3JYNA

Crystal structures of pseudomonas syringae pv. tomato dc3000 quinone oxidoreductase complexed with nadph
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
325
structure length
325
Chain Sequence
MAKRIQFSTVGGPEVLEYVDFEPEAPGPQAVVVRNKAIGLNFIDTYYRSGLYPAPFLPSGLGAEGAGVVEAVGDEVTRFKVGDRVAYGTGPLGAYSEVHVLPEANLVKLADSVSFEQAAALMLKGLTVQYLLRQTYQVKPGEIILFHAAAGGVGSLACQWAKALGAKLIGTVSSPEKAAHAKALGAWETIDYSHEDVAKRVLELTDGKKCPVVYDGVGQDTWLTSLDSVAPRGLVVSFGNASGPVSGVNLGILAQKDSVYVTRPTLGSYANNAQNLQTMADELFDMLASGKLKVDGIEQYALKDAAKAQIELSARRTTGSTILIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Quinone oxidoreductase
publication title Crystal structures of Pseudomonas syringae pv. tomato DC3000 quinone oxidoreductase and its complex with NADPH
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
total genus 104
structure length 325
sequence length 325
ec nomenclature ec 1.6.5.5: NADPH:quinone reductase.
pdb deposition date 2009-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3jynA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3jynA01
3MJSA 3PTZA 4OJNA 4YAGA 3X2EA 5HM8A 2XPCA 3V2UA 4D0RA 2W8ZA 1NNUA 3QWHA 1ZK2A 1UUFA 3SJ7A 3GQVA 3GZNA 4M86A 4YWJA 4KDFA 4BO8A 3E48A 1G1AA 3W8DA 2QYSA 4U7WA 5TT1A 2AMFA 1IHXA 2AW5A 1W0CA 1PGQA 2WDZA 4BHTA 1ZVMA 1E3WB 1ISHA 1CEQA 4L74A 1M6WA 4PGFA 4WCFB 1IHYA 1JWAB 1K3TA 1XHLA 2WD7B 4GX1A 3OA2A 3H5AA 3VZPA 4QEDA 1P9LA 3RQSA 4XYLA 3S55A 4QT0A 2ZYAA 4IIUA 2JAHA 4HV4A 1B7GO 1BXGB 3ENNA 4D3FA 1LTHR 5B4TA 1E7WA 2FR1A 2Q1TA 5EESA 2VZ8A 2CUKA 2Y0EA 3CZMA 2O4CA 4FC7A 4I08A 5IN5A 4JGBA 4U0KA 4XR9A 1LLQA 3KV3O 1LRKA 2DM6A 3IMFA 2C2YA 2WE8A 1U4OA 4NBVA 3D7LA 4DLLA 2E6UX 3TZ6A 1KYQA 4PZEA 3SXPA 5KJ1A 3D4PA 1KOLA 2IYOA 1IZ0A 3PJGA 3BMCB 2BMAA 4J1NA 3ZWWA 4NNJA 1NVGA 4J43A 3TZQA 4DQXA 2PNFA 5BNIA 2IZ1A 4EJ0A 5CEEA 4BV9A 1GR0A 4XX0A 4YJGA 5F1OA 3F1KA 4NBWA 1P1JA 2JD1A 3HDHA 1R4MB 1T1SA 2FPIA 2GUGA 2W4QA 4B3IA 1FDWA 2Y1CA 4L73A 4UVEA 2E48A 2FR0A 4GGPA 1YL5A 4TVOA 2GYYA 3L6DA 4I9HA 1EVZA 3I6QA 3GEGA 1BSVA 4A0SA 1NFFA 1JAYA 3QSGA 1UDCA 2RH8A 3RFTA 4QO7A 3GOHA 4I8XA 1YB5A 4YVFA 3TWOA 3HG7A 3WGIA 4NK5A 4XA8A 4O1MA 2ZB4A 3F3SA 4RO0A 3F5SA 3VPGA 3V1TC 5IDQA 2ZQYA 3FR7A 1MUUA 1LJ8A 2AE1A 1H5QA 4P22A 5TF4A 4Q3CA 4XIJA 3VVBA 1RM0A 5IFLA 4BGUA 3AW9A 4JP3A 3IDSA 1QXSA 1DEHA 1XLTA 3ZWAA 3IP1A 1DIBA 1AE1A 2QRKA 3PHJA 3CIFA 4P4LA 2IEDA 1XQ6A 1P77A 3AUSA 2IYPA 1ULUA 2HO5A 2GASA 4Y98A 3EW7A 4BKUA 2VNSA 3VPXA 3PGXA 3GT0A 4G65A 2WYVA 1BW9A 1KVSA 4GKVA 4CR7A 3JD0A 4OM8A 1HDOA 4DUPA 4FDAA 3G3EA 4I5DA 4LRSB 3I9KA 2HCTA 4BB6A 2PD6A 1ONNA 4N54A 4QXMA 2EIHA 4UVIA 2E49A 2O7QA 1EBUA 1X7HA 4LVCA 1YXMA 4JX8A 5THKA 4E6PA 4NBUA 3DZBA 3SLKA 1U9JA 3PLRA 2VT2A 4XR4A 1L1FA 1B3RA 1PQUA 2WM3A 1YH3A 1UZMA 4PLCA 2AE2A 5C7IO 3FNHA 5L4NA 2OP0A 4Q3EA 3FI9A 1HT0A 3QWFA 4DQVA 1YL7A 3LT0A 4CR6A 2NQTA 1JA9A 4OQZA 5EN4A 4OGWA 5CFZA 4J2HA 1PL8A 4NJOA 3RC2A 4B4UA 2BELA 3C3XA 2Y67A 5F5LA 3HQ4O 1JKFA 1EE9A 1YBMA 4FGWA 1YS4A 1PJLA 1PJ4A 2EWMA 5L45A 1B8PA 1DC5A 3MJEA 4CMAA 3CUKA 3RROA 1MA0A 1O94A 1GUFA 1D3AA 5DF1A 5FF9A 2SCUA 4CM6A 1UXKA 3DBLB 1U2DA 4O59O 1GPDG 3L0DA 4RVUA 2JFFA 1AHIA 2PH3A 4L4SA 4NQZA 1Z6ZA 2ZK7A 3WYEA 3EAGA 3OJ0A 5JCXA 1K0UA 4BNYA 4ZVVA 2IDZA 1NVMB 4M87A 4O63O 5AVOA 1VJTA 1XG5A 3RASA 5BSFA 1QYVA 4E31A 3JQ9C 4II2A 3OMLA 3AFMA 2NSDA 4EDFA 1R0LA 4UVDA 4Y9DA 2E37A 3BMNB 4GI2A 2VWHA 3S8MA 4W4TA 3DZGA 2B69A 4TWRA 3FN4A 4R69A 2OZPA 1CDOA 3GVIA 4HKTA 2HDHA 2NACA 1PZHA 5I7VA 2OHXA 3GFBA 3ZWBA 1TA4A 3JQ9A 5HBRA 3OJFA 3INRA 3WFJA 4FGSA 1PJ3A 3PGJA 1E7QA 2AEJA 4TRRA 3NT5A 4K6FA 3SC4A 1NFRA 1R0KA 3LZ6A 4AJPA 5L53A 1K2WA 2VYND 5JYEA 5B37A 3BHIA 4H15A 4JNKA 2FHSA 2ET6A 2ZYGA 3DAGA 1HF3A 2EGHA 2YHUA 4FQ8A 4FB5A 3IIEA 3DBRA 2AXQA 2JAPA 1M75A 2Z95A 2I9PA 4R1SA 1IB6A 1M6HA 3INGA 2OUIA 3OJOA 1GADO 2D1YA 3EMKA 3L9WA 1K6XA 4IIVA 4OSPA 5A3JA 2XXJA 3HUDA 3WIDA 5C7LO 5CP8A 5I8WA 4Q3BA 4CMEC 1CF2O 2HK8A 4MP6A 4JQCA 1O6ZA 4WLEA 4UVGA 2DAPA 3DZHA 1Q0HA 4FJ2A 3FNFA 4TKLA 1IULA 4NJMB 3HZZA 4CV3A 4MIYA 3WNVA 3WFIA 5DULA 4B8WA 1YOVA 2VN8A 4L4XA 4JJIA 3PHGA 3JSAA 3ZWYA 1F8GA 4FN4A 3GK3A 1E6EA 4CMEA 4URFA 2NM0A 2GN9A 2Q49A 3ZWNA 2I66A 3WMXA 4YRBA 2BHLA 4U6QA 1V3VA 5K0ZA 3ETDA 2CF6A 3U09A 1WVGA 3PYLA 3RUAA 4RCVA 1B0AA 4NIMA 2J5RA 2ZB3A 4PN3A 4FBGA 2VTDA 1B26A 2RIRA 4QUKA 4Z9XA 1SOVA 3I9JA 3H2ZA 4PVCA 4RVHA 1Z75A 4XGKA 4BNUA 4OOEA 1I3LA 1LRJA 2YYYA 2F1KA 3PQDA 4HFJA 1OFGA 4BNJA 3S1LA 2YUTA 2CDAA 5EERA 5TQVA 2J3IA 3KRTA 4X54A 4D0SA 5TLSA 1Y8QB 1NM5A 2VHYA 2X4GA 2XAAA 3MJTA 3ULKA 2VUTA 2G1UA 1PX0A 3JQBC 2DVMA 2HUNA 2YHIB 2OBYA 1P33A 4W6ZA 1X14A 2J3HA 5EMHA 1VSVA 1LI4A 1U5AA 1MXHA 5CDYA 1PQWA 3QY9A 4W99A 4B7UA 1U3VA 4OO3A 2CDBA 1LDNA 4K28A 1H6BA 3WGZA 5A5EA 2W90A 3AOEC 5G4KB 1BMDA 4DREA 4J49A 1I0ZA 2BI7A 2V7PA 1DIAA 1ID1A 5GZ1A 1JWBB 3JQBA 3NKLA 1XDWA 3WQQA 1FDTA 1ZSYA 4C7KA 3ZNNA 2Q2QA 3FD8A 3ADOA 3SEFA 5DNAA 1DC6A 4PG8A 1FDSA 4ZU3A 3L9XA 1Y8RA 3K31A 4WE3A 3WGYA 3PZBA 3BA1A 3VKUA 3AOEA 1HYHA 3DFUA 3QE3A 4IJKA 3LF2A 4ZRMA 1DJNA 2X9VA 5THQA 1HDRA 1JAXA 4IGFA 2BKAA 2NTNA 2JCVA 4J3FA 1SPXA 3MJVA 3PP8A 4LN1A 4OAQA 4XQCA 3JYNA 4GPD1 1GZ6A 4PLTA 1E5QA 3NDRA 3DC2A 3JQCA 4MVJG 1ZKMA 2A35A 4HXYA 1YQXA 1DPGA 1ISGA 3ZWVA 4PFJA 2RAFA 5C5IA 1EMDA 2HAEA 2VCYA 3RUIA 2JHGA 4JBIA 2ZCVA 2B5WA 5CG2A 1YGYA 1X0XA 4AJKA 2X9NA 5DCUA 2IZ0A 5DOVA 2NV6A 5COAA 3B20A 2C07A 5TX7A 2HJSA 5CDSA 4Y6RA 1C1DB 1E3LA 4ILKA 4MINA 4A7PA 2PGLA 5T57A 1ZEJA 3K8ZA 1W73A 4JJFA 4EEZA 1N8KA 2HQ1A 2BGMA 3G17A 3T7CA 4ALLA 1ZXLA 4QTZA 5IDYA 3RVDA 1I10A 3GY0A 1ZW1A 3L77A 4BGEA 1U5CA 1VC2A 3BMQA 2QRJA 3AY3A 1MX3A 3EZLA 2Y0DA 3TL2A 4PCVA 3GPIA 4RDIA 1PGOA 4BO4A 3GG9A 2ZYDA 4PG5A 1JVBA 3F4BA 3KB6A 3QJ5A 4PG4A 2GPTA 3TZHA 2PWZA 4R1TA 4YJHA 1CIVA 1ZFNA 8LDHA 1SAYA 2CY0A 3PK0A 3P7MA 1UJMA 2VNAA 5IJZA 1XWFA 4TRNA 1ENYA 3S2EA 1E1LA 4IMPA 3K9QO 3JQGA 1OBFO 4R4JA 3IAHA 3EK2A 3FCOA 3AY7A 1WNTA 1EFKA 3I5MA 3DMTC 3MWEB 4YR9A 2EKQA 3NGXA 3E03A 4E2ZA 3ZW9A 2R00C 3C1TA 3L6EA 5L7YA 1SEPA 3B1KA 3HE3A 1F06A 3OQ1A 2CMDA 3JQFC 2GLXA 3GZ4A 2HSDA 4CM4B 4CMKA 2EJVA 2G5CA 1I3NA 4DGSA 1MB4A 1EZ4A 1B16A 1PS8A 1YB4A 3B1FA 5KOIA 3DMTA 3K6JA 2FZWA 1ZK1A 4ND5A 4FOOA 3UOGA 1A9ZA 4B4VA 4QQRA 3HDQA 2R00A 3PIIA 3PQEA 3KETA 1IE3A 1HETA 2VRBA 3MEQA 5JY6A 5ILGA 1Q0LA 4IDDA 3KBOA 3ROQA 3JQFA 4P38A 4XWYA 2Y1EA 2WWRA 2O3TA 3WYCA 4WEQA 1A72A 1DOHA 3JQAA 1UP7A 3WYBA 3Q2KA 4NK4A 3H2SA 4J7CA 3WR5A 5FI3A 2R2GA 1YRLA 4IUYA 3BZUA 3GDOA 2I6TA 5I9LA 2CVOA 1U7TA 4AFNA 4WECA 2VHXA 3LYLA 4GBJA 3AY6A 3TDKA 3TJRA 4PLPA 1RM3A 4IINA 2RH4A 3BHJA 3MOGA 2IXBA 3SVTA 5EINA 4L4RA 4LMRA 4CQLA 1MLDA 3GVXA 3NT4A 5A05A 4NR0A 5CHEA 1NAIA 1O95A 2AG5A 1FMCA 3NDIA 3ZH2A 3GGPA 4BKQA 1U3UA 2Y93A 1NQ5A 2CVQA 1D1TA 3Q1LA 2J3KA 5DBFA 3NAQA 3OBBA 4Y8VA 4UVHA 4DXHA 3D64A 3EDMA 4YEDA 4XYBA 2YDXA 5CDUA 3R6DA 4DIOA 1DBVO 1H6AA 3AI1A 3Q2IA 1B3BA 3DFZA 1DC4A 4CMGA 3JD4A 3DHEA 1XQ1A 4KMSA 5A9TA 1LC0A 2TMDA 3RUFA 5COQA 1OAAA 3QWAA 4LW8A 3PYXA 5FI5A 4R41A 3UW3A 3JQ8A 2C29D 2OOSA 4DLBA 4WKGA 1A9YA 1VPDA 3DHNA 3RJ9A 3GN2A 1J4AA 3LC2O 4W7HA 4E33A 5B1YA 5LCXA 3VH3A 3OM9A 4BOYA 1DLIA 1Q7GA 4DYVA 1EK5A 1YB1A 5IDXA 4IJUA 4WUVA 3H8VA 3U4HA 3FR8A 4MVJH 1IUKA 2VUSA 2I5PO 3FWZA 5U1PA 1WDLA 2GN6A 4J9VA 3WGQA 2X86A 1X7GA 4IZIA 3RUCA 4BVAA 1QKIA 3FPLA 3QVSA 3JCZA 3VDQA 3WWZA 4BNVA 3IJPA 1KVRA 3GPDG 3DBVO 1PGJA 4CUZA 3S2GA 3C85A 1AGNA 3VTZA 1N9GB 1DHTA 1GQQA 5JAZA 4RVSA 1T4BA 1E0DA 2HMWA 1JU9A 2A4KA 2PKQP 4TMFA 5BNTA 1Z45A 2JFHA 1Q2XA 2Y99A 2B4RO 2W2KA 1JKJA 3I1JA 4J16A 3V1YA 5A02A 1LU9A 3HB4X 5FEUA 1K89A 2PLAA 2PK3A 1ENOA 3CINA 3JYPA 2QW8A 3F46A 3RIHA 1W8DA 1RYDA 1V35A 1WDKA 2FN7A 2GR9A 2HMTA 2Q2VA 4CQMA 1F0YA 4R5HA 3KEQA 1NQTA 3GDGA 5BNFA 2EW8A 1HE4A 5L4LA 4D7AA 3UUWA 4Z6KA 1NVTA 3M6IA 1H6CA 4RJTA 2EHDA 4RGBA 3F1LA 4PZCA 3W8EA 3WJAA 2TMGA 4CUKA 5K9ZA 1YDEA 5TRTA 4KZPA 3OSUA 4AJ1A 2Q1WA 3TF5A 4MIOA 1U8FO 4Z0PA 5A9SB 4Z0TA 4P8RA 3W6ZA 2O48X 3JYOA 3MZ0A 4QFDA 1P3DA 3RFXA 3WGOA 1RYEA 1I32A 4M89A 2GCGA 4ALJA 1MP0A 1T24A 3EUWA 4FFMA 4YAKA 2HMSA 1BHSA 4ID9A 1D7OA 1I36A 4R54A 1GD1O 4XGIA 2WYWA 4Y6PA 5TT0A 2Q50A 3L4SO 2DKNA 3LLSA 1S6YA 3PWZA 5EL0A 3K92A 1I24A 1A71A 4OXYA 1GV1A 3D0OA 1DRVA 4MPDA 2P9CA 5IZCC 1WPQA 1H2BA 3DTYA 3ONEA 4MKXA 2Q1SA 3Q6IA 1GUZA 1UR5A 3O4RA 1VRWA 1EFLA 4YXFA 4QO8A 3AI2A 3FWNA 2Z5LA 4O5OA 3BIOA 4J1TA 3D3WA 5JNLA 1RM5A 4NU6A 2EKPA 3DBHA 1EE2A 2P5YA 1ADBA 3ITDA 1PR9A 1K5HA 2OGUA 4FIZA 3TFOA 4PLFA 5IZCA 4ZJUA 2ZIZA 4WNCA 4GMFA 5GY7A 4WOKA 5ENDA 1SZJG 3HNPA 3WIEA 3BMOB 2VHVA 2NNLD 4TZTA 3RUHA 3O8QA 4R5MA 5C7OO 1X1EA 1NFQA 4L75A 4CMIA 4IQ0A 1P45A 1T2FA 5JDIC 3WLEA 2CFCA 2W98A 4IBOA 5ES3A 2V6GA 3I83A 1NASA 1V3UA 3N7UA 4Z9YA 3DL2A 2IXAA 2HMUA 4KOAA 3ETEA 1YJQA 3FF4A 4CM1A 1N2SA 4P4GA 4EW6A 5TIIA 4J7UA 4IXTA 4BGIA 4J4TA 1DAOA 3EC7A 4Q39A 4FS3A 5BQFA 2HRBA 3M1AA 1QV6A 3C1AA 4NH4A 5IXYA 3G1TA 2J6IA 5JDIA 4TROA 4MVJF 5ITWA 4OL9A 5A04A 1A5ZA 4AICA 3K73O 1YJ8A 2A94A 3PIDA 3QVOA 2R6JA 1JTVA 3NJ4A 2QX7A 1NP3A 3GGOA 1HZJA 2VWPA 4AJNA 3DZFA 1ISMA 2ILTA 2GZ2A 2VYVA 5JS6A 1H0KA 4GLOA 1E3SA 3P5SA 4YACA 5FFFA 2DFDA 1EDZA 1PU2A 3OP4A 4AVYA 6LDHA 1O8CA 2DQ4A 2AQKA 3GNTA 1CRWG 3I9OA 4XDZA 4BO7A 4CODB 3WGHA 1F14A 1BXZA 4GAEA 1MGOA 4DPLA 1S7CA 3TPCA 2GN8A 5JPIA 3K30A 3DQPA 2B36A 5DCWA 4WGGA 2H63A 4E30A 4J9UE 3DOJA 1GYQA 4YQYA 3RC1A 2QZ9A 3ZV4A 5G0VA 1ARZA 4MKZA 4HADA 5L9AA 4YRDA 2Y1FA 5BSGA 3LDHA 4Z0HO 4Q3AA 1BRMA 2VHZA 1WP4A 2ZKLA 3DZIA 4Q3DA 1W6UA 2VQ3A 4IMRA 3ANLA 5ER9A 5JMWA 2EF1A 4ALNA 4EEXA 1I2ZA 1SEVA 2Q1UA 4BNFA 2D5AA 4ZQEA 3S2FA 3GZNB 3QQPA 1U3WA 3RJ5A 3IS3A 5TNXA 5I8ZA 4LGVA 1ZH8A 1QLJA 3VH1A 4CMJA 4DQUA 2ZJ0A 1JLLA 4CMHA 2WYUA 3QV1A 4CM8A 4LSMA 4AJOA 2DFVA 3VTFA 3LVFO 3RU7A 3K96A 3EGOA 3CSDA 2H1SA 3JYQA 4IS2A 1MC4A 1CYDA 4YQZA 2VUUA 4PLGA 1ZK0A 3AM4A 4MVJE 4BO3A 4E5YA 4GX5A 2ZQZA 1IPFA 1SMKA 5JMPA 2PZKA 1PL6A 2D5CA 4ZQGA 1VLLA 2DT5A 5DP1A 3L6OO 3WMWA 2AQHA 1KEUA 4BNIA 4MKRA 2P91A 3H5RA 3HSKA 1T25A 2NVBA 5C37A 1TB4A 2NUAA 4ND1A 2C54A 2I65A 3CH6A 3KYDA 3LQFA 3IKTA 3KXDA 4BMNA 1PIWA 1QR6A 3VH4A 5T8KC 4CM7A 1E7RA 1Z73A 1GPJA 4BKRA 1NWCA 1LDGA 4OYRA 2D59A 4KQWA 4E2YA 4LMPA 1ZJZA 4E5MA 4YJGB 2DBRA 3BXXA 4LK3A 1UXGA 1TT5A 4UUMA 1EQUA 5T8KA 4CM3A 1GQ2A 1EVIA 1E1KA 3EVNA 1IY8A 1P0FA 2P2SA 4O6VA 4Q9NA 2BFPA 4PRLA 4TRMA 1EK6A 1E3JA 5T6BA 3AU9A 5IN4A 4B8ZA 4I1IA 3ZWPA 4EZBA 1HYEA 3GH3A 1GCOA 2NTJA 7MDHA 5CEJA 2RCYA 3Q3CA 5DBIA 1LXCA 3EZYA 3I3OA 4B7CA 2OFPA 4DIBA 1GTMA 3ZGYA 2FOIA 1O0SA 5I9NA 2NVUA 4TKMA 3AM5A 3N58A 5B12A 2HK9A 3BYZA 1E3IA 1ZBQA 4JK3A 4FR5A 3WTBA 3GNSA 5T67A 3W8FA 3TQHA 1T2DA 3CEAA 5ADHA 1R16A 2NLOA 3GLQA 2VZ0A 2ZTLA 4RVGA 1QYCA 2JD2A 1HYGA 4J91A 1P1RA 4FD3A 1VL6A 3UFXA 4QECA 5DZSA 5K1SA 4MP3A 5COBA 4J4HA 2AA3A 1BW9B 2WD8A 4CV0A 3TSCA 1J6UA 4R3NA 1BDBA 3OECA 3OJEA 4CLEA 2C5AA 1LQUA 1ZJYA 2HLPA 1ZUD1 1MFPA 5ICMA 2FR8A 3H3JA 3RD5A 2G0TA 4G81A 3KHUA 1CQJA 5BR7A 1ULSA 4MOWA 4PLZA 3OEYA 4BNGA 2P9GA 4E21A 4YYZA 5ICSA 2W2LA 4BL5A 4F6LA 2FY8A 4WLNA 3QA9A 4XRGA 1GY8A 3RSHA 4DTIA 1GUYA 4AJJA 5IF3A 3U0BA 3IUSA 3ASVA 1ZZEA 4S3MA 3GMSA 3ITKA 1LDEA 3DR3A 3RBZA 1R4NA 1I2CA 2BFAA 3JD1A 1C3VA 1GV0A 3PFWO 3D5QA 4NBRA 3PYMA 3W6UA 2A92A 5DOZA 3ICPA 4P4NA 3KTDA 3ASUA 3GG2A 4E5KA 4XIYA 1ISIA 1EUCA 1IOLA 3U62A 1TEHA 5T64A 3FNGA 4IDAA 3F4LA 4M1QA 2Y1DA 1L7EA 3M2PA 2HKIA 3C7CB 4DPKA 4JBHA 3A4VA 3DAFA 1UAGA 4LCEA 1AHHA 3ZWXA 3MWDB 4XB1A 2AQIA 4IDCA 4R9RA 3SLGA 2Q45A 3UAGA 4DL9A 3OHSX 1DHRA 1UH5A 4FW8A 2I76A 4PIVA 1PJ2A 4JP2A 4DPMA 3HDYA 3KUXA 4CL8A 1Q7BA 3NUGA 1SO8A 4DBVO 2PKRA 1YE3A 3DB2A 5KTKA 3RWBA 5KCZA 1H9BA 1I33A 3LF1A 5MDHA 2D2IA 1HLDA 4H3VA 3PHIA 1NPYA 3COSA 2C20A 2YDYA 3H9UA 3ON5A 5HA5A 3WWYA 4CLOA 4YAIA 5JXWA 4ALMA 3LT2A 2I3AA 4E13A 1NR7A 3I9LA 1HDGO 1X1TA 2FSVA 4TQGA 1OOEA 2P5UA 3JQ6A 4HWKA 4RZHA 1Y7TA 4GLLA 1HRDA 3QVTA 4WASA 4YJFA 2DUUA 3GDFA 4RF5A 1UXJA 3BTVA 3E1KA 1R12A 5EIOA 4WOJA 5TC4A 1P1FA 4GQAA 4BS9A 1QYWA 4JROA 4DC0A 1T2CA 5A1TA 4GX0A 3FBTA 3NTOA 4CLHA 4G2NA 4IJWA 3CKYA 1XEAA 3WXBA 4LSWA 1LC3A 4NZ9A 1PJBA 2O3SA 3RBXA 1DO8A 4BNWA 2D8AA 2I99A 3ZV3A 3A06A 4YB8A 3GEDA 3R1IA 2JKVA 4ZRNA 3KEOA 3AUUA 3DBRB 3ZNQA 4PG6A 2X6TA 3PLNA 2DTEA 3PHLA 3ZHBA 2Q46A 3ONFA 4BNMA 1FK8A 5G4LA 3UN1A 4RQUA 4I9NA 2X8LA 4WEOA 1K6JA 3IL2A 5A9RA 1RKXA 3AWDA 1KEPA 1SCUA 1NBOA 1M66A 5G0UA 5G2OA 2G82A 2EV9A 2YQ5A 5ENVA 4BGVA 1LLCA 1JDJA 1M76A 2X23A 2EP7A 3CPSA 3D5TA 1BGVA 1GQYA 4Z9FA 1YOVB 1Z74A 2VWQA 3JQ7A 3JV7A 3STHA 1GZ3A 2IODA 1IZ9A 2P4HX 1VSUA 3TZCA 1B15A 3DMYA 5ILOA 4BNTA 2G17A 1N92A 3ENKA 4A26A 4AL4A 1EUDA 1ONPA 1O89A 1X13A 1F12A 2JFGA 3H5NA 3HB5X 4CV1A 4E5NA 4QSMA 5JDCC 4D41A 1R66A 3KYCA 4IY1A 4FFNA 1DB3A 2Y68A 1VM6A 3JQAD 3TL3A 1Y81A 4W82A 3R3SA 4WK6A 5EQDA 1UP4A 3AI3A 1GCUA 1HTBA 2EP5A 4U5QA 4IZHA 3ANNA 1PS0A 1C1XA 1PR3A 1I3KA 1LRLA 4MVJD 3MTJA 1E1MA 1KVTA 1EBFA 1GL3A 4L76A 4ZN6A 3UCXA 5JDCA 5DDIP 1JVSA 3E5RA 3D4OA 1D1SA 1YQGA 2DBVO 3SBOA 3EHEA 2H5LA 4DYDA 1H6DA 3UXYA 4DIFA 2ZTUA 3K5PA 3FBGA 5AXBA 5U4QA 1U3TA 1HDZA 3A9WA 1LDYA 2OMEA 3MTGA 4L8VA 1ZNQO 4D45A 1BG6A 2VRCA 3SC6A 1I01A 2FMUA 4I5FA 4MO2A 4R16A 2I3GA 3GC6A 1KY5A 4MDHA 4N5LA 3B6ZA 4R01A 1WZIA 1Y8RB 1DRUA 2DPGA 1DFHA 1X15A 4XYMA 4MVJP 5L51A 1DIHA 4GSKA 3WQRA 1Y1PA 4R1UA 3B70A 1UAYA 2EJWA 3TNLA 4KQXA 1B8UA 1M67A 1Q0QA 3H9GA 4RORA 3RKRA 4W9NC 1HDYA 4ONEA 2PD4A 4XD2A 4ALKA 3WG9A 2QZZA 1EUZA 5AQ1A 3BTUA 2BRUA 5JC8A 1JKIA 4U0JA 3NT2A 1SB9A 2BGKA 5CEFA 2NTVA 3NTQA 1KETA 4EUEA 1ENZA 3PFFA 4RPHA 4WLUA 1GDHA 2PZMA 4PVDA 3GVHA 4W9NA 4GKBA 2YQ4A 3VZRA 2VTEA 3IJRA 2GZ3A 4UREA 3BTSA 3KZVA 4J4BA 3X2FA 1X7DA 1T2AA 3FNEA 2J5KA 2E82A 2AG8A 3OQ6A 2Y1OA 2H6EA 4Y6SA 2V6FA 1KY4A 4RF3A 1GU7A 2I67A 1E5LA 1NPDA 2NADA 4BNNA 4A2CA 1WLYA 3VPSA 3RC9A 4BO0A 4CR8A 1PQPA 3E9NA 1PJSA 3BMQB 4CQMD 4XJSA 4CLRA 5IDWA 4D79A 2YZ7A 1J5PA 1HWYA 3VPHA 4B4WA 3U4DA 2D4AA 4CPDA 3GN1A 4PLHA 4D43A 4BV8A 4UEOA 4GL4A 1JN0A 1PJTA 1TXGA 2B83A 4JXKA 4YJHB 1DFIA 2DTDA 4WCFC 5L3ZA 1P44A 1Q7CA 4BKOA 5F3RA 1UDBA 4IS3A 2AEMA 1XCBA 4FFPA 4C4OA 2Y66A 1D4FA 1AUPA 5LDHA 3JQGB 5KJEA 5IAAA 1PJCA 4TVBA 4HFNA 4YDRA 5KVCA 3ZU3A 2ZATA 1AN9A 1RM4A 4IJVA 4HUJA 9LDTA 1E3WA 4J1SA 4MJLA 4EUFA 2FPPA 4WCFA 2WD7A 4YCAA 5JCJA 4Z3DA 1ZMOA 1ZCJA 4XYEA 5G0WA 3RUDA 4DMMA 1A4UA 3ZHZA 4BMSA 2XF8A 4E32A 1BXGA 4UAGA 3VVCA 1E6UA 3Q11A 3TRIA 1P1HA 1QG6A 4OXNA 3WBFA 4RV9A 3PRJA 3MJ4A 2O3JA 1LQTA 1OC4A 4E3ZA 2P9EA 1NAHA 1ZK4A 1Y5RA 2BH9A 1E77A 1YVEI 2PGDA 3VZQA 3HJAA 2VHWA 2RHRA 3D1LA 3QWBA 3C24A 1UDAA 3DDNA 3DAPA 3E8XA 4EYEA 2X5JO 4RLHA 4XQ9A 5F21A 3GUCA 2DU8A 2FP4A 3BMCA 3OIGA 4XB2A 2ZTVA 4MVJI 4PLYA 1DRWA 4JJGA 1FDVA 2CD9A 3I6IA 4KDEA 4RVFA 3JYLA 1TLTA 1DDOA 1VJ0A 3JQAB 4K6CA 2OL4A 5EPOA 1GZ4A 1J49A 1HLPA 1LNQA 1WZEA 1BTOA 1BXKA 2C0CA 3JQEA 3IUPA 3O26A 5AOVA 3V2GA 4B3HA 1GEGA 1R4MA 3G79A 5I7SA 4OQYA 1Z82A 8ADHA 3OJLA 4FFRA 2O2YA 2DUWA 3GRPA 1TVEA 3AU8A 4CQLB 4RPJA 2WJPA 3I52A 3ZCXA 4XEHA 3Q9NA 3EVTA 1OC2A 1GFSA 4CM9A 4OXKA 3GAFA 1ML3A 3LSYA 3WSWA 1Y5MA 1WWKA 3R3JA 1G0NA 4YAEA 1FXSA 4CL3A 3QIVA 2EEZA 3CTMA 2PKQO 3OF2A 4KTVE 3GHHA 1N5DA 2PZLA 5KKCA 2UYYA 2VYVD 1CJCA 4F46A 2JJYA 2B0JA 2QQ5A 3ZU5A 2X5KO 1IL0A 4XJTA 4ND3A 4J90A 4ZGWA 5TJHA 4RL6A 2Q3EA 4DRYA 4E4YA 3JQ8B 4HFMA 5HTOA 4GVLA 5IXSA 2VWGA 1ISFA 4DA9A 1YONA 4AJIA 4WCDA 4KUHA 1BVUA 4ROSA 2BLLA 2PH5A 2C82A 3KSUA 4J1QA 1I3MA 2O23A 4IDEA 1UZNA 3ZU2A 4LRTB 1E92A 1C0LA 2UVDA 1PTJA 3G49A 3R0IA 5EQFA 4AJHA 1IYZA 3U5TA 5FYDA 1KEWA 5GZ6A 1EQ2A 3EY4A 4KWIA 3WJ7A 4ALIA 2Q2WA 1ZMTA 4EBFA 2B35A 1PGPA 2UV8A 1YL6A 3WTCA 3ZU4A 5LC1A 5DBGA 1DLJA 4J6FA 5A5FA 2GZ1A 3M1LA 9LDBA 5JAIA 3Q9UA 3G0OA 1PZGA 1ZIDA 3WICA 2X58A 3UH1A 3E82A 1E7YA 4E12A 3NV9A 1XKQA 2ZB8A 2W2KB 2PY6A 1H94A 1XU9A 1N7GA 1H9AA 4PLWA 1QRRA 1ADFA 1VL8A 3AOGA 2RHCA 1HSZA 5TSDA 5MGBA 4EITA 2OO5A 2BGLA 1Z7BA 1UP6A 1E7MA 5JE8A 4ZQBA 2X0NA 3P2OA 1DIGA 2WTBA 2Z1NA 2DLDA 4I5EA 4CQMB 4ZQFA 1SOWA 1VL0A 4R68A 3OICA 5JAQA 5FWNA 4OH1A 1WMBA 3UGKA 3W4KA 5I7FA 3CZRA 4CLXA 3GMDA 3ZI0A 1BVRA 2Y1GA 3DBLA 4HFRA 5F1PA 3F6YA 2HU2A 3PEFA 4WLFA 3CE6A 4OKNA 1N1GA 3SJUA 2HK7A 5JY1A 1QV7A 1XR3A 2YV2A 2O7SA 4IM7A 5JC1A 4A5OA 3I9NA 1ISJA 2X9GA 4UUOA 4WPGA 4AJLA 4J2OA 2PV7A 3I9MA 1HSOA 3ZNPA 3PHHA 3S2IA 4BMVA 3C7AA 3E6AA 1QSGA 2QHXA 1I8TA 2XOXA 1QYXA 2DBZA 1OZAA 4YT5A 2FSSA 4GSLA 3EYWA 1CWUA 1HE3A 1NXQA 1O9BA 3BMNA 4K26A 2HJRA 2PR2A 3K2BA 3OFSA 5GMOA 4RDHA 3O9ZA 4BNKA 1YBVA 2Q4EA 2QRLA 4M55A 5JYDA 3ZV6A 2WSBA 3DEYX 5JAMA 3VAZA 4IDFA 5GZ3A 5L95A 3B1JA 3A1NA 4B4OA 1KIFA 2X7HA 3D4NA 3D3WB 2WE7A 3DBHB 3G1UA 3H7AA 4ITUA 3HN7A 4RLSA 3SX2A 4UUPA 4AJEA 5CDTA 3WOHA 3FSRA 1G0OA 4KUEA 5DT9A 4I9UA 4FC6A 1P31A 2QIOA 5J23A 2YW9A 5AXAA 3WX0A 1RPNA 2V65A 4RPLA 1TT7A 5I9MA 2GF2A 3O38A 1Q1NA 1WXDA 4IQ8A 2GERA 3NJ8A 4EGFA 2NQ8A 4YAJA 3O8QB 4F3YA 4YRAA 2GO1A 4CMIB 5F1KA 5BSHA 1VE9A 1JQBA 3H4VA 4JBGA 3UCEA 3VDRA 3VZSA 4G5HA 1BWSA 3WSVA 1LEHA 1W4ZA 5A4DA 1YDWA 5KVSA 4CMCA 1C0KA 4CUJA 1I30A 3OQBA 3OIDA 1EEHA 3BAZA 3HFSA 4XDYA 1HE2A 3VH2A 2C5EA 4IPTA 3UKOA 2EG9A 4PLVA 3HFGA 1F17A 4GWKA 3UVEA 1NHGA 4Y67A 1H2HA 1KBZA 5TJ9A 1EDOA 1AXGA 1P0CA 1XELA 4NJMA 3CMMA 3PJFA 3TN7A 4DLAA 5CG1A 2H9IA 2P68A 1TI7A 3U49A 4TRJA 1YBAA 4NPCA 3KOUA 3NX4A 3GNQA 4TZKA 5H82A 3KYBA 2HRZA 1GEEA 3WS7A 2W2LD 4RPGA 3RC7A 4HY3A 2JL1A 1N1EA 5CAEA 1HDCA 2LDXA 4AJ2A 3QW2A 1DXYA 3A28A 3O03A 4E2XA 3FPCA 2VZ9A 5KWEA 3TFQA 2P4QA 4XCVA 4TSKA 3ONDA 4FPXA 1OI7A 4HX5A 3KM0A 5JSFA 1KS9A 4KP7A 3OH8A 1H93A 3GEMA 1HXHA 3FHLA 4EI2A 1FJHA 3I4FA 3PWSA 1Y8QA 3T4EA 2NU9A 2B5VA 2EXXA 1I2BA 1NPTO 2A9FA 2YHIA 3GVPA 4GMGA 3L07A 2O2SA 4L9RA 1ZSNA 4H16A 4NU5A 2O4UX 4J0EA 1DJQA 1E1NA 3M2TA 4Q3NA 5G0TA 4D3DA 4RF4A 3W1VA 1R37A 1GYRA 5G4KA 2PGJA 2C7VA 1ZEMA 3A14A 1NQAO 3PDUA 2PTGA 3GUYA 2CNBA 1PGNA 4FSHA 3U3XA 1ONOA 3LU1A 1IPEA 2OORA 1SBYA 4BQRA 1YO6A 1U2GA 3TOZA 1T4DA 3UF0A 1LUAA 2GSDA 3LT4A 1QYDA 1YQDA 3LC1O 4CM8B 2EERA 5L7TA 2RBEA 3RU9A 2PA3A 3UCFA 2DPHA 1MC5A 2EGGA 1I5RA 3CMCO 3KSZO 1C14A 3FTPA 2Q4BA 4W7IA 1LLDA 1LDMA 3TZKA 5A3VA 1HZZA 4D46A 4GH5A 4IGEA 2YY7A 4B79A 1HL3A 4WJZA 4N7RA 5JBIA 5KJCA 3H9QA 5H81A 5B4VA 2UUPA 4GGOA 3GVCA 4KTTE 1Y9AA 3QRWA 3QWIA 2VT3A 4R51A 3CXRA 3HADA 5DP2A 3MOIA 1SB8A 3GGGA 1ADCA 3KYDB 1U28A 1WDMA 6ADHA 2IE0A 3ZWCA 2X1HA 3DO5A 1PEDA 1R15A 4CM5A 2E4AA 4F45A 2B4QA 3PJEA 1WMAA 4ZQHA 4ND2A 3KO8A 3PXXA 1C1DA 3V5NA 3PQFA 1T26A 3OIFA 4D42A 4MIEA 3V1UA 3HDJA 4O0LA 3PJDA 2POQX 3PI7A 1M2WA 3ANMA 4NHEA 3TOXA 2GNAA 4BO9A 1F8FA 3HWRA 4MP8A 3NTRA 1JW9B 3DZKA 3WB9A 3ROKA 2PD3A 1DSSG 5HS6A 4WLOA 4DC1A 4HNHA 1TT5B 4FJ1A 4FCCA 5KNLA 4BB5A 2YFHA 4IXWA 5CPFA 3DXFA 2OBNA 3QVWA 2HMVA 2D0IA 2BD0A 4PRKA 2UUOA 2VYNA 1UXIA 2X0JA 1OMOA 1X0VA 5EJ2A 4WNIA 2J5QA 5TGDA 2V6BA 1PJQA 1LLUA 1HEUA 2IEBA 5C3MA 4U6SA 3OETA 3PDJA 2XXBA 4NG5A 3PPIA 2NVUB 4II3A 2CVZA 4BNZA 1EVJA 3RI3A 2JCYA 3H65A 3QLJA 1A7KA 3H3FA 3FTNA 4N5MA 2O50A 3ZW8A 4A73A 3UICA 2X0RA 2EKLA 4M8SA 5L7WA 4I5GA 1V0JA 3WDSA 4RPKA 3NYWA 3JD3A 4Z3KA 5U9CA 2B4TO 4BO5A 3I23A 3U4IA 4XRRA 4ZICA 5IG2A 5TS3A 4A10A 3AUAA 3PWKA 4XYGA 5B4UA 4CM4A 2Y05A 1XIVA 3DZJA 1NX6A 1Z7EA 1HKUA 3AFNA 3T4XA 4AJ4A 4YT8A 3WBBA 4RF2A 4YBZA 2JD0A 1QMGA 4ZA2A 5LDGA 4ZHSA 1RWBA 4HNGA 4OIMA 2X5OA 3WGGA 4BO2A 3IKVA 1HDXA 3QVXA 2CZCA 3DTTA 1PWXA 1C0PA 3VOSA 3RFVA 3ST7A 3ZDFA 2C59A 2OP1A 1R4NB 1BDMA 3AJRA 3DONA 4JN6B 5JO9A 4F6CA 4JLWA 2VRCD 4GX2A 1B14A 1PSDA 3OEWA 4OOFA 1UXHA 2Y0CA 1R0SA 2YFQA 2GRAA 3BHMA 5JLAA 2GGSA 2O3QA 4NFYA 2WMDA 4AG3A 3U4CA 1U8XX 1SNYA 1Y9EA 3E18A 3LK7A 4PZDA 5KVVA 4B7XA 5HRUA 4PG7A 1PL7A 1KVQA 1GAEO 1LSOA 2NWQA 1VKOA 1UZLA 3C8MA 2OXIA 3W4JA 1XA0A 1MG5A 2PFGA 3UHAA 4YA6A 4BNLA 4EUHA 1QORA 3IP3A 4FJ0A 1KC1A 3PVZA 4BUCA 4D3SA 3BTOA 5HWSA 3AUTA 3Q0EA 3GA0A 4IQGA 3K2EA 3C7DB 4R1NA 1O5IA 3F47A 3GAZA 3H9EO 1V8BA 1ZXBA 4RVDA 4CLOB 4UUNA 5L4SA 3DHYA 3RCBA 1LX6A 4LISA 4IDGA 1GYPA 3ZWMA 4GVXA 3RKUA 3NGLA 4OSOA 4XGNA 4YJFB 4B3JA 4M54A 3HN2A 1T1RA 3VPFA 2FRDA 1LSSA 1VI2A 1SC6A 3ROMA 1L7DA 2B37A 7ADHA 5A06A 1NTOA 2BFOA 1FF9A 5AXCA 5A03A 4JIGA 5ITVA 2ZTMA 1N7HA 4UEKA 2CDCA 1V9LA 3KSDO 4UEJA 4EJ6A 4ESOA 2CF5A 2VOJA 4L0QA 3ZHYA 3KLMX 4BKPA 1WAMA 1N9GA 4OMUA 3RUEA 2C7GA 3AK4A 3ABIA 3PZRA 4OHUA 1FDUA 2J8ZA 4LCJA 1D8AA 4XQEA 5G0SA 4E2WA 5HS4A 1E7SA 3ZV5A 5KIAA 1K6IA 1XYGA 1A4IA 4YJDA 2QG4A 5AXDA 3V2HA 4DWVA 3IQDB 3E9MA 3OA0A 3GFGA 4FFOA 3H6KA 4ZD6A 4DBZA 2QYTA 4E5PA 4R3WA 4H7PA 1KC3A 4CLDA 5JCJD 2VOEA 5KJ6A 5L40A 2WEKA 3IC5A 4J0FA 3DWFA 5JW6A 1C0IA 4IDBA 1DIRA 5AYVA 3VHRA 2NU6A 2ZJ1A 1NHWA 4QX6A 4BIIA 1U7HA 3DOCA 1XSEA 1DAPA 5DCYA 1QP8A 3LT1A 1J0XO 1LA2A 5A9SA 3P2YA 2Z1MA 1Y6JA 2F00A 3JQ7B 3ZZNA 5CPBA 1HE5A 2ZB7A 4MVJA 3MJCA 4N5NA 2YV3A 2EW2A 4DMLA 4UULA 5F5NA 2YJZA 1PS9A 3H9JA 4NMHA 1AXEA 3F9IA 4GWGA 1VKNA 1V3TA 1NWHA 3LLVA 4RQTA 5KJFA 1LSJA 1E6WA 4DVJA 3RAJA 1VJ1A 2IZZA 3HHPA 3KYCB 3WGTA 4A03A 4XZ3A 1E3EA 3AM3A 1KERA 1KEVA 1LDBA 2FZEA 2GN4A 2UDPA 3KVOA 4INAA 3NDJA 5K6AC 3E5MA 1PZFA 2AQ8A 1PZEA 3F5QA 1DFGA 1KVUA 3JD2A 4ND4A 4XKJA 1C1XB 2DTXA 2NU8A 3WNQA 3ICCA 1A27A 5CDGA 1MV8A 4YT4A 1P1KA 2CSUA 1V6AA 1QLHA 1ZO8A 2Q99A 4YTEA 4CJXA 2GDZA 3JTMA 3IOYA 5I7EA 3JQDA 3ZNOA 1ZK3A 1LSUA 1EVYA 5K6AA 1CETA 1T2EA 4CM9D 3BMOA 2NU7A 2DBQA 2D3TA 1ADGA 3W4IA 2AHRA 1U1IA 4NFSA 3WLFA 3T7EA 2DC1A 2X22A 5KKAA 1U4SA 1G6KA 1P74A 2ZCUA 3GHYA 4R9SA 4MVJM 1MFZA 3L4BC 4WLVA 4BNXA 1ORRA 4NDNE 4J7XA 5DN9A 1P1IA 4FFLA 4S1VA 3E9QA 2O3UA 3D3EA 2IRWA 2BF7A 3GF4A 2JHFA 3NEPX 3INTA 1DC3A 4BO1A 1ZSVA 1B2LA 1PWZA 4RZIA 4D44A 5JO0A 5ER6A 1R6DA 3L4BA 2AEFA 3ADPA 4HP8A 4CV2A 4BQPA 1ENPA 4KUGA 3GR6A 5KVQA 4E0BA 5IZ4A 1NQOA 4U8GA 2O3RA 3WQSB 1B8VA 1YWGO 5JFOA 2V6MA 4NBTA 4BNHA 1NYTA 3ROPA 4JCOA 4XQGA 2FPGA 4LVUA 4OKIA 3I4CA 3KLPX 3ZWOA 4FOSA 3U9LA 2UAGA 2YV1A 5BSEA 5T5QA 3VKVA 3ZHXA 3C1OA 3DOOA 4YT2A 2X0IA 4QFCA 4N18A 3P19A 1YKFA 4CMBA 1WW8A 4M49A 2BFMA 1CERA 2C2XA 4K9DA 5H83A 4C7JA 1XGKA 3QHAA 3V8BA 2BI8A 4KWHA 1RJWA 3NRCA 3GRKA 1LBEA 3QP9A 1MXFA 4YPOA 3VC7A 3RBVA 3ZN2A 1A7AA 1CQIA 4NI5A 4NFHA 2PZJA 3N74A 1NR1A 5BT9A 2LDBA 4EJMA 4CLRB 2NVWA 2JCXA 3FRJA 3MCVA 4BO6A 3ETGA 2G76A 3ORFA 3LC7O 4K1LA 1MG0A 2GD1O 4HBGA 2J3JA 1XU7A 4A27A 2FWMX
chains in the Genus database with same CATH superfamily
2R7NA 3WL8A 2BZ1A 1X87A 3M89A 2XD9A 3G82C 4MQFA 1J1IA 1ECBA 3W2GA 1ZAKA 2GAAA 3MPUA 3V7NA 4BX3A 5EJ6A 1JDSA 3KQSA 5HM8A 1M6NA 3CFYA 3V2UA 4D0RA 5FAKA 3C5VA 3U17A 1V8FA 3QWHA 4K6OA 2F3RA 3U7GA 1ZK2A 2KYRA 3E4DA 4QJ5A 4WV3A 2IA5A 2HDWA 3FFWA 2Z04A 5T4EA 5JWRA 1FTWA 1QK4A 2VF5X 5AM5A 3QK7A 1DWUA 1U3DA 4CDRA 3ZQUA 2JI7A 4RU1A 4MPPA 3RHZA 2WIDA 5IPFA 1MB9A 4ENTA 1S89A 3X43A 4AT1A 1XVLA 4L9WA 4BO8A 3E48A 5AVVA 1G1AA 2FN9A 4F5DA 4OYHA 1H8ED 1WKBA 4U7WA 1O96B 2AW5A 1W4CA 1PGQA 2WDZA 2H08A 1E3WB 4MR8B 2FPPB 4LUCA 1K3TA 1GGJA 1PFGA 3E9CA 4B45A 4ZTUB 4Q4AB 1DUVG 4PZPA 2UYHA 3RQSA 2RJOA 4QT0A 1OX4A 1U5BA 4IIUA 4W1RA 3RTGA 1JLMA 1B7GO 1BXGB 4R71A 4ERNA 3J81k 2Q1TA 4CI9A 2BISA 1J09A 2CUKA 3KTFA 5F5XA 1IJBA 4HWRA 5IN5A 4RSGA 4JOBA 5IABA 1LRKA 2DM6A 3FSEA 3IMFA 3U7IA 2WE8A 1U4OA 3BVPA 4RGYA 4RTNA 2PO5A 4QYSA 2O8CB 3TZ6A 5TEWA 1T5DX 2YOGA 4COOA 1IDN1 2Y1KA 1QC5A 3C8DA 3D4PA 3SEAA 4O4IA 3AKZA 3IPYA 1IZ0A 5AI0A 2FP4B 3ND7A 2BMAA 5C53B 2R4QA 4HXEB 2CBGA 2GCPA 1U31A 4PYIA 2II6A 1RTTA 3TZQA 4DQXA 2PNFA 1Q6ZA 5BUZA 3HJHA 3O75A 4R9VA 1KORA 3V1MA 3P0EA 5IDXA 3CR8A 4PO8A 1OXKB 4LDAA 4C6TA 4EJ0A 2H16A 4BV9A 1Z0FA 1QBGA 1JH9A 1HLFA 4CE6A 1QONA 3HXLA 4L6IA 4NBWA 4YP1A 2LCFA 4JR2A 4DCSA 1E2HA 1K5PA 1SVKA 4PEVA 3NTXA 1T5TA 1GT6A 4E08A 4FMCB 4M21A 4Z3OA 3TG8A 4L73A 3HCOA 4XWKA 4TLMB 3L6DA 4ARSA 3GRAA 3I6QA 4RL4A 6Q21A 3OQOA 3RAPR 3AESA 1XAIA 3KZMA 1F8YA 3ADBA 4N7MA 4OGKA 1WR8A 3O1IC 4QO7A 3RFTA 1USGA 3HG7A 1HEYA 4NK5A 3OOWA 1FNBA 1Y8CA 4RO0A 3KT6A 4LHXA 3G88A 4TTSA 3FR7A 1XZJA 3H42B 1K63A 1TLLA 4BEJA 4CTJA 2J7KA 3IQGX 1IBRA 3ZD6A 3WHIA 3QKUA 3AW9A 4IIYA 3R2JA 2BFCA 3PGLA 2FU5C 2W42A 3UHOA 1AE1A 1U1FA 4XLTA 4P4LA 4E88A 1M1YA 4OH7A 3CTPA 5EUQB 2IEDA 3G2OA 2QR5A 3ROXA 1TCBA 1MBZA 1H85A 2ZSJA 3AUSA 4H2DA 4LXGA 4HPWA 1O54A 1U7WA 3OZFA 2HO5A 1YASA 3QLVC 4L5CA 2WIAA 3EW7A 4BKUA 2VNSA 5ICCA 5KVAA 2V6JA 3VPXA 2FCAA 3K70B 3GT0A 1ZUHA 3OHPA 3SPXA 1BW9A 2GK4A 4GKVA 2DWPA 4TSFA 3STXA 1Z4JA 3ZJUA 4QBKA 4XUGB 4EF4A 2IC5A 2A9VA 3G3EA 4LRSB 5ESXA 4DLXA 3T54A 3LXXA 1O6GA 2PBFA 4RBNA 4DLNA 1UIMA 2P40A 2CNWD 2IX9A 2PD6A 3C3JA 4MQ5A 4N54A 4BPBA 4ENWA 4RTMA 2G3YA 3DXZA 5BR1A 3V1LA 1EBUA 3FF1A 2YVKA 3U7JA 1EFPA 2VJNA 1NJ8A 4K6GA 3VR5H 4E6PA 5JSUA 1RXUA 3LBHA 2UKDA 2M2IA 5ALEA 5BN4B 4XR4A 4G5QA 5GGXA 3BL8A 1WIWA 1KDOA 5LQMA 2RD2A 2ZUSA 1UZMA 3F7MA 2AE2A 2IYAA 4GI7A 3GLKA 1KI4A 2BW0A 2FHPA 1NXVA 2OCAA 2O0JA 3DKRA 1YR8A 3L1HA 1L7MA 3KJEA 4EG1A 5L4NA 2OP0A 2P75A 3GT7A 1HT0A 2GN0A 4AIIA 1Z6PA 4GS5A 4MIKA 5AH0A 4EDHA 4FONA 5BV2P 5ALVA 5JTUA 1A2OA 4DHWA 1JA9A 1ETUA 3DB1A 4HQRA 4J2HA 3BEOA 2AMLA 3F73A 4OLBA 1XI2A 2V5VA 1EP1B 2GK7A 2PRIA 4N0MA 4ZZIA 2WHXA 3ABRB 3EVCA 4FGWA 1YBMA 4UDXX 4UQOA 3IAEA 2F9LA 4ZI2A 2I7CA 5L45A 1WB5A 3QENA 4BE4A 4LWQA 1QP0A 1MA0A 3BORA 3D8SA 4O02B 5DF1A 3CPEA 1MF7A 2JJMA 5DI3A 3FWYA 3L4JA 4CM6A 1RAHA 1MEEA 1Q83A 1UXKA 2A1UB 3DBLB 3EAQA 4DB2A 3MMXA 3KKKA 4O59O 1AQ6A 2IHUA 4YRJA 3SSMA 2P9FA 2RG1A 5B3JA 3BXZA 1BEZA 2NN3C 3N39C 3A4TA 2JLSA 2PH3A 3FLMA 3SZLA 4NQZA 1SXIA 1VYHA 3E1GA 1MZVA 3QJGA 1P7CA 4ZOLA 3WYEA 1V39A 4F4UA 1MJHA 3DLHA 2O8BB 1K0UA 4LI3X 1HMYA 4RENA 2ZJ7A 2N1BA 2IDZA 3IIJA 3FPFA 4V0OA 3QI2A 1R18A 3NBFA 2Z2IA 3ML1A 2DEUA 2MSKA 4HB3A 4IW3B 2HU5A 1OJLA 2F1RA 4HTAA 3RASA 2GLUA 2I34A 1FFGA 4II2A 3V9AA 2YWEA 4RYLA 3Q6NA 4R2MA 1C7QA 1TTQB 2JI6A 1R0LA 2FG7C 4EDFA 1XRMA 2PX6A 3NKVA 4AULA 5KYWA 1MC1A 4AS1A 3IIIA 3DZGA 1NN1A 1NVAA 2X4DA 3FN4A 4U2CA 4TWRA 3I0NA 3NM6B 2OZPA 4UHBA 3GVIA 4HKTA 1CHNA 1B23P 2R1VB 3BSSA 3B6JA 3R3YA 3RWMB 3T1QA 2OHXA 1YRAA 3FSJX 1XCJA 2C84A 2W43A 2GILA 1CV2A 1AZWA 1QR2A 3N28A 3OAAA 4MRNA 1TA4A 3H9CA 3OO0A 4MYUA 3UO8B 4B17A 3ESXA 5HBRA 3OJFA 1KWKA 2BYTA 3IR5A 1WNFA 4QOGA 4RC9A 3VR4D 4F96A 5BN5B 1W4AA 5LIPA 1QQ5A 3VR1A 4TRRA 4R2IA 4DDMA 4K6FA 4BDTA 4GM4A 3SC4A 1NFRA 3X1KA 4M9SA 1A7UA 1HV8A 5ANRB 3F78A 3T7RA 3B3JA 3NU1A 4N82A 1NF3A 1NW7A 4H15A 2I4TA 3EVZA 1DX6A 2FHSA 1K7SN 3TLXA 5KWVA 1NNEA 2C2WA 2ZYGA 3DAGA 3K6SA 1Q0UA 2YVAA 2ZTHA 3EJWA 2HRQA 4M2LA 4QAJA 3ZKAA 2Z95A 4C3VA 4LF8B 1L4LA 4O4IF 1NVDA 1VLJA 2C8VA 1ZH6A 1M6HA 3DV0A 1P2SA 3WLOA 2LCIA 2P2NA 3KOMA 3FDZA 2WU3A 2LVBA 3GLVA 4NE9A 4R7ZA 4OSPA 3EDYA 3LTEA 3TBHA 3WIDA 4FT2A 3FIUA 1KZYC 3FAKA 4XVUA 3H6GA 3BT7A 2O05A 3D4IA 4BLWA 1QPGA 5KYKA 3PGA1 3UJBA 4CFZA 1CNFA 4EYQA 4QU9A 4QKQA 4NZPA 1BX0A 2AUTA 4GC9A 4XPZA 2GHQA 1SULA 1S02A 3O8BA 1NF8A 2JJ1D 2DAPA 4FQ7A 4UVGA 3QU2A 3T5TA 1XU4A 4EX7A 4W5HA 1A8SA 4TKLA 5DNDA 4UPVA 5YASA 3QUAA 1EZZA 2Q9UA 4MIYA 1YMUA 3TAXA 2H4YA 1CUHA 2FSFA 1YOVA 1PKXA 4JJIA 4ILEA 5D51S 2CXXA 5MN6A 3HA5A 2D1FA 3L18A 1ZOLA 3JSAA 3ZWYA 3RAGA 4F5WA 4FN4A 1KHHA 3AJEA 4QLAA 2RONA 3ZWNA 2EQAA 2FJ0A 4G84A 6REQB 5EIXA 1N5KA 4F21A 3GEHA 3BD8A 1QJ4A 2PKEA 1V3VA 4QUBA 3OT4A 4E70A 1WVGA 2C2BA 2GESA 3LP8A 3PYLA 5CAEB 4RCVA 2C4KA 1C3LA 3M70A 4NIMA 2EGUA 2YIJA 2ZWVA 3LDFA 3HNRA 4DRXA 2RIRA 4QUKA 3TX2A 3D6TB 1SUEA 4IF6A 3FPBA 3FRIA 4A1FA 4PQFA 4BNUA 1JILA 4F2GA 1EI9A 3S8YA 2PSDA 2WJZB 2A88A 1DKUA 4FE7A 4X91A 1QHEA 1EQAA 1U9IC 3Q2OA 4X00A 2GAJA 2VPQA 4HFJA 3VSBA 4EI8A 2O57A 5I5GA 3COJA 1U11A 2AFIB 3H0EA 2AI1A 2ODTX 2MOKA 4HDSB 5TQVA 5TLSA 2QR3A 3KUUA 4D0SA 1P0PA 1Y8QB 1NM5A 3BSYA 1SVSA 2VHYA 2XAAA 3MJTA 4GEGA 4JJZA 1Q44A 2G1UA 1PX0A 4OGFA 3ULKA 3PTAA 1M8PA 2QK4A 3UG7A 3U4QB 1P33A 2WUFA 3B52X 3DZ8A 3F5DA 3ER6A 3ICVA 2Q3CA 5WRFA 1QPZA 3KAQA 1LI4A 5HOEA 4LJRA 2ZI3A 3Q7TA 4B7UA 1AT1A 4H3SA 5E4TA 2PNJA 4OO3A 3B6IA 4PE5B 1TO6A 2VJAA 5A5EA 1AG9A 5G4KB 4UTVA 2LNDA 2RHLA 3K8YA 1BMDA 3BFKA 3N70A 3QTLA 2XUPA 4I1UA 5CURA 3H8JA 1UK7A 2V7PA 4LIPD 13PKA 4RAOA 2QX8A 2G5TA 4QODA 5CD1A 1YACA 2QGZA 4EATA 4Z54A 1FDTA 4OB7A 2WY2D 3NRBA 4MUXA 4QASA 2EOAA 4B6GA 4UTNA 5I7UA 3BRWA 3EFOA 2Y0BA 1Y8RA 3KR2A 2G0AA 2IIPA 2JH9A 2YVLA 4WE3A 3VR2D 2PGNA 4H7HA 4EO7A 4L4UA 4YRFA 1VMKA 3AKDA 3WGJA 1HK7A 3EUFA 5CCDA 3RS3A 4KFRA 2HWXA 1C2YA 1YHZA 5BVGA 3GLTA 4KRGA 1Z4KA 2GK3A 2X9VA 1DWOA 3GL9A 4I3FA 4XVQA 4I4LA 4IV0A 1K27A 2BKAA 2IKQA 2NTNA 2EAUA 1IEQA 2CL5A 1I80A 3DWGA 1SQFA 5CX1A 1DJOA 1Q12A 3JYNA 4GPD1 2CBZA 2ZXEA 1KMMA 2IBTA 3E7DA 5CFQA 4LZPA 2O59A 1E5QA 3JQCA 4RY8A 3RRYA 4ETIA 1E1RD 3ZWVA 2XV1A 1ISGA 1TRHA 1ZL2A 2Z4RA 4KXWA 3JAWB 4PFJA 3IEMA 3VUEA 2JHGA 4PPYA 1FJ2A 1XT6A 2YC2C 5AK3A 2E1RA 3M5DA 5EZSA 2X9NA 5DCUA 5LOVF 2GKSA 2NV6A 5CFNA 5CDSA 3LQ1A 3PC4A 4PZLA 4ZOLF 1POXA 2ZAMA 2PGLA 4A7PA 4BC0A 5K01A 4YUVA 5FLKA 1PJAA 3QEKA 3C3PA 4NCHA 2Q7DA 1XZBA 1N8KA 3N75A 4A1OA 3IT2A 4AZ0A 4BYGA 1XNRB 1SUCA 5A0FA 1V1RB 2DY0A 4G0MA 2XNKA 3PRYA 4ALLA 3SMVA 2QSYA 4HDAA 1WULS 3GY0A 4Z7JA 1NKTA 3OQHA 3OZBA 5K51A 2ZRHA 4NCKA 1VC2A 2P5SA 5IT0A 3BMQA 2EWWA 3AY3A 3T3IA 4Q7QA 1MX3A 3BRSA 1GAQA 3EZLA 3KZCA 1E2MA 4GOKA 3IPXA 4KACA 3U80A 3WKBA 1F2TB 1COWD 5K8VA 3A1FA 4RDIA 5C1OA 4RH3A 3IOMA 4IHJB 5CRIA 1J7JA 2EKBA 2P11A 2V45A 2J0VA 2AK3A 3CEMA 3QJ5A 2IU4A 1EXMA 3QX9A 4PXSA 1KFEB 2GPTA 2QM0A 1L6RA 2QU7A 5KYUA 2DULA 8LDHA 1H4SA 1V5EA 1FP6A 2CFSA 1T0HB 3TIVA 4YNBA 3PK0A 1PT7A 2H9AA 5E7QA 3P7MA 1ZGHA 1UJMA 2VNAA 5CVTA 5IJZA 1ENYA 3S2EA 5BURA 2E21A 5KAMA 4N1AA 3K9QO 2PTHA 1OBFO 3T61A 3IAHA 1UJNA 4YDSA 4QQ8A 1W87A 4ICIA 3WLKX 3I5MA 3DLPX 3MWEB 3AJDA 4WXPA 2NXWA 2YWJA 1TU3A 3E03A 1SKBA 4B7AA 4D4KA 1A9TA 1YE5A 4L16A 2R00C 1JEYB 3RABA 3DW1X 2WNIA 3RVJA 2L69A 3U56A 1SEPA 1SU7A 3B1KA 5FADA 4ZVQA 4LMAA 4MS3A 3OQ1A 2CMDA 2QLFA 5F7ZA 1B4DA 1N2XA 4MA5A 1QGAA 1LVUA 3LECA 2HSDA 4CM4B 3ZDXB 3C16C 2PMEA 4P3OA 1P2FA 2C3OA 1JT2A 1Z6TA 1P9WA 4G0YA 4ZOBA 1ZK1A 4ND5A 4FOOA 3IQIX 1A9ZA 3UOGA 2GCIA 3FLBA 3K6KA 4OL0A 4QQRA 4ZVUA 3VU1A 5F1YA 4ZKDA 3PIIA 2Z9DA 3PQEA 1IE3A 3RRZA 3RSSA 3KETA 1RLOA 4LV6A 1ADYA 2UZ1B 4WKPA 1RC8A 1Y7HA 4PSAA 3ROQA 1MA3A 2IP4A 1Y3CE 3HLKA 3DE7X 3GPLA 1JQLB 2WWRA 3HRHA 3CF4G 2GDJA 3R7BA 5ALIA 1JDBC 3A31A 4C6SA 2A57A 1UP7A 3SK0A 3BSWA 2ID8A 4EYKA 2D2VA 4BJ1A 2D06A 1UKAA 3ODPA 4NK4A 3DTNA 2ZQ5A 1C7IA 3SSOA 3AEKA 3H2SA 2FUG6 4H1WA 4H1VA 1GTL1 5FI3A 4B3MB 1WLSA 1EBBA 3DH0A 4X7MA 4X63A 1X38A 4ZAGA 5I9LA 5J2TB 1SH7A 2IKSA 2A1IA 2CVOA 4QNRA 1JTEA 1O4WA 2NO4A 2XUAA 4AFNA 1HNWB 2NO9A 1P2TA 1ZHHA 3LYLA 3MGGA 2D2XA 3PCRB 3MT9A 4PLPA 3WYAA 1BD4A 4BP1A 4CCAA 2RBKA 2IHKA 2XYHA 4Q37A 1EP9A 3QVJA 5LBIA 5IUJC 3RAFC 4AO6A 4ZAVA 2EJBA 3NT4A 1K7FB 2ZRNA 1T8PA 3HYTA 3HKEA 1O95A 2RGNA 3QW4B 3ZH2A 1XA3A 3GGPA 3TLYA 1E3QA 4ZMBA 4JQOA 2O2HA 3CM0A 1R6XA 3D2AA 4JLJA 4C78A 1XRJA 4DXHA 5CB4B 1CQZA 5EJ5A 5CK4A 3WK9A 1C5KA 2BBWA 4IUCS 1CNEA 4K9PA 3STVA 1AV7A 2VH2A 4D8UA 2VQFB 2WF7A 2PGAA 2WSSD 2XITA 3GDWA 1H6AA 5CH8A 4KG7A 4UW9A 4OI1A 5JTTA 4EY8A 8ATCA 1TK2A 1E6CA 2CVHA 2ODQA 1KP2A 4Q5IA 5DU2A 2OR3A 2JVKA 5EZQA 5K0CA 3UW3A 2IS2A 2DSTA 3TDMA 2OOSA 2WAYA 5JQGF 2EIXA 3KTAB 1YDHA 2WW8A 5AD1A 3DF9A 1SWWA 2FWBA 1CQPA 3GN2A 3LC2O 4MITA 4MRAA 5NLLA 4E33A 1NBHA 2BFBA 4FR0A 4EPXA 1US8B 4YMVA 4YRQA 1Y4UA 2OTCA 3SVZA 1EK5A 3VYWA 4WUVA 4X8LA 4RA9A 1GL9B 3VPBA 3NS7A 3FR8A 2V03A 4Q19A 5KS2A 3MT0A 2V7GA 1O5TA 3FWZA 3B5JA 5K3CA 3N2KA 3P2JA 4PLYA 2X86A 1X7GA 1XYVA 4D9EA 2PX3A 3FPLA 4HAZA 1GNPA 5E8JA 5LXTA 3VDQA 1NVEA 3IJPA 4AXXA 4RHCA 1NNI1 2NXNA 3DBVO 4TYPA 1N9GB 2W7TA 1G3UA 1Q1ZA 4LJ4A 1GQQA 2XTJA 3DTVD 5JAZA 3I5YA 4RVSA 4KGVA 4IJMA 1SU4A 2PKQP 4QYIA 5IARA 2XUFA 5HK8A 1Z45A 1Q2XA 1QS0A 2W2KA 1LTQA 1RXEA 3C3MA 3I1JA 3I5UA 3LSTA 3DEKA 3MRXA 4J16A 3V4LA 1E8DA 1ZR2A 4UFPA 1OZHA 2CT8A 5A02A 2EBHX 3WYNA 3UAWA 2PLAA 3AR3A 1ENOA 2XMCA 3CINA 3H2GA 3JYPA 2I1VB 4KX5A 3F46A 1OXXK 4DCUA 4IWYA 2ZBRA 1E5XA 4G36A 3UYKA 4Y1GA 1YJCA 1YR6A 3H2IA 3EPHA 2Q2VA 2YRWA 1F0YA 3QLEA 5AM0A 1NQTA 1GUAA 1IG0A 1TW2A 3GDGA 5BNFA 2EW8A 2FEPA 3ETJA 3L8CA 1ULHA 4HAIA 3UJ7A 4C0QC 4IFEA 1NVTA 2FTKE 4LYGA 4M88A 1FVXA 4Q3LA 3DEJA 4QTXA 3D8NA 1SBIA 4RJTA 2NU6B 2VJPA 1JDPA 4Q9HA 4PZCA 3W8EA 3WJAA 5LYYA 2ZU6A 4G25A 4BRWA 5K9ZA 4GMHA 1U7OA 3OSUA 1QGOA 3L6CA 4PAWA 5JNRA 1X9HA 2W9XA 1C8BA 2PRYA 3K1YA 4QD3A 4DUGA 3QPVA 5JV5A 3F5FA 3W6ZA 2ZRAA 3HJRA 4NPAA 3FGPA 1P4SA 1QE5A 4RVCA 5UKDA 1RYEA 3SS9X 1I32A 4M89A 1BFDA 4OYYA 3WGOA 2VDJA 1RRCA 1Y4SA 4FFMA 1PDWA 1NGSA 4YAKA 1KP3A 3OT5A 1ZD3A 1Z5NA 2HMSA 1D7OA 1GSOA 1I36A 4JH0A 4XGIA 4DNXA 2WHEA 4HRXA 2GRJA 4J1TC 4I46A 1V47A 3TMAA 5EYPB 1CJTC 1INLA 1E79A 3EDCA 4RCZA 1VPWA 1ACMA 2NMVA 3VV2A 3PWZA 2V7XA 3FMPB 3K92A 4YX9A 3ZBTA 3R5KA 4GRIA 4NF2A 2E2WA 4UPDA 4BQQA 2I03A 1OWMA 3ESAA 4KEAA 5HIKA 4F4DA 1WG8A 3KR1A 4IFBA 1DX9A 4OX9B 1IEWA 4L28A 5IT5A 1EFLA 4BYMA 1J8VA 1E1DA 2B2CA 2I2AA 3O84A 4M6WB 3BIOA 1WF3A 2OENG 5CDFE 1FB5A 2IXDA 2GEUA 4NU6A 3RRJA 3ACDA 4XIGS 3ITDA 2BM8A 3FPSA 3RANA 3KPYA 4G8DA 5JAUA 1VHTA 4N3AA 4PLFA 5IBPA 1DJLA 1FA9A 4WOKA 1RT9A 4YRZA 4FZ5A 3A6EA 4CKWA 1JYFA 2NU7B 3C3EA 4PW0A 5DNUA 4JFAA 4H4CA 4TZTA 4R5MA 1CG6A 4Z86A 2BHNA 1T4GA 2A59A 1X1EA 1WXQA 2WUEA 2XI4A 1V16B 2FPLA 3KPUA 4PONA 4QOEA 4C07A 3F3MA 3BE6A 3DMGA 3WLEA 4ZO7A 4H6XA 4IO0A 8ABPA 1NASA 1XC7A 2ZJZA 1PN3A 5HR5A 4CXMA 1XNQB 3BD7A 4BAGA 1YJQA 1YA6A 3FF4A 4HUQA 3FCCA 4EW6A 3OE7A 5FFMA 4X1YB 3QG1A 5TIIA 4HUTA 4OXIA 2YWBA 4Q39A 3WHPA 4FS3A 3DCYA 1Z0SA 2ATIA 1DRJA 3K35A 1Z7YA 4M9XA 4QBFA 3K0HA 2F9FA 1IUNA 3C1AA 3G1TA 4LYEA 1KYXA 4TROA 5AJUA 1GPMA 4ZZ3A 2E1PA 5A04A 5LZ9A 3UUFA 2YKGA 1W88A 4QDKA 3PKJA 4JI6B 1EDBA 3FYDA 1FUUA 3ITEA 1UZUA 2R6JA 4G4JA 3NJ4A 4FFBA 5EP1A 4LJ9A 3GBSA 1J22A 3CUTA 2Z8ZA 3X1ZA 4LC9A 3TMYA 1EFRA 1W1IA 4B7ZA 2D54A 4B09A 4CKEB 4E1VA 1SQGA 1FVHA 2ZR9A 2HOQA 5EMJA 3ROFA 1QIDA 1CVLA 1DMRA 1E2QA 1FX0A 4YIHA 3AIKA 4YACA 4FDLA 3SF0A 3IAFA 3W9UA 5L6LB 3QMPA 4ER0A 5BYKA 3MSXA 4J3NA 4JLPA 4HAUA 4BO7A 5IASA 3W2TA 1OAOC 1R10A 1MW8X 2B30A 1TM7E 1JNXX 3HA7A 1KEKA 2WSYB 2IYYA 3N2YA 5KTPA 1T10A 3I2JA 4U4AA 4A8JB 3BWXA 1X1RA 4R3UC 1BYUA 2RB5A 3L2OB 2BGUA 2O1SA 3C3KA 1T9DA 2W22A 3K30A 1NRWA 1JE1A 2Z08A 1APBA 1YZYA 4CU5A 2E5LB 2HA7A 2A5FA 4E94A 1GYQA 2OAP1 4QYWA 4YQYA 2QZ9A 4WN3A 4RSRA 3KKNA 3Q1KA 3F3KA 1YFKA 4YGXB 4DVGA 5IEJA 4DQDA 1AA6A 5L9AA 2Y1FA 4AB1A 3LDHA 4MWDA 4QU5A 1XTKA 1BRMA 2VJMA 2Q5HA 1IAQA 4PHTA 4MQFB 3GCZA 3TPFA 3FROA 1MT3A 2VH5R 2G77B 3ANLA 5JMWA 2PRZA 4IH9A 3BZBA 1ZH0A 2EF1A 4B5KA 2P6UA 3B85A 4JBNA 4BASA 2REXB 4BNFA 1G42A 1G3IA 1SHUX 4D02A 3GJYA 5ALYA 4MX8A 2D74A 3ESZA 3QQPA 3R5HA 5A5GA 1XCOA 3LQ4A 4AWBA 5KCMA 1QLJA 4A16A 3VH1A 1C7FA 2AWNA 2DKFA 1UINA 2YTZA 3N8IA 4TLEA 5TY0A 1RYYA 1HT1E 1QRUA 2OV2A 3OD5A 3EZ2A 4ZJYA 5DB4A 3TSWA 1FXUA 1BXRA 4B46A 2I2CA 3VTFA 1NRIA 3LVFO 2O1WA 3U44A 3EGOA 4YDQA 2XGJA 4JLKA 2A9OA 2H1SA 3JYQA 3UFXA 4YQZA 2D4HA 3WRYC 1OX4B 4PLGA 4QPJC 1U5BB 4E5YA 3L79A 3CLKA 2LUOA 1WE2A 2Z3VA 2ZQZA 2MWMA 4EYGA 2PMDA 4Z1MA 1PYOA 1ZH4A 3EXHA 3JQQA 3WNDA 4O4JF 3SEQA 2JLWA 1CW2B 4BNIA 4MUYA 3CO5A 3D02A 1FSSA 3A2NA 3H5RA 3HSKA 2NVBA 3SOZA 4QUGA 5H3LA 1TB4A 1VPEA 3ZD8A 3RF6A 1ORWA 4UUAA 2KM1A 3TB6A 3O90A 1QC5B 5ARDA 3WDLA 4BMNA 5I51A 4RVNA 2AF3C 4HLNA 5FHRA 5KNCD 2AYZA 4O4IB 1ZM3A 4QPNA 1SXQA 5T8KC 4EOGA 5JVDA 4WXYB 5J2UF 1YZTA 2G83A 3FOBA 2YOFA 3QEBZ 1Q84A 2HA3A 4BKRA 1EFTA 3JVEA 1LDGA 2AYXA 3LUHA 3EVDA 4R81A 5KHLB 4EKNB 3B89A 4G5XA 3TG2A 1B43A 4JHXA 4X97A 2ZRLA 4MEJA 4C6TB 4KNYA 3V1KA 2XRMA 1F2DA 4IJ6A 2Q6VA 3R5SA 4DILA 1NJFA 4EGAA 5LQJA 4NS4A 3CHYA 1MU0A 3O3OB 1EA5A 1UXGA 2VDOB 1AGYA 4LSZA 4UUMA 1EQUA 3SOPA 3JARA 1G64A 3LLCA 1L5GB 1EVIA 2HJGA 1AB5A 3EVNA 2YR0A 2ODEA 5HKBA 2P2SA 3GFVA 4ZAZA 1Z28A 3U7QA 2NAPA 5EVJA 1AZTA 3AESB 2O5VA 4FUTA 4L78A 1EK6A 2LD4A 4Q1BA 3T4PA 2NW6A 4PICA 1T3HA 3A6GA 1TZJA 3AU9A 2RCNA 5T6BA 3RSQA 4DXAA 4KPEC 2UXCB 1KFCB 4K2HA 4YQEA 5KWJA 1TFUA 3DJYA 1U04A 3T3OA 4HDKA 7MDHA 5KSZA 2ZVQX 2IWHA 2XMBA 5IX8A 3A2LA 1IOZA 1LXCA 3I3OA 4HH3C 5LP6A 1D2CA 1VLVA 3KKPA 3OKFA 3KOWA 5FA5A 3VU8A 3VKHA 1XMIA 2VF4X 1TD9A 1T8SA 5K8JB 2NVUA 2BFCB 2VP6A 3AM5A 4TKMA 3VR0A 1VKZA 5HKAA 4S1NA 5GJBA 1M1YB 1U2QA 1XJ5A 3TKYA 3WA7A 3OIYA 1SKUA 3OY7A 1D4ZA 1YMVA 2NLOA 4Q05A 4L85A 3KLBA 3FYTA 4J75A 2JD2A 1P1BA 5A1JA 5BWNA 1FJGB 1H65A 1VGQA 3MTIA 3O0DA 1PK8A 1T36A 4P3XA 5DZSA 1Z18A 2AT1A 4V0MA 4LBYA 3LBYA 4I19A 2AA3A 5CGQB 1BW9B 5E4YA 4FP9A 4CV0A 2UZ4A 1AIPA 1A8PA 1FNSA 1T29A 1RLMA 1BDBA 2QQEA 5TMBA 2QUJA 4IWNA 1ZGBA 3OJEA 4KI0A 2WUVA 2O7NA 2C5AA 3KVNA 4JVOA 4XD7A 2HLPA 1L8XA 3S27A 1HO3A 1UWKA 1R0YA 2VF7A 1YJ5A 1B1AA 4QRHA 2G0TA 3A1CA 1EFPB 5K0NA 5C4IA 1CQJA 1UFOA 2Q07A 1DXHA 4PLZA 4YYZA 2P9GA 2QMEA 5FTKA 4PX3A 4TL6A 2QSUA 4F6LA 2ZGVA 1YJXA 3RT7A 3QA9A 3LPLA 2FSIA 4ABTA 3DUWA 2O1EA 1U1EA 5DBEX 1XWIA 1JVNA 1R0CA 4O4HA 3SQMA 1XDGA 2RHOA 1ATIA 1DBRA 4DSOA 1R4NA 3AL0C 1SD2A 3RRBA 4HN4B 5F9FA 1FFSA 3OZVA 2OHFA 4L7VA 5A7FA 4S0ZA 2A92A 5DOZA 2DECA 1X7WB 4KXNA 2BFEA 3ELBA 1HFWA 1A2BA 2FQYA 2Y2UA 1X3SA 5CNKA 1MO5A 3KKMA 1ESDA 1IOLA 1TEHA 5E9QA 4I6EA 3VTAA 1JEDA 4M1QA 1Z06A 2A67A 4CBVA 3R74A 1ZVQA 1A8HA 1CF4A 2ZYTX 2HKIA 2PBRA 5DI3B 1G8MA 2IYFA 2GS9A 3OT1A 4WNYA 2IHTA 4LCEA 1UAGA 3ZWXA 5ITSA 1EAMA 1M0WA 4XB1A 2KBEA 1L6IA 4DL9A 1GGVA 3R7LA 4U9HS 5AICA 3OHSX 3ZLJA 1DHRA 3IPAA 1L7QA 4IICA 4ZOLB 1CJBA 1N6HA 3HDYA 5EPEA 5JXIA 1TC1A 3GLGA 1CFJA 1WEHA 1Q7BA 2F48A 5IK2A 3FSGD 1OZFA 1SO8A 1IHOA 4HLCA 4TVKA 4X0EA 3USES 5KTKA 2JLUA 1I33A 2REOA 4KBFA 4HN9A 2GBGA 3A10A 4G0WA 3QNMA 1T0JB 5H68A 3D6HA 3T3DA 2X15A 2YDYA 3H9UA 5L3VA 2H4FA 3IRVA 4P2BA 4F8JA 1QVWA 3QU9A 4ALMA 1AJEA 5KYWB 1VIDA 1OF1A 1Y1SA 2YWHA 3QX7A 4WERA 4PYJA 5CT4A 1RLTA 1REQA 1X2EA 3I2YX 5DGTA 3Q0IA 5BRJA 4RZHA 1TM4E 1HRDA 3PXUA 1P3Y1 4LC0A 5DRYA 4JLDA 5DHAA 4MA0A 1YQTA 4GM0A 2HHAA 4KRYA 1CULC 5HJ2A 1P1FA 3LRPA 4GQAA 3RSZA 1QYWA 2REBA 3AUYA 3RIMA 1Q15A 1ZUIA 4FDVA 4WNAA 4I7EA 3NCHA 3R7NA 2DX7A 2OV1A 1Q95A 3KWLA 3WLQA 4V1CA 2FE1A 4KQJA 4ZU6X 1PJBA 1SIBE 1YZ3A 1LPBB 4OQEA 2CHGA 4W5TA 5E3HA 2OO3A 3EJ6A 4RABA 1BHQ1 1SBCA 2I99A 3ZV3A 3A06A 1YDFA 4YB8A 4B43A 3EIEA 1JR3E 3LY5A 4BZPA 1F7VA 1ZIXA 1YB6A 5SZJA 3K6SB 4FLFA 1YS6A 2WSLA 5AI5A 4RK0A 4J0IA 4TLBA 1JZQA 4LZLA 2I2WA 1KR2A 3PLNA 3DGFC 4HGRA 3DV0B 2VP2A 1LV7A 4DJ5X 4F8EA 3ICWA 2Q46A 3ZHBA 1PF7E 1RXWA 4U8HA 5G4LA 5CFRA 1NURA 3FDZB 4P4UA 3IE1A 1KEZA 1IVSA 1YOBA 4HPXB 2ZI4A 4I9NA 2XQFA 2B8NA 1WY5A 1K6JA 2NZJA 2XT0A 2NAFA 4KXLA 2IS4A 2HQSA 4AQ7A 3WXMA 2P8SA 4QJIA 4O2BA 4A2QA 2H8GA 2OZEA 5ALKA 1PBNA 1XLWA 4IEIA 5ENVA 3REOA 1WBDA 4GPZA 1K7CA 3C39A 1VXRA 1P0MA 4G24A 2EP7A 3CPSA 4KVGA 1GQYA 1VHJA 2PUTA 2I9KA 4Q00A 1YOVB 1Z74A 3RODA 1D5CA 4ER6A 3L0ZA 6AT1A 3NP7A 5BV0A 5HW0A 4H0NA 1IUPA 2WJVA 4MUBA 3ZDAA 1B15A 3I5XA 4XJVA 1TQDA 3DMYA 4KN8A 3IMCA 3SEZA 5ILOA 2AOVA 1ZD8A 2FUG1 2I62A 4TQUS 2PAFA 2ZYHA 2GX6A 4J94A 4B47A 1J8QA 3UAOA 4A26A 5LP6F 3RIEA 3SP1A 1O89A 1H2FA 1F12A 4EPVA 4M0EA 4QSMA 1OFIA 3N6RA 3OTQA 5JDCC 1I6LA 4D41A 2AKAB 1DB3A 4FFNA 3JQAD 4DRXB 2J9FA 1QF9A 2QTCA 2ZSFA 4X8MA 1QIEA 1RWKA 2HPAA 1K06A 4DJAA 2XT6A 4BCDA 1LGYA 4WMLA 1HTBA 3DE0X 3ANNA 4YMTA 1GCIA 3LH5A 4YLGA 3H87A 1SIWA 1WQ4A 1GDDA 1PDVA 1M34E 4MVJD 3O9VA 2PL3A 1A5TA 3DDSA 2OHVA 2ZRKA 1W2WB 4MGKR 4HT3B 3UCXA 2V7WA 1YQEA 2DHRA 3VR2A 3JR3A 2YFKA 1FXWA 5JPDA 2XLCA 3OX3A 3JZDA 4ESVA 3EHEA 2H5LA 1J9GA 4DYDA 5EJMA 2TMYA 3W0LB 1QVZA 3O1JC 3PFNA 1A77A 3FRHA 2EFEB 5H59A 5U4QA 5ES4B 1HDZA 3A9WA 3PRHA 5JAOA 1BYIA 5KKNB 3THWA 3AL2A 3CLHA 3WV4A 2J4DA 1JLKA 2VRCA 2FMUA 2VAWA 3IQEA 1QGUA 4I5FA 5LNK1 1P19A 1E1RA 1E69A 3FYHA 1USUA 5J40A 4BX8A 1A04A 1KGSA 4GVPA 2NZVG 2YY6A 5B4TA 4HEJA 4IP0A 4O4HF 1WZIA 3EFOB 3C6KA 2VPZA 1L7XA 1Y8RB 4P3NA 1YZLA 2DPGA 4ROTA 1I6WA 2QNBA 4LGMA 4TUYF 2B8EA 1U98A 3ZK7A 2VJKA 3G9XA 4MKIA 4MVJP 3R7AA 4GKAA 1GZHB 5AJTA 4EMTA 3DL4A 3P5BA 3LV8A 1DIHA 2J6BA 4JBYA 5BVGB 4OA8A 1JSRA 3P9IA 4JZKA 3B70A 4UFNA 3RYTC 2I2XB 1AHPA 3I6ZA 3K94A 1DG3A 1B8UA 1Q0QA 5EWMA 3RKRA 3AB7A 1YCHA 1JH8A 1FSGA 3CW8X 5CX1B 1EVKA 4ONEA 4KFTA 4XD2A 2VLBA 1VG1A 4G89A 4N8DA 2C9YA 3NBZC 2BRUA 1ZM2A 5ALPA 5A6VA 5DYWA 4RNCA 1KI8A 3KJIA 4HGOA 2QYOA 4NMLA 5K3EA 2RARA 5CEFA 4BP8A 2NTVA 3EIFA 3EGWA 5IDVA 5K0TA 5HRCA 2AZXA 3H97A 3HLYA 3IULA 5E9JA 4Y2HA 3PFFA 4LDZA 1NQVA 3U31A 2O06A 3SF8A 5HUJA 1COWA 2PZBA 1ZS9A 2YQ4A 3VZRA 3B6KA 4Q7LA 2VKQA 3D54D 3IJRA 3T34A 4PZUA 3WAKA 4FINA 3FYSA 4UREA 4A2CA 3BTSA 3KZVA 4P32A 1J0DA 4AZ0B 3GZTB 3SFVA 3HVIA 4U5XA 1EHYA 4TS3A 3VPDA 2TRSB 5K8TA 4CDNA 2VA8A 2WJHA 4XFKA 3DEIA 5KO2A 3L0IB 1U0TA 2VHTA 1E2DA 4PGGA 1QHSA 5J1TB 1TA0A 2ZBVA 1ZJ4A 3OMXA 2BSQA 1E0SA 1WLYA 3VPSA 2JA1A 1PQPA 2PVSA 2AG6A 2XVXA 3BMQB 4BB0A 2ZYUX 5C1IA 4CQMD 2DETA 2PLFA 4HYYA 2YJ3A 2YZ7A 1RHKA 1DUSA 1P9RA 3HR8A 3KG2A 1HWYA 2F3PA 3VPHA 3QFRA 2NUTA 2DUNA 2D4AA 1HMPA 4CPDA 3L0YA 3TXYA 4HQLA 3VHQA 4DBLC 2HT1A 2R62A 4GL4A 1NW9B 5KYUB 1L4FA 1QAOA 2WWFA 3GOQA 3E84A 1X86B 2DTDA 4IZ6A 1V6SA 4RWEA 4W1SA 3MBOA 4BKOA 4BQNA 1UDBA 3A6DA 1GO2A 1OTYA 8OHMA 3SIXA 1XCBA 4D4IA 1YBFA 2R6FA 3TTTA 3KU1A 3CNNA 3A9RA 3M3HA 4I1SA 1DAGA 1ODIA 4GC5A 1XTTA 2B1QA 3MAJA 1KI1A 4PQEA 4JQZA 1CJMA 1PJCA 2R7LA 4P58A 1YR9A 3DBOB 1AN9A 2ZIVB 1TKBA 1EWVA 1OU4A 1PFYA 1Z5UA 1Z2AA 3TB4A 5K2OA 2GEJA 4YCAA 3M9LA 3R0ZA 3B7GA 4EHJA 5G0WA 1D2AA 3NHUA 4OAOA 3WHKA 3ZR4B 3LOUA 2QV0A 3V8EA 4M1SA 3A2KA 1JFVA 1JHOA 1TUBA 2FK7A 3F6EX 3FWPA 4MS3B 3R5TA 4PO9A 1P1HA 4UAGA 3TE6A 3W4IA 3NI2A 4NTZA 2PA0A 3TOCA 4ENQA 4Y9SA 3J7TA 1LQTA 2DQSA 3W1VA 2Y6UA 2ZIEA 1Y5RA 3BL6A 1D8TA 1CFZA 2P9ZA 4ETWA 2I1QA 3IALA 2O8FA 4M22A 2IH2A 2R47A 2PGDA 5KQSA 2WU0A 3SHWA 2RHRA 3GLHA 3GLGB 3BK2A 4B81A 3OP1A 4ZGGA 3DAPA 3E8XA 2X5JO 3OKPA 2OHJA 2I2DA 4XQ9A 5K45A 3GUCA 3PUIA 5FLYA 1P18A 4N0DA 4YBRA 1FDVA 3PKIA 3JYLA 2P3LA 1QNLA 3LAWA 3RGWS 3NDPA 1JZSA 1S3SA 2PS3A 1OXBB 2CLDX 1MAWA 1GZ4A 4B33A 1HYQA 2XGMA