4UEJA

Closed state of galactitol-1-phosphate 5-dehydrogenase from e. coli in complex with glycerol.
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
346
structure length
346
Chain Sequence
b'MKSVVNDTDGIVRVAESVIPEIKHQDEVRVKIASSGLCGSDLPRIFKNGAHYYPITLGHEFSGYIDAVGSGVDDLHPGDAVACVPLLPCFTCPECLKGFYSQCAKYDFIGSRRDGGFAEYIVVKRKNVFALPTDMPIEDGAFIEPITVGLHAFHLAQGCENKNVIIIGAGTIGLLAIQCAVALGAKSVTAIDISSEKLALAKSFGAMQTFNSSEMSAPQMQSVLRELRFNQLILETAGVPQTVELAVEIAGPHAQLALVGTLHQDLHLTSATFGKILRKELTVIGSWMNYSSPWPGQEWETASRLLTERKLSLEPLIAHRGSFESFAQAVRDIARNAMPGKVLLIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GALACTITOL-1-PHOSPHATE 5-DEHYDROGENASE
publication title Enantioselective Oxidation of Galactitol 1-Phosphate by Galactitol-1-Phosphate 5-Dehydrogenase from Escherichia Coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 110
structure length 346
sequence length 346
chains with identical sequence B
ec nomenclature ec 1.1.1.251: Galactitol-1-phosphate 5-dehydrogenase.
pdb deposition date 2014-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4uejA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4uejA01
5JE8A 4I9UA 1DLIA 1I01A 3W8EA 1ID1A 2VHZA 3CXRA 3GMSA 4BO9A 3UF0A 1CDOA 1BVRA 1E3LA 3PDUA 1GQ2A 5IZCC 1U9JA 4WLOA 1C0KA 3SX2A 3G3EA 1E7SA 1Y9AA 4J43A 1CQJA 4I5FA 1IL0A 1QRRA 3PVZA 5ITWA 2C7VA 1NTOA 2EHDA 3WFJA 4CUJA 2A9FA 4GVLA 3KHUA 3O03A 3AI3A 2EXXA 5IDYA 3EK2A 3QVWA 3HADA 4D42A 4MKZA 3P2YA 1X7DA 3ZWPA 1CF2O 2EIHA 4IJUA 4RL6A 2J3JA 1XCBA 4L8VA 1LC0A 1ONOA 1F17A 4J7XA 5L7WA 3D5QA 1UZLA 4MJLA 1U7HA 4Z0PA 4WLUA 3NT2A 3PYXA 3ROPA 4LK3A 3VVCA 1FDWA 4N7RA 2R00C 5B4VA 3HNPA 4AFNA 2DTEA 3N74A 5IXSA 2BFMA 4BNMA 5F5LA 1JA9A 5G4KA 1KS9A 1CRWG 2NWQA 2P4HX 4IDBA 4NK4A 1KEVA 3FR8A 1PGJA 4DA9A 4C7JA 1E7YA 3GVXA 1D8AA 4W9NC 3U4HA 4HV4A 1B0AA 1G1AA 2ZYDA 3GEGA 5JDCC 3ASUA 4YACA 4GX2A 1QV7A 2ZKLA 5A04A 4P4NA 3GHYA 4FFMA 4QO8A 4ZQBA 3OM9A 1BHSA 4NDNE 3N58A 3VPSA 4Z9YA 3QRWA 3PLNA 1A9ZA 1X1EA 3PGXA 4UUPA 3D7LA 4A7PA 5ICMA 2J5KA 5JY1A 1CEQA 4PZEA 1KEWA 3IQDB 1GYQA 3BAZA 4MVJA 4CMKA 4PGFA 3LT4A 3WICA 3LT1A 4MP8A 4PG6A 4RVGA 3ZU4A 3NDJA 1I30A 4K26A 2HK7A 1ZK1A 4UREA 2G0TA 3WWYA 3MJTA 3PZBA 4KUEA 4TZTA 1HDGO 2EF1A 1CJCA 2X58A 1QORA 3OFSA 1UP4A 1EUZA 1I5RA 3PDJA 5A9SA 2C82A 3I9MA 2GYYA 3JV7A 2X8LA 2B4TO 1KEPA 2OBYA 2VHWA 2I99A 3HDHA 4BKOA 5A3JA 3U09A 1AHIA 1YOVA 3W8DA 1WP4A 2G17A 3KBOA 3I9LA 4RZIA 3OP4A 1HRDA 1OC2A 4DQXA 4RVFA 4BVAA 5EN4A 4GKVA 3Q6IA 3OEYA 4E5YA 3DBHA 5HS4A 4N54A 4W7HA 2I3AA 3WQSB 4E5NA 1EFLA 1DIGA 1BGVA 1RWBA 1E3WB 4JGBA 5K9ZA 1HZJA 2E82A 1HE5A 3AOEA 1DFIA 2QZ9A 1SNYA 2VYVD 4IMRA 2FR8A 3I3OA 3PP8A 2RH8A 4QXMA 4YJHB 3Q11A 5JCXA 1DAOA 3ZV5A 2QIOA 3DHEA 1OMOA 3DFUA 1PZFA 1FJHA 5L4LA 3DC2A 1P1HA 2HMWA 3IUPA 3BTOA 2EP7A 3Q3CA 1M67A 2NADA 4R1TA 4R9RA 2P4QA 3RU9A 1WZEA 1LTHR 1MC4A 4NBWA 5AXBA 1VKOA 1H2HA 4L76A 1ADCA 3BHJA 3CSDA 2PTGA 3B6ZA 1DC6A 1SAYA 1ULSA 2B36A 1GYPA 1EE9A 3PWKA 3WJAA 1ZXBA 4FGWA 5AQ1A 9LDTA 2Q1WA 3LSYA 4OAQA 5ER6A 1K3TA 2NNLD 1R0KA 3AY3A 4YAIA 1T1SA 5L51A 1DRWA 5KOIA 3VH2A 4KWIA 4CMCA 4MKXA 2FY8A 4RDIA 1E1KA 3D3EA 2O3RA 4M54A 2WE8A 1LSSA 4M86A 3GG2A 1ZK4A 4EUEA 3KLPX 4EZBA 1KVQA 1WDLA 4YJGA 1M6HA 3AWDA 4XYGA 1QR6A 1LLUA 3GNTA 1TT5A 1M2WA 4J3FA 4AJPA 1NAHA 2JCVA 3TOZA 3DHNA 1E7RA 5TGDA 3JD4A 3GH3A 4FR5A 4FJ0A 1HDRA 3STHA 1JQBA 1MXFA 4XYLA 1S7CA 2Q50A 4OQYA 1JU9A 3DMYA 4OSPA 4XKJA 5T6BA 1UXKA 3WNVA 1W73A 2AQKA 1KETA 4F3YA 2BLLA 2Y93A 3TZ6A 1JDJA 2EW2A 2DBVO 5BT9A 5KNLA 3PWSA 3AUTA 2VWHA 1XG5A 3BTUA 4FN4A 2ZQYA 5EJ2A 3JQ7A 3ZGYA 2VHVA 1V3UA 2Y0CA 4XR9A 1EZ4A 2GF2A 5L9AA 3BHMA 4EDFA 3ZH2A 3OH8A 4NZ9A 2BFOA 4IJVA 3WGOA 1ML3A 5MGBA 2JAPA 4PLCA 3UOGA 1ADFA 2PFGA 1DRUA 1VJ0A 2UYYA 1CETA 4GSLA 2Q2VA 4D46A 3KYDA 4J1NA 3JD2A 4BGEA 4NU5A 3GF4A 1JAXA 5JS6A 2WWRA 3UGKA 2A92A 1UZNA 5LDGA 4BNZA 1PTJA 5L40A 1Y8RB 4CQLB 2CNBA 5CEFA 1T2FA 1BWSA 1RM4A 1H9AA 4B7XA 4CM4B 4CM9D 2DAPA 2IEDA 3HDYA 1DO8A 3JQFA 3M1AA 4B4VA 1MC5A 1B15A 1Z7EA 1HETA 4FPXA 5DOVA 2P5UA 4Q3NA 1NX6A 2POQX 4RPKA 2HLPA 3KSZO 1PS8A 4PCVA 4WCFA 1LDBA 4XQGA 4JJIA 2GN4A 3FR7A 4E0BA 4LSWA 1EMDA 3UKOA 2D59A 1C0LA 1IUKA 4IGFA 1E5LA 3RFTA 3WGYA 3B20A 4HNGA 1WXDA 4IMPA 5TC4A 1NHWA 3WWZA 5JO0A 2Q2QA 3VVBA 1E7MA 1NQOA 4DBZA 1QYWA 4J0EA 1LUAA 3NTQA 1HKUA 1DRVA 3DFZA 4MVJF 1NR7A 1UXGA 3G0OA 1T4DA 1LJ8A 3BMOB 3HJAA 5I9MA 4A03A 3QQPA 4BGUA 2CDAA 5A5FA 3NEPX 3U4CA 1A7AA 2D8AA 4BNTA 2OO5A 3WSWA 1A5ZA 1VC2A 5HBRA 4BO4A 4U0JA 5ILOA 3LVFO 4MIYA 1ISHA 2VYND 1HWYA 3DB2A 3I9KA 4FFRA 4DQVA 3FN4A 3JQAA 1PGOA 4GL4A 5CDGA 3FBGA 4ZQHA 1JKIA 1E3WA 1UZMA 3PQEA 1SBYA 4MKRA 4XD2A 5CPFA 4DPLA 4J2OA 2AEMA 4E12A 2BFAA 1JN0A 2NVWA 2ZB8A 3ETEA 3P2OA 4HX5A 5KVVA 1N9GA 4O5OA 3OJEA 4CR8A 4K6FA 2IRWA 3DMTA 3GN1A 1K2WA 4PG7A 1E1LA 2IYPA 3S1LA 5AXAA 3PIIA 1Z74A 1T24A 4OXKA 4Z3KA 5EQFA 4CV0A 1E5QA 1R4MB 2HAEA 1DFGA 3BMNB 1U4SA 4CODB 2NQTA 4OM8A 4PRKA 4CM9A 4YQZA 4QTZA 5T8KC 1I32A 1C1XB 3F3SA 3K30A 1I3KA 2EEZA 2ZIZA 4IIVA 3W6UA 2NU8A 2V6FA 2Y1FA 4DGSA 3GUCA 3DO5A 4O63O 4QUKA 2B83A 2Y68A 5EPOA 4B4WA 3QVXA 2Y05A 5BNFA 4R3NA 1BRMA 4IXWA 3QY9A 4BNGA 5L95A 3D64A 4WGGA 2H6EA 1U2DA 3LDHA 4TROA 1IZ0A 3E82A 5BSHA 1KERA 2DT5A 2PH5A 5GZ6A 3JYNA 4PG5A 3I52A 3WB9A 2B4QA 5CHEA 3SXPA 1N7GA 3NJ4A 4BNUA 1BXKA 2EV9A 3K8ZA 4YRDA 2HMUA 4L75A 3V1UA 3RKUA 4YAJA 2AG8A 3GZNA 2JCYA 3PYMA 1LQUA 1R4NB 3TWOA 5TIIA 1R0LA 3JYOA 4L4XA 2GR9A 3NYWA 1KIFA 1JW9B 1U3VA 1NHGA 1XKQA 3RC1A 3WYEA 4RLSA 4CMGA 1PGNA 1UXJA 4YCAA 1ZMTA 1GEEA 3O8QB 3OIDA 4MDHA 1DC3A 1VLLA 2JFFA 4YRBA 3ENNA 2WTBA 4QSMA 2GASA 4CLOB 3WQQA 2UDPA 4NIMA 2BELA 1YL5A 3RD5A 3ULKA 4M8SA 4EUFA 1NBOA 2ZTMA 4LRTB 4BO6A 1GUYA 4JBIA 1U8XX 2DKNA 5IDQA 4OGWA 1HDZA 1B14A 2V6MA 3GN2A 5JDIA 4RQTA 3F4BA 3TRIA 1VI2A 2ZJ0A 2HMTA 3IUSA 3W4JA 4CM4A 4TVBA 4D3FA 3AOGA 2XXJA 2J3HA 3AU8A 3DOJA 5L4NA 4XB1A 1AGNA 3E9NA 1AUPA 3I23A 4I1IA 5CPBA 3ZNOA 1SB9A 4GPD1 5I7FA 1SB8A 4IZIA 1GZ4A 4KTTE 2RH4A 3UHAA 4QECA 1N8KA 1P1KA 3OHSX 3AUAA 3GMDA 5A4DA 2WMDA 1Z75A 4J2HA 3WS7A 4CLRA 3QV1A 1EDZA 4U8GA 5ENDA 3MOIA 4WEQA 2Q1TA 5DCUA 1NWHA 3OMLA 3F47A 1U28A 1P1JA 2QYSA 3EC7A 4E2XA 5THKA 3VHRA 2PZKA 1C3VA 2NLOA 3ZWCA 1BDMA 1VSVA 3JQGA 3WMWA 3NT4A 4CQMD 5KKCA 1B7GO 4M49A 3IKVA 3TJRA 2QRJA 3O4RA 1YWGO 5G4LA 5L45A 4GSKA 5JY6A 3RU7A 5AVOA 4DYVA 2DTDA 3PXXA 4EEXA 3PJDA 1ENYA 4IQ0A 2FPGA 3H6KA 3V5NA 3FWZA 1Z82A 4L9RA 1T1RA 1ADBA 2OFPA 1CYDA 3GR6A 4RPJA 2Z5LA 2EGGA 3Q9NA 3NV9A 4J91A 4ESOA 2JD1A 4PVDA 2FRDA 3L07A 4EYEA 1CERA 4E5PA 3JQ8A 3PYLA 4AVYA 1V9LA 2GCGA 3FNGA 1F0YA 1U2GA 4IY1A 1KC3A 1Y9EA 3DBRA 4W4TA 3EW7A 5EINA 3CMCO 3C24A 3RQSA 3WLFA 1O5IA 4HP8A 2FZEA 4GGOA 3JQCA 4AJJA 4ALMA 1R4MA 1U7TA 3WTBA 2Q1UA 1MGOA 2BGLA 4W82A 5GZ3A 1UAGA 5FFFA 4W6ZA 3OJFA 2X9VA 1YDWA 2AA3A 3MJSA 3I9NA 1C1XA 4YJFB 1DB3A 3FTPA 4IS2A 4QT0A 2X23A 1GZ6A 1HYGA 4JBHA 2O2YA 4RZHA 5KTKA 1G6KA 1LXCA 3RUCA 3A9WA 4NK5A 3ZWWA 2ZTUA 5LDHA 3V1TC 2E49A 3GGPA 4Z9XA 2BHLA 2Q99A 3PQDA 3NX4A 3OICA 4RCVA 4TRRA 4DVJA 5KVCA 4I5GA 3NDIA 4AJHA 4RF5A 4S1VA 1IHXA 1EK5A 1LRKA 1PS9A 3OBBA 4CM6A 5JMWA 2R2GA 4TRNA 4OSOA 1P1FA 2NVBA 3VKUA 2ZJ1A 1NASA 2D4AA 1ZFNA 2YDYA 3COSA 1Q0QA 1HTBA 5JPIA 4Q3EA 1I10A 4PZDA 1RPNA 3BTVA 1KEUA 4J49A 3Q9UA 4H16A 3V2GA 2Q46A 2WD7A 4UUMA 3U9LA 3O8QA 3HB4X 4XDZA 1N1EA 1R37A 4PG8A 1MFZA 4TKLA 4CQMA 2QYTA 1MP0A 1NVTA 1Z6ZA 4BNKA 4R51A 2GNAA 3BYZA 3UUWA 2RAFA 4ZN6A 4FC6A 5A03A 4DREA 5CDUA 3GAZA 4WNIA 1K6IA 4CV2A 4AJNA 4PLTA 2C0CA 1NM5A 2O3UA 5JXWA 2D1YA 1ZBQA 1HDCA 1PEDA 2FZWA 2NU6A 3LC7O 3BMCA 4Q3AA 4FOSA 2RHRA 4Y6RA 1DEHA 4L0QA 1MUUA 1I0ZA 2WD8A 1TLTA 3D4PA 3W1VA 3L4BC 2FR0A 3WR5A 1LDNA 2IZZA 4KQXA 5FWNA 1YGYA 2X1HA 2VWQA 4XB2A 4BMNA 1DIHA 3OECA 4NJOA 2QQ5A 3WFIA 3DBLB 4U6QA 1VL8A 1WDKA 1EUCA 1DIAA 1AHHA 2V6GA 4FBGA 3RWBA 4FC7A 1S6YA 4R68A 1OAAA 5K6AC 5DBFA 5HM8A 4RV9A 3WGQA 1I33A 3GOHA 3PHGA 1CIVA 2C5EA 5G0UA 4D0RA 5JAZA 1EUDA 3ONFA 1PL7A 2BF7A 1WW8A 1TXGA 2JL1A 4BV9A 3QA9A 4NFSA 5DP2A 3NDRA 4MVJD 1Q0LA 4J1SA 2VZ0A 3NRCA 1BDBA 2W8ZA 4XA8A 2CY0A 3FRJA 1DHTA 4WNCA 5U1PA 5IFLA 3AJRA 4BIIA 4N5NA 4BMVA 2FSSA 2Y1OA 3PQFA 3R6DA 4ZRNA 2X22A 4ZICA 1AN9A 3BZUA 1LSOA 3EUWA 5B4UA 4LN1A 4AJ1A 5FEUA 2C59A 4G2NA 2VNAA 5KJEA 4R5MA 1PQPA 3X2FA 3OSUA 3JQ9A 3GK3A 3TF5A 4HFMA 1TT7A 1X0XA 4ZRMA 1W0CA 1E6EA 1ZNQO 3D4OA 4ZVVA 1RYEA 4B79A 8LDHA 3EMKA 3UW3A 5DDIP 3HE3A 4EJMA 3PWZA 4Z9FA 3PK0A 3U62A 2IXAA 4CLEA 4Z0TA 3CEAA 4OOFA 3K31A 4WCDA 4CM8B 2HJSA 1UDBA 1ENPA 3GHHA 3GVPA 1XYGA 3VH3A 4OMUA 1SEPA 2IYOA 4HFJA 1Q7BA 2J5RA 1LU9A 1PJSA 2AQIA 3JQBC 1KVRA 1XWFA 2CDBA 5DP1A 3UXYA 3H9GA 3OA2A 1UDCA 3K2EA 4FIZA 4R1NA 2DTXA 2C5AA 1NXQA 2W2LA 1GY8A 5HS6A 2PKRA 3ZWYA 1XEAA 4IQGA 3DAPA 2C20A 1R66A 2PZJA 5L7TA 1Z7BA 3B1FA 1UXIA 3FHLA 2OXIA 1PJ4A 1GCOA 2VN8A 3TFOA 4ND4A 4IQ8A 5FI5A 4FFNA 1KVUA 1P1IA 2JCXA 3FCOA 4YJFA 4DPKA 3M2PA 2PK3A 5F21A 4IDGA 1EQ2A 3RROA 1XU7A 1I2CA 2OP0A 1E7QA 2X7HA 4TZKA 5DF1A 3WGHA 4EJ0A 2DBQA 3SLGA 1AXGA 3H7AA 1ISIA 1DIBA 2EERA 3ROKA 4LSMA 3FSRA 1ZSYA 4Q39A 3ZW9A 2BFPA 1NQ5A 4DIFA 3EZLA 3VZPA 3U5TA 2XOXA 2ET6A 2JD2A 1LLQA 2VHXA 4GKBA 3TOXA 2DFDA 2FR1A 1XDWA 4IDDA 2AG5A 1NP3A 2V65A 2YV2A 2HU2A 5JC8A 3CTMA 3HN7A 1Y8QA 4WPGA 3AI1A 3QE3A 3TL2A 5KJ1A 3GFBA 1H6DA 1MLDA 4DQUA 1HZZA 3JYPA 3RAJA 3VPHA 3H9JA 1Q1NA 4AJEA 4HWKA 4B3IA 3EYWA 1C1DB 1LDGA 1JWAB 2C2XA 2PGDA 4ILKA 3GDGA 3TSCA 2HJRA 1U4OA 3IS3A 4EI2A 4GAEA 3UCFA 3GEMA 5KWEA 4R54A 1N1GA 5GZ1A 3RFXA 3JQEA 4KWHA 1QMGA 2CVOA 2GN9A 2GERA 3HDQA 1V6AA 4PLHA 1KOLA 1GAEO 3K9QO 4ZQEA 3HHPA 1T2DA 3LLSA 4CLDA 2O3SA 2OZPA 4TRMA 5CG2A 4P4LA 3PTZA 3VTZA 3ZU3A 1HE2A 1RM3A 4TKMA 5TF4A 1J0XO 2DVMA 5MDHA 2D3TA 3ZV4A 2D5CA 2O23A 3VKVA 4WLVA 1VKNA 3DBLA 2HKIA 3INRA 1IULA 3PHIA 2GZ2A 3WYBA 3HSKA 1ZEJA 2W2KB 3GGOA 4A5OA 1Q7CA 1GADO 4K6CA 5EERA 4E13A 2R6JA 1SOVA 4H15A 3DZFA 2EWMA 2AQHA 2Z95A 3LT2A 3CKYA 4WLNA 3WBBA 3WJ7A 3UH1A 4DC0A 2B69A 4WECA 2FPIA 1N2SA 2Y1EA 5C5IA 3ANMA 1GTMA 3MWEB 3H9QA 1SZJG 3H4VA 3ORFA 4P4GA 2VRBA 5IZ4A 4IDCA 3SJ7A 1B8UA 4JCOA 1PSDA 4DL9A 2BGKA 2FSVA 3E9QA 3FF4A 4G5HA 1U3TA 2EKQA 4B7UA 5DNAA 3ZHBA 3MJVA 4HNHA 5EIOA 5BSFA 2DLDA 3C1OA 5ADHA 3OF2A 2VUSA 5KJFA 4U0KA 1G0OA 4YA6A 3ZDFA 4CLHA 4CMBA 4A10A 2P9EA 2GGSA 4L73A 5B12A 3GPDG 1ZMOA 1H0KA 2NTVA 4FFOA 4NJMB 4ITUA 1WMAA 1N92A 1DC4A 5A5EA 4II3A 4CMEC 1IPFA 3E03A 2DFVA 4GLLA 1YL6A 3W6ZA 3JQAD 4E5KA 2CUKA 4XQ9A 1XQ6A 3AUSA 3LQFA 4URFA 4FB5A 4R69A 2PD4A 3ITDA 4LGVA 3DBVO 4Y98A 4Y6SA 1GYRA 1M66A 2FPPA 3Q2IA 4OO3A 4CM7A 2SCUA 3WGGA 1E0DA 4E2WA 4YT2A 4UVHA 3OEWA 4J1TA 3CH6A 4ND3A 3HG7A 4UUOA 4J0FA 1WDMA 2ZYGA 4HFNA 4J4TA 3ZHZA 5IDXA 4GWKA 2TMGA 1I36A 1I8TA 3DONA 3PJGA 4Z0HO 4PLWA 4FFLA 1MFPA 3ZWOA 4RVHA 1NAIA 1HE3A 3AY6A 3TNLA 3GVIA 3U4DA 1GUZA 1E6UA 1QYDA 3BHIA 3RJ5A 1MB4A 1PJLA 1I2ZA 1U3UA 5BNIA 2W90A 4BL5A 4MVJG 4GVXA 4KMSA 2UV8A 4KTVE 1ZSVA 1LNQA 2D0IA 5TLSA 2JKVA 3C1TA 3L77A 4CPDA 3VPGA 1Z73A 2AXQA 2BGMA 2HK8A 2LDXA 1WPQA 2Q49A 2Y0DA 4MVJI 4XYMA 4GMFA 3KXDA 4DC1A 5C7LO 2EJVA 5KJCA 1Y5MA 4YBZA 1D1TA 1Y81A 2NM0A 4UVEA 2CVZA 1U3WA 1X13A 4I9NA 3KLMX 4FCCA 3BA1A 5JCJA 2J3IA 4BMSA 3K2BA 4BNHA 3K92A 5HA5A 2HDHA 1RJWA 1FK8A 4PRLA 4YVFA 4E2YA 3NTRA 2I76A 2O7QA 3H9UA 3GY0A 5C3MA 4P38A 4NBTA 1MV8A 4DBVO 3FWNA 4QFDA 1LSUA 5DZSA 2QZZA 3W4KA 3WYCA 1PZGA 2IZ1A 4QFCA 1LDYA 2VWPA 3ICCA 1YL7A 4MIOA 1J6UA 1C1DA 3NKLA 2Q4EA 2AMFA 4PLPA 1DIRA 1NPYA 2I6TA 2YQ4A 2J6IA 4Q3BA 3RUIA 5KCZA 1EBFA 1AXEA 5G2OA 1P74A 2YHIB 2V7PA 3VZRA 4CV3A 2B35A 2UAGA 1RM5A 2I9PA 4F46A 2ZB7A 2O50A 3NTOA 4BNNA 1FDTA 4YJHA 2VUUA 3D3WB 4GX0A 3ABIA 3QSGA 3RC2A 4D7AA 1O9BA 1ONPA 4O59O 4HY3A 3GNQA 3ZV3A 4JBGA 1EE2A 3GRKA 1ZJZA 2RIRA 3P19A 1H6BA 3D0OA 3B1KA 1PJCA 2PZMA 2PR2A 1F06A 2O48X 3OQ1A 1DOHA 1EEHA 2DBZA 5I7EA 1IPEA 4UUNA 1WVGA 3UFXA 2Q2WA 5AYVA 2IXBA 2CVQA 3EZYA 3KSUA 2I65A 5HRUA 4WASA 4D79A 2JHGA 3KYBA 4FSHA 4HADA 1UP7A 3AOEC 3DAFA 3GA0A 1DJQA 2EW8A 4GMGA 4GLOA 1WAMA 5DBGA 3AU9A 3PHLA 3G17A 3UICA 1ZH8A 2EJWA 3NT5A 4NFYA 4DIOA 4GWGA 3KO8A 3HQ4O 3P5SA 4FD3A 4GQAA 4RGBA 5DOZA 4JJGA 3S2FA 7MDHA 2VRCA 5ILGA 1BW9B 4RVSA 4EGFA 4Q9NA 1EVIA 4IIUA 5B1YA 3HFGA 2JFGA 3IP1A 3INGA 3U0BA 2WM3A 4RLHA 3IMFA 4ND2A 1U5CA 1TA4A 2XF8A 1EFKA 3AM3A 2PY6A 5JAMA 1SPXA 3T4EA 3VPFA 2E37A 3OETA 4J6FA 3GUYA 4PLVA 3TFQA 1XHLA 5TS3A 2O7SA 1BVUA 4MOWA 1YB4A 3CPSA 1E3JA 1GQQA 1JTVA 1K5HA 3LF1A 1HEUA 1VPDA 3INTA 4O0LA 1VE9A 4YAKA 1X15A 1U5AA 1OOEA 4FQ8A 2VNSA 3V2UA 5L7YA 3RSHA 4AICA 4CLXA 3ZV6A 3F6YA 1YB1A 1E77A 4D43A 2UUOA 3L6DA 5IF3A 3AK4A 1XGKA 4NNJA 1GQYA 3FPLA 5ICSA 1Y8RA 4CQLA 2X4GA 1ZCJA 2ZTLA 3DEYX 5DULA 3ZNPA 1LA2A 3D5TA 4OL9A 4XRRA 2Y67A 1X1TA 1Q0HA 1EVYA 2OOSA 2A4KA 2VUTA 1KYQA 4ID9A 4M87A 5H81A 3TL3A 1P31A 5KJ6A 4NG5A 4QX6A 1IHYA 3H3FA 4N18A 1F8FA 3QWFA 4HXYA 4B3HA 1YBMA 1RYDA 1JVSA 4QEDA 2VWGA 3UVEA 3ZWXA 4CR6A 4NU6A 2FP4A 2PZLA 4Y9DA 5DT9A 5LCXA 2JD0A 3TZKA 5IZCA 2YV3A 1GPJA 4JN6B 1H5QA 2YY7A 1PQWA 1BXZA 3FPCA 4IDEA 1M76A 5IN5A 1HXHA 3C7CB 4BV8A 1EQUA 3L0DA 1YONA 2Y1GA 3GAFA 4BO3A 4LCJA 4OQZA 2UVDA 2TMDA 4AG3A 2VOJA 3RCBA 3JQFC 3WBFA 3I4CA 4CMHA 1X14A 2ZCVA 2AHRA 2PGJA 1E3IA 5JAQA 1NVGA 3BMOA 4BQPA 5C37A 3E5RA 3GG9A 4WCFC 4EUHA 1P77A 5TQVA 3H9EO 2VCYA 3TZHA 1FDSA 5A9RA 5HWSA 5JO9A 1OC4A 4J16A 1YQXA 2E6UX 4E4YA 1V35A 3ONEA 4D3DA 2O4CA 3F1KA 3JYLA 1UUFA 1P44A 2GZ1A 2R00A 3JTMA 1PWZA 5B37A 5L4SA 2BD0A 2YHIA 4FJ2A 4BNIA 4EW6A 3DOCA 2AE2A 3D3WA 3H5RA 4XYBA 1XU9A 5I7SA 3HFSA 2H63A 1P45A 1Z45A 3C8MA 3EVNA 3V1YA 2ZB3A 3JD3A 5ENVA 4W9NA 3RUFA 4DMLA 2HK9A 5JDCA 3WNQA 2EKLA 2YV1A 3K5PA 3AW9A 3QLJA 4ZJUA 1D3AA 3GC6A 5DCWA 3RUEA 4HKTA 4K9DA 2JHFA 1ZK0A 3F5SA 3MOGA 3F4LA 3NGLA 4R1SA 4RDHA 3NJ8A 1O89A 3G49A 2NV6A 1HYHA 3Q0EA 3WDSA 1YQDA 4XRGA 4EITA 3QWIA 1DC5A 1QYCA 3KOUA 3BMNA 3WGIA 4ZQFA 2EP5A 1ENZA 2WSBA 3QVOA 4RPGA 1IYZA 1YB5A 3H8VA 1EVZA 1XIVA 1DAPA 5G4KB 2Z1NA 1N5DA 3WMXA 3IJRA 1EDOA 2RBEA 2DQ4A 2P9CA 2HCTA 5JMPA 3DMTC 2PKQP 4NMHA 4XWYA 5TT0A 2NVUB 3L6EA 1UP6A 1PGQA 4ZHSA 3K96A 2P9GA 1V0JA 1PGPA 2QRKA 4J1QA 1PR9A 4YDRA 2BH9A 2HUNA 5CDYA 1VM6A 1P0CA 1T4BA 5H83A 1LEHA 5BSGA 1Y5RA 2Q45A 4ALNA 3CE6A 2Y66A 2CD9A 2EKPA 3ZCXA 3UN1A 2GRAA 4R41A 3AY7A 4CL3A 3ADPA 5TJHA 2C54A 2ZYAA 4BGVA 1R4NA 4Y8VA 3PHHA 2C2YA 3P7MA 3F5QA 1T2AA 5JFOA 4M55A 1DHRA 3IJPA 4LISA 4W7IA 3HB5X 4BNLA 5IAAA 2UUPA 3U49A 4ALKA 1PJ3A 4BS9A 4RJTA 1J49A 1WMBA 3K73O 4DLLA 2IDZA 3RKRA 1NPTO 4MVJE 1SEVA 5JNLA 1MX3A 3L4SO 4K1LA 4CLOA 1V3VA 1T25A 2J3KA 3GZ4A 2ILTA 4OHUA 4AL4A 5JYDA 1DJNA 4MINA 1I3NA 1SC6A 4LMPA 2XAAA 1NPDA 5A9SB 2X6TA 1VL6A 2DU8A 1B8VA 3IAHA 4F6CA 1F14A 1YOVB 3AI2A 4YWJA 1GV0A 4NQZA 2W2LD 3QIVA 5JBIA 4UEOA 4JX8A 4YYZA 5J23A 5ITVA 3DBHB 5EESA 5CEEA 3GT0A 4E21A 4LVCA 2X0IA 3E5MA 3NGXA 4XDYA 1HSOA 5G0TA 4B4OA 4CUKA 3E18A 2X5OA 3B70A 1JLLA 3DZJA 1LDMA 3AFNA 1E92A 3EDMA 4BKRA 3SC4A 4ZD6A 3DQPA 4BO2A 4CR7A 2HRZA 1HF3A 5CDSA 4I5EA 3WOHA 1DXYA 2JFHA 2ZTVA 4WLFA 4E6PA 5JDIC 1W8DA 3TDKA 1ZEMA 1J5PA 3OJLA 1PR3A 4NH4A 4XIYA 5TT1A 4D41A 1K6XA 1OZAA 2B4RO 1UH5A 4PLZA 3EY4A 3MJEA 3WG9A 2IE0A 1ZKMA 4BO0A 1GEGA 3JCZA 3BMQB 3WXBA 3QVSA 4B8WA 1HDXA 4GBJA 2GN8A 4MP3A 5FF9A 4F45A 1I2BA 3IOYA 1NFQA 3UCEA 2QX7A 1Y6JA 4YJGB 3WX0A 4N5MA 1GU7A 1U1IA 1A4UA 4ND1A 4AJ2A 1VSUA 4AJLA 4JK3A 1EBUA 4CJXA 4WUVA 1QKIA 1TT5B 4NBUA 1H9BA 3ENKA 3LT0A 4MP6A 3C1AA 3IIEA 3FBTA 2JAHA 1ZSNA 2OMEA 2Q4BA 5IG2A 4UEKA 2G5CA 5ER9A 1KVSA 2XXBA 3E9MA 1BG6A 1KY5A 2CZCA 4IZHA 4K28A 3SBOA 4IBOA 1PU2A 3ONDA 5BR7A 2VQ3A 2YFHA 4XYEA 1RKXA 1PS0A 2NTJA 4JNKA 1ZZEA 4OOEA 1EVJA 4WOJA 1YDEA 3JQ7B 2G82A 3LYLA 2OL4A 4TWRA 3ZI0A 4FDAA 3MJCA 3SC6A 1OFGA 3F46A 1HSZA 1HLPA 1LDEA 2NTNA 4WJZA 2CF6A 2GPTA 3DZGA 3ICPA 3KYDB 1GZ3A 2OGUA 1O0SA 1PJ2A 2P5YA 1DPGA 4J9VA 4YR9A 2HMSA 1QXSA 1M6WA 2JJYA 3GPIA 5GMOA 2Y1DA 3VDQA 4FJ1A 3VZQA 3L6OO 2NVUA 1WZIA 4IS3A 3DZHA 4JLWA 5G0WA 5BQFA 3E48A 3VC7A 1BTOA 1EK6A 3FNFA 2ZB4A 4J9UE 4MVJP 5G0VA 4CM3A 2CDCA 4ONEA 1LQTA 4KQWA 1B8PA 3TN7A 3M1LA 3WQRA 2EGHA 1PJQA 4IDAA 4UULA 4E2ZA 1Q2XA 2X0NA 4WCFB 4XGKA 3I83A 5U9CA 2G76A 2P2SA 4C7KA 2QHXA 3KV3O 3WGTA 4DLAA 3QWAA 4A0SA 1UXHA 2X9NA 5KKAA 4F6LA 3ZU5A 1MG0A 5EQDA 3W8FA 3ANNA 1ZJYA 4GH5A 1HE4A 3AM5A 4PLGA 4PFJA 2G1UA 4BQRA 3I1JA 1IY8A 3DZKA 3MCVA 1GD1O 2ZATA 3KEQA 4Y6PA 5JLAA 1C0PA 1Q7GA 1T2CA 3HDJA 1H94A 2WDZA 4HUJA 1XR3A 4ND5A 1NQAO 1TEHA 1QG6A 1HYEA 1R6DA 1DFHA 3AM4A 4BO5A 2GDZA 5I8ZA 3DDNA 1H2BA 3KM0A 1R0SA 3MZ0A 3BTSA 3GLQA 3F1LA 2NACA 1D7OA 2I5PO 2B5VA 3B1JA 4E31A 5G0SA 1VJ1A 3HUDA 1DBVO 3EVTA 4EBFA 3QWBA 5F1PA 4B7CA 3KRTA 3H2ZA 2X0RA 3ST7A 3V8BA 3JQAB 5CAEA 2WYUA 4FW8A 1K6JA 3DAGA 1L1FA 5JYEA 5T8KA 4KUHA 4MPDA 4YRAA 1FF9A 3VH1A 1ISGA 2V6BA 4BNYA 4L4SA 4PZCA 3ZHXA 4JP3A 1OBFO 3PPIA 1KY4A 2F00A 4L4RA 1N9GB 1ZO8A 2DPHA 4OKNA 3WIDA 3PLRA 4DMMA 1BXGB 4WE3A 3GNSA 1K0UA 1YBVA 4BNFA 1X0VA 2HSDA 1SO8A 4O6VA 4R9SA 3QW2A 3H65A 4CMIB 3WTCA 5COAA 4LMRA 6ADHA 1P9LA 3GGGA 1YJQA 2NQ8A 2NUAA 1LX6A 2PKQO 3GVHA 2VZ8A 1ONNA 5JC1A 5JCJD 1ZXLA 2X0JA 3M2TA 5F1OA 3QJ5A 1OI7A 1F8GA 1R15A 2NU7A 1E1NA 3E6AA 3O9ZA 3JD1A 3ON5A 3K6JA 4UVGA 1ZVMA 1I24A 1PWXA 4XQEA 4RVUA 5CP8A 3EAGA 4X54A 4E32A 4HFRA 5TNXA 2ZQZA 2OUIA 1X7HA 3ANLA 4B8ZA 4YAEA 2DUUA 3OIFA 3PFFA 3L9XA 3Q1LA 2YW9A 3BMQA 9LDBA 4R01A 2O4UX 4C4OA 5L53A 1IE3A 3L9WA 4BKQA 3DTYA 2DM6A 4OJNA 4G65A 1R16A 5AXDA 4JIGA 3S8MA 2YQ5A 3A4VA 4BHTA 1LLDA 2LDBA 2GSDA 3A1NA 3JYQA 4J7CA 4YAGA 3JSAA 3OJOA 5DN9A 3C85A 4CM8A 3GZNB 1XELA 2YHUA 3D1LA 1M75A 1NYTA 1QYVA 4Z6KA 4RF3A 3SLKA 1V8BA 2PH3A 4AJIA 1W4ZA 1LLCA 1QYXA 1NNUA 1H6CA 3ITKA 3LU1A 1ENOA 4XGIA 3OIGA 2DPGA 4M1QA 3E1KA 5A3VA 3JQ9C 1HLDA 1JWBB 1P3DA 3CINA 4WOKA 5CG1A 1YJ8A 3ZHYA 4YTEA 3EHEA 2J5QA 3H3JA 1YQGA 1UDAA 4JP2A 2NSDA 4IJKA 2YZ7A 3DXFA 1NR1A 1GDHA 3VDRA 2Y1CA 5T57A 2OORA 1ISMA 1H93A 4XR4A 3LK7A 3RC7A 4BUCA 2O3JA 2X5KO 3I9OA 3DR3A 1A9YA 4PG4A 4LRSB 4J4BA 2VYVA 3SVTA 2O3TA 4J7UA 1DLJA 2PV7A 1IZ9A 2PD3A 1O94A 2W4QA 2DC1A 1IOLA 1GUFA 5LC1A 5BNTA 1Y1PA 1D4FA 1MA0A 3QP9A 4LCEA 5C7OO 2VRCD 4YB8A 2CMDA 4KDFA 3T7EA 3PI7A 4MVJM 1E3EA 3RFVA 2BI8A 2B5WA 1QLJA 1E6WA 4YT4A 1RM0A 1VRWA 4FOOA 3PEFA 1KC1A 4PLFA 3ZN2A 3ZNNA 1B26A 2E48A 4BKUA 3MTJA 4R4JA 4XGNA 5JAIA 1TB4A 2WJPA 4NFHA 2YFQA 4RO0A 3PRJA 2HQ1A 3MEQA 2O3QA 4G81A 5F1KA 4AJKA 2X5JO 4E30A 4L74A 3RBXA 1PX0A 3C7DB 1A4IA 4CLRB 5K0ZA 1B3RA 1YE3A 3I6IA 5F5NA 4YXFA 4LVUA 1QP8A 2IZ0A 3T4XA 4ALIA 3PJFA 4EEZA 1XLTA 5H82A 2WYVA 4E5MA 3C7AA 5L3ZA 2HRBA 4BNWA 2GLXA 8ADHA 5I7VA 1YO6A 1FDVA 1GFSA 2WYWA 5THQA 3GFGA 1YVEI 5F3RA 1J4AA 4A73A 4KOAA 3A06A 1PIWA 4CMAA 1K89A 1SOWA 1YRLA 5AOVA 1O8CA 1L7DA 3E8XA 3JQGB 4H3VA 3IKTA 3KTDA 2H9IA 1U8FO 2XPCA 3LC2O 4R16A 1XQ1A 4GX5A 2AE1A 2VOEA 1A27A 1MXHA 1PQUA 4IDFA 3ZZNA 1B3BA 4I9HA 2FHSA 5KVQA 3LLVA 1LSJA 3Q2KA 4RF4A 3CMMA 3DL2A 4Y67A 3WIEA 5T64A 3KYCB 4RF2A 4XCVA 2W2KA 3FNEA 3LF2A 3N7UA 5FYDA 1NFFA 4DUPA 2P91A 4WK6A 1ORRA 2BI7A 3A14A 3DTTA 1BXGA 2VT3A 3HWRA 4MVJH 2BRUA 2I66A 4ZGWA 1ULUA 3JQ6A 4OYRA 3JQ8B 1ZW1A 4CM5A 4CMIA 3IL2A 1DDOA 2RCYA 1HT0A 1B2LA 1LRJA 3DBRB 1XA0A 3O26A 4BO7A 2AQ8A 3T7CA 4NBVA 4QQRA 3MTGA 1IB6A 2Q3EA 1D1SA 1FDUA 2Z1MA 4ALJA 3VZSA 4CM1A 3DHYA 3DOOA 4J4HA 1BMDA 3AUUA 3QWHA 4QO7A 4W99A 4YJDA 3WLEA 2H1SA 2HO5A 2PNFA 4ZQGA 3ROMA 1VL0A 3RUDA 5DCYA 1SCUA 1H6AA 3R3SA 1NWCA 1MG5A 3OQ6A 4ROSA 4WKGA 2AEFA 4ALLA 3V2HA 3SJUA 2YYYA 4NHEA 3ETGA 3KSDO 3BXXA 3RBZA 4XIJA 1E1MA 1N7HA 5A02A 4NJMA 3VTFA 5T67A 1LRLA 1P33A 4B3JA 5A05A 3TZCA 3TPCA 1ZK3A 3OA0A 4BB5A 4RPHA 4J90A 3KEOA 1QLHA 2VZ9A 1GL3A 1LBEA 4I5DA 2C29D 2J8ZA 5TJ9A 4D44A 4P8RA 3RC9A 5A9TA 1NFRA 2I3GA 3JQDA 5KIAA 3KB6A 5JSFA 4YEDA 3DZIA 2GD1O 3KETA 1G0NA 3RJ9A 1FMCA 3FNHA 2Y0EA 3F9IA 4TSKA 1WNTA 2W98A 3PZRA 1P0FA 4BNVA 3L4BA 2WD7B 4KP7A 4XX0A 4EJ6A 4BOYA 3U3XA 4XEHA 2AW5A 3HZZA 4IUYA 2YUTA 1HDYA 4RORA 4CQMB 4E3ZA 1A71A 5K6AA 2RHCA 2VYNA 3AFMA 4BO8A 1O6ZA 2CSUA 4A26A 1WWKA 3W4IA 3PHJA 3O38A 1ZUD1 5K1SA 3I4FA 2PWZA 5DBIA 3PGJA 3BMCB 3CZRA 1KVTA 4A27A 1YH3A 3SEFA 4R3WA 3H5NA 5ES3A 4KUGA 1ISJA 1YS4A 1PL8A 4U5QA 5CDTA 2F1KA 4B4UA 3RUAA 1C0IA 4WLEA 4ZU3A 1YXMA 3RVDA 2X86A 4RVDA 4DPMA 2IODA 4OXYA 4HBGA 1GV1A 4S3MA 4BB6A 1TVEA 4TVOA 3I5MA 3IP3A 1NQTA 1A72A 1QV6A 3VOSA 2VHYA 1JAYA 3QVTA 2GO1A 4IINA 5A06A 4CL8A 3S2GA 4E33A 1ZIDA 4UEJA 2WE7A 2O2SA 3OQBA 1AE1A 3VPXA 4DTIA 1PL6A 3GDFA 3GQVA 3ZWBA 4NPCA 2PD6A 1BSVA 3MJ4A 4Z3DA 3RIHA 3ZW8A 4D3SA 3S55A 1A7KA 4DRYA 4OKIA 1T26A 4GI2A 3ZWVA 3LC1O 3GEDA 5TSDA 3CIFA 2NU9A 4YPOA 3ZWAA 4BO1A 4XZ3A 7ADHA 2CF5A 1TI7A 3JQBA 2OBNA 3GDOA 3R1IA 3R0IA 3VAZA 3ZWNA 3G79A 3RI3A 1HDOA 4FFPA 5I8WA 2I67A 4YT8A 1Y7TA 4RPLA 5IDWA 4Q3DA 3KUXA 1VJTA 4OH1A 3M6IA 4R1UA 3WSVA 1PJBA 4BNJA 1UAYA 1C14A 4CMJA 2X9GA 3WGZA 1V3TA 3KYCA 3IC5A 1ZK2A 1FXSA 3DZBA 2QG4A 4TMFA 4JXKA 1ISFA 1I3LA 3I6QA 4ZA2A 4D0SA 2YJZA 3X2EA 2B0JA 1P1RA 3ADOA 4PN3A 5GY7A 1WLYA 4N5LA 3H2SA 4U6SA 1I3MA 3QHAA 1W6UA 4WEOA 3ROQA 2A35A 2FN7A 4I8XA 1L7EA 2FOIA 2Y99A 2GZ3A 4FS3A 1KBZA 4H7PA 4IJWA 4PVCA 5TRTA 2A94A 4DXHA 3I9JA 1YKFA 4YT5A 4CUZA 4M89A 3FD8A 4DWVA 5CEJA 5JW6A 6LDHA 3R3JA 1BW9A 2OP1A 3HN2A 3TQHA 3G1TA 5CFZA 1HL3A 2AEJA 3JD0A 2PA3A 3PJEA 3KZVA 4OXNA 2D2IA 4TQGA 1NVMB 4IPTA 3G1UA 4CV1A 1PJTA 2B37A 1JKFA 1PZEA 1LI4A 3D4NA 3MWDB 3ETDA 5C7IO 2FMUA 2YDXA 1E7WA 2BKAA 2D5AA 2BMAA 2VTEA 2ZCUA 1O95A 3RUHA 3S2IA 3FI9A 3A28A 2FWMX 4DYDA 5B4TA 4U7WA 1DSSG 5COQA 5KVSA 2DBRA 2IEBA 3RBVA 3UCXA 3ZNQA 5IN4A 1GR0A 4UAGA 4NBRA 1B16A 4GGPA 3PFWO 5BSEA 1F12A 2DUWA 3RASA 3S2EA 2QRLA 2PLAA 2ZK7A 5I9NA 3EGOA 4FGSA 4BNXA 5TX7A 4KZPA 1JVBA 3U4IA 4KDEA 3NUGA 4NR0A 5U4QA 5T5QA 3ZU2A 1E3SA 2GUGA 3CZMA 1Y8QB 3ZWMA 3NAQA 2C07A 4GX1A 2E4AA 4OIMA 4JQCA 2VTDA 2QW8A 4NI5A 1GCUA 2P68A 3DWFA 4XJSA 3PIDA 1SMKA 1UJMA 4DIBA 1JKJA 3BIOA 4MO2A 3TZQA 1ADGA 4IXTA 4JROA 3OJ0A 5COBA 3UAGA 1ARZA 4YQYA 3VH4A 2VT2A 4JJFA 1PZHA 4XJTA 5I9LA 5IJZA 2C7GA 2EG9A 4I08A 2GN6A 4UVIA 3GRPA 4RQUA 4D45A 1YBAA 1CQIA 5EMHA 4UVDA 3CUKA 3GVCA 1QSGA 1XSEA 5IXYA 4XQCA 4DLBA 5FI3A 4A2CA 4R5HA 2CFCA 4IGEA 4PLYA 2HMVA 4TRJA 3FTNA 1T2EA 4AJ4A 3IDSA 3H5AA 4II2A 4MIEA 4BKPA 2WEKA 4Q3CA 5EL0A 2Q1SA 3ASVA 2PGLA 1LC3A 4IM7A 5AXCA 4AJOA 2H5LA 4BGIA 4LW8A 4P22A 5HTOA 2OHXA 4PIVA 1CWUA 1X7GA 1GPDG 3C3XA 4O1MA 4INAA 3LZ6A 3KVOA 5A1TA 1R12A 4CMEA 1UR5A
chains in the Genus database with same CATH superfamily
3IQFA 1DKOA 4Y2HA 5JE8A 1G3UA 3JWJA 1A5BB 1D4ZA 2CKMA 4KIWA 1M1UA 1I01A 4Q9JA 1JX6A 3W5AA 3C8UA 4M9CA 3UK2A 3GMSA 4JLSA 4DBLC 5ADUS 5DGIA 4A9AA 4X1KB 5IZCC 3ZHTA 5IAGA 5F7JA 1S2IA 2BM8A 3W5IA 1O7JA 3I0NA 1Z37A 2VF4X 3X2FA 1KIAA 1JLKA 2YMQA 3H3XA 3SX2A 3VOTA 3G3EA 5JHHB 2DPYA 1CQJA 3OUTA 2HLNA 1IL0A 2IDKA 2CE7A 1G3QA 3LVBA 3PNBA 3PVZA 4TS4A 5ITWA 3KYIB 2CYAA 1A2OA 2MWMA 4OFZA 4PHGA 3RK0A 2R6ZA 4CUJA 3A8TA 2E4UA 2OXTA 4EVSA 3KHUA 3O03A 3BWXA 5FI0B 3OE7D 3HJTA 4D42A 3QVWA 4D9BA 2F3QA 1W0KD 1RC1A 2QNIA 3OAAA 1SQ0A 1TM1E 1L5HA 4MKZA 1W47A 5AM2A 2ATXA 2PWBA 1RRKA 4MQUA 2AMLA 2JI4A 5FBZA 2EIHA 4IJUA 3U44B 2C00A 1LX7A 3KV1A 2JFZA 3QOWA 4G26A 4E5VA 1GCIA 5GP1A 1NJ6A 1LC0A 2DWOA 3KQWA 2FPPB 1XZCA 2EX0A 4MJLA 2OCKA 1E1RA 1USKA 4B0OA 1E5DA 1XL1A 2OV8A 4LK3A 3ROPA 5I4IA 3OPVA 1CVIA 3HNPA 2FWIA 1EYZA 2B61A 2DTEA 4HN9A 3G89A 1V2HE 1BDJA 4JY7A 5ETJA 4BNMA 4YMTA 2IK8A 1KS9A 1CRWG 2NWQA 4IDBA 4LY3A 4NAVA 3PNQA 4C7OB 3W77A 1A50B 3FR8A 3M6WA 4Q9IA 3M3DA 4ZCMA 1ZRSA 1R9NA 1D8AA 1KI4A 5JBQA 2IYTA 1IB0A 1B0AA 1S3IA 1TF5A 1YMQA 2K6GA 2RGNA 2WUFA 3U31A 1UPXA 5JDCC 5D1HA 3FRIA 4EGCB 1QV7A 1THMA 4Q24A 5AM1A 2PXAA 1M7GA 1XQ9A 2I9KA 1ATIA 2YHBA 5KX5B 3HKCA 5CNIA 1AGPA 2BE7A 4FFMA 1YASA 4FFSA 3B6JA 4GVPA 4QGBA 1RRMA 8GPBA 1OXKB 1BHSA 1VXOA 1A1SA 5H02A 3N58A 3U7QB 3O8CA 4U5XA 1YAJA 1YULA 3T9BA 2ZUCA 1U0BB 1EX9A 2H1CA 3DMNA 2WVGA 4ZOQI 4FMDB 1O97D 1W4AA 5KYNA 1B8OA 3HYTA 4IMIB 2G6TA 4ZC8A 5JY1A 4F1KA 2I29A 3MWDA 1RFLA 4NYIR 4PZEA 3M4JA 4EKEA 2WWXA 5BXYA 4MARA 1JDVA 1XCLA 2ZSEA 1AMUA 3IQDB 1GYQA 2EJUA 3S40A 3DEJA 1YZLA 3K2IA 4MVJA 4CXMA 4CMKA 1C9MA 3SF0A 3GB9A 1FRNA 2JCBA 3ETLA 2VJCA 2N46A 3NBUA 2FV8A 2IHNA 4YUWA 1XTVA 3ZU4A 3WYAA 4HR7A 4BE7B 5T6MA 1KHHA 1FYXA 1QGOA 5FBHA 1HEIA 1C7ZA 4KFSA 1ZC4A 3B60A 1ZK1A 3LY8A 4Y2JA 3WWYA 1NR5A 3A32A 3NP9A 5FX2A 4KUEA 4TZTA 5G41A 3OP1A 1MPTA 2VQEB 1I5RA 5BO5A 1IJEA 3E1GA 4QYIB 1M10A 1VYTA 2JATA 1QZZA 3JALB 3LRXA 4G8DA 1KEPA 4MQ4A 2VHWA 5A3JA 3HJFA 4M98A 3U09A 4NAHA 1YOVA 4ZT5A 13PKA 4TKZA 5LU9A 3E7XA 4QLBA 3KBOA 3O7MA 4JC8A 3N05A 2H52A 5E1OA 3OP4A 1HRDA 1OC2A 4IIXA 4RVFA 2FF7A 4DCTA 4ZAXA 3Q6IA 2VS1A 4QKQA 2I3AA 4FR0A 4MV6A 3AL3A 4E5NA 1EFLA 2E7ZA 1DIGA 5IBPA 1T8RA 2RAUA 3A37A 3FMOB 3VO9A 5KQLA 4JGBA 4MYRA 1ZGGA 1ZX1A 1HE5A 1C50A 3RS9A 4AMBA 1LPMA 4QDJA 2W4IA 3Q11A 4FTWA 4UD6A 3PKIA 3SYMA 4D2IA 4QYTA 5JCXA 3HTXA 1LI7A 1PZFA 4MUMA 1DG1G 5J1SB 5J63A 4BFZA 2O8VA 3FXAA 1PK8A 1E1QA 2HMWA 1WBJB 3E0XA 2EP7A 1Z5PA 1TTTA 4N48A 2NADA 3WWOA 1A8UA 3I30X 3LQRA 4O2AB 1HH4A 4PQFA 4I4LA 3C5EA 3C3PA 4JBXA 1JB1A 4F9FA 2Q41A 1H2HA 3X2EA 1Q21A 1XCGB 3F90A 1DC6A 1SAYA 1ULSA 2YRWA 1FZQA 4MMZB 1LPOA 1XTZA 3MCZA 3U7RA 3GL9A 1V7QA 3WJAA 3T94A 3VZCA 3KQKA 3AZQA 4LHVA 4X62B 5DO9A 3HY3A 2BM0A 5KTRA 1A9TA 1SVIA 5ER6A 3MN1A 1N6IA 4FSDA 4M9ZA 5C51B 5DW3A 4YAIA 2ZUDA 3AJDA 1XVAA 3TB4A 3VH2A 4CMCA 1BKSB 1RHQA 3HLYA 1UANA 2ONYA 2VJMB 3FPGA 1N78A 1WQ3A 1E1KA 1U1CA 3D3EA 3EVDA 1ZD3A 2WE8A 3RSSA 2A78A 3T5AA 1BOOA 3V1KA 1UPFA 3G7UA 1M1NA 2ATVA 3KLPX 4RJJA 4YJGA 5ALTA 4EI9A 1P2VA 2YS7A 2F59A 3E9DA 4OMDA 4XYGA 3MUEA 3VDMA 5DM60 4ENRA 1QR6A 4L8FA 3DL0A 2R6FA 3K0FA 4MPRA 5AKEA 5CYPA 2D54A 1SRQA 5TMEA 4EQ6B 1P6UA 1NVBA 4C07A 1Q0TA 3BD7A 3J7AC 1Z88A 1C80A 5IASA 4G8CA 3CRNA 3TE7A 2PE5A 1XZLA 5ALIA 4ZVSA 3TOZA 2GPAA 4RIFA 2P6RA 4FJ0A 4KR7A 1GGVA 1P2BA 1L5FA 3TO5A 4XYLA 1HMPA 1VYHA 3ZHBA 1Y9DA 3DMYA 4XKJA 5T6BA 4B8YA 1W73A 4EH1A 2C98A 4EMSA 1N2CE 1TAQA 2FZGA 2J9XB 2XVXA 1LZLA 3Q3EA 4KG7A 4P4TA 5I5GA 5LOVB 4NZOA 4LF7B 1QCYA 2HIHA 4Z9BA 2DBVO 2OG2A 3OJCA 7MHTA 3PWSA 2A7QA 3DE0X 1FLNA 1SBHA 2YMLA 2PM8A 1XZKA 1V3UA 3TIIA 3DM9B 1VA4A 1Z8FA 4RADA 3AFIA 4QNRA 4IJVA 3GJTA 1ML3A 3NPMA 5ALGA 3Q7SA 5ALPA 3WGOA 3ZIUA 2A9QA 1MDFA 1MHPA 1ADFA 2PFGA 3UOGA 4GSLA 2Q2VA 3O8DA 2I7XA 4J1NA 2CHFA 3WIVA 3VPDA 2L2QA 3IP7A 1Q17A 3AJ8A 4QDTA 5LMNB 2WWRA 3UGKA 1OWLA 3AGQA 3EN0A 2P69A 1KJQA 2F7SA 5EHIA 2UZIR 2PS9A 2C99A 1E6CA 1VDMA 2X9LA 1PFGA 2VKQA 4JQOA 2JAWA 1RI1A 4HVCA 4NCAA 4CEIB 2G0AA 1SHJA 2ON6A 4CM4B 2JLZA 1D0IA 5HKKD 4B6QA 2ZPAA 4G0WA 3JASB 5DYYA 1P9WA 3HDYA 1DO8A 3K6RA 2XNSA 1RBQA 4ZO4A 1XNGA 2CCKA 3M1AA 2XE7A 5B3JA 5IBQA 2CXXA 1ZI6A 4M22A 5AP9A 5K8JB 8OHMA 1Z4QA 4GOMD 1UBTS 3OMWA 4Q3NA 3M4YA 4DF3A 3FVVA 2DZDA 1BHJA 3EQ8A 3BE8A 3QMPA 1LDBA 1WXXA 3KCQA 4R83A 1S7GA 4IVNA 3JWIA 3FR7A 1X8KA 2AC2A 4JOSA 1U2RA 2Q27A 3F7OA 2IOQA 4D02A 1L4MA 3EDYA 3R9XA 5EJ8A 3R6GA 3E7PA 3RNLA 2D59A 4BFYA 2RH9B 1JPVA 1C0LA 1U0OC 5GGXA 1IUKA 4O3FA 2A5JA 1XK6A 4PO8A 3RFTA 2G77B 1Y9JA 3B20A 1W52X 2GHQA 1GR1A 2Y4OA 4G5SA 3GLTA 2ONCA 1R8SA 3GAMA 3CZAA 3A2NA 3K32A 1XRRA 3MGBA 1S8NA 5TC4A 3X1WA 1NQOA 2QAGA 1S4MA 3AP3A 5EHNA 4OMFG 4RUKA 5BYKA 3RSQA 4TX1A 1ZGAA 2J3MA 3DFZA 1O96A 4KE6A 2FFBA 3M3HA 4MVJF 3UWKA 4M8KA 1ABBA 4ZFNA 2OESA 2JFPA 5EJFA 4KKVA 4PPFA 3BMOB 3ZE1B 3HJAA 4G1MB 3QX3A 1UK6A 2EZ9A 4FXPA 4E12A 4Q7LA 3RNOA 2K2WA 3NEPX 4COOA 1QQTA 2FW9A 3CLRD 4Y1FA 5HBRA 1WZUA 3PDHA 3RYHA 3KELA 4MV1A 3T7TA 4UZSA 4JXZA 1FYEA 3I05A 1W5TA 3DB2A 3GFPA 1WU8A 3EZ9A 1AQLA 4FFRA 1AGYA 3OEHD 1Z2PX 1FLVA 4DA0A 4F71A 1QFXA 2WJ4A 3A6HA 3FY4A 3H5TA 5CDGA 1MABA 1UFRA 4QL3A 4YP1A 5FRDA 1YIAA 1ML4A 4B1FA 1B1AA 3GLKA 5CPFA 4ZJPA 1IVSA 1TCVA 4DPLA 2FPGB 2WKSA 1KHTA 2YN2A 2GFQA 3R7WA 2BFAA 1HBJA 1L7AA 5KVVA 2DR2A 1Y42X 4W9RA 2HBZA 4PAWA 3OJEA 5EMJA 1WIWA 3REQB 4D4IA 5ICGA 2RGWA 4K9MA 1IU9A 5HUQA 3ME5A 3GZJA 1BH6A 3K72B 2BC9A 3FKSD 1E1LA 4C4PA 4DCNA 4ZVPA 5LZ2A 1OTHA 4GECA 4KL8S 3PIIA 3IUQA 4QUIA 3GUVA 4JR1A 4H1TA 5BMVB 3R3VA 4OXKA 1NBHA 3HY6A 2OLJA 4W1RA 1NY6A 1OBVA 4KQ9A 1E5QA 1GA1A 3RM3A 4QTUB 1LBHA 1OH7A 1JFRA 3REOA 1BS9A 4GR4A 2EDAA 3KKLA 2ZR9A 3DE2X 3MIZA 4N3CA 4OM8A 1JEOA 3U26A 4XIGS 4YQZA 3SIWA 4GYYA 4UXHA 3EA4A 1TMYA 1Z6PA 5J5AA 1LK7A 1I32A 2V0CA 5F77A 4YRTA 1R18A 2ZSBA 3F3SA 4Z4GA 1IJBA 3IPXA 1YZNA 4ERNA 4R2KA 1GNQA 2A33A 2EEZA 1PQYA 2VDQB 2ZIZA 4IIVA 2V6FA 2Y1FA 4QTXA 3W6UA 4O63O 5AVTA 4Z2AA 1ATZA 3UUGA 4XUCA 5EPOA 5F35A 4B4WA 3QVXA 4GEKA 4L6AA 5HIIA 1G16A 4IXWA 4IUCS 4BNGA 3FOCA 4WOBA 3R9WA 2IEGA 2BFFA 2Z8YM 4WGGA 4E5SA 1L7RA 1KZ7B 2OHOA 3LDHA 4DDUA 1RRGA 4LAFA 2IUTA 1IWPB 2MMGA 3VR6A 2FHPA 2DT5A 4D74A 5JVDF 1CUXA 4E4RA 5EVCA 5AJXA 2PGXA 1N7GA 1VE7A 3NJ4A 1A76A 2EV9A 3K8ZA 1L4NA 1R8YA 3VSDA 2C0PA 4NBNA 5MN5A 1Z2EA 2JCYA 3PYMA 4FI3C 2PUHA 1IBCA 1LQUA 1R4NB 4FNGA 3BWMA 2I6GA 3LQYA 2GR9A 3UB2A 3OWXA 1FSPA 2EKDA 3IH5A 3EZXA 3E2PA 4UU0A 2PRSA 4L7QA 2AGVA 1RWWA 4O2BA 4EVIA 1U8EA 3WYEA 1FTSA 2DH6A 2OCPA 3MJRA 2QTLA 2FEMA 1ZRNA 1QX4A 3E8SA 4DJFC 5C8VA 2MDTA 2PYIA 3MFYA 1H8HA 1SHUX 2OV4A 4QQFA 3O8QB 1YAHA 1DT3A 1DC3A 1OGYA 2WM2A 1MRZA 3BFPA 1JIQA 1SWVA 4YRBA 2BFNA 1MEJA 1ZA1A 3N0XA 1K8RA 4MKFA 3S27A 1G19A 2PS1A 4QSMA 5GAJA 3PGKA 1ZM2A 2WG0A 1RJ9B 1YL5A 3ULKA 1RQRA 1S2OA 1NBOA 1BU8A 1X9HA 2C2MA 2Z2JA 4W1SA 3D0KA 5EP2A 4OHYA 3RE1A 1YFJA 1GUYA 2H1HA 2M6SA 3HB9A 2XLCA 1HDZA 4RHEA 3I6ZA 2ERYA 3GN2A 3M4ZA 4QGGA 1GL9B 1T5SA 1AQNA 2B5OA 3F4BA 4JYZA 3HS3A 4MRRA 3MRSA 1VI2A 2ZJ0A 2ZCJA 1Q6ZA 1XEWX 4H7KA 3IUSA 2W2OA 5E2IA 2OZEA 2XHEA 3AR3A 5E1DA 3TEJA 3D6AA 3EGEA 3LPDA 4DMCA 2H5JA 1OI4A 3ZY2A 3IELA 3O4GA 1U0GA 1X80B 2CEAA 4XB1A 3TXXA 5CCXA 2IYAA 4RY8A 1AGNA 5F7ZA 5CPBA 4IWNA 2ZVPX 5BN4A 2DWQA 2CV2A 2ZPTX 2QSZA 4LJ4A 3QLUA 2ZBRA 5I7FA 3QXSA 4FM9A 3F5FA 1VBNA 1PNTA 1O95D 4ZT3A 5FIUA 1M6EX 1XEFA 2FP3A 4QECA 4Y2GA 2JI6A 1P1KA 4KHZA 4BVEA 5BT8A 2UZ3A 4CU2A 1QBGA 1J25A 4QU0A 5AVUA 2WMDA 2ZRQA 4IWXA 1KRXA 5K0GA 3HBNA 3LC0A 3HBFA 2CMFA 3PX7A 1EDZA 5ENDA 3RVLA 4Y6GB 3BRWD 3EOBI 5D2CA 3GPLA 4G36A 5BOSB 1DJPA 4MCAA 4K5QA 2FPMA 5DCUA 4CIVA 4DR6B 3QX7A 3WB2A 1XL0A 4GOJA 1T8SA 4KXUA 4BDSA 4J0QA 4AP5A 2QYSA 2WV7A 4X44A 3RRNA 2WUVA 2XUIA 4Z1MD 3K8OE 3CVYA 4DHEA 4LVOA 4MW2A 2BKUA 5AKKA 4E09A 5CFPA 3W90A 1P3JA 4DNFA 1RQ2A 3CC8A 3M7IA 1SVSA 3W1EA 3P4YA 1BDMA 2PXCA 2RB5A 2F62A 2P75A 5DHQA 1D4OA 4Q48A 5ALQA 4CQMD 1L1RA 5CVVA 5KKCA 4YO8A 2A9PA 2ECQA 4M49A 3TMYA 1AA9A 1KEKA 5FV4A 1FTWA 1WXGA 2EQBA 3T3PB 1SOAA 3KP1A 4HAUA 1QGZA 1YWGO 3LO8A 5L45A 3RU7A 4G67A 1QP4A 4DYVA 5AM4A 5SZKB 3PJDA 1YDMA 4X7BA 1C4KA 4FHGA 2NPFA 1VG8A 3V5NA 2ETXA 1Z82A 1LK5A 1ADBA 1T1RA 1H1TA 2IF0A 1V43A 4ND5A 4Y9SA 2VSNA 2Z5LA 3NIFB 4DR2B 1P7WA 3OCVA 1L4YA 3NIWA 3NV9A 2JD1A 2PEZA 3HA2A 3L07A 2RKWA 1XDZA 3NHFA 4AVYA 3N8KA 1Y4DE 3CSUA 4I2VA 2GCIA 1XV5A 3BFJA 3I01A 2GCGA 2XNKA 3FNGA 4OL0A 1U5BB 3NUQA 4YXWD 1DBRA 4UUQA 1ZM7A 5GONA 3CMCO 3UFBA 3AIKA 2OCLA 3FOWA 4IQFA 4D0NA 4FFWA 4YCCA 2IXTA 3VNVA 4GGOA 3PQ3A 4X66B 5FWYA 4KB5A 4IHAA 4QHTA 4EI7A 5JNTA 3KDPA 4D25A 2Q3BA 1FNNA 1E2IA 4OHMA 4P7JA 1E8MA 4OBXA 1RYNA 1ZOIA 5JZ9A 2ZYWX 4S05A 1ZAYA 2OE2A 3MJSA 3I9NA 4WJKB 4OK5A 1DB3A 3U3ZA 1GZ6A 3AHGA 1KJYA 2G9VA 2UZ1B 5JZVA 2PCLA 1E60A 1W2GA 2WSMA 4NK5A 3SR0A 3JQQA 3ZYCA 1C3OB 2E49A 2XD4A 3ORSA 4QELA 5DPMA 4ZGBA 3G2HA 2Q99A 3PQDA 3CLTD 3D02A 3NX4A 1UQRA 3HYNA 4TRRA 5E3HA 5KVCA 4I5GA 3NDIA 2PX2A 3EPLA 2CLSA 5D5HA 3NEJA 4HVAA 2CNWA 3VR4A 3IOEA 3FUUA 3L8CA 3OBBA 1M5TA 4CM6A 5JZOA 2BIFA 1Q1GA 2R2GA 3L49A 3U48A 1ECPA 4WJLA 4UBIA 3HKEB 5JROA 5H59A 2GZDA 3UMFA 3MAAC 1EFVB 2NZWA 4B6PA 1PW5A 2YDYA 3COSA 1Q0QA 2CLHB 3H2KA 4KN6A 5CX1A 4KX3A 1SG9A 2Q5HA 1QAMA 4M9RA 4WINA 4PZDA 1NKSA 3BTVA 4QUAA 3ENQA 1L5VA 4XD7A 2WD7A 1YI8A 2HGZA 1CHDA 4GMKA 3DJFA 5AHXA 1LW6E 4UUMA 5E6RB 2XKKA 2HBQA 5JWRA 3K4HA 5CA0A 1AA6A 1M2FA 1BDIA 3S2SA 4TKLA 3J80A 1MP0A 5LQJA 1W88B 3WA6A 4O2BF 1KYZA 4PSCA 4R51A 3WAKA 2FN8A 1U2TA 4FC6A 4BVBA 1FP7A 1W1WA 5KNDD 1K6IA 1LJLA 4YMGA 4DWJA 3FH0A 1VSQA 4F8JA 2O3UA 4PYLA 4DSNA 4BDTA 4ZMSA 3I2JA 3HR8A 3B6KA 3CEJA 1T2VA 3DDSA 1PBTA 1DEHA 1FFGA 1MUUA 2PQ2A 2WD9A 3STUA 1CR2A 1I0ZA 5K6TA 2CLIB 3QE0A 3D4PA 1SY7A 3SHWA 2IZZA 1GN9A 4JBLA 2X1HA 3BOSA 5GVRA 2VWQA 5K51A 5JTTA 4NJOA 2QQ5A 2ZQ5A 1DIOB 3SS9X 5AMXA 1EUCA 5D6NA 1DIAA 1UOPA 3CJTA 2Q9AA 4PXYA 5DBFA 1XP5A 2V96A 1JDZA 2ERXA 3WGQA 4F8EA 1XWWA 3BB4A 5G0UA 2C5EA 2XGJA 4H0NA 3VBCA 1E2BA 3ONFA 1WW8A 2BF7A 4X6XA 1JS1X 1BA3A 2G08A 1TXGA 2JL1A 3GLHE 4QBTA 4A23A 1RACA 4CF5A 5EJ9A 4NFSA 4PR3A 5C31A 3UC9A 1OB5A 3N86A 1E64A 4UHEA 4AXXA 3M6XA 2BFBB 2MOKA 4TMYA 3NRCA 3HCAA 2B30A 2O52A 2CY0A 4LTNA 1E9SA 3QVJA 4JP1A 1F2DA 1W93A 3T5CA 5BN3A 1BJTA 4BMVA 3RYTC 2JJQA 4EARA 1S9DA 2AZMA 1IBRA 1FU7A 2CNOA 3HRIA 4Z54A 4ZRNA 4IILA 5DRYA 7ADHA 4IHKA 4UTRA 3FOFC 1R3DA 3B38A 4YJ3A 4D9GA 1RXCA 4O1HA 3T41A 4AJ1A 1FYFA 1PHPA 3AGPA 3NATA 1KMNA 4HGYA 1GWNA 2ORIA 5CYGA 4ZC1A 3UQYS 5B57C 3QENA 2WHYA 3Q3HA 1JR3A 2J31A 3GK3A 3IPLA 3KOOA 4UAVA 5EGSA 3TF5A 2XKAA 3AKEA 2GEKA 3ILVA 1I13A 4AC9A 3DAHA 2ZUSA 4PCUA 1W85A 2X2OA 3I0MA 3FETA 4XX1A 5CXQA 1K06A 3QOFA 4RA6A 1A5SB 1B42A 1ZLYA 3L01A 1VTKA 4FVTA 4ZVVA 3CZ4A 3RODA 2CBXA 4FBLA 4EJMA 3ZD6A 4WT7A 3EAQA 2IXAA 4CLEA 3HP7A 4Z0TA 3AR8A 1IG0A 2C04A 4WCDA 3ELBA 4FYHA 5KYYB 2WTNA 3LPAA 2G04A 3GVPA 3JRXA 4OMUA 2X0DA 1NU6A 4WUTA 1ONBA 4R8LA 1PJSA 2AQIA 1MPXA 3LQ2A 2DQSA 1JLSA 1VSBA 2A5FA 4ZZIA 3UXYA 1OROA 1REQB 1XZQA 2P3LA 3NHLA 4P4UA 2EAUA 5J2TF 2HPZA 2O9JA 3P0IA 1F5NA 1E3DA 3KDAA 4R1NA 4V0SA 3WHIA 2GN2A 1QHYA 1H66A 2GXQA 3L2OB 3QH4A 3TI9A 1CDEA 1NXQA 1GY8A 5IKMA 4WACA 1J8YF 3B8HA 1EFHA 2O07A 3GEEA 4I36A 1HG1A 3EFOB 5DYIA 2JIMA 3RSZA 2FFQA 4Y2QA 1QOQB 2APJA 1KJNA 1O77A 5L7TA 4BASA 3FHLA 5DEOA 3UJPA 4V2UA 1QRTA 1EZ1A 3EZ6A 1PJ4A 1IUPA 2VN8A 3IEMA 5EG5A 5IK2D 3CO0S 4IQ8A 5JATA 4FFNA 3E7FA 1PJRA 1KVUA 4YJFA 2JCXA 4CKEB 1P0QA 1O08A 1V2GA 5LNK1 3SDSA 1T5TA 3I45A 3L8EA 1RAIA 2WWTA 3EFBA 2CDNA 3LJKA 2IV7A 2BFEB 3TLCA 4DMFA 3J81k 2WQ7A 1E7QA 5DF1A 2VPPA 4R8SA 5H1YA 1L8XA 2GM9A 1SA0A 3RTGA 1DU4A 1PN3A 2OXFA 3H7AA 3L1IA 3NFRA 3P0JA 2HA4A 3NTVA 3FTFA 2PMEA 2Z9CA 1GPLA 5F2KA 3AUXA 5DNEA 1JG1A 4LGCA 1ZSYA 1XMPA 4CTNA 5FNVA 2J4DA 4L85A 4UM5A 1D09A 4MWGA 1J8VA 3EZLA 3GRFA 3P97A 3VZPA 4N6OA 1PHRA 2CKDA 2GS9A 5CNJA 3T3EA 4DSOA 2VHXA 5C8YB 3T95A 5E38A 1WLSA 4TLBA 1A8SA 2FFRA 2AG5A 4HDRB 4IIJB 1V8PA 2IY9A 2F55A 4OA5A 1IHUA 4BX3A 5DTEA 2GZSA 3CTMA 2WMNB 4RVNA 2GZMA 4AJ9A 5JBNA 1WXQA 4HNUA 4DV5B 1MLDA 1YS1X 4OK3A 4Y1RA 4DQUA 5JJLA 1HX7A 3JYPA 1AS3A 1QZ3A 3RAJA 1UFQA 1J70A 1Q1NA 1Z0IA 1R9MA 2IPOA 1M6VA 3H9JA 3KTAA 1V95A 2GBGA 3F3YA 4HWKA 4TL7A 4V02A 5EJMA 4C7MA 4DCOA 1JWAB 2C2XA 2PGDA 3OD1A 4EI2A 1U4OA 1UM9B 1XB2A 3NAMA 3GEMA 1GAJA 4R54A 5DIZA 1QM5A 3HDTA 3S68A 1NI5A 3RFXA 3JQEA 1SBQA 1TVKA 1QMGA 4GFDA 2W00A 1FP6A 4RCYA 4YRFA 5CA0F 2GBIA 1NBAA 4LZZA 4ZQEA 4JC5A 2NW6A 5SZIA 4Z51A 1V4NA 3V4LA 4IEIA 3ZQJA 1PFYA 2XZTA 3IGFA 4KXLA 3CX8A 1KOGA 1QC5A 4TRMA 3TYXA 2QRVB 3THWA 4I3HA 1FC0A 1W36D 1RKUA 1IBSA 1KK3A 2O8DB 3ZU3A 3PPXA 5EYPA 3UKDA 2WAXA 4ZEMA 4YMLA 2J09A 2QTMA 3QKSA 3GWGA 2D1SA 1KZ4A 5BQPA 4A0FA 1ZXXA 1VKNA 3EHDA 2P65A 3DA8A 2W6JD 3ABRB 2IX9A 3INRA 1SVWA 3PHIA 1N8SA 4QQ8A 3USCS 2Q4TA 4MQEB 2W2KB 4MH0R 3REFA 3GGOA 2PVPA 5CJ2A 3T38A 4A5OA 3LCVB 1UOQA 1RP7A 3T4UA 1GRQA 3H42B 3PLAE 3LVQE 4E13A 4AW9A 5E2BA 2R6JA 3GCWA 3L7YA 3WJ7A 1MQAA 3ZIAD 4DC0A 4U3JA 2B69A 4KXWA 1U9IA 2Y27A 4WECA 2Y1EA 3BD9A 2MYUA 4WBXC 3NEYA 3FDZB 4R7GA 5C5IA 3H9QA 4P4GA 4A1FA 3OO1A 3MHPA 4B6RA 4GOND 1LK0A 1RRFA 2BGKA 2FSVA 4KQ2A 3L7IA 3FX2A 1M73E 1T13A 3ZY6A 4YECA 3F6CA 1NXXA 2EBWA 1IHPA 2YYZA 5ALUA 4TTTS 5GPBA 5ADHA 1G0OA 2H4FA 5IUNC 3FTEA 1KEZA 1N5OX 1Z17A 3GFRA 2XDQA 2BV3A 1IY9A 3VKWA 5J2UB 5AVYA 3GPDG 1Z39A 1H0KA 2NTVA 4J6EA 4NJMB 3ONVA 2XUZA 2ZKIA 4RPCA 4ITUA 2LCQA 1PCXA 2YBEA 3JARA 1L1EA 3KSBC 4YJ3F 1IPFA 5EEGA 1K68A 2V54A 1YL6A 2PGIA 2Z8YA 3D8SA 2CUKA 4B6OA 3NQ41 1KGSA 4JCCA 4URFA 2PD4A 5LPNA 3ITDA 1GZ7A 4BVJA 3MRVA 2ZYSA 1GVNB 1WA5A 3DBVO 2PMKA 3QLEA 4Y6SA 1RWKA 5ALKA 3SS7X 1M66A 4DEVA 4E1BA 3Q2IA 4O4JB 4CM7A 2SCUA 4OFBA 3JAMA 3JAKA 2PUVA 3HNRA 3I4LA 1N5MA 2HRDA 4IVQA 3ZY5A 4BO9A 5K5EA 2BBWA 4HRVA 3FW1A 2C5HA 4KBGA 4LVNA 2VTKA 3IIKA 3L8FA 3PJGA 3OZ7A 3R09A 1QUFA 4JVMA 1PVOA 5JYCA 2GILA 2ACEA 1E79D 3H13A 1EG7A 4PLWA 2QTRA 4I1YA 4KXQA 2ZRPA 5EJIA 1NAIA 1YC2A 3U2QA 1V5FA 4AWAA 1CUEA 4M7PA 1GUZA 3U4DA 5FPYA 4KPEC 4EUSA 3DBOB 3DMPA 1MVNA 4FCTA 4OHPA 4RQAA 3QVUA 1HM5A 1WSDA 3N0VA 3QVLA 1E4YA 4GVXA 4KMSA 4WESA 5LMUB 2XODA 1F1JA 2C2GA 4OGKA 5AO9A 5I7HA 1ZSVA 3K0BA 4P34A 1YMVA 5FADA 3DDUA 3MELA 2JKVA 1HL7A 1Z0ZA 2A9OA 3C1TA 1Z4MA 3D6FA 3ELYA 4O08A 3BJMA 5FUWA 3SLRA 3W8NA 4CPDA 2VA8A 3A9SA 1TKRA 4AIRA 2HK8A 3HUUA 4L08A 1G21E 2LDXA 4GMFA 4DC1A 2XHZA 3LYUA 3ZD8A 4PFKA 2AYZA 1M1YA 2PUJA 2EJVA 2EVWX 5FBLB 4YBZA 1M8JA 1D1TA 1Y81A 1UT5A 1NP6A 3N59A 1RMQA 2HXYA 4FZJA 4I9NA 1MTZA 4D1YA 1MJHA 4FCCA 4YWHA 1S2DA 1N32B 5ALZA 2RGNC 3VR0A 3FZQA 1JFVA 4Z7JA 1FOEB 2ESRA 2G1KA 2J3IA 4M0KA 4MS1A 4RESA 1K4YA 5T3YA 3FCEA 4PGAA 2O59A 2QPAA 4N0EA 1CCWA 5AW6A 4NU8X 4YVFA 1FX0B 1OLOA 3MT7A 4E2YA 3GY0A 4DBVO 4F86A 1AXRA 4LSGA 3VJMA 4QFDA 2ZXEA 1LSUA 3OQVA 5DZSA 3G8AA 3EXAA 4HATA 2PXXA 3RJTA 4HPJB 3GLFB 5FNVF 3SKVA 2Y1XA 5E6UB 1YZQA 2FUKA 3CEPB 1W581 3OOYA 2R2AA 4S0ZA 1IY1A 3WI7A 3ICCA 1YUBA 4TV8F 2HHJA 1T5LA 2ZDGA 2GZHA 3A25A 2BR3A 1XKXA 4GG1A 1DIRA 3K0CA 2I6TA 3W7AA 1J06A 4IIGA 4YUYA 4HEHA 3ADKA 3E3AA 4HLCA 5FAXA 4JKOA 2NU9B 3RUIA 4A6PA 1EBFA 1P4SA 2D00A 1DBPA 1XMIA 2YHIB 5DWDA 1SIOA 1Z38A 1C3EA 2HCRA 2UAGA 2C9DA 4JT4A 2ZB7A 2O50A 3R7AA 4RMIA 2JLVA 2H00A 4YJHA 1DEOA 3BGDA 1YCDA 1O9BA 3LYAA 3M89A 1ACLA 1ONPA 5EMNA 3SNHA 4BVGA 4EELA 3LY7A 3ZV3A 3HEBA 5DTIA 4B09A 1EE2A 2BEUB 1JDTA 3LKZA 3R7DA 1ZIYA 3D8NA 4GR9A 3L92A 4FHZA 5BSKA 4BLOA 2KLBA 1KZGB 2RGAA 3QX9A 4AN4A 4HDSA 2YWCA 2XYHA 1PJCA 1L6RA 4I8IA 3OPYB 4OX9Y 3EJWA 4V1CA 3OQ1A 1EEHA 4YO7A 3JQRA 3AZPA 1E2KA 2GAOA 1IPEA 3TLBA 1UWLA 1V7CA 2B8NA 4WZZA 4YRJA 3K1JA 4HH4A 5CR9A 2P79A 5AYVA 3UFXA 1VXRA 1WXHA 2CVQA 2R44A 4GNKA 3EZYA 4HSEA 3NGMA 4H3HB 5C2JB 3HMKA 2FUNB 1UWVA 1UP7A 4MI3A 4HB4A 2EW8A 2ZS7A 4GLOA 1WHTB 1X38A 1WAMA 3OOWA 2P2LA 4HNAA 1E2FA 4GRAA 4LRXA 1JLHA 4N9WA 4O5AA 5BWBA 4R2XA 1AURA 1NP7A 2GT1A 3UICA 4HRAA 4DIOA 2HUPA 3EUAA 3KO8A 5BN5A 5CLQA 2R1ZA 2HQOA 2EWVA 1EXVA 2QL9A 1EBBA 1VB3A 1L5GB 3RTCA 4Y0VA 4JJGA 3I5AA 4IXDA 1KAHA 4O4IF 1EVIA 4TLLB 5B1YA 4IEFB 3LHSA 1M0EA 3U0BA 2PSEA 2FUCA 5K3SA 1J07A 3B85A 4RBNA 1IY0A 4ENPA 4Y9RA 2XIJA 3OCZA 1EFKA 2IEIA 4HK4A 3HZRA 1FMFA 2JGMA 3GP3A 3RRJA 2BDUA 3HXQA 1L4EA 3OETA 4E3WA 3PUVA 2Y77A 3LUDA 4YNBA 2F4VB 2QUZA 1E69A 1JTVA 1L0BA 3GRYA 4K9RA 1K5HA 4V03A 1HEUA 2ZBPA 3R3WA 1ORVA 1YRWA 2AWNA 1VPDA 1FYDA 1VE9A 3NTUA 3WWCA 1A97A 1OSNA 4HMPA 3NHAA 2G28A 5K8VA 1CULC 4TUYB 4BRUA 4ZAFA 1W0JA 3BIXA 2CXPA 2IJGX 4ILEA 5F5XA 1XN1A 4AICA 1N4AA 3H19A 4X20A 1KF0A 2VP2A 1ZJ6A 2A9JA 2MSEB 2V97A 5IF3A 1RXYA 3DLHA 2JK0A 2C77A 5BV2P 1HQKA 1KOFA 1U6KA 3GFSA 4HQRA 4KE7A 3DZ8A 4MRVA 4N3GA 3W5CA 1OXUA 4QPDA 4YMSA 3NWEA 1JKJB 2I2BA 3GROA 2X4GA 3H9BA 3RCBA 1ZCJA 4NCJA 4QE3A 5DULA 4C89A 5L3QB 4MJ3A 1GZDA 3QSYA 3N6RA 1LA2A 4MDYA 3IVXA 2Y67A 1V6SA 3FFAA 5HF5A 3A2KA 3DV0B 3LRTA 2V58A 1YR7A 3H3FA 3BQMB 4N18A 1Y48E 1M2NA 2H1LA 4B3HA 4OI1A 1YBMA 3H1TA 5C0OE 2RHJA 4MVYA 5EIXA 2ZAOA 5ABPA 2A3RA 2YVAA 4QEDA 5BRAA 3UVEA 3VR3A 1M72A 2GJ9A 4EI8A 3N8IA 2W2MA 1UDXA 4IIDA 4QVKA 2X2PA 2PZLA 3KKKA 5LCXA 1IRIA 2QF7A 3TZKA 3G9ZA 4K3UA 4ED9A 2YV3A 1Y4SA 2EFEB 2XUFA 4H4DA 1GPJA 4BWVA 1H5QA 1LF5A 1WXFA 3O82A 4IDEA 1PT5A 2OSVA 5MHTA 4PRYA 1QQ6A 1HXHA 2PAAA 1EQUA 3RWOA 1RKQA 1U1EA 4TLEA 4Q03A 2Y1GA 4BO3A 4ND8B 2ZRIA 3TLEA 1Y6QA 2I7VA 3K9LA 3CW9A 1TZ2A 3EOZA 3NHPA 4AG3A 2WUGA 5ICCA 5JD6A 5JQGA 1KAQA 2NO1A 4LPKA 1AK9A 4A5SA 4CKBB 3OFJA 3PEWA 2VOJA 2QRUA 4UBMA 4DCPA 1G2QA 4LOHA 5B3JC 2V1UA 2QI9F 1NLFA 2DCUA 4WOPA 3HVIA 1E9DA 3H0KA 3ORQA 5EJGA 2JIBA 2BEKA 2HGSA 3B12A 4UHFA 5DHPA 2NYVA 3H9EO 621PA 1SUWA 1FDSA 1RXEA 2V74B 1RNLA 5HWSA 5JO9A 1VI5A 4MWBA 1BN7A 2E6UX 2VJOA 4EJ2A 1RS0A 2XNJA 3B2QA 2C8LA 3JYLA 3LCMA 2FEAA 3G0GA 1CQJB 5DHAA 2H4HA 4F2PA 2NX2A 1WL8A 2ZYHA 4LFCB 3A26A 3KOZA 4S04A 3ZKAA 4XVRA 4EO7A 3ZHRA 3W9BA 1SZCA 1CLUA 1DKUA 1E2DA 1P6XA 3KJIA 4BMCA 2SKEA 1SXJD 3GIDA 2XQVA 2OV1A 1V5GA 3LUGA 3Q2OA 5BPFA 5JFGA 5I7SA 4QODA 2H63A 3EVNA 2GOYA 4BN0A 1L5HB 3AV0B 1Y3CE 3MUFA 1XZIA 3SYTA 3WFZA 3MJHA 2HK9A 1ABFA 2CLMB 1DTSA 2OBFA 2VSXA 2ZE7A 4M0MA 2Q6LA 5AQEA 3R7NA 3AW9A 5FCDA 1JE0A 1P17A 5K05A 4K9DA 4NZPA 2XMDA 1ZK0A 5KC8A 4YMIA 4QYXA 3V4RA 3NJ8A 1H0RA 2H0QA 1HYHA 3A4IA 1LWNA 2F3SA 3WDSA 3BBPA 4CETA 3BMNA 4Z53A 1MJNA 1ODFA 2EP5A 2ZJZA 3QVOA 4N8DA 1U7PA 4RPGA 2NYUA 2PDAA 2WLTA 4YP9A 3FZYA 1UQTA 1DAPA 5LP6A 1IBLB 3JXEA 1QG4A 1OPXA 1YRBA 2OQRA 2RI1A 4QREA 4TSRA 3WMXA 4JI2B 3AVOA 1Y3BE 3L0SA 1T0UA 5E8JA 4DQKA 2XRYA 2RBEA 2C4KA 1QO0D 2P9CA 1KGDA 5JEEA 1E94E 1O6CA 4MA0A 2F8TA 2C2BA 2PKQP 4KYIB 5BQOA 5HK9A 5JRZA 2LP4Y 1PGQA 2WT9A 3NKFA 5ARDA 3O0DA 1WOYA 3QUAA 4J1QA 3RSGA 4YFYA 4NL4H 3NDPA 1MH1A 2VHEA 4NU0A 3W7VA 3HKCB 2HUNA 1VM6A 4F9EA 4UJ5A 2FTKE 4HN2A 2KBFA 2DMRA 3V1LA 1O57A 2XY4A 2Y66A 2ZJ3A 3CE6A 4HAXA 5ALSA 5TQ2A 4YDQA 2EKPA 3VYSB 1KXZA 3CUUA 5ELMA 4WMLA 3TXYA 1DEXA 2GRUA 3ADPA 3AY7A 1DBQA 4KZKA 4XGQA 5LZ5A 3PU6A 3KS9A 5AESA 2IHTA 2BONA 4BGVA 5IVPA 2YXLA 5EZYB 4MMXB 1SIUA 2IHYA 4KACA 4QD3A 4GKAA 4BBAA 3H17A 2QV7A 1FDIA 3PA6A 3PHHA 4YJ2B 3P7MA 3KD3A 1T9GS 3P2KA 4F97A 3RREA 1MQSA 2J4CA 3HB5X 3JZMA 4PFQA 2ZW9A 3U49A 3WL6A 4ALKA 4NNPA 1PJ3A 3I62A 1M83A 4RJTA 2PUDA 1T1GA 4JJKA 4MWSA 3K73O 4NLLA 4FZ3A 4QGHA 3RKRA 1UBFA 3JWHA 3AJAA 2ZE6A 1TYDE 3CEHA 4DW8A 4M1MA 5LQRA 2FDXA 1XZMA 2FOLA 2I7TA 3EW9A 1U0NA 1V3VA 1T25A 2Q3MA 3GZ4A 4OHUA 1KORA 2WIDA 4ZZ1A 1AG9A 4FWBA 1I3NA 4KO8A 1SC6A 2VT7A 1NPDA 2VDNB 2QXTA 2XE8A 2ZWOA 1HOTA 1I1OA