3JYNA

Crystal structures of pseudomonas syringae pv. tomato dc3000 quinone oxidoreductase complexed with nadph
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
325
structure length
325
Chain Sequence
b'MAKRIQFSTVGGPEVLEYVDFEPEAPGPQAVVVRNKAIGLNFIDTYYRSGLYPAPFLPSGLGAEGAGVVEAVGDEVTRFKVGDRVAYGTGPLGAYSEVHVLPEANLVKLADSVSFEQAAALMLKGLTVQYLLRQTYQVKPGEIILFHAAAGGVGSLACQWAKALGAKLIGTVSSPEKAAHAKALGAWETIDYSHEDVAKRVLELTDGKKCPVVYDGVGQDTWLTSLDSVAPRGLVVSFGNASGPVSGVNLGILAQKDSVYVTRPTLGSYANNAQNLQTMADELFDMLASGKLKVDGIEQYALKDAAKAQIELSARRTTGSTILIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Quinone oxidoreductase
publication title Crystal structures of Pseudomonas syringae pv. tomato DC3000 quinone oxidoreductase and its complex with NADPH
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Oxidoreductase
total genus 104
structure length 325
sequence length 325
ec nomenclature ec 1.6.5.5: NADPH:quinone reductase.
pdb deposition date 2009-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3jynA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3jynA01
3E18A 4CLXA 3S2EA 3CMCO 4S1VA 2VCYA 1XIVA 4H3VA 4LGVA 1JA9A 4DRYA 1H9BA 3VH1A 2WE8A 3I1JA 1GL3A 4XR9A 5JY6A 4CMGA 3S8MA 1WW8A 3C7AA 3FCOA 4C7JA 4XQCA 3INRA 4QECA 3C24A 4FCCA 1U3WA 3RASA 4INAA 2OZPA 5JNLA 1AN9A 3HG7A 3MCVA 2QG4A 4IINA 2AW5A 2B4TO 2QZZA 4BNTA 1EE9A 4BHTA 1PGJA 3ZWYA 3IS3A 4JBGA 3RC2A 1KY4A 3QA9A 1B3BA 1PGOA 3RUDA 3WGHA 3G3EA 3NV9A 1LSJA 2BFOA 5JAMA 1BMDA 3FR7A 2YHIB 1A27A 4DIOA 1X15A 1LDNA 3NUGA 2GN9A 2YW9A 1BVRA 1M2WA 4NBWA 1VJ1A 2P9GA 1E1NA 3EDMA 2RAFA 4Q3DA 4EEXA 4FJ2A 4P8RA 1HL3A 3GG9A 1O9BA 2WMDA 4ALMA 3LF2A 4XGNA 3M2PA 3C1OA 3WYBA 2PK3A 3RUEA 5TC4A 1LSUA 2VOEA 4I5FA 4CM4B 3AU8A 1GR0A 1M67A 2NNLD 4RLSA 4CM8A 3NTQA 1NPTO 5JCXA 4B4VA 1PX0A 1LBEA 4CV3A 3L6EA 3RJ9A 2AQKA 3QVWA 4RF3A 4J43A 2W2KA 4DVJA 3WX0A 1RPNA 5BR7A 4YQZA 2GNAA 3TPCA 1QMGA 4XGKA 1K6XA 1B15A 4EDFA 3UOGA 2V6GA 4RV9A 2EHDA 4ND3A 3ZWWA 1MC4A 2AEJA 1BW9A 4A5OA 3HUDA 1ZMOA 2HSDA 2CUKA 4BUCA 2PZMA 2E48A 4YBZA 1SAYA 5A9TA 3E8XA 4I5GA 3TZQA 2NLOA 3GEGA 4Y8VA 3D0OA 1MG5A 4GAEA 3AY6A 2D5AA 4KDFA 1Y8QA 1DSSG 4IQ8A 1HYGA 4BNFA 2VN8A 3QY9A 2O3RA 1T2FA 4OH1A 2EEZA 3UFXA 4FGSA 1NQAO 4WKGA 2P9EA 4OGWA 3GGGA 1RM4A 3JD4A 5FF9A 3DC2A 3LT1A 4U5QA 2F00A 4IUYA 1Q7GA 3DZBA 2X9NA 3DO5A 4R51A 3I9LA 3GUCA 1P3DA 3HN2A 5JLAA 1FMCA 2A94A 3TRIA 4ZN6A 1PQUA 4CMIA 3KV3O 1ENOA 4ITUA 3K2BA 2OP1A 2PZJA 4H7PA 5EL0A 3U49A 2NVUB 2J3KA 2NTVA 1KBZA 1FDVA 5JBIA 2EJWA 2HUNA 2PKRA 3DBLB 4JQCA 2DC1A 1GEGA 4GX1A 4NMHA 4CQLA 2DT5A 3VPXA 2ZB4A 1AHHA 5AXAA 3DMTA 2C2YA 4N7RA 1B14A 4KTVE 5DF1A 1OOEA 3E1KA 4BO6A 4BO9A 3H5AA 1O0SA 5KKAA 4A0SA 2B5WA 2PD3A 4NBTA 4XYGA 3OA0A 4QUKA 1YB4A 4XQEA 4XD2A 2J5KA 1HDGO 4AJ4A 4BNWA 3DOOA 3I9MA 2IRWA 1KERA 5G0UA 1YQDA 3TQHA 1LDMA 2EF1A 5JE8A 3ROPA 3BMNB 1DJQA 4E12A 3GZ4A 2YDXA 1E3LA 4MP6A 2QYTA 2JCXA 3O03A 3TL2A 1R16A 4U7WA 3RFXA 2CMDA 2VNAA 1NHGA 1V0JA 4N5MA 3VHRA 1DAPA 1LX6A 3O8QA 2W2LD 2BELA 1U3VA 2XXJA 2C54A 4J2OA 4NK5A 8LDHA 2I5PO 2IXAA 1J49A 3NTOA 4A27A 4NH4A 1TVEA 3F5SA 1CERA 1BDBA 2OORA 1UDCA 4U6QA 1SOVA 2AQ8A 2ZB3A 2EERA 2WM3A 4FS3A 4TMFA 3I9NA 1EDZA 1NQOA 2Q4BA 4AJKA 3UXYA 3JQ7B 3JQFC 4K6FA 2YHUA 3NKLA 4KUEA 5IN4A 3B1JA 3Q0EA 3WGTA 2GLXA 4YB8A 3HB4X 2DVMA 1PJCA 2OL4A 3L4BC 4YJHA 5TGDA 3I83A 5KJ6A 2VUUA 2X5JO 3JD1A 2VQ3A 1YDEA 3I9JA 3RBVA 1LRJA 5EN4A 4ZHSA 3FSRA 1NFQA 5ITVA 4AJNA 4R1NA 2FY8A 1MV8A 4YJFA 4GPD1 4N5LA 4BO5A 4TQGA 5CFZA 1RKXA 3GZNB 3VVCA 1U1IA 2A4KA 3L4BA 4I9HA 3H9QA 4BOYA 4YYZA 4PG5A 4Q39A 1DC3A 5IG2A 4TVBA 3KETA 1QKIA 4K6CA 3PWZA 2Y1DA 4AJPA 4TRNA 3CEAA 5ITWA 3ZU5A 2FSVA 3L6OO 1E5LA 2NTNA 3GHHA 3MZ0A 4KDEA 2VRCD 3U4IA 2V7PA 1C0IA 1YJ8A 3VTFA 1ZMTA 2VHVA 1KETA 2DKNA 4HNGA 3WTBA 2O3SA 2CDBA 3R3SA 4QO7A 4YDRA 3KYCA 1WAMA 1X0VA 3GGPA 4BVAA 4IZIA 1PJBA 3DZFA 3H3FA 1U5AA 4E2ZA 4PG4A 4QQRA 4IGFA 3PGJA 5L3ZA 4WGGA 1DIAA 3RBXA 4OQZA 4PG6A 1BGVA 2Z95A 3HE3A 3JD3A 4I1IA 4E5NA 1KEWA 1EBFA 4IM7A 2X5OA 4UVDA 3MWEB 3GUYA 5DOVA 2EKPA 1NVMB 1QLHA 1ADFA 1DRVA 1QV7A 4CM6A 5IDQA 2ZYGA 3OJFA 2GN4A 2DTXA 3MOIA 3H2SA 3QSGA 3CMMA 3GVIA 2X23A 4M8SA 2JCYA 5HS4A 4A26A 1QXSA 2W8ZA 3OA2A 2VUTA 1IUKA 5KOIA 1P1IA 3JQGA 4OAQA 4RPHA 1GZ3A 1ARZA 1U4SA 2LDXA 4NBRA 5G0WA 3LQFA 3VPSA 4CM5A 5EQFA 3WSVA 4XWYA 2Y0DA 1PGPA 2X1HA 3UH1A 4LCJA 4TRMA 2DTEA 2YFQA 1RM3A 3QW2A 4UVHA 4BO7A 4GLLA 1I2CA 1E0DA 1K6IA 3DL2A 4E0BA 1SC6A 3OSUA 4DIBA 1TLTA 1XHLA 2CZCA 1A9ZA 1U28A 4NR0A 2AEFA 4XIYA 3TFQA 4CMHA 1XSEA 1VC2A 4PLYA 4J6FA 4E2WA 3DMYA 2R6JA 4HX5A 2HK9A 5DULA 3BHIA 4BNMA 5JXWA 1QG6A 1YGYA 2ZTLA 3ZNNA 1I01A 3GT0A 2IYOA 4J2HA 2UVDA 2C07A 4PZEA 1D7OA 1LXCA 4YJGA 2NVWA 3UCXA 2RH8A 3E82A 4CM8B 4CMEA 4EI2A 1R0SA 1Z75A 4M55A 4E4YA 4NJMA 3PZRA 3I3OA 4CR8A 4J0EA 3QWFA 4DTIA 4EUFA 1ZIDA 1Z74A 2GN8A 2HK7A 2PLAA 3OQBA 5JO9A 2QRJA 3ONFA 2GSDA 2ZTVA 4DWVA 5I7EA 5KJCA 3B1FA 3NGLA 4FBGA 1YKFA 3AM3A 4U6SA 4NFYA 1Z7EA 3IMFA 5IZCA 4J7XA 2G17A 4ZRMA 4XB1A 5CHEA 3O9ZA 5AXDA 6ADHA 4BGEA 2B4RO 3CTMA 4PZCA 3DFUA 3BMQB 3SC4A 4L4RA 4IMRA 4YRDA 4BQRA 3GA0A 5I7FA 3DZGA 3ZNOA 2YFHA 2C20A 3WBBA 3I6QA 2AG8A 3CE6A 1MB4A 2DTDA 2EIHA 4RF5A 3K96A 4RVFA 1DOHA 1OC4A 1T4BA 1HZJA 4RVSA 1V8BA 4L8VA 2NUAA 4IXTA 4LISA 2EJVA 1CQIA 1XA0A 1H93A 2ZK7A 2FRDA 2Y68A 1T24A 1TXGA 3SEFA 3KVOA 3DBRA 4KUGA 3DHNA 1LDYA 2QRLA 3JQAA 4UEJA 3U62A 4GSKA 4BNYA 2P5YA 1P74A 2D8AA 4NQZA 1KVQA 4FQ8A 5DBFA 1BXGA 4CMIB 3IIEA 1H6DA 3DFZA 4HNHA 4F6CA 2GZ2A 1VSUA 1XELA 1I3LA 1Y8RB 5HBRA 3TNLA 2WD7A 2AQHA 3HDHA 3JYNA 4OKNA 1J0XO 4TKLA 1E7RA 1R0KA 5G0TA 4CQLB 5JFOA 4IPTA 3HFGA 2P4QA 3FD8A 4XR4A 4Y6PA 3C7DB 5G2OA 4MJLA 2Q2QA 2ZYDA 3KSZO 5ILOA 4WE3A 1QSGA 5JW6A 1TT5B 3ZWMA 1XLTA 4E2YA 4GX2A 1A4IA 3OEWA 3AFNA 3OBBA 4Z6KA 4JXKA 3F6YA 5H82A 1P1FA 2WWRA 3CH6A 4CV1A 4L4XA 1OMOA 5L40A 1L1FA 1AXEA 3RKUA 4OYRA 4CM7A 3X2EA 4RZHA 3GC6A 1IZ0A 3KHUA 2VWGA 4ZICA 3AUSA 1NR1A 1MA0A 2Q46A 1E3IA 4JCOA 4P38A 3ZU4A 1R6DA 5FI5A 4IS3A 4DA9A 3ON5A 1HDCA 1V9LA 4ZQFA 2CVQA 3I6IA 4AFNA 1DB3A 2Z1NA 1QYDA 3W4IA 4NFHA 2IZZA 2Y0EA 2J6IA 3QIVA 2DM6A 3STHA 2HJSA 2PZLA 4PLGA 3MJTA 5C7IO 2QW8A 2EW8A 1WDMA 1D1SA 3Q6IA 4R1UA 5DP2A 1UZMA 3GDGA 3PLNA 1MX3A 4GGOA 3UHAA 4K26A 4YJHB 1PL6A 5G4KA 4EUHA 2UUPA 4Q3CA 4CUJA 4A2CA 1GYQA 1C1DB 1GQ2A 3VPGA 1Y9EA 3ANLA 3BMCB 1N2SA 4D0SA 1QYCA 2EWMA 3AUTA 4XDZA 3OFSA 2O3TA 3TZ6A 3PJGA 4OXNA 3OJ0A 3AUAA 3V5NA 4I9UA 4D42A 1PQPA 2DFDA 3Q9UA 4YRAA 5TT0A 1P0FA 2EGHA 2X7HA 4IQGA 5JSFA 3FPLA 3WIDA 3JQEA 3DHEA 4TRJA 2EG9A 3WSWA 3WWYA 1U9JA 5G4LA 2IZ1A 4BKRA 4WECA 1VJTA 1IHXA 4BKOA 2ZJ1A 3CXRA 2HMWA 3A28A 4CV2A 1A71A 2HMSA 3PIDA 3INTA 1YB5A 1ZSYA 2C5EA 1P0CA 1XGKA 3EHEA 3MTGA 4WLOA 5A9SB 2GZ1A 3KUXA 2CVOA 3ZWOA 1DFIA 3MJCA 3P2YA 4AL4A 3H9UA 3ICPA 4BO8A 1VE9A 1F06A 2VRBA 4RVDA 2GYYA 2JD2A 5G0SA 1KVSA 4XCVA 1UZNA 1Y1PA 4W9NC 5U9CA 4CJXA 4RJTA 1V3UA 1UP7A 2NQTA 4FGWA 4DIFA 1Q7BA 3ZWXA 1S6YA 3FHLA 4WLFA 3GN2A 3ROKA 3I5MA 1GCUA 3AUUA 3UF0A 2NU8A 3DQPA 4H16A 3S2FA 3TF5A 5I9LA 4DYVA 1NNUA 4WNIA 2WJPA 3ZCXA 3JQBC 2I3GA 1E6UA 2EXXA 4GI2A 2B69A 1I5RA 1NTOA 2V65A 3FWNA 5AXCA 1D1TA 4A7PA 1M76A 3H9EO 4B7XA 1MC5A 3FPCA 3ZWPA 5ER6A 4DBVO 3HB5X 1CIVA 1D3AA 2O7SA 1SEPA 3UVEA 3W6ZA 1P44A 3WNVA 2SCUA 2IEBA 5LCXA 1G0NA 3GEMA 3CIFA 4KTTE 5CDYA 4I5DA 3GDFA 2YV2A 2P91A 2AEMA 3D64A 3NDJA 1YE3A 4LSWA 1NX6A 3KBOA 1A72A 4RORA 3WWZA 4DREA 5EESA 3K92A 2VUSA 1P1KA 1PWXA 2I6TA 4F45A 2HMTA 3RFVA 1ONOA 5IZ4A 3QWHA 4W6ZA 5B37A 4R9RA 5HWSA 3U09A 2VHZA 1FDSA 2I99A 2CVZA 1D8AA 3RJ5A 5TJ9A 1XR3A 2CNBA 1TB4A 2WTBA 1RYEA 4RVGA 1C3VA 5BNTA 3L07A 1YONA 3V1UA 1UXHA 3F3SA 3KXDA 3SX2A 4G2NA 4PVDA 3HNPA 1H2HA 3D4NA 3RU7A 2D2IA 4NBUA 4BNKA 4XYLA 4YT4A 1NAIA 1UJMA 5B4UA 3AU9A 1DC6A 1GYRA 3KLPX 2VZ9A 1YRLA 2Y05A 1EQ2A 3ETEA 4CM3A 4PLFA 1PIWA 2X58A 2WYUA 3RUIA 2RIRA 4YQYA 3VZPA 4ND1A 4ZA2A 3VAZA 3PHJA 2JAPA 4F6LA 4MVJA 3LT0A 2UV8A 3ZWVA 3AFMA 2E4AA 3W6UA 3NGXA 4WEOA 3ZNQA 4YR9A 8ADHA 3JYPA 1O89A 3G49A 5A5EA 2D0IA 1K6JA 3E9NA 4D7AA 1PS9A 5TNXA 4BNUA 1PZHA 2DPHA 3K73O 1H6CA 2EW2A 2GF2A 1U2DA 4IDAA 1NR7A 3PEFA 5BSFA 4NHEA 4KQXA 2A9FA 4FPXA 1PGQA 1XQ6A 1LC3A 1ULUA 3UICA 4BO2A 1Y5RA 4PLVA 4D43A 4NU5A 1E6WA 3JQAB 1KC1A 3H6KA 3GNQA 3COSA 3FF4A 2HJRA 4BO0A 2Q1SA 1VRWA 4I8XA 1BXGB 1E6EA 4IIVA 3KSDO 1JTVA 2Z1MA 5A02A 5TLSA 1SB9A 1HKUA 4HP8A 1Q1NA 2EP5A 3BIOA 3RC9A 4YT2A 4CLRA 1RWBA 1OI7A 4R69A 4OM8A 4Z0PA 4DC0A 5TIIA 4J1NA 3ONEA 1TEHA 1V6AA 2R00C 4ALNA 4M49A 4DUPA 4ZRNA 4OL9A 1KEVA 3VVBA 3QRWA 4L73A 2GPTA 3WGQA 3L6DA 4NJOA 2GASA 4B79A 1PU2A 3KM0A 1X1EA 4MVJH 4EYEA 3U4HA 2IXBA 3QVTA 1SCUA 1HSZA 2BGLA 5K1SA 4R4JA 2OOSA 3GVXA 5KJ1A 2R00A 2UAGA 2OXIA 2PNFA 1MXFA 1IY8A 1ID1A 5IDWA 1YVEI 3HSKA 1O95A 2GO1A 1I3MA 3PXXA 1KC3A 5H83A 2F1KA 4BQPA 1CQJA 3PWSA 5TF4A 1LTHR 1UUFA 4QXMA 4MIEA 3P7MA 2C59A 1RJWA 3RSHA 3E9QA 3T4XA 4ZVVA 2P9CA 2NVBA 1FXSA 4J1TA 2BGMA 4CR7A 4E3ZA 1M6WA 3BAZA 2PKQO 4MKRA 5F5LA 4N18A 1ADBA 4E30A 1G6KA 4FOSA 2A35A 3JQAD 3JD0A 4IY1A 3H8VA 4WLEA 4ZQGA 3S2IA 3E6AA 4BGVA 4FD3A 2VYVD 5AXBA 1EFLA 3RUFA 4WOJA 5A03A 4ALKA 4CLOA 3WMXA 2Y93A 2BI8A 3B70A 5KIAA 1TT7A 4MKZA 3VOSA 3FR8A 5G4KB 3RWBA 4NNJA 1LLQA 1BHSA 1WZEA 2XOXA 5LDHA 1U8XX 3SJUA 5KKCA 2VTEA 1YBVA 3FNEA 2A92A 3EZLA 3GY0A 3S55A 4FN4A 2Q49A 4R54A 1WMAA 4TRRA 3HDYA 3DMTC 3BXXA 2CY0A 2JD0A 1DFGA 1R37A 5L4LA 3HFSA 2O4UX 1T2CA 3DZJA 3H65A 1LEHA 1EVZA 5AYVA 3B1KA 4QX6A 1JLLA 1XKQA 3PHLA 4KZPA 4YCAA 4A03A 3PHGA 3GHYA 4ALJA 1HYHA 4FSHA 1K2WA 1QV6A 4J4TA 5L51A 5ES3A 1YL6A 3QV1A 1R4MB 4FFPA 1T25A 3RUHA 1ZSNA 3X2FA 1ZEJA 1DPGA 3IL2A 2PH3A 1JKIA 4IJVA 1R12A 1B8UA 3ETDA 3QVXA 4L0QA 5L9AA 5JC1A 3I4CA 2FR0A 1YXMA 3AY3A 2R2GA 3H5NA 2Q4EA 1Q0HA 4OOFA 4BGIA 1VI2A 4JJGA 1NQ5A 3WQQA 3B6ZA 3GMDA 4K9DA 1I24A 3FNHA 4PFJA 3V2UA 1U8FO 2FZEA 5IF3A 5CPBA 1LI4A 3EK2A 2WYVA 2DUWA 2BD0A 4URFA 1FDUA 3K9QO 1F14A 1GU7A 1W0CA 4A73A 4CMJA 5DCYA 3U4DA 4D3FA 3JQ8A 1C1XA 3ONDA 5DN9A 3RI3A 1J6UA 1J5PA 4C4OA 3R6DA 3MWDB 1KY5A 4CUZA 3G79A 3QWAA 3D5TA 4DLAA 1ZXBA 3L4SO 1XCBA 2TMDA 4OOEA 3FBGA 3N74A 4JROA 2X86A 3TOXA 4RDHA 4DL9A 1KIFA 3A9WA 3GR6A 1ORRA 1ZZEA 4MPDA 4NDNE 3BHMA 4KWHA 2W4QA 3ICCA 3O38A 1HRDA 1PTJA 4MP3A 1CYDA 4Z9YA 1R66A 5I9NA 2YDYA 2UYYA 3GN1A 1LLUA 2B35A 3IP3A 3KZVA 4XZ3A 4YVFA 1UP4A 5F1OA 3F1LA 1Z6ZA 4WLUA 3PI7A 3OIDA 1LQUA 1DIGA 1PGNA 4NZ9A 1PWZA 3EZYA 2WDZA 4CL8A 4MIYA 5BSHA 1FF9A 4CLHA 4FR5A 2C7GA 1PS8A 3OQ6A 3I23A 3UN1A 4BO4A 2Q1TA 5CEJA 2PZKA 2FMUA 3LLVA 4BKQA 4RO0A 4FJ1A 1A9YA 3PJDA 5G0VA 2D1YA 1JDJA 3ENKA 3TFOA 2HAEA 4MVJE 1ISIA 1K5HA 2X6TA 5JYDA 4CMKA 3I9KA 3LSYA 1KS9A 5EPOA 2VYND 1VPDA 3ZZNA 4I08A 4YAIA 4OMUA 1M66A 3PK0A 4IMPA 4BNJA 3GPDG 4B4WA 3W8DA 5AOVA 4WCFA 2FPPA 4B3JA 3WLFA 1GQYA 1P9LA 1ENYA 1N9GB 2X4GA 3V1YA 5HA5A 3KEOA 3OIFA 2CDCA 3RKRA 3KOUA 3V1TC 4KOAA 1DLJA 5JMPA 1HE3A 3C8MA 4J1SA 2CSUA 3F4LA 4X54A 3NT4A 1CRWG 1I30A 2I9PA 4L4SA 3WJ7A 5JMWA 2AQIA 1GAEO 5B1YA 3H7AA 3NYWA 3DAGA 4IGEA 2AG5A 2PGJA 4B4UA 4B8WA 4K28A 1PS0A 2VOJA 3MEQA 3NJ4A 3ZN2A 2ZYAA 5JCJD 4J4HA 1ZBQA 4DQUA 2BFPA 3CKYA 1EBUA 1I2ZA 2YV3A 3A06A 1VL8A 3BTSA 1EZ4A 5K0ZA 1IE3A 4NBVA 1PSDA 1S7CA 3WGGA 4RQUA 4QT0A 2O3UA 4D44A 3ZWCA 1GZ6A 2DBRA 2J8ZA 5C5IA 1NXQA 3T7CA 3AI1A 4N54A 3RC1A 3JYOA 2FZWA 4GL4A 3B20A 2PFGA 4YA6A 2HK8A 1HSOA 3AOEA 5I9MA 4AJ2A 3IKVA 2W90A 2BFAA 4CMEC 1E3WA 4RCVA 4ALIA 3IJPA 2TMGA 1B0AA 1MFZA 4JJIA 1DXYA 3DOJA 5TQVA 3W8EA 1B3RA 4FC6A 2Q1UA 4DPMA 3SVTA 1C0KA 1BWSA 4IJKA 1GZ4A 4LW8A 5A3VA 1QYXA 3C3XA 3LC1O 2C29D 2OMEA 2H63A 1GUFA 3K5PA 4WJZA 5TSDA 2ZJ0A 3N58A 4WLVA 5IZCC 3PYXA 2FSSA 3V2HA 3DZKA 3E5RA 5KJEA 1XU7A 1VLLA 3PLRA 4IDDA 4LK3A 4K1LA 3LT4A 2AXQA 9LDTA 2W2KB 1DFHA 3PDJA 2GRAA 4DBZA 5K9ZA 1AXGA 3INGA 3N7UA 1GV1A 2YV1A 1SNYA 4BNHA 4YEDA 1JWAB 3QWIA 2JFGA 1IULA 5COBA 4CR6A 1OC2A 4CMBA 2J5RA 1UAGA 3BA1A 3WICA 4Y6RA 4I9NA 1F0YA 1BW9B 1H5QA 4NFSA 1P1JA 3H9JA 3WYEA 4DYDA 3BHJA 4W82A 2WE7A 4PVCA 3SBOA 3OMLA 1AGNA 1B8VA 4OQYA 5KVCA 1HEUA 4W7IA 1Y8QB 3AW9A 5HM8A 2DBVO 5BT9A 3AI2A 3DTTA 2DUUA 2O50A 4YJDA 2IYPA 1R4NA 5EINA 1Z45A 1R15A 3M2TA 1Z82A 4RPLA 5CDUA 1MG0A 3EYWA 3FTNA 1LU9A 3JV7A 4GMFA 1X1TA 4R1SA 5A5FA 3DBHA 1HDXA 4WLNA 4MDHA 1HTBA 4E5PA 1PR9A 4J0FA 1UR5A 1UXJA 2AA3A 2GZ3A 2PWZA 3L9XA 2HRBA 4EJ6A 7ADHA 1ZJZA 1HWYA 3VZSA 1EE2A 3LK7A 4HY3A 4CLEA 3ADPA 2VZ0A 2NV6A 2PKQP 2C5AA 3OH8A 4PLHA 4B3IA 2FP4A 1SMKA 3DTYA 3DZHA 5GY7A 1KEUA 3RCBA 4PG8A 2RHCA 3VDRA 1ZCJA 4MVJF 3QQPA 4R3NA 3M6IA 3Q2IA 4BKPA 3L0DA 3T4EA 3GOHA 3NEPX 3OECA 1WMBA 1B26A 3VH4A 3VZQA 5C7OO 3CINA 2C82A 1NVGA 2B5VA 3NAQA 2QYSA 4L74A 2D4AA 3LT2A 2CD9A 4ZQBA 3OHSX 3VC7A 2FWMX 3KLMX 5FYDA 1E3JA 1JU9A 3AI3A 2VT3A 3GPIA 1GCOA 2Y66A 3PYLA 4GMGA 3D1LA 3ZV4A 4MP8A 2JHGA 4MVJI 5A06A 2C2XA 3DHYA 4QEDA 1IOLA 4QTZA 3IDSA 4ND4A 5KJFA 3JQ9C 4JX8A 2Q99A 3PIIA 2G76A 3LF1A 1IB6A 3MOGA 1GYPA 3O8QB 2DBQA 1AUPA 1LLDA 2J3IA 1ONPA 2VHXA 4ONEA 5F21A 4B4OA 5T8KA 4BMNA 5KNLA 1G1AA 4RL6A 4XJTA 2BRUA 3JQ9A 5GMOA 1YQGA 4CPDA 3GK3A 2ILTA 1NWCA 1OZAA 4UEKA 1PZEA 1E1MA 1O94A 2ZCVA 1SPXA 5H81A 2QZ9A 3HDJA 3JD2A 4XRRA 4YAGA 2FR1A 2EV9A 4Y98A 1GTMA 1P1HA 3S2GA 4FC7A 3RUAA 3M1AA 1XYGA 2Q45A 1ZUD1 5DT9A 3H2ZA 1E1KA 2HQ1A 3DB2A 4NIMA 1V35A 4AJEA 4JBHA 1SEVA 1U3TA 2HMVA 4WEQA 3HJAA 4JN6B 4FIZA 4YJFB 4GH5A 1E92A 1UDAA 4JP3A 3ZV6A 4Z0HO 1ZKMA 3QVSA 2IEDA 1B2LA 1H6AA 1GPJA 4GLOA 3A1NA 1I10A 4JLWA 1WP4A 4AVYA 3D4OA 4JP2A 3AJRA 4LN1A 1N7HA 5FFFA 3LYLA 5T64A 2W2LA 2ZQYA 4GX0A 4YACA 4EW6A 1LA2A 4C7KA 3RAJA 3GAFA 4YAJA 3PHHA 1KVRA 1NP3A 3P2OA 3SLGA 2Q2VA 2NU6A 1YB1A 5JAIA 1FDTA 1T26A 2IDZA 4KP7A 3ZU2A 3GNSA 4UUMA 3ZU3A 2E82A 4LRTB 3KO8A 1RM0A 3T7EA 4D0RA 3KYCB 1LLCA 2RBEA 4O59O 2NADA 1E5QA 3DBLA 1C14A 5THKA 1H9AA 3FN4A 3VKVA 1HDOA 1WWKA 3M1LA 2O48X 2YJZA 3JQ6A 5BNIA 2BKAA 3OJLA 1K89A 1K3TA 3PFWO 4Y9DA 1YO6A 1VM6A 1PJSA 5BQFA 4KUHA 3AM4A 4II2A 2CF5A 1ZEMA 3GFGA 4FB5A 4UVGA 3ZW8A 2JFHA 3PPIA 2UUOA 4HWKA 3RU9A 2RHRA 3PP8A 4GX5A 5IXSA 1ISHA 3KSUA 1UDBA 1PQWA 2B83A 1YS4A 3BMNA 4LVUA 4IJWA 3JQGB 3VKUA 1IYZA 1HDZA 1UZLA 4L76A 5JDCA 2ZCUA 2VRCA 1DRUA 5KVSA 3IKTA 3PWKA 4D45A 1PZFA 4GWKA 5CG1A 2OGUA 1GV0A 3ADOA 3ZH2A 3K8ZA 3UUWA 3PZBA 5MDHA 1XDWA 4EBFA 3U4CA 3U3XA 1ISJA 4UULA 1Y5MA 1Q0QA 1W73A 5MGBA 9LDBA 4MVJP 1B7GO 1EMDA 1XEAA 3UCEA 3PTZA 4Q3BA 4Q9NA 1KVTA 3PYMA 3GQVA 4IQ0A 3JQ7A 1N7GA 1VJ0A 3ANMA 4HV4A 3QVOA 3SXPA 3GAZA 3C1TA 4FFRA 4LSMA 2V6MA 4ALLA 1BG6A 4JK3A 4TZTA 4AG3A 5CEFA 2C0CA 4YJGB 2GERA 2CF6A 4GBJA 2PGDA 2FPIA 3ZHZA 5C3MA 3EY4A 5B4VA 4NJMB 3F46A 1ZO8A 2C7VA 4MO2A 1HLDA 1NBOA 4XRGA 4JJFA 3Q3CA 2VWHA 1AE1A 1YBAA 3GZNA 1DBVO 2H5LA 3CZRA 3IAHA 1FJHA 1EUZA 4KWIA 3C85A 5COQA 5F5NA 3OETA 4IZHA 2X0RA 4EJ0A 3K6JA 2E6UX 3TSCA 4CM9A 2OUIA 3OEYA 1RYDA 2YQ4A 1LRKA 4M86A 5L7WA 1PEDA 1PL7A 2VHYA 1PJQA 4R1TA 1PZGA 3F4BA 4E32A 4HFRA 1Z73A 3OF2A 2H1SA 2PD6A 4QFDA 4HFMA 4CV0A 5I8WA 1ZSVA 4PIVA 1B8PA 3DXFA 5GZ6A 3GLQA 3ORFA 4RGBA 2GDZA 4EZBA 3CZMA 5JDIA 4ZGWA 3ZDFA 1T2AA 5CDTA 3DBRB 1U5CA 2NSDA 2H9IA 4II3A 1UXIA 2IZ0A 2Y99A 1DLIA 2P68A 1L7DA 4PLZA 3EUWA 5T67A 4IBOA 1CF2O 2JJYA 1I0ZA 1SBYA 4B7CA 5C37A 5K6AA 1OAAA 1SB8A 3FRJA 4Z0TA 4J3FA 3NDIA 1Q2XA 4E33A 2WD7B 2OBYA 3WQRA 3DAFA 2X9GA 4DLBA 5CG2A 1PJLA 1YJQA 2ZB7A 4RZIA 2BFMA 2J5QA 1GY8A 1T4DA 1KEPA 3K31A 3L77A 4XEHA 3RD5A 1XQ1A 1NYTA 3H5RA 2ZB8A 2JCVA 3NX4A 2HDHA 3R1IA 4MVJG 1WXDA 5L4NA 4ZQHA 4BMVA 2VT2A 3D3WA 3PJEA 3IP1A 1LNQA 2BMAA 4ZD6A 3WFIA 3RBZA 4ID9A 4Q3AA 4U0JA 3U9LA 1E7SA 4R68A 5IN5A 4BS9A 2HRZA 3PFFA 5TS3A 4MVJM 4BNIA 4CMAA 2E37A 1WLYA 2JKVA 4TVOA 1W4ZA 4XYMA 4H15A 4HBGA 4XX0A 4QFCA 1ZNQO 1TI7A 1WDKA 2FOIA 3AM5A 2DLDA 1OFGA 4NU6A 4FFOA 3IUSA 4GSLA 2BGKA 3HN7A 3ZV3A 5B12A 2UDPA 3JYLA 4YT5A 3FNFA 5B4TA 1CWUA 2OBNA 3FNGA 2BLLA 3BYZA 3RC7A 5TX7A 1B16A 2W98A 4RVHA 2IODA 4RDIA 1D4FA 1NM5A 1N1EA 3BMOA 4J49A 2AE1A 4HFNA 4O1MA 3UW3A 4UUOA 5CDGA 5IDXA 4HUJA 5ENVA 1ENPA 1ENZA 4XDYA 4B3HA 1NPDA 4NK4A 3K2EA 3O4RA 1M75A 1N5DA 4PLPA 4BNLA 1YL5A 3TJRA 5JYEA 2I67A 3ASVA 3VH3A 4OXYA 1L7EA 3UGKA 1HF3A 1A4UA 2P2SA 5GZ3A 5L7YA 3BZUA 3HDQA 3GF4A 3BMQA 3H3JA 1WPQA 4FDAA 2O3QA 3ANNA 5T5QA 1BRMA 1I36A 3EMKA 2BF7A 1EFKA 3KRTA 3DR3A 5DP1A 3WIEA 4O5OA 3OQ1A 3JTMA 3PVZA 4F46A 3VPHA 1U4OA 1YOVA 3MJEA 4NI5A 3LZ6A 3WYCA 5IAAA 2FHSA 5BNFA 2QHXA 3ZWNA 4RPGA 1J4AA 1NQTA 2J3HA 5AQ1A 3PQFA 3RVDA 4AJJA 5JAQA 4FFMA 3QWBA 3BTVA 4DPKA 2DBZA 4CQMA 3NDRA 3PDUA 5C7LO 4YT8A 4W4TA 4ZU3A 4RF2A 1E1LA 3VZRA 3WGZA 3R0IA 5CEEA 3WMWA 1Y8RA 1DO8A 1GADO 2OP0A 3E9MA 5I7VA 2NU9A 2I3AA 3D7LA 3G1UA 2JD1A 1ADGA 2JL1A 2X0JA 4YTEA 3WS7A 1H2BA 1EUCA 3AWDA 2Q50A 2P5UA 2CFCA 1GD1O 1NHWA 1X7GA 1X7HA 2XF8A 3IJRA 4NG5A 5EIOA 4BMSA 1HZZA 4BNGA 4E6PA 4E21A 1T2EA 5A3JA 1QYVA 1HT0A 1TT5A 4PZDA 2QX7A 3G0OA 1GUYA 2EP7A 1ZFNA 2Y1EA 4UUNA 4FW8A 3V8BA 5EJ2A 3WQSB 3TWOA 1MP0A 1GFSA 1P45A 1P1RA 3LC7O 2DQ4A 2WSBA 4O0LA 4Z3DA 4UVEA 3JSAA 1ZW1A 1SZJG 2OHXA 4GVXA 5EMHA 3Q9NA 3F47A 3QJ5A 2GCGA 1EK6A 5JPIA 7MDHA 1P31A 2PY6A 2DPGA 3QE3A 4M87A 3GG2A 1N8KA 1IZ9A 3ZV5A 4R01A 1AHIA 2BH9A 4QO8A 4DQXA 4J1QA 1Q0LA 3GEDA 3PQDA 4JGBA 3HZZA 5TT1A 3FWZA 5ICMA 5LC1A 4XYBA 2Y1GA 2O3JA 4MIOA 3E03A 2PD4A 1LDGA 4LRSB 1Z7BA 1X14A 5DBGA 5L4SA 1ZK0A 5THQA 1GPDG 4Y6SA 1JWBB 1LDBA 1NVTA 3WXBA 4AJLA 1DHTA 1HYEA 5ER9A 1EEHA 1I8TA 3NT5A 1EK5A 4HADA 1E7YA 5TRTA 5A9RA 2PGLA 4ND2A 3GVCA 4AJHA 3SLKA 1JAYA 3GGOA 1I3NA 2VNSA 4EGFA 4Q3NA 3PRJA 2Y1CA 5COAA 3F1KA 1C1DA 1ZJYA 2ET6A 2O2SA 4QSMA 3JQFA 4E5YA 4IDGA 4AICA 3DOCA 3BMCA 2X9VA 3NJ8A 2O23A 1N1GA 3KTDA 1KOLA 3UAGA 3CSDA 2X5KO 2NWQA 4E31A 1EQUA 4OXKA 4WCFC 3VDQA 1EVYA 1LSSA 4BV9A 4EJMA 4RF4A 1HETA 1N92A 1U2GA 5FEUA 4IDCA 3RFTA 4WCDA 1DC4A 4UAGA 1ISMA 4CL3A 4TZKA 1CDOA 1UP6A 3G1TA 4BKUA 1VSVA 1X13A 2YQ5A 3C7CB 4UUPA 1LC0A 2GGSA 2B0JA 1DAOA 2QQ5A 1ZK2A 3KYDA 3TOZA 4BNXA 1UXKA 2ZKLA 3JQDA 4RQTA 4GQAA 3JQCA 1CJCA 2WYWA 2YY7A 4DMLA 3KEQA 4RVUA 2ZQZA 1ONNA 3GRPA 5A9SA 3FI9A 4DPLA 1ZH8A 1C0PA 4ESOA 1NAHA 3WNQA 3QHAA 1BVUA 2JFFA 4PRLA 4IDBA 1ZK1A 4DC1A 1ZK3A 1W8DA 3U0BA 5DBIA 1T1SA 2HCTA 4G65A 3NTRA 3AOGA 5F1KA 4XYEA 5F3RA 2YYYA 4ZJUA 3ASUA 1HXHA 4U8GA 3AOEC 1A7AA 4DGSA 2FN7A 3DZIA 3ROQA 4BO1A 4CLRB 4P4NA 2AHRA 3BTOA 4BV8A 4XQGA 2FR8A 1VL6A 2DFVA 3ETGA 3WB9A 1YQXA 1F8GA 2NU7A 2RCYA 3OICA 3R3JA 4PLTA 3P5SA 2VHWA 2Z5LA 4J7CA 4D46A 4LMPA 3DBVO 4CMCA 1PJ4A 1I32A 1HDRA 3HQ4O 4L9RA 4UEOA 3G17A 5DNAA 5L7TA 3CUKA 4WPGA 1Y81A 1BDMA 3VPFA 3D3WB 4IS2A 1W6UA 5ENDA 2B37A 3VH2A 1LJ8A 5HS6A 4CM9D 1DHRA 1PL8A 3Q2KA 4I5EA 1FK8A 5A4DA 4MVJD 2EGGA 4L75A 1Y7TA 4O6VA 1YH3A 4R5MA 1Q7CA 4R16A 1ZXLA 3EVNA 4IIUA 4XA8A 2OO5A 3PJFA 3ROMA 1DIHA 3CPSA 4GKVA 4HXYA 3BTUA 4TKMA 4AJ1A 4DQVA 4E5MA 1EVJA 4YRBA 1NFRA 2VWPA 3TN7A 4PLCA 1E7WA 1DIRA 1WDLA 1PR3A 4IJUA 4LCEA 2B4QA 4ND5A 3TDKA 1LDEA 4FFNA 1HE5A 5BSEA 2X22A 2YUTA 4PN3A 1VL0A 3I4FA 5HTOA 4IXWA 3A4VA 1DJNA 1U3UA 2PA3A 3BMOB 1JKJA 2HMUA 2J3JA 5JS6A 1CEQA 2E49A 3VTZA 2EKLA 2Y1OA 4CLOB 3JYQA 4GKBA 4S3MA 4CUKA 5JC8A 3WDSA 2GR9A 2HLPA 3ST7A 5I8ZA 3RROA 4XKJA 2D3TA 1MXHA 4OO3A 3WOHA 1PJTA 1IHYA 2OFPA 3W4JA 1X7DA 5DDIP 5EQDA 1WZIA 1XU9A 4YAKA 3WGIA 2I76A 1JKFA 4PCVA 3KB6A 2GD1O 2NQ8A 1E3EA 5U1PA 4WOKA 4FOOA 3D3EA 2DAPA 3DDNA 3IOYA 4GWGA 5FWNA 1CETA 1GQQA 3GVPA 4OSOA 3P19A 3MTJA 3E5MA 1DC5A 1YOVB 1JQBA 2HKIA 2LDBA 4BB5A 4WASA 4J90A 1G0OA 4OKIA 1PJ3A 3UKOA 4JBIA 4OJNA 5LDGA 4BB6A 3WR5A 2VYVA 4CQMB 2Q2WA 4CM1A 4FFLA 4D3SA 3GH3A 4J7UA 4XGIA 3LVFO 3WLEA 1XWFA 5L45A 3AY7A 4O63O 1IL0A 5TJHA 3L9WA 3GDOA 1GEEA 4J9VA 4DLLA 4CLDA 1LUAA 4Z9XA 1QP8A 4M89A 4PRKA 2YHIA 5T8KC 4UREA 4PGFA 3WG9A 5DCWA 1SOWA 1Y9AA 4EEZA 3MJVA 4R3WA 1JW9B 1JVBA 5A1TA 1VKNA 1YBMA 4RPKA 4R41A 4BIIA 1UXGA 1H6BA 4DMMA 3C1AA 2FPGA 1WVGA 3JQ8B 1C1XB 2AE2A 2PTGA 3FBTA 3OJOA 4E2XA 3D5QA 3ZW9A 3ITKA 4CM4A 1IPFA 4YWJA 4CODB 1A7KA 4HKTA 2EKQA 4FJ0A 2Y0CA 3O26A 3TL3A 3LLSA 4BNZA 5CPFA 4XIJA 1R0LA 1C0LA 4XQ9A 2PV7A 4D41A 3V2GA 4B7UA 2P4HX 4J4BA 4IDFA 3ZHXA 1EUDA 1HDYA 3U5TA 1NFFA 3TZKA 3GFBA 3F9IA 4G81A 4WNCA 1JN0A 3E48A 1KYQA 2Q3EA 2WD8A 2ZIZA 5HRUA 1T1RA 2O4CA 4GGPA 4JIGA 4Q3EA 1XG5A 4R9SA 1LRLA 4DXHA 1EVIA 1ZVMA 3OJEA 2X0NA 3ENNA 3NT2A 3H9GA 4BGUA 4B8ZA 1NPYA 4CQMD 3EGOA 3OIGA 5FI3A 2PR2A 3LU1A 2PH5A 2JAHA 4JNKA 5BSGA 3DAPA 2G0TA 3K30A 3SC6A 1I3KA 1I2BA 2X0IA 1V3TA 1P77A 4YPOA 3LC2O 3ZWAA 2XXBA 1TA4A 2D5CA 5U4QA 1O5IA 5IXYA 1O6ZA 3GMSA 4WK6A 4PLWA 5CDSA 2QRKA 1T2DA 2G5CA 4J16A 4LVCA 4F3YA 1MFPA 1MGOA 4J91A 1FDWA 2ZTUA 1Y6JA 4YAEA 2CDAA 1HE2A 3WBFA 3EC7A 5DCUA 4TWRA 3NRCA 4BNNA 5ILGA 3MJ4A 1I33A 2BI7A 3FTPA 3OP4A 3EAGA 5KTKA 3WTCA 2NVUA 4NPCA 4U0KA 1EDOA 3AK4A 1UH5A 1E7QA 3EVTA 5DOZA 3WJAA 3JCZA 1F17A 2Q1WA 4IDEA 4LMRA 5A05A 1YL7A 2Y67A 1ISFA 1X0XA 1H94A 1QYWA 1KVUA 3KYDB 4WCFB 5A04A 5CAEA 3ZHBA 4OSPA 5EERA 5L53A 1WNTA 3DONA 4W7HA 4E13A 1UAYA 4P4LA 5IDYA 3IUPA 3RQSA 4ZQEA 1H0KA 1R4MA 2AMFA 5JDCC 2RH4A 1IPEA 2HO5A 4WUVA 4RPJA 5IFLA 3Q11A 1OBFO 3F5QA 3EW7A 3TZHA 3A14A 3W1VA 4AJIA 3GNTA 3WGOA 1O8CA 3GRKA 2O7QA 2G1UA 1F8FA 3ZI0A 3ZHYA 1ZK4A 4UVIA 1E77A 3WGYA 3OM9A 3PGXA 3UCFA 1DEHA 4MINA 1PJ2A 4W99A 4W9NA 4MKXA 2V6FA 3KYBA 4ILKA 3PHIA 1NWHA 1NASA 1HE4A 2X8LA 1ADCA 2VYNA 4EITA 2H6EA 4N5NA 1HLPA 2XPCA 4P22A 1DIBA 5JY1A 1P33A 2G82A 4YXFA 5L95A 4BO3A 3I9OA 1E3WB 1SO8A 5KVQA 2O2YA 1A5ZA 3RIHA 2VZ8A 4AJOA 2VWQA 1VKOA 2VTDA 1YDWA 3MJSA 3WFJA 5F1PA 5JO0A 1DRWA 1F12A 3JQBA 3QLJA 2HU2A 5AVOA 3RUCA 2I66A 4PG7A 1MUUA 4M1QA 4J9UE 1BXZA 3ITDA 3IQDB 5ICSA 3ULKA 1E7MA 5GZ1A 2GUGA 2NACA 2V6BA 3GVHA 5JAZA 1LSOA 5J23A 4P4GA 2I65A 2JHFA 1U7HA 3ZWBA 4Z3KA 1E3SA 4D79A 5JCJA 3HADA 2ZATA 3ABIA 1LQTA 1JVSA 1JAXA 3DEYX 1MLDA 2WEKA 2POQX 4OHUA 1QORA 4KMSA 4KQWA 3D4PA 5DZSA 1V3VA 5KVVA 5IJZA 1ULSA 5CP8A 3S1LA 4XB2A 2NM0A 1YWGO 4Z9FA 4R5HA 5JDIC 5KCZA 5T57A 3LDHA 1GUZA 1U7TA 4Y67A 2IE0A 3Q1LA 1QR6A 4A10A 4E5KA 3I52A 3ZGYA 1K0UA 3QP9A 4M54A 4D3DA 1BXKA 1ISGA 4EUEA 4MOWA 3TZCA 3W4KA 4BNVA 1ML3A 3W8FA 5I7SA 4TROA 3IC5A 2ZTMA 2QIOA 1GDHA 4ROSA 3H4VA 5ADHA 1DDOA 2GN6A 5T6BA 6LDHA 1QRRA 5K6AC 1R4NB 1BTOA 2B36A 2BHLA 2DU8A 3DWFA 1RM5A 4XJSA 4HFJA 4RLHA 3HWRA 4OIMA 2Y1FA 3DBHB 4TSKA 1BSVA 4GVLA 1N9GA 3SJ7A 2NTJA 1QLJA 3ZNPA 3PQEA 2XAAA 4BL5A 5KWEA 2D59A 1M6HA 4G5HA 2YZ7A 3HHPA
chains in the Genus database with same CATH superfamily
3E18A 4CLXA 1DKQA 3CMCO 3GJTA 1I4OA 4S1VA 1DEKA 1IK6A 4PPNA 5H80A 4BKMA 4E94A 4DRYA 1KYXA 2WE8A 3I1JA 3KHSA 3QKIA 4Q16A 5EWMB 1AMUA 2PV0A 2OYRA 2FP4B 3GBSA 1Y4AE 1YDFA 3AB3A 4UC0A 3FCOA 4C7JA 4P4UA 1OAOC 3IQHX 3INRA 4QECA 4YAWA 4MQBA 4LYFA 4CG0A 1KZ6A 3BAFA 1VLMA 3RASA 4INAA 1C4KA 1OKKD 4RENA 1PNVA 1FVOA 2K87A 4B0PA 1L5RA 4KQMA 4DUGA 3IMGA 1KOGA 3KKLA 5EE1A 3O94A 4UM9B 4ZYVA 4CGZA 2V58A 1T9HA 3DDHA 3O4HA 3UMGA 1C29B 2ZRMA 3N39C 4MZDA 1IAVA 5F35A 3B1YA 2QI9C 1X1SA 1W47A 2R96A 3ZWYA 1NF3A 3RC2A 5FUBA 4QEZA 3QA9A 4CHGA 2ZJOA 3RUDA 5JAMA 1NVUQ 3EPRA 2BFOA 1N2HA 4BDTA 5IC6A 4O1IA 2ZRQA 3NIFB 3GZJA 4FFSA 1HEIA 1IWOA 3PB3A 1LDNA 3EA0A 3NUGA 5JPDA 2YW9A 4S2EA 2VK2A 1N75A 1J39A 1NM5C 1VJ1A 4CHTA 4MKGA 4QOIA 4MGYR 3EDMA 1YB7A 4UXHA 2RAFA 4I6JA 2FWRA 2QDXA 4HSGA 4YWHA 2WZCA 1HL3A 4REOA 5H59A 5LQDA 1J8YF 2D5LA 3TTVA 4DDUA 3MW8A 5B3LA 2PK3A 3R5JA 2IV2X 5TC4A 1P4SA 2IXDA 3CX7A 3MAJA 4I5FA 4V3BA 2R5WA 4CM4B 3E1GA 3KDAA 5JCXA 3UXMA 3EXFB 3NTQA 3O92A 4B4VA 4FCWA 5GONF 2O19A 1PX0A 2O5VA 4ER3A 4PAQA 3L6EA 4A15A 2FG7C 1TIPA 4U9HS 4G1BA 5A4IS 3CV3A 4DWOA 4NWIA 5EJMA 3MJRA 4YQZA 3QVJA 1JYFA 5BR7A 1YVRA 3D2LA 3R44A 1YJBA 1OTXA 4AX4A 1WHSA 1GNRA 4HGQA 4XGKA 5K3FA 3TNJA 4EDFA 3UOGA 2I8AA 2G08A 4C2AA 1JH9A 2WJHA 5E2BA 1JX6A 3IODA 3CH5A 4PFQA 1CXZA 4UBKA 5FBLB 1P6QA 3HUDA 3ZTWA 2CVPA 1SUIA 3B7PA 1G7TA 1UBHS 2ADOA 1PEYA 2QMYA 4XJVA 1K5GA 3RVMA 2BTQA 3TZQA 1RQPA 1GPWB 3C6YA 2GEDA 3PGKA 4UM9D 3M5CA 4Y8VA 5A3QA 4F4CA 1VB3A 1X2BA 5JXHA 1XBTA 4RFSB 1OH7A 2JFOA 2W70A 1V26A 1EGVB 4ESVA 1G9TA 3N5CA 2JI4A 2ZSFA 3Q5GA 4BFSA 5M2QA 2D0OB 2I6XA 4OGWA 3JD4A 2RDMA 1E2BA 1M8FA 3LT1A 2OLJA 2IEIA 1OWLA 2WAOA 3N2GA 2ATXA 3AEXA 4IIJF 3DZBA 1DG1G 2ZIVB 5EXEA 2DLCX 1A2KC 2IK8A 4MGHA 5G3YA 4BCBA 1FMCA 5DO9A 4ZN6A 4FWBA 5DW0A 3BGDA 4TTQA 4IR7A 2JVIA 4UU0A 3IEIA 1N1DA 4ZVRA 3VOAA 5IXJA 3KZCA 4QM7A 3BSSA 1IJKA 1FDVA 3LRPA 3IAXA 2ZIWB 1Z2EA 3SKVA 3M9LA 3AILA 2WAAA 3MOSA 3RVJA 2HUNA 1WDTA 4JQCA 5FPYA 3MTDA 1C3OA 2G1KA 4MKHA 5ALMA 3WWOA 1EIZA 2ZUUA 4U2EA 4CQLA 3EULA 3JARB 4ABTA 1IHDA 3V00A 5CBPA 1AHHA 1KMMA 3DW1X 4DG5A 2ZIAA 5DF1A 1PYGA 1OOEA 3E1KA 4BO9A 3CVXA 2IU3A 2VHEA 4MJ7A 1FJXA 4RA6A 4UD6A 3I9V1 4OA8A 4IH1A 5DLQC 4RM3A 4KREA 2PD3A 3VYUB 1JJVA 4J0HA 2XH8A 1VHDA 3KZ1E 4NBTA 3IOBA 1GXSA 4L22A 4PNPA 1WXEA 1YB4A 4Y0NA 5ALRA 4D57A 2J5KA 1HDGO 3C3WA 2VVTA 4FGLA 4S1OA 4E6EA 1YQDA 1NMQA 4HNUA 4U2BA 5JE8A 4E1VA 3BMNB 3DT6A 4URZR 3D6MA 4EW2A 3S4YA 4Z5XA 1IM5A 3EXG2 3TL2A 2QQEA 3RFXA 1KE1A 1IG3A 3DO8A 2V3VA 1NHGA 4EHNA 4HLDA 2ZR8A 3RS8A 2R97A 3U31A 3G88A 3FHTA 1T36A 1DAPA 2Z2KA 3Q8XB 4C89A 2BELA 1U3VA 1TECE 4B46A 4J2OA 1EFTA 8LDHA 3U4QA 4TSRA 5K51A 5JANA 2AVDA 3ZLTA 4LGYA 2V7XA 5F9FA 3T41A 4XTRA 4C88A 2OORA 2XHZA 3MAGA 1V5EA 3CS3A 1T1IA 1KI6A 3NALA 3ZS9A 2QRVA 2VQSA 2EERA 4XPIA 1R2QA 3V9AA 1EFRA 1WEHA 2W7TA 2X2OA 4FUTA 3T61A 3PT9A 1U6JA 1OASA 1I1NA 3CCCA 4KI7A 1M2FA 2VYCA 3KEMA 3B1JA 1UXOA 4ZRDA 5IN4A 2Z57A 4U2KA 3Q0EA 3WGTA 1VYTA 2GLXA 1NNEA 1GT91 1ZD5A 1Q20A 3I83A 2X5JO 2WPDD 4OB8A 1U2GC 5JQWA 2JS7A 1YDEA 2XVZA 3I9JA 2X0FA 7MHTA 4FP9A 4ZYXA 5ITVA 1Y63A 4AJNA 1AF7A 2FY8A 1IBLB 1V6SA 2IXTA 4TQGA 3Q8WA 3H1TA 3KNZA 5FUMA 3T5PA 2AV6A 4FFWA 4Y1RA 3VVCA 5JD4A 2NYRA 3LHDA 4NNPA 5EPEA 5LMCA 2ZIFA 3H9QA 1D2AA 4NAUA 1AVTA 2JFVA 4R0VA 4TL6A 4TLMB 3QEAZ 1DC3A 3LOUA 2RD2A 3GRCA 2XYPA 3AHJA 3P45A 4TTSA 3DFKA 4W6QA 5CB0A 1OB2A 1SU4A 4TRNA 4HGRA 3K09C 2FPSA 1E5LA 3GHHA 4KFCA 3BD9A 4KDEA 3LBFA 4QOGA 4LDZA 1J23A 5GOZA 1JR3E 1Z0IA 4RGQA 1EX6A 1C0IA 2R1UA 3KL4A 4TMTA 4ZKEA 2XQGA 4BX9A 1UWCA 3AZPA 3GLKA 5CD9A 4HJXA 1KZHA 2VHVA 4X24A 1ZICA 2DKNA 3WDMA 4G0YA 3EWIA 1Z62A 1M2EA 2I2BA 3TD6A 5BR1A 1DL5A 2XGOA 2XUFA 4K9QA 4Q9DA 2V7VA 1R5JA 4QO7A 4BFVA 5CH8A 3KYCA 2PL1A 3CT4A 1H2EA 2CXTA 4YLYA 3B7GA 4PSUA 4F93B 2NXEA 3FFWA 3H3FA 1U5AA 4LI0A 3D3JA 2Y4NA 2VDRB 4F97A 2L2QA 2FR8C 3AHHA 4X85A 4WGGA 2PCJA 3MLBA 4PG6A 1D04A 1QFYA 1WU8A 1WUIS 3QUAA 4I0WB 2ZEJA 4QBFA 1GG2A 1KEWA 3CUWA 1NBME 4IM7A 4Y9SA 2X5OA 1B4DA 3PQ7A 5G1OA 2IU4A 3TEJA 1NVMB 1KJQA 1ADFA 1TQHA 4ZT7A 1Q11A 4FMCB 1PTKA 4D8VA 4L3WA 1YGPA 2DTXA 2H2FA 2V7EA 4NCAA 3H2SA 1XTJA 2EF0A 2JFXA 4M46A 4D26A 5CA0B 5JSHA 2I4IA 4Q6WA 4ZYZA 5HS4A 2JCSA 1QXSA 2DY1A 4JC8A 1U3DA 2W8ZA 3Q0TA 3RLIA 4DV2B 1QGDA 3G9XA 3DM9B 1SM4A 2FK7A 4PGAA 1IG0A 3MWKA 3LQFA 3IEUA 3O31A 5JSQA 4KXWA 5JBNA 3UH1A 4Y7DA 3H7IA 1IEQA 4XE5A 4IP0A 1W4RA 16PKA 2HWYA 2ON6A 4B48A 2DTEA 4HATA 4LHXA 1FTWA 1RM3A 5FR1A 3T7JA 4EMSA 4UVHA 3HU3A 3O1JC 3L79A 3CEJA 3M9XA 1K6IA 2AI2A 1C7IA 3WIVA 4E0BA 5KQRA 1Z5VA 1U0NA 3D2AA 1Y80A 2BBOA 5FUVA 1A9ZA 5ESDA 2AEFA 4MVCA 2YZGA 1VG0B 1XSEA 1Y9DA 4U7GA 1ISSA 3K0EA 4Z1OA 3DMYA 5CT5A 2HV9A 3TQIA 4CCAA 3QELB 3BHIA 1OFUA 1S7GA 4MJ3A 4HT3B 3RU3A 1GZ7A 1CJUC 1K92A 4FMDB 4H7IA 1YGYA 1C4OA 2ODNA 1C81A 1GLNA 4HGNA 4LS3A 3R23A 1G5QA 4XLLA 2C7OA 1G19A 1XK6A 3RK0A 2GEKA 3ESQA 1IONA 5C4IA 4MW0A 3GT0A 4E7PA 4B3RB 3N2KB 3R7BA 3M5DA 4LOKA 4YJGA 2OENG 3UWPA 2RH8A 3E82A 2BAGA 4CMEA 1QJCA 2OBFA 2HU5A 4WIAA 3VR3D 1Z75A 1NI4A 1N2ZA 1WXGA 3PZRA 2QZPA 3I3OA 1HBJA 5ALSA 4CR8A 3NG1A 1TKBA 3NJRA 3WLAA 4XFDA 3HXTA 2IEGA 1Z74A 2PS3A 4KPYA 1N2CA 2PLAA 3K20A 3OQBA 3RPEA 1VECA 5KJCA 5FADA 5LMZA 3NGLA 1XA4A 3TVDA 3TVYA 2CMKA 1JHZA 4F84A 3I1YA 1Z7EA 1FU4A 1OLXB 2PAAA 2WHQA 2D8MA 4G85A 2G17A 2V97A 1T8YA 5LZ5A 1XVVA 1ZI6A 4YO8A 4BGEA 2R4QA 2OXCA 2B4RO 2QLTA 3OOEA 2NUTA 3ZCPA 4PZCA 3UHJA 3PUKA 3BMQB 3SC4A 1WY7A 1U7PA 5I7FA 5E9AA 1GFZA 2JAOA 3H18A 5C5CA 4MWCA 4BWGA 2YFHA 1EP2B 2C20A 2QMOA 4IKOA 1SR8A 3AR8A 3G0HA 2AG8A 4CKWB 2DTDA 2FFRA 3O5AA 3SVLA 4G09A 1N2GA 3P0EA 4RHYA 2EW1A 1T4BA 5DHQA 5CLJA 2EZ9A 1V8BA 1MJFA 2NUAA 3EGDA 2J9YB 4L8VA 2Z6QA 3PC2A 5JHGB 1NF8A 1EWVA 2D5IA 3VYTB 4RXUA 1J8DA 2AWNA 3REGA 3S70A 3C4VA 3ER9A 2DPYA 3OZSA 4WXMA 2QRLA 2ZI4A 4BNYA 1AQLA 5AK4A 4JT8A 3FPBA 1JHAA 2D8AA 4OP3A 1E9DA 5C5EA 1KI9A 1DOZA 3NBXX 4FQ8A 5EJAA 1NMEA 4UPVA 5EHIA 3KJFA 3SZLA 3EFOB 4MRPA 5A62A 1Z2PX 4HNHA 4CT5A 4CETA 3E4CA 1H2YA 1K5PA 4LTNA 4JL5A 2GZ2A 4DSAA 1I3LA 1GG8A 2WD7A 4ABYA 3JYNA 3EG9B 5BOSA 1VBKA 2NU9B 1QK3A 4MCAA 2O7RA 4DUYB 4JBYA 2P4QA 3FD8A 2IWHA 2JHAA 1EUCB 3H1EA 1DZ3A 4PBTA 3LFTA 4IG9A 5EYPA 1E1YA 3NBZC 3UMFA 1GUBA 1NIPA 1OVMA 2FNAA 4UFNA 5ILOA 3RADC 4NENB 4K9NA 2I34A 4BU0A 4WE3A 2VI5A 4U63A 3AY0A 1FQOA 5JW6A 1TT5B 1Y42X 2Q7XA 3K0SA 5LKAA 1YVDA 4TZ6A 4YH1A 2V9ZA 4HR7A 1A4IA 3OEWA 3QKRA 4O33A 4Y7CA 5IKPA 5B1IA 4JXKA 1CUFA 1E2PA 3K6KA 2VPXA 1AB6A 3EOZA 2Q5LA 3KEGA 5HK9A 1GPUA 2WWRA 2FEAA 2LXNA 3G2KA 4N5DA 3CH6A 3STTA 3VR2D 1JHXA 1H66A 1ODFA 4DR7B 3DEKA 2IEYA 4ERNA 2A86A 5F3WB 4KMRA 1L1FA 3RS3A 3AF1A 2DQSA 4OYRA 1ZD4A 4NDAA 2H1CA 5B1SA 4CNQA 1MHTA 2WM2A 1UJ4A 3G6KA 3LTNC 1MPTA 4LJ5A 3AUSA 3MQFA 2WB2A 1RQ7A 3SQLA 1E1DA 1MA0A 2H59A 2I2AA 4QG7A 2WJAA 1VSTA 1C4XA 5F7JA 1RXIA 5ALFA 1EXDA 2NT4A 1QHHB 5HJEA 3ZU4A 5FI5A 4EVQA 1QVRA 3TPFA 1CJVC 2WYHA 3ON5A 1HDCA 1Z39A 4IUDS 4C6TB 4G9EA 7ABPA 3NTLA 2BFCA 5B2EA 2DMRA 4ZQFA 1PUXA 1DB3A 1Z29A 1N36B 1AK2A 1QYDA 2I2CA 3LGAA 3N59A 3EXG1 5ALDA 2IU6A 3CJQA 3BFPA 1NU8A 1P6UA 2VH2A 3HEAA 3ED5A 4KQCA 2DM6A 2ABWA 2XUAA 4FFVA 4P4SA 4MW7A 4AMGA 1CLUA 1YHZA 4FONA 2YRWA 1MR3F 5CXQA 1UKCA 2PVCA 3Q5DA 1S2MA 4OQLA 1GZ5A 1TZMA 1WDMA 3PQ2A 4ZOEA 3RVQA 4ROTA 5HZKA 3DNFA 4RDCA 2PUAA 1NUTA 2QI9F 2XKBA 1EZ1A 4GGOA 4YCMA 2BY4A 2Q6LA 4H31A 3RARA 3ZEIA 1NVXQ 2C5BA 1YB2A 3HJHA 5I3CA 3ECAA 4Q3CA 1ZKDA 2GEFA 4CUJA 4A2CA 2HA2A 4JMPA 3T5BA 3MNFA 2B3TA 2VYFA 1KTVA 1FFAA 1N2SA 3A1TA 5ALHA 5B64A 5EUMA 4D0SA 2EWMA 3UWMA 1YRHA 3L0CA 1QUEA 1L6IA 2N46A 4OXNA 3AUAA 2ZBQA 2OKCA 1ATZA 1QHYA 1PQPA 4HDSA 3TR5A 3V5NA 2JFWA 4D42A 4DMCA 1Q1QA 5BN3B 1MC8A 1T1GA 3FPLA 3GFPA 1JMKC 1LJLA 3SQNA 3WWYA 5SICE 1FP4A 1THZA 2BVNA 4BKRA 3N0XA 4WECA 1FW6A 4O3FA 2PFKA 4LNUA 1LX7A 4BKOA 4C4RA 2ZJ1A 1G42A 2AX4A 3T5TA 5DSZA 4EKNB 1TK2A 1V4NA 1SBHA 4LHZA 2JVKA 1F1BA 3B1ZA 1YB5A 2XE7A 2OXTA 3MWGA 3TTUA 3ZY6A 1KH3A 1KH2A 1T6ZA 2ZANA 4J0GA 2QY6A 1RI2A 3EHEA 5DBOA 1OX4B 3T6KA 2AUTA 3ETJA 4MYHA 4WLOA 5JRJA 3CUEF 4FKBA 2ZS9A 2WFAA 5IH3A 4HO1X 3MJCA 3HMKA 3ICPA 1X7XB 1EVEA 1B2RA 1VE9A 4XD7D 1SH7A 3SHFA 2WINI 1FNBA 5DIFA 3VC3A 2IOFA 3DV2A 3JASB 1IN1A 2JD2A 4JP1A 3RRJA 5FI0B 4R1MA 4XCVA 1UZNA 2CXXA 2EGUA 3PNBA 5I4BA 4W9NC 3TCNA 3UJHA 4C5CA 2GCEA 1S2NA 1WQ1R 4A8JA 4CJXA 2C57A 2IYNA 2M6RA 4DIFA 3C39A 4AO8A 5A0VA 2CV0A 1E1CB 1KARA 3GN2A 2NOAA 1BVYF 4C0SA 1UBGA 1XK7A 2I80A 1GCUA 3QKSA 1H0SA 2MMCA 3IIMA 2YJ3A 3O95A 5ISMA 3DQPA 4L4ZA 3T5DA 4F2DA 4JYZA 1LVHA 4JJAA 1YUNA 3ZS8A 5BSRA 2BJHA 5AVWA 1MAHA 1YS6A 2NU7B 5CJPA 3HCPA 4P6VF 4GI2A 4CI9A 1LPOA 1FFCA 2B69A 1I5RA 1MORA 2GKSA 3IVMA 2CNWD 4RKQA 1XDBA 1YK1A 4A7PA 1M76A 1QIEA 4HAUA 4B7XA 4DQ0A 2ZREA 5I9SA 3ANSA 4COKA 2L18A 3VUEA 3ZLVA 1U8CB 4HLNA 3ZUGA 3HB5X 1K66A 1SEPA 4OHRA 2IXFA 1P44A 5LA6A 5SV2A 3TDMA 1RWWA 5L3SB 3RRNA 4CIAA 2B2XA 3CIFA 3I58A 3VYWA 4YMLA 4JKOA 1L5HB 4RJJA 2HBZA 1RIFA 4MW9A 4A0QA 3O8CA 1DJOA 2ZBEA 2P91A 2AEMA 4DV1B 1FDIA 3HVKA 1QS0A 1YE3A 4DEYA 2XKKA 1UJCA 1A72A 2QTVB 4DREA 2I2DA 4MKIA 4M76B 2VHTA 4Q00A 2CUZA 2DT8A 4RVNA 4EI9A 4F8JA 1P1KA 1A82A 4F3NA 5ERXA 2BOVA 3O1LA 4X8OA 1DEAA 1ZIOA 4FNMA 5AHWA 3RFVA 4C08A 4F45A 3A6FA 1U80A 3QWHA 4RKWA 3ENZA 4R9RA 5B37A 1ODLA 5BSUA 3U09A 1KH1A 1Y1TA 4F2GA 1KY3A 2ZXFA 5G3ZA 5IAOA 1OWNA 2QRHA 3NAGA 5B6JA 1TJ3A 4QEKA 4MA5A 5HQ3B 3HRKA 4W5OA 3E9RA 3U61B 1VTKA 4OX9Y 2G6BA 1N2CE 2H4XA 4R8VA 1REQA 1C80A 3TOCA 1K75A 5SY9A 3BD7A 4QHSA 4U7DA 4KWEA 2ORIA 2VQEB 4PVDA 3HNPA 3CSUA 2ZM6B 3OQMA 3H2JA 2IY9A 3D4NA 2A33A 4NBUA 4Q7JB 2ZTSA 5FNVA 2M9MA 2YWDA 3SK0A 4BFUA 3QTLA 1DC6A 1DT3A 1DC8A 3HRIA 1HKHA 5B4UA 1XDSA 1AURA 2IQIA 1H1LA 5AVTA 1K97A 4WASA 1EQ2A 1YSCA 2HHJA 4NJEB 4F8EA 3TKLA 1ZA2A 2WYUA 2RBGA 4YQYA 1HYQA 2BGUA 3AIKA 3VAZA 3AR4A 1E79D 2JAPA 2O14A 4B8YA 3SVZA 3ANTA 3K0BA 3LT0A 3W8NA 5JZVA 2J5XA 1VL1A 1DBSA 1JJ7A 2QSYA 4GM1A 2XX3A 3CLTC 4FINA 4ZI7F 4ZAGA 3Q7RA 8ADHA 3AP1A 1FRNA 4RMJA 3JWHA 1CS4C 2RIPA 5FTKA 2XZOA 3BIWA 5B2FA 3C6KA 2V4ZA 3E9NA 1PS9A 1GAJA 2X8BA 4NZYA 1PZHA 3KQWA 2XYHA 2DPHA 3K73O 3PUVA 5EZYF 5A4FS 1JG3A 2GF2A 3R0JA 1U3CA 5L8VA 2YJGA 4IDAA 1GZVA 1BN6A 2G9QA 1L6RA 3PEFA 3KB8A 4ZT4A 1Q1EA 2H4YA 3LC0A 3MILA 3CZPA 5BT8A 5ITSA 1XQ6A 2H7VA 1JSCA 2IGBA 3WLSA 4GD3Q 2H1IA 5AI6A 3UICA 1OHHD 5J4LA 5J4VA 1AKTA 3WLNA 1XCOA 1V7PC 2R84A 2Y0PA 2HJRA 5BQOA 4BO0A 1T8TA 5CFQA 1GTVA 1VRWA 4G25A 1EHIA 4IUBS 1E6EA 4IIVA 5DH9A 3O90A 4HLUC 1X7WB 4EDHA 1SB9A 1HKUA 3SJCA 4HP8A 4L4YA 1FYVA 4OM8A 1S01A 1AO3A 4EW3A 4A0RA 1POXA 4K2AA 1TEHA 3OE7D 1KBOA 3AEKB 1V6AA 4H7EA 1JIVA 3SCZA 5FBQB 1KXZA 3F49S 3RANA 3JAKA 1BYUA 2HADA 3N28A 5HFAA 3ERCA 1MQ8B 3L0OA 3QRWA 4JYBA 2X2FA 3UK0A 5B36A 2ZI5A 3DT8A 3GJ4A 3KM0A 4DJAA 2ZBRA 1KORA 1L4GA 1X1EA 5K6TA 3TLCA 2IXBA 3E9ZA 1SCUA 4E88A 1IBRA 2BGLA 1J20A 2XB9A 2YIJA 5DTMA 3GVXA 3E2IA 3CLRC 1FP1D 4Y9RA 3GJYA 5KJ1A 2R00A 3R7FA 2UAGA 1ETHA 2BCGY 2VP5A 2OXIA 1MXFA 3SEZA 2W42A 2BEVB 2OECA 2GAAA 1YVEI 3HSKA 2GO1A 1I3MA 1S3FA 1LQ2A 1Z08A 5FL7D 5JWHA 4PYKA 4DR3B 2F1KA 3DCYA 4B40A 1KK3A 5HQJA 3PWSA 5BXQC 1I4LD 2YASA 4XX1A 2BUAA 3TXXA 2HSGA 4Q24A 1M8KA 2WWWA 3ZXUB 3P7MA 4MUXA 5AICA 4DCGA 4D82A 1EWQA 1KRXA 2IBTA 3RSHA 5DTQA 4GWLA 1UEIA 3T4XA 4I14A 1FXSA 4JT9A 1V4BA 2REXB 3HUEA 2V55B 2JAUA 1P7YA 5AIAA 3KQUA 4BJHB 1M6WA 1MHPA 3KXKA 3BAZA 2PKQO 4MKRA 5LM3A 2DUMA 1CK4A 1R00A 1NJFA 1T3GA 3DEJA 1EFCA 3CNQS 3ZI7A 5DLDA 3EXHB 4E30A 1AQIA 3GT4A 4A8HA 5IYZB 3IAUA 3QNUA 1PL0A 3R24A 4Z0NA 2V5AA 4ZCIA 1E2QA 1H9CA 2CWDA 4NX2A 3MSXA 3M6MD 1QB7A 1KXJA 3OTHA 3G8BA 4FD3A 4KK3A 3JR3A 2DFNA 4XLZA 2OV6A 3OM8A 4CKXA 2GEBA 1NQXA 3A58B 4WOJA 4HEQA 1PQ4A 3QVMA 2MYTA 4NP6A 4REMA 4GMXA 4JXZA 1DV2A 1WF3A 1GNPA 1G5RA 3PPXA 1KQ3A 4M3NA 1D5CA 1N0HA 2BI8A 1ZH0A 3B70A 4E22A 5KYXB 2H1FA 2IIVA 4BVLA 4W63A 3DSRA 4TV9B 4MV5A 4F06A 3VOSA 3RWBA 2F9LA 4EP1A 1W94A 5BMVF 4CIBA 2D7CA 3GEBA 2PX5A 2IYYA 5KKCA 1MH9A 2ZUBA 3HJRA 2RGEA 3CIOA 2A92A 3DKKA 3S55A 1K8XB 1X1DA 2J32A 2AXEA 2EFHB 3K9WA 2ZWAA 2Q49A 2VJNA 3OIVA 4KRXA 4R54A 4TRRA 1PT5A 4Q3KA 4Q03A 4DA6A 1TYAE 3BXXA 3T1HB 2CT8A 1UJ5A 2JDID 1R37A 2QBYA 2WW8A 1M2GA 1T2CA 1UK9A 2O4UX 3H65A 1LEHA 1EVZA 2C2GA 1NBWB 1KJYA 3H05A 3HR4A 4RXTA 1N6OA 2IIQA 1U0OC 4QX6A 4DCSA 3AKCA 3TW4A 2E5FA 2VHUA 4I19A 3VHXA 5KDOA 3SQWA 1W36B 1XKQA 3M6UA 1E6KA 3AJ8A 3FOZA 4RD3A 5KTMA 5CAEB 1ONSA 1CV2A 2GK4A 2QMQA 4LVNA 4WSOA 4ALJA 1QV6A 5E6RB 2Y6VA 4M1WA 4TT3D 4DB2A 1C5KA 4Q21A 1QUFA 2XB2A 3EHDA 2QV7A 3QV1A 1KF0A 2YH2A 3C15C 3C4QA 2HCBA 1UQUA 1VP9A 3DNPA 4XASA 4MLCA 3FFAA 2ZBPA 3T99A 1JKIA 4PAWA 5E2IA 4Q1CA 3T15A 1R12A 2VXOA 4FYVA 3ETDA 3KVRA 3QVXA 3I30X 4L0QA 4YJ3B 5H4HA 2IS6A 2GHQA 1YXMA 3AY3A 3EVZA 1DEXA 4HGZA 2R2GA 3W7VA 1X19A 3OKFA 3QFRA 1NUSA 1NQ5A 2XUGA 3N75A 3QW4B 3WLIA 1IN8A 4N40A 1U8FO 5IF3A 5CPBA 1LI4A 1FQJA 1NW7A 1R6UA 2OORC 3KELA 1YQUA 3I04M 4URFA 1ZR2A 3PR3A 4OVKA 5KINB 1F14A 1GU7A 4DR5B 1W0CA 2EFGA 4A73A 4U7JA 1GM5A 2JEZA 4YAFA 3JQ8A 2R7NA 3GUHA 1WSBA 1U11A 1J6UA 1J5PA 2V74B 3RUPA 4C4OA 3CE9A 4MRSA 1E9VA 2BONA 4YONB 3A70A 3MWDB 2XRFA 3MMNA 4N7JA 5HFJA 1Z6PA 4CUZA 2XCTB 3DH0A 2B98A 2D00A 3G79A 3QWAA 1UMDB 3L7YA 5PGMA 3G6WA 1ZXBA 4TM7A 4DLAA 2JEOA 2D1SA 3L4SO 2PL3A 4G1FA 2NNWB 1C8KA 3FBGA 3WJ1A 3HS3A 4JROA 1DWQA 4QYWA 3TOXA 4BMZA 2COUA 2Z1DA 3CR7A 1MABA 2EFCB 1KIFA 3V2IA 4DCMA 5JATA 5LXTA 1EX1A 2PRJA 1ATIA 1YRWA 2B4AA 3MWJA 4KQGA 3REFA 2JIMA 1F2TB 2F4NA 1ORRA 1UJ2A 2FSIA 4D4LA 2XDWA 2FQQA 3W6PA 2IHBA 1K4MA 4HAIA 4LAFA 3UJ8A 1HRDA 1R6TA 4MP3A 5IJ0B 3BS4A 1V5IA 1BFDA 2CFTA 4IGKA 1YR7A 2PXCA 2QGZA 2WC1A 4Z9YA 5SY4A 3GN1A 1F6WA 1X2EA 2KMLA 1DC7A 2WA1A 3IP3A 1Y3DE 3KZVA 1XPRA 4B4DA 5F1OA 1EZZA 3H5VA 1Z6ZA 1L4MA 2IYZA 4WLUA 1ZNZA 3PSAA 5AHOA 2X1VA 3KB1A 4ZOQI 2GHRA 4D3XA 2IPXA 4ENUA 2NV2B 3FGNA 2JJ2D 2OZEA 4YRGA 1G6OA 4MIYA 1QBKC 3AXTA 4LZOA 2UZ1A 4X92A 5EZ6B 3UPDA 1M5TA 1BCRA 2C7GA 2PGXA 4BRSA 3OQ6A 3I23A 4WRRA 3VHLB 3FYCA 4TSFD 5BPHA 4URHA 1EEXB 2ZJFA 4BO4A 5AVJA 1TX4B 3LBHA 2BFFA 1KO5A 2AFIE 2PZKA 2TS1A 3LUBA 4BKQA 4BLWA 2ERCA 4CF7A 1UADA 4KXXA 4OM7A 4S24A 1A9YA 3PJDA 3KC2A 1QRDA 3II6X 4OUDB 1TJ4A 3OPQA 3OLZA 2WJWA 1WXXA 3TFOA 4Z53A 1ZQ9A 1ISIA 5DT2A 1JQDA 2WB4A 3TG8A 4GQIA 3I45A 3FYUB 2BUBA 3RREA 1GTJ1 1JMVA 2KWIA 2J0QA 3P2JA 3EFEA 1KS9A 2PFSA 5EPOA 5GIPE 3WYAA 2VYND 2FWJA 5TMPA 3GLHE 4J3NA 2ZSDA 4O0MA 3P9XA 2QRPA 4IMPA 4BNJA 3WZ2A 1L8AA 1FRFS 2B2NA 4R1OA 5AOVA 2VLBA 3TX2A 1FA9A 2W0MA 1O96B 4M7RA 4OK3A 3RRYA 4GI7A 2D6FA 1E58A 1BU8A 3H16A 2I33A 2RBKA 3HWSA 2BL4A 5CX1B 3V1YA 1V1MA 3IAS6 3UQZA 5FPKA 2CDCA 1J25A 3LZDA 3C8ZA 1I7NA 1ESZA 1M5UA 1XLWA 4D1YA 1AV6A 5JMPA 3NIWA 1AS3A 4P2BA 2ZJ8A 4J1SA 3C6ZA 2CSUA 3F4LA 5LQKA 4L4SA 1I30A 3OZFA 3WZMA 2ZT8A 2W6MA 1Y3AA 3H7AA 3IEPA 3NYWA 3TLZA 2PXXA 2N0SA 2PGJA 2E5WA 3HDVA 3BBLA 4KW7A 4R8LA 4BWFB 2XVMA 2VOJA 3MEQA 4BMYA 1LK7A 4M0PA 3H9CA 1D6NA 2A58A 2VF4X 3SQMA 1C7RA 3A6JA 4NCHA 3A06A 2V3CC 3BTSA 4I8IA 4LWOA 4R9NA 4B76A 1IE3A 4QSHA 4FGZA 1RAGA 5P21A 2W2NA 1OIWA 3TE7A 3WGGA 1MAWA 5JTUA 2M6KA 1O87A 5A5DA 4MB0A 4QT0A 3MBKA 1E6CA 1OA0A 4G1EB 5AK0A 3BDAA 4YP1A 3SX0A 2J8ZA 5C5IA 1HE1C 4LPKA 3A1SA 2HA5A 3RC1A 1SRQA 2SNIE 4HWSA 1IRXA 2FWPA 3A4NA 3JYOA 3P9RA 3VVLA 4B3MB 4PQGA 3ZLUA 3FWYA 3IKVA 4ZCSA 2QN6A 2AYYA 4NCXA 1E3WA 2J41A 4OMDA 4RCVA 1JZSA 5J1TB 3ICOA 4B87A 1TAQA 3CVVA 3DOJA 4B6EA 2Q1UA 5PNTA 3WC4A 4CIXA 5CURA 3LYAA 5F7OA 4KLRA 4LW8A 5E7IA 1ZN7A 4IWYA 3C3XA 3R9IA 1JNYA 1RI3A 2ZTHA 2IELA 3D7MA 3HCAA 2G06A 5AUQA 3Q40A 4C76A 2H63A 5TSDA 2ZJ0A 3B9RA 1LFAA 1QANA 3KUKA 3N58A 4N39A 1KZ4A 2ODAA 3LGXA 4L8WB 4M22A 4ZAVA 3HKCA 4UUBA 3E5RA 2CVHA 4UM7A 5KJEA 2PUEA 2AMJA 4IDDA 4LK3A 3GUUA 4K1LA 4DEXA 1TLFA 3EQ6A 3HVIA 1Y3FE 2EZTA 3SF8A 3OFKA 2W2KB 1WMDA 2GRAA 2BDEA 4RNDB 1IXYA 1AXGA 1P7PA 1U1CA 1YI1A 1ZRSA 2PMWB 3ENQA 1OKKA 2YV1A 3A6PC 5J2TB 2LRHA 1QBGA 1SFRA 5HE8A 4PC1A 3NTUA 4BNHA 5I8PA 3TRFA 1IULA 4CR6A 5C34B 1GKUB 2F8MA 5E4FA 1OC2A 2E1PA 1RWOA 3E2PA 5FT9A 3R7SA 3C8UA 5IT4A 5L3VA 5IT0A 2ZU6A 4G5XA 1P9WA 3BA1A 3AXSA 4Y6RA 3VC1A 1F0YA 3GV0A 1BW9B 2GO7A 2VR1A 4HQLA 3NOXA 4RA9A 1M2OA 2H3EA 3WYEA 1LD3A 4DYDA 3DEIA 2H3HA 2JLRA 2PIAA 5C4MA 3EVFA 3OMLA 4MGKR 1AGNA 2W11A 5D6NA 4OQYA 1G9SA 3DUFB 4LBYA 1PHPA 3PS9A 5EHGA 4NCKA 4UZEA 3E3AA 5BT9A 2GCPA 2WOOA 3TOSA 1JQLB 3KPWA 3SZMA 2O50A 2IY7A 8GPBA 5I01A 4P98A 4V2UA 2BZ1A 1LGYA 1Z3IX 2L69A 3RS9A 3KQLA 1JA0A 4XSGA 1N9KA 1BS9A 1R15A 1TPYA 4F3KA 1V4VA 2F48A 5CDUA 1I7QB 1MG0A 1KKLA 3AV0B 4AY6A 1LU9A 3QFCA 2E1RA 1C0EA 3IPAA 3B60A 1T0BA 3ED1A 1TD9A 2FEWB 1YS7A 4DLTA 3S2ZA 4Q19A 4C7OB 1TC2A 4JUDX 1T4CB 1HDXA 1F2DA 2FRXA 2H4JA 1DDGA 1I80A 5AJYA 3BXFA 4EJ6A 3N3AC 2HRBA 1Z5OA 1DCMA 3E4DA 3WI7A 3PVSA 4RK5A 3PCTA 3OOJA 3FTFA 5AFSA 3HVJA 1MT0A 2Q07A 4B82A 1CVLA 4D3YA 5EWMA 2VZ0A 1IZ7A 2FP4A 1U9YA 1Q0PA 3DTYA 3EXAA 3WKAA 1EESA 1BAPA 4XVRA 1FUIA 3BSYA 3VV3A 1P7ZA 3VDRA 1QZ3A 1ZCJA 3IEKA 2AZ4A 3HBJA 4MVJF 1IQ0A 2HNKA 1PFWA 1V8OA 4OI2A 1ZINA 4OV6B 2INGX 3L0DA 4HB4A 2WF6A 1OGYA 4OQFA 4ZEOA 1WMBA 3VZQA 3T7DA 3T94A 4FTWA 4S05A 3WV5A 1N0IA 2PHZA 2R62A 2UXCB 3LMKA 3NAQA 1UIRA 2QYSA 3ZQUA 2AN3A 3BXHA 3LT2A 1M8GA 1M6VA 2WM8A 1UFVA 2AJ8A 1AXRA 1BFKA 1UPTA 2V54A 3AI3A 3OHSX 1GCOA 2Y66A 3PYLA 3ZV4A 1Q77A 1IBKB 3EVEA 4MEBA 5A06A 5KSOA 1V45E 5C4GB 2FF7A 1KYTA 1Q0UA 3U44A 1GRQA 3DMRA 3LDFA 2PSSA 1SVKA 5JXJA 3GLGB 1K9VF 1KK0A 1KEEB 2CB9A 3VDMA 4F4JA 4RIEA 2FUNB 4DS3A 2X5XA 1DPFA 2J59A 2OQIA 3LF1A 1IB6A 5FFNA 2Z04A 3MOGA 1GYPA 2R9VA 1O94C 4FDUA 2PZBA 1PWEA 4N9WA 1U7ZA 4TL7A 3I62A 4UTNA 5KNLA 3ZQKA 4TTIA 1Y7LA 2HB6A 3EXFA 3ITNA 3EQ9A 2H4HA 2ZRGA 3JWPA 2KBEA 3S0JA 4GXRA 4JLBA 1G17A 1YIDA 1NLUA 1NWCA 1OZAA 1QGUA 2EFDB 4JLVA 1L0BA 2OGSA 4DDMA 4ZT5A 3UMJA 5H81A 4AZ3B 2IKQA 2QVLA 2QZ9A 1CFJA 2ZPTX 3HDJA 2HQSA 4QU5A 1T3HA 4XRRA 3UMCA 1H85A 2P35A 4YAGA 1GTMA 1MQ9A 3R5FA 5G53C 5BUQA 1VB5A 2QM7A 4EY6A 3JWGA 4PAGA 1GFIA 1QF7A 1ZUD1 4P3NA 4XQ0A 4LJAA 1HI9A 4NIMA 3TL6A 1FX0B 1US8A 1N6KA 2FN8A 3HXPA 4AJEA 2J09A 4BN5A 1SEVA 2FMIA 4YV1A 4LEIA 4DKJA 4NEQA 2EKBA 1RWNA 2R4UA 4YJFB 2ZXEA 3FHCB 4Y30A 4FXPA 1Z5ZA 2RKWA 3BZBA 3K5HA 3I37X 2O7NA 1DX4A 3P26A 1UDAA 4WQMA 2PH1A 4TX1A 2FHPA 3QVSA 1B2LA 1SC1A 5J5VA 1W1IA 3EIFA 3N8HA 3SIPA 3L6RA 3TDNA 4GLOA 5IKEA 2KLHA 1WP4A 3I72A 3VKFA 3IPXA 5FFFA 3KJIA 2GLTA 4Y6QA 1XKLA 4GX0A 3HO1A 1Z34A 4KPUA 3GWGA 3RSCA 3WGUA 2GN1A 3CW8X 2DWUA 1G21A 3INNA 5AIBA 1YB6A 3H17A 2DWOA 2I6QA 2IY8A 1QGZA 3FSGD 3HBLA 5EIEA 1NP3A 3P2OA 4EFLA 1YZ3A 1CQXA 2Q2VA 2XDYA 4EZBA 2NZVG 2QN1A 4Z4EA 1LJUA 4D9EA 3ZU2A 1YI0A 2IDZA 2OXRA 3N0TA 1WCXA 4L9SA 3S2YA 5DPMA 3ZU3A 1RXVA 2VJOA 4A8JC 5BSVA 3JALA 4LRTB 5C80A 1AKMA 3UO8B 5JR3A 3HMQA 4CE6A 4D0RA 1LLCA 2RBEA 3OJXA 4YDQA 4O59O 4YCLA 1DO0A 2VAWA 4LTDA 5DNYB 1G7CA 4X7BA 2Q3BA 1H2AS 1W96A 2QD2A 3O8LA 4UW9A 5THKA 3MMPA 2V6JA 3D9QX 3FN4A 3L46A 1N8NA 1WWKA 2MR6A 2YJZA 2WPDA 4BAGA 4URVR 5BNIA 3OJLA 2AKYA 2VF2A 3PFWO 3Q7QA 4HNTA 1H42A 1YO6A 1VM6A 2R25B 4GNRA 1KP2A 4MI9A 4XDHA 3KVNA 3FRIA 4EO9A 1ZEMA 4U6NA 4FB5A 4LBZA 2JFHA 4BX2A 3OE4A 5G02A 3PPIA 1JTFA 4EGSA 2UUOA 3TEFA 4HWKA 4AM8A 1XZEA 4ED9A 3EARA 3RU9A 4D5EA 4EB8A 1P1CA 3AMVA 1NVDA 3H11A 3I28A 1NJ5A 2RHRA 1L5MA 3NM5A 4GX5A 4HF7A 1ISHA 3TZBA 3UC5A 4BPRA 5IXSA 5AR1A 3EXEB 3L0YA 4F4UA 3MINB 3QOFA 2X4DA 3BMNA 3V8NA 2DSTA 2BMDA 2EIXA 5CW1A 4JC0A 4HH1A 1EA7A 2GLUA 2NXWA 2PLFA 1UZLA 3HL0A 5JDCA 2ZCUA 2HYIC 1DRUA 3PFNA 1QG2A 4GWKA 2HR1A 1E59A 3LUAA 3J81A 5A6VA 2ODPA 2WF9A 4BZXA <