4UEJA

Closed state of galactitol-1-phosphate 5-dehydrogenase from e. coli in complex with glycerol.
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
346
structure length
346
Chain Sequence
MKSVVNDTDGIVRVAESVIPEIKHQDEVRVKIASSGLCGSDLPRIFKNGAHYYPITLGHEFSGYIDAVGSGVDDLHPGDAVACVPLLPCFTCPECLKGFYSQCAKYDFIGSRRDGGFAEYIVVKRKNVFALPTDMPIEDGAFIEPITVGLHAFHLAQGCENKNVIIIGAGTIGLLAIQCAVALGAKSVTAIDISSEKLALAKSFGAMQTFNSSEMSAPQMQSVLRELRFNQLILETAGVPQTVELAVEIAGPHAQLALVGTLHQDLHLTSATFGKILRKELTVIGSWMNYSSPWPGQEWETASRLLTERKLSLEPLIAHRGSFESFAQAVRDIARNAMPGKVLLIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords GALACTITOL-1-PHOSPHATE 5-DEHYDROGENASE
publication title Enantioselective Oxidation of Galactitol 1-Phosphate by Galactitol-1-Phosphate 5-Dehydrogenase from Escherichia Coli
pubmed doi rcsb
source organism Escherichia coli
total genus 110
structure length 346
sequence length 346
chains with identical sequence B
ec nomenclature ec 1.1.1.251: Galactitol-1-phosphate 5-dehydrogenase.
pdb deposition date 2014-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4uejA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4uejA01
2A92A 3FSRA 4H3VA 1WPQA 1LTHR 1I8TA 1FK8A 2AXQA 4CMJA 4CMBA 4U0JA 2HQ1A 2WDZA 3F6YA 3S2FA 1F14A 4A27A 4DIBA 4YAJA 4CL3A 4XRGA 4CLOA 3DC2A 1XWFA 3FF4A 4TKMA 1H6BA 1VSVA 3CE6A 2DC1A 1EVZA 3ZU3A 1I36A 3SXPA 4J4TA 2PA3A 1YO6A 4J6FA 1YL7A 3UHAA 1NYTA 3VVBA 1QYDA 2Y1DA 2OGUA 1Y5RA 1SPXA 2PKQP 3AY3A 4CLOB 1XQ6A 4WEQA 4FJ2A 3CEAA 4DTIA 2ZTMA 3OM9A 2G17A 2DTDA 5CG1A 1YQGA 1X13A 4KQWA 1E3JA 3HSKA 3EZLA 1BVRA 2Q46A 4U8GA 3INRA 3GGPA 3R3JA 2QG4A 4S1VA 2EKLA 2OXIA 3WSWA 2AHRA 2X5OA 5IDYA 1ZXLA 4DQXA 2PGLA 3DONA 2VT3A 1IY8A 5BNFA 3MJSA 3UXYA 1OAAA 4EUEA 1NPDA 1HTBA 3BIOA 3RSHA 1S7CA 2AEMA 1RPNA 2EW8A 1J6UA 3QSGA 2PY6A 4YAEA 2GNAA 4O0LA 3ZV6A 3LC7O 1F8FA 4AJNA 3AFNA 3UCEA 5DCUA 4AJ2A 1DLIA 2Q50A 1NAHA 2EKPA 4YJGA 5FYDA 2HRBA 5A4DA 3RD5A 2ZATA 5F1OA 4E2YA 5B1YA 3D4OA 2UDPA 4XB1A 2EGHA 2GN8A 3OIGA 4FCCA 3SVTA 3TN7A 4FW8A 5BSGA 3PHGA 1DAOA 4WK6A 4YT4A 3VPXA 5IXSA 3ZU4A 3WNQA 5T5QA 4KDEA 2RCYA 1PWZA 2Q1WA 1A7AA 9LDTA 3PDUA 2O3QA 5K0ZA 2YQ5A 3KM0A 1M75A 1NWCA 4Q3NA 3PEFA 2C07A 2FRDA 4YJGB 3C24A 1X1TA 1U5CA 5AYVA 1HETA 3KTDA 2FHSA 1F8GA 3VHRA 3BHMA 3WX0A 1CRWG 2BI7A 4RGBA 2GN9A 4BO6A 3PHHA 3CZRA 2CSUA 4CM7A 3V1UA 1Z6ZA 4EJMA 1K0UA 2ZYGA 1UR5A 1T26A 2DBRA 1VLLA 4BGUA 1RM5A 3R3SA 3AY7A 3N74A 4P8RA 4XJTA 4E13A 2UV8A 1Z7BA 2IRWA 1I2BA 5U9CA 3ONDA 1TB4A 4PLFA 3GUYA 4A26A 1V0JA 3ZHBA 4M86A 2JCVA 4XKJA 1IZ0A 1HE5A 5G0TA 3WGYA 1ZH8A 4RVHA 1SB9A 3F5QA 3ZV3A 3HN7A 2CDAA 3D1LA 4IJUA 1U7TA 1SEPA 1I3LA 2OL4A 1PL8A 2BFAA 1AHHA 4J2HA 1RYDA 1P33A 3BHJA 4YAGA 4FFMA 4BQRA 4BNFA 1VKOA 1S6YA 1ZSYA 3HUDA 1LDGA 1HE3A 3WJ7A 3AK4A 3GN1A 4ILKA 1LDBA 3PGXA 1IB6A 2ZTVA 2BFOA 1K2WA 4Y67A 1CDOA 4E31A 3H9UA 2J5KA 1FDSA 4HY3A 4YRDA 2AQHA 1ZEJA 4P22A 5EERA 3FNHA 2J6IA 3OIDA 3PJEA 2ZTLA 4WE3A 5DCYA 4YJHA 3OFSA 3ROPA 4W9NC 2ILTA 3LLSA 1MG5A 4B7CA 3BA1A 1E3WA 3DBHA 5KJ1A 1XGKA 1P3DA 2D3TA 2WYWA 2YFQA 4XR4A 3DHEA 4IQGA 1NXQA 2HKIA 4CLEA 1GFSA 2RBEA 1M67A 2HCTA 3I9KA 5EESA 3UICA 3H9QA 5GMOA 4FN4A 3WSVA 1YDWA 4YJHB 2VWGA 3VPGA 4L4XA 3RQSA 4BNZA 1PGOA 4XYLA 5THQA 1VM6A 3JQFA 1E3WB 3DBHB 3LF1A 3U4DA 3FPCA 3IL2A 1CWUA 4PGFA 3KSDO 1E6UA 2DLDA 4NBTA 4RPJA 2D59A 1DEHA 2FPPA 1C14A 4IQ0A 4QO8A 5JDCA 3DAFA 3H6KA 1BTOA 5HWSA 3IP3A 4ROSA 1HRDA 2VYVA 2GF2A 2XPCA 1ZO8A 3AOEA 4CL8A 3FRJA 4PIVA 3BMQA 4IJWA 4W6ZA 4OKNA 1SC6A 2RAFA 3GQVA 4M8SA 3PYLA 4YAIA 3SX2A 4QX6A 1N1EA 4E21A 4E6PA 4YRAA 3UN1A 3SEFA 3RFTA 3ZV5A 1DOHA 4AJJA 3A4VA 4D44A 4D3DA 1ISGA 1YBMA 4GAEA 3BMQB 1YL6A 3MJVA 5FEUA 1ZNQO 3Q3CA 3NT2A 4YEDA 1SMKA 4UEKA 5KJFA 2VWQA 2D5CA 3JD0A 2NADA 1ZSNA 3DOOA 1Q7GA 4FD3A 4NMHA 3NKLA 4ZQBA 1PJLA 2QZZA 1GYPA 5IN4A 1IZ9A 1W8DA 1ULUA 1DRVA 5JE8A 1UDBA 4NK4A 2FR1A 2X0IA 4B4OA 3H65A 4FOOA 1M6WA 2FN7A 2OMEA 2W98A 3SBOA 3RC7A 5KJCA 4UUOA 5AOVA 4NK5A 4PLPA 5IAAA 5A3VA 3HNPA 4HNGA 1E5LA 4KZPA 4R4JA 2GASA 3GRPA 4JROA 3H8VA 3D4NA 2ZTUA 4G5HA 3K30A 1E1KA 2G0TA 4YBZA 1A9ZA 5KJEA 1VSUA 5JNLA 3D5QA 4HFMA 1LLQA 2AEJA 2FOIA 3X2FA 1M76A 3G49A 1B26A 4AJKA 5I7VA 1J0XO 5A5EA 4WCFC 5HM8A 3HZZA 2Q45A 5JCXA 3LT0A 1BG6A 1P1FA 2QIOA 3MEQA 2W2LA 3DMTC 4RVSA 2NU9A 3MOIA 2VOEA 1FDVA 4K26A 5ILOA 1WMBA 4CM9A 4RVGA 4J90A 5IDXA 1ZVMA 3ANLA 2DTEA 4I9UA 1DC6A 3MJTA 3T4XA 4CM3A 3NDRA 1JQBA 5JYDA 1H2BA 3W1VA 5CDGA 3GUCA 4XR9A 2EV9A 3EUWA 3JQ8A 4CV1A 3W6ZA 2H9IA 3STHA 1LSUA 3WIDA 1Y5MA 1M6HA 4J3FA 3AUTA 4IXWA 3FTPA 1LDYA 5H83A 1E0DA 2DT5A 4ZQEA 3TNLA 3GLQA 1T2AA 3DZFA 2IZ0A 1D7OA 4GX1A 1HDYA 4IJVA 2WYVA 1G6KA 2YQ4A 3E8XA 3JQ8B 3FWNA 2GSDA 3S1LA 6ADHA 2VUUA 5HTOA 2JFGA 3ETGA 4NBUA 4J4BA 3D5TA 3OSUA 4CMEC 3LC1O 1BGVA 5CP8A 3RC2A 4TRRA 1OC4A 4CV3A 1DFHA 1TT5A 4GVXA 3I6QA 1YXMA 3UUWA 4MKZA 3BTVA 3ZGYA 3WGZA 1O8CA 1IPFA 2X22A 1H6AA 1M2WA 2WD8A 1NBOA 3WGHA 3SLGA 3L6EA 3MWDB 5F1PA 5I7FA 1EVYA 4BUCA 5JW6A 4XDZA 1ZFNA 2CVZA 5JCJA 2Y1EA 1J5PA 1R0KA 1N92A 5KJ6A 3ZCXA 5B4VA 2CF6A 1E77A 3F4BA 2CFCA 1NHGA 1T1SA 1TT5B 2Q1SA 3I9OA 4UREA 3KYDA 3PHIA 2BRUA 4NI5A 4CR8A 4K6CA 4BMVA 4BGEA 1AUPA 5I7SA 5ENDA 3U09A 3EVTA 1QKIA 3LVFO 3U4IA 2VYNA 1H9AA 8LDHA 4OXNA 1NAIA 3I9NA 4MP8A 5AXBA 1KY5A 4NG5A 2DPGA 3ONEA 2Y99A 4R9RA 4W4TA 5G4LA 4PLGA 1YKFA 2X7HA 1YQDA 4Y6PA 5TT1A 3ZWXA 1K5HA 3KYDB 2VWPA 4DGSA 3AUAA 4O6VA 3JQAD 9LDBA 1U9JA 3DDNA 2NSDA 4D7AA 2NTNA 4KUEA 2NVUA 4WLEA 1G0NA 1LU9A 1A9YA 1R0SA 1MA0A 3P2OA 3L4SO 1E7QA 1EVJA 1NM5A 1F17A 3GFGA 2R00A 2CMDA 1DSSG 1HEUA 4A03A 4ALIA 3PQFA 2FPIA 5EPOA 1BW9A 4ZICA 1SB8A 4CLDA 3IC5A 1GCUA 1NP3A 1KIFA 1XYGA 2NVBA 3GMSA 4OJNA 1AN9A 3TQHA 4IDAA 4PVDA 4FDAA 5K9ZA 1KEUA 3QWIA 2AEFA 4KQXA 2NVUB 1Y1PA 1Q0HA 3CPSA 2CDCA 1QR6A 1V8BA 4BKRA 1HYHA 3KYCA 5KVCA 4FGWA 3GT0A 5T57A 1DRUA 2WE8A 5CEEA 4JP2A 1LI4A 3ZHZA 3U4HA 1BVUA 1B2LA 4DLBA 4B4UA 4EJ6A 1PX0A 1PS9A 4E2XA 3AOEC 4YXFA 3GDOA 3IUSA 3WYCA 4RVFA 5JC1A 4AG3A 3H5RA 4LSMA 4Y98A 3PFFA 4OSOA 4GX0A 2OBNA 5A05A 3KRTA 5ES3A 1A27A 3KYCB 3L77A 4EUHA 4HX5A 3OA0A 3U49A 3CKYA 4XJSA 3FPLA 1QORA 4R3NA 4TVBA 4GPD1 3LLVA 4PLZA 1IOLA 3OETA 1GEEA 4BO4A 1SBYA 3QWFA 2B37A 4XDYA 5JFOA 3H5AA 4GSLA 3OEYA 4EZBA 5CFZA 5JAMA 2WE7A 3FNFA 2YUTA 2D1YA 4WECA 5TJHA 4JQCA 3VZRA 2EJWA 4MP6A 5EQDA 1RM0A 2VTDA 3LT4A 2Z95A 3GG2A 3Q6IA 1UXHA 4PG4A 3KSUA 2Q99A 1XELA 2YV1A 5EMHA 3UFXA 5A3JA 1FF9A 2YHIA 3IMFA 2VRCD 1I3KA 2YW9A 3I6IA 4N18A 4ZU3A 2BF7A 1U3WA 1VL0A 4U5QA 5L45A 3ANNA 4F6LA 2IEBA 4YRBA 4NJMB 4CV0A 4FSHA 4G65A 1LDNA 4J1SA 1LRJA 4RL6A 1LX6A 4J0FA 4DVJA 3ICCA 2HO5A 2FMUA 3RU7A 2B35A 1GL3A 1B8PA 4IDCA 1VL6A 2YHIB 1Y9AA 3RJ9A 1CJCA 1UXGA 1F0YA 1GU7A 1HYGA 1PGQA 2Z1MA 3E1KA 4WUVA 5KKAA 2AG5A 3BYZA 1TLTA 4FFRA 5LDGA 2YHUA 1R4MA 4PFJA 4E2WA 2Q2VA 4Q3CA 2NUAA 4AICA 1ULSA 4BV8A 4XB2A 2EXXA 3MJEA 3FD8A 4MVJD 3AI2A 3OEWA 3RC9A 4B3JA 4MIYA 1ZSVA 4FIZA 3TSCA 4NBVA 3DTTA 3TDKA 1KEPA 1C3VA 1WZIA 4J4HA 1M66A 2JD1A 1EE2A 1EUCA 3ORFA 2VUTA 3NEPX 2HMVA 1LLUA 2DM6A 4IZIA 5F5LA 1PS8A 1QLJA 3L4BA 4LVUA 1AGNA 4M1QA 1R4MB 3AU9A 1N2SA 4A2CA 1HDRA 3DFZA 4IGEA 2BFMA 4BL5A 1A5ZA 1JDJA 4B4WA 2F1KA 1KEWA 3RIHA 3GAZA 2DFDA 1NR1A 4R5HA 4XQ9A 1R66A 2JCYA 2ZQZA 4EGFA 4HADA 2VOJA 3PRJA 3F1KA 3RWBA 5HBRA 4LRSB 1G1AA 1GPDG 2EIHA 3DHYA 3QJ5A 3AY6A 3ZW9A 1V3TA 4KMSA 4ITUA 1CF2O 5A03A 1VPDA 2GCGA 3C1TA 4OHUA 1OOEA 4HKTA 3V2UA 3TFQA 2FSVA 2O4CA 4MOWA 4J7CA 4DMLA 3IDSA 4GWGA 3P19A 4ND3A 3EHEA 1ZJZA 1T4DA 1YB4A 4EJ0A 2VTEA 4CM6A 3QVXA 1I33A 1LNQA 3QLJA 3P7MA 3S8MA 4D46A 1PZFA 4L75A 3KLMX 2FPGA 4JIGA 1QYXA 4QFCA 2C7GA 1LJ8A 1OBFO 1P1RA 3DB2A 3GY0A 5TNXA 1O0SA 3VKUA 4B3HA 3PZRA 3GG9A 4E0BA 4UVEA 3RVDA 3D3EA 1LDEA 1NPTO 3H2ZA 1ZK1A 2ZB4A 2JAHA 1BXGB 2EEZA 1LLCA 1K6JA 3OHSX 1K6IA 2YV2A 4ALMA 2B5VA 4JJGA 3WNVA 3QIVA 2QZ9A 1UUFA 3RKRA 5IZCA 2HMWA 2PD3A 3JD4A 2G1UA 4OSPA 3SJUA 2Q1UA 2R2GA 2VN8A 2PR2A 3NJ4A 1K3TA 2B5WA 4TRMA 3H9GA 1XHLA 4YJFA 4QECA 5BT9A 4BNGA 4BO8A 3KHUA 2V6BA 3DQPA 2Z1NA 3BAZA 1OFGA 3KLPX 1PL7A 1V9LA 5ITWA 2I3AA 1HF3A 1R15A 4CMCA 2FWMX 3EVNA 5BQFA 4LW8A 4NIMA 3C7DB 4AJPA 5G0VA 3ZWWA 2DBQA 1E6EA 3ITDA 3HDYA 1E6WA 1GUFA 2HMUA 5TS3A 1U3VA 3WJAA 5FWNA 4HFRA 4YJFB 4UUPA 4E3ZA 4RJTA 5MDHA 3B20A 5L40A 3K73O 3ENNA 2FZWA 3GGOA 4R9SA 3VTZA 4E12A 1YQXA 3PVZA 3Q2KA 4WLFA 4TQGA 1TT7A 4CODB 3PDJA 2BMAA 4RF3A 3FNGA 5JMWA 2GN4A 2PH3A 5ER9A 1O9BA 1EDZA 5HS4A 3H3FA 3R1IA 4Z0PA 4UEJA 5AXDA 1NQTA 3ULKA 1NFFA 4DRYA 2A9FA 4J43A 1UAGA 4K9DA 1KC1A 2IXAA 3PPIA 3OQ1A 1HZZA 3LT1A 4CJXA 4GI2A 2VWHA 4BNYA 1NVMB 1E3LA 5EN4A 1Q0QA 4IDBA 4OO3A 1GYQA 2CZCA 2IXBA 4II2A 4WPGA 2P9EA 3FTNA 2QQ5A 1KY4A 2RH4A 1O6ZA 4I8XA 1NFQA 1F12A 2P9GA 1GQYA 1KBZA 1A4UA 3OJ0A 4NU6A 4RF4A 2VCYA 2HLPA 4L4SA 4TRJA 3ZWYA 4D3SA 1Z7EA 5T67A 5CEJA 1PTJA 1MB4A 3R6DA 1GTMA 2PK3A 3JQBC 2PD6A 4XIJA 5IG2A 3A06A 2QYSA 4YQZA 2AE1A 2Y68A 1K89A 3DBLA 2AQKA 2G82A 4MVJG 1PR3A 4PLTA 3K9QO 4E2ZA 4R16A 1QYWA 3ON5A 2Q1TA 3HWRA 1ZBQA 5DP2A 3TL2A 1ISFA 4W7HA 3TZQA 1FDUA 2D2IA 4TMFA 1LSSA 2I6TA 3UVEA 5I9LA 3AFMA 2Z5LA 3OQ6A 4ZN6A 4J7XA 1H93A 3DBLB 1LC3A 3ZWVA 3CINA 4DQUA 5CDTA 1O95A 4IM7A 2POQX 2WJPA 2ZQYA 3C7AA 3K31A 1ZK4A 1QMGA 1ISIA 4J91A 3RU9A 2GLXA 3IQDB 4LISA 4GMFA 5TLSA 2B4QA 4F3YA 1JU9A 2CVQA 2EJVA 4RLSA 1J49A 4ZQFA 3PJDA 3FR7A 3E9MA 1DPGA 3V5NA 4DIOA 3VH3A 3U4CA 5TQVA 1XKQA 3KXDA 1XG5A 3PLNA 1ZMTA 1CETA 4EW6A 1P0FA 4CMKA 2B36A 1X7GA 3RI3A 3JYPA 4RVUA 4RPLA 3VTFA 3ZZNA 1DFGA 2IODA 2R6JA 3C1OA 1UP7A 4BO7A 5ER6A 2G5CA 2C29D 2X5KO 1LSJA 4IJKA 4E5YA 1A72A 2NTVA 4RPGA 4HWKA 2X6TA 4R1SA 5T6BA 4IUYA 1KVUA 4IMPA 1MXFA 1PQUA 1YGYA 4KDFA 4PLYA 4JLWA 4BNUA 1ZK3A 3WTCA 1HDOA 4FFPA 3EW7A 2W8ZA 3WXBA 2JKVA 3GGGA 3JQ9C 3L4BC 1H9BA 3A1NA 3B1KA 4PG7A 1G0OA 3W8EA 4TZTA 1YB5A 4BKQA 2YYYA 2DUUA 1NQ5A 2PZLA 4YPOA 4FJ1A 1JKFA 1SOWA 5GZ1A 1BMDA 3KO8A 3W4KA 4XQEA 5IFLA 5IN5A 2X0NA 3FBTA 1U3TA 1I24A 3O38A 4Z9YA 1E5QA 1MX3A 2DQ4A 2E82A 3G79A 1WLYA 3KEOA 4JBIA 3RFVA 4KWIA 1E92A 3RUFA 5I8WA 4J1NA 5JAIA 3EK2A 4I5EA 3VH2A 1Y6JA 3WFIA 4PVCA 1YVEI 3RUEA 4EUFA 4CQMA 1C0KA 4BKPA 4MVJP 4N5MA 3Q2IA 2JCXA 3VH4A 3PQDA 1I32A 4J0EA 2WD7A 1XSEA 3DZJA 2NTJA 3OICA 3CTMA 5DZSA 1E3IA 3K2EA 4TSKA 4DMMA 1QRRA 3ENKA 2Q4BA 2BGLA 5JDIC 4UAGA 3VPSA 3TFOA 2HRZA 3GHHA 3FHLA 4YACA 4MVJE 3S2IA 2NM0A 4CQMB 1BXKA 2PH5A 4JN6B 5COQA 1X15A 3RJ5A 4D41A 2O23A 4JXKA 1T1RA 3UCFA 3MTJA 3G3EA 2X9GA 4L76A 1EQUA 2WD7B 1GZ4A 1YJ8A 4Z3DA 1QYVA 4C7KA 1PWXA 1EBFA 4L74A 3FNEA 3I4FA 1IYZA 1U2GA 1MC4A 4WNCA 3GOHA 2VT2A 5IZCC 4XA8A 2EWMA 1C1XA 5EINA 1HYEA 3TWOA 1EBUA 1R6DA 4OGWA 2JD0A 3ST7A 4CLXA 4RPKA 1ZUD1 5AVOA 3FR8A 4U6QA 4R01A 2BKAA 1UDCA 4L73A 4B7XA 4D3FA 2W2KA 3SC4A 4OXKA 2PZKA 1JKIA 2XAAA 4P4LA 2OP1A 4QSMA 3RASA 2I9PA 1HLPA 4IMRA 4FFLA 3JSAA 4MKXA 1IE3A 1PS0A 2FR0A 1H2HA 4ZA2A 1C1XB 3C3XA 4BNNA 1CERA 4NFHA 5JO9A 3EMKA 3OMLA 1GAEO 4DLAA 4R1UA 4BO1A 5BSEA 3ZHYA 2HAEA 4Z0TA 4YT2A 4N7RA 1KVQA 1Y8RA 1N7GA 1GCOA 5G0UA 5FF9A 2W2KB 2XF8A 4JGBA 3PXXA 1L1FA 5CDUA 2Q2WA 3DZGA 4BMNA 2D0IA 2NU6A 2P2SA 5JAZA 1PJ3A 2CY0A 5KVQA 5JAQA 1VE9A 3GAFA 1DJQA 2O48X 2O3TA 4LRTB 1FJHA 2C20A 2QRLA 4BB5A 3KUXA 4EEXA 1DC5A 5T8KA 3AM3A 1Y8RB 3ETDA 3K2BA 1D1SA 1ML3A 4ND5A 2OFPA 4I08A 2X23A 4RF2A 1PZHA 5H81A 1JN0A 5B12A 4Y9DA 4R1TA 2Y1GA 4ZJUA 1UXJA 4N5LA 3FI9A 3IIEA 1JWBB 1YS4A 2W4QA 4KOAA 5KCZA 3PLRA 4NR0A 2DTXA 3NDIA 1DHRA 2JHGA 2FY8A 3PZBA 4Y8VA 4QUKA 5DDIP 4IS3A 1C0PA 1QP8A 1ENOA 5CPFA 3WGQA 4D42A 4BVAA 5IJZA 1ID1A 3RC1A 3V1TC 3HN2A 4QEDA 1UZMA 2X1HA 3GPIA 3ZWOA 4Z9FA 3WBFA 2FSSA 1MV8A 1YH3A 1FMCA 4XX0A 4B4VA 3GF4A 2HU2A 4FC6A 3Q9NA 1O89A 3OH8A 1PJCA 3PJFA 1T24A 1LDMA 3H7AA 3KEQA 3ZNNA 5I9NA 3N7UA 5I7EA 2H63A 5KKCA 3CH6A 3INGA 3NTRA 1PJ4A 3R0IA 5G2OA 2JJYA 4BHTA 5L4SA 1HKUA 1WNTA 1ZKMA 2Y67A 3DAPA 4OYRA 2DAPA 2YZ7A 1MC5A 2AQ8A 1T2CA 2GZ3A 2PGDA 5L4LA 5DULA 2Y1CA 3K5PA 3FBGA 1DAPA 3QY9A 3T7EA 4DQVA 4RCVA 5DBGA 3WQQA 3O26A 3NT4A 2O4UX 3EC7A 5JY6A 1KOLA 2GD1O 1WWKA 3ROMA 1YB1A 1GUYA 2ZK7A 3JD1A 4E32A 3O4RA 2DBVO 3OJEA 4U0KA 3AU8A 3QV1A 4BGIA 1DIGA 4E4YA 1EUDA 3JQ6A 1B3BA 1WDKA 4PZEA 3JYLA 5F5NA 1PGNA 1QV7A 4IPTA 3ASUA 3GEDA 4XGNA 3DBRA 4CM4A 5ILGA 4YA6A 1E7SA 2IDZA 2GERA 2EGGA 3B1JA 3DWFA 3MJCA 1HXHA 2I76A 2BI8A 5DNAA 5U1PA 1U8XX 4P4NA 1P1HA 3G1TA 1YWGO 4W7IA 5DOZA 4MVJH 1XDWA 2YDXA 4LCJA 3DZKA 2YFHA 4OIMA 1HE2A 1LRKA 4R5MA 5IDQA 2H1SA 5JPIA 3DBRB 2A94A 4CM4B 4BNIA 1U1IA 1NFRA 2CDBA 1CIVA 1U28A 4YVFA 4YR9A 3ANMA 3GPDG 3LC2O 4DREA 3I23A 2CNBA 2OP0A 4H16A 1UZNA 2O3SA 3DTYA 3GZ4A 5LC1A 3W4JA 2GZ2A 2VHVA 3UH1A 4RDHA 3E18A 4LGVA 2C54A 5JLAA 3TZHA 3AI3A 4WEOA 1ADGA 1D8AA 1H6CA 1PJ2A 4M55A 2ZJ1A 3VPFA 2J8ZA 4WLOA 2WSBA 3FCOA 4R41A 2ZCVA 1LEHA 5B37A 3ZNPA 1ONNA 4NNJA 1DIAA 4NH4A 3WDSA 2DBZA 3F1LA 1T2EA 4FBGA 3GN2A 1LA2A 3WQRA 1E1MA 5L7WA 4KP7A 3JQFC 4I5GA 1U7HA 3GA0A 4GGPA 2D8AA 2X9NA 3EZYA 2E49A 3I52A 2V6GA 3GVHA 5DCWA 3BMNA 1OMOA 1BW9B 1E7WA 2ZB3A 3M1AA 3DZHA 5JDCC 5A5FA 3L6DA 3BXXA 3GVIA 2EG9A 1HDZA 1X7HA 2X58A 1L7DA 4GH5A 4QO7A 4E33A 1HZJA 3DR3A 3MJ4A 4NZ9A 4LSWA 1GQQA 2E37A 1N9GA 5TF4A 4NDNE 3W4IA 3S2GA 4UEOA 3BMNB 4IIVA 3ZWBA 4J1QA 3WFJA 3V8BA 4BO9A 1XR3A 4PZCA 3WMXA 4CM5A 2OUIA 4AJOA 4EITA 4PLVA 2EP5A 1MUUA 4URFA 4EBFA 1YE3A 1FDWA 2H6EA 1AE1A 1GQ2A 3EAGA 2BGKA 3UAGA 2B4TO 1I5RA 3PWSA 1RM3A 1VL8A 1N9GB 1R4NA 1R12A 2O7QA 1GZ3A 4RVDA 1XU9A 5G4KA 2RH8A 1HE4A 2AA3A 4LK3A 3VAZA 4ND2A 1BSVA 3WLEA 2HDHA 4DUPA 4PRLA 3ZH2A 3HHPA 4MP3A 4YT8A 2HUNA 4ND4A 4M89A 3I3OA 1Y81A 4IIUA 4GLLA 1A4IA 3VVCA 4BO3A 2DFVA 2V65A 3JD2A 1R4NB 3AI1A 3QP9A 3JYQA 4MINA 1E3EA 4BOYA 4L8VA 4HNHA 4WKGA 5G4KB 5COBA 3DXFA 1EEHA 4IDDA 2NV6A 4NBRA 5HS6A 3FN4A 1NQOA 3KV3O 4WLUA 3WMWA 3IOYA 2O3RA 4DYVA 2F00A 4YCAA 3TOXA 5ITVA 2J3JA 4MVJF 2Q49A 1Q7BA 3UOGA 1WZEA 1D1TA 4FPXA 1B15A 2VYVD 4NBWA 1MXHA 2VRBA 2HK7A 3CMCO 1X0VA 5ADHA 4G81A 1CYDA 2QX7A 2P5YA 4NJOA 1SAYA 3K6JA 4OKIA 2GUGA 4I5DA 4PLHA 2QYTA 2X5JO 3JD3A 1VJ1A 3EDMA 5C37A 3ICPA 2GO1A 1Q7CA 1JWAB 4IDFA 1U4OA 3GNTA 4I9HA 1IHYA 2DUWA 4PZDA 3NX4A 4DYDA 3NTOA 4D43A 1ZW1A 2ZYAA 3X2EA 4MKRA 2P9CA 3KYBA 1XQ1A 4JJIA 4YQYA 3HFSA 1P1IA 4NFYA 4PLWA 4RO0A 1H5QA 1E3SA 1YJQA 1XU7A 5GY7A 4BNTA 3WGIA 2EHDA 4RLHA 1ZIDA 1U4SA 3NDJA 2VHXA 1ZK0A 2P5UA 3WYEA 5AXAA 3U0BA 4LN1A 4F46A 8ADHA 3M2PA 4UUNA 2I67A 4BMSA 3GDGA 4L9RA 1EZ4A 4OQZA 1DRWA 4EEZA 1T25A 1L7EA 3JQDA 2QRKA 4M54A 1ZJYA 3NUGA 4ONEA 4P4GA 3CXRA 5L95A 1LSOA 3GH3A 1H6DA 3AW9A 5BSFA 4W9NA 4OMUA 1UXIA 2Y0CA 3HDQA 1FXSA 3IUPA 2X0RA 3KZVA 4L4RA 1P1JA 2P4HX 3IKVA 4TWRA 5JYEA 3PHLA 3WB9A 1IUKA 4MVJI 1NWHA 4QT0A 3T7CA 3ZWMA 1RJWA 2VHWA 2XOXA 1QG6A 3TJRA 2RIRA 2WMDA 2WWRA 1ISHA 1LQUA 4KWHA 3ZV4A 5KNLA 1NR7A 3QRWA 5DT9A 4FR5A 4XQGA 4EYEA 2C5EA 3RAJA 3F9IA 5B4TA 1R37A 4EI2A 3JQEA 1EDOA 1PGPA 4BB6A 4RZHA 3U5TA 2Y0EA 4WLNA 3S55A 3V2GA 5CHEA 2W2LD 1WAMA 1JVBA 5A1TA 4XEHA 3AUUA 1E7YA 2PZMA 1PL6A 4CM9D 4BGVA 3BMOA 4KTTE 3RBXA 4UVGA 1U3UA 3JQCA 2OBYA 4X54A 1MLDA 2Y1OA 3G1UA 1DO8A 3AWDA 1U5AA 1PQWA 1ORRA 5F21A 5IXYA 3D0OA 1YRLA 4IDGA 4CR7A 3E9NA 3GNSA 3QQPA 1FDTA 5H82A 2BD0A 3OBBA 4ESOA 2AE2A 1B7GO 4QTZA 2J5RA 4DC1A 1SCUA 1JKJA 4TROA 1GADO 3TL3A 5JO0A 1WMAA 2C0CA 3BMOB 4ZD6A 3WICA 4L0QA 3WGOA 1BHSA 3NAQA 5CEFA 1BWSA 4LVCA 5DN9A 2G76A 5AXCA 5G0SA 2VHYA 2P91A 3LK7A 4CMAA 1XEAA 3GFBA 4GKVA 1HT0A 3RROA 4PCVA 3UF0A 3O03A 3ROQA 3M1LA 4Q9NA 5U4QA 2D4AA 1PJQA 2OOSA 1GUZA 4OAQA 3TZCA 3PHJA 4YTEA 5EJ2A 4UVDA 4BNKA 5TJ9A 6LDHA 2JFFA 3BTOA 1DLJA 2R00C 1UH5A 5JY1A 4B79A 3G0OA 4GL4A 4I9NA 2B69A 2YY7A 1JW9B 3NYWA 4Q3DA 3UW3A 1KC3A 2E48A 2OHXA 2BHLA 1P1KA 3GK3A 3Q11A 3TPCA 2Y0DA 3ASVA 2BGMA 1JLLA 1CEQA 1P0CA 2WM3A 3C7CB 3E03A 4DL9A 1V6AA 1ONPA 3GVCA 1PSDA 4ZQGA 2SCUA 1Z75A 1IPEA 3DOJA 5L3ZA 4BO0A 4XQCA 5HRUA 5THKA 1DFIA 4IY1A 4U7WA 2NQ8A 1ISJA 4J2OA 5G0WA 2O3JA 5JCJD 3I5MA 4GQAA 4WASA 2QW8A 4XYBA 2Q4EA 1KVSA 3ZU2A 3D7LA 3JV7A 4E30A 3QVTA 4UVIA 1RWBA 4YB8A 1NPYA 4XYGA 2W90A 4IGFA 1ENZA 1I01A 3JYOA 4WCFA 2EF1A 1PEDA 1N8KA 3C8MA 4FOSA 3V2HA 5T64A 4IINA 3DMTA 4OH1A 2PGJA 2Q3EA 2VYND 4IDEA 5ENVA 2VZ0A 3B6ZA 4O63O 5C7LO 2J5QA 1I10A 3C85A 3CMMA 4BKUA 4DC0A 3PJGA 2CUKA 4D79A 1DIHA 4U6SA 1CQIA 3S2EA 1ZK2A 4BNJA 1KVTA 3HDHA 2J3IA 2B0JA 1UP6A 2AW5A 2FP4A 3PFWO 4QQRA 4WCFB 1NTOA 3TF5A 3WR5A 4YWJA 3MZ0A 3PI7A 1DJNA 3ZW8A 3LT2A 5LDHA 1YDEA 4GLOA 1I30A 2X9VA 1HDCA 4BNLA 5AQ1A 5JBIA 4WOJA 3ZN2A 3BHIA 3VPHA 3OECA 2YJZA 3JQAA 1QYCA 3WG9A 1VC2A 2I66A 4CMGA 3RFXA 3LF2A 3O9ZA 1WVGA 1B3RA 1LQTA 4NPCA 2GR9A 4CMEA 1DB3A 2ZJ0A 1WDLA 3HB5X 5EIOA 2IYPA 3F3SA 1IL0A 4FFOA 3AM5A 3BMCA 3JQAB 4G2NA 2CVOA 3EY4A 4GVLA 1MFZA 3L9WA 2AG8A 3OJLA 4JP3A 4LMRA 3VDQA 3VH1A 1TI7A 2PWZA 4PG6A 4Z3KA 1TA4A 4BS9A 2GN6A 4ND1A 5TSDA 3KOUA 1H94A 1PGJA 1I3NA 3HJAA 3PYMA 1HSZA 1I3MA 2HK9A 3SLKA 2PNFA 2Y66A 3RBZA 4BKOA 2WYUA 3A9WA 1JAXA 2OZPA 2RHCA 4DBZA 3BMCB 1WW8A 4MJLA 4OOFA 3JQGA 3F5SA 3DZBA 3WS7A 3PWZA 3RUDA 3GRKA 3WOHA 4J7UA 3DFUA 3ROKA 5A9TA 3TRIA 5L53A 3E6AA 3L9XA 3GVPA 4OQYA 7MDHA 4JX8A 3QVOA 1KERA 4LCEA 4ZVVA 1VRWA 5GZ6A 3UKOA 1IULA 4UVHA 4GKBA 2X0JA 3DEYX 3Q0EA 4WCDA 1PJSA 3I9MA 3UCXA 4CR6A 2XXJA 1DC4A 3GEMA 4OL9A 3JQGB 1OC2A 3A28A 1WP4A 3DL2A 3IS3A 2DKNA 4AJ1A 1GV0A 4FGSA 4N54A 3KBOA 4R69A 3PTZA 2D5AA 5DOVA 1YBAA 2WEKA 4MDHA 2PV7A 4Y6RA 4TVOA 2ZB7A 3UGKA 1EFLA 2IYOA 1ZCJA 1O94A 1Z82A 3HDJA 1Y9EA 3MWEB 4MO2A 5KVSA 2VRCA 3U9LA 1VI2A 2ET6A 2X4GA 2C2YA 3PIIA 4JBHA 5C7OO 4OXYA 4E5PA 2PFGA 3F4LA 4QFDA 1P9LA 4XWYA 4BNHA 3OJOA 2HSDA 1UZLA 2O7SA 3E5MA 1DDOA 5A06A 1MP0A 3ZDFA 4F45A 4RDIA 3KB6A 3BZUA 1YL5A 3ETEA 2Q2QA 4YYZA 1EK5A 1Q1NA 5A9SA 1V3UA 4WGGA 4B3IA 3KETA 3EYWA 3QA9A 5BNIA 5IZ4A 2A4KA 3OIFA 3Q9UA 3OA2A 3HADA 3H3JA 4UULA 1YONA 1QXSA 4NHEA 3LDHA 5EQFA 5J23A 1BDBA 1GPJA 1XIVA 3AM4A 3WLFA 4MVJA 2GRAA 5L7YA 1Y8QA 1LUAA 3L6OO 2C82A 2HJSA 2TMGA 3TZKA 1B8VA 1BXZA 1R16A 2JD2A 1SEVA 3H4VA 4GMGA 4O5OA 4UUMA 5A9SB 4CUZA 4XZ3A 1UXKA 1W0CA 5DBIA 3ZWCA 4PG8A 3WIEA 4ALNA 5CDSA 2NNLD 2GPTA 3P2YA 1UJMA 5JXWA 1AXEA 2O2YA 4CLHA 2V6MA 3SJ7A 4C4OA 5LCXA 4BNVA 2OO5A 4K6FA 4FS3A 4IQ8A 1Y8QB 4XCVA 2VZ9A 4B8WA 5K6AA 2PZJA 1PJTA 3ONFA 3Q1LA 4XGIA 3PK0A 1EMDA 1PU2A 1I2ZA 2VNSA 3QVWA 2BELA 2VZ8A 4ZGWA 4RV9A 1DBVO 4I1IA 3ZHXA 2UYYA 3E5RA 4BO2A 4GBJA 4H7PA 1T2DA 5I9MA 5GZ3A 4IBOA 2UVDA 1SZJG 1EQ2A 5DF1A 1B16A 3ADOA 5FI3A 2IE0A 3NGXA 2ZYDA 4IXTA 1WXDA 2FR8A 1BDMA 4OM8A 1B0AA 1C1DA 3P5SA 3WTBA 3RUAA 1EVIA 1E1LA 4JJFA 4Z0HO 1GV1A 3L0DA 1HWYA 3ABIA 4JK3A 3VKVA 5B4UA 4FC7A 2JAPA 1GDHA 4BQPA 3IJRA 2PKQO 3MCVA 4HFJA 3E9QA 4HUJA 4CMIA 1ZEMA 3GR6A 4AL4A 4Z6KA 5JS6A 2NWQA 3M2TA 1C1DB 1P77A 1QSGA 1PIWA 4WNIA 3U62A 1WDMA 1ADBA 4XYMA 2B4RO 4EDFA 4E5MA 5A04A 2ZCUA 3CUKA 1TEHA 2GYYA 4GWKA 4DXHA 5L51A 5DP1A 2JHFA 1DC3A 3RBVA 3VOSA 4JNKA 4INAA 4R68A 3RUHA 4BV9A 2H5LA 2VUSA 3PQEA 4CMIB 2J3KA 3TZ6A 2Y1FA 1F06A 1U8FO 3H2SA 2BFPA 1W73A 2NACA 4W82A 1NX6A 1GZ6A 4FB5A 3DO5A 2V6FA 2A35A 2I3GA 4TZKA 1P44A 4AJIA 3BTUA 3OF2A 5IDWA 3DAGA 1P45A 1ADFA 1Q2XA 1HL3A 3K92A 1UDAA 2PTGA 1ZXBA 3GEGA 2VHZA 3NTQA 4Q3AA 1C0IA 3LYLA 3QE3A 3OQBA 4Q39A 3IKTA 4DLLA 1KS9A 5MGBA 4IS2A 1AXGA 4ZRNA 3CIFA 4CMHA 1VJTA 4DPMA 1JTVA 3DBVO 5TIIA 2YDYA 3H9EO 3RKUA 1GYRA 5DBFA 2LDBA 1C0LA 5FI5A 3NGLA 3NRCA 3I9LA 4NFSA 4RQUA 3SC6A 2UUOA 3DOCA 2EW2A 2X86A 4CV2A 1PJBA 4CM8A 2HMTA 1H0KA 3LQFA 4CUKA 4CLRA 2J3HA 1GEGA 3PYXA 3HG7A 5ICSA 1N1GA 4HV4A 4RF5A 5KWEA 2HJRA 2WTBA 4M49A 4R3WA 3H5NA 3LU1A 3QHAA 4YDRA 1VKNA 2O3UA 1DIRA 3W6UA 3D64A 3G17A 4ZRMA 5EL0A 4A10A 4Z9XA 1EUZA 2E6UX 1E7RA 2GDZA 1Y7TA 2DVMA 4A7PA 4AVYA 3QWAA 3GHYA 3QWHA 4CM8B 4IZHA 1NVTA 4QXMA 4FQ8A 2CF5A 3W8DA 4CLRB 3AOGA 4O1MA 3A14A 2NU8A 3TOZA 3WWZA 2NVWA 1MFPA 1PQPA 5TC4A 2GZ1A 2ZKLA 1U2DA 1ENPA 1XCBA 3F47A 2HK8A 4GX5A 4NU5A 3I83A 4LMPA 4HP8A 2FZEA 1YOVA 2NQTA 2P68A 3EGOA 4BNXA 1ADCA 1GD1O 4AJHA 2E4AA 1XLTA 1LLDA 2C59A 4A5OA 1IHXA 1W4ZA 2ZIZA 4CPDA 2DU8A 1ARZA 1ONOA 4OOEA 4KTVE 3PWKA 4MPDA 3DMYA 4BIIA 3MOGA 4AJLA 3INTA 4S3MA 1T4BA 4J49A 2NLOA 3ZWAA 2Y93A 4CQLA 5JC8A 7ADHA 1RM4A 5KIAA 1YOVB 4WJZA 3ZI0A 1ZMOA 5ICMA 2IZZA 3E82A 1CQJA 4J16A 1MG0A 4MIOA 5F1KA 2BH9A 2RHRA 3AUSA 3OP4A 3GNQA 4E5KA 2V7PA 1X1EA 4ALLA 3W8FA 1KETA 1AHIA 2C5AA 4II3A 3F46A 2P4QA 3RUCA 3H9JA 4XYEA 4W99A 2VQ3A 3I4CA 5I8ZA 2EKQA 1NHWA 4CQLB 4YAKA 5L4NA 4O59O 3NV9A 4I5FA 1B14A 3JTMA 1A71A 1BRMA 4AFNA 2VNAA 1ENYA 1OZAA 1YBVA 4XGKA 3NT5A 4PLCA 3VZSA 4AJEA 1HDXA 3GVXA 3KSZO 1ZZEA 5A9RA 2X8LA 3HE3A 1GY8A 5F3RA 1PZEA 4RQTA 2JL1A 1P74A 3IAHA 5TRTA 4CUJA 3IJPA 4R51A 1PR9A 4ALKA 1NQAO 3AJRA 4JCOA 3JQBA 5HA5A 1QV6A 3I9JA 3O8QA 1ISMA 3RUIA 3D3WA 3FWZA 1RYEA 2LDXA 4TRNA 5K1SA 1TXGA 4BO5A 1LXCA 2XXBA 5KOIA 1GR0A 3PGJA 3WWYA 2O2SA 5TX7A 1JVSA 1I2CA 3ADPA 3HQ4O 3ZNQA 3C1AA 4Y6SA 3ZNOA 4WLVA 4B7UA 3PIDA 1K6XA 2TMDA 3O8QB 4FJ0A 4CQMD 3ITKA 4C7JA 3D3WB 4NJMA 1KEVA 4TKLA 1NVGA 1SOVA 1QLHA 1B8UA 2YV3A 5CDYA 5K6AC 2I5PO 4RZIA 1Z45A 2I99A 2Y05A 2PD4A 3DHNA 1D3AA 4ALJA 3KVOA 1HSOA 2BLLA 3WGTA 4XRRA 3VC7A 1DHTA 5L9AA 4XIYA 2B83A 4NQZA 2I65A 4PN3A 4M87A 2QRJA 3T4EA 2HMSA 4ID9A 1HDGO 3OJFA 1NNUA 1RKXA 3GDFA 4Q3EA 2C2XA 2EP7A 4BNWA 3LSYA 2JFHA 3JYNA 3LZ6A 3N58A 5T8KC 1T2FA 3GZNA 5FFFA 5JMPA 4YT5A 1SO8A 3V1YA 1O5IA 4KUGA 2GGSA 1SNYA 1V3VA 1JA9A 5TT0A 3M6IA 4P38A 3ZWNA 5JSFA 1VJ0A 3GMDA 2OORA 3CSDA 3B1FA 4RORA 4J1TA 4J9VA 5C3MA 2IEDA 4Q3BA 3JCZA 3GZNB 1LC0A 3CZMA 1NASA 3HFGA 2QHXA 4A73A 4BNMA 4F6CA 4D0SA 3QWBA 1N7HA 3VZPA 4FFNA 4GX2A 4XD2A 1KYQA 1Z73A 1Z74A 4K1LA 4AJ4A 2DPHA 5A02A 2EERA 4YJDA 4DIFA 3COSA 3JQ7A 3HB4X 3I1JA 4CM1A 4WOKA 2C7VA 3JQ9A 3WYBA 4A0SA 3ZU5A 1DIBA 1D4FA 4B8ZA 5BSHA 1MGOA 3NJ8A 3PP8A 4JBGA 3QVSA 3K8ZA 3K96A 4MVJM 2AQIA 4PRKA 4K28A 1LRLA 1J4AA 1P31A 3GC6A 4KUHA 4R1NA 1LBEA 5BNTA 4HXYA 4ZHSA 1KVRA 4ZQHA 1EE9A 2IZ1A 3JQ7B 3MTGA 3E48A 3DZIA 4DWVA 1R0LA 1HLDA 1X14A 1A7KA 5COAA 4DBVO 1V35A 2ZB8A 4DPLA 1EK6A 2CD9A 3L07A 2UUPA 3WGGA 1E1NA 3WBBA 3B70A 5C7IO 4GSKA 4E5NA 3BTSA 3D4PA 4D45A 1BXGA 4H15A 3WQSB 1XA0A 5CAEA 1OI7A 2PKRA 4D0RA 4HFNA 5BR7A 5TGDA 5JDIA 2NU7A 4N5NA 2UAGA 3ZWPA 3IP1A 3QW2A 2PLAA 4GGOA 4RPHA 5CPBA 1I0ZA 4R54A 3VDRA 1UP4A 1Q0LA 5CG2A 2O50A 5L7TA 4HBGA 5KVVA 4DPKA 1EFKA 5KTKA 1UAYA 4MIEA 4PG5A 1DXYA 5C5IA 1TVEA 1W6UA 1JAYA 1N5DA 3U3XA 1X7DA 1PZGA 2AMFA 3VZQA 4DA9A 4J9UE 5IF3A 1E7MA 1X0XA 3RCBA
chains in the Genus database with same CATH superfamily
3GELA 5L3VA 3FSRA 3DLAA 1UBOS 1WPQA 1RQ2A 1U28C 1LTHR 1I8TA 4CMJA 1XZ8A 4HVTA 4MIKA 3KPJA 3HP4A 5JRDS 1FE8A 3P9YA 5EJEA 2XHEA 2ZZKA 4CLOA 4DEXA 1RIIA 1XWFA 5FDFA 2GBFA 1OU4A 1QAMA 3OQVA 2A9PA 4X7RA 1V1MA 3CX7A 1I36A 2H18A 3U16A 1YO6A 2G67A 3K1YA 5LP6F 2NN3C 1P1BA 3QEMB 3JZAA 3R0VA 2G9QA 1QZUA 4G4JA 5DU2A 4ZZIA 1CULC 1BE0A 1M3SA 2CLDX 1AN0A 2V8OA 1Z0ZA 3JALB 4X94A 1JGTA 2F17A 2OGUA 3IPLA 2R68A 1PFQA 1Y5RA 3P9KA 3WB0A 3UATA 1ZUIA 1BEZA 3ZJVA 1SBTA 3PQ7A 3VR6H 1UADA 1V5GA 1DKPA 1XQ6A 3F6PA 3GD7A 1R50A 2J9XB 4KREA 1XCGB 1XB2A 2PKYX 3DVAA 4XWKA 1JNXX 4D9IA 4QUAA 4LDNA 5ALEA 4LAFA 3OOSA 1TVKB 4NV3A 3ENQA 1XKTA 3GMTA 4BYMA 3MTAA 1X13A 3C7TA 3L7IA 4JWKA 1YVRA 4KQWA 4TMXA 3HFRA 1BVRA 3TTYA 2XD9A 4GHWA 4AN4A 1MW8X 3HJGA 1D0VA 5CVJA 2AHRA 1P7VA 2FG7C 1AKNA 2LIVA 1IBLB 4LFCB 5D3MB 5DLPA 4EHFA 3MOSA 2JHAA 1NPDA 4MRPA 1XMSA 4EUEA 1MAHA 3RB8A 3PC3A 3RSHA 3MS4A 1MDBA 1RPNA 4YJ2F 1J6UA 4FDMA 1YR2A 1Z37A 3DGEC 3LDGA 1FBNA 1CUFA 1YBHA 4QICA 4BECA 5ITZB 1RQRA 2OC9A 5LXTA 4RK6A 1F8FA 1PJ8A 4S1WA 1E2MA 1TPZA 3AFHA 1KFEB 1NL3A 4FHEA 3FAZA 2WYHA 3KKOA 5H8WA 2W2OA 1DLIA 1NAHA 2HRBA 4XARA 1JHAA 2J3QA 5ECDA 1RRVA 3D3QA 3RD5A 3DFMA 2OOKA 4FYXA 5F1OA 4HBZA 3NS7A 1PP4A 1X1RA 2Y77A 4LF7B 4N5IX 4P08A 4XB1A 4BQFA 4QYIA 2EGHA 3H5LA 1NRXA 2VIIA 4XB6B 4F9GA 2OVBA 5BT8A 4TWAA 3PHGA 4YT4A 4WVFA 1BD4A 1FPQA 2W4MA 3E4CA 5ALOA 5IARA 4YREA 4KDEA 3WNQA 4P36A 2KW5A 5H80A 3MWFA 4DHEA 3JVIA 4B80A 3PDUA 4MCHA 4QQFA 5DGHA 3RG2A 9LDTA 3KM0A 3DEKA 1M75A 4Z1MD 5KINB 2XKAA 3Q6NA 4QNMA 3JU3A 4UAVA 4OFZA 1QE5A 2XCIA 1Q50A 3QFFA 5K3EA 1R6TA 1HETA 1W4RA 5AYVA 3KTDA 2FHSA 3OD5A 4Q24A 5HTKA 1XFAA 2IVFA 1TU3A 2DG2A 5DM0A 1OXUA 5ALIA 2R4TA 2X4IA 3VHRA 1KH3A 4P7GA 1C9KA 4K2HA 4PPYA 1CRWG 3IVMA 4GE0A 2VA8A 4RGBA 4IIYA 1ZRSA 3FDFA 1TM7E 3CZRA 1GA1A 4FI3C 4BTVA 3HBMA 2C1EA 2CSUA 4P3PA 5CIYA 4HTAA 4WK2B 2J6HA 4FR2A 5H5JA 1T35A 2GJ8A 1K8ZB 4C04A 5F5XA 1U0HC 1I14A 2AFVA 4FGUA 1RC1A 2J33A 1S3FA 1XVIA 4D96A 1NRWA 3M6XA 2RI6A 3N74A 1G20E 1Z5ZA 4I1YA 1LPNA 3AJAA 1II0A 2I71A 2QJWA 4XJTA 1SG6A 5DWDA 3DLPX 4WY2A 1QQ6A 1I2BA 4ARBA 4U4AA 1FYEA 4DNFA 3NNSA 1IPHA 3CG0A 1WW2A 2AX3A 3AUFA 4FVTA 3I2JA 4PXSA 1ZH8A 5FQNA 2I2BA 1RJGA 2VH5R 4UDYX 2SICE 2V98A 3EPJA 3U4QB 2FZ5A 3ZV3A 3HN7A 1CJVC 4Q18A 3D1LA 4C2TA 4KC0A 2XE8A 2P6UA 5K01A 4OI0A 1WU7A 3ELBA 3BKXA 2GI4A 1PL8A 2BFAA 2LCFA 2XWJI 3KB2A 5ALJA 4EKDA 1RYDA 3W78A 2PVPA 3ZUPA 1MOQA 2FFHA 2PBFA 5AVJA 4FFMA 1RADA 1TTTA 3SKXA 1IY2A 1L5QA 3PF9A 4Q66C 4CEHA 1RP7A 1XEWX 2OO3A 1H42A 2L42A 4MS1A 2VEOA 2VDUE 1U7WA 1AB6A 3BIFA 1N33B 3H9UA 2HRDA 4QPPA 4HNRA 1MORA 4KN5A 4EX7A 1WY7A 4DR4B 1ND5A 4N9QA 2JA1A 5K6RA 3PJEA 2ZTLA 2PXAA 2RGGA 1LWOA 5C34B 3WMGA 4KK3A 4WKPA 2JI6A 2NZYA 1IM2A 4QPJC 3SIRA 3U39A 1MG5A 4M1KA 4F21A 3ID6C 3BA1A 5KJ1A 4WKBA 1FSGA 2HT1A 2D3TA 2X8JB 4CKBA 1KZ9A 3DHEA 1YHYA 3R5KA 4IQGA 5P21A 4JA2A 1QTIA 4B4DA 2WTXA 1GZSA 4QE3A 9GPBA 1SUFA 1DG3A 1U8CB 3IT2A 1ISSA 3PNOA 1U7XA 1YQWA 3N07A 4FN4A 4JEUA 3WSVA 1FJGB 4O4IF 3RQSA 3C3WA 1Y48E 1WHTA 1PGOA 3VX4A 1Z6QA 4XYLA 1VM6A 1ZIPA 4EY6A 2C7QA 3LKVA 2IF0A 3DBHB 3QHPA 3WMRA 2JVIA 5EP3A 5KYVA 2HSWA 2P4SA 3CZCA 3AEQA 2H16A 1P0PA 5AMXA 2I7VA 4PGFA 2YV4A 1C8LA 1FFHA 4C6SA 3LD9A 5A4AA 1ONBA 1ZOSA 2AN4A 2QD1A 2GEDA 4X24A 3RVNA 1KZHA 3SBEA 3I2FA 5JDCA 3LMKA 2ZREA 1U90A 3LFUA 3PPVA 4X3PA 3WKAA 3PF8A 3IP3A 3MUFA 3U4QA 2GF2A 2KSQA 2AC2A 2XPCA 5TPZD 3AO0B 4CL8A 3GH1A 3FRJA 1H4VB 4PIVA 4ARIA 1Z38A 3BMQA 3I42A 4IJWA 3OIYA 3CISA 3DDSA 1SC6A 4HZUA 4AM8A 3ZD6A 4C2AA 2HA2A 2R2AA 4YAIA 5AW1A 4R6XA 2GPBA 4NC9A 4QX6A 5LPNA 3NHFA 4I66A 2I29A 2AXEA 4CEJA 3AIMA 3OT1B 1EFHA 3RFTA 2CEAA 3SD7A 1T91A 2ZIFA 4EWLA 3E84A 4AJJA 1VI6A 2QYOA 5A04A 1EX7A 4MRSA 3WV4A 4C6HA 4IIGA 1YOBA 1T29A 2WK1A 1NVVQ 3B51X 1PD1A 2J08A 5FUYA 1ESEA 1IIRA 3CX4A 3ZTYA 4ZI7F 4IX9A 3OPVA 1YL6A 4HI0E 1VPWA 4N3CA 4GYWA 3CVJA 3EW9A 3NOXA 1E2NA 5KJFA 2G1PA 3PUJA 2IHVA 5IULC 4TV9F 4DEYA 4L0MA 3AKZA 2O8VA 2VLIA 4FD3A 4NMHA 5LQKA 2A1TR 4M0LA 3QI7A 2HCFA 2BUCA 5IN4A 1AK9A 3G5LA 1IZ9A 1SHUX 1W8DA 2ON6A 4MRNA 4N5HX 4OB8A 1YC5A 5LZ4A 4KR0A 4FHFA 3SM9A 3IEUA 1RE0A 4ZHQA 3WL3A 3BE5A 1NBME 4QLAA 5AOVA 2IA5A 4NK5A 2XZOA 3L7JA 5IAAA 1QHYA 3HNPA 1CR2A 1I2MA 4A16A 3FNQA 2GASA 3GRPA 4N12A 1F4LA 2HCJB 3I01M 2ZPTX 3AW8A 3D4NA 1LS1A 2ZTUA 3K30A 3O1HB 1ABFA 1IG0A 4G4SO 4WK4B 5DIZA 1NDHA 4I3HA 3STVA 3HU3A 2UZ0A 3I3SR 4KO3S 1A8IA 4EY5A 2CSXA 1VSUA 3BJMA 2CLMB 1PNVA 1LLQA 2QJOA 3Q7IA 4HFMA 2FOIA 3RTBA 3I8OA 4ER0A 2OT3B 1EHCA 1M76A 4HAVA 2JJ2A 3T1TA 4JC5A 4L08A 3ICWA 1XL1A 4JBYA 4AJKA 4JBXA 1VMDA 3K0CA 1S2DA 1TAHA 3HZZA 4WAUA 2XNDA 1VB3A 5EKUA 3UC9A 5JCXA 1C4WA 1BG6A 1P1FA 2NTEA 1PT6A 2QIOA 2ZSKA 3DMTC 3QLUC 5EJ4A 2VHCA 4OH7A 1YAJA 4IUDS 2AC7A 4X1YB 4K26A 1WMBA 3DAYA 4Y9RA 4U2GA 3SJAA 3ICEA 5K51A 4XSGA 3L8YA 4X8LA 5JD5A 1T8RA 1TA9A 3ANLA 5IAOA 3GFFA 3CJQA 4QKQA 4I9UA 3MJTA 3MMPA 3NDPA 4AYTA 3BX1A 4HDCA 3OCZA 3NDRA 4CM3A 5JYDA 2C4VA 2IDJA 2GX6A 3W1VA 5BXYA 1FTSA 2NU9B 4YCMA 2EV9A 3EUWA 3JQ8A 3W6ZA 4UOQA 1DRKA 1CUYA 3LXUX 1UJBA 4JASB 3STHA 2ARKA 2SECE 3KDAA 1AQYA 3AUTA 4P58A 2YY6A 2XI4A 4IXWA 3FTPA 3S28A 3LHKA 2XLCA 4G5YA 4C5CA 3HACA 1GVNB 3UM9A 2DT5A 3CWCA 4PBRA 1QB8A 3GLQA 5E38A 2PUDA 1T2AA 1T5LA 3DZFA 4OMFG 4GX1A 1ZJWA 3OPXA 4IJVA 3FWNA 1UJ6A 1L6IA 1UWVA 4RIEA 1KO7A 3CRMA 1FZTA 2WB4A 3ETGA 4NBUA 1IY9A 4YRKA 1T9GS 1R0BA 1KSHA 1XCPA 5DHTA 1QK3A 2MCFA 2YIDA 3BB1A 3IBGA 4TMVA 1S5PA 1BGVA 2EQAA 3K72B 3UW1A 5CCXA 2CXUA 1NV8A 2AFHE 2QJFA 5I8PA 2PJRA 4CV3A 2IY9A 3CUSA 4HK4A 2FFRA 2ZJZA 3LYAA 4MKZA 2D2XA 3VMMA 1HA3A 3Q8KA 2XW6A 4OJKA 2X22A 2A9OA 3VBEA 1SVIA 3MF4A 1H6AA 1N2OA 2HNKA 5SY6A 1K7XB 3HRKA 3OF3A 4LS3A 4MUKA 1BU5A 1X7WB 2IOQA 2OO7A 4JSTA 2WLTA 2RHLA 3QJGA 3L6EA 1G5HA 3MWDB 1XTKA 3OZRA 5F1PA 3A4NA 3OIWA 3OQPA 1JL3A 2NSLA 2AYXA 3BEOA 2IHYA 1RD4A 3G2LA 1PBNA 4K9PA 4O1IA 2BTQB 3DSRA 4MRAA 1ULAA 1CCWA 5JD6A 5LNK6 1U8TA 5B4VA 2DZDA 4K03A 1E77A 2YYAA 1KMIY 3AH8A 5B36A 1TMYA 1THMA 4URXR 1T1SA 3H2IA 2XV1A 1T3ZA 3E8MA 3I9OA 4YRGA 3RSOA 5JHHB 3I61A 2BRUA 2ZIXA 4K6CA 4BMVA 3DMHA 3DKRA 3IPCA 2P1ZA 4BGEA 5KS2A 3UJ3X 4MV7A 5I7SA 5ALHA 3K5IA 4K9SA 3EVTA 4AYWA 2VYNA 5FP0A 1NAIA 3I9NA 2CHQA 4E6EA 1EX9A 3E22A 2VP4A 4FOLA 4NG5A 3SOPA 3P9CA 4PLGA 3EZ9A 1NUPA 3IYLW 4F84A 1YKFA 2V4ZA 2ZBEA 3TLKA 3ZHRA 2GHIA 4TM8A 5TT1A 4ZDIA 3E2MA 3DQQA 1B6RA 2CUNA 4DGSA 5KX5B 1SRRA 2C8JA 3MTDA 2AFHB 5I7UA 3JQAD 4PSUA 1U9JA 2JFNA 5FLEX 5KYUA 4YUWA 2NTNA 3TGPA 5EMMA 1QVWA 2H92A 3OEED 1QKJA 2VDRB 4DS3A 4WLEA 5DGXA 3ZDBA 2FE4A 5BSVA 3COWA 2QV7A 3O1JC 4S0XA 1MA0A 3P2OA 4UBJA 2JLYA 2Z57A 3GLSA 3W3AA 2EGUA 1HEUA 4ALIA 1TEVA 5FBQB 1M5TA 1BW9A 2NZUG 2HA0A 4HWPA 1SB8A 2AKYA 1LF0A 4I6EA 3THSA 3TQIA 5K8CA 621PA 4G0VA 1DBIA 1J5XA 1KIFA 2H1LA 2NVBA 3TM5A 3UJAA 2P2LA 2IUTA 3PDCA 4AWXA 1SHTX 3L5KA 3WI7A 1WB6A 4FDAA 3R5SA 2EW1A 2ECQA 4BN0A 4IOJA 5K9ZA 3HMQA 3QWIA 2AEFA 1WV1A 2BJWA 3C5CA 4GOXA 1Y1PA 4PAGA 1Q0HA 1QNLA 3JVEA 4BFLA 2CDCA 3RK0A 3SJCA 2O52A 2BR4A 2TECE 3CNEA 3CGGA 3VKWA 5FUMA 5T57A 3S6JA 1LBQA 2YN4A 4PTYA 4OBXA 4KPYA 3IVGA 4Z9BA 2GXUA 2QS9A 1XJCA 1P4GA 3CLUC 5EP1A 2QU8A 3G13A 3KUCA 4KMRA 4V02A 2N47A 3U4HA 4DLBA 1B2LA 1LI7A 3H18A 4MWOA 1QGYA 5CLGA 3TVYA 3ETLA 1HC7A 1QDLB 2HRQA 4EJ6A 1PX0A 1UMDB 2DP4E 2FGJA 4FNOA 5J40A 3GDOA 4C7MA 3T3OA 4KQJA 4AG3A 5H70A 3ADBA 1L3CA 5CK4A 4D8XA 1IJEA 1WXXA 4Y98A 5IASA 1OVMA 5A05A 4RADA 1W75A 3EN0A 3MINB 4OHCA 3KRTA 3ZXYA 4FMCF 1A27A 1M2VA 1CFZA 2QMUA 3R44A 3X43A 2VJQA 3ZDDA 4HXFB 1Y37A 1YGPA 4EUHA 2XMZA 3GCGA 1WL8A 1O3YA 1QORA 5ALGA 4LYYA 4XLLA 4D9FA 2V4MA 4TVBA 2C83A 4IV8A 1KI6B 3MERA 1OW3B 1S8AA 3SZUA 1GEEA 2BLNA 2HLHA 4UZSA 1RSZA 3H5AA 1J7JA 3JWHA 4EZBA 4Q4AA 4HYEA 2O0LA 3FNFA 2YUTA 4IEIA 2SHKA 1W5FA 4WECA 3U3RA 3TIIA 4NZOA 3VKFA 1M1ZA 4KG7A 4B40A 3AL3A 3UAWA 4D9JA 5ESRA 5CFPA 5JZ9A 2FQQA 3EFBA 2X0FA 3OHMA 2ZRPA 5BN4B 3KB8A 4IDNA 5DI3A 2WIBA 4PQFA 2VNIA 5A2QA 5EIBC 4NENA 2VK2A 2ADFA 4D3XA 1MX9A 2YW9A 2GHRA 1MVOA 3M34A 1NNEA 4N18A 5DASA 4YCCA 3LP5A 1VL0A 2BUBA 3PENA 3VR0A 3NATA 5L45A 3ZJTA 3NAZA 5HOQA 2WHYA 1WXFA 2OCPA 4F6LA 1KIAA 2C2BA 1XDBA 1WCIB 1P2UA 2ZS7A 4CV0A 1W7AA 1Y9ZA 5BRNA 1LDNA 4J1SA 2QI9C 4W1RA 4PSVA 4XVHA 4ZT6A 4DVJA 2HD4A 1YRYE 4G0OA 3ICCA 4HC4A 4PZUA 4O5AA 3RM3A 4AY5A 3TQQA 1GL3A 2CJWA 1B8PA 4RABA 4DCSA 2QVYX 3QPAA 5DKFA 1E89A 3RJ9A 4H4DA 3LV8A 4KSCA 2Z3ZA 3CLUD 2N1MA 4Q9IA 1QIGA 1GU7A 3E23A 2VDQB 2ZJBA 2ZBPA 2YY5A 1JEEA 1TLTA 2YHUA 4AICA 2YC2C 2JA2A 2OV8A 1A9RA 1RKUA 2FH5B 3IUQA 1QHSA 4XB2A 1OKKA 4B3JA 1Y4SA 3QKRA 4PFKA 3GUUA 4YUXA 1TD1A 3DTTA 3NR2A 2K2QB 5IBPA 1KEPA 4U7DA 5E95A 1IBKB 1M66A 2EKDA 1ORWA 1JHMA 2JD1A 2OQIA 3E3AA 4MYSA 4FONA 1X9GA 1ZD9A 3M1YA 3NEPX 1MJFA 3O95A 2OYCA 5MGNA 3F74A 3HJTA 4RV5A 3EZ7A 5LQSA 3PC8A 2AMJA 1QLJA 5KNBD 1ABEA 1N2SA 1PT9A 1AMNA 3KT0A 4IGEA 4BL5A 1A5ZA 4EFDA 1PW7A 2YJ3A 4MUFA 3AR5A 2F1KA 2LRHA 2P6RA 4PM4A 1EM8A 5LL6P 2XYQA 5IKPA 5JXHA 2GHQA 5EI5A 5CDFE 3PC6A 1EUCB 1RABA 2JCYA 1JHUA 1L0BA 4EGFA 4EYKA 2VOJA 2RGUA 4BBPA 3W6OA 2C4WA 4LRSB 4MV9A 2O6HA 1G1AA 5EIBD 1GPDG 1IN7A 2ZSDA 3YASA 5CA0B 1CDDA 1V5WA 4KQ2A 5K3FA 2AN3A 2TYSB 4PO1A 4PQGA 1FNSA 5LBUA 1VBNA 3TPFA 3DE0X 1ZA2A 4S05A 1VPDA 2OECA 2HPZA 3MJHA 4OHUA 1T3GA 2QROA 5FTNA 3V2UA 3TECE 5P8WA 3SC2B 1RI5A 1UBCA 4IDOA 1PKXA 4MYHA 4PHFA 1PZXA 2RJ3A 4RFLA 4DNXA 2FUNB 3JQPA 1SG9A 1M1YE 1EVQA 3GLUA 1C8BA 5FB3A 3LRPA 1SKUA 3EHEA 1YB4A 2AFRA 3A1SA 2ZI5A 5C8DA 2VTEA 3LCJA 2C9CA 5T41A 5IX8A 1YI0A 3P7MA 1I5OA 2R8YA 3FXAA 3H11A 1RDFA 3U4AA 2PA0A 1EFTA 4D46A 3VSAA 3KLMX 1GNPA 2I6QA 4F2GA 5BYAA 4ASUA 3RAPR 4OHWA 1PX2A 3IA2A 3LPMA 5B6PA 5JYBA 2FWJA 1P1RA 4ZI3A 3S8EA 1YMVA 2I87A 2ORIA 1M2FA 3NHMA 4AO6A 2F3UA 1RKQA 2CLEB 2FPRA 2CHFA 2YXBA 2OE2A 1E66A 3F3YA 1FVOA 3VDNB 2R7MA 1NJ8A 1LLCA 2Z2YA 1NV9A 3OU2A 5FV7A 5ICGA 3WNVA 1UUFA 4A4DA 3MA0A 4RWEA 2HMWA 1NVUQ 1RQXA 2G1UA 4ID3A 2GM3A 4GPZA 4XJXA 1WO8A 2XR1A 3SVLA 1RWQA 2R2GA 1XVTA 5GIPE 4ZC8A 4JV5B 4A8JB 3GEPA 1K3TA 2B5WA 1DEKA 3Q5DA 1UQTA 2P6NA 3KFXA 2WTUA 1XHLA 1B0UA 3GX1A 4M9XA 4WD3A 4XX1A 5F2NA 4RIHA 5BT9A 1WD7A 4BO8A 3KHUA 3BAZA 1PLKA 3KLPX 3HCOA 2W8BB 3E3LA 5IVPA 4CTMA 3TO5A 2EX1A 1H4QA 3E7XA 3Q85A 2R8BA 2FSFA 3G9UA 4LJSA 2A30A 4QJBA 1NF2A 4B82A 3CNOA 4EIWA 2QN1A 3SIWA 4EW3A 3UXMA 5DMHA 3HKBA 1TC2A 5DXFA 1E2IA 3ITDA 4JBNA 2CNWA 1E6WA 1ZESA 2HMUA 4CG0A 3AT1A 4HVLA 1CF9A 4GXTA 5FWNA 4WFKA 4E3ZA 1OFUA 3MCAA 3B20A 4IO0A 5L40A 2XWBF 2JZOA 3P0EA 3VJLA 2FZWA 1RAHA 2WTNA 3GGOA 4TPKA 3ZCRA 4E12A 3UQYS 4WLFA 4LJLA 2IPNA 1G38A 1R2QA 1ZH2A 4YP9A 4RF3A 1N2HA 3FNGA 4J0GA 4MQ5A 2GN4A 2P1DA 4OREX 1O9BA 5ER9A 1EDZA 3NHWA 4DAOA 5HS4A 2DFPA 3WLMA 4EK9A 1E1CA 2HWKA 2NZWA 4IG9A 2D1RA 1NQTA 2E1RA 1R4AA 1BOOA 4MVXA 3K7EA 4DAEA 4DRYA 3EZ6A 2FEXA 1YSCA 2PIAA 1UAGA 1KC1A 4KLRA 3FSJX 1KHTA 4Z3OA 4DG5A 3A11A 5EN4A 4FM9A 5C0OE 5J58A 3ER9A 3ZLJA 1F8YA 4OO3A 1GYQA 2HW8A 1OGIA 1QPBA 1ZITA 2CZCA 3W79A 4DUGA 4ZVRA 4C4ZA 1HTTA 2W6NA 5BW8A 1KY4A 2PT7A 1O6ZA 2YXPX 1IQPA 4UCWA 5JBNA 2QGNA 1ZH6A 3BD6A 2VCYA 2JAWA 2YXEA 2F1OA 3HN6A 3PB3A 4KI7A 1OYYA 2J32A 3AMVA 3FDZA 4WADA 3ZWYA 2Z43A 4DZZA 5CEJA 1MB4A 4PXYA 2D1TA 5IAKA 3TE7A 4ZAFA 3GD5A 1JBEA 5F35A 5BQOA 2XCLA 2BFBB 1VMKA 2R62A 3FFWA 2R8ZA 4WKNA 4XGQA 4YQZA 1E1DA 1YB2A 2Y68A 1K89A 5JQWA 2AQKA 2D0PB 1QGUB 4K6GA 3BCRA 3C7KA 4NYJQ 4AMYA 2OHHA 2GVNA 2OFWA 4UKDA 4M8NE 1OVGA 1SZDA 2W6OA 3K9QO 4E2ZA 2YBEA 3LZDA 2C7PA 3MLEA 2PMFA 4R16A 5B1SA 5KYTA 5IBQA 3D3JA 2WIDA 3EVZA 2Q1TA 5JOQA 4YPVA 5DP2A 4KE9A 4FBMA 3SF8A 3DWEX 1DDIA 3TZQA 2WABA 2D2IA 3K15A 4IX1A 3UVEA 4BUJA 5JMOA 1NNI1 3AFMA 3WLHA 1TDJA 4PTLA 5BQ3A 4ZN6A 2VDWA 4OHYA 4RIFA 4W6QA 3N2LA 4MR7A 1NN5A 2V97A 1HLGA 4WFQA 3O3OB 4IAOA 3FNBA 3JWJA 1N5OX 2CJYA 4HRXA 4HGPA 1XCMA 4X00A 1K7FB 2QP4A 1SC4A 2LVBA 2PZFA 3OFND 4CT4B 3A1DA 1FDOA 1Z5UA 4A8HA 2J6CA 5AKJA 5K0LA 1W96A 2IP2A 3IQDB 4GMFA 3QF7A 3IKJA 4PGMA 1Z2OX 2BMEA 3CHYA 3I28A 4MAAA 4LDJA 3PE6A 4GOMD 1B4DA 2BFNA 1QFYA 2CVQA 2Q1YA 2GXAA 4BP8A 1Y1LA 3B5JA 4LQ4A 4ZQFA 3PJDA 1OPXA 3FR7A 1Z4JA 2E4UA 2V7QA 3NANA 3V5NA 4JUDX 4DIOA 1CLUA 3RLIA 3SHWA 3VH3A 2AW3A 4LECA 5F12A 1H8HD 3KXDA 2K87A 3AVTA 4RD1A 2BYTA 2WYIA 1CETA 1GJRA 2C3MA 2K4MA 2PYZA 1XZEA 1ZKDA 4EW6A 2B36A 4QOFA 3TNYA 1M72A 2NYUA 4RVUA 3T7AA 1A7UA 1YA4A 4DA8A 2IODA 2R6JA 1NW3A 2M9MA 2P35A 1GM5A 2Z2KA 4BO7A 2G5CA 1G20A 3CJTA 2GYVA 2J87A 2V4UA 3IBTA 1DJPA 3P9PA 3HV0A 3PVCA 4X45A 3SK0A 2LWIA 1J56A 3CUYA 4PQRA 3C6KA 3NXKA 4CG2A 1J2RA 2ZG6A 3DPUA 3I0NA 1OT3A 1VTKA 3L7AA 5KB3A 4PPNA 5J2TF 4KDFA 4AIIA 1ZK3A 2GEUA 1GKKA 1HE1C 1ZCZA 5CVCA 3UFBA 1SPBS 3G2MA 4TXHA 4L15A 4BB0A 3IEXA 3VNBA 3EW7A 2C95A 3WXBA 3UJ6A 3JQ9C 4F5WA 2WJWA 5LQCA 3AJ9A 3MW8A 1MH9A 1NF9A 1CY4A 4D2IA 3TB4A 2OFOA 1G0OA 1F6BA 4L3WA 4TZTA 4BKQA 5D87A 1GPMA 3QI2A 2ZRBA 3TL6A 3D9QX 4JC0A 3ZK8A 2X7JA 3ZXSA 4OA5A 4CEHB 4YPOA 4K9KA 2D06A 3FMOB 4QRHA 3B36A 3HVJA 3W4KA 3N8KA 3Q1KA 4LG1A 2R3SA 2N42A 5GVRA 4DV3B 1Y42X 3ZCVA 1OLXB 1MX3A 3REOA 5LZ9A 3RFVA 1V9CA 1TKAA 5I8WA 2GCNA 3NLLA 2QUBA 4QUBA 3G9TA 3VR6D 1ODFA 3LDAA 3ZGZA 1A82A 1EM6A 3CONA 4MQUA 4OU5A 1YCFA 2X0EA 4CQMA 5HFNA 1C0KA 1ZOPA 3R5TA 4QHTA 1OASA 3LGSA 3OC6A 3VH4A 2OXFA 4J0EA 1XSEA 3GFTA 5A3QA 5C7YA 3JVVA 1R5OA 3CTMA 1JEYB 1FCJA 2HGSA 4UAUA 4DIKA 2E4ZA 4DT1B 3W2EA 2ZXFA 3L1KA 3CZ9A 1UJCA 5ES4B 1VJRA 1XCOA 3VPSA 1YFJA 3TFOA 2HRZA 2HLDD 3WRVA 2GYUA 3T95A 1IQRA 5ELMA 2OVFA 5MFZA 1WHTB 3ITNA 2PH5A 1K8XB 1V25A 2PGOA 4GKAA 5COQA 1F2VA 4YMSA 4D41A 1N0IA 5JPCA 2R8RA 1FRZA 3KZKA 1T1RA 2H9AA 2H3EA 2X9GA 1DBRA 2WD7B 1KRWA 3BB4A 4Z3DA 4KAFA 2F1HA 1XOIA 3A10A 1RAGA 3FHCB 3GRFA 3WLOA 4C7KA 4CDMA 4Q93A 1K66A 1GKLA 3EOZA 2GEKA 2VT2A 5KNDD 4DA6A 4C20A 1Z56C 3G1WA 5EINA 3VJMA 5JNLA 4JOQA 3OT4A 3D6VA 1F0PA 4TMYA 1RWPA 3ZQKA 3KUKA 4OGWA 2JD0A 4CLXA 3DLTA 1Q21A 2Q29A 1YHNA 2H07A 2ORED 3KE8A 3A3YA 3HPRA 4IOLA 4L73A 1UDCA 2BISA 2ECKA 4B7XA 5IH3A 1UCFA 4JVMA 1NQVA 5JG7A 1ZUNA 3WGKA 1QNFA 1WOMA 2FB9A 1NP7A 3EGEA 4P4LA 3WYAA 2XT9A 4EO4A 4PYJA 3RASA 2GBGA 4KR3A 1HLPA 3S40A 2FQXA 1NR5A 4FFLA 4DXDA 3BAFA 1C1XB 3WJ2A 4UE6A 4NFHA 1CUCA 1VGVA 1VCIA 1X2EA 2PO5A 1M33A 2P1RA 2XDYA 4NPHA 1MENA 1X77A 4US0R 3ZHYA 4O2BF 5AD1A 3S2SA 1CS0A 4KO8A 1DIOB 1T0UA 3H1TA 1KVQA 4N7RA 2EBHX 3VAYA 1FP4A 1GCOA 2H7YA 5G0UA 5KHAA 3RYCB 1RCUA 3HI6A 3E35A 4JGBA 5AKEA 1L1FA 5CDUA 2R8PA 1KFCB 4CTNA 3UAYA 4RVNA 1N2IA 2OKGA 5DLDA 3H2GA 2NU6A 4A91A 3WNBA 2O0JA 4TQ9A 2CY0A 3S27A 3WLSA 5KTYA 1IDOA 2P3SA 3TRFA 2FFJA 2EYUA 1LTQA 3NJRA 3T6KA 3X1XA 1P18A 3BUSA 1Z47A 1P5ZB 3FYUA 3JZDA 1U3CA 4NESA 4Q48A 3P2JA 2PFKA 3NWJA 4HDSB 2IV3A 4UFPA 2AXPA 3VOBA 3MILA 3I92A 3T9DA 3VSCA 3DGFC 4LQDA 4ND5A 1MB2A 4ARUA 2JIBA 4BCCA 1PZHA 2IK8A 5H81A 5B12A 1Y6FA 3QKUA 2Y1GA 1D0IA 1P91A 5LBTA 4ZJUA 1REQA 4BLRA 4F4FA 3IIEA 2JFOA 3GRYA 1FQKA 1YS4A 1QE0A 4Y6GB 3W7BA 2DTXA 1DHRA 2JHGA 2WHPB 3O8NA 4IHJB 2WHRA 4BY9E 3G7UA 1NXOA 3KOOA 2R6HA 5IUKC 3WJ1A 1OA1A 1YCHA 1ATIA 1JECA 4MVWA 3WV5A 4D42A 4EATA 5KOJB 2CV0A 1RCFA 4J0KA 4I1OA 1RPAA 3ZWOA 1OX6A 5FH9A 4Z9FA 3VR2D 2ISQA 1H3NA 1ZM2A 2AJLI 3DCYA 5DHUA 3SHOA 2FSSA 3HP1A 2APJA 1WXHA 2KLHA 1HM5A 3R7SA 3KJZA 2AOWA 2J6BA 2VJBA 4B4VA 3O8RA 3GF4A 3HYSA 2JANA 2AX4A 3OTHA 4ECAA 4EABA 1N77A 2HU2A 2QXYA 4FC6A 1O89A 1DPFA 4M98A 3BEDA 2JEZA 4V24A 2ACEA 4QM6A 4L1KA 5I7EA 1WZCA 4JXZA 5L4SA 2PL3A 1KARA 1M2NA 1VG1A 2JJYA 2DPYA 3FSGA 4JT9A 1P0MA 2XTAA 2Y67A 2AOTB 2C4TA 2DAPA 1I51A 1DNPA 1CUZA 3QKSA 2BMWA 5HGJA 3WYNA 2CL0X 5FAXA 3JATB 1GTSA 2PGDA 4HAZA 2Y1CA 4INZA 3K5PA 5ARDA 1SBCA 1X6VA 3FBGA 3FNRA 3NWPA 4AY3A 4DQVA 5C32A 2IQ5A 3P9QA 1Z3CA 2C94A 2P30A 3I2KA 3NT4A 4RCVA 3I0MA 3WQQA 4AAYA 1L5WA 1A9OA 4B2YA 1GUYA 3QUCA 4E32A 3O4RA 2DBVO 3IP5A 5ILQA 3AU8A 3TI7A 2FMFA 4ZKDA 2OLJA 4LQLA 2FTKE 1DIGA 3BGVA 3FUXA 3GJ6A 3QFCA 1EUDA 4V0QA 4B81A 4KXNA 2X41A 1B3BA 1Y6ZA 4G5OA 2XUIA 1S3SA 2AH5A 3S81A 2ZLBA 1UPBA 4FT4A 4N48A 1X1CA 1Z18A 5EJMA 3LIIA 1OREA 1WA5A 4PIPA 4X1OA 1IBMB 3H2JA 4DVGA 5E2AA 4YIHA 3TTXA 2QUZA 4KYVA 1XKXA 2FXIA 3MJCA 4L5JA 5AOCA 2R7NA 2YQZA 1WXQA 1NW6A 2CD7A 4TS9A 4MUBA 5DNAA 1SVKA 2GJKA 5U1PA 4RETA 2WG1A 2JGDA 3PPYA 1N78A 1RWVA 5DOZA 2OAGA 4QFMA 5D3KA 4MVJH 4R31A 2YDXA 4LCJA 5IDQA 1ZD8A 2H1SA 1O4WA 3BM5A 2G04A 3LY5A 1T43A 3L4JA 2KMLA 2YXLA 1W0JA 2A94A 4CM4B 4BNIA 3WE7A 2CYBA 1Z29A 4LRXA 6REQB 4ZMSA 2HRRA 5FWYB 1NI4B 4MA4A 3IEMA 1Q3KA 2QTAA 4OQNA 2C3OA 3FPAA 1F7UA 4DREA 3I23A 2CNBA 2HV9A 2O14A 4EOGA 3LCCA 1XFDA 2CK3A 3JASA 1UZNA 2O3SA 5KYGA 2OZLA 2CCKA 4R7TA 1GDTA 5TMEA 1Z07A 3U4MA 3P0FA 1JFFA 3TR5A 3E18A 4LGVA 1PK8A 4B9EA 4MEAA 2VPIA 4RSGA 3TZHA 4WEOA 4DBLC 4LV5B 1M1NA 1H6CA 1PJ2A 1YQQA 4E09A 4E11A 4DLRA 1BS2A 1LF5A 1EJ2A 4YCBA 2YWCA 3PLAE 4DY6A 1MV5A 1CB7A 1P2GA 1U0EA 3A31A 4IQ4A 4PY2A 4RAOA 1ECJA 1L7XA 1IVSA 2WKWA 4NH4A 3WDSA 2REQA 3C5EA 221PA 3B7PA 1RJDA 4CIXA 1LA2A 5A4MS 4XWWA 1GAXA 1P5RA 4N39A 3V80A 1A8UA 2GUWA 4GBMA 1Q15A 3JQFC 4HS4A 2VPWA 4FS8A 4M9CA 1UM8A 1RQ7A 4IFEA 1QBGA 5IHXA 2D8AA 3EZYA 4QTTB 1HUQA 1BOFA 4Z4EA 1AF4A 5G1PA 3TD6A 1AGRA 1XTVA 3K94A 2I1QA 3P9RA 2XVYA 3I52A 4G9GA 4I3FA 4OD0A 4DLVA 1BW9B 4G56A 4NYIQ 5A5FA 3L6DA 1F5SA 2CJXA 3BXXA 3DPSA 5TQ2B 3T5DA 4MUJA 2QOEA 5LYJB 2EG9A 2IBSA 1X7HA 2C58A 3LUPA 5K0CA 4BFYA 4GH5A 4ZEMA 4NEGA 1BH6A 2OYSA 3NKVA 2YMLA 2OFFA 4UUBA 4NL4H 1CVIA 3GLGE 1C80A 3P96A 5E6SB 3HO1A 1J1UA 1N9GA 4JGGA 2JGNA 5TV2A 5REQB 3KDPA 3IXLA 3N1UA 4P3YA 4RCZA 4BRZA 2FUKA 4FYVA 4UEOA 3AEZA 2HM7A 2HTEA 3BMNB 4IIVA 4HCJA 4JYMA 3DMDA 4RMHA 3STWA 3HEMA 3WC4A 4E88A 4PZYA 4JL6A 2GHTA 4PZCA 2Q3FA 1ZUWA 5E9AA 3TW8A 3HVUA 2OUIA 5B58C 1A9XA 1G7TA 4YCNA 5KZMB 2VXOA 4O4JB 4M7RA 1XNQB 4FNAA 1YE3A 4A82A 3DOUA 2BGKA 4IXNA 3UAGA 2D2VA 5C2JB 1PWYE 1DKRA 3LRTA 4KBGA 2C2HA 4C7XA 4U9IS 4RVDA 4BLQA 2ZEJA 3NHBA 4H7IA 3Q2OA 1AQJA 1BVHA 5J4YA 3OCJA 3K09C 1L4GA 1XP8A 4UEWA 3LBAA 3WFZA 1Z8NA 4BWGA 1GA6A 1Y6QA 5CFLA 1BKDR 1CXZA 4P0TA 5B2EA 4R1QA 4Q4JA 1DAGA 3ZH2A 4UE3S 3HHPA 1IOVA 2AK2A 3TOCA 1NVDA 2PT5A 2RGNC 1Y81A 3AERA 1G59A 1L7RA 3ADKA 4RLQA 2RAUA 2DFVA 1YZKA 4ZPJA 2QPAA 5GAJA 1AVTA 1L4YA 3AI1A 3H0EA 2IBMA 3JYQA 1GNSA 3MPOA 1O6CA 1E3EA 3IEIA 3PS9A 4HNHA 4L8VA 3GRUA 3H5WA 5COBA 3DXFA 1EEHA 1TL7C 2NV6A 4IDDA 2BBWA 5HS6A 2PU7A 4Z4HA 2B1IA 2VAVA 4C07A 3KV3O 2GBLA 5LBIA 5AVZA 5FTKA 3O84A 3LWZA 2PPLA 4QLBA 1CZUA 2F00A 2H59A 5B53A 1KAQA 2J3JA 4G25A 4DYVA 2O05A 4EF6A 3G8DA 4FX2A 1TF7A 2AS0A 2OSVA 3M6LA 4XSHA 5K5EA 4TMWA 2FOLA 1PR4A 5LN1A 4N40A 2VRBA 2OGWA 3PTLA 1X0VA 3MD9A 4PSCA 2GCOA 2P5YA 1ML4A 1UL1X 4RD4A 1RKBA 3N0XA 4NE2A 3EFEA 3CB2A 4Z0NA 4TLLB 5HP4A 2QYTA 4KNYA 3JD3A 1VJ1A 2WHXA 4A0RA 1QQAA 2CJWB 1NC3A 1DTWB 2QAIA 2CXTA 3ICPA 2ODPA 3T15A 4DF3A 2RGAA 5BWMA 1EVKA 5ECWA 4H7DA 4EMUA 4MX8A 3GNTA 5HG0A 4W1SA 4DYDA 1RW4A 2HLDA 3H7IA 3TMKA 2ZYAA 2ODQA 4IP0A 2KBFA 3KYBA 1XQ1A 1L3IA 3EWIA 5ESDA 3H6GA 3CKMA 4N7MA 1LJUA 4NFYA 5K0BA 1OLUA 4RO0A 1E3SA 1YJQA 1XU7A 2QTHA 4N5DA 3CBQA 3QOWA 1FFXA 1U4SA 4G26A 3NDJA 1D2AA 1ZK0A 2KS6A 2FK8A 1EXDA 4KQ6A 1GGNA 3M2PA 4LOIA 1E0SA 4BMSA 2AYYA 3GDGA 4IVQA 4L9RA 3GJSA 1TYZA 4ER5A 3LK6A 1L7EA 3DOFA 2QRKA 4GPBA 1UJNA 3HABA 1ZJYA 1UOPA 1Z5VA 3NUGA 3NPAA 3CXRA 3CYFA 3GH3A 4KACA 3AW9A 4J3NA 1GRVA 5JQGB 2H06A 2ZRKA 1UXIA 1EM8B 4MTLA 1L7NA 1UOEA 1NZJA 2P4HX 3AHHA 1EI9A 4P92A 3X1WA 2BEVA 3PHLA 4V38A 3UB2A 3WB9A 5KEIA 4R81A 4PSKA 4QT0A 3GI1A 4NTZA 5JS2A 3T7CA 1CUJA 2C4UA 2VHWA 3TJRA 1CF4A 1D2CA 2QG6A 1G9TA 3VR3A 3WZ2A 4G1FA 2C04A 1I7QB 1XN1A 2G40A 1PJA<