3JYNA

Crystal structures of pseudomonas syringae pv. tomato dc3000 quinone oxidoreductase complexed with nadph
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
325
structure length
325
Chain Sequence
MAKRIQFSTVGGPEVLEYVDFEPEAPGPQAVVVRNKAIGLNFIDTYYRSGLYPAPFLPSGLGAEGAGVVEAVGDEVTRFKVGDRVAYGTGPLGAYSEVHVLPEANLVKLADSVSFEQAAALMLKGLTVQYLLRQTYQVKPGEIILFHAAAGGVGSLACQWAKALGAKLIGTVSSPEKAAHAKALGAWETIDYSHEDVAKRVLELTDGKKCPVVYDGVGQDTWLTSLDSVAPRGLVVSFGNASGPVSGVNLGILAQKDSVYVTRPTLGSYANNAQNLQTMADELFDMLASGKLKVDGIEQYALKDAAKAQIELSARRTTGSTILIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of Pseudomonas syringae pv. tomato DC3000 quinone oxidoreductase and its complex with NADPH
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Oxidoreductase
molecule keywords Quinone oxidoreductase
total genus 104
structure length 325
sequence length 325
ec nomenclature ec 1.6.5.5: NADPH:quinone reductase.
pdb deposition date 2009-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3jynA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3jynA01
2JD0A 1FMCA 3ZGYA 4CMJA 3PTZA 4J1TA 1PR3A 5KIAA 1XSEA 4R5HA 1BW9A 3PJDA 4AJPA 3DOJA 2HMWA 4GGPA 5BSGA 1YL6A 4J3FA 4FFOA 2I5PO 1YOVA 1YWGO 3RC9A 2DTXA 4NBRA 3KYBA 4W99A 4DPLA 1QYDA 1E3SA 3E8XA 2G5CA 3DBHB 1Y8RA 4PVCA 4HNHA 1PJSA 5JNLA 3O8QB 4D45A 3QRWA 2RHCA 2WD7A 5KJ1A 5IDXA 3TZHA 4E2ZA 5KTKA 2QIOA 3DXFA 1ML3A 3AFMA 2GYYA 4XRGA 4MVJM 1ISHA 3VPGA 5C7OO 4D3SA 1Y8QB 2XPCA 4I9HA 3PGXA 1SC6A 4W7HA 1E3WA 4LMPA 4R9SA 3A28A 4E2WA 4CM1A 4J1QA 1NFRA 5IFLA 3WX0A 2WEKA 1U5CA 4OYRA 4A5OA 1JVSA 1LBEA 4LGVA 4BNJA 2CSUA 4YJHA 4OQYA 3UW3A 2JD2A 5DOZA 3UCXA 2NADA 2NU9A 2F00A 3WMXA 1GPJA 3TL2A 3GG2A 4NIMA 4FOSA 2EHDA 3CIFA 4BMNA 2JCYA 2UYYA 3G1UA 4Z9FA 3HFGA 3S8MA 4U7WA 3RD5A 3ZWCA 4F6LA 1ENOA 3KB6A 1YDWA 1P1JA 1YL5A 1DC6A 2Y66A 3KEQA 4RL6A 3EDMA 4JLWA 3NT2A 3SBOA 1Y9AA 1MA0A 4NBTA 1D8AA 4O63O 5JS6A 4EUEA 1LU9A 2HO5A 4FC7A 2WYUA 1K89A 4TKMA 2C0CA 2J3HA 3FTNA 3ROQA 4EEXA 5JW6A 4FFRA 1DEHA 5HTOA 4B4OA 3U4CA 4BV9A 4GAEA 5EIOA 4A26A 2IXBA 1BW9B 3T7EA 1V3VA 1KVSA 2BGKA 2GPTA 4O6VA 3UXYA 2B4QA 3PP8A 1EE2A 4GWGA 4AJNA 4PVDA 2VZ9A 3LC1O 1YB1A 2EKPA 3IDSA 4MIYA 2P5UA 5EESA 1E5QA 3RBVA 3P19A 3OICA 2DM6A 4LRTB 5F1PA 3ZU4A 4BNMA 1A27A 2BFPA 3CE6A 3QVOA 4J2HA 4ZQBA 4YR9A 4EUHA 2R00C 3ZHXA 1PU2A 3V1YA 3O4RA 3OF2A 3NRCA 1QKIA 4GH5A 3FN4A 1ZW1A 1T2FA 1GZ6A 4IGEA 3OQ6A 5AYVA 1LJ8A 3AI2A 3K2BA 2ZB8A 3N58A 3WGHA 1HSOA 1F8FA 3RUHA 1ULSA 2F1KA 2FWMX 5TC4A 4CMIA 4FCCA 5K9ZA 1E3LA 3ST7A 1QYXA 4PRKA 1E7YA 3LT4A 3GGPA 1L7EA 3DHEA 1PL7A 4B8ZA 2GNAA 2GASA 3PFWO 3P2OA 2DPHA 4CLHA 4ZHSA 5H83A 1GADO 3BHIA 1CQIA 1JKJA 1EK5A 3B6ZA 3DB2A 5A9TA 4CLOB 1WMAA 5A4DA 4MVJF 3WJAA 3D1LA 3GVIA 3RROA 2TMDA 2G1UA 5JYEA 2C59A 1GD1O 3OQ1A 4WK6A 3PQDA 1NVGA 4QFCA 2C7GA 5EL0A 4CLOA 1CRWG 1U2GA 1W73A 3NUGA 4MVJE 4C7JA 2JFGA 3G1TA 4PZEA 5EN4A 5H81A 1MFPA 2E49A 1UP4A 4LSWA 1C0LA 3CINA 3F4BA 5EMHA 5BNFA 2PWZA 3E5MA 5G0UA 5FEUA 4OAQA 2Y93A 3JYOA 4ESOA 2I9PA 2NACA 5CEJA 2FZEA 1QV6A 2Q4EA 4PLWA 4XCVA 4AICA 1A5ZA 3I6QA 4R9RA 3G3EA 4IDEA 1HLPA 5IZCC 1GAEO 1P0FA 4BNGA 4JROA 1GZ3A 2WE7A 4I1IA 5B37A 4BQRA 4Z0TA 2IZ0A 4CUJA 1YJ8A 5C37A 1YVEI 4LCJA 1NFQA 1U1IA 3MJSA 1ONNA 1WPQA 4DIBA 4UULA 2JHGA 2Q2VA 3MOIA 1IHYA 3QWBA 2C2YA 3C1TA 4J0FA 2NVBA 3HDYA 4TMFA 3ADPA 4GVLA 3ZWPA 4CLEA 2ZYAA 1VKNA 5T6BA 4YJDA 2DBQA 1PWXA 5GZ1A 5T64A 1ISMA 1E7WA 1UZMA 4Z6KA 5DULA 3RWBA 3H4VA 2CDCA 3TOXA 1MB4A 1P1KA 2X5KO 2Y0EA 1FDTA 1LSJA 2GDZA 3L4SO 2E4AA 1V9LA 4U5QA 2FR0A 1E7SA 3DMTA 4HX5A 4NFHA 5COAA 5A9SA 3KO8A 4CJXA 3EW7A 1F8GA 4D42A 1ZMOA 5BSHA 4WCFB 2J5RA 4D7AA 4R5MA 1ISIA 1JKIA 1GDHA 3G49A 1TB4A 4CUZA 1GU7A 3BAZA 3GH3A 4OHUA 4WPGA 5ER6A 1PZHA 4I5GA 1H94A 9LDTA 1Z75A 1SAYA 1QG6A 3Q3CA 4CQMB 1GCOA 5DBGA 1AHIA 5HS6A 1WAMA 3SX2A 1CETA 4U0JA 4A27A 5L95A 1E3EA 1D3AA 1X1TA 4J1NA 2DU8A 2X5OA 2GN4A 2YHUA 1Q0HA 5U1PA 2BLLA 1H9AA 4QO8A 1EFLA 4HFJA 1E7MA 3DEYX 3PWKA 5CDGA 4DMMA 3S2IA 1UZNA 4J6FA 1BVUA 4J90A 1U9JA 1EVIA 4FGSA 3WQQA 3VPSA 4HWKA 2I3AA 3A14A 3ETEA 3RKRA 3LVFO 1G6KA 1P1RA 2Z1NA 2PLAA 3ZW9A 1YOVB 3R6DA 3GFBA 1AN9A 3QSGA 4EEZA 5DZSA 1BSVA 2E6UX 3KBOA 3NGXA 2PKQO 2J6IA 4R54A 4JJGA 5CPFA 1E1MA 1N7HA 3UCFA 2QYSA 4H3VA 1A9YA 2YW9A 4CODB 2Y1DA 1R66A 3GR6A 3OJEA 5B4TA 1LDYA 3OFSA 2GO1A 2O7QA 3ZWNA 5JAMA 3JD1A 1A71A 2BFAA 4HFMA 4A03A 3TF5A 2ET6A 2YHIA 4XDZA 1H2BA 3JQEA 3BA1A 1X15A 4RPJA 4YCAA 3WBFA 3WJ7A 2FR8A 1DLIA 3PHIA 4IIVA 1NPYA 4E0BA 4J4HA 2D3TA 1F17A 2QHXA 4PIVA 4IS3A 2HQ1A 2GUGA 3PIIA 4U0KA 1VL8A 1P77A 4F3YA 4R4JA 5L51A 2JCXA 3F1KA 4NPCA 4J49A 1QV7A 4NK5A 3OJLA 3L07A 1GQ2A 4QQRA 4WKGA 4BV8A 4L4RA 5TF4A 5BSEA 3E6AA 4FR5A 4N5NA 2PTGA 2C29D 4O59O 3K5PA 3DZIA 4UUMA 1I2BA 4JCOA 4UVIA 4D44A 1Z7BA 1ZSNA 4AJ2A 2FPPA 2E82A 3IKVA 2Q1SA 3OH8A 4KDEA 4PZCA 3ZWAA 4HFNA 4DPMA 2DUUA 4L8VA 1JWBB 1VM6A 4E32A 1X7HA 5EINA 2NM0A 3WYBA 2OO5A 1HEUA 3DTYA 4HXYA 1O95A 2EXXA 3HSKA 1YB4A 3H9EO 4B3JA 3GFGA 3DFZA 5BNIA 1DIAA 2JHFA 1Y5RA 3DONA 4TVOA 3UFXA 1H93A 4EZBA 2D59A 4I5DA 1NASA 5L7TA 3RFVA 1YQXA 5LDHA 2OOSA 4OM8A 1G0OA 2PD3A 4BHTA 4CMGA 1TLTA 2HK7A 3U62A 5EQFA 4UVEA 2E37A 4N5MA 4DUPA 3ICPA 3DAGA 3DAPA 4OL9A 1E3JA 4E2YA 1V8BA 3GNSA 1D4FA 4UVHA 3JD0A 4Q39A 3DZKA 3PDJA 1HDYA 3GEDA 1I30A 3MWDB 3ZWBA 4CPDA 2QW8A 2CF6A 3GAZA 4R1TA 2OP1A 5A9RA 3FSRA 3AI3A 3I9MA 1K6XA 1VE9A 1IE3A 1FDUA 2VYND 3GDFA 3RC7A 5KVCA 3LYLA 4IM7A 3HB5X 2Y67A 5DCUA 2GZ3A 4Y9DA 3OA2A 1JKFA 4XD2A 4HNGA 1GV1A 1ZK3A 2PKQP 1YBMA 2P9CA 3N74A 4YXFA 2VUUA 5L4NA 4MOWA 3I52A 3SVTA 4J4TA 1K3TA 1I3NA 1V6AA 2ZQZA 3AUSA 1QYVA 1DB3A 4H15A 4HUJA 3U4IA 1WW8A 1BXGB 4NJMB 3V2HA 4XYLA 3UN1A 1C0KA 4WLOA 4BGVA 3ASVA 2W90A 3HNPA 4PLYA 2XOXA 2JCVA 3AUTA 2VHVA 3ETGA 5HS4A 3D3EA 4R69A 2AXQA 4IDGA 4BNFA 4BS9A 2AG8A 4ID9A 1KEUA 2YDXA 1ULUA 4FJ0A 3BMCA 2AMFA 3ONDA 1MP0A 1HYEA 1N2SA 5TX7A 3PK0A 3CMMA 3GZNB 2YFQA 3PZRA 1WNTA 2I76A 4K9DA 3UCEA 4NNJA 4JBHA 3WGZA 1R16A 4D3FA 1G0NA 1DDOA 3V1TC 2AA3A 3PHLA 5L4SA 2X58A 1U3UA 3M1AA 5A9SB 4WGGA 1QYCA 1EDZA 4IQGA 1SMKA 4OXNA 3K8ZA 4R1UA 3OM9A 1IOLA 4HY3A 1BHSA 1FDVA 2JFHA 4AJEA 4AVYA 4BO8A 1IY8A 4J7CA 5I8WA 1F12A 1LDNA 2FSVA 2NU7A 2O3RA 4W9NA 4ZVVA 1NQTA 1Y81A 2DTEA 5JCJD 3L6DA 4GX1A 4ZRMA 3JYPA 3NX4A 4PG7A 2Q1WA 4TSKA 5KJCA 2YFHA 3FRJA 4J4BA 3ZV6A 3KRTA 3BMNA 1EFKA 2WMDA 2ZB3A 2WE8A 2B0JA 1C1XA 3KXDA 4ZQHA 4P4GA 4MINA 3WGTA 4B8WA 5JLAA 2EGHA 3JYNA 4TQGA 1PS8A 5L45A 3RJ9A 4CM5A 2Q46A 2P2SA 4CV0A 4YT4A 1LDGA 3GF4A 2GERA 3PFFA 2A9FA 3DHYA 4URFA 1YXMA 3RSHA 2VN8A 4B7UA 3AI1A 4XZ3A 2B83A 1HYGA 3Q0EA 2EKLA 2VTDA 2V65A 1PL8A 3OECA 4Q3EA 1LXCA 1N7GA 1L7DA 4UUNA 1DFIA 4DGSA 3GNQA 4DREA 3K96A 5I7SA 3JQFA 4KP7A 5JMWA 4PLPA 3RVDA 3A1NA 1M2WA 3FNFA 1H6DA 4FC6A 2NWQA 3IC5A 3GK3A 3H5AA 4XB1A 2X9VA 1UZLA 4DMLA 2VHXA 3BMCB 1DO8A 2J8ZA 4JP3A 4OXKA 1ID1A 4NU5A 4XQCA 1E77A 4MP3A 4R01A 4AG3A 4CLRA 5A1TA 1U8FO 4LISA 5LC1A 1ZFNA 3ZWXA 4FFMA 4KMSA 4AJLA 3I3OA 3QA9A 4OMUA 4JQCA 5FI5A 2GF2A 1EBFA 1KC3A 2O7SA 4J0EA 5DBFA 1TVEA 4Y6PA 4XX0A 3ULKA 2J5KA 2P4QA 4RF5A 1T1RA 4IQ0A 2WYWA 4IUYA 4RLSA 4XR4A 3PJGA 2YV1A 3WWYA 1AXEA 4RCVA 2Y68A 3EHEA 3MOGA 5KVSA 5JFOA 1DAOA 5KVQA 1XU7A 5C7LO 3EVTA 5FYDA 3T4XA 2OZPA 4E5MA 2B69A 2DVMA 4DA9A 2ZCVA 4J7UA 4CMCA 1E1KA 3RUEA 3CSDA 3WIEA 2ZJ0A 1LDEA 2IRWA 2PY6A 2Y1EA 5TQVA 2X1HA 3P7MA 3DO5A 3GEGA 1KIFA 1PJTA 3RUFA 2XAAA 4DLBA 3JCZA 2HK8A 4L76A 4OSOA 1SCUA 2Q50A 2DPGA 2Q99A 5T8KC 4XYMA 3KSZO 1GYPA 5JAQA 2PZMA 5I7EA 3S2GA 2Q1TA 1P1IA 1EVZA 1U5AA 4F46A 4PLCA 3OHSX 1PGPA 1RPNA 2RBEA 4XIYA 4CM9A 4CMHA 1ZKMA 3W4IA 2OMEA 4HBGA 4KOAA 5TS3A 1J6UA 1QSGA 2VUSA 3WOHA 2VRCD 5F1KA 4AFNA 3I83A 2JD1A 3IAHA 2EKQA 5DDIP 4YBZA 4Y67A 4JNKA 4BO1A 5EJ2A 2WTBA 1CIVA 2OP0A 3A06A 1KEVA 4GQAA 3BZUA 1N9GA 5I7VA 1C1XB 3SEFA 5COBA 3JQ9C 1GEEA 3C8MA 4K6CA 3BMNB 3VVCA 3EK2A 3AOEC 3QVSA 1ZCJA 2IEBA 2EERA 4M86A 4YVFA 4ND3A 3ANMA 1J0XO 2H9IA 1P3DA 2UDPA 3DZGA 1UP7A 1HZJA 2HJRA 1U4OA 4P4NA 2P5YA 3I4CA 4WCFA 3EC7A 2VUTA 1OBFO 2Y0CA 1YONA 4IMPA 2RAFA 3NYWA 3RCBA 4HP8A 1B2LA 2X0NA 2PH5A 1NPTO 1C0PA 1KBZA 2WD7B 4U8GA 3E1KA 2UAGA 5KOIA 1R37A 3OIFA 4IGFA 2OL4A 1LC3A 1PR9A 2LDXA 4J16A 4RDIA 5DT9A 3AY3A 4OH1A 4G2NA 1HLDA 4MPDA 4DQVA 2DLDA 1AHHA 2C7VA 3KETA 4MVJG 3PLNA 5A06A 2PFGA 4JN6B 1ZNQO 1GEGA 2ZTLA 4GX0A 3ZW8A 3DWFA 4B4UA 3I4FA 1DRVA 4GVXA 4NU6A 1L1FA 4B7XA 4BMVA 3S2EA 4FB5A 4ZQGA 2B4TO 5DP1A 3PHGA 2BI8A 3SJUA 2EGGA 3LSYA 1IHXA 3DBLA 4KDFA 1EZ4A 1B0AA 4MP8A 3L6OO 2OGUA 4PGFA 4A0SA 4A73A 2G76A 1NR1A 2DAPA 3WICA 4OQZA 2Y1OA 2Y99A 2H63A 4XRRA 4AJIA 5CG1A 4XJTA 2AW5A 4ZJUA 2WD8A 1G1AA 1NVMB 1RM5A 2JL1A 2ZYGA 1BRMA 4NZ9A 2JAPA 3MTGA 4ND1A 5CDUA 2P9GA 1J49A 2RH8A 3WGYA 4WUVA 1M6HA 2QZZA 2X0RA 3FBGA 4BKOA 5L7YA 5L53A 1DOHA 4IJKA 5KJ6A 3EGOA 4RPLA 2VOJA 2JFFA 4RQTA 4B7CA 4EITA 2O4CA 4A7PA 4E31A 5I9NA 1MV8A 8ADHA 1ADCA 5AVOA 1SB8A 2AE1A 3GUCA 3RFTA 5FFFA 1X0XA 3D7LA 3LF2A 1J5PA 3C1OA 3LC7O 4IMRA 3S55A 2D0IA 3JQ7B 3JQBA 4DC0A 4WLFA 4L0QA 1NQAO 1W8DA 5CEFA 1ENPA 3JD2A 2X22A 1HE5A 1MG5A 3O38A 5AXAA 4GLOA 3GN2A 3WSVA 3PQEA 1UXKA 3KZVA 5F5LA 5JY1A 3VVBA 1W6UA 2C5AA 4Q3NA 4GGOA 1BXZA 2G0TA 1PJBA 2EW2A 4A2CA 2R6JA 4GMGA 3WLEA 2O3TA 3UF0A 4BKPA 1E6WA 4KUHA 1UXIA 3MEQA 1X7GA 1WZIA 2OUIA 4CLRB 1B8PA 1PGJA 2YDYA 2YV2A 1Q2XA 1EBUA 5TNXA 1SBYA 3OP4A 1PZFA 3I9KA 2AEFA 3KUXA 4QT0A 4IDCA 1MG0A 1CDOA 1VJ1A 3IJRA 5IDWA 1ISGA 3CUKA 4RDHA 3WBBA 2QZ9A 1XEAA 3CH6A 2D5AA 2VRCA 2PZKA 3NJ8A 4NFSA 3VC7A 2HSDA 3QJ5A 3QWFA 3GGOA 4BGEA 4BGUA 3VKVA 1HKUA 2H1SA 1PGQA 1YBVA 3JQDA 3RC2A 3SLKA 4WNCA 1LQTA 1IZ9A 1LEHA 4BKUA 5JBIA 4QECA 1JLLA 2NQTA 3LQFA 1JA9A 3E48A 3TWOA 2DFDA 4D0RA 4RQUA 2D5CA 3RJ5A 3D4NA 5KVVA 2DC1A 3BMOA 1ZVMA 5F3RA 3D5TA 3EVNA 3WGQA 1YBAA 3B1KA 4J2OA 1HETA 3BMQB 1U4SA 2TMGA 1FXSA 5DBIA 1SEPA 5I8ZA 4RVHA 2NVUB 3V2GA 3DZJA 4IJWA 3MJVA 3KLMX 1O89A 5ILOA 4UUOA 3TZQA 1LA2A 1ADBA 3C7CB 4RV9A 4RF3A 3TZCA 4B4VA 4RVGA 4WEOA 3R3SA 4B79A 5JO9A 4D46A 5GZ6A 1NTOA 4JXKA 5T8KA 3H6KA 5U9CA 2RCYA 5G0VA 1YKFA 3BIOA 2Q3EA 2ZIZA 2VRBA 1A4IA 4IS2A 1DJNA 5T5QA 4TRMA 2AE2A 5EPOA 3DBRB 2BELA 1ZH8A 2VWPA 4J9UE 5DCYA 3GRPA 3KM0A 2LDBA 3Q1LA 2X23A 4FOOA 2VYVD 3CPSA 1SNYA 1O6ZA 4FFPA 3MJCA 1ENZA 4NR0A 4BNVA 3CKYA 3F4LA 1DIRA 2UUOA 1EQ2A 4MVJA 2BKAA 3SLGA 1KVTA 4TRJA 4RPKA 2EJWA 5F21A 1D1TA 3KVOA 4G81A 2W2KA 4YEDA 4EJ6A 4AL4A 2YJZA 2EEZA 3PEFA 2V6BA 1C3VA 3PGJA 4Z9YA 3WFIA 1D7OA 4QXMA 3ZDFA 4QUKA 5IDQA 1LTHR 3ON5A 1HXHA 2XF8A 4OGWA 3PI7A 2ZB7A 3W4JA 4H16A 4DWVA 1T2AA 1NVTA 4BNXA 3IMFA 3RASA 1Q7CA 3GRKA 1UXHA 5JE8A 3VTFA 3G17A 3O26A 2HMSA 2BFMA 1MLDA 4M1QA 2NVWA 4E6PA 5CEEA 3GDOA 3F46A 3LZ6A 3WR5A 4ND4A 5GY7A 3Q9UA 1DAPA 1VPDA 3DOOA 1Y6JA 2POQX 4PG4A 3LT2A 1ZK4A 2YY7A 4IXWA 4RPGA 1XHLA 1FJHA 3U5TA 1A7AA 2BGMA 3RKUA 2FPGA 1BVRA 4UVDA 3PWSA 4TWRA 5CHEA 1HDGO 2C07A 2CD9A 3AK4A 2AQHA 2DFVA 2HU2A 4YT8A 2W8ZA 4GSLA 4XEHA 4CM6A 4BB5A 5TJ9A 3JQ7A 1H6AA 1SOWA 1UDAA 2V6MA 1UUFA 1MXFA 2VWQA 5ICMA 2PR2A 4WLNA 3GOHA 3NDRA 1JAXA 3ENKA 2VWHA 3RC1A 4CV1A 3BHMA 4XR9A 3FNGA 4D79A 1HE3A 3GHHA 3N7UA 3GQVA 2FHSA 3OBBA 3PPIA 1ZSVA 3QWAA 3KSDO 2RH4A 3RQSA 3W6ZA 1PZGA 2BH9A 4ONEA 4WECA 3WGGA 4E5NA 4ZN6A 2WJPA 3E9NA 4YT5A 4BNNA 1LRLA 3HJAA 4DBVO 4YJFA 3GZ4A 4NG5A 1I32A 3IOYA 1ZK2A 1KY5A 3ZWMA 3OJOA 3QIVA 4IDDA 4B3HA 2FY8A 3FNEA 2BF7A 4IZHA 3GHYA 5BR7A 4FBGA 3GVCA 4IDBA 1Z6ZA 1KETA 2X9GA 1Y7TA 3B1FA 5DOVA 5IDYA 1C1DB 1PJ2A 1GR0A 1PQUA 1U2DA 2PGLA 2UV8A 5T57A 2FP4A 4CM4A 4CV3A 1ZIDA 2Q4BA 4N5LA 4GPD1 3GVHA 1KERA 3DBRA 4JBGA 4YRAA 1VL0A 1I36A 1UH5A 1XQ1A 3GPDG 3GC6A 1C1DA 3NDIA 3GLQA 4TKLA 1NAIA 5JMPA 1HTBA 1WDLA 3KSUA 1B14A 3AW9A 4YA6A 4BMSA 3SC4A 4OOFA 4OO3A 3AUAA 3JQ8A 2PD6A 5JY6A 1H6BA 4MJLA 5G2OA 3RFXA 1OOEA 1SO8A 3EYWA 3LLSA 3H3JA 4U6QA 2VCYA 4RVDA 4FD3A 3NJ4A 1MGOA 1P45A 1DC4A 1QXSA 1SOVA 3AWDA 3BHJA 4WLEA 2GZ2A 4INAA 3AJRA 1B3RA 2DBVO 4WCFC 3LU1A 4W9NC 4ALLA 4F6CA 1CF2O 2UVDA 3D4OA 2OHXA 3D64A 3PZBA 2AEMA 4C7KA 2V6GA 4J91A 3F1LA 5BQFA 1M75A 3M6IA 1KY4A 3QWHA 4FW8A 3ONEA 3DBHA 3CTMA 4CV2A 2E48A 2J5QA 5JSFA 3ZN2A 1Z82A 2VYVA 3EMKA 3TL3A 1GCUA 2O2SA 3EUWA 2AQKA 3LT0A 2GLXA 2WWRA 3HUDA 1XGKA 3ZWVA 3TRIA 4MVJD 3F9IA 4R16A 5HBRA 1K0UA 2YQ4A 1VC2A 4RZIA 5JO0A 1Y1PA 3QLJA 4UEKA 5IG2A 3W8DA 3JQAD 1UXJA 1R0KA 4KUEA 4P8RA 5DNAA 1PQPA 3I5MA 4GSKA 3L4BC 4NQZA 4P38A 4E5PA 4MIOA 5A03A 2HRZA 4NMHA 4XQ9A 5THQA 1K6IA 1LUAA 1XKQA 5HM8A 1X14A 3JYQA 5IZ4A 4CMAA 2VTEA 5TLSA 3AFNA 3O03A 4DRYA 3PYLA 3UVEA 2I66A 3INTA 3DMYA 1CEQA 3OSUA 5ENDA 1DIHA 5A05A 4QTZA 4YAJA 3VH4A 1Q0QA 1LDMA 1XDWA 4HADA 5MDHA 1VSUA 5L40A 3NTQA 5L3ZA 1U3VA 4S3MA 4CR6A 4FGWA 5KWEA 5JCJA 1WZEA 1LDBA 3PRJA 4JBIA 4BNYA 4CUKA 2CUKA 1ORRA 1DLJA 1HDRA 1O8CA 4W7IA 4ZQEA 1GUFA 1AE1A 3KYCA 4R68A 3JQ8B 4E21A 4RF4A 3U4DA 2NLOA 2YV3A 3EY4A 4CM8B 2YUTA 4YYZA 3EAGA 5I7FA 5K1SA 3F5QA 3DZHA 3ZH2A 5F5NA 2C82A 5K6AC 4XGNA 2B5WA 2V6FA 3U49A 1I24A 1JW9B 2NSDA 4EW6A 2NU8A 3RAJA 5JDCC 5JPIA 3UGKA 2B37A 1YE3A 3DOCA 3I6IA 4IQ8A 1E92A 4LRSB 4Y6RA 3M2TA 1ZUD1 4LMRA 5BT9A 3JQCA 1GL3A 4FFLA 3FI9A 1U8XX 4BO5A 1X1EA 4RORA 4EJ0A 3V8BA 1IL0A 2Y0DA 1VRWA 4E5YA 1AUPA 1Z45A 3P2YA 4LVCA 2I6TA 1VL6A 2Q49A 3DC2A 4G65A 4NK4A 3BYZA 3NGLA 4XDYA 5I9MA 4E4YA 3I9LA 4XQGA 4YJHB 4NI5A 1LQUA 1VSVA 3K30A 5L4LA 1NFFA 1RJWA 1DBVO 1ENYA 3BTUA 1NWHA 2HKIA 2VZ8A 4FIZA 4NJOA 1E3WB 4GKBA 4BVAA 2O3UA 4YJFB 4Y6SA 4IXTA 3GEMA 1I3LA 5CDSA 1NM5A 3AM5A 3WB9A 3AUUA 4GKVA 4GWKA 1LSUA 1Z74A 3RUDA 1B26A 1WP4A 2GR9A 1KOLA 3VPXA 2EV9A 3GMDA 1JDJA 3QHAA 2EF1A 2AQIA 4YAKA 5JDIC 1CQJA 1TT5A 3O8QA 3P5SA 2CDBA 5DCWA 3RI3A 3GZNA 1R15A 3INGA 4JX8A 3CZMA 4M8SA 5I9LA 2DT5A 2EP7A 2J3KA 4BGIA 1W4ZA 4L73A 4K26A 4PLGA 2I67A 5HWSA 1GZ4A 3NT5A 4R41A 3EZLA 3IS3A 1C0IA 3Q11A 4LK3A 3WDSA 4ALIA 2X0JA 3OETA 3COSA 4L4SA 1DRUA 4MDHA 9LDBA 3M2PA 2HMVA 2QQ5A 4DTIA 4XWYA 2IYPA 4MKXA 3ZV4A 4DIOA 4L74A 4FSHA 2CFCA 3QQPA 4I08A 4NH4A 4BOYA 1LLDA 3ANNA 5KCZA 2XXJA 3DQPA 3T7CA 4G5HA 2VHWA 4L9RA 5HRUA 4ZD6A 4YJGB 3RBZA 3H2SA 1EE9A 4LN1A 2ZK7A 4J43A 3GG9A 2I3GA 1I10A 1DPGA 2VOEA 5ES3A 5JCXA 3HADA 3KTDA 3O9ZA 4CQMD 1MFZA 1CWUA 1ZK1A 1QP8A 5KNLA 1YO6A 2C5EA 2W2LA 4CM9D 4N7RA 1T4DA 3KEOA 2DQ4A 3E18A 3MJEA 4CMEC 3FBTA 4BO2A 4K1LA 5TJHA 1OI7A 5G4LA 1ONOA 4ZQFA 3VPFA 4Z3KA 5CAEA 3FHLA 3QWIA 1GY8A 4FJ1A 4WOKA 5IXSA 4M54A 1LI4A 3C7AA 2R2GA 3H7AA 3ZHZA 4O5OA 3TSCA 1TT7A 5TT1A 3C7DB 3JQAA 4RLHA 1W0CA 2CVOA 4QSMA 2VYNA 1ISFA 4B4WA 3OIGA 3OQBA 3H9QA 3TQHA 4E2XA 1U28A 4OKNA 1QR6A 3GVPA 4YB8A 5GZ3A 2W2KB 3WMWA 2QG4A 5G0TA 5IAAA 2IZZA 3W8EA 3Q2IA 3Q2KA 2HJSA 4PFJA 3U4HA 4L4XA 3WXBA 2B5VA 4NFYA 5JXWA 2O2YA 4J7XA 1ZXLA 1ZBQA 3QVTA 1XIVA 1R4MB 5G0SA 4QEDA 1SZJG 4NJMA 4PZDA 4JK3A 1P9LA 4YRDA 4YQYA 5KJFA 1IUKA 1JWAB 2J3IA 4KWIA 1Z7EA 3U09A 1HWYA 3DAFA 3D3WA 4BO7A 1HE4A 4BNUA 3A9WA 2BD0A 4BNWA 4Q3CA 5T67A 4EYEA 5LDGA 2GD1O 3BTVA 4NBVA 1JAYA 3WNQA 2OFPA 1VKOA 3K31A 4ITUA 1T4BA 5TGDA 5AXBA 2EJVA 1XLTA 4BKQA 3CZRA 4DPKA 3GUYA 4XJSA 1XA0A 4R3WA 1BDBA 2ZJ1A 4KUGA 4WLUA 4CMBA 3PQFA 3PYMA 4P4LA 4O1MA 1S7CA 1I33A 3K9QO 3PIDA 3WSWA 2CF5A 4FS3A 1O94A 3KYCB 3JQGA 4XGKA 4H7PA 5IXYA 1O9BA 2A94A 4YQZA 5A5EA 1HF3A 2I65A 3FWNA 3GT0A 2I99A 4PG5A 4F45A 4DQXA 1F14A 4K6FA 2ZCUA 4XKJA 4DXHA 3BMOB 1ADGA 1KVQA 2ZTVA 1DIBA 1N9GB 5ENVA 4CL3A 2C20A 2O3JA 1YDEA 2Q2WA 4I8XA 4NHEA 4EUFA 4RO0A 3W8FA 3AY6A 3TOZA 3F6YA 4QX6A 1UDCA 4L75A 4KTTE 2DUWA 1GYRA 4AJOA 3KOUA 1BGVA 4W82A 4EI2A 3ZHYA 1ZJZA 3PHHA 5AOVA 1HT0A 1ZEJA 1E1NA 3PYXA 4PG8A 5JC8A 6ADHA 2QRJA 5FI3A 3ZCXA 1YH3A 1LC0A 4R51A 3NEPX 1YQDA 3U0BA 1JQBA 3NTOA 3NDJA 2VNAA 3FF4A 2PZLA 3E5RA 3IQDB 3VZRA 1I3KA 3ONFA 2VHYA 5BSFA 3HE3A 4HV4A 3L77A 3OIDA 4M89A 1IULA 4DBZA 3BTOA 1BMDA 3PJFA 1ZO8A 4WOJA 3CMCO 5B4VA 2DKNA 3K6JA 4R1SA 2AQ8A 3VZQA 5K6AA 3FTPA 5G4KB 1P44A 1BTOA 2Q2QA 4ZRNA 3WYCA 2CVQA 3LK7A 4GLLA 2ILTA 4LSMA 3SC6A 1XU9A 3TZ6A 3DZBA 4RF2A 1I01A 3DL2A 1MC4A 1R6DA 4XA8A 5AQ1A 3FNHA 2ZTUA 2HK9A 2RIRA 3ZHBA 1ZMTA 4JGBA 4JJIA 4QFDA 4PLFA 1SPXA 3KYDA 4S1VA 1T2EA 2BI7A 3VH1A 4ALMA 1B3BA 4CQMA 4PN3A 1I5RA 1HYHA 2IYOA 3FWZA 1RM4A 3LLVA 7MDHA 2DBRA 3RUAA 1Y5MA 1DJQA 3I1JA 3ROMA 5FWNA 4LW8A 1PJCA 1DFHA 1E7QA 1NNUA 2WM3A 1HDXA 4IY1A 1WDMA 2WYVA 3C3XA 4N54A 3IKTA 2FPIA 3DBVO 3GAFA 1X7DA 1VJ0A 4EGFA 1T26A 4TZTA 1B7GO 2NTVA 4GBJA 4WNIA 4CLDA 1J4AA 1HSZA 1KS9A 1LNQA 3D4PA 2OXIA 1FDSA 5IN4A 3ZI0A 1GYQA 4TZKA 5CDYA 4CM4B 4MKRA 2O23A 5KKCA 2EIHA 1GTMA 1PX0A 1WVGA 3E03A 1GQQA 1Z73A 4KQWA 3B70A 3SXPA 2J3JA 2FR1A 3ZZNA 4TVBA 1OMOA 2P4HX 4UEJA 1RM3A 4BUCA 4CMEA 2P91A 1XQ6A 2O48X 4RVFA 3SJ7A 2VNSA 3L9XA 1T25A 4ILKA 5CFZA 4CL8A 2NTJA 1H0KA 2JKVA 1CERA 3HDQA 3L0DA 1PJQA 4BO6A 2BRUA 4GMFA 3S1LA 3ZU3A 3UUWA 2UUPA 3ZNOA 3VHRA 3HN2A 3RBXA 4UEOA 2NNLD 5A5FA 5IZCA 4OSPA 1I8TA 1UXGA 2QRLA 1YJQA 1ZJYA 2BFOA 4FDAA 2GRAA 4GX2A 3LT1A 4IIUA 5JAZA 1JU9A 3E82A 1PJLA 4KTVE 2CZCA 3VPHA 3LDHA 1KYQA 5B1YA 1WXDA 4E12A 4KZPA 1NR7A 4BO3A 3ASUA 3Q9NA 4DVJA 3JQBC 2FZWA 1EVJA 4I9NA 2EG9A 1Q7BA 1TEHA 5JAIA 4NBUA 1R12A 2NTNA 1ZSYA 1M66A 2FMUA 1WMBA 2X9NA 3MZ0A 4FFNA 3ADOA 4O0LA 1LX6A 5CDTA 5THKA 4E5KA 4UAGA 2IZ1A 4FJ2A 4ALKA 2X0IA 3G0OA 2YHIB 4CR7A 1MXHA 2QYTA 1XELA 3LC2O 3MTJA 1YS4A 1CJCA 4D43A 2G17A 3DTTA 3JQAB 1T24A 4AJ1A 1DHRA 5ADHA 3EZYA 2PD4A 1P33A 1XCBA 1JTVA 3HQ4O 1R0SA 1V3TA 3PDUA 2CVZA 1T2DA 4Q3DA 3H9UA 3MCVA 4R1NA 5A02A 4CQLA 2HCTA 2B36A 3K73O 1EUZA 4GL4A 5KKAA 1CYDA 3JYLA 2Z95A 4UVGA 3L6EA 1Y9EA 5CG2A 1I2ZA 1HDCA 2HAEA 4TROA 1UJMA 3HG7A 3L9WA 3H5RA 4BO9A 1OZAA 5JDIA 3ENNA 5AXCA 2HUNA 2DTDA 3ICCA 3IL2A 1V3UA 1F0YA 3PLRA 1EQUA 2CDAA 3ANLA 3ZU2A 4BB6A 3ETDA 4NBWA 3GGGA 2NVUA 1N1GA 1NX6A 1AGNA 1I2CA 2GN6A 2ZB4A 1ONPA 4YACA 6LDHA 3PVZA 1NBOA 1GQYA 8LDHA 4I9UA 1EUCA 4XB2A 1NP3A 4MP6A 3RUIA 3QP9A 4XIJA 4I5EA 1OFGA 4Z0HO 3WGIA 3BMQA 3JQFC 1HRDA 4ZICA 4RVSA 1GUYA 3JD4A 1NYTA 4YAGA 1HDOA 2R00A 5JC1A 3K2EA 1MUUA 1PEDA 1UP6A 3C1AA 3TJRA 3RU7A 1ZZEA 3HB4X 1NQ5A 2FOIA 3H5NA 3JV7A 4IJUA 3DBLB 1GPDG 4Z3DA 3K92A 2A4KA 1HL3A 4ZGWA 5L9AA 1ZEMA 2EW8A 5TRTA 3ABIA 4DQUA 3E9MA 3OMLA 1EEHA 1NPDA 5BNTA 1N1EA 3H2ZA 3F5SA 3VDRA 5HA5A 5KJEA 1TXGA 2O3QA 4HFRA 3JQGB 4YT2A 1PZEA 1DRWA 2H6EA 3D5QA 3WWZA 1HZZA 2ZQYA 3FPLA 3HN7A 4WLVA 5H82A 1WLYA 3TPCA 3MWEB 5TSDA 4BNIA 3A4VA 3JQ6A 4ND2A 2CNBA 1YQGA 5CP8A 3R0IA 4N18A 3I9OA 4WCDA 1YGYA 4X54A 3UOGA 2Y1GA 1N92A 5A3VA 2PK3A 1DC5A 2BHLA 4C4OA 4RVUA 4GI2A 3AM4A 1DC3A 1DIGA 3RIHA 1JN0A 5C7IO 3QVWA 4CMKA 4U6SA 4AJHA 3UICA 4BNHA 3I9JA 2A35A 5GMOA 4IZIA 1PS0A 1K6JA 1DHTA 3GDGA 2ZTMA 1LRKA 1PGOA 4WE3A 4BNKA 3GVXA 1EDOA 1U7TA 3WQSB 4ALNA 4IDAA 2Q45A 2W98A 3W6UA 2FSSA 4BNZA 1DSSG 1JVBA 2Q1UA 4JP2A 2IE0A 2AG5A 1X13A 5K0ZA 3GY0A 1PIWA 3FR8A 3PHJA 2GSDA 4PG6A 5ICSA 1EUDA 4IJVA 2IEDA 3ZU5A 3V1UA 3H8VA 3FCOA 2AHRA 1ZK0A 3E9QA 3AOGA 1P1HA 5COQA 1PS9A 3STHA 4BNTA 3U3XA 1H2HA 5B4UA 4XYEA 4XYGA 3DZFA 1ZXBA 1TA4A 4OKIA 4WEQA 1NWCA 5FF9A 1A72A 1M76A 2YYYA 4EJMA 5A3JA 1R0LA 3CXRA 4ND5A 3NKLA 4XGIA 3ITKA 1V35A 4RGBA 1SEVA 1HE2A 3OEYA 5EQDA 1X0VA 1YRLA 3UKOA 4MKZA 3DFUA 3DR3A 1EK6A 4PLVA 3UH1A 4FN4A 4Z9XA 7ADHA 1Q0LA 5U4QA 1V0JA 1OC2A 2X7HA 4PCVA 3X2EA 4DIFA 3GNTA 1E6EA 3AY7A 4ZA2A 1KVUA 1A9ZA 2PA3A 4BIIA 3MJTA 1R4NA 1PGNA 3G79A 3H3FA 3WTBA 1P1FA 4Q9NA 1NXQA 3VTZA 4YJGA 1NAHA 3OJFA 1H9BA 1YL7A 4LVUA 3TNLA 1MC5A 4YTEA 4DLLA 3BXXA 3OA0A 2ZKLA 3DMTC 1VJTA 3GPIA 3T4EA 1FF9A 3B20A 1KEWA 3HHPA 3I23A 5TT0A 1KC1A 4QO7A 2Y05A 3DHNA 3R1IA 2YZ7A 3IP1A 1E6UA 1P31A 2CMDA 4YPOA 4YAEA 3WYEA 1QYWA 3ORFA 3CEAA 3OEWA 5DP2A 4AJ4A 1VLLA 3AM3A 3I9NA 2JJYA 2QX7A 1ISJA 3VDQA 1T2CA 2AEJA 2ZATA 1D1SA 2IODA 5AXDA 3IP3A 4E33A 2X6TA 3WTCA 4BKRA 1QMGA 3WG9A 2BMAA 2FRDA 2D1YA 1B16A 2SCUA 4DLAA 3JSAA 4Z0PA 1H5QA 2Y1CA 2RHRA 4AJJA 3UAGA 2DBZA 2PNFA 3H65A 2Y1FA 3NT4A 1XYGA 4J9VA 3WNVA 3ZWWA 2X8LA 1Q7GA 4MVJH 1E5LA 4DC1A 2EP5A 1QLJA 4NDNE 4PLHA 3QV1A 1IZ0A 2XXBA 4J1SA 1DFGA 2IXAA 4Q3BA 5G4KA 2HDHA 3VKUA 4YAIA 3AU9A 1OAAA 4YWJA 1P74A 3D3WB 1U3TA 2NV6A 2GN9A 4KQXA 4EBFA 5ITWA 2GGSA 5EERA 4DL9A 3L4BA 4HKTA 3S2FA 3C24A 3TN7A 2ZYDA 1R4NB 2B4RO 4BL5A 4M49A 4EDFA 3HZZA 3KV3O 2VZ0A 3WS7A 5G0WA 1QLHA 1BXGA 1RYEA 3KYDB 4Y8VA 5ER9A 1E1LA 1GUZA 1QRRA 3DDNA 3GMSA 4P22A 2VHZA 1K5HA 2W2LD 1EVYA 1IPEA 3KLPX 4D3DA 1UDBA 2O4UX 3Q6IA 1LSOA 4E13A 2WDZA 4JJFA 2HRBA 4Y98A 3INRA 1RYDA 3QE3A 3BTSA 1RM0A 2IDZA 3TDKA 1LLQA 2GZ1A 1S6YA 3RUCA 1E0DA 3H9GA 4D0SA 4B3IA 4TRRA 4DYVA 2P68A 1OC4A 3FD8A 2WSBA 1VI2A 4CR8A 4LCEA 2VQ3A 4W4TA 4ZU3A 4PLTA 2PGJA 2G82A 2W4QA 4MO2A 1XG5A 1WDKA 2C54A 4IPTA 2A92A 3LF1A 1F06A 5B12A 3NV9A 1LSSA 4BO0A 4CQLB 4WJZA 2PV7A 1SB9A 1XWFA 1RWBA 3WQRA 2X5JO 3PJEA 3ITDA 4M55A 1E3IA 4CM3A 1U3WA 5F1OA 1PQWA 4R3NA 4PLZA 3NAQA 1IB6A 1N5DA 1UAGA 1GV0A 2PGDA 2YQ5A 3ZNQA 4TRNA 3JD3A 2V7PA 4FQ8A 1M67A 4WASA 3U9LA 1I0ZA 4IBOA 4IINA 4BNLA 4I5FA 3FPCA 1FK8A 1ARZA 3HWRA 5IJZA 1M6WA 2PH3A 1HDZA 4CM7A 5C5IA 3TFQA 4YDRA 1A4UA 1NQOA 3ZWOA 5L7WA 3W4KA 2X86A 3GN1A 3GA0A 3F3SA 5TIIA 5IN5A 1O5IA 1TT5B 3ZWYA 1UR5A 1PTJA 3C85A 1P0CA 3KHUA 4FPXA 4XQEA 2O50A 1NHWA 1LLCA 3PWZA 1Y8QA 2QRKA 3R3JA 3VZSA 1DXYA 4OIMA 4UUPA 2VT2A 3UHAA 3WFJA 3ROPA 4JIGA 1E7RA 1B8UA 2H5LA 4AJKA 3OJ0A 2X4GA 3D0OA 1UAYA 3ZNPA 4K28A 4MVJI 3TFOA 4M87A 1B15A 1Y8RB 3ZNNA 3RU9A 5MGBA 1LRJA 5IF3A 1R4MA 3JQ9A 3WLFA 5ITVA 1U7HA 3HDJA 3HFSA 3NTRA 4OJNA 3WIDA 3AOEA 3VOSA 2D8AA 2EWMA 2Z1MA 2HMUA 1GFSA 1KEPA 4CMIB 4UREA 3VH2A 5LCXA 1XR3A 4GX5A 2NUAA 4PRLA 1C14A 3WGOA 4CLXA 1MX3A 2HLPA 1BXKA 3MJ4A 1N8KA 2GCGA 1TI7A 4II2A 1BG6A 1AXGA 3VZPA 3IIEA 2FN7A 4IDFA 5A04A 4Q3AA 2Z5LA 3ROKA 5JDCA 3ZV5A 1PL6A 2HMTA 2OORA 4RPHA 2O3SA 5CPBA 3VH3A 3IUPA 1EMDA 4RZHA 1Q1NA 1RKXA 2OBNA 2C2XA 2OBYA 3B1JA 3IUSA 3QVXA 4OOEA 4CM8A 4BQPA 1IPFA 4MVJP 1O0SA 3V5NA 3M1LA 4DYDA 2B35A 3X2FA 4ALJA 2VWGA 5J23A 4W6ZA 2D4AA 5ILGA 1A7KA 5C3MA 1BDMA 4RJTA 4BO4A 1BWSA 2PKRA 1WWKA 2D2IA 2VT3A 4OXYA 1K2WA 1H6CA 2GN8A 3VAZA 1T1SA 1NHGA 1PSDA 1LLUA 1B8VA 1PWZA 3FR7A 1PJ3A 4MIEA 4ROSA 3JTMA 5DF1A 4A10A 3F47A 3HDHA 4E30A 1FDWA 3H9JA 2CY0A 2NU6A 4E3ZA 4YRBA 1QORA 3V2UA 1YB5A 2BGLA 2JAHA 4II3A 1KVRA 3AU8A 3TZKA 2PZJA 3QW2A 2P9EA 3IJPA 1PJ4A 4XYBA 3W1VA 1ADFA 2NQ8A 5JYDA 1I3MA 4KWHA 4D41A 1IYZA 3PXXA 3ZV3A 3QY9A 5DN9A
chains in the Genus database with same CATH superfamily
4EP1A 3ESXA 3PDHA 5BOSB 4B75A 3NORA 4CMJA 2D2VA 3PTZA 2EFDB 3LCJA 4PCLA 1JHAA 1XSEA 1ZM4A 4C5AA 1EAYA 3HA3A 5AKHA 5KIAA 4DG5A 3E0QA 4AJPA 2W6QA 4GGPA 1X2EA 1TU0A 2QP9X 2JK0A 4KN8A 2ZROA 4J3FA 4L5CA 1GXSA 1K08A 2ID4A 2DTXA 5IMSA 4DPLA 1E3SA 3S8EA 3E8XA 5KHLB 4PVCA 2IPNA 3F7TA 5JNLA 2J6HA 2H0RA 3O8QB 4E1VA 1T36A 5IDXA 4RTRA 1A0OA 1UBRS 2IYWA 4WVLA 3TZHA 2PZFA 2C8LA 5KTKA 2QIOA 1XXHB 4AT1A 1QVVA 4ITVA 3RF6A 1JBKA 1NW6A 2HMAA 1W75A 4CG2A 3GEPA 5DW0A 5ELLA 4KBFA 2WYHA 1VHJA 4AZWA 5C7OO 4P84A 1EB8A 4D3SA 4GP9A 2A3RA 2XPCA 4D81A 2AC2A 3CZ4A 1UJ5A 2XE4A 1SKBA 4W7HA 4PCUA 3A9TA 5CXXA 3WL3A 5ESXA 3A28A 3BF7A 2ZT7A 4E2WA 4J1QA 1NFRA 3ONNA 3WX0A 5JNUA 1ITZA 1JVSA 1LBEA 4LGVA 5T4HA 2PWYA 2WSSD 3O83A 4LXUA 1A9TA 4GI1A 4YJHA 5F2OA 16PKA 4ANFA 3UCXA 2NU9A 4PSCA 2F00A 1JMKC 4XWOA 10MHA 1GVHA 3TL2A 3ILSA 4R8MA 1LB1B 4M9RA 4OHYA 4NV3A 4WKPA 3DCNA 1F3LA 3QYPA 3KB6A 3WL7A 4YMWA 4ZMBA 1P1JA 4EVRA 4YFYA 1S2MA 2FNAA 2Y66A 1ULBA 1DPFA 2G0NA 3SAJA 4M9CA 3T9BA 4LYYA 3VHQA 1UKBA 4RL6A 3RS3A 1I3CA 3WO1A 3EDMA 3THYA 2K87A 3SEZA 1U0GA 2G1KA 2ZEJA 3AT1A 3PUJA 4G36A 2V98A 1OFUX 4QARA 4AZ0B 1ADJA 2ON6A 4NBTA 2I3ZA 4L5YA 4HYEA 1YS6A 4BVFA 1XDDA 2HO5A 3BOSA 3KZNA 4QUBA 2L17A 2BWJA 2J3HA 3FTNA 3ROQA 5JW6A 3QMMA 3BMXA 3IMCA 2EIXA 1RFGE 3OLZA 4B4OA 4BV9A 1BCRA 3PUZA 1AN0A 2IXBA 3T5PA 2AR9A 4O6VA 1JHPA 2OECA 1BVYF 1F8YA 3X1DA 3ZHSA 5EIBD 4PVDA 2CD7A 1B00A 1OKKA 2VZ9A 3RBVA 2EKPA 3HHEA 4RY0A 3P19A 3X2SA 1KWGA 4OI4A 5F1PA 2J85A 2A5GA 4J0GA 3UK0A 5REQA 3D7SA 2ZPTX 1GTG1 2NXCA 4ICIA 5LQJA 3G5TA 1RJFA 4J2HA 4O4JA 5F5XA 4EUHA 2R00C 3WRYA 2H1OA 1X1SA 1MPXA 3L7DA 4I4LA 3DTVA 1HGXA 3O4RA 3OF2A 1QKIA 2PSSA 5FBRB 1BDHA 4RDCA 3EFHA 1HQYE 2QN7A 4B74A 4AZ3A 4KQIA 1LJ8A 3AI2A 1H8HA 1M2NA 3WNZA 1BEEA 1K66A 1MQ8B 4LF6B 4CMIA 1CY4A 2F1KA 4H7HA 2ONJA 1SUCA 4PRKA 3SHVA 4KOEC 1E7YA 2HQOA 3FRIA 2N75A 3LT4A 1T15A 4X1IB 2K4MA 3AHEA 3SY8A 3DHEA 1NYQA 1WKBA 2AC4A 2GASA 1SC9A 2DPHA 4OQDA 5H83A 1JFRA 1GADO 2RHJA 4TN1A 1CQIA 1CR0A 1FFWA 2OD9A 2RGWA 1UMBB 3E5NA 1YZLA 4HH3C 1JEDA 1Z3IX 3KR0A 4JKOA 5A9TA 2XXAB 4Y2JA 4FMDB 4UHCA 3D1LA 3RROA 1DU4A 4E1BA 2FF5A 2G1UA 2VJKA 1GD1O 3FKSA 3H1EA 5D00A 1W0JA 2DG2A 5A2GA 1FZQA 1T4MA 4OD0A 1CRWG 3JXEA 3PEVA 1EYZA 1XVVA 3SLRA 3LTNC 1W73A 1M34E 2GN0A 2JFGA 3DDWA 4HS9A 4XEUA 2WA2A 2AZDA 2E49A 4DV4B 2X1LA 4IHKA 3ZC3A 1FSFA 2R25B 4LSWA 4DLUA 3ZLJA 1P8AA 1YACA 2G9QA 4Y2QA 3QUAA 4TWJA 1XT6A 2CHFA 4RMNA 2BAGA 4EUSA 1PZXA 2BGNA 3ZHTA 4TVSA 3PEWA 1DCMA 1GNVA 5CEJA 3O2SB 2AMJA 3C6QA 4KPGA 1PJRA 1T0JB 3H5TA 4DWWA 1HLPA 1FFXA 2A86A 1JZSA 4H6VA 1VLVA 1WMFA 2QP3A 3IVGA 5IEBA 1NRIA 2A1UB 1J21A 1CS0A 4JROA 2PMFA 5KYUB 5BXYA 1AGXA 1KR5A 2WE7A 2ROQA 1L7VC 5EJIA 5AVJA 2PRJA 4Z0TA 4CUJA 4XDHA 3QX9A 1BKYA 3CHYA 3C6BA 1V5IA 1ONNA 1R4AA 2JJ2D 1Z4JA 5D2CA 4ML3A 3ZK7A 3ZV5A 4DIBA 3HMKA 4JI2B 1KI7A 1FLAA 3ZDCA 2OK7A 4QPZA 3VSEA 1YFKA 2B8WA 2QE6A 5AVKA 3KB1A 2Z5VA 5CDFA 1X86B 3DGEC 4LHVA 3UB2A 3AVXA 3RRBA 1WUKS 1GGKA 3HUUA 4Q3LA 5GZ1A 3U2QA 3P32A 4BU1A 4EG7A 3DAOA 1WB4A 4ABYA 1ISMA 4GECA 5AUNB 4Z8XA 1YVDA 4FK8A 2HNKA 5EXSA 2CDCA 4AY4A 1NVVQ 1AHPA 1KI8A 1N8SA 2Y0EA 2VSOA 2BZGA 4NCIA 3FAKA 1ATIA 3LQ2A 2JAWA 3FOAA 3RWMB 3U1TA 1GA4A 4US1R 3FFTA 5JU6A 5A9SA 5CA1F 4OHVA 3EBPA 3B3QA 2JLAA 4WCFB 5BSHA 4ZVSA 2OC4A 3GJSA 5CB4B 5KSWB 4J76A 1XLUA 1VIDA 3U7QA 2OBFA 1QTNA 1JKIA 4QBFA 1DADA 1NMQA 1TB4A 4CUZA 1GCAA 2IL1A 5FWDA 4D56A 3MERA 1KZ6A 4EZEA 2VTBA 5KMGA 3ISTA 1UINA 3KQVA 3QPAA 4ECEA 3R7WA 2XHZA 1NUUA 3QE2A 1UOPA 1GCOA 4F72A 2O8CA 5HXAA 1IEVA 1FPMA 5BUSA 4U0JA 1FQJA 1K6EA 3QEMA 4PW0A 1JA0A 4JVMA 2AYYA 4F5ZA 3N0WA 3OEHD 1XZIA 2WKQA 1YKGA 1Z83A 4YJ3F 4BQEA 1N5JA 1GFZA 2BLLA 2J87A 5LYJF 1JSLA 2I7DA 5CVUA 1ZMXA 2H8GA 2P3OA 1KMCA 1V1MA 1M7HA 3GIDA 4H60A 2Q4OA 4QO8A 3DEYX 3PWKA 4R8KA 3REOA 2DZDA 5CDGA 1DXOA 4DMMA 1UZNA 2XNDD 4GDFA 2JLRA 4DNFA 4I0WB 1BVUA 3BJZA 2BSAA 5JXHA 1SIUA 4TWAA 1ZVKA 3OU7A 3AEKA 2G07A 3KOXA 4WOBA 3K20A 3WQQA 3VPSA 3RLFA 1Y9JA 5J2UB 4HUQA 1EXMA 3A4YA 3DWEX 4P7GA 3RFCA 3O94A 3ETEA 4MHSA 4JZKA 2P62A 1TZBA 1G3IA 1G6KA 4Z8YA 4XD7A 3KYIB 2B21A 3D8RA 2W0MA 5B6JA 8MHTA 2L82A 1DO0A 2QMOA 2B2NA 1G291 1HMPA 1ODFA 1YK1A 4ZZ2A 3K70C 4EEZA 5BQOA 2E6UX 2IS4A 4PR0A 5JJBA 2PKQO 2R62A 2HA6A 3NCHA 5CUQA 3V8QA 1QUEA 3P8ZA 1JG7A 4OXQA 1E1MA 3N8KA 3IDAA 4HQLA 4EARA 4AQDA 3ZHOA 1YF3A 3STWA 2ZW9A 2WF9A 3JATA 4H3VA 4HDNA 1A9YA 3TNFA 2IX3A 2YW9A 4RTKA 4IAOA 3E1SA 1TGYA 3E4DA 2ETVA 4MLCA 1RKUA 3B6JA 4Y1EA 1LDYA 4IHAA 1XZLA 1EFHA 2O7QA 1KH1A 1E2EA 1OFIA 2OGTA 4HAOA 2H7CA 3RAPR 3CLTC 1C7RA 2BFAA 4HFMA 4QUDA 3TF5A 2QQFA 4R98A 2ZI5A 1IMOA 3RK1A 2YHIA 2LKCA 1M2OA 3C87A 3JQEA 4GOLD 2GBIA 1N4DA 1RLJA 2YJ3A 1KRWA 3PHIA 1KIAA 3I9V1 1ZC3A 4PEVA 1IH8A 2D2FA 1RLMA 2VPQA 3AY0A 1VZ3A 4B2LA 3PIIA 3OQJA 1UJBA 1TGVA 3AESB 4H4CA 5AH0A 1ZJ4A 4F3YA 1VDZA 3C16C 3S27A 3TOSA 1KOGA 3QOYA 2Q27A 2QUZA 2X2PA 4J49A 4NPCA 1QV7A 4XM2A 3X1YA 1PKEA 3OJLA 3DTNA 3L07A 4YV2A 3KLNA 4LF4B 2PIAA 3JR3A 4BV8A 3O90A 4L4RA 4DCPA 1RZRD 2DUNA 1S3GA 5EEHA 3OUZA 4FR5A 1Q91A 4O59O 2C29D 4WXHA 3PT5A 5CLHA 5CVJA 2J07A 1BXRB 4UVIA 4MA5A 4H31A 5DU2A 3KX2A 3E3AA 3H5VA 4V0OA 3TGLA 3BILA 2QKYA 3IKVA 3TI9A 1E62A 1Z26A 1GNQA 2AJTA 2GBLA 3LX8A 4G67A 1QGED 3AEZA 4HFNA 4L15A 4MQFB 1IUOA 4XUDA 4DPMA 4F91B 3ZJ4A 2X4DA 4P5EA 1U1FA 2YCBA 3BVPA 4KVAA 2ATXA 4HNQA 4A92A 5K6TA 3DTYA 3VR5H 5J4KA 1J8VA 4KREA 1YB4A 1JUDA 1OZHA 2SBTA 4C2UA 5TPWB 1TUBA 1IFXA 1QV9A 4EF5A 3CR8A 4ER6A 5HIJA 2JHFA 1AF7A 3DONA 3MIIA 2AZTA 4KC0A 4TVOA 1WB5A 2Y92A 4MPTA 3X0DA 1R6TA 1QB8A 1TDJA 5FL7A 3PGMA 3INYA 1VI6A 1VGQA 1YR7A 2QN2A 1NZFA 2R8ZA 2VF4X 1JKMA 2VCEA 4OGFA 5L7TA 3RFVA 2C5BA 1Z12A 2UYHA 3MLBA 3IAS1 3VYRB 3NHSA 5LDHA 1G0OA 3QFCA 1FVOA 3K09A 5DN6A 1DJMA 5C34B 5EMLA 1N4AA 1BMTA 2Z04A 4MKHA 3DDZX 1TF7A 3LVBA 4IXNA 4OB8A 2QMHA 1T5IA 1U9IA 3M6LA 5EQFA 1Q1ZA 4MW1A 4UVEA 1T9GR 1AOXA 2E37A 4JOCA 4IH1A 3RS4A 4AIIA 3CJQA 4BMCA 3DAGA 4CL0A 1PDWA 4OL9A 2VDNB 4PNHA 3TIVA 4UVHA 3JD0A 4Q39A 1DCFA 3DZKA 4C6RA 1JQLB 2O7NA 1HDYA 4ZPXA 4YS6A 1I30A 4EG5A 5AK4A 1LPSA 3F6EX 1W25A 3GAZA 4R1TA 3G8AA 2Q62A 1RC0A 3BWDD 2HLDD 1K6XA 3T35A 2N46A 2RSLA 2H57A 1E0AA 5LVAA 1FDUA 2HCBA 2FEXA 2VYND 4QOSA 2WRZA 4HSGA 1VBFA 2ZU0C 1CV2A 4UMEA 2Y67A 5BP7A 3WLNA 4Y9DA 4Q19A 2BFBA 4XD2A 4UNNA 1QU2A 1GV1A 1C7JA 3O3CA 2PKQP 4I50F 5E7IA 2P9QA 1XZFA 5KNDD 1VHQA 4AU1A 4KMMA 1K27A 2N3ZA 2CJWB 4JC0A 5H9WA 5DBEX 4ZCRA 3BCRA 3MS4A 3FXAA 1VCMA 2UKDA 3AUSA 5CU7A 1BXGB 1XDZA 3QY0A 4XYLA 3RARA 3FCYA 3FGOA 1C0KA 3BFKA 2IK8A 3EUAA 2AKAB 3A1DA 3ASVA 2H1FA 1N3IA 3QNMA 4I4TB 4MB0A 3UV6A 4M38A 4BFXA 4BBZA 5IWAB 3ZDBA 2XOXA 4BTLA 5BT8A 4JB2A 1PQYA 5G53C 1ISSA 4PQEA 4AN1A 4IDGA 2FSPA 2AG8A 2OT3B 3FLBA 4ID9A 1KEUA 2YDXA 3BE8A 3LA6A 1XZCA 2ZRAA 1KAQA 3K0BA 2X5XA 3V8EA 2AMFA 2C3OA 1AGYA 1MP0A 1M8FA 1N2SA 3DKVA 4F6RB 4B40A 3VQTA 4F3RA 1CNEA 5JVDA 2JARA 4NABA 1E9CA 3WGZA 3SHOA 2R6ZA 4NS4A 3V1TC 2AA3A 2QTBA 2FXIA 3PHLA 2Q3BA 2J9GA 1NP7A 4Q4JB 4E4RA 3PGKA 1G19A 2J32A 2WTNA 2GK6A 1UC5B 1KSHA 3DE1X 3K8ZA 1EGVB 2A67A 3NETA 1ZUHA 4R1QA 4UCFA 4YYEA 3CF4A 5K0BA 1FDVA 1IY8A 1ULTA 4KWCA 4AXXA 1G2OA 4J7CA 4AO7A 4IOKA 1F12A 2E0IA 3K1TA 2ACWA 2CJWA 4UMDA 4LV5B 5KTPA 3UJ6A 4LOJA 2CXTA 4J0HA 3WLRA 4V03A 1JT2A 5BPFA 3FPFA 2CLOB 1T8RA 1A9PA 4MVCA 5FTLA 5IW8A 5JCJD 3ZDDA 2WNSA 5HFJA 3R4VA 4HLQB 5BYKA 4I4IA 3LX5A 2WT8A 3EH1A 2Q1WA 3JAWB 3PD1A 1E99A 1FPQA 1T8PA 2WIJA 4J4BA 4R8SA 4LOLA 5ECGC 2QMYA 1IZYA 3T3EA 3ZV6A 5C1OA 4B3MB 1A7UA 1C1XA 2B0JA 3L8EA 4FFBB 4P4GA 4HSEA 2O05A 4JYBA 1KEZA 1L8AA 4L50A 4MINA 5JLAA 4B8WA 4PHCA 4NZMA 4WY8A 1JJFA 3LVQE 4Q9IA 5ICCA 2P2SA 4F5EA 3PRHA 4G84A 2QI9C 3ENVA 4XLLA 4P3PA 3RB8A 2UYCA 1SU4A 1Z47A 2A9FA 3DHYA 1YZQA 2ZWVA 4YMSA 5FNVA 3W7BA 1JA1A 3Q0EA 1TO2E 1DUVG 2VK1A 2H0AA 2V65A 4QQ8A 4Q3EA 3LCVB 4M8LA 5IKMA 2AK3A 2V7GA 1QIFA 3TQIA 1GAWA 3BJEA 3QUQA 1MTOA 3GNQA 1MJFA 2ZVQX 1J2EA 3JWJA 3K96A 4GWLA 4W1PA 4D82A 3KTOA 1NXXA 4YMUA 2C00A 2YHSA 5EMNA 4HDMB 1ZL2A 2G28A 3NVMB 4D9IA 3EVZA 3FNFA 2FETA 1H6DA 3D6AA 4HNAA 5CGZA 3IC5A 1M6YA 3GK3A 3H5AA 4XB1A 5K4AA 5JQGF 2JGMA 5CIQA 2XNCA 4QU9A 4W5JA 4Q18A 1O95D 1XDGA 1RWWA 4LF5B 2EBWA 4E7OA 1WCIB 4UNSA 2IXGA 1E77A 4MP3A 4R01A 4XQCA 2UVPB 4CLRA 5A1TA 1J33A 1Y9ZA 1DGQA 1O54A 1E79A 1ZFNA 3ANYB 3GJ5A 1J90A 1MJGM 3WLJA 3QA9A 1I1QB 3SSOA 4XB6B 2A0WA 4BXOB 3EGVA 1EBFA 2DPYA 2SKDA 1GAJA 1XRNA 1ZOPA 1TVEA 3ZGZA 3ROXA 5JSQA 1Z0FA 4XX0A 2FFRA 4X95A 4MVYA 1AURA 2V7VA 1CKEA 4IQ0A 3IFSA 1SVUA 3W5BA 1LZLA 3PJGA 1WXGA 1OV4A 4LY9A 1AXEA 3WWYA 5DX0A 1SZCA 1CFZA 4RJJA 5KAPA 4YCDA 1EGMB 1V39A 4YCJA 3VPDA 3MOGA 1XKLA 1EWKA 2W2NA 4C21A 5KVSA 4US0R 1ACMA 1V37A 1I2AA 3P2IA 2FUKA 3T4XA 1FP2A 3WLSA 3C48A 2ZCVA 5AOCA 5FR1A 4BV2A 1BA3A 3P9KA 3HB7A 1OXKB 5F52A 2IZ7A 5TQVA 1MA3A 1Z5GA 2JH8A 4XASA 3T34A 2CEKA 1KK3A 4TLBA 3ZS9A 1LY1A 4S0XA 1SXJC 4I3FA 4MR8B 1FMTA 1Q1BA 5CB4A 1SCUA 3H8SA 3UANA 1VGVA 1VJ5A 5JPDA 3R4CA 4F8JA 4AJ9A 4XM1A 2RHBA 3OPXA 2B7CA 3L0ZA 4GYWA 4TYNA 5L8VA 1H1DA 3V48A 2XKJE 4O4LB 1SQ0A 5I7EA 1RJ9B 2Q1TA 2JJ1A 3IP8A 4BZWA 1U5AA 2GEUA 4EG6A 3TUJC 1BC5A 4PLCA 1GG5A 2IXDA 1BWPA 4AWBA 3PXBA 4G1CA 3UNXA 2GZHA 2WHRA 1T1EA 5JJKA 4XUGB 3ZCRA 4AM8A 2I4NA 4DAOA 4B6QA 1VPVA 3AIIA 4FNOA 5TS3A 4HXFB 3R7AA 2VUSA 5A3SA 3WOHA 3KVNA 2FSUA 1YMQA 1QVWA 2IH2A 4AFNA 3I83A 2VF8A 2PUHA 3M3DA 3UPUA 5DDIP 1I6MA 4BO1A 1V6CA 4G1UC 1EA5A 4X8LA 5EHIA 3AWIA 4BYGA 4I2NA 1HV8A 4GQAA 3IPAA 5FPTA 3TO5A 4L16A 1VRCA 1N5KA 5COBA 3JQ9C 1GEEA 3C8MA 2IFTA 1I4TD 3BMNB 3NVAA 1VE1A 3OX2A 1FSZA 3EK2A 5CVVA 4N6GA 2CV1A 3QK7A 2WM9B 2L19A 4M86A 4YRNA 3GUVA 1MDFA 1PT9A 1X80A 4PO3X 3FNIA 4IIXA 4YRSA 2BP7B 4H9GA 3DVQX 1CY0A 4PSKA 4WZBE 2HJRA 3I04M 4P82A 1ODSA 5AI5A 2RB5A 3VR6D 4FS8A 2YY5A 1ULHA 4WCFA 5H80A 1ACJA 1OBFO 1YONA 2CKMA 2GJ8A 4IMPA 3NYWA 3RCBA 4ASUA 4F4FA 2A9VA 3UXEA 5ALZA 3PR2B 3VR0A 1Q0RA 1U2SA 2PH5A 1NPTO 3WKDA 5IJ0A 1KBZA 2WB2A 3SZOA 1KPHA 2J9XB 4YDHB 3VYUB 1L4LA 4ZT7A 5DIZA 5KOIA 4K3UA 3L7MA 4KPEC 4TGLA 3QF4A 2NYAA 3OZTA 4IGFA 3SSNA 5KTMA 1I94B 1R1DA 3F8TA 4U3JB 1EGHA 5AJXA 1AV7A 1PR9A 2WPDD 3KSAC 2LDXA 3OLYA 4RDIA 1WUTA 1W30A 3LCCA 3OZBA 3R09A 3HJTA 1NJ5A 1A5TA 1AHHA 1SUIA 3KETA 5KPDA 2ONYA 2YNMA 3FCAA 4UTRA 1VSBA 2PYIA 4XPIA 3WK6A 5A06A 3Q8KA 3QOFA 2OXTA 2RHGB 3MQ2A 3ZJUA 3SE7A 4ESVA 2ZTLA 4LTDA 4KR9A 3UC9A 3ZW8A 1L9XA 2GMWA 4KU4A 2I2CA 3I4FA 3NBFA 4PAWA 4TL8A 3ZCTA 2PMKA 4B7XA 2D0DA 1W6RA 4P5PA 3OU2A 2C2MA 4JUAA 4KYIB 5H16A 1NKTA 4J94A 2C3UA 4QYWA 4RKFA 4YI5A 2D62A 4LJ7A 3GT4A 3WV5A 4FB5A 4QUAA 2ID7A 1ZISA 2B4TO 5DP1A 3FLAA 3PHGA 5FLKA 3IHWA 5K5EA 2EGGA 1XFAA 1ABEA 2IHYA 3ZK8A 5HQTA 3EXFB 4KDFA 2OHFA 1EZ4A 2AJ8A 2CZGA 1B0AA 2HQSA 3AW8A 3MSXA 4A0SA 1Z0SA 4PQFA 4ARZB 1JEAA 2G76A 5D51S 5K3BA 1NR1A 2WQ6A 3WICA 1JDVA 1BXRA 1YRHA 1K9VF 2GAAA 2P1DA 4UE3S 1JTFA 3FYHA 2P3SA 2F1IA 5ALRA 4P34A 4LQCA 2W43A 2JL1A 4NBLA 1BRMA 2ZDGA 4HUTA 4H0FA 2QR3A 3ELDA 3OPYI 5CH8A 3Q0IA 3FNRA 3W04A 2R1UA 3R74A 1J49A 3F67A 5TMBA 2OCIA 2RH8A 3WGYA 4N8SA 2BMDA 2IA5A 4WUVA 3S5UA 1M6HA 2QZZA 2WJIA 1OV6A 4BKOA 5L53A 1UEXC 3JU3A 3FTEA 1DOHA 4IJKA 2Z57A 4KFRA 4RPLA 2OGZA 2JFFA 2XEXA 4RNCA 2P6RA 4G4IA 3RVMA 4B7CA 2FPRA 3VNUA 1WDWB 4A5SA 3RO7A 1Q6YA 8ADHA 2UU9B 1E6MA 3GUCA 3QW4B 4ZZIA 3PXCX 3D7LA 2LP4Y 3LF2A 4TTRA 5TVKA 4C4RA 1Z4IA 4X94A 3S55A 5JD6A 3Q3JB 3K5IA 1G5IA 3JQ7B 4X8MA 1GKIA 5JXJA 1BH6A 1OT5A 1C9EA 3UJ8A 5K4HA 2IDJA 1XLTC 4MTCA 1XN4A 1HE5A 5AXAA 3GCZA 1E2NA 3O1LA 3HJCA 4UDOA 1M10A 2AC7A 2HV8A 3HDTA 4R1LA 1Q1EA 1N5OX 5LZ2A 3VVBA 4MCHA 2ZTHA 2ZREA 4GGOA 5FFMA 2QD1A 2XMPA 3DYIA 3S7TA 2WT4A 3N6VA 3UF0A 1CW2B 2IC5A 1Z4PX 4LKRA 4YAOA 1M2KA 3PXEA 3MEQA 1T9KA 4JQOA 3UMFA 4YCNA 3NHZA 4D96A 3WE7A 2RAPA 1V1RA 1PR6A 2XHEA 3L1VA 1TAUA 1PGJA 4OJMX 5FT9A 1Q2XA 2BGGA 3WRWA 3VC2A 1EP1B 1S3SA 5GVSA 3GJ4A 1S8AA 3EPHA 3N2GA 3OE7D 3MRSA 2AEFA 4AY6A 1QIMA 2HHAA 4IDCA 3DFIA 4UC0A 5H4HA 4XTRA 5EWLB 3WLKX 1VJ1A 1P61B 2FN9A 4NYJR 3KFLA 3CH6A 2VRCA 2HDWA 3D8HA 1V2HE 2W2XA 2ORED 1Z2DA 3IUYA 3DFFA 4NFSA 1FJ2A 4RA9A 1JG3A 3VC7A 2ZRQA 4KQHA 3P96A 5DGIA 5ENZA 5J5CA 1MC1A 2DHQA 3E3OA 5KQGA 3HJBA 1COWD 2FMFA 3RC2A 2XDQB 1J42A 1WY5A 1LQTA 5EXDA 3TTTA 2H2AA 4QECA 2VLBA 1JA9A 1U3FA 1Y98A 4Q34A 1G5PA 5NLLA 5FTMA 2HOQA 5GV7A 1SHLA 1ZLYA 5ITZB 2HIAA 4ZIRB 4C88A 1US8A 3KAPA 4J2OA 5FKJA 4Z4IA 3LWZA 4V2IA 1U6JA 1C41A 3SIXA 2WR8A 3E22B 1GU1A 4M1ZA 3I5YA 4M6WA 4EHBA 4RVHA 1CRLA 3HA2A 5CXSA 1UQTA 4IJWA 3HXPA 1ODCA 4W8GA 1NRWA 1O89A 2H1VA 5ILOA 2Z9DA 1FLNA 4UUOA 2RJNA 4DR4B 3MWFA 4QDZA 4FMPA 4I6EA 1YI8A 2QXUA 4RF3A 4L07A 4WEOA 1GUDA 5I9IA 5AK6A 1N57A 4JH0A 4RK6A 2OCLA 5JO9A 2C4WA 4B79A 5AHKA 2XE7A 1XD8A 2M1XA 5BRAA 4PPYA 1CTQA 3G0IA 5G0VA 5LP6F 1NF9A 1Q14A 2FSHA 2ZCJA 1YKFA 5FQNA 2UZ0A 4MRRA 2ZIZA 1C2TA 2DH5A 2VRBA 5EJ4A 2I91A 3O6VA 1KZ1A 1NQWA 3O4HA 2A4MA 2O0JA 1XN1A 2RKWA 1BROA 1ZH8A 4LDAA 4JLSA 2PX8A 4J9UE 1XPOA 5CBKA 3KM0A 2GLTA 3KHKA 4W5NA 3COVA 3Q1LA 4KIGA 4G23A 2X19A 3CPSA 5JYCA 4LQ4A 3QV2A 5EIXA 1EVQA 1S1CA 3EFEA 3MT8A 1RQPA 1QF9A 3W9BA 2J4DA 3S2UA 1MV5A 2WMYA 3B9QA 1D1TA 1KZ9A 3KVOA 2W2KA 3ZYCA 3IMGA 4GO1A 2YW2A 4AL4A 3GLRA 2EEZA 4BLSA 3WGUA 3WI7A 2OQIA 3F9CA 3PEFA 2V6BA 3RVBA 3NPAA 3PGJA 1DTEA 1O5OA 1XAIA 3DEJA 3H5WA 4B6GA 3WFIA 1D7OA 1T0PA 2GLUA 3AIOA 3I32A 3ZDFA 1KI6A 1NG1A 2A57A 2RE8A 4UPDA 1LTHR 2JGEA 2JIPA 2JLXA 1OH8A 3SEAA 1LNSA 1WPXA 2Q29A 1P80A 1ZN7A 4GU5A 1DJLA 1MJHA 3H99A 5DRYA 3W4JA 3OFND 4CXMA 1B42A 1W5SA 1T2AA 4N39A 4DWVA 2P9YA 4W1SA 2BSQA 1G4AE 4BNXA 5JE8A 3FVQA 3M4ZA 2OFXA 1KOJA 4JA2A 1NF2A 4ZO6A 3VTFA 2AN9A 2R6R1 4DDWA 3O26A 2R79A 1VCHA 1W0KA 5AW8A 2ATIA 3TCNA 1QX4A 1L7PA 4TLAA 4EJ2A 3MUOA 4HJXA 4M1QA 4RLQA 2NVWA 3ABSB 4UZSA 5CEEA 3WR5A 4GKKB 4ND4A 5LBUA 5GY7A 3LUGA 3Q9UA 5A6SA 3SFZA 3EFOA 2YVUA 5AVRA 4DUGA 1Y6JA 2PL5A 5I9SA 1EUDB 3TB6A 5BMVF 5BORA 4PG4A 5LNK6 4MNTA 3DMPA 4IXWA 2YY7A 3VMMA 3A2KA 1XHLA 1FJHA 4GKAA 1RQRA 2WZDA 4Q9DA 3RKUA 1BVRA 3NBZC 5KNDH 3GFOA 3VJRA 3TKLA 2E87A 2A2ZA 2NO4A 1W88B 2H29A 2F4NA 4NU8X 3I5XA 1G8PA 4IWNA 2QRQA 2PX0A 5JAHA 4E08A 2DFVA 1KDOA 1K88A 2YS6A 4WJKB 2C2BA 1SQ6A 2H1RA 5TJ9A 3CH5A 4BB5A 4ZYYA 3GAMA 3TSZA 2IYFA 2V6MA 5AWFC 1N36B 1UUFA 4MHTA 3TDNA 3G0DA 2ORIA 3IV6A 2OCBA 2YMMA 3MXTA 4Z2YA 5B30A 5BUQA 4B71A 1PYGA 2RGNC 2RHDA 1SCQA 3ENKA 1RXYA 3IA7A 4UUQA 3RC1A 4EHDA 5HJ7A 2ZIEA 4D98A 3BHMA 4XR9A 3EQ6A 1QG4A 1HE3A 3N7UA 3GGSA 1YA6A 3OBBA 3QWAA 1ZD1A 3KSDO 5FOTA 3WGGA 2OHGA 5FIUA 2WJPA 2PL3A 4YT5A 3RVJA 4BQSA 2POCA 1ESEA 2I62A 2IYAA 3GBPA 5EFZA 3WQBA 2DERA 1JYFA 1MX1A 5C8YB 2QZJA 4OLAA 1KDTA 4PXSA 4S1OA 1ZK2A 2WKWA 3ET4A 3NHMA 4HB0A 3ZQ6A 1W5EA 3NBKA 4W9RA 1HLFA 3FNEA 1VMAA 2WIDA 3GHYA 4IZHA 2XD4A 4RD6A 3I45A 1Z6ZA 1KETA 2PS1A 3BIFA 3FMVA 4ZAZA 5JLJA 1G16A 5DOVA 2ZJ2A 4KRXA 1RRVA 3L04A 4M2LA 4R6WA 1FRVA 1PQUA 1RYZA 1T8TA 4AYXA 3B2NA 2FP4A 3GT3A 1MEJA 4LOKA 5AKXA 4P3KA 3WB0A 4GPD1 4CM4A 3R2JA 2YZGA 4DAEA 3KPWA 4FM9A 1ZNYA 4PR3A 1VL0A 4YRAA 1XQ1A 3UJNA 3GPDG 5I9BA 4JV5B 1UOQA 2ENWA 1JWLA 5JMTA 4EAAA 5KMGB 2OSVA 3T5TA 1NAIA 2QX9A 1HTBA 1SELA 2QAGA 1IONA 2B6HA 4HJRA 4BMOB 4ER0A 1I3OA 2QRMA 3AW9A 3BJMA 4RA6B 4ZCQA 2VXBA 4OOFA 4OO3A 2XODA 1U8ZA 2PD6A 3AUAA 2C4TA 5CT8A 4YRFA 5FBLB 1SO8A 3UOWA 3PEUA 2VCYA 4EB6A 4FD3A 3CVOA 3NJ4A 2B78A 4KGXA 5JS1A 2IEZA 121PA 1CQWA 4B80A 5I7HA 1UZUA 5HTKA 4XWKA 5IYZA 1D7AA 1N6LA 4F21A 1TK9A 4QXRA 1APBA 1NMSA 2J59A 2LZ0A 5CK5A 3SNHA 3D64A 1QG0A 3PZBA 5EWLA 1ES9A 4B7ZA 1FLVA 4MWOA 1HL7A 4O4HA 3F1LA 1WP9A 2PAFA 3OBIA 3QBTA 5BQFA 3SVLA 2Y9MB 3QWHA 3KKKA 4UU8A 2GCEA 1UANA 2ZSUA 1V7ZA 3MWGA 3MA0A 4MUYA 3KVYA 5DNYB 5K3OA 4WOPA 1I4OA 4ZVPA 3Q8WA 1Z82A 1CY1A 1D2RA 3EUWA 3KJIA 4W9MC 2QU7A 4Z9AA 1JHUA 3PD0A 3AVWA 2P2DA 3L5KA 1RXCA 3LXUX 4MVJD 2QTNA 1LBHA 3QBDA 2YZKA 2NT3A 3F9IA 1ZI9A 3OLWA 5F12A 3CCCA 2YQ4A 5HBRA 1OB5A 2F3QA 5G40A 2GI4A 4JLAA 1OX4B 2VDVE 4M21A 1JSXA 5IC5A 3ZVLA 3DLAA 3EWSA 3W8DA 4JQSA 2V7XA 3THWA 4P8RA 5DNAA 3I5MA 3AKYA 3L4BC 3GRCA 2YUIA 4P38A 2JGNA 1H65A 5D87A 2HRZA 4CG1A 4E5PA 5A03A 3AERA 5C51B 1J5EB 5HM8A 4RFSA 1AQLA 4ZCLA 1YCFA 1J8DA 4UM8B 1IZ7A 1KI3A 2AD5A 4FEEA 3FYTA 1K98A 3UJCA 1ZJWA 2WTAA 3M6FA 3OSUA 4J29A 4QTZA 4LJ6A 4UKDA 2Y9PB 5MDHA 1T9HA 1K7CA 2QU8A 2Q9AA 3GW8A 2FPOA 4IIGA 4P31A 2B34A 4S3MA 1DT5A 2ORVA 3HP4A 4FGWA 4N82A 5KWEA 1E63A 4OFZA 1OWOA 3OQHA 4N6NA 3CCBA 3AKDA 3SZLA 1CRPA 2CXQA 1GU0A 2CUKA 2VTVA 1ORRA 2XWBF 3HC7A 4RIGA 3VFDA 1O8CA 1VIMA 1AE1A 4R68A 3JQ8B 4B34A 2HA0A 1MABB 3MBKA 4Q48A 1C1HA 3OSZA 3EY4A 3NW9A 2VSQA 4YV7A 4DJEC 4GPIB 5IK2A 2AG0A 1VXRA 3KOZA 3V00A 3F5QA 4QEKA 3G9QA 3DZHA 4C43A 5F5NA 1NUAA 1PVDA 3HCWA 5G3ZA 4XGNA 5JHGB 4ZU6X 1JQ3A 5MHTA 4A6EA 2B0CA 4KLRA 1F9EA 1Q20A 1SG6A 1VKJA 1XZJA 2XLCA 5JDCC 4C1BA 2RGAA 4O4JF 3UGKA 3K9BA 3C3BA 5IARA 3CLUD 3PQ6A 1BX3A 3C74A 3G85A 1CUJA 5FUQA 4LMRA 1HX7A 4CKWB 3L4JA 2DHCA 2XKBA 1GL3A 4FFLA 4X7MA 5KOYA 1XPRA 1IXYA 3BKWA 3FI9A 2EKZA 4MUMA 3JVUA 4IJ5A 2Z6VA 5LXTF 1E9EA 3LCRA 1ABBA 4E5YA 5SYNA 4LMAA 1AUPA 4CKXA 2IHUA 3O47A 1EXWA 1KF0A 2H2DA 2VATA 5CLQA 3TBFA 4BASA 2GVDC 4FB4A 1CEEA 1X9HA 3IE0A 4JOBA 3NGLA 2QJTA 2WVAA 4XDYA 5I9MA 1B6RA 1L7QA 1T0BA 1WHTA 2LIVA 2WTEA 3PR1A 4JB8A 1TIKA 3PFNA 3TB4A 3IPLA 5T4FA 3CS3A 3DNPA 4YRJA 5KWSA 1K8XB 1LQUA 1V7PC 1VSVA 2I6FA 2I2XB 2Y8EA 3EDYA 4IX9A 4K6OA 5AW9A 3UXHA 3N2KA 3BTUA 4BP3A 3NR2A 3LNTA 1W2HA 2NZYA 3I2IA 4FIZA 4NJOA 1E3WB 2WPNA 4M8IA 5EYPA 4ER5A 5LBIA 4A2WA 4IXTA 3QUTA 3AF0A 5DYGA 1CD5A 4DADA 3WB9A 1EVLA 3FOWA 5E7QA 2EF1A 5HKKD 4NWIA 1KAHA 5FP0A 4PNEA 1CQJA 4WTOA 2FUG6 3P5SA 4JLVA 1R15A 4JX8A 3T5GA 3D8BA 2CLCX 5I9LA 1CLEA 2EP7A 4YRMA 3NZEA 2J3KA 5B3JC 3F5FA 1W4ZA 2O19A 3F6SA 1R0XA 4IGIA 4K26A 2I67A 3DUFA 1A88A 2ARKA 2J4CA 1F2TA 1WCXA 4CU2A 4R41A 3IS3A 2HSEA 4EVIA 5B2FA 4RD4A 2JGDB 4HHEA 1RRMA 3OETA 1KO4A 1ZGHA 2QZSA 2HJGA 2JLBA 2ZVDA 3OWOA 3P2JA 4DSUA 2EF0A 1G66A 4MKXA 4NZPA 3FZQA 5BURA 1L8LA 3VTAA 1JSRA 3BBLA 3DHWC 4DIOA 1IVSA 5DWQA 1VKRA 3G9TA 3SS9X 4FSHA 3QQPA 1M0SA 4NH4A 3F90A 3N5CA 4NOLA 4Z2AA 5JXIA 4N3CA 2XXJA 3UGJA 4H7IA 4I99A 3M9XA 1G98A 3T7CA 1K97A 1JHQA 4G5HA 3JAKA 4L9RA 4DLYA 1XVTA 5HRUA 4LBYA 1EE9A 4RGQA 1Y8AA 2PUTA 2ZK7A 2FOXA 1TU4A 1Z18A 4IRMA 3PDIB 4J43A 3V97A 4BLQA 1BMFD 2VOEA 4Q82A 2C5HA 3B51X 3CN9A 2Q9UA 3IAXA 3DVRX 3O9ZA 3R8XA 1I6LA 1QP8A 4Q5IA 1V6SA 4FTWA 4LJ8A 1XXHA 4WHMA 5EE5B 3C4QA 2W2LA 3TZEA 5AJWA 1MTZA 3BEDA 4N7RA 1NLYA 2F1HA 2FPLA 3KEOA 1SN7A 3EIOA 3FCSB 3MJEA 3R6WA 4G97A 4P36A 5G1OA 3EQZA 2PYZA 4K1LA 1U4NA 2V7BA 3ELUA 3TBHA 4K8RB 2PS3A 2QVLA 5A4JA 5M34A 5BV2P 1QHGA 3DWIA 3KL4A 3MGAA 1XB2A 3Q12A 4UTZA 2JHAA 3QWIA 5IJAA 5KOHA 2XCSB 3RWOA 8ABPA 4CIAA 2FUNB 3ESZA 4WOKA 4RS3A 4M54A 5IXSA 1C7EA 4DA7A 1QGUA 3C7AA 3KJQA 1Q1AA 3TSCA 4B3SB 1TT7A 3BDVA 4MYCA 4PE5B 4ZOLA 2FWAA 2SNIE 3PUKA 3R24A 3R7BA 1U11A 4MARA 2HRCA 3ASZA 3O9MA 3GZTB 4S0ZA 2PT6A 1MOPA 3HWWA 1UPXA 3W5IA 5CFPA 5K01A 3FNBA 1MB9A 1H3EA 2RGBA 1QRTA 1E9DA 2FWJA 2UYOA 2OV4A 4F97A 3ZGXA 4EKDA 1OXVA 1J8QA 1QYRA 5JNRA 4WZBA 4MH0R 3ME5A 3Q2IA 4FLMA 3ZWQA 1BE0A 1QF6A 3U4HA 5K2OA 4EYOA 4HPWA 4KXYA 4JCCA 4NFYA 2O2YA 5JXWA 2BMEA 2Z3VA 4J7XA 3CA8A 5KX5B 5AD1A 2VZLA 4UU0A 1DARA 3BSSA 1UDRA 3OIVA 4JP5A 4JK3A 1O8BA 1XTZA 1JWAB 1G20B 2J3IA 4KWIA 2QN9A 1ILEA 3NDPA 4MUKA 5TS2A 4RV4A 3D3WA 1HE4A 5D8DA 2ZSEA 2FZGA 4BNWA 1P5JA 6YASA 3T7TA 1SJ9A 2GD1O 5A5VA 2HREA 4H7KA 1G21B 1KMHB 1PW5A 5CITA 1CR2A 2OFPA 1M2VA 5AXBA 4G5QA 1AQNA 5E4JA 1XLTA 4BKQA 1UOOA 3CZRA 1G17A 1O0CA 1ZHOA 4QICA 4XJSA 3C5WP 1XA0A