4FYXA 4MCIA 1AZWA 2BOVA 3OZTA 4I6JA 3GV0A 3RUFA 3OP4A 5HJ2A 3I04M 1F0NA 1AS0A 1NGSA 1H85A 4YMSA 1QGED 3FMPB 2HH9A 4CGZA 3DMHA 2G9ZA 3QYAA 2RGWA 1CUYA 2ZBQA 3FZNA 4WGFA 1NWCA 3RVSA 3VNAA 2R3SA 4YAOA 4B73A 4I4IA 1Z2EA 1JSLA 4IBOA 2OCXA 2PTGA 1DOHA 2Y8EA 4DABA 2UXBB 1XMJA 2VPTA 3JQ7B 1TQHA 1Z39A 3HU2A 4K3VA 4OSPA 4Y1RB 3S27A 3ZY4A 1A9TA 2VSYA 3N2LA 3ZDCA 4ZYXA 4DHEA 1L8AA 2PL5A 3AHEA 2WKPA 4GE3A 3F6RA 3QI7A 4TPKA 3H0EA 1BZYA 3D3NA 3GEEA 5ERGB 1YZKA 3RNLA 3TIIA 5TIIA 4WKBA 3IMKA 3U7JA 4U39A 2ASVA 1TPZA 3V2IA 5LJLA 3KSMA 1HPLA 4PS1A 2PFKA 4BWYA 1SQ0A 4MH0R 1SBQA 4GT1A 4J1TC 2I1VB 3ANSA 5L3QB 4D3YA 2Z30A 4GMFA 4UD6A 3R75A 4D43A 3OOHA 1A77A 1N7GA 2A1UA 2GXSA 1AGRA 1K06A 2Y0EA 2QRQA 3D8RA 1GEEA 5D00A 5I7WA 3KEFA 2C5BA 5LQRA 1NR7A 1YS2X 2X0JA 1DG9A 3KZNA 1GRVA 1NDQA 2IDJA 2VT3A 1XQXA 3R5HA 4KJXA 2VQEB 1XK7A 4KUHA 5AHKA 4QGHA 1I2BA 1KAQA 3V6LA 1YBAA 3GY0A 3LO8A 4M0EA 3P2YA 5L3QA 2RGUA 4JB8A 3AHFA 2WM2A 4GOXA 3IKMB 3G23A 2YZ7A 4G41A 1O8CA 3H2ZA 4F5ZA 1M6VA 3VKGA 1J56A 1JHYA 1Z28A 2J87A 5U9CA 4BZXA 4KLZA 3TFOA 4AQYB 3HRHA 5J9FA 4L28A 2O3SA 4OEHA 2QNBA 4DQ0A 2WZQA 4ECAA 4MVJH 5KWEA 4GO1A 5IKPA 1VBFA 1N2GA 1K5HA 3TIXB 4OKSA 3VDQA 3D54D 4JX8A 4MW5A 1KO8A 2EWWA 3WLJA 3U31A 2JB9A 1JR3E 3L4BA 2WJGA 5C5EA 2EP5A 5LD2C 2E6KA 5F98A 2QI9F 1HV8A 3JQAD 1FYVA 1GCUA 2AJTA 3M4NA 4M1KA 1FF9A 1N33B 4YJHB 1MO6A 2EQBA 4AMVA 1XVIA 4HUJA 3IULA 1IHYA 1Y8RA 1H2AS 3G8BA 3NEJA 1H2YA 1WXFA 3OF5A 3QMMA 1T5OA 3CBGA 2Z4TA 4IIGA 1KZ9A 3AOGA 2AYZA 2EIXA 3MWEB 4PINA 5EZSA 1AB5A 2P40A 5FT9A 1O9BA 3EY9A 1N6OA 2J6CA 5FORA 4BMOB 3S7ZA 2QZ4A 4RULA 1PT7A 4P4SA 1D8AA 3I23A 4AIRA 4TYNA 3MMSA 5C32A 2E7ZA 5HOQA 5M7EA 3ESBA 4OYLA 4KQEA 3AF4A 2E5FA 1JV2B 1KEWA 3D3QA 1UADA 4JELA 4V38A 1M5TA 1FFAA 2HJGA 3AR2A 3UJAA 3DAPA 1LWOA 1VGVA 2HIHA 4AZ0A 1AKRA 1T6XA 3GD7A 5JAUA 3BL6A 1KQFA 4GL2A 3UKOA 2IZ0A 1YR9A 2GXQA 1WD7A 2XQFA 2UZ1A 4WLFA 5EJ6A 1SZPA 2O0LA 4PR0A 3ZZUA 1WIWA 4E5UA 3BJZA 1JKJA 3QEBZ 4Q02A 3U9LA 4RH1A 4RPCA 1TTPB 3M2PA 3H1AA 3HACA 2PGAA 4LF6B 1FSFA 5EKDA 3W3AD 5U4QA 4RE6A 2QWXA 2NP7A 4IDDA 2V7GA 5C5CA 4AG5A 1UBGA 1LJUA 1Y1QA 2A84A 3NRJA 4RD1A 4WK6A 4DAOA 3MT8A 3B9QA 3D3WB 4HATA 2FSSA 4A3SA 3TUZC 1A04A 4I4TB 1DVRA 1RRVA 4ZO4A 2H1RA 1ZMOA 3ZGLA 2RG7A 1ZH6A 1DKQA 3FHJA 4RGYA 4DYDA 5AKJA 3PCXA 3V4FA 3K1JA 2SNIE 4LDJA 3WAGA 1XX6A 3UYLA 1Z0UA 3LX4A 3IIJA 1J1IA 1XEFA 1Y1PA 2FJ0A 3R09A 3X1ZA 1VE9A 3AY7A 4TKVB 4UBLA 4B6FA 4NAUA 3KAKA 4CN8A 3LUPA 4CKEB 3KT3A 5K8TA 4U6NA 5DW3A 1H4SA 1FSGA 3NYRA 3IYLW 1KO7A 5EE0A 3TTUA 3DPSA 4IV0A 3FGZA 3WK5A 1P61B 4C78A 3MXTA 3OSZA 4FYKA 4PN3A 1FU7A 2XHZA 3KZXA 4A6XA 1DAIA 1ZCFA 1XBTA 2WA1A 3CHYA 3GG9A 3MLEA 1ZW1A 3QBVA 4V02A 1PR5A 3E27A 3OLWA 5LMUB 1MXHA 4R69A 4KW7A 4DCGA 3HUUA 1KEPA 2Y1XA 5I9LA 3O47A 2JLRA 2XWJI 5EP1A 4YMVA 2W6PA 1QGDA 2C4MA 3HABA 4JJAA 4CL3A 2CXNA 1BE0A 4Q3LA 3DTYA 1TW2A 2A35A 1KOFA 1EIWA 1ZM2A 2EZTA 4Q3OA 4O2BB 3OM0A 4BRWA 4URYR 3QI2A 2HSDA 4TZKA 5ERYA 2QX9A 4EQ6B 4AYWA 2H8GA 4EHIA 5KWSA 3JQAB 5ESRA 4EF5A 5I4CA 3C6XA 2G4LA 4MR9B 1L7XA 1FPQA 1YKGA 1YQTA 2FSHA 2JH8A 1S3IA 2Y05A 3ELWA 4XGQA 4BGIA 6Q21A 5K8VA 2VF2A 4GLFA 2IP2A 1J09A 2VAVA 2QRMA 2WFZA 4JYPA 4RIIA 1WCXA 5ESWA 1P80A 3PF8A 1X1SA 3EVZA 3WWYA 4KAAA 4HNGA 4I9NA 5JCOC 3AIKA 3PQ5A 3U6BA 4MTLA 4IM7A 1KSJA 2PBLA 3JASB 4PHTA 1ZJYA 3DO5A 1Z6QA 5D3ZA 2JAPA 5CFOA 2BM0A 4KQFA 3NVKI 1PZEA 4V2UA 1PSDA 1Z6GA 3OKCA 1DEOA 2GN8A 2XOEA 3TLKA 3OX4A 2ZITA 1E9EA 1WXIA 2QTFA 3N8HA 1R6XA 1KK2A 2NACA 3DYVA 2XE8A 4RVHA 1FNSA 5B2ZA 3ZWNA 1N6HA 2XGSA 3R2JA 4FOTA 1AF7A 1SD2A 3WB1A 4O2AA 3WO1A 1KXZA 1MOZA 1YE3A 3UAVA 4CCYA 3AR6A 4JLMA 1ORIA 2DT8A 5DCWA 2GR9A 2Z9DA 4UDOA 1R1DA 1V1RB 3BK7A 4FP9A 4PZEA 4DV3B 4G9GA 3H2GA 4QFBA 2HU7A 2QZ9A 1QANA 2ODQA 2HGSA 2W9XA 1MH1A 2AZ4A 5JJKA 2YH2A 4QYSA 3WL5A 2H8KA 2UDPA 3TH5A 4BWVA 4YV0A 5CB6A 1CUSA 4QRHA 5ICMA 3TGLA 3FKJA 2A9VA 2DHDA 4H7FA 1YVDA 1HC7A 1OFVA 3QF4A 2PZMA 3T1YB 2ZM6B 5JI3E 4O1MA 1WB4A 4A4DA 5BY2A 1EG2A 1CY4A 3SKXA 2QUZA 2OV4A 2QUHA 2VUUA 4HGQA 2H0QA 4Y7DA 3SX4A 5DIFA 4ECEA 5CFRA 1VB5A 3U44A 3OIWA 3VC2A 1Y42X 2BLLA 3I4LA 3TRDA 2GBCA 2C7VA 1NQTA 1HL3A 1ZJ4A 3TXAA 2L82A 3WK6A 4PAOA 1KIAA 1SEVA 2WTEA 2UXDB 1YE8A 3H9CA 3FYSA 1FUIA 3WRWA 2PHZA 1WLSA 4CTNA 3GPDG 2IKQA 4HGYA 3ZWMA 1OSNA 3DOHA 4KQ1A 3UGTA 2HJSA 2HMWA 4GVPA 4QAJA 1HG1A 4OUDB 4HX9A 3TLJA 2CLMB 5IKXA 3R5SA 3M1IA 3PS9A 5C5DA 5C51B 3GLIE 3OO0A 4Z4QA 3JU3A 4QULA 1TRKA 2R2GA 5GJVC 3RU2A 3F3KA 2WMYA 3FVVA 1ZGZA 2Q5FA 3JD1A 1B1AA 1XDGA 2NN3C 1OOEA 2XGMA 2W6QA 1EUCA 4IJKA 4TVSA 4HGZA 2WIFA 3KVOA 1NSYA 1PGNA 3NWOA 3AILA 3SHQA 2HHHB 4ZAFA 4WZBB 2ZJAA 1CEQA 2G6BA 4RHYA 2AHOA 1NJFA 4RA6A 1W4BA 3FHCB 4WBSA 5ECDA 2FHSA 4Q34A 3BH7A 2W2LA 1U8XX 4QQ8A 1QH8B 4RPLA 4ENTA 3BD6A 2EFDB 1C41A 2B4RO 3KT8A 3LQ4A 1S02A 2CNKA 3MTIA 2CLSA 2D2XA 1SVNA 1C1YA 3FRJA 3E9QA 1NVXQ 2XJ9A 4JFRA 4PO9A 4FM9A 3WLIA 3WZMA 4IZHA 3AVUA 2QN2A 2WZBA 3ZK8A 2XAAA 1BEZA 2PJZA 3UUGA 4F04A 4MDFA 4LEIA 2B35A 1SIOA 2FF7A 2PH3A 3IE0A 1B8OA 3K5HA 4L0QA 1A8UA 1OWNA 4ZGWA 3QX9A 5CBPB 5JDCA 3UJNA 5K8CA 2YXBA 3BL5A 1DQPA 2TMKA 1TQ8A 2WAMA 1N0IA 3NAGA 3SM3A 5CYGA 1XPOA 4N3CA 2EHJA 1MX1A 1W85B 2W0SA 3QOYA 2BKEA 3FFAA 4JU8A 4L6AA 4R84A 5HFNA 3NTXA 4GOKA 4ZA2A 2GTPA 3EQ8A 4FFDA 4P4UA 1OGJA 3CW9A 1ZXLA 4KU4A 5JO0A 4ZVUA 4FMBB 1T5SA 3AP1A 1JYSA 1K4MA 1OT5A 2NZUG 3DE6X 1CZOA 2AN1A 3PT5A 2CMFA 3ACCA 3AM4A 4JT4A 1E20A 1BN7A 1U2GA 1Y3IA 4RY8A 4D8VA 1U7OA 3WGQA 2PH1A 4Z4EA 3MSCA 4U8HA 1DSSG 1RWXA 2L42A 4YAGA 4R9NA 1QP7A 5J4VA 2IU4A 3ZDRA 3JAWA 4YUAA 2XE7A 3FPHA 3K9WA 3VGPA 5BSEA 2Y0PA 1TCCA 1R18A 1H1TA 3UHFA 2GWHA 5TX7A 1RXYA 2H4HA 3CJTA 3ILSA 4YRIA 1V9SA 3FPKA 4J1QA 3VTKA 4A8JB 1UFRA 4LOLA 1AQIA 5LYJB 5FPTA 2VHTA 1ELOA 3I01A 4JYCA 4RK7A 5AUOB 1HOTA 1PR3A 1OW3B 1GD1O 4G09A 1WXDA 3QE4A 3P2IA 2PQ2A 4NMLA 3VV2A 4L0MA 1CRPA 3AHJA 3KTAA 1P1FA 4KHZA 2E4WA 4KX5A 3Q5DA 4WDRA 1Q16A 3WGVA 3D8TA 4E4TA 3TG8A 2PO5A 1KMHB 1ZNWA 4JJ8A 4Z8XA 5A4DA 2PCJA 4HDCA 5JISA 3B5EA 1UFVA 4X44A 3QX3A 4IMRA 1GP2A 4TTPA 2YWHA 2XQIA 3I92A 3VOTA 5JYCA 4KBFA 1WPXA 1ZUIA 2PWBA 4C4YA 3D7SA 1GGEA 4ZJYA 3H5LA 5GOTA 1X7XB 2Q0XA 3D0QA 1GG5A 3PPWA 3FLEA 3MS2A 4MQEB 1LBHA 4OQMA 4RTMA 3CBQA 3SX0A 3T7EA 1X8JA 2P9YA 2R8RA 4BVGA 5LYJF 5B6PA 3ANNA 1O94C 1E92A 4BNGA 3G49A 2WHQA 2X8BA 1E32A 3D8SA 1IXZA 4YJ3B 3UHPA 5K0TA 3CZCA 4GPIB 2XUFA 3HJCA 3QMPA 1H65A 2G5CA 2PBZA 5E6UB 3VU9A 1R9NA 4Z1MA 4BIIA 2QSZA 1NVBA 5AI0A 5BN5B 3KOWA 4AVYA 4R9SA 1AK1A 1T9ZA 1EB8A 2E49A 1C8BA 2H65A 1Z6AA 2OHFA 2WTXA 4UNRA 4B32A 5F5NA 1JDUA 1FFCA 3ZU3A 3KS9A 1I4TD 1YMUA 2PL3A 1XZKA 3GLHB 2CMDA 3A9CA 5J2UB 1XCLA 2QQEA 5CURA 5CK4A 3SC2B 1L7OA 1SHLA 4AWXA 4NXMB 3D6UA 3UEOA 1GDDA 5LZ8A 4B4DA 1KGDA 2POQX 4JUCA 3TB6A 4MKHA 1T4GA 1ISIA 1QH0A 1C0LA 4D0LB 4QKQA 1VPVA 2BMJA 7ADHA 1KMMA 5LSAA 1COWA 2FSFA 2WF8A 5KC9A 2E37A 4PU0A 4B6SA 5A5EA 4PBTA 1NNLA 2WJ3A 1GNSA 4CEJA 4EUEA 4NCHA 5K6RA 3FPCA 3K5WA 1GRNA 3TTYA 3BAFA 3LKBA 2BGIA 3OTGA 2AXNA 3I5YA 2PVSA 3B12A 4NY1A 4KXFB 1K75A 4J76A 1G3QA 5ARDA 4RQBA 4BO5A 8GPBA 4H60A 1P60A 1WQ3A 3SS8A 1U5BB 3HKCA 3PVCA 5E8RA 1EVLA 1SQFA 1A9SA 1N0VC 2VDJA 2C3UA 5TPZA 5CG2A 4Q1EA 4DCPA 1B74A 3M3PA 1ZMRA 4IJWA 4R2WA 4OXRA 1RC0A 2IDMA 1A5SB 2QG6A 4GBMA 4X1IA 5HIJA 1KAMA 2IK8A 3OG9A 1Y5RA 4MIEA 1F0PA 1OIVA 4QPJC 3A9UA 2PIAA 2D2VA 1GZ3A 3DDZX 3IPLA 5DYWA 3U17A 1X7WA 2IXAA 3PE4A 4MNTA 3H2JA 1N3IA 1RCTE 3FBTA 2QP4A 4RA9B 2Y2VA 3RPEA 3HM2A 1OVGA 5I6DA 1E5TA 5TXGA 5KC8A 1E1NA 1BMFA 2AZTA 2HIMA 4H1WA 1FFGA 4M1WA 4X60A 4QDXA 2M1ZA 4J90A 5C4IA 5KNCD 3PC8A 3QVGB 2WUEA 4AXXA 1A50B 1GA6A 1PX2A 4PFSA 3E84A 1PTJC 4TXLA 3PLRA 2W2MA 2WUFA 2CY0A 2JRLA 2BDUA 5JLJA 2IS6A 4QSHA 3W9UA 1VP3A 3F9RA 4P36A 2VDLB 3Q0EA 3UTCA 4ARBA 4UM9B 4CFYA 3MT7A 3S2IA 4DARA 4ZICA 4X54A 3UJ6A 3ZWDA 1NXQA 2BZ1A 4KAFA 3KJXA 3RS5A 3M0EA 3ANLA 3I9V1 1F12A 1SKAA 1U2DA 1RYYA 4M9SA 3Q7TA 4OHOA 3O38A 1Q7TA 1R15A 3FNQA 4FLMA 4I6GA 3T1TA 2WR8A 3WAKA 1G55A 4GKAA 4X20A 2C97A 1EZ4A 1Z74A 4QNMA 3ZIAA 1TEZA 4CQLB 2R5WA 2YWGA 5FWNA 2H9IA 3IQWA 3MCAA 1GPKA 4CLRA 1JQBA 1US8B 3ROEA 2ODEA 5AKLA 4J6EA 5ANRB 1GARA 4TS3A 2DQZA 4HNQA 3SEAA 4BVJA 1SFRA 1CY1A 1E8NA 1FDSA 1OLUB 2O2SA 3EUFA 4K0KB 2H54A 4FWTA 1BDJA 1N0HA 4O4JF 2LV8A 1T8SA 2Q4TA 4WLOA 2R751 4R7TA 5FOVA 3TW0A 3CISA 2XUHA 1AQLA 2ZS7A 3IELA 2O5VA 2P69A 2WU4A 3KOOA 2ZCUA 4KOAA 1MO4A 3C5EA 1L9KA 3S2GA 3AF6A 4L5IA 4BXOB 1ZOOA 2O2YA 3MGGA 4NG4A 4B3HA 1L2TA 4ZJUA 1IUOA 1SC9A 1XMPA 3GZNB 4RZ2A 3N86A 4NFHA 1CR6A 1U94A 3QFHA 2HRCA 4R2MA 4WOKA 4MV6A 4GI5A 2EKZA 1M1YB 4ESEA 4U6QA 1IN5A 3AWDA 1GR0A 3R77A 4WN9A 2B5VA 4EJ2A 3GI1A 1NYLA 2H2FA 2J3IA 3SK0A 2YOHA 3UOGA 5IRCD 1UL1X 2HTFA 5DGHA 2EP7A 1QMGA 2O6HA 4RVOA 1KHTA 1USGA 3HYTA 3VO1A 2R8ZA 2ZSBA 4FYPA 4P5EA 3OKFA 3OZEA 5LZ5A 1U3UA 3Q6NA 5CT9A 1PV4A 1T25A 1QWOA 3SEFA 5K5EA 2HU8A 3MWDB 2MOKA 2PL1A 3K0BA 5EINA 2CVPA 3E5RA 4FKBA 3EA4A 3IAS6 3I3OA 5KWJA 2FSPA 5BR1A 3IT2A 2AI3A 3RU7A 3DG9A 1MX9A 2ECQA 2FG6C 1PF7E 1TJ3A 4KPGA 2ZAMA 2GEVA 3OJFA 4RV4A 4IQ8A 4LNHA 2YMMA 1FFHA 2Q27A 3DLPX 4P80A 4CUZA 3CNBA 4Y2TA 3ONWA 1SC4A 1A3CA 2IYPA 5DGDA 5GV7A 5K2OA 4YALA 5I7EA 3PQ8A 3V1MA 4YWJA 5EGNA 4X24A 5YASA 4LWZA 1R64A 2CMKA 2FPIA 1PE0A 3GARA 4MUJA 4EVIA 4HDNB 1GTSA 1B26A 1N3YA 3TVDA 1G8PA 1NC3A 4JJ7A 1KPIA 2V7TA 2HJRA 4Y1RA 4N0EA 4TYWA 1X19A 2XSZD 3F5QA 4M38A 2QLTA 4ZOAA 5FD8A 1DUVG 2P0EA 5IS2A 4MQFB 4F0JA 4YQEA 2JIQA 3CR7A 1GJRA 3ED1A 4MA0A 5F33A 3NGMA 2X76A 1PYOA 1IBKB 4C6RA 1ULBA 4BKOA 2DJIA 3WWPA 3KKNA 3OI7A 2GZ1A 1WY5A 2YXPX 3CONA 3MUEA 5T3YA 3BL8A 2AZMA 4NFLA 2B4TO 4ZRMA 5EPEA 5EJAA 3QU7A 1WXXA 4OXNA 3V1YA 1Z5ZA 2JBWA 2E4AA 3JSXA 4B4UA 5IT9A 4YXFA 4ZI7B 4EGQA 2EW1A 5A03A 1YB4A 3MD9A 4IIJA 1IEXA 4BVEA 5C8XA 1YZUA 1YQXA 4NRDA 1VA5A 5HF5A 4QO8A 3SYLA 1L5ZA 3G5TA 2OWEA 5P21A 3ORQA 4D44A 5I7HA 4BVLA 3EEYA 2PUHA 2Z4RA 4MIKA 1ECPA 1UJBA 4CCAA 1YAHA 4CDMA 2FMFA 1T4MA 2BI8A 4IXTA 1UKAA 3ENWA 4LV6A 1FPMA 3R3VA 2OHJA 2HHCA 4P82A 4LZZA 2IPNA 3HJNA 5EL0A 3ANMA 3TWOA 4RHFA 4V0MA 1BS9A 2PXCA 2RH5A 2QBYB 3W3AA 3QFSA 5JCJA 1U7XA 1LDNA 1OWOA 3EVBA 5J5CA 2APJA 3R5KA 3V2UA 5BVHB 4OD0A 5K3BA 3BK1A 2RJNA 4IDBA 4QOEA 3SIXA 3DAYA 3L0SA 3SOPA 3UENA 3R9WA 5AW2A 4QOHA 2D0DA 3E70C 2GEDA 4X84A 1Z22A 2BJVA 1PJBA 2RK3A 2X7XA 4I1IA 3SX2A 2X0EA 3IXLA 3LXRA 4C0XA 1SIBE 5JXIA 2BGTA 3RHZA 1AHPA 4WK2B 5DB4A 4TM8A 3NT5A 1T3ZA 1SY7A 2ZIZA 4I4TF 3UJ9A 2VDWA 2YJNA 3NEAA 4V2IA 4C4ZA 4EFMA 3D0KA 4EJ6A 3RRBA 1OFUA 1ZVKA 3DAOA 1LTKA 3ZHRA 4ZOQI 3LYUA 4CNBA 3G0GA 3RYFB 1N6LA 3OPMA 4JVSB 3HJRA 3FJYA 6ADHA 3RREA 4INOA 2I7TA 1Y5LA 1XRRA 2Q6LA 5EZ6B 1HH4A 3ZE1B 4EGFA 4BAGA 3T95A 5E1BA 4O33A 1KYVA 5DP1A 3T4XA 5AI9A 2AX3A 4QRIA 4DIFA 5A7FA 1U8CB 1O6GA 2XA9A 4EHAA 4X95A 4QPPA 5DOVA 2HDOA 1KQ3A 4JLKA 3TX2A 1WZCA 5GJBA 3FB1A 2G77B 4N4AA 2ZDQA 1U9CA 1XJWA 1DFHA 4HQOA 4TOIA 1XNHA 1GGJA 1GAEO 3H8JA 2EJUA 2C5FA 4IZOA 5D3KA 2D4AA 4ZIRA 4FMDF 3AERB 5CYOA 2VJMB 4TWRA 2G9NA 3TR6A 2WYOA 1EFKA 2WK1A 1JKXA 2GPBA 3VBEA 1EVZA 1L4UA 1HLFA 3CW2A 4OQQA 3RVOA 3T8YA 4UHEA 3H2SA 1FFWA 1V7ZA 1XWWA 1YDFA 4J0FA 4AZ3A 4FGUA 1P1CA 1USUA 4QFCA 3OEHD 2MMCA 3DNMA 1FMJA 3DWFA 2UZ1B 3KYCB 4K9QA 4Q1VA 4HRVA 2D1RA 1X15A 4TWAA 3IIKA 4GYWA 2JS7A 4MR8A 1T2DA 3FYDA 2PMKA 3PQ6A 4FB5A 2LIPA 4Z4IA 2ZRKA 5F76A 3NDJA 5EJMA 3ISJA 2NPIA 4M21A 1HSOA 3A1SA 2JFNA 1OASA 4GKBA 4HF7A 2VNSA 1NP3A 4HRAA 5GZ1A 2IHNA 3E82A 2DRIA 4MRRA 4V0KA 4GMDA 4ERNA 4KMOA 1AQNA 2HA7A 2Y66A 4Z86A 4NH4A 1N32B 2QMUA 3V46A 3KKQA 1NIJA 4G4SP 5CB4F 4FGSA 5AVZA 1TKCA 4MS1B 4LMAA 1L8LA 1KDPA 4WW0A 4D9GA 3GUCA 1V6SA 2PRSA 2CUNA 4G01B 5AO9A 3ABQB 2BFCB 3ZIUA 2D2IA 2I33A 3SVLA 1YO6A 2NXEA 2UVPA 2O2CA 1KQOA 2NZWA 3NAZA 3BWMA 5BRAA 4F91B 4GC9A 2HNBA 4AX8A 3HVRA 1FRZA 3KUXA 3MRXA 5ILOA 2BFOA 1U11A 1ZKMA 2PZBA 5CD9A 4ZHQF 3TXYA 3VYTB 2ZJOA 4DJTA 2ZBPA 3DBOB 4OJNA 1AKYA 1SUPA 1DWPA 4G0NA 1C9KA 4P5PA 5DNEA 1JVSA 3IEKA 4PZZA 4POOA 2QRLA 2VF5X 5BMVB 1JHAA 1DU4A 1PL6A 2NUPA 4HO1X 2R66A 1JBQA 5THQA 5LQKA 3DTVB 4IDPA 3NDBB 2ZT7A 4CM7A 1FU4A 1JILA 1NJ2A 2C3PA 1O8BA 1DXHA 4PV7A 4EPXA 1LLDA 5I8WA 1JU4A 4X6XA 5C18A 2ZVQX 1QYDA 3RSLA 3DDNA 1DAEA 2P2ZA 2P4EA 4OHCA 4I1YA 4JLBA 1PNQA 2OBMA 3RRZA 4M0PA 5DNVA 5IUJC 2OYSA 2HB6A 2OB2A 1Q1GA 2QVBA 4PX5A 5CVDA 3HXPA 2XWQA 3HDYA 4Q3KA 1D9ZA 5KVVA 3EF3A 4HDQB 2JVKA 2BBSA 4WKGA 1G8YA 1Z83A 5KOIA 3A4TA 1LDMA 10MHA 5BSUA 5LDDC 1B93A 4MJLA 4YLEA 4X1YB 1IVSA 1DC5A 2Q3LA 3H65A 3V3TA 2HPZA 2GASA 2R0QC 4G9EA 4FIDA 3UB2A 1SH7A 3UH0A 2YXNA 3R6WA 3AETB 3F1LA 4GRAA 4QLBA 1OFHA 2Q2OA 3G2PA 2BGGA 1EK5A 1QQAA 3U4CA 1W4RA 1E6LA 4UVIA 2O59A 4KG7A 3H3JA 1HETA 1X7YA 2O8DB 1BXRA 1H6DA 3HGMA 3NAQA 2F1HA 1DELA 1Y5NA 2D2EA 3E3AA 3MG9A 2BFBB 5C8YB 3SKVA 1NPYA 4GOND 3KV3O 3MZ0A 2C96A 3L7AA 1VJCA 4AMUA 2LBPA 2WIJA 4JBYA 4XM0A 5SZIA 3W7AA 5JNWA 1Q0QA 3U7HB 5K8LA 5AVQA 4KN8A 4UMDA 1AX9A 5BQ5A 2A67A 1QF7A 3E81A 3MPUA 4LZOA 1N7JA 3H8WA 1O95D 2R5FA 2V6FA 2I1QA 1K3FA 1L6IA 1R0WA 3BXGA 3QJ5A 5H7XA 4CLXA 5KQRA 1I2AA 3SHTA 2JLQA 2X86A 4HXYA 2HQRA 3H11B 3WL8A 1Z35A 3INTA 1WB5A 5F7OA 1LU9A 1EG7A 2Q1XA 1Z63A 4IUYA 4XYGA 4LC0A 1VL1A 1EWVA 1YQ9A 5E9AA 1OY1A 2DR0A 5COBA 2H2GA 2IYYA 3LAWA 4XD2A 1JDVA 1T6ZA 3ZBQA 1ZRNA 3D7LA 3C3WA 2FWBA 4KYVA 4D80A 1BX1A 5JYEA 4OHPA 2GEFA 3SFTA 3TLBA 2Q5IA 5FEMA 4FKZA 4Y2SA 1BX3A 4CFSA 5IWAB 1XL0A 2FWMX 1MC5A 2YFYA 1FMLA 3NYIA 3O0TA 4ZCTA 2Z57A 1A9OA 1MDBA 2C31A 4XGIA 2XDWA 5KYGA 2VTBB 5K4HA 2F3UA 3USZA 2NPFA 5C9ZA 4Q9LA 1QX4A 4XSGA 1Q7EA 5ALIA 3Q4GA 4ND8B 1MD9A 4OAOA 4DA0A 1A7JA 1KGSA 2ZRJA 3C8MA 2BHRA 3RBZA 1OXBB 2XUKA 4C5AA 4HH1A 1NBHA 3L2OB 1XRSB 4PC3A 5FBWB 1K27A 1QYRA 2FJUA 3D7KA 2RHRA 1B6RA 1NQXA 3OC6A 3EPJA 1MC1A 4LVUA 1G66A 4PICA 3G2IA 4A0RA 3RBVA 2OFFA 4D5GA 4EB6B 5LQUA 3AG5A 2OBLA 4QBTA 1VG8A 4HWOA 4TROA 3O8CA 2G9UA 4BTEA 4WJLA 1Q57A 2JI4A 2DFLA 2L19A 2YRFA 1E9RA 1K3TA 1NM5A 3AESA 4IF6A 4PYNA 4WJZA 4C20A 2VIIA 3K9QO 5G40A 4NYJQ 1ULHA 3LX5A 4IG4A 2QTVA 4NYMQ 3V8EA 1Z2OX 3AFIA 5A6VA 5BN4A 2ZU0C 1R6DA 1V16A 2OFXA 1JALA 1EK2A 3PR1A 5H1YA 1YJCA 1GNLA 3KSZO 3UK7A 3MCVA 3UG7A 4IL5A 4M99A 2WDPA 4MP6A 3D3WA 5I01A 5FL7A 1JLLA 5ALLA 5ALPA 3JD3A 4R0VA 2J0UA 4P08A 1HG0A 3FYTA 3LNTA 2WPNA 4OX9B 3TIFA 3CRW1 1GXSA 3HA3A 4MINA 3WJ1A 4EABA 1H3EA 2HSEA 3K70B 2AC2A 1DQYA 2WIAA 3B1XA 4FINA 4EGSA 4F12A 3RIHA 2IDZA 1K4YA 4ZZ0A 4K6GA 1WVGA 1SIUA 1G16A 1HQDA 3L49A 1WU8A 4H16A 3CY6A 2HLDA 3V8MA 3T41A 3AUKA 2F59A 2P8SA 1BA2A 1V3QE 3D6HA 3VZPA 2X0IA 2ZR7A 1USIA 1E2QA 4D4KA 1EGHA 1QNFA 3DHYA 2RSLA 3AESB 2EFHB 2ABWA 4RMGA 3DFKA 3H6KA 1A72A 3WXMA 3AVXA 4YNBA 5DHTA 1U02A 4I1UA 3CX8A 4DEXA 4L6IA 2IH2A 1T5IA 3GUZA 5TGZA 2ZIVB 2XYGA 4K8RB 4RF4A 4WFQA 3HYNA 5D3MA 5SY4A 2IBTA 5JVDF 2ISSD 2WU3A 1JE0A 4NAHA 5FFFA 2WYHA 1ZC4A 2CKDA 4I5GA 5SICE 1CIJA 5JD6A 2AKAB 2JH9A 1JH9A 2CT8A 1XPRA 2F8MA 1TT5A 3I8SA 3FWKA 3NETA 3JQDA 2BGLA 2OK7A 3QBEA 4FNGA 4C0QC 4QG3A 2OBFA 4YCNA 3KSUA 4P93A 4II3A 2ZBRA 3GGJA 1GO2A 3SVTA 4YPVA 2J4FA 2H1HA 4YT5A 3THRA 4LZAA 3N59A 3H04A 1VJGA 4CUJA 1QPGA 2ZWMA 1NMXA 2FSGA 3DLTA 3JRNA 3N2KB 4P8RA 4DLYA 4W5NA 2YZ2A 1FX0A 4NEQA 3K7EA 2JL1A 1DAFA 5K3SA 1M2VB 2QNRA 3E7XA 4OFXA 1JDPA 1DBSA 2BM1A 3M9LA 3MF4A 4H18A 1CE8B 1RQNA 4L8WB 5A3QA 3SU8A 4KJZA 3BERA 4OBEA 2HO4A 1GFIA 5B7PA 4LWPA 5L3VA 4Q1BA 3D8UA 4DR3B 2GD6A 1NQOA 2OKCA 4RSGA 3SHFA 1RM0A 2RMKA 3M6FA 5A7HA 2FGKA 2EBHX 2W2LD 1BS2A 1ACMA 3HVJA 3OZUA 4HDKB 3NIDB 1L5GB 1J6UA 1F9EA 3D4LA 3JQBA 1SD1A 1Y9JA 4LCJA 4PWZA 1TKRA 2QGZA 2ZG6A 4KK4A 3GLFB 1QIMA 2KSQA 5G4KA 3PUKA 1Z25A 1Z6XA 4I1PA 3TW8B 3HCEA 4RDXA 4TSKA 1XLTC 4RKWA 4FVTA 4ZTUB 3FNEA 3OQIA 5CVUA 1FC0A 1X7XA 4BNVA 2CBZA 4ETMA 4DR2B 2J46A 5H68A 4XE5A 4ZYWA 1NRJB 1NVEA 2QTCA 1BMDA 3TM5A 1U3CA 5CIWA 1N78A 1I4OA 2R6R1 4NATA 1L5KA 2D5CA 3HMQA 4AF8A 1ZGCA 5D7BA 4EF4A 1ZC3A 1NT4A 4X7RA 1WUKS 2IXFA 2W83A 4OB7A 1Q0UA 3IOEA 3TECE 3ZU4A 3FH0A 3E15A 5AJYA 1CY0A 4F06A 5HS6A 4CKCA 1M5RA 2OY0A 3T3PB 4R0NA 2A5DA 2A5JA 1DAOA 1R12A 3QKTA 3A37A 4FEGA 1IRXA 1IXSB 2WD9A 5LPNA 1JL3A 2PWYA 1MIHA 4GBGA 4JC4A 4Q37A 4Q93A 2ZS9A 3T3MB 3VDMA 3VSAA 4DQUA 2CB0A 3UWSA 5MN4A 3SYNA 1I51A 3OHSX 2DPMA 1V1JA 1LF0A 3CLTD 2Z04A 3ZQ4A 3WGJA 1ZOPA 3BJRA 3IJEB 4DV4B 3I64A 1LUAA 1VE6A 2IEIA 2EARA 4F60A 1T5LA 5F1PA 1GQRA 1I80A 3BGDA 3IAAA 3QUCA 4F1JA 2R25B 1T9KA 2ID4A 1BRMA 5K4GA 2GS9A 4P7JA 1X2EA 1QFSA 3FMVA 2ORIA 4TLAA 2VYQA 3G8AA 1RW4A 2GFHA 3U3DA 2BP7A 4X6LA 4RX1A 3KE8A 1C2TA 4MGIR 1N5LA 5CX1A 1N8KA 4MKZA 1M83A 2GH1A 4JLNA 3FM9A 2VP3A 1KI8A 2HXYA 3MINB 1J20A 3AR9A 1AGPA 2YDYA 4P6VF 1GPNA 1NFRA 4L57A 1T36B 1N4DA 2B21A 4H1HA 4LHEA 3AZQA 3RKUA 5JS7A 3WAJA 3DFUA 1RYEA 3VTAA 1YRYE 3JAKB 5DH9A 1POXA 4PSCA 2I4LA 3Q6MA 2ODAA 3BIJA 5JS2A 3UAXA 3LY9A 3NIGB 2CGEA 5CD1A 2G0TA 3FNRA 1R27A 1XA4A 3QVTA 1G4AE 1VHDA 4FOLA 3RSQA 4BJ5A 4BVKA 4WCVA 4EP1A 1F06A 3BMNB 2QMZA 4KYTA 3Q8KA 5HJEA 4DGQA 1FP1D 2IPXA 3N3BC 4WPGA 3K6JA 1U4SA 1OD6A 2H85A 1PD1A 2X77A 2FWPA 4K03A 5TQ0B 1SMKA 2B78A 2P8JA 5EWJB 2V7BA 1QB7A 2EFYA 4GXQA 2NO1A 3I05A 3I6ZA 4QYWA 3VNRA 4LNUB 3ZV6A 3IH5A 3WNBA 3LFUA 4Q4AB 3NGXA 1SWVA 4UTXA 4OHFA 2JCYA 3ZCXA 1NP7A 2I0FA 1W1IA 1GQQA 1TJ5A 2PXHA 3JATB 3NYWA 4H3KB 4UE3S 4IDHA 3WDSA 3WWZA 3BTUA 1AG9A 1SUWA 5REQB 4QL3A 1PZGA 3IR5A 3C6BA 4J2HA 4H4CA 4CMIA 1DGQA 4OJYA 5CLLA 5J63A 1UP7A 1ADFA 3O03A 4FFMA 4B45A 4AZTA 2IHBA 1QJ4A 3L1HA 5EKXA 3QKWA 1W4AA 1YSCA 1W36B 2BDEA 4R6WA