3JYNA

Crystal structures of pseudomonas syringae pv. tomato dc3000 quinone oxidoreductase complexed with nadph
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
325
structure length
325
Chain Sequence
MAKRIQFSTVGGPEVLEYVDFEPEAPGPQAVVVRNKAIGLNFIDTYYRSGLYPAPFLPSGLGAEGAGVVEAVGDEVTRFKVGDRVAYGTGPLGAYSEVHVLPEANLVKLADSVSFEQAAALMLKGLTVQYLLRQTYQVKPGEIILFHAAAGGVGSLACQWAKALGAKLIGTVSSPEKAAHAKALGAWETIDYSHEDVAKRVLELTDGKKCPVVYDGVGQDTWLTSLDSVAPRGLVVSFGNASGPVSGVNLGILAQKDSVYVTRPTLGSYANNAQNLQTMADELFDMLASGKLKVDGIEQYALKDAAKAQIELSARRTTGSTILIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Quinone oxidoreductase
publication title Crystal structures of Pseudomonas syringae pv. tomato DC3000 quinone oxidoreductase and its complex with NADPH
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Oxidoreductase
total genus 104
structure length 325
sequence length 325
ec nomenclature ec 1.6.5.5: NADPH:quinone reductase.
pdb deposition date 2009-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3jynA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3jynA01
3DWFA 4GL4A 2NVUB 4YR9A 4HP8A 4BKRA 1HYHA 1LX6A 2HCTA 3AFNA 5A9RA 1GCUA 1NPDA 3HWRA 3NT5A 4XGIA 4WEQA 5TT0A 1FDSA 4BNWA 3SBOA 3K73O 2Q4EA 8ADHA 4W7IA 3EYWA 2OL4A 1QR6A 1NFQA 1LSUA 4DIFA 2FR8A 3I9OA 4QXMA 3ZCXA 1ZJZA 2O48X 2DM6A 3K2BA 3ZHBA 4D3FA 8LDHA 1MC5A 1T2AA 2JD0A 2J3HA 4N5NA 3F4BA 3QWIA 2EW8A 4R9RA 5KWEA 1VRWA 4YEDA 2WD7B 3HQ4O 1ULUA 4BNJA 3TWOA 3U62A 1ISIA 3GGPA 4GX0A 1PJLA 1QRRA 2XXJA 1QORA 4GX1A 5G0VA 3ZNPA 4XDZA 4CR8A 3JQ8B 3ONDA 5FEUA 1AE1A 1YO6A 2JL1A 3AY3A 3K31A 3BA1A 4NBTA 5AXDA 4U5QA 2AG8A 4PG6A 5KVSA 5I8ZA 3QJ5A 3IDSA 4HNGA 3WWZA 1P33A 2DTXA 4MKZA 5L7WA 3HDYA 1I01A 1XU9A 5EIOA 1XQ1A 3AI2A 3GMDA 3ADPA 2X7HA 1HKUA 4UULA 4ILKA 3GOHA 3T4EA 2QRJA 1HDYA 1DEHA 3MOIA 4E4YA 1MXFA 3X2FA 3JQCA 4YRAA 3HJAA 3SLKA 2AEFA 3VPSA 2CMDA 3QV1A 3E5MA 4UEJA 1J5PA 3PLNA 3DB2A 3JQFC 4ESOA 4XB1A 4XYBA 5TGDA 4RVHA 1NASA 2D1YA 2CFCA 4MVJI 3GN1A 4JN6B 3JQAB 1MXHA 4Q9NA 4BNLA 4AJKA 5CDYA 2O7QA 1PZHA 4Y98A 4ND2A 1PWZA 5G4KB 4QEDA 4AJIA 3BZUA 1LDBA 5A5EA 4DMMA 2Q50A 3OJ0A 4UVIA 3KEQA 1C14A 1N1EA 5TNXA 1KYQA 1T4DA 4JP3A 1EVYA 3A4VA 1A71A 2DAPA 1YE3A 2J6IA 2X58A 4MINA 3VPGA 1R16A 1EVZA 2O2SA 5A02A 2CNBA 2NU7A 3M6IA 3NJ4A 4CLDA 2VWHA 2PKQP 2IXBA 4NJMA 3NTOA 2I3GA 2Q4BA 4L9RA 3RC2A 2PZJA 1NPTO 4OM8A 1U3TA 1ENZA 3LF2A 1QYDA 1IHXA 2ZCUA 3VPFA 5F1KA 1NFFA 4BOYA 1ISHA 3OMLA 4NBRA 4J1QA 4JBIA 5DOZA 1JWAB 4EI2A 1S7CA 3GLQA 1LDEA 3RSHA 1F8FA 1LJ8A 2Y0CA 4FJ1A 3ABIA 4P8RA 4RLSA 1UAGA 1NPYA 5BNTA 2EP7A 5FI5A 4BNKA 3JQBA 4BKQA 2VZ8A 3HE3A 2DBRA 1E3JA 3CUKA 3ETDA 1HZJA 2CZCA 4OL9A 3WQRA 4MOWA 5L3ZA 1KEVA 3WDSA 5L45A 5G0TA 2OFPA 2C2XA 1P3DA 2IRWA 4ALLA 3H65A 3DBVO 5KVCA 1WXDA 3QWAA 3KO8A 2Q1TA 3AOEA 1NM5A 4IQ0A 5KJ6A 3EAGA 1O9BA 3ROMA 2UVDA 1DBVO 3ANLA 1HDXA 4E13A 1HSOA 1PJ2A 3ZN2A 4E2XA 4R3WA 3MZ0A 4K26A 2W8ZA 1DLIA 2VYVA 2V65A 1HRDA 2P5UA 2C20A 2FHSA 3GRPA 5ICSA 1GZ4A 1DAOA 3IOYA 1RJWA 4Z3DA 3WGZA 3ZWOA 2BRUA 4NFSA 4E5PA 2WD8A 3C7CB 4CJXA 2DC1A 3AJRA 3DZFA 4YACA 1DXYA 4PLWA 1NP3A 4OH1A 1JLLA 1K3TA 4JP2A 3AK4A 1LDYA 4CLHA 4CQMB 1BDMA 4JROA 1JA9A 1BG6A 3JYPA 4DPKA 2VYNA 2Y0EA 1XSEA 4IMPA 3WB9A 2Y93A 3E5RA 2CDBA 3RFXA 3FNFA 4PFJA 1DSSG 1YQXA 4OQZA 1I10A 2FY8A 4RPHA 2AW5A 1Z75A 4OMUA 2O2YA 3CSDA 5JSFA 1FDWA 2GN9A 5F5LA 4FJ0A 5KJ1A 2VT2A 3WYEA 4RF5A 1GQ2A 5KNLA 1LXCA 1PEDA 3GUCA 3RIHA 1D4FA 1YQDA 3EY4A 3GEGA 5HA5A 3ZHYA 3Q9NA 3VTZA 3QWFA 3LT1A 2X86A 1B8PA 1LSOA 3MEQA 2O4UX 4NIMA 2RH4A 5JC1A 2I3AA 1ZH8A 4NJMB 3FHLA 2CUKA 5DN9A 1HTBA 2POQX 3SJ7A 5AVOA 3L9WA 1RM0A 1U3UA 4IXWA 1DRUA 3KRTA 5K1SA 4E2ZA 2R00A 1H6DA 2BFPA 4EEXA 3PI7A 4RGBA 1K5HA 2PLAA 1NVMB 4FD3A 1DC4A 4RPGA 4CM4A 1T4BA 1GPDG 3CPSA 2IXAA 3PWSA 1WWKA 2VNAA 5L95A 4DBVO 3D4OA 2ZYDA 3JQBC 4IDDA 5LDGA 4QSMA 1U5CA 2AE2A 5JDCA 3HB5X 2PKRA 2VYND 1YXMA 3TSCA 2GZ3A 2PD4A 2ZK7A 4Q3AA 4J43A 1GDHA 4I9UA 3ORFA 4AVYA 4D0RA 2HO5A 3OFSA 2FN7A 3GHYA 2YV3A 6LDHA 2UUPA 1D7OA 3IAHA 1Q0LA 1J49A 4UAGA 3AOEC 2PD6A 1N92A 4O63O 2EGHA 3O03A 1NBOA 4RF2A 4HWKA 1C0KA 1V9LA 2I6TA 2VRCD 4J4BA 3TZQA 1GEEA 2B69A 2YHUA 4KTVE 3FTPA 1YJQA 4RPLA 3T7CA 1DRVA 3U3XA 4BB6A 2Y67A 1LI4A 4TRRA 2FPIA 5DF1A 2GRAA 1IE3A 5I9NA 1IUKA 1B0AA 3QE3A 1RYDA 2O3QA 2FRDA 2ZKLA 4YJFA 4JJGA 2BGLA 4IPTA 2FOIA 3QRWA 3C1TA 1U7HA 1GYPA 1HT0A 1ONNA 4OXYA 4E2WA 5F5NA 1VI2A 2EWMA 3UH1A 1YKFA 3FN4A 3ETEA 2NLOA 1YBMA 4XYLA 2FZWA 1H2HA 3Q0EA 1E6UA 1QMGA 4D79A 4R1NA 2H63A 1PGNA 2Y05A 1WAMA 3MOGA 3GH3A 4MVJD 3EVNA 4B79A 1NWHA 4HUJA 1TXGA 4IJVA 4QT0A 4BO0A 4CLRA 3JYQA 4KZPA 3GVHA 3GQVA 1EE9A 4QECA 3KVOA 4WLOA 4L0QA 2X9NA 4KMSA 1TLTA 3QIVA 1PGOA 2GNAA 4FFOA 4ZQEA 3LC7O 3RUDA 3AY6A 2ZJ0A 2ZTVA 3K9QO 5A9TA 3WIDA 3PWZA 1CYDA 3AM3A 4XGNA 4WNIA 3WGTA 5T57A 3INTA 4J4TA 1UZMA 3JYOA 3DMYA 5DCUA 2B4QA 1RPNA 4P22A 5B4TA 3MTJA 1YB4A 3C8MA 5JMWA 4C7JA 4M8SA 3IP1A 4B3IA 2HK8A 4CL3A 3AUAA 3MWDB 2JFGA 2R00C 2JHGA 1BVUA 2X8LA 1GUYA 5FI3A 1H9BA 3RUAA 2A94A 2PA3A 4YQYA 3TF5A 3GGGA 2NUAA 4CM4B 4O5OA 4WOKA 1Y5MA 2FPGA 2GASA 1KC3A 4YDRA 4BIIA 3AW9A 1EEHA 3AM4A 3P5SA 1EQUA 1DFHA 1UDCA 1VKNA 3KZVA 5JLAA 5I9MA 3ITKA 3FD8A 4IM7A 4DC1A 3VKVA 2W98A 4D0SA 3DHNA 2PGDA 4HBGA 2C5AA 3WGOA 2CY0A 3BMOA 5JDCC 4A73A 5CDGA 3C85A 5CDSA 1MV8A 4MIOA 4NMHA 3RD5A 3GFBA 3KYCA 2VHXA 4II3A 4WOJA 2GSDA 1GZ3A 2G76A 2VOJA 3QLJA 1L7DA 1UR5A 2JD2A 5JXWA 4IDEA 3M1LA 2QX7A 1A9YA 3K6JA 2HUNA 4PCVA 2XXBA 4S3MA 4WUVA 4BKUA 1AXGA 5DT9A 2YFHA 1XR3A 3L6EA 4L4SA 1E1MA 3I1JA 4DYVA 2A4KA 3JYNA 2VHYA 5H81A 1LEHA 3DO5A 3JD2A 5U4QA 1R0SA 1H94A 2BMAA 5B1YA 3ENNA 2HDHA 5L40A 2B35A 4I9HA 4EUFA 4IJWA 4BS9A 1M6HA 4YJFB 3NKLA 4XYMA 4E5MA 4PZEA 2QQ5A 4Z9FA 3V2HA 1M6WA 2UAGA 4BGUA 1N8KA 5BSGA 4IINA 4Y67A 5U9CA 4BO9A 4H16A 5MDHA 1E3EA 1T24A 3HN7A 2DU8A 2DBZA 1IY8A 1NQAO 3NT4A 4YT8A 4CR7A 4OGWA 1WPQA 4NFYA 5KCZA 2Y1EA 3PQFA 4MKRA 3OHSX 3P2YA 2HRZA 3FR7A 1HLPA 1SB9A 3ZWBA 1TT7A 4LMPA 4CLRB 3PQEA 4UUOA 2YDYA 4JJFA 4NH4A 3HADA 4Q3BA 1KC1A 1WZEA 2ZCVA 3PZRA 1W6UA 4XZ3A 1LRLA 2AMFA 4YPOA 1E5LA 5HS6A 3GDOA 1RM4A 1OBFO 2NWQA 2OBNA 3WSWA 3P19A 2JJYA 4XRGA 1J4AA 2ZB8A 2VWQA 1X7DA 2P4HX 3C3XA 4JK3A 2D0IA 1BWSA 1PWXA 3K8ZA 3JQGA 1ADBA 1Y8QA 4NQZA 4E5YA 1X0XA 4ID9A 3PHGA 3I6IA 1IHYA 4Z3KA 1XGKA 2IODA 4BNNA 3Q11A 3ROKA 1WMBA 1CF2O 4J9UE 4HFMA 1E92A 3U49A 4RZIA 5LC1A 5IN5A 1WDMA 1J0XO 1K89A 4XRRA 1D1SA 1Y1PA 1HYEA 1V3TA 1FF9A 1KVUA 3PJEA 4R5HA 3RASA 4PLHA 4YXFA 2PR2A 2H5LA 1Z45A 3W8EA 2JAHA 4Q3CA 4AICA 2DT5A 2JCXA 1Y7TA 3ZU5A 1DPGA 4QO8A 3OJOA 1E7YA 1PS0A 2YV2A 4BO3A 5JYDA 5TLSA 1TEHA 2EEZA 3JCZA 4HV4A 2HMUA 3D4PA 2P9EA 5JFOA 1E7SA 3FR8A 3LC1O 3LSYA 2Q2VA 4AJPA 1T1SA 1A7KA 2WE7A 1VPDA 3C1OA 1I3KA 4PG4A 1ENYA 5TRTA 4FBGA 3L4BC 4K6CA 1N7GA 1C3VA 3NUGA 1YOVA 4Z0HO 1O89A 1HSZA 3NX4A 4FFPA 3IS3A 2XOXA 4QQRA 3JQ7A 2UYYA 3DZKA 5J23A 2BHLA 1WVGA 4L4RA 1I3MA 3IUSA 4M87A 1P45A 3A14A 3VH2A 1K6JA 4FIZA 3U4DA 4L73A 1DHRA 1ZK0A 5EN4A 5HBRA 3HFGA 4CMAA 2BFAA 1EK5A 3V1YA 5JDIA 2BELA 1GL3A 5G0SA 2X22A 4XJTA 4NK5A 5THKA 4KUHA 3F4LA 1I3NA 3E1KA 5BSHA 3V1UA 2J3JA 1XCBA 1AHIA 3LLSA 4I5GA 4GWKA 3RJ9A 1GR0A 2AG5A 3OQ6A 4GLLA 4WLFA 3WX0A 2QYSA 1FDTA 4D46A 2I76A 1V3VA 4I1IA 1YL7A 1XYGA 1E3WA 1I5RA 3AU9A 3F5QA 3B70A 1KVQA 2NACA 4FFMA 1DRWA 4PLPA 4QTZA 1GUZA 4GKBA 5EPOA 1Q1NA 4YVFA 1A27A 1H5QA 1NWCA 3U09A 3ZDFA 2CVQA 3VHRA 4X54A 3NRCA 1LLDA 1MG0A 3JQFA 1H6BA 4CV2A 3SVTA 1E1LA 4D42A 3I9MA 2VUTA 1U2GA 3M2TA 3AWDA 1N9GA 3DFZA 2P9GA 2VHWA 1QLHA 1JW9B 1F12A 2GUGA 1J6UA 2TMDA 1Q7CA 6ADHA 1P0CA 1P74A 3CZRA 4IDFA 3WYBA 4UREA 1CWUA 1PS9A 3FNEA 3INGA 1UXGA 2VHVA 1KY4A 4GI2A 3UF0A 3PK0A 4A0SA 3WQSB 3KBOA 3L07A 3JQGB 3QVTA 1DIHA 1T1RA 2VWPA 1Y8QB 4KUGA 5HWSA 4J1TA 5DULA 2AQKA 5F1OA 4E6PA 1PQWA 2W2KA 4U8GA 2H6EA 4BKPA 1GV1A 2E49A 1ADFA 4JGBA 4HNHA 3H3JA 1EVIA 1ZIDA 4NJOA 1X7HA 4DTIA 4FPXA 2BI7A 2HK7A 4XA8A 2ILTA 1I24A 1KVSA 3PGJA 4CM6A 4UVGA 1UXHA 1PZEA 1ZJYA 3VZQA 3ZW8A 2PY6A 3ANNA 3JQEA 1DOHA 4FC6A 4CMEA 3E6AA 5A06A 3WG9A 4NDNE 3CH6A 4PZCA 4YB8A 1M66A 3MJVA 3RCBA 5I7SA 1A5ZA 1W73A 2X0IA 4UUPA 5ITWA 4GKVA 3PPIA 4Z0TA 3MJCA 4DYDA 5C7OO 3DR3A 3R3JA 4E2YA 1Z6ZA 3NEPX 3DOOA 2TMGA 1UP7A 4LSMA 3IKTA 1ZK1A 4W82A 5KKAA 3TOXA 2ZYGA 1YOVB 2H1SA 2I9PA 1BXKA 1P1RA 1DO8A 3VZPA 5JAQA 2PZMA 3JQ7B 4MP3A 4ZRNA 1P1HA 5F3RA 2AXQA 5ILOA 1NNUA 2CVOA 2DFVA 4LISA 3W8FA 5HS4A 1GPJA 2I5PO 4L76A 1L7EA 1KVTA 2PH5A 4D3DA 4Q3EA 2QZZA 1VSUA 3WGHA 3GA0A 1XWFA 3FNGA 5JDIC 2YW9A 3H2ZA 4BNHA 2X9VA 3ROQA 4KQXA 3L9XA 5DCWA 2QRKA 2DLDA 2OP0A 5G2OA 1PZFA 1B26A 2HQ1A 3NDRA 3BHIA 1RKXA 2PV7A 3U0BA 5COBA 1MGOA 3H7AA 2BGMA 5A9SB 3R6DA 3GVCA 1SOVA 2Y1DA 3WNVA 4DIOA 1ENPA 1FDUA 4GSLA 1JKIA 3ON5A 4KP7A 2OXIA 1KEWA 3QP9A 4J2OA 3V1TC 2DVMA 4TRMA 2GCGA 3W1VA 2V6BA 1U3WA 3OSUA 5FF9A 3E8XA 5JCXA 4ZN6A 3JSAA 3EZLA 4DLLA 2I65A 2FMUA 1AGNA 3WICA 1IOLA 4J3FA 5H83A 3GZNA 5IAAA 1DIAA 1W4ZA 1E6WA 4FFRA 4B7CA 3I83A 1JTVA 3DZIA 4ALJA 1BGVA 5EINA 3WS7A 4ALKA 4BKOA 2J5QA 1WLYA 3HHPA 2YV1A 2CVZA 2NU9A 4XYGA 5A1TA 2YHIB 1Y5RA 2EV9A 1BTOA 4CR6A 1DFGA 3DMTA 4AJEA 2BFOA 2CDCA 4CM3A 4EDFA 1YONA 5T64A 3SC4A 5C3MA 4Y9DA 1VL0A 1PIWA 3RROA 4YTEA 4RORA 1XA0A 1NVTA 5IN4A 1PL8A 1SOWA 1BHSA 3B1FA 3ROPA 4ALIA 5HTOA 7ADHA 4BNMA 3RU9A 2W2KB 5COAA 2W2LA 4CMHA 1HDCA 4EJ6A 4WPGA 4BNUA 4EUHA 2DPGA 2RH8A 4B4OA 5ADHA 3I23A 3BMCA 3INRA 3K30A 5FYDA 2J5KA 1NR1A 4JNKA 2X5KO 3N58A 4B7UA 3PXXA 5CEEA 1XIVA 1M2WA 2D4AA 3ETGA 4CMEC 5L51A 1V35A 2JD1A 3S1LA 3RQSA 4CMGA 2YDXA 3L6DA 2HLPA 3T7EA 4RCVA 3ZU3A 3DL2A 1UZLA 3STHA 1DJNA 2HKIA 4YJDA 2C82A 3EHEA 3FWNA 3DOCA 5ES3A 1NXQA 3GNTA 4BO2A 4UUNA 1I33A 1UH5A 1O6ZA 3HDJA 5EQFA 1MFZA 5JAMA 3O26A 5CEJA 4BO7A 1F8GA 4G2NA 4BGIA 3F6YA 5K0ZA 3VVBA 5A05A 4G81A 1GAEO 4BV9A 2V6MA 4TKLA 4XEHA 1BXGA 4GSKA 3AY7A 3KEOA 4YCAA 2C2YA 1C0LA 4IBOA 4MPDA 3ZI0A 3D5QA 4XQEA 3LF1A 1A9ZA 2CF6A 5I9LA 4G65A 2GDZA 1ZSNA 4E21A 3PWKA 1LU9A 3PDUA 1EZ4A 3OICA 4U7WA 2W2LD 4CM1A 3TJRA 1PL7A 1I30A 4U6SA 2YFQA 5IXSA 5ER9A 1QSGA 2HMVA 1O8CA 4FS3A 2GGSA 3ZWPA 1T2DA 2R2GA 3TRIA 3UVEA 4M49A 2IE0A 4B3HA 3KB6A 3LC2O 4M55A 1GADO 2NU8A 3MCVA 2DQ4A 1RM3A 5K6AA 3AUSA 3LQFA 3AM5A 3GFGA 3KSDO 4YAJA 3WBBA 4B4VA 2X23A 4B7XA 4RPJA 3JQDA 4J0EA 1V6AA 1DC5A 1UJMA 3MTGA 1VL6A 2X9GA 3IKVA 4GPD1 1JKJA 2F1KA 2OORA 2Y0DA 1QLJA 4ZVVA 2EKPA 4W9NC 3W4IA 3KUXA 4RVDA 2VRCA 4WASA 1GU7A 3DMTC 4BL5A 4FFLA 4TSKA 4E0BA 1EDOA 1QV6A 3DFUA 1GFSA 4FR5A 5JYEA 5EESA 3ZU2A 4E32A 3H2SA 4KTTE 5GY7A 4BO4A 1GZ6A 1WP4A 2ZB3A 1QKIA 3PGXA 4JLWA 2JAPA 3OETA 3D5TA 3ZWWA 1A72A 4OKNA 1SO8A 3BHMA 2XAAA 3BMCB 2DTEA 3WGGA 1B3BA 1I8TA 3OBBA 2NU6A 1G0OA 1PQUA 4R3NA 2NQTA 3V2GA 3F46A 3HDQA 1E1KA 3ONEA 1HE4A 3CMMA 1E7QA 5L4LA 1ZVMA 3NYWA 3OH8A 4R41A 4BMNA 4DQXA 4DWVA 3GPIA 3EK2A 3N7UA 3O8QA 3VH1A 4BNYA 3I9KA 2DKNA 3DZBA 1LA2A 4OSPA 3K5PA 4AJLA 2WJPA 4MP8A 4PRKA 4MVJA 3GAFA 1EBFA 4DPMA 4YAKA 4GX5A 1QP8A 3L77A 1GY8A 4GVLA 3BYZA 4OXNA 3CEAA 4WLUA 2Q49A 4QUKA 5LCXA 3DAGA 4XD2A 3UW3A 3VTFA 1G6KA 1ULSA 2JFHA 5AQ1A 2PZKA 3SJUA 2X0NA 2CSUA 4E3ZA 3T4XA 3DAFA 5CEFA 3I3OA 2EF1A 1IULA 1X1TA 3W4JA 1R15A 3PYLA 4ND1A 2V6GA 1BXGB 2PNFA 3FPCA 1ISMA 4FB5A 4XDYA 2AQHA 1PJQA 1QG6A 2W4QA 4E33A 5IJZA 3GVPA 3OEYA 1DDOA 2RIRA 5IZCA 1ZFNA 1HLDA 2ZB7A 1IZ9A 4AJ4A 2RHCA 4WK6A 5H82A 4J0FA 4WLEA 1HF3A 5EQDA 4YRDA 1KS9A 4KDEA 4RVFA 4KDFA 4MIYA 5JCJA 4CL8A 1H2BA 5CG2A 5GZ1A 3WTBA 2O4CA 3ZNNA 3E48A 3PJDA 4JXKA 1KBZA 3OIFA 4PLCA 2B36A 1N1GA 3NV9A 2RAFA 4J7UA 2GZ2A 3FPLA 1F17A 4WLVA 4IDBA 3WGYA 3Q1LA 3B1KA 4W6ZA 4XIYA 5K6AC 1X0VA 1ZK4A 4TRJA 2NADA 3PJFA 3RUFA 1Z7BA 2BD0A 5T67A 3PTZA 3VDQA 2IZ1A 2P68A 4KWIA 1Y81A 3VDRA 4XCVA 2NVBA 3G17A 4YAGA 4ZQBA 1WZIA 1SEPA 1ZK2A 3CZMA 1CRWG 1OMOA 4EJ0A 1NQ5A 3I4CA 3OF2A 4L75A 1ZMOA 1BXZA 2X5OA 3RFTA 4EUEA 4QFDA 1PL6A 2NNLD 1YQGA 4M54A 2IZZA 3BTVA 2X4GA 4EGFA 1EK6A 4DC0A 2FZEA 3QVOA 1O94A 1PJCA 1NX6A 2ZTLA 1BSVA 4N18A 3S2FA 4UVDA 1B8UA 3U4CA 5KJFA 1JN0A 2G17A 2BH9A 2OP1A 2BGKA 2EKQA 4BHTA 1DLJA 4WKGA 1C1DA 5KJCA 4MVJF 2WM3A 3ZWVA 1XHLA 1OI7A 5A9SA 5JCJD 4CPDA 4MVJP 3RJ5A 1UZNA 1VLLA 3DHEA 1CIVA 2HK9A 3O8QB 3KLMX 3WTCA 3ZNOA 2GF2A 4J91A 2B4TO 2GN8A 4LN1A 1VKOA 2EHDA 3G3EA 3SEFA 4BO8A 4C7KA 4CLOA 5C5IA 4R5MA 3VOSA 4LVCA 4J1NA 2Q45A 5A4DA 4OSOA 3ZNQA 1ISGA 2WYUA 3ICPA 3JQ9A 5JBIA 4D7AA 3RC7A 1GUFA 1ZK3A 3LT0A 4OOFA 3ZW9A 4YAEA 1PJBA 1H6CA 1VJ0A 4IDAA 4PVCA 1E3SA 1I36A 2VZ0A 3GEDA 1DIGA 4CM9D 2J3KA 2A9FA 2PFGA 2Y1CA 4HKTA 4S1VA 3L4BA 3DOJA 1BW9A 3ST7A 2VCYA 4TRNA 3RUEA 1WMAA 2RCYA 3PFFA 2GERA 5JW6A 1WNTA 1YBVA 1Z82A 3GHHA 3A06A 3LK7A 2AHRA 4BNTA 1B7GO 5IZCC 4BO6A 4IXTA 4NK4A 3K92A 5IXYA 4PZDA 2FPPA 2FP4A 4RDIA 1P77A 4DIBA 3LDHA 3PP8A 4CMIA 4M86A 1VM6A 4U0KA 4E5NA 5TX7A 3F47A 3AUTA 4NBWA 4CMCA 2X0RA 4IDGA 2JFFA 5EL0A 5CG1A 4FOSA 1SB8A 4A26A 3JYLA 2FR0A 1NQOA 2QW8A 5EMHA 4CV3A 1ZXBA 1LSSA 4CV1A 1XKQA 3EZYA 1B16A 5JAIA 4L74A 2ET6A 4A5OA 3CMCO 1R4MA 3TDKA 1P44A 4XYEA 4EZBA 1LTHR 2F00A 3GDFA 1U4SA 5AXCA 3HNPA 4R01A 1IPEA 5I7EA 4CMJA 4MKXA 5TIIA 4DA9A 1P1FA 2C5EA 3G0OA 3WFIA 1OZAA 3BTSA 2O3SA 1LUAA 4XQ9A 5CP8A 3U4HA 3VZSA 3GN2A 3U9LA 2P2SA 4IGFA 5I7FA 2FSSA 3PRJA 3IC5A 1UDAA 2EERA 4W99A 4CUZA 3FSRA 5I8WA 3IMFA 3HDHA 1YGYA 2E48A 1NYTA 4P38A 1LDGA 1YL5A 1M76A 1C1DB 1H9AA 4BUCA 3A9WA 3IL2A 3GT0A 5F21A 2EW2A 3ENKA 4I5DA 4XQGA 2BFMA 1PGPA 1QYVA 1F0YA 2HMWA 3I52A 1BRMA 3CTMA 3GVXA 4IQGA 4P4LA 3ZZNA 4UVHA 4XB2A 5FWNA 4WGGA 1MUUA 1OFGA 3NDIA 2D3TA 4BB5A 2BI8A 3ZWNA 3BMOB 4RPKA 4PLFA 4IGEA 1I2ZA 1Y9EA 4FOOA 1GTMA 3JQ9C 1YB1A 3RAJA 4LCEA 4UUMA 5CAEA 4NNJA 4RVSA 2QG4A 3KYCB 4TZTA 1JDJA 1JKFA 1A4UA 1Q7BA 2CDAA 3BXXA 2ZB4A 3WNQA 3QWBA 5KJEA 2EGGA 3IUPA 1JAYA 1BW9B 5JY6A 3OQBA 4GQAA 4D45A 1M67A 4JX8A 4CUJA 2VZ9A 3PHHA 4EJMA 1HXHA 3VH4A 5CHEA 2EXXA 1SEVA 4QX6A 2Q46A 1EE2A 3K96A 3QW2A 4RVGA 2NVUA 3PZBA 3I4FA 4MO2A 1D3AA 3UCFA 3F1LA 1HL3A 3F3SA 4CMIB 1PTJA 4P4GA 5G4LA 2Q1UA 2X1HA 2HJSA 3ASUA 1EMDA 4C4OA 3C7DB 3D7LA 3AU8A 2Y1OA 4CMBA 3KV3O 4URFA 3VPXA 3GEMA 1IL0A 2EP5A 1JU9A 2NTVA 3ZWMA 1B2LA 4B8WA 3JD0A 4YA6A 1ISJA 3WJ7A 1XEAA 4PVDA 1XELA 2G82A 2WD7A 3TNLA 1R0KA 4RL6A 1PJ4A 4ZHSA 1ORRA 4TQGA 1VJTA 2JKVA 3H9EO 3L6OO 3SXPA 1HYGA 5KOIA 4MDHA 4A2CA 1SMKA 1E7WA 2UUOA 4EITA 3BMQA 5ILGA 1LRKA 4ITUA 3LLVA 3TZCA 1DIBA 2B4RO 3WYCA 4DPLA 4WCDA 1DC6A 3GNQA 3GG9A 3RUIA 5AXAA 5A03A 3NGXA 1VE9A 3DZJA 4PLTA 3NT2A 2E82A 3Q2KA 2YQ4A 3I9JA 3WLEA 4CM7A 4YRBA 1E6EA 3O9ZA 4PLYA 1QYWA 1R0LA 2XPCA 2P5YA 2RHRA 4OHUA 4DQUA 1ZZEA 3JQAA 3JD1A 4DBZA 2PTGA 1EBUA 4ZQGA 3DQPA 1V8BA 3IJPA 4GH5A 5ICMA 5IFLA 2G5CA 4PGFA 4P4NA 1SNYA 4DMLA 1SPXA 3H9QA 1BVRA 1KOLA 1U8XX 4A7PA 3TZ6A 1YWGO 2OUIA 5ITVA 2E6UX 2C59A 1D1TA 4GGOA 3BTOA 3WGQA 3WMXA 4MVJG 3CINA 3WWYA 1SCUA 3JTMA 3NTRA 3SC6A 1FJHA 1MLDA 3QSGA 4GLOA 3QVSA 3AUUA 2OHXA 3TFOA 2NVWA 1T25A 2IEBA 1ZEJA 1QXSA 3LYLA 4ZQHA 2C0CA 3IP3A 1PU2A 2D2IA 4YJHA 2JCYA 1K6IA 4LGVA 3WBFA 3EGOA 4AJNA 2WWRA 4BQRA 5BSFA 3RC1A 1U5AA 2DFDA 2O50A 3PIIA 1IZ0A 4XX0A 3E18A 4FQ8A 4EW6A 3TZKA 1Y8RA 3GNSA 1HZZA 3AI3A 4XQCA 3S2EA 1OAAA 4BNFA 1HDGO 3ZHZA 4GMGA 4Z0PA 1MP0A 3OA2A 5FFFA 3VPHA 5GMOA 5JPIA 1VJ1A 4NBUA 1A7AA 1PJ3A 2YQ5A 2ZQYA 5CDTA 2B5WA 1E3LA 1H0KA 2E4AA 2BLLA 2IYOA 4I9NA 3UAGA 3FTNA 4ZQFA 3OEWA 1HE5A 2VHZA 4II2A 2O3JA 5A04A 4NBVA 5B4VA 3JQAD 4BMSA 2NV6A 3UFXA 1R37A 5L7TA 2WTBA 4E30A 1A4IA 1VC2A 2P9CA 2D5AA 3TZHA 1OC4A 3WJAA 4M1QA 1LRJA 4IUYA 3WGIA 3UKOA 3NDJA 3PEFA 1E3WB 3RUHA 2Q1SA 3B1JA 3KOUA 4IMRA 4QFCA 3W6UA 3VH3A 4K9DA 3HSKA 5IDQA 2WEKA 1YS4A 3RI3A 4D41A 1TI7A 5TQVA 1GYRA 2C7VA 1TB4A 3WXBA 3PQDA 2DUUA 4CV0A 1IB6A 3D3EA 3DBRA 3ADOA 4IIUA 4N5MA 1KETA 1YDWA 4J90A 4R4JA 5U1PA 1Y9AA 4N54A 5DBIA 3RKRA 3UCXA 2Q2WA 3BMQB 1N9GB 4RVUA 4J6FA 5TF4A 2AEJA 2Y68A 3DZHA 2P91A 1YVEI 4W9NA 3UUWA 1AXEA 1PQPA 1MA0A 2JCVA 3IIEA 3W4KA 4CQMA 2DPHA 1UXKA 3MJTA 1XQ6A 2IZ0A 1BDBA 1YDEA 1LNQA 1FXSA 1N7HA 2OMEA 4H15A 4A03A 3E9NA 5JC8A 5JNLA 4TZKA 1U1IA 4O1MA 2B37A 4K28A 1ADCA 1B15A 4K1LA 5TC4A 3H9GA 2VOEA 2JHFA 1EUCA 1LLUA 2XF8A 2C29D 3W6ZA 4ND3A 4GBJA 5TS3A 1I2BA 4PG7A 3O4RA 1ZCJA 4AJHA 4BO5A 4FDAA 1ZSYA 1Q0HA 1JVSA 4CM8A 4DRYA 4MVJH 4JCOA 4H7PA 4AJOA 2NTJA 3ICCA 4OKIA 1EUZA 5ER6A 2CF5A 3FF4A 1W8DA 3MWEB 3I6QA 3LU1A 5C7IO 1K6XA 1UXJA 1LDMA 4YJHB 1GD1O 4YT5A 3PIDA 3RWBA 4DL9A 1EFKA 3HB4X 3Q9UA 4EBFA 5JO0A 2ZATA 3DBHA 3RC9A 2WYWA 2WSBA 4AG3A 3L4SO 1V0JA 2IEDA 1NHGA 2YZ7A 1C1XA 4KOAA 1AUPA 1Y8RB 3OJFA 3ZV5A 1CQIA 1E3IA 2CD9A 3ITDA 3NAQA 1PR9A 2NQ8A 4TWRA 4R54A 1IYZA 1B3RA 1G1AA 1XG5A 1XLTA 1C0PA 2I99A 1C0IA 1EDZA 1P31A 3CE6A 4PG5A 4CQMD 3AI1A 5DDIP 4DQVA 4B3JA 4YJGA 3LT4A 4NPCA 4B4WA 5GZ3A 4INAA 4ZD6A 3EUWA 4AJ2A 4LSWA 1DHTA 2HU2A 3I5MA 3RBXA 3V2UA 3TN7A 4DLAA 3LT2A 4PIVA 4ZRMA 1IPFA 1R6DA 1VSVA 4XR9A 5DZSA 4U0JA 4O6VA 3AOGA 3G79A 3KLPX 1SAYA 4RQTA 2Z1NA 4ROSA 2IYPA 1ZNQO 1CQJA 5THQA 3DTYA 3EC7A 2GN4A 1GV0A 4YQZA 3JQ6A 4HADA 1TT5A 1O5IA 1OOEA 2DUWA 1ZXLA 3JD3A 2GO1A 3C7AA 3RBVA 5CPFA 3DBRB 5DCYA 3JV7A 1B8VA 1E0DA 1R12A 3GZNB 1KY5A 3H4VA 2C54A 4NU6A 1UUFA 4BV8A 3D3WA 2J3IA 4IIVA 2EIHA 2EJVA 4ND5A 4WCFA 3HN2A 3BIOA 1M75A 3DBLA 1P9LA 3GF4A 4OIMA 3WSVA 4FGWA 9LDTA 4F6CA 1D8AA 2PWZA 4PN3A 2NTNA 3EW7A 3ZV3A 4DREA 2ZJ1A 3V8BA 4J4HA 3RUCA 2VTDA 1ZO8A 1DIRA 3G49A 1FMCA 5MGBA 1LSJA 1PS8A 2QHXA 4ALMA 1LBEA 4MP6A 3C1AA 4IZHA 4OOEA 1Q0QA 4BNVA 1P1JA 1NAIA 2ZTUA 4O59O 4PLZA 4XGKA 4YWJA 1FK8A 4XIJA 1E77A 2VUUA 2ZQZA 4CM8B 1Q7GA 2QZ9A 4UEOA 4ZA2A 2BKAA 2GR9A 4CQLA 4WJZA 2VYVD 4ONEA 3ULKA 1U28A 4IDCA 4AL4A 1CETA 1N5DA 5LDHA 5JE8A 3V5NA 1ZMTA 1PX0A 1GCOA 1Q2XA 3NJ8A 5DNAA 4Q3DA 2Q2QA 3FI9A 2Q3EA 3DBHB 2Z5LA 4UEKA 3QVXA 3UOGA 2YJZA 4KWHA 3S8MA 3E82A 4OAQA 3P7MA 3PFWO 3DAPA 4RDHA 5COQA 5T6BA 1P1IA 1C1XB 3S2GA 3GC6A 1PSDA 3GAZA 3EDMA 4EYEA 1X7GA 3ZWXA 3ZU4A 4FSHA 4K6FA 1YL6A 4JQCA 3OA0A 3OECA 4HFNA 5DP2A 1PR3A 1ZBQA 4NHEA 5B12A 1U4OA 3GMSA 3B6ZA 2Y99A 4WEOA 3CKYA 1LC0A 4FCCA 4HFRA 4YJGB 4IY1A 4L4XA 4OQYA 4B8ZA 3F9IA 4GGPA 1KEPA 1KEUA 2VNSA 4H3VA 1T2EA 4ZGWA 5BNFA 1LDNA 4GVXA 4TMFA 2G0TA 4Z6KA 5A3JA 2PH3A 3DONA 2DBQA 2W90A 3NTQA 3QWHA 4R1UA 4AJ1A 1NTOA 4IZIA 3RFVA 1ZSVA 3ZWAA 1VL8A 2FWMX 1UP4A 3EVTA 4HY3A 1LQUA 1ZUD1 2D5CA 3Q6IA 1CDOA 4WNCA 4IJUA 3IJRA 4J16A 3OIDA 5DP1A 2VTEA 4N5LA 1QV7A 3MJSA 1TT5B 2Z95A 2D8AA 2GPTA 3OIGA 3NGLA 5C7LO 4FFNA 3PVZA 4RQUA 4RO0A 1Z7EA 4CM9A 5F1PA 4F46A 3UGKA 5IDXA 1XU7A 3KYDA 4J9VA 4NZ9A 3I9LA 5L9AA 4J7XA 1X14A 3D3WB 5L53A 4DLBA 4LVUA 4RLHA 4YYZA 4WCFC 4WCFB 4Y6SA 1B14A 4MJLA 1SBYA 3DBLB 4OJNA 4BMVA 1CERA 2PZLA 2R6JA 1HE3A 2I67A 2D59A 4F45A 5K9ZA 1CEQA 1YH3A 4WE3A 3F5SA 2YY7A 3GUYA 2QRLA 1MG5A 4I5EA 4LK3A 1ONOA 2QIOA 4OXKA 1WDKA 3TL3A 5A3VA 1ZW1A 3WIEA 4RJTA 4TVBA 2GLXA 3KETA 3UICA 5BR7A 2EG9A 3SX2A 2OBYA 1O95A 1I3LA 4GAEA 5DBFA 1T2CA 3U5TA 2E37A 2P4QA 3HZZA 1RWBA 3H9UA 2EJWA 3M2PA 4CQLB 5BQFA 1E1NA 1L1FA 3WQQA 1ADGA 1GEGA 1DFIA 2C7GA 4OYRA 4ZU3A 3RVDA 4YT2A 4DXHA 4AFNA 3GRKA 3E03A 4W7HA 1YB5A 2G1UA 3PDJA 4R68A 4OO3A 3TQHA 4CMKA 4Q39A 1QYCA 5L7YA 5ENVA 5EJ2A 1JQBA 4Y6RA 1EVJA 3GDGA 3DZGA 3ZWYA 3L0DA 1AHHA 4BNIA 2BF7A 3PYXA 1NAHA 3HUDA 4AJJA 4I8XA 4R1TA 3KSUA 4CM5A 5EERA 3OM9A 4O0LA 5TJ9A 3S55A 5JAZA 1X1EA 3KYBA 4Z9XA 4BO1A 3DEYX 5DBGA 1XDWA 1K2WA 4XWYA 5AOVA 3ZH2A 2X0JA 4LW8A 2DTDA 3QQPA 3KTDA 2UV8A 3RKUA 1MFPA 4RF3A 4CLXA 3WMWA 3FWZA 1Y6JA 3OP4A 4R69A 4RZHA 4ZICA 1X15A 3BMNA 5B37A 4NI5A 3D1LA 4YAIA 1UXIA 4NU5A 5JMPA 1DAPA 2OOSA 2X6TA 4FC7A 3SLGA 3MJ4A 1YJ8A 2Q99A 2B83A 4IS2A 3D4NA 1ID1A 2VT3A 1I2CA 3RBZA 4IS3A 1SC6A 3VAZA 1NFRA 4FN4A 5BSEA 4R16A 1I0ZA 3ZV4A 3P2OA 3QY9A 3FRJA 1PZGA 4MVJE 4NFHA 4W4TA 4LCJA 3H5AA 2HJRA 2PK3A 5TSDA 4BVAA 1DJQA 3O38A 3OQ1A 1U8FO 1U2DA 4Q3NA 2WMDA 4YBZA 5B4UA 4WECA 4A27A 4HXYA 4XR4A 2VQ3A 3WR5A 4WLNA 1PGJA 3H9JA 3FBTA 5JO9A 3H3FA 3I9NA 3OJLA 3GK3A 4I08A 3KYDB 2HMTA 4D43A 2A92A 3ASVA 4EEZA 2Y1GA 3ONFA 3BAZA 5BT9A 2PKQO 2B0JA 1JWBB 1H93A 1NQTA 4JIGA 4MIEA 4E5KA 5G0UA 5JY1A 1RM5A 5L4NA 2GZ1A 2A35A 4FW8A 1E7RA 3KM0A 3DDNA 3GVIA 3VKUA 2O23A 3ANMA 2AQIA 3COSA 3FNHA 3RU7A 5HM8A 1O0SA 1Z73A 4J49A 4JBHA 1JAXA 4TVOA 4BGVA 3PJGA 4E12A 3Q3CA 3KXDA 4M89A 2Q1WA 3D64A 5CPBA 4ND4A 4F3YA 1KERA 2GD1O 1R4NA 5KVVA 4PRLA 4RV9A 4IJKA 1NHWA 2RBEA 2NSDA 2VWGA 1HDOA 2C07A 4XJSA 1KIFA 4L8VA 1GQYA 5AYVA 1NVGA 2AE1A 2FR1A 3N74A 2QYTA 2NM0A 3E9QA 4PLVA 5KVQA 4B4UA 1LLQA 1N2SA 2AA3A 4NG5A 3IQDB 2HRBA 3H5RA 4CLOB 1PGQA 4KQWA 3QHAA 3PYMA 3M1AA 5IDWA 1DB3A 3OJEA 3H8VA 2LDBA 1MB4A 4TROA 1I32A 1MC4A 3B20A 5T8KA 4KUEA 4D44A 2VRBA 3HG7A 5GZ6A 3FBGA 1S6YA 2DBVO 3G1UA 3MJEA 5KTKA 2J8ZA 4E31A 3WLFA 2WDZA 3GG2A 3UN1A 3PHIA 3AFMA 4R1SA 1HETA 1QYXA 4JBGA 1EFLA 4D3SA 2YUTA 3C24A 3QVWA 3BHJA 4CLEA 3VVCA 2J5RA 1ONPA 2Z1MA 5IG2A 4Y8VA 2O7SA 4FJ2A 3W8DA 1V3UA 1F14A 1GYQA 1ENOA 3TL2A 3PHLA 2O3TA 2O3RA 4BNZA 5A5FA 2YYYA 2HSDA 3ZWCA 5C37A 1CJCA 1ZEMA 1E5QA 3BMNB 1EQ2A 3ZHXA 2PGLA 3VZRA 1K0UA 3JD4A 4LRSB 2B5VA 2OZPA 5I7VA 3R1IA 4I5FA 2VUSA 3UCEA 1KVRA 3HFSA 1P1KA 4PLGA 3LVFO 4GMFA 1UAYA 1SZJG 4LRTB 3S2IA 1ARZA 5CFZA 3DHYA 3E9MA 1WW8A 4HFJA 3CXRA 4CODB 2UDPA 5G0WA 1ML3A 5L4SA 4U6QA 1LLCA 1X13A 4FGSA 4N7RA 3EMKA 1HWYA 3K2EA 2HMSA 1U7TA 3H6KA 1R4MB 3U4IA 4R51A 2EKLA 1P0FA 1PJSA 3A28A 3UHAA 5T5QA 3D0OA 3JQ8A 4BGEA 4JJIA 1G0NA 4XKJA 3WOHA 4GX2A 1T2FA 1OC2A 3A1NA 4TKMA 4J2HA 4RF4A 1U9JA 1DC3A 1E7MA 1YRLA 3GZ4A 1HE2A 3GGOA 1ZKMA 1TVEA 1WDLA 3G1TA 2OGUA 2I66A 3GY0A 5IDYA 3TFQA 2PD3A 3TOZA 3UXYA 4BNXA 4HX5A 3R3SA 4LMRA 4DGSA 3GR6A 2ZYAA 4NR0A 4CUKA 4MVJM 4UVEA 3TPCA 1BMDA 3CIFA 2Y66A 4PG8A 1H6AA 1YBAA 4QO7A 1NR7A 2SCUA 1GQQA 2V6FA 3GPDG 3X2EA 2GN6A 1W0CA 2ZTMA 5CDUA 4GWGA 4YT4A 1R4NB 1AN9A 3QA9A 5HRUA 2WE8A 1Z74A 1HDZA 5G4KA 2FSVA 2AEMA 3PHJA 4J1SA 2Y1FA 2V7PA 2YHIA 1HEUA 5JS6A 4R9SA 1JVBA 1TA4A 1U3VA 5KKCA 3KSZO 2LDXA 3KHUA 5ENDA 3WFJA 2IDZA 2H9IA 2WYVA 1R66A 3ZV6A 2AQ8A 1LC3A 1MX3A 1EUDA 4F6LA 3DC2A 1HDRA 5AXBA 1RYEA 5TT1A 3H5NA 2HAEA 5T8KC 4ZJUA 5IZ4A 1UDBA 5DOVA 4Y6PA 2X5JO 3DTTA 3FCOA 3LZ6A 4IQ8A 4Z9YA 3VC7A 3ZGYA 1T26A 4BNGA 4DUPA 3Q2IA 5BNIA 5TJHA 2GYYA 5KIAA 5IF3A 2O3UA 1ISFA 3F1KA 4BQPA 4G5HA 1PJTA 2OO5A 1F06A 2PGJA 7MDHA 4DVJA 4J7CA 1FDVA 4ALNA 3R0IA 2VN8A 3DXFA 9LDBA 1LQTA 3PLRA 1UP6A 4A10A 3BTUA 2ZIZA
chains in the Genus database with same CATH superfamily
1O9GA 1YMUA 3DWFA 1GSOA 3DW1X 4YO8A 4BXOB 4CN8A 3L1KA 3WQBA 4OTZA 2DGDA 4ATNA 2X7XA 2DUNA 1HYHA 2HBRA 2M32A 1GNVA 2N0SA 2XZDA 4WZBA 1NPDA 4G1CA 2B4KA 2H0RA 3TTXA 2GFHA 2Y9PB 1E1QD 1JH8A 5AH0A 2R8XA 8ADHA 4W7IA 3G5TA 3D81A 4IV8A 3I8SA 3IDAA 4ETWA 4RJ2A 3JVIA 1P3Y1 5AI5A 2FR8A 1NVFA 4QXMA 1GRCA 1ZJZA 4AP5A 3ZHBA 3CNEA 4CDMA 5F64A 5I7OA 1T2AA 4PC6A 1C8VB 3UK0A 1FP2A 2FEPA 1VIAA 4DQLA 4AIIA 3F78A 1UPAA 1WMEA 2EW8A 2QSZA 5KWEA 2VJMB 3BWMA 3MSXA 3U56A 4UUAA 1YFLA 3TUZC 5H4GA 5L3SB 1RI2A 3IAS1 4L8WB 1J0AA 4GX0A 3GGPA 4GX1A 4RL4A 4ZKEA 5JSHA 5G0VA 4CR8A 3RC8A 1L5RA 2FZ4A 1OLXB 5FEUA 1M0SA 1G18A 3AXTA 4OD0A 2JL1A 2B7CA 5AXDA 1NJ6A 3PXUA 4U5QA 1PJZA 3C6XA 3KFLA 2AFIE 4K9RA 5EZYF 1Y4AE 3IDSA 4HNGA 3CR3C 2DTXA 1QVRA 1M1YE 2B82A 1I01A 2DP4E 1GA1A 3GX1A 3GMDA 3MMNA 4JC0A 4Z99A 5EIOA 2BGUA 3RGGA 4ILKA 3BJEA 4MZXA 3T4EA 1X77A 3VR3A 3IOCA 4D8TA 1HDYA 4L5AA 4F3RA 2Z04A 2EZTA 3TQTA 1OX5A 3HRIA 3TEFA 4K0RA 1L7PA 4Q19A 1YOBA 1RFGE 3GQBB 2CMDA 2HCRA 3OCZA 3QV1A 5AHRA 2CVHA 1OXUA 5BV8A 3FOEC 3DB2A 4ESOA 5L3QB 4MUGA 1TFRA 2AS0A 1G6HA 1Z2EA 1RQGA 4MVJI 2AKYA 4JN6B 1MXHA 2ZS7A 3ANYB 1JHUA 3IVCA 5JAHA 3HNRA 2R0QC 3QSYA 3D6HA 4G0NA 2RMKA 1PL0A 1C50A 1E59A 1QGOA 4KG7A 4I66A 3BZUA 1MVOA 1TO2E 2VK8A 1LDBA 4GXRA 3AEXA 5EIXA 5HIAA 4A0RA 4B2LA 1QYRA 3BRCA 3KEQA 5CA1B 4DLZA 1XI2A 1SWVA 3Q3JB 1T4DA 4KACA 3C2QA 3NVAA 1BWQA 1VLHA 4OI0A 3VPGA 4B3RB 3DDCA 1R16A 5AK4A 1Z0FA 2P30A 1L8QA 2ZUTA 5JXJA 4Q7JB 2VWHA 4BLWA 5CK4A 2PKYX 4OHYA 1AUQA 1JXQA 4NZPA 4Y6OA 5E7IA 1FYXA 3RJMA 4EHKA 2AX3A 4L9RA 4OM8A 4BCCA 2PIAA 3Q40A 4YCBA 4ZVLA 3UT0A 1H8ED 5DWQA 3LF2A 2NT4A 1OROA 1U1FA 1F3OA 2JLWA 4LI3X 4M8LA 4W9RA 1R3UA 4ND8A 3PUIA 4AY4A 2NZ8A 2C7PA 2FSUA 1RVDA 2H11A 3OMLA 5JASA 4JCCA 4BFSA 1XZCA 5DOZA 1JWAB 5CCDA 3TX6A 1ILEA 1KH1A 3ETLA 2Y0CA 1DG3A 2P4EA 1OTHA 5CLJA 2M1XA 2BJWA 3ABIA 1JLHA 1YULA 3HFJA 4P8RA 5IKMA 3VR5H 4XWWA 4DR5B 2VK1A 2YRWA 4R84A 3Q9LA 3LO5A 1WL8A 3UT6A 2YVAA 2Q5OA 4OL9A 1QK4A 4PS0A 3ETDA 3G6WA 1JMYA 3WIOA 2C2OA 3WQRA 5L3ZA 4KXUA 4DF3A 1I6LA 1BJKA 4BFUA 5L45A 4V38A 2OFPA 3DM9B 2IRWA 3DBVO 4EJSC 3MN1A 1V6CA 5DSXA 3L46A 2OKGA 3NDBB 2A3NA 4O3FA 5DBHX 3USCS 4DMCA 2Q1TA 3BEDA 1NM5A 4QYIB 4IQ0A 3IAAA 3ROMA 2ZUBA 3A0UA 3ANLA 4QYTA 4WN9B 5KNCH 2CT8A 3NBXX 3QU5A 5IUJC 1JJIA 2DHDA 2R8RA 2W8ZA 4HJRA 4MRSA 1BCRB 1W4BA 1B4DA 1RRFA 1HRDA 2VH5R 3QXHA 2ID4A 1ECGA 3OQOA 3ZLBA 1U8CB 2RJ3A 4YJ2F 3C6YA 2XA9A 5ICSA 1GZ4A 2QL6A 3UBTA 3KIPA 2ICAA 3K3PA 4JFAA 1RJWA 4FX5A 2JA1A 3WGZA 3KKOA 4KYVA 1R0CA 2PUEA 4E5PA 1NNLA 1CCWA 3C7CB 2GEDA 4AWBA 4BWFB 2O19A 5M04A 1M54A 1V4NA 2DC1A 4P4TA 1VL1A 3MT9A 1XMVA 1L8AA 1NP3A 4OH1A 2E18A 4HTAA 1JLLA 3LDFA 3TNFA 2AN1A 5A4FS 4BFZA 4PCLA 3UUFA 1PNQA 3U4QA 2KLBA 2NZJA 1LDYA 4IVNA 2AZTA 3BIWA 1XDBA 2EHJA 4ZVQA 3S68A 4CQMB 2C5FA 2QVYX 4D6PA 3BXHA 3TLGA 5B4VA 2XMDA 5D1HA 3CLTD 4GVPA 4JOCA 3F5FA 5BV7A 1XSEA 3C3KA 5K8VA 1OA0A 4IMPA 2VHCA 4DABA 4Y3UA 2Y93A 4LZAA 1XU4A 1KOJA 2CDBA 4KIFA 5J1SB 3GLIB 3ZWDA 1N2IA 5ES4B 1YQXA 3N0TA 3S2UA 2ZI6A 3NLLA 3Q5DA 3YASA 2ERXA 4MSUA 4ZCMA 4G1EB 1Z75A 1V8FA 2O2YA 4QUIA 5BMVA 3CSDA 5CDFE 5JPDA 5F5LA 2VA8A 1BS1A 2INGX 2WP0A 3WYEA 5KJ1A 3PT9A 1EJ0A 1PEDA 3RIHA 2VF5X 5FAXA 4OV6B 1KE1A 4DJTA 4FU0A 1A0OA 4EG0A 2CFRA 1PD1A 2P2NA 3LT1A 1KEZA 2PH1A 4TUYF 4EPXA 1T3TA 3F9RA 4D97A 4JEHA 1DEKA 1MEOA 2C2ZA 4QQ8A 4JB2A 2RH4A 1Y8CA 2ATVA 2IUYA 1R10A 3WY9A 4NJMB 3MF4A 4J0DA 3GYGA 3I09A 4N3AA 3QYPA 3HTXA 5CT5A 3KXKA 4JYMA 2I6XA 1R6AA 1G8AA 5GIPE 4Z53A 3RTBA 4WUTA 4U2GA 5AVOA 1RM0A 5K1SA 3MWDA 1IN1A 1UBHS 1IBRA 1RAEA 1J9GA 3B5IA 1W6RA 2WNIA 3MBOA 3ELBA 2QTVA 4HYQA 2DB3A 4HZUA 4J7AA 1IK4A 2BR5A 4AMUA 3ZBUA 5C5CA 4RPGA 3LX5A 3SQMA 1GPDG 2BUAA 4H7EA 4OHWA 3CPSA 4M38A 4BTVA 5JPCA 4NCHA 1N9KA 2ZYDA 5AR1A 1G5RA 3JQBC 4LWPA 3UENA 3X3HA 3N6VA 3T54A 1GDTA 2AE2A 4QASA 5JDCA 1DMRA 3AIMA 4UZEA 4TWJA 2YMQA 2J7PA 1YXMA 2CZQA 4Q1EA 4UJ3A 4ER5A 3II6X 4Q3AA 3EVEA 4KQIA 3ORFA 1V5GA 3OFSA 1OASA 1ORIA 2IPXA 2YV3A 3GHYA 4JHXA 1AMOA 3HGTA 2Q6VA 1XVUA 2NG1A 2VATA 1XWIA 5DX0A 4FR0A 4TM7A 4UAGA 4HDOB 5K3FB 2PD6A 1N92A 2ATCA 2JH3A 3JAKB 1NBOA 3E27A 1OH7A 2O5EA 1FZQA 5HPYB 4RF2A 3EAFA 1C0KA 2I6TA 3DMNA 4XLZA 3TZQA 2E5WA 1HDIA 1UOEA 1DIOB 2B69A 2OENG 2PGXA 2SHKA 1EAYA 1MB0A 3RARA 1C7EA 3FTPA 4YAFA 3KKMA 3RHTA 3T7CA 4G85A 3HKBA 1DRVA 1KYVA 2A8YA 2FSIA 5DM60 4C3VA 3KB1A 1THMA 4X93A 4F56A 2YYZA 1LI4A 2XZTA 2H4WA 1IE3A 1T15A 2LXNA 3HCDA 2UVQA 4QBKA 5I9NA 1IUKA 5IWAB 2JFVA 4JP5A 5T3YA 2FUCA 2C4NA 3UPTA 3H5WA 4JJGA 4ZOBA 2NSJA 4BEWA 4DB4A 1E64A 1MO4A 4RKFA 3HUFA 4KXYA 3K1AA 4YYEA 3DFFA 4WSOA 2W2VA 5F5NA 1T6BY 2IEIA 2EWMA 3O92A 5FWYA 1YKFA 4M4SA 2NLOA 2BFCA 5CK5A 4EUKA 4I4IA 3ZH9B 1H2HA 1TM5E 1RAFA 5FX2A 4G4GA 4R1NA 3IILA 3IQZA 2J9RA 2OGTA 4MA4A 4NMLA 4AZ0A 3EGVA 4ZCIA 4LF8B 2BFWA 5ALMA 1Y3BE 4INZA 2IDMA 2IOFK 2OFXA 4HUJA 3AW8A 4IJVA 4LYGA 4CIWA 3GFSA 4QT0A 5E3JA 2ZZMA 3C70A 3P2MA 2Q9CA 3BWYA 4KZPA 5C8VA 2C4MA 4QPNA 3EOAI 1BOFA 4QTUB 4CCWA 3RS8A 3TLZA 2G9VA 1DBPA 1NZDA 5AW6A 1O0CA 4EZIA 3I9V6 2QRUA 5LLTA 4FFOA 1KF0A 2DLNA 4ZQEA 3LC7O 1WABA 2R6DA 3KKPA 3OOWA 3U4AA 1G60A 3A1EA 5A9TA 1SZCA 3WIDA 4EOGA 1GITA 2ZRPA 3AM3A 4WNIA 1GTG1 5FRDA 1CY8A 4Q1DA 1JHOA 4J4TA 5HCIA 1M5RA 2P65A 4ERNA 2B4QA 1RPNA 4O2RA 4X9XA 4N6NA 2VAWA 3DNFA 3TOVA 4CW7A 5TQ2A 5B4TA 4HQLA 1THTA 1VYUA 4C7JA 1EWQA 2OHFA 5AK0A 2CVFA 3AUAA 1OPXA 4X1YA 2WA1A 4LBWA 3CX7A 3VJRA 2X8LA 2FPUA 1VMIA 1H9BA 1ZM3A 4HNUA 1PK9A 2ETXA 1UBSB 2OE2A 2UYQA 2Y3IA 1FTQA 3T94A 2CL6X 3GB9A 3D8TA 3BCHA 2AK3A 4K2HA 4MR7A 3T38A 3FCXA 1OLOA 1LBHA 1M6EX 5E6UA 2J4DA 3L0OA 5CVCA 2A57A 3P5SA 4ZT5A 1UDCA 3KZVA 1NV8A 1E2KA 5ECGC 5JLAA 4P5EA 3UJHA 5F2NA 3ZHOA 2H9AA 3FD8A 1CJKC 1C0EA 3VHXB 4CKCB 3TLJA 5KX5A 1GNPA 3DHNA 4IF4A 2UZ4A 2V9PA 4B71A 4A73A 4GKJB 3MMXA 3WK4A 1G5TA 4MUHA 2HCJB 3U3KA 3D6JA 1ZL2A 1AKTA 2ANCA 1QH9A 1B8OA 1RTKA 3OAAA 4L0CA 5K8IA 4DR1B 3GRZA 3CNOA 2VHXA 1IRIA 2ABWA 4ESVA 4MUXA 1G8MA 2OHOA 1G16A 2C1EA 4II3A 2GSDA 4DSZA 1C3EA 3EFHA 1SG9A 2TMYA 1EX9A 4LJRA 4KQKA 2VXYA 4URWR 4KX3A 1YASA 2JD2A 4HDMB 5JXWA 3FOAA 1A8SA 4ZP1A 4AW9A 4QVIA 2H1IA 2DH6A 2W11A 3HJBA 4N9QA 3T5TA 1Z4MA 3K6JA 2XXBA 3SR3A 3AF3A 4WUVA 2ZUCA 3QX8A 3M9WA 3UWKA 1AXGA 2I6GA 5HZKA 2YFHA 2F3TA 1K88A 2BV3A 5J1TB 1J56A 2E9SA 3DPUA 3BM5A 1EDBA 1AURA 2W42A 5ALYA 5ETJA 3JYNA 2O8FA 1AKYA 1Y80A 3NHUA 2FPIB 3OOEA 4TSFD 5H81A 1J33A 3DO5A 3JD2A 5U4QA 1GG9A 1H94A 2BMAA 3DV9A 4AMYA 3ENNA 3ZDDA 4QSHA 1Q44A 2B35A 1U0LA 1JIIA 1SBZA 3L7AA 1M6HA 2FRDC 3MWYW 3H1BA 2ORIA 4IJWA 1CUDA 2QEQA 1GKKA 4WNAA 4PZEA 1KNQA 2QQ5A 4XYMA 4YH1A 4Z9FA 4B3DA 2ZREA 1M6WA 4HLDA 2IUUA 3D0RA 4BGUA 5ABPA 2BFDB 4ZT3A 3NZEA 2Z2XA 3A3PA 5CUQA 4BFCA 3ZV7A 4YR7A 1T24A 2G83A 1RI1A 2Z2YA 1OT5A 1WJGA 1HLGA 2O6LA 3HYSA 3Q9SA 4A92A 4AMVA 4CR7A 1JDBB 1VL2A 4OGWA 4LKRA 3THYB 4B83A 2Y1EA 3D4LA 4S12A 3OHSX 3MUEA 5K3AA 1UMCA 2EIXA 1HLPA 3M81A 4BB0A 3L79A 2XDWA 4M98A 4O2LA 4J76A 5K51A 5CB4A 3U16A 3QPDA 4CLRB 2AXPA 3L41A 4MW9A 4TL8A 3ERCA 4KLZA 3IQFA 3O7WA 5AUNB 4JJFA 2XGMA 5E9AA 1CC1S 1MV5A 2G9RA 3P45A 3PICA 3V7WA 4Q4AA 3MRVA 1WZEA 4F2DA 2ZCVA 3V3TA 1PD0A 4BJ1A 1O54A 2FRXA 4BBJA 3D4BA 4R0VA 4YPOA 4X65B 2UZAA 1OBFO 2OBNA 1XPUA 1VRCA 4K6HA 5J2TF 3SIWA 2JJYA 2PAAA 4XRGA 2Q3BA 2ZB8A 2D8MA 4Z3OA 4GQIA 2P4HX 4KWEA 5BXYA 1ZMBA 5EJ8A 1XPOA 5LYYA 4OXXA 1SC3A 1BWSA 1XZDA 2C5SA 4M6WB 1L5FA 1PWXA 1V1JA 3K8ZA 1F2UB 1A3CA 3I1FA 1ADBA 4YRQA 2HXSA 1U0HC 1Y8QA 3DT9A 4M60A 2P8JA 1M2FA 4NQZA 2VQDA 4ASUA 2W2XA 1Y9ZA 3OPYA 3Q11A 4HLUC 3ROKA 1FQWA 1CF2O 1OAOA 4HFMA 2JLXA 2X8BA 5LNK1 4JOBA 1E9AA 3KJNA 4PC1A 4PGAA 1V7CA 1SKAA 1WDMA 3SSMA 3HS3A 3D8HA 4XRRA 1K89A 1LTQA 3WKDA 2CJXA 5I4KA 4YCNA 2P9ZA 3PJEA 1V3TA 3RASA 5JS1A 4YXFA 1Y1LA 2PR2A 2H5LA 3VZBA 4DCNA 1QQ5A 5KTSA 3LTEA 1Z45A 2ZXUA 3TEMA 1GILA 4Q3CA 4OX9B 1NUPA 5E7JA 3TMKA 2JCXA 3CH4B 1Y7TA 2AF3C 1YNOA 2D0OB 3ZU5A 2DH5A 2J0EA 5JYDA 1E1CB 3E1SA 5TLSA 3JCZA 2HSWA 4LXYA 1KYTA 4BIMA 3VTAA 3D4PA 2P9EA 5JFOA 1AA6A 4ZRDA 2P3SA 4R6XA 1E7SA 5KYGA 1BX3A 3QEKA 1CR1A 3FR8A 4MQFA 4NECA 1FFYA 2Q2VA 4KAXA 1A7KA 4EO9A 3H87A 2Z6VA 1U2ZA 3KOZA 4G5OA 4PG4A 1ENYA 5AT1A 2XZPA 4FBGA 3CH5A 2ZRKA 1TA9A 3AFIA 1C3VA 3NUGA 1YOVA 2XDQB 4RSRA 4V0NA 4WFQA 4Q9KA 4OUDB 3X43A 5BVGA 2OTCA 3OC6A 5B57C 1QF7A 1A9QA 1GXSA 2XOXA 3G59A 1Z8HA 1KI6B 5HIKA 1ZM7A 4X60A 4OJKA 4EVSA 1XZMA 4RENA 4Q0MA 1JP7A 2CJFA 2QOEA 3ZKAA 4S1TA 1KQPA 5KYYB 4C14A 5EE1A 3P0IA 4EMTA 5JTTA 2XYVA 1NVDA 2JLCA 2ZIVB 3O8OB 4FIZA 2HF2A 3HKEB 2HJGA 3KDPA 2D2EA 5HBRA 5K8LA 1TGYA 1PG0A 1EK5A 4MZDA 3V1YA 3NNNA 4BMOB 2X8JA 5G0SA 4F3NA 3HVHA 3BXEA 4KVZA 5B2EA 1QQBA 1CUSA 4HB3A 3KT3A 2Z6UA 3H9CA 1GL9B 2FH5B 5DYIA 3NAZA 5FLKA 2XODA 4H18A 4P2BA 1HE8B 2QGZA 3I8XA 5HMLA 3RYHB 4C0KA 5HJ2A 3RJ9A 1OZ0A 4HB2A 3WX0A 3R9XA 4WLFA 3I01A 2QYSA 1JIJA 5D7NA 4D46A 2PBLA 3OHMA 2H85A 2GBFA 4KLNA 4O4JA 1H3EA 3FHTA 2J33A 3AU9A 4ZGBA 1A95A 5DNYB 2G4VA 2YXLA 2Z58A 2X3YA 4EKYA 1PDVA 5AKIA 1R8XA 1WF3A 4RVOA 2ZZNA 4EG4A 1NV9A 4DKXA 1A27A 1NWCA 3U09A 5JWRA 3OP1A 3L93A 3OOYA 1MG0A 1MZVA 4LIPD 4WDRA 3EC1A 3O2QB 5GONF 5M7EA 3I9V1 4D42A 3IT2A 3OZWA 1E1QA 3P2IA 1NNSA 3Q10A 3QVLA 2R5WA 4JD5A 2VUTA 2Y2VA 4TYNA 2R5NA 1JILA 5JNTA 1ZHHA 1NKSA 4ZU6X 3VR6H 1SGWA 4IUCS 5BQFA 5ICMA 3GNLA 4D4JA 1RZRA 1UDXA 4KVGA 1DCMA 3L8DA 1Q7CA 3ZJ4A 2CJWA 6ADHA 5LQDA 1NBME 1P0CA 1T29A 3CZRA 1RYMA 3K4QA 4G0VA 4DDMA 1Z2DA 4DM3A 3ZLUA 2ZSDA 5T7BA 4GI2A 2F90A 2BTQB 4WWHA 2WYOA 1RE1A 1YKSA 2F3RA 1DIHA 1T1RA 1N3IA 5AIAA 1J09A 2F3UA 2JAUA 3K32A 1QKJA 2AG6A 5F1OA 2W2KA 3S3TA 3Q15C 5C9ZA 1ADFA 2M98A 4JGBA 2GJ8A 1ABBA 4HNHA 5K0EA 3H3JA 4QBTA 2H2HA 4DV4B 1ZIDA 4I4NA 3CW8X 4WKOA 4UD6A 5I4IA 3SC3A 5FTKA 1I5EA 4KHPB 2HK7A 2PL5A 4H7HA 1R5JA 3A37A 2REBA 2O2CA 4YMTA 5CM2Z 3PGJA 2O20A 2CV1A 1CNFA 4G1UC 3IEIA 2XNKA 2L0XA 2Z5VA 3RTDA 3R3YA 2ZS8A 3ZW8A 1NC1A 2PY6A 4BE7B 5HK9A 3MTBA 1MO5A 5EMNA 4Q16A 4CMEA 2D7CA 3D7KA 3E6AA 3WWOA 1DX4A 2QW0X 5TDHA 4JKOA 1UFOA 4PZCA 1B0ZA 3WG9A 4DG9A 4YMVA 3DWIA 3HC7A 4G24A 4QM7A 4OYLA 1OI4A 3QMMA 4MB0A 4U2DA 1MH9A 4MRNA 3NWBA 2H0AA 4D9HA 5C7OO 2JEYA 3A2LA 2OMKA 3RK0A 4AKSA 1P61B 1SXGA 1XHEA 3DOOA 4JI7B 2JFQA 1SA0B 3L8HA 1T2UA 3N39C 1Z13A 3PX7A 4F8JA 2QLMA 3FDIA 4DNFA 4X97A 4PNEA 5JQGF 4W82A 5KKAA 3LNCA 4KKXB 3CSUA 1T5HX 2GF9A 2ZYUX 3HYLA 4KE7A 4EJSA 1J0EA 1QG0A 4UXJA 5AWFC 3WIBA 4G26A 1GNLA 4KXFB 2QL5A 3LRXA 2PWPA 5JAQA 2DF8A 2PZMA 2Q0SA 4Z86A 4A6XA 3JQ7B 4ZRNA 1P1HA 1OBHA 1HO3A 3DMDA 4KO8A 5F4BA 1ECCA 2QD2A 2CVOA 1C29B 1KYIA 3Q88A 1P0MA 5IMSA 4E7PA 2P3OA 4OI1A 2C2KA 1RYNA 6PFKA 1ZMRA 4AMGA 2QZZA 5JAPA 3AV3A 3ZGLA 3ABQB 4J2TA 5FI1B 4LYJA 1KDTA 4QVKA 1K8RA 4Q6WA 4CETA 5JDIC 3CVWA 4LF4B 4BV3A 1Z8NA 1Z26A 2WJVA 4BNHA 5DCWA 3L9XA 4FZ3A 5B3AA 4HNAB 4QM6A 2VAPA 4F04A 5GGXA 3BHIA 3OU7A 4M1OA 1CU1A 2YVLA 3QV2A 1MGOA 5COBA 2BGMA 3FCYA 3P9PA 4OLFA 4B75A 3GVCA 2Z8XA 5JXHA 4PAGA 1SOVA 5DHUA 3WNVA 4C4AA 4DIOA 3RRFA 3OOJA 2RJNA 4GSLA 4EHBA 3OEED 1M1ZA 1C7FA 1XAHA 1ZU5A 2DVMA 2GWRA 3IUNA 4N40A 4YREA 3WWDA 4C5AA 5FF9A 4EVIA 3E8XA 1JDPA 4TQ9A 1YQUA 5FL7D 2FCAA 5LFAA 3W5DA 4MCHA 4PTZA 1YR1A 3ZTYA 2I65A 1OYVA 4RLQA 5FPKA 1M1UA 2A5DA 1D9XA 4S0XA 5H83A 3WGUA 5EJIA 4R0MA 3SZ3A 5KYXA 4HGQA 4FFRA 3V1NA 4B7CA 2XSZD 3I83A 3DZIA 2WF7A 1R1DA 2IP4A 1XMSA 1VG8A 2K4MA 3BFXA 3P9QA 4O4HF 3WS7A 4ALKA 5FT9A 4C20A 2YV1A 1II0A 2NU9A 3TPZA 1C7QA 3CNQS 1MAWA 2YHIB 1FS6A 1Y5RA 2FHPA 4LRXA 3U19A 1Z5GA 2BFOA 4R1OA 4CM3A 5IC5A 3NIWA 5JJ5A 1EM8B 4RQAA 1X7YB 2ZKIA 3RROA 2RGXA 4GD3Q 1NVTA 4JELA 2X1VA 1WZUA 1TTQB 5IS2A 3TB4A 1IFXA 4MRPA 3QOYA 4OGKA 2FG6C 3IH5A 4OATA 3RU9A 1S1MA 3OZTA 5COAA 2W2LA 4CMHA 2QX4A 1HDCA 4F2WA 4GL2A 5JJLA 4BLQA 1BYUA 2JGKA 1NVBA 1JS1X 4WPGA 4BNUA 4ZMRA 4TT3A 2FFAA 3QEAZ 3DEFA 1C8KA 3N8KA 1TGVA 2HQRA 3BMCA 3D2CA 3AHIA 3FA2A 3INRA 4RYDA 5FYDA 1JLRA 3NBMA 4LDZA 3N6XA 4R9VA 4L16A 3B6IA 1A7UA 2QG6A 2IYVA 4JNKA 4OA5A 4WXMA 2KMLA 2X5KO 3O4JA 1DU4A 1DL5A 3U26A 1QV9A 3W04A 1M2WA 1UKZA 4QGGA 4YUAA 4AQDA 2ORED 1GOTA 3PGLA 1G3MA 1V35A 1JR2A 3M6LA 3S1LA 4AMZA 4ACBA 1ZCZA 2Z9CA 2P9JA 4EA6A 2VK4A 1FFHA 3L6DA 1LPSA 2HLPA 2O8EA 1AS2A 2AMVA 3EVBA 4INPA 1I2AA 3FPFA 2ODTX 2HKIA 5HF8A 1KPHA 1SUBA 4F5WA 4WZBB 5J4VA 3A9RA 2PZ8A 2F1HA 3E7WA 4DLXA 4LK2A 4OHMA 1NXQA 4BO2A 1UH5A 5DV9A 4MRMA 4DB2A 2NW6A 1JEDA 1L8LA 2HO4A 5ALIA 4ZI7F 5IULC 4IHJF 2PUGA 7YASA 1Z6AA 3IQWA 3E4CA 5EUBA 3WLMA 1L2TA 4YPFA 3FPBA 5A05A 1GQOA 5LMUB 2V58A 1VJRA 2JIPA 3OZCA 5KWVA 4MRVA 3AFHA 4U9UA 2BMVA 4X8OA 5LBUA 5B3JA 3O4HA 1C0LA 1DAIA 4IBOA 3ZI0A 4XQEA 1OYYA 4ZJPA 1W8IA 3IPCA 4KI7A 4EO4A 1N0WA 4L9AA 4RTQA 4Z7OB 2CL0X 5BN4B 3ZZTA 3PWKA 2GS9A 1GZDA 5LP6A 2ADFA 2IEZA 3A2KA 2IXFA 1JMVA 5JSQA 4WBNB 3DXYA 3STYA 3OZAA 1RYBA 1ZRHA 4PY2A 4U2FA 4CG2A 4ZCLA 3KKNA 4IDQA 4NYMQ 3TJRA 1YIDA 2NYVA 3HB0A 1E6KA 4FT2A 4U6SA 3GFRA 5IXSA 3BWEA 4DIMA 2P0AA 1JQKA 1OQAA 1QSGA 2A88A 2Q6LA 2VT7A 1FDRA 5AM2A 3P0EA 1FJXA 4FS3A 1D1PA 4TL7A 4C2TA 4RD6A 4XPIA 4IH4A 1T2DA 3PPVA 3TRIA 4M49A 2ZVJA 1UMDA 3KB6A 1N6IA 1ZKDA 4ZVUA 4M55A 3RREA 5IW8A 3AEKB 2GB4A 2PGNA 1J2EA 2DQ4A 1M2EA 1VG1A 1MORA 1QZ3A 2PRKA 2VQFB 3FXAA 3SPXA 1Z8DA 2C4UA 4QDUA 1PT8A 2YX1A 5C2JB 1Z83A 2G80A 2R1VA 3AM5A 3GFGA 3KSDO 4YAJA 5HP4A 3QJGA 1Y37A 4B6OA 2IELA 2EFEB 2ZE7A 4RPJA 4B7XA 5AVQA 5LYJF 1PQYA 2N3ZA 2ZIFA 4QXAA 3O8CA 2E4WA 3GJQA 1UJMA 4FFSA 2JS7A 4W5QA 2HZBA 3AM1A 1WU7A 2Y0DA 5JADA 4ZVVA 1VYVA 3FLAA 1JKXA 2Z3VA 4LJ6A 3AB7A 3KUXA 2XAUA 3ELDA 1Y5IA 1NW9B 4LE0A 4YRCA 1CNMA 5DYTA 3T3DA 1YJCA 1XL1A 1EDOA 1GQRA 1XXHA 4KQCA 4LV8B 3DFUA 3RJTA 3IERA 3SFVA 4E46A 4M0DA 4FR5A 1QB8A 5JYEA 4BJ3A 3CKKA 1RYFA 4TMZA 2COEA 5EESA 5J9FA 4C7BA 3F97A 2LIPA 4KTTE 3T4PA 1CE8A 2WM9B 2WUGA 4FVTA 3HYTA 1GZ6A 3ND5A 3DAHA 3MHPA 3A9SA 3PGXA 2O2GA 4D4KA 4OKNA 3W9YA 3E22A 3ESBA 3QUAA 3WLIA 1H0SA 3HVKA 2C7OA 1VE6A 1G8YA 4UATA 1B3BA 3EQZA 3IO3A 4ZTZB 1E79A 4G0MA 1AUOA 4ND8B 1DARA 2AOWA 1AV7A 5I9TA 1Q16A 4V24A 3TW8A 3HDQA 1D2AA 2YHAA 1HE4A 3ONEA 1KZ9A 3DCIA 5L4LA 3DCJA 3OH8A 4BMNA 5AD1A 4HAXA 5HK8A 2WUDA 3CZ9A 1X39A 3MTIA 3VH1A 4OAOA 4BNYA 2DFPA 3DZBA 1J8YF 4UM5A 4OSPA 4ZOAA 3K5PA 2IH5A 1HG0A 5BUCA 2XYPA 1CP3A 4PRKA 5E4FA 3GLIE 2B1GA 3EAQA 4HAWA 3FJOA 3PCXA 1R8YA 1O6FA 5TF0A 1M83A 1WKCA 3DVQX 5ANRB 1NBWB 4KXVA 3N07A 1DS6A 3BYZA 3N2LA 2GMWA 4IDPA 4OXNA 4UDXX 4KITB 1ND6A 3OF5A 5LCXA 4BATA 1FUIA 3VTFA 1G6KA 4BFWA 5KOHA 1RRMA 2IDJA 4EW1A 1OWPA 2J3MA 2P9TA 3KUCA 1FOEB 1P5RA 3SJUA 1K4MA 3UJ6A 3V4FA 3T4XA 3MYRA 5HQ3B 5CEFA 3I3OA 2VAMA 4G2TA 2RFLA 4G0YA 1BX1A 1U3DA 3IIJA 3KOWA 1OH8A 5EP4A 2MWMA 3FPCA 4ND1A 3L8GA 1IQRA 1R4AA 4OVKA 4PSUA 1SIUA 4G89A 3UK7A 1JR6A 2Q4DA 3GELA 1JR3A 5JVDF 2FPSA 2FF5A 3N87A 4OQ4A 4CKEA 3AXSA 1OHHD 1FNCA 5M29A 2ZSIA 4FD2A 3OEYA 3U1VA 1KIMA 1HEYA 1K5DA 1NP7A 1ZD2P 4GPZA 4Q3KA 1Z12A 2NVOA 4AJ4A 2IE8A 3F6PA 4UARA 5H82A 4MKIA 1B2RA 2QN1A 4RK4A 3PR3A 1SCIA 1KS9A 4KDEA 4KDFA 2V1UA 1AKWA 4LYEA 1T9KA 4KMRA 5JCJA 1H2BA 1U8EA 3G2IA 4KK4A 4ZZ1A 2J08A 3LI2A 2V54A 5DSTA 3ZY2A 1EZZA 1Z3CA 2DPXA 3D7RA 4JXKA 2EARA 4A8JA 2B36A 1F6DA 1N1GA 1T3LA 1Y1QA 2ZITA 2G6TA 2RAFA 3PDHA 2OG1A 2PN1A 2X19A 3O2JA 4CIBA 1IQPA 3WO0A 5K6AC 4DUYB 3TZBA 1X0VA 1ZK4A 1DGQA 2NADA 2WVHA 3I72A 1A5TA 4UCFA 2HTFA 1GPNA 4HDSA 5GVRA 3VDQA 2X40A 1PSZA 2GZMA 2C1XA 2ZJZA 3HR4A 4ZJYA 3OZDA 1RP1A 1SCKA 1Y81A 2CDNA 5EAIA 4MW1A 2DYKA 3OCYA 3G17A 3AR2A 2J41A 1ZH2A 2FFHA 5CX1B 5BMVB 1GL6A 1P6UA 3NVKI 1YBHA 2BEWA 1CRWG 1M7GA 4Z4FA 1KFCB 4XH9B 1NQ5A 3I4CA 4CF4A 1N33B 1GVNB 5LB2A 4ZOLB 2YZNA 4U00A 3V55A 4EZEA 4I0WB 2ZYVX 1X92A 4F7WA 5JEEA 1EUYA 1D2MA 1KI4A 2ZRMA 1YQGA 2Y1WA 3DE4X 4M54A 4X24A 4XB6B 3RVLA 5DM70 1FW6A 4FNOA 1SOMA 2CZGA 3NHKA 1ZH6A 4DN6A 4EGFA 4JDUA 4PAWA 3AUYA 2JGJA 2R6CA 4TSFA 3H6HA 4DC0A 4UHKA 1EFRD 3S0JA 2Q1XA 4OU4A 3HVUA 3ZWKA 2XD9A 1A50B 1BSVA 2ZTLA 4IOLA 3S2FA 3G88A 1B8UA 2AT1A 3X44A 1FX1A 1KMHA 1Y3CE 2L18A 2OP1A 3ER6A 2KB0A 3GPBA 3KQQA 1DLJA 1PF7E 5C8ZA 4IWXA 4TLCA 4UM9B 2WM3A 3ZWVA 3FUCA 1YUBA 3P0FA 1CUFA 5H9VA 1M2OA 3CJQA 3IIIA 3BWDD 3IUYA 2H0QA 3P9ZA 3QU9A 2N9UA 3GT3A 4CPDA 2ZM6B 2ST1A 2ZIXA 3RJ5A 3NYQA 1UZNA 3WTCA 2YC2C 2VDJA 5EFZA 2IU6A 5HIMA 1EFPB 2GN8A 1AN0A 2E5FA 4C7KA 1KJ8A 1QQTA 5C5IA 4OK3A 4GKAA 4EENA 4R5MA 5EWLA 1XNQB 1X7ZB 3GRFA 1Z29A 4I55A 5BRNA 1KI3A 1PNOA 5C8YB 2BUBA 2Q45A 2GTHA 4QJIA 3ZNQA 1ISGA 4UTOA 4MI3A 1GQFA 3LBFA 4U9IS 4W5JA 3V7FA 2LRHA 3LXRA 2XMGA 4P83A 4MYDA 1GUFA 5KS2A 2HPAA 3LT0A 3FOFC 2W9XA 4OOFA 3EDRA 3B13B 3KT0A 4M1MA 1VJ0A 4IDAA 4PR0A 1E3SA 1I36A 3GEDA 3VYTB 3PEEA 4XWGA 4D6YA 3GCGA 2J3KA 1XXHE 4EO7A 4EY3A 5IAOA 1NZFA 5LOVF 2V7XA 1E1YA 1GUDA 1GGNA 2FEAA 2WPDA 5EG5A 3JZFA 2GEJA 4F4FA 3FETA 4OU5A 3STTA 4CL0A 1PFYA 1VGVA 1VTKA 2BEUB 4WZAA 4YO7A 5TV2A 4Z54A 1RQRA 4M1YA 2Z8ZA 3ROZA 3HKBB 4URZR 4L28A 4JLOA 1B7GO 4V0KA 5IZCC 1TE2A 2ZYSA 3PC6A 1QR2A 3ABOB 5TQ0A 2BFEA 3K92A 1F8YA 4KAJA 1RD4A 2C94A 1VB3A 2FP4A 4DIBA 3ZY4A 3LDHA 4GMXA 4B2IA 4BUZA 1VM6A 4U0KA 1BA2A 1X9IA 2AXEA 4NEQA 3QLUA 2DE0X 4Q02A 4TTJA 2OFWA 1O6CA 1S02A 3F47A 3AUTA 4NBWA 1T9AA 2D1SA 2IYEA 1WD7A 5FJJA 1JDVA 3U2QA 4CMCA 1W1UA 4OHVA 3K1AB 4EB6B 3G2OA 1JSCA 3NOQA 5EL0A 3UKJA 4GNKA 3LCMA 4F4UA 1SB8A 1QM5A 1N5IA 1Z6GA 4KSCA 4QHYA 4GYKA 1Z5NA 1ECBA 1K97A 1NQOA 2CXHA 2FR0A 3I05A 2VJNA 4J16C 3R7WB 4BC0A 5HZHA 2UYHA 3RSQA 3ZD6A 5FTWA 1N5MA 5KKNB 1PN3A 4TLBA 2J1LA 1GRRA 2Z1DA 4QGAA 4L74A 2ET6A 2GQ0A 3MT7A 5DYWA 1AGYA 3CMCO 4XM2A 4AZ0B 1C3OA 1B73A 1Y7LA 4UD2A 4XYEA 3B1WA 2VEOA 1M5TA 2FYTA 3MA0A 1ZIPA 1QHSA 1ISRA 4ROTA 4HX2A 2OXEA 1OWMA 4G07A 1RI4A 1YB7A 2DOKA 1MDFA 1BN6A 1NXOA 1SHTX 1U4SA 1Y3FE 1COZA 1MJGM 2QVCA 3HBJA 3HI6A 3ILYA 3M5PA 1ACMA 2VP6A 3B2EA 4KLRA 1IVNA 4E1VA 4Y2GA 2AJCA 5FJIA 5TIIA 4ENRA 1XLVA 1QGAA 2GXUA 1RBMA 1P7CA 1U8ZA 3DT6A 2R1UA 1OZAA 3K9HA 2O3SA 1BOOA 2FUEA 3O93A 4M8IA 3U4HA 4DLRA 2P2SA 1TUEA 4U6NA 2VJAA 2V7QD 2FSSA 2AMLA 3PQ3A 3WE7A 3U13A 2QAGC 3KZNA 1T8TA 3ORHA 2BCJQ 1DAHA 3FSRA 5CTJA 3IMFA 2CLHB 1C41A 1E3DA 5BSUA 3U3ZA 4B7ZA 1NYTA 2Z57A 1KY2A 3STXA 1U9IA 2D1QA 5TQ2B 2DQKA 3WMFA 5CXUA 2PS1A 3VOTA 2JLVA 1M76A 1QBGA 1AQYA 4X1YB 4HOYA 2BTOA 2GJKA 3IB3A 1WVMA 3QKWA 4LMBA 4QUJA 4ZV7A 2EL7A 1FPMA 1M2JA 2EW2A 4I5DA 3SDSA 4IIGA 1DG9A 4BLVA 1UOQA 4V3CA 4K9PA 3OPQA 1BRMA 1K8QA 1CZLA 1EXVA 5AI4A 4IQGA 4P4LA 1LWNA 1W2GA 5FUWA 1FMLA 4YJKA 1D0SA 3OPVA 1A1SA 2G0NA 1MT3A 1MB9A 4NZNA 4C4ZA 2D3TA 7REQB 4MV1A 3VNAA 4L6CA 3ZXYA 2JFNA 1GM5A 1E6MA 3UMYA 3QPCA 1IH8A 4XVQA 5DBOA 3SY8A 2GCOB 4JVSB 5JD3A 3QPVA 3FKSD 3MLEA 3S40A 2IVZA 1EJBA 1H2WA 4GOND 3KAQA 1RYZA 1CYEA 1EBBA 1NG9A 4RANA 4YRGA 1X19A 4HQ0A 1JDJA 1ITZA 1A4UA 4DC9A 4KMMA 3IODA 2GJSA 3QWBA 4QHSA 3KAPA 1UT5A 4FLEA 3ODPA 4BLOA 3VOBA 3EPRA 1BW9B 4PV7A 1XKLA 3WLPA 4BKMA 1Q50A 3OQBA 1P29A 2VHJA 5SY6A 4D45A 4JX8A 4LXQA 2VZ9A 1K7EB 3ZK8A 3MT8A 3UMJA 1EWYA 4D4HA 1AHPA 1RQPA 3JWEA 4C06A 3OKPA 3CW2A 3RUPA 4CGZA 3K9NA 4L4YA 1EIWA 4XTRA 4Y30A 4KQMA 1IN8A 2NVUA 3K5IA 1WQ3A 4OXIA 3AUXA 2O8FB 2X5XA 3K8QA 3EY9A 1FB5A 4TXLA 3UCFA 3VSBA 2DHCA 3F1LA 4II7A 1J0CA 3QI2A 3RG8A 3T1OA 3MGKA 3N2GA 4I1VA 1DUSA 1G6Q1 4M9UA 3ASUA 3SBXA 1EMDA 1G7TA 2ES4A 2DQYA 4C4OA 4KSBA 2OVBA 3D7LA 3ZDXB 2Y1OA 2EGUA 4URFA 5IF9A 3M3PA 2J09A 4D8VA 1J9ZA 2B8EA 3MNFA 2NTVA 3FCAA 4OYHA 3MXTA 3REOA 4C4PA 5C7YA 3ZWMA 4BNDB 4B2YA 3D6AA 4N9WA 4YWHA 2PMKA 4AWAA 1EHIA 1U7OA 1ISJA 2I2DA 2P6MA 2WWFA 3GT7A 3WJ7A 1NJ1A 2MSCB 2F1IA 2ZI3A 4LJ5A 1FSZA 4EB0A 3ETJA 1UMCB 3D59A 5HRCA 4ZTUB 1PV1A 4GXQA 1K5PA 1RJEA 3LPCA 5DHQA 5FPTA 1ODJA 1YVDA 3IA2A 4NAUA