4UEJA

Closed state of galactitol-1-phosphate 5-dehydrogenase from e. coli in complex with glycerol.
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
346
structure length
346
Chain Sequence
MKSVVNDTDGIVRVAESVIPEIKHQDEVRVKIASSGLCGSDLPRIFKNGAHYYPITLGHEFSGYIDAVGSGVDDLHPGDAVACVPLLPCFTCPECLKGFYSQCAKYDFIGSRRDGGFAEYIVVKRKNVFALPTDMPIEDGAFIEPITVGLHAFHLAQGCENKNVIIIGAGTIGLLAIQCAVALGAKSVTAIDISSEKLALAKSFGAMQTFNSSEMSAPQMQSVLRELRFNQLILETAGVPQTVELAVEIAGPHAQLALVGTLHQDLHLTSATFGKILRKELTVIGSWMNYSSPWPGQEWETASRLLTERKLSLEPLIAHRGSFESFAQAVRDIARNAMPGKVLLIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GALACTITOL-1-PHOSPHATE 5-DEHYDROGENASE
publication title Enantioselective Oxidation of Galactitol 1-Phosphate by Galactitol-1-Phosphate 5-Dehydrogenase from Escherichia Coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 110
structure length 346
sequence length 346
chains with identical sequence B
ec nomenclature ec 1.1.1.251: Galactitol-1-phosphate 5-dehydrogenase.
pdb deposition date 2014-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4uejA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4uejA01
2WE7A 3DC2A 1I2BA 4J6FA 3GVPA 3FR7A 4W82A 3AM3A 1RKXA 3ORFA 2Q4EA 4JBHA 1QRRA 4GMFA 1H9BA 3CZRA 1PGPA 3KYCB 3A14A 1FDTA 4MP3A 3NEPX 3RUDA 3DZKA 4WCDA 1MFPA 4DBZA 1Q1NA 3ZV5A 5HM8A 2PTGA 3V1UA 3GZNA 4CUKA 3ENNA 2NU9A 4YRBA 2JFHA 3JQEA 4CR8A 3OETA 3WQRA 1E3WB 4IJKA 2VWGA 4IY1A 4OIMA 2H63A 4UULA 3WXBA 1WXDA 4Z0HO 2X86A 3AY6A 1C1DA 4J2OA 4Y67A 3RU7A 1DHTA 3RROA 2O3SA 4ZRMA 4C4OA 3ETGA 2QRLA 2ZATA 3C1OA 3D7LA 1O6ZA 1BGVA 2DKNA 5ICSA 3TFOA 1LA2A 4M89A 1NXQA 3ZNQA 1OFGA 4D3FA 4CMKA 4RL6A 2Q2QA 4FSHA 3S2IA 3ZV3A 2EW2A 1U3UA 4Z9FA 1UJMA 1XELA 5TNXA 3U9LA 5LC1A 4CMBA 3DR3A 3ZU4A 1YB5A 1KIFA 3WX0A 5F3RA 4GL4A 3FBTA 1KEUA 4M1QA 1RWBA 3INTA 2DAPA 4R1SA 4CM5A 3MOGA 2EHDA 1D7OA 5AXAA 1Q0HA 2P4QA 3WQSB 2AQKA 3BYZA 2Q99A 3GY0A 3WLFA 4YAKA 1IPFA 3WOHA 1T24A 2PZKA 1BW9B 1DOHA 5I9MA 1PS8A 2R2GA 4L76A 5DF1A 4Q39A 2HUNA 5ER6A 1PZFA 3TZCA 2NNLD 3FPLA 1IUKA 4I5DA 2VNAA 3I4FA 2JFGA 3EVTA 2VYVD 3K73O 3JQ8A 3TZKA 3GFGA 1QYWA 3I52A 5CAEA 2X23A 4IDDA 2QIOA 5TF4A 1WZIA 1I3NA 4Q3AA 1IOLA 5JCJA 4R3WA 2NADA 4HV4A 1KY4A 2A94A 3E5MA 1JKJA 4FS3A 2QX7A 1C1XB 4O63O 5JO9A 4E32A 3K2EA 2RH4A 1ZK4A 2YJZA 4J7XA 2PZMA 4B7CA 4Q3BA 3QA9A 3PYXA 4YBZA 5JAZA 1KEPA 4CR6A 1X14A 2YDYA 3BA1A 5T8KC 3VOSA 4G5HA 2DBZA 3K31A 4YEDA 1TB4A 2I6TA 3KV3O 2NVBA 3S55A 1SC6A 4WPGA 5KIAA 1NHGA 1Y5RA 3VZSA 1SB9A 4U5QA 4BKQA 3ABIA 4LMRA 4XYLA 3Q0EA 5IN5A 4JROA 4XIYA 1ISJA 4UUOA 1GFSA 3JQBC 4XB1A 2XPCA 5BNFA 3JQ7B 3RKRA 3IOYA 3OEYA 5JC1A 4CV0A 3OM9A 3A4VA 3QP9A 5GMOA 1XQ1A 3DZBA 4E13A 1FDSA 3RUIA 1Y5MA 2YQ4A 3Q2IA 1VI2A 3LC2O 1T2DA 2E6UX 3FTPA 1GZ4A 4ND4A 2GN6A 1GUYA 1ADGA 5G0SA 1FJHA 3DOOA 1R4MA 4GX2A 1LNQA 3RC1A 4E2ZA 2X5JO 3E18A 3MJVA 3IDSA 1GEEA 1NWHA 3HWRA 5EIOA 3GRPA 3BMNA 3KB6A 1PQPA 1V6AA 4ILKA 1KC1A 5JNLA 3HB4X 3ONFA 1BXZA 3WB9A 4R5MA 3V5NA 4NG5A 3L07A 1GV0A 4FW8A 2EG9A 5IFLA 2PZLA 4AJ4A 5G4LA 7ADHA 1N5DA 4WASA 3GG2A 3NJ8A 1MLDA 8LDHA 4XQEA 2Q46A 2V6GA 2NU7A 1JAYA 1K5HA 3JQ9A 2IEDA 4PZEA 1YRLA 2SCUA 4IZIA 2WE8A 3VC7A 2VT2A 4TRRA 2Z5LA 4D41A 4EUEA 2Q1UA 2CNBA 1XSEA 3SBOA 1Y8QB 4BNKA 4N7RA 4GBJA 1GR0A 2JCYA 1ADCA 3R3JA 4Z9YA 3S2GA 1B7GO 5TT1A 4RDIA 3O8QA 3DB2A 4WGGA 1U5AA 2FSSA 3D0OA 5C3MA 1T2FA 2GLXA 5F21A 5DBIA 2EEZA 4UAGA 3U4DA 2C59A 3S2EA 2BH9A 3GVIA 4E4YA 1YL5A 3HJAA 1CQIA 5JE8A 2V65A 4E5MA 5DP1A 3JQCA 1AGNA 4WLFA 4DQXA 1GADO 4BO9A 4CLOB 3PP8A 4QFCA 4GX0A 2HJSA 3SC4A 3JD2A 3ZHZA 3HQ4O 3UXYA 4PLPA 5BSGA 3TSCA 4ITUA 4KUEA 1SOWA 3V2UA 2FRDA 1P1FA 4RLSA 1UH5A 3EYWA 4JP2A 1JTVA 4AJOA 1GUFA 1EK6A 2W4QA 1D1SA 4MPDA 4EITA 1PGOA 2E37A 3DZGA 2HMUA 3KUXA 2JCVA 3PYLA 4LVCA 1ENYA 4YJDA 1H9AA 1IB6A 4PVDA 4UVIA 1DJNA 3UCFA 4J4BA 3GH3A 1B0AA 1JKIA 2G1UA 3PWKA 2C07A 2JD1A 1C1DB 3OIDA 3F1LA 3UKOA 3AU8A 3ZWBA 3C1TA 2HRZA 3DFZA 3OIFA 4XQGA 5DOVA 1DBVO 1HRDA 3ITDA 4PRKA 1C0LA 3VHRA 4FB5A 3V2HA 4Y9DA 2UAGA 3HN2A 3BTVA 2JHFA 4PVCA 3VH3A 1T2AA 4TVOA 3STHA 2E4AA 2B83A 1DLIA 3D3WB 4U6QA 3RU9A 3LK7A 4OXYA 2FPIA 2X0RA 1WMAA 1AUPA 1G1AA 3JYOA 4HUJA 2OP1A 2VYVA 4NIMA 1P74A 2J3KA 3CIFA 3OJEA 2D2IA 4DPKA 4G81A 3MTGA 1MXFA 3Q11A 4R5HA 4CM7A 1IULA 3F9IA 3GAFA 1SNYA 3H4VA 2O7QA 1BG6A 2GF2A 4QQRA 2AQIA 3C24A 3F4LA 3NT4A 3UVEA 4JJFA 4AJ2A 2V6FA 4MVJF 4RZHA 4BGVA 3RJ9A 4URFA 1Q0LA 3K6JA 3IUSA 1E7WA 4CQMD 4BO1A 1K0UA 1U9JA 1E92A 2O7SA 3EMKA 3JQ8B 4A5OA 4OQYA 1DC4A 3I9NA 2PFGA 2YDXA 1BHSA 1X1EA 2Q2VA 4K1LA 4TRJA 1SO8A 3KZVA 1NQ5A 1ZSNA 4WLUA 2NTJA 4FCCA 3ZHYA 4B79A 3P19A 3ULKA 4RORA 3B1JA 4EEXA 3U4HA 2HLPA 1LDGA 4ONEA 3NRCA 4KTVE 4I08A 2DTXA 4NBVA 4BO8A 1GZ6A 3OH8A 1NWCA 4YJFA 3NKLA 1ISIA 5HRUA 4J7CA 1PL8A 3VTFA 4R1NA 1PJCA 1NM5A 2EW8A 3RC7A 4YA6A 4DQUA 4HFNA 4IGFA 3N7UA 3ZHBA 4HY3A 3DMTA 3MJTA 2I3AA 1TT5A 1RYEA 4LGVA 4N54A 5AVOA 3KBOA 4P4GA 3DL2A 1N2SA 3VH1A 2BHLA 2CZCA 2EGGA 1U3VA 2AEFA 3DBHB 3UGKA 1BRMA 4GSLA 3PQEA 4XGKA 1Q2XA 3G0OA 1NFRA 1Y7TA 2JKVA 3H9GA 4J1TA 2VRCA 4YPOA 1PJLA 4J1QA 3WTBA 4OSPA 2GN4A 1Z6ZA 4ZQEA 1ZIDA 1RYDA 1H94A 3PGXA 4J0FA 4FFRA 1PZHA 3JQFA 2HCTA 4ZQFA 3OJFA 4ROSA 4RZIA 5L53A 1U28A 1ZZEA 3EHEA 4NBWA 4RPGA 2OOSA 1TEHA 2POQX 4PLYA 4YCAA 2EJVA 4CMAA 1E1KA 4PLCA 1O89A 3VH2A 1T1RA 2AMFA 4I9HA 3PJEA 2YZ7A 1X0XA 2GRAA 1PJ2A 4J3FA 3WWYA 2AXQA 2H1SA 2OL4A 4MKXA 1RM0A 4AJPA 4YWJA 4W7HA 3ZNNA 4YACA 3GZ4A 2W2LD 3H6KA 4MDHA 4J4HA 3VZRA 1ZXLA 4HBGA 4E33A 1B15A 5DZSA 5A02A 2B69A 1HZZA 2OMEA 4XGIA 1DPGA 4QXMA 3VKVA 2Y99A 3QSGA 3SLGA 4XGNA 4QUKA 1HEUA 1IY8A 5B4VA 3M1AA 1DRUA 1R0LA 3E9QA 3CSDA 3MCVA 4J7UA 2HSDA 2X0IA 2CUKA 5JMPA 5ADHA 3I83A 4FIZA 3AOEA 1ONPA 2H9IA 5LDGA 4MOWA 3WBBA 4EDFA 5K6AC 4ZA2A 1J6UA 1LXCA 1O8CA 1GYPA 1SZJG 1WDKA 3GHYA 3WIDA 1FDWA 3ANNA 1XIVA 3GG9A 1HZJA 1WDMA 4CMJA 3TOZA 5JDIC 4BNWA 3K92A 5IF3A 4E0BA 2CF6A 2DBRA 2GYYA 4BO4A 4U0KA 1WAMA 1JAXA 1ZW1A 3PFWO 1YE3A 3NDJA 4BVAA 1LDYA 3D4PA 4FQ8A 1I5RA 1EK5A 4FOSA 4IDAA 1WNTA 4R1UA 3T4EA 5A03A 2O23A 2EWMA 3PWSA 4GX1A 5A04A 4B8WA 4QTZA 1MX3A 1WMBA 5T57A 2NU6A 5IG2A 1PU2A 2P5UA 4TRNA 1N1EA 1H2HA 3AU9A 1V3VA 5KVCA 4BO6A 3PRJA 3HHPA 4MVJD 1YBAA 5HS6A 5KCZA 4MP6A 4FBGA 5GZ3A 3X2FA 3W4IA 3JV7A 5ILGA 4CQMA 1DIHA 5L4SA 3RBZA 3GUYA 2D8AA 3E1KA 3MWDB 3WSVA 3BAZA 5EINA 2GERA 3EZLA 1LDEA 3CXRA 4ND3A 1LSJA 2R6JA 3GQVA 1DRWA 1K6JA 1VLLA 3H8VA 1GCUA 4J9UE 5I8WA 1I0ZA 1QYDA 4BB5A 4JLWA 3WICA 1RJWA 4NK5A 3ZU2A 1PJSA 3G1UA 3WYCA 3I3OA 1I2CA 4PLHA 3UCXA 1EVYA 1DLJA 4PLVA 2PGDA 1A71A 5U9CA 3RFXA 3EAGA 1ZK0A 1O94A 1ONNA 5F5LA 4PG6A 4R41A 4CM3A 2YYYA 4JQCA 4DBVO 1TVEA 1BW9A 4E6PA 1I10A 3Q9UA 2HDHA 3NTOA 4HADA 5G0TA 4WOJA 5L7YA 2FR1A 3PDJA 4R4JA 1JWBB 1X1TA 4NDNE 3ZWYA 1CDOA 4Q9NA 3RJ5A 4NQZA 5KJEA 5IAAA 2QZ9A 4BNFA 4ZU3A 3GGPA 1Z82A 5EQFA 3ROPA 4OOFA 2BKAA 3PZBA 5CEJA 5IN4A 4YDRA 1PZGA 3ROQA 4GWGA 3E48A 2EIHA 2HK8A 3D3EA 4IPTA 4XR4A 4CM4B 1DEHA 3GEMA 1AE1A 3EW7A 4XIJA 1EVZA 5COQA 4ZVVA 1TT5B 1PS0A 4PZDA 1DC6A 2I99A 3D5QA 4XRGA 3AI1A 4TZTA 2I3GA 2I9PA 2HJRA 2DT5A 2D4AA 3KLPX 4PGFA 1UXIA 1QLJA 3GA0A 4OSOA 1R16A 9LDBA 1L7EA 4MIYA 3ZV6A 4YXFA 3QVSA 3FBGA 4UEOA 3WR5A 5EERA 5TQVA 3AY3A 3EC7A 3TNLA 1NR1A 3JYQA 3NTRA 4BNLA 4BNVA 3VTZA 3WGZA 1GYQA 4UVEA 3V1YA 1U8XX 2J6IA 3JQ7A 4ALIA 4DA9A 3GNQA 3ZWWA 5A06A 3GGGA 5FEUA 1IZ9A 1M66A 4RPLA 4XWYA 4WNIA 2RHCA 1ZJZA 3KXDA 4LISA 1E3EA 1OZAA 1DFGA 3Q3CA 4BGIA 1EE2A 2OBNA 1KS9A 2FPGA 1X13A 3U49A 1AN9A 4A26A 3NGLA 4WCFC 2AE2A 3IIEA 4JBGA 4ZQGA 1T2EA 4IS3A 4N5LA 3TOXA 2AG5A 2O4CA 3I9JA 5L45A 4I1IA 4HP8A 1GUZA 3FTNA 4LSMA 3Q6IA 4RQTA 4JJIA 3BXXA 3BMQA 5JAMA 2XXJA 3TJRA 2JD0A 4PRLA 3AUAA 4RPHA 4RLHA 1A5ZA 1T2CA 1X7HA 1GDHA 3IJRA 5TGDA 1KVRA 1P31A 4I5EA 2EKLA 3R6DA 1K3TA 1PL6A 4BNXA 3AM5A 2O2SA 3PXXA 2C7GA 4D3DA 2YV1A 2OHXA 2VUSA 2CDAA 4YQZA 4YVFA 3VDQA 2Y1EA 1VJ1A 4J16A 4O5OA 2O3TA 3JQBA 3R3SA 4BGEA 3E82A 4B8ZA 1SMKA 1R4NA 4L74A 4GSKA 4PFJA 1BWSA 4MVJA 3GNSA 4B4OA 4BKUA 4MINA 1NASA 2HQ1A 4GAEA 4IQ8A 4NK4A 5EESA 4ALKA 5A5FA 2FZEA 1F06A 3T4XA 4OOEA 2LDXA 4D79A 4RPKA 4IZHA 1LRLA 3GHHA 1I32A 1HYEA 5L3ZA 2FSVA 5HTOA 4GQAA 4W9NC 4LN1A 4W6ZA 5GZ1A 1SEPA 2J5RA 3RI3A 4R69A 3FCOA 1B8PA 1YDWA 2IDZA 4JK3A 5ITWA 5COAA 4TKMA 3VPGA 3TWOA 1PQWA 1RM5A 1DAPA 3H3FA 4CMEA 1KYQA 1ZSVA 3MTJA 1G0OA 2O4UX 4E21A 2W2KA 3PJDA 5BSEA 4YAJA 2FHSA 3PI7A 1UR5A 4CQMB 1NAHA 1NQTA 1D3AA 4TWRA 3ZWPA 3GPDG 3EUWA 1Y6JA 3DTYA 4F6LA 1NTOA 3DAPA 2P9CA 2GCGA 2J5QA 2VUTA 2GSDA 3ASUA 3EK2A 4Y6SA 2G82A 5L4LA 2P91A 5IZCC 2QRKA 2FR0A 3D3WA 3H5NA 3QQPA 4S3MA 4ZQHA 1EUZA 2Y0CA 2B4RO 2Y1FA 2VYND 3PEFA 3UW3A 4YT2A 1U7TA 3KETA 4RVSA 3AI3A 1P1KA 3HN7A 3VKUA 1MP0A 3FF4A 5JY1A 4BKPA 5ER9A 4PN3A 4OL9A 4BQRA 4INAA 3CTMA 1FXSA 4GGPA 3TZQA 3JYLA 4ZGWA 4HKTA 3H5RA 1P9LA 5KJ1A 2YV2A 3GAZA 3HDJA 2VHZA 5DOZA 4B4UA 4CV1A 2Y1OA 1BDMA 4YRAA 1R0SA 4OAQA 1XQ6A 4KUHA 3RQSA 2X22A 4UUNA 3DBVO 4PIVA 4XZ3A 2B5VA 2DM6A 2DTEA 2RHRA 4J2HA 1RM3A 4KQWA 3VVBA 4B7UA 1EEHA 4MVJE 4IDCA 1DC5A 3OF2A 1ZJYA 3NV9A 4R3NA 2UUOA 2DFVA 3D4NA 2HU2A 3FPCA 4YR9A 1PSDA 3GLQA 5ENDA 1KBZA 2Y0DA 4DC0A 1YBVA 5DCWA 4CLHA 1LDMA 4OH1A 4L73A 3L4BA 1R15A 2QYTA 1QSGA 1LI4A 4NH4A 1BSVA 4PCVA 4F3YA 5JO0A 4IMPA 4IM7A 2Q2WA 2VHXA 1L1FA 2C2XA 3CMCO 4XB2A 4D0RA 4DIBA 3DXFA 3INGA 5TIIA 4OQZA 1HE3A 4CM6A 5A9TA 5DBFA 2GO1A 2O3QA 1SB8A 3KVOA 3TRIA 3OA2A 3GFBA 1GAEO 1NR7A 4HFMA 5CFZA 4AJHA 1I3KA 1FDVA 3DBHA 1P3DA 3QV1A 3RBXA 4CLDA 4DYDA 5CEEA 3PQDA 2VZ0A 4A73A 3QRWA 3DHNA 1YONA 1R37A 3I4CA 4KTTE 3L6DA 3JD1A 1U4OA 3GF4A 2B36A 3COSA 1UAYA 4UVDA 2YV3A 3TDKA 1ENOA 3GK3A 4XCVA 4DVJA 4LRSB 4XDZA 1NPDA 3JYNA 4I9NA 2GZ3A 4TKLA 3M2TA 1Z75A 3KRTA 2X0NA 3H2ZA 1I30A 4GI2A 4KUGA 4XD2A 2OXIA 1KVQA 3WYEA 4N18A 5ENVA 4BV8A 4CPDA 4NBTA 5JXWA 3M1LA 4WNCA 3F6YA 2X9NA 3O4RA 1GCOA 3HG7A 3ZI0A 5HWSA 1O9BA 3TN7A 2QRJA 1DFHA 4BV9A 2NQ8A 3BMQB 1PJ3A 1H93A 1YOVB 3LT4A 3I9LA 3S2FA 4WLVA 1P45A 4NBRA 1M2WA 4NJOA 1LRJA 2ZYDA 3G17A 2EGHA 2TMGA 3BTOA 3I6IA 3NT5A 1XHLA 2YY7A 1KETA 2AW5A 3QHAA 4XQ9A 4Z0TA 1CEQA 1NVGA 5KTKA 4RDHA 4FD3A 3CPSA 4CLRB 1PJQA 1I2ZA 3WIEA 2BLLA 4KZPA 2X7HA 2VRBA 4E12A 2ZTLA 2AEJA 3JCZA 1EQUA 4II2A 4WEQA 2J8ZA 1R4NB 3WLEA 4BNNA 4HFJA 1EQ2A 1UP6A 1A7KA 3W8DA 2Y1CA 2VTEA 4FDAA 3DOJA 4GKVA 4D45A 1YKFA 3D1LA 3E03A 3P2YA 1E3SA 1GZ3A 1EFLA 3MZ0A 4ZICA 2IZZA 5DULA 3GMDA 1UZLA 4ND2A 2NVUB 3GEGA 2TMDA 4IBOA 5L9AA 3C85A 4UVGA 3ONDA 1GQQA 4J1SA 5I7VA 1N92A 2XAAA 2PH3A 3IS3A 3VPFA 3AY7A 6ADHA 2VYNA 1PJTA 1E7RA 2DUUA 3INRA 2QHXA 1HE2A 1OC2A 1HSZA 2W2KB 4BUCA 3NUGA 4A7PA 2BFMA 1W73A 3U62A 3T7CA 1XGKA 4KWIA 3AWDA 5U1PA 1YH3A 2ZB3A 1G6KA 5L40A 4QX6A 1UDAA 1Z73A 5JPIA 2OZPA 1E6WA 1SOVA 5IDXA 5C7LO 4YAIA 1ADBA 3ANMA 3F46A 1LDBA 3G49A 4U6SA 3OICA 3WTCA 5BR7A 3NT2A 1H6BA 2UV8A 3KLMX 5JCXA 4NU6A 5A4DA 1R12A 3LLVA 4BNMA 1K2WA 1MFZA 4NHEA 1IHXA 1PR9A 3ZWVA 4WK6A 5TJHA 3PLRA 2QZZA 2YHUA 1TXGA 1ZK3A 2R00A 4DRYA 1ZO8A 4J43A 1Q0QA 3Q2KA 3GN2A 4LCJA 3HDHA 3ZWNA 1M6WA 2X5OA 4AICA 1LSUA 2Y1DA 3UICA 3IMFA 1DC3A 4A03A 1B26A 2BI8A 3F1KA 1JDJA 4M54A 1EVJA 1X7DA 3DZFA 4DLLA 3LQFA 4IINA 3O38A 5G0WA 2YHIB 1BDBA 1M6HA 1Z74A 2PR2A 3AW9A 1U5CA 4LRTB 3W1VA 1L7DA 4NZ9A 1RM4A 4GLLA 4EJ0A 4QO7A 1ARZA 1E6UA 3AJRA 3RFVA 4D42A 3ZHXA 4Q3CA 5DNAA 4L8VA 5JC8A 3KYBA 2A92A 3TL2A 1R6DA 2GN8A 4XR9A 4ALLA 1EBUA 4EI2A 5B1YA 1N7HA 1PS9A 2CMDA 2JAPA 2PNFA 2UUPA 2NU8A 4PLWA 1I3LA 5JMWA 3E9MA 1NX6A 1YGYA 2EJWA 2ZYAA 5TT0A 1PX0A 2Q49A 3P5SA 4DPMA 4YT4A 1X15A 1Y81A 3R1IA 3LYLA 2DLDA 3WGHA 1P1JA 2DPGA 3F4BA 4BNUA 4GLOA 3PPIA 4CM4A 2WEKA 4DIFA 1Y9EA 3TZHA 5DN9A 4GGOA 5K1SA 1H0KA 4CUJA 1FK8A 5JY6A 5CDGA 2D5CA 4UEKA 2HAEA 4OM8A 1WLYA 1YQGA 3FWZA 5TRTA 2BGKA 1VPDA 1YJ8A 3ZN2A 4P4LA 3NGXA 4IDEA 4OGWA 3ENKA 4UVHA 3JQ9C 5JBIA 2QYSA 4IJUA 3FNFA 2PY6A 3GC6A 3QY9A 4YJHA 1H2BA 2V6MA 4W99A 5BSFA 1F14A 3JSAA 4F46A 1ZUD1 1YB1A 3FRJA 2PGJA 4ZHSA 3ADPA 1EDOA 3GVCA 5A1TA 1V9LA 1V35A 2A35A 4WECA 2P9GA 1LLCA 3DTTA 1VKNA 1YQDA 4LVUA 2Q1WA 2FY8A 5JFOA 2G76A 1HDGO 3DO5A 2ZTUA 4J4TA 5JS6A 3PIIA 2PKQP 1GY8A 1VJTA 4U0JA 5AYVA 3OFSA 4E3ZA 2LDBA 4YT8A 2AEMA 3IC5A 1DIGA 1MA0A 1QG6A 3V2GA 2XOXA 4AJLA 4WOKA 3VVCA 4BIIA 2VWQA 5ICMA 5AXBA 1TI7A 4ZRNA 3WDSA 5KJCA 2Q1SA 2AG8A 3D5TA 3KEOA 5TLSA 2C5EA 4BO2A 2NM0A 4YRDA 4GWKA 1EUDA 3KYDA 3E6AA 4JXKA 5T5QA 1A27A 3UAGA 1BXGB 5MDHA 3U0BA 1CJCA 3E5RA 3PHGA 3K5PA 1E3JA 2BF7A 3WGGA 4QEDA 1Q7GA 1E0DA 3OMLA 4L4XA 4MIOA 3H9EO 5I8ZA 3KHUA 2CF5A 3P7MA 4JN6B 3GT0A 4I5GA 1KEVA 3QW2A 2X58A 3NX4A 5B12A 4E2YA 2Y1GA 4WCFA 1YL6A 4HNHA 1GU7A 4O1MA 4X54A 5TX7A 4CMHA 1WPQA 4W4TA 1A9YA 1BTOA 4I8XA 3PWZA 2D3TA 2EXXA 3MEQA 4A10A 3SEFA 1XA0A 5C37A 2OFPA 2UDPA 3F47A 4KQXA 2VNSA 2UYYA 4AFNA 4W7IA 1MC4A 4TZKA 1HLDA 1GV1A 1NVTA 1V3TA 2W90A 3DZIA 1QV7A 1O95A 5FI5A 4OJNA 4WUVA 1V8BA 3U4IA 2O48X 2VTDA 4N5MA 3QWFA 1VRWA 3LT2A 4WKGA 5HBRA 3RSHA 3ETEA 5KKCA 3CUKA 1H6CA 3BZUA 4O59O 2P2SA 2JHGA 4FFOA 3VPHA 1LLQA 3RIHA 2E82A 1ISHA 1JLLA 1LLUA 3K2BA 1PGQA 4ND1A 4WLOA 1M67A 2VUUA 4YJGA 3RASA 1QV6A 1WZEA 4FGWA 3TZ6A 2Z1NA 3D64A 4D0SA 1N7GA 4W9NA 3DBRA 5KWEA 3DONA 2BFAA 2C0CA 2Y93A 3M2PA 4A27A 3JQAD 4NMHA 4H15A 3PHIA 2ZJ0A 1VKOA 1ISFA 3H7AA 1WWKA 3ICPA 1XLTA 5CHEA 5F1OA 3QWBA 2Q50A 4E5PA 4RPJA 3GPIA 2DVMA 1ZBQA 3DFUA 1DRVA 2GNAA 3H5AA 3GDGA 2PZJA 4YTEA 3ZU5A 4DTIA 4Z0PA 3HB5X 4Q3EA 1U2DA 1C3VA 4F6CA 3KSZO 5J23A 2VHYA 3OA0A 2ZQZA 2ZB4A 4FFMA 5C5IA 4HXYA 4EW6A 3DBLB 3ZV4A 1B3BA 1AXGA 1Z7BA 1HSOA 1DO8A 4MVJH 4L4RA 5CDUA 1MG0A 3ZWCA 2OUIA 3K96A 5JW6A 2NQTA 5IZCA 1UXHA 2I66A 2PV7A 1VL0A 2FMUA 3RCBA 4JNKA 3A1NA 2VZ9A 1P0CA 1DAOA 3O9ZA 3I6QA 3QLJA 3WNVA 1MB4A 1PR3A 3C8MA 2J5KA 1HDOA 4A0SA 4KDFA 1SPXA 4AJNA 5C7OO 3VPSA 1WDLA 1KERA 3HUDA 1ENZA 1JVBA 1HDZA 4Q3NA 1HF3A 2EERA 4IIUA 3W6UA 3O26A 2FN7A 1NFFA 5KVSA 3HFGA 1A4IA 1B8UA 1S6YA 3PJGA 3S8MA 4AJJA 3RUCA 5B4TA 1P1HA 2W2LA 4OMUA 4YJHB 2NUAA 1B2LA 1S7CA 2I65A 2PD3A 1J0XO 4OO3A 2FOIA 2EKPA 1ULSA 3F5SA 4TSKA 4E2WA 3EZYA 3SX2A 5FWNA 5L4NA 4ZN6A 2ZKLA 4CV2A 2IYPA 4RO0A 1GPJA 1M75A 3ETDA 2BGLA 3PGJA 1ZK1A 3N74A 5JDCC 1I3MA 5JCJD 1IE3A 4FPXA 2Y0EA 3HSKA 1HWYA 3JYPA 2ZYGA 1QKIA 3W4KA 1ONOA 4L4SA 1K89A 4RVDA 1T4DA 4JP3A 3NDIA 2J3IA 3OEWA 3FD8A 1BXKA 1LQUA 1QR6A 2C29D 3C3XA 1QXSA 2WD7B 3LU1A 4MKRA 4EBFA 2HK9A 3GOHA 3U4CA 1E5QA 4HNGA 4JCOA 3JTMA 4AJEA 4CLXA 2PKRA 5I7FA 2C7VA 1U2GA 4RVHA 4J9VA 1QLHA 1YOVA 3FR8A 5H81A 5T8KA 1HLPA 2AQHA 3I1JA 1Z7EA 3SJ7A 4CR7A 5IDWA 4D43A 3EGOA 1QORA 5I7SA 3ZWXA 3L9XA 1EFKA 1OC4A 3IJPA 1B3RA 2WSBA 3G79A 3KYDB 2VHVA 4ZD6A 4QT0A 2HKIA 1EUCA 3QE3A 3E8XA 4CQLB 4CLRA 5IXSA 5JSFA 4IXTA 4H7PA 2J3JA 1KOLA 3S1LA 2BI7A 4YQYA 2GUGA 3G1TA 5EJ2A 3JQGA 1PJ4A 3BIOA 4ND5A 3U09A 3BMOA 3RC2A 4F45A 4DUPA 3G3EA 4C7KA 1O0SA 1AHIA 1ID1A 2OGUA 3LT1A 1QMGA 2EV9A 4TRMA 1C0PA 4R1TA 4BNIA 1ZH8A 2NACA 5ITVA 3NTQA 3IUPA 1TT7A 3OIGA 4WCFB 4NNJA 1SAYA 4EZBA 3PHHA 5EQDA 4CL8A 5F5NA 4WLEA 4NFYA 3ZU3A 1DB3A 2NVUA 2C2YA 1MUUA 1EBFA 1JN0A 1ZMTA 2OP0A 2WYUA 4IGEA 4DC1A 4DLAA 1ADFA 3HNPA 2VZ8A 3Q9NA 4FC6A 2BD0A 3CH6A 3DAFA 2ZCUA 2RIRA 1IHYA 4BKRA 4MO2A 4BNTA 3I5MA 1UXKA 1JU9A 4GMGA 4DL9A 3VDRA 5CG1A 5KJ6A 3UF0A 4OKNA 3LC1O 3O03A 1OI7A 2F00A 2JJYA 1A9ZA 1HE5A 4LCEA 4JIGA 2VCYA 4NR0A 3ZGYA 2D0IA 2CVOA 3AM4A 5KJFA 4B7XA 1NQAO 1SBYA 3ROMA 3A9WA 3JQAA 5A9RA 4D46A 2PWZA 4KP7A 4KDEA 3KO8A 1VL8A 2Q1TA 1DIBA 2PH5A 4MVJP 9LDTA 4CUZA 2X8LA 5CDTA 2ZB8A 1LBEA 2HMSA 3IP1A 4CL3A 4Y8VA 4TVBA 3WGYA 2CDBA 2CSUA 3DQPA 3NAQA 4MVJG 4YJGB 5DCUA 1LRKA 4BO5A 3DHEA 1KC3A 3PFFA 2AE1A 3BTSA 3DBRB 3B20A 5A3VA 2JAHA 1E1LA 4WJZA 3W4JA 1LSSA 1W4ZA 1HT0A 1G0NA 3QWAA 5CDSA 3DWFA 2J3HA 3IKTA 4PG8A 3H9JA 5BT9A 4RQUA 4Y6RA 3LLSA 3MJCA 2YHIA 3HFSA 4DWVA 2B4QA 3UH1A 2JCXA 4GX5A 5IZ4A 3KM0A 1LUAA 1ENPA 1HTBA 4KMSA 5AXDA 4L0QA 1ZEJA 4EUHA 3JD4A 3CMMA 2VN8A 2FP4A 2YQ5A 4ZJUA 2YFHA 1CIVA 4NBUA 1WVGA 4AJKA 1R66A 3NDRA 1MGOA 4WEOA 3OJLA 4M87A 5B37A 4KOAA 1BVUA 3RUFA 5IXYA 1YXMA 3ANLA 5KVVA 1CYDA 1LSOA 3WS7A 3A28A 3KSDO 3L9WA 1QYCA 3QVOA 4RVUA 1Z45A 3JD3A 1D4FA 2JFFA 1QYXA 4BMSA 4J49A 2C20A 4RCVA 2PK3A 4NJMB 1TA4A 1XU7A 2WTBA 4PLZA 4EEZA 5G0VA 1DFIA 2WDZA 1YWGO 2B0JA 4XKJA 2RBEA 2BMAA 5JYDA 1ZFNA 5JLAA 4CODB 1NAIA 3V8BA 3L6OO 5I9NA 3UFXA 2C54A 2GN9A 5BNTA 1ZNQO 1TLTA 3H9QA 4BB6A 5L51A 2DPHA 1JQBA 3EY4A 4XJSA 5CG2A 1LLDA 1EZ4A 3C7DB 4R68A 4XJTA 4QSMA 4J1NA 3OQ6A 3D4OA 3L6EA 1JW9B 1YQXA 4RGBA 1W8DA 5FF9A 1MV8A 1PQUA 1MG5A 1J5PA 2W8ZA 4IDFA 4BO0A 4NI5A 4B4VA 5IJZA 1E7MA 3MJSA 3V1TC 1NFQA 1PWZA 5JYEA 1A72A 4CMIB 5DBGA 7MDHA 3IL2A 4IJWA 4BO7A 1ORRA 1FMCA 4IMRA 1B8VA 5DCYA 2UVDA 3W6ZA 1VL6A 1CWUA 4GPD1 1YVEI 5KNLA 4M55A 2QQ5A 3GDFA 1OBFO 2AA3A 5BSHA 2DTDA 4BNHA 2RAFA 4FJ0A 1Y9AA 1DJQA 3WGIA 3QVXA 1LC3A 5H82A 3F3SA 5TJ9A 3LT0A 3UCEA 1E7YA 1XDWA 5L95A 1F12A 2PD6A 3FN4A 2W98A 3ON5A 4XX0A 4KWHA 1SEVA 4FJ2A 4IQ0A 4J91A 1VSVA 2DBQA 4M8SA 2VRCD 4DYVA 4YAEA 4FC7A 3BMCB 5TSDA 3ZWOA 3JQGB 4CMEC 1Y8RB 2YFQA 3BMOB 4DGSA 2VWHA 2GPTA 3GNTA 3AFNA 4FJ1A 2ZQYA 4ALNA 1PGNA 1XKQA 4FFNA 2VT3A 1BXGA 1CF2O 2QG4A 4I5FA 1UZMA 2I76A 3K9QO 3ZWAA 3KEQA 4NU5A 4YAGA 2CVZA 2V7PA 5DDIP 2HO5A 2GR9A 3PZRA 2WD8A 1QYVA 2B5WA 3KSUA 1HXHA 1F0YA 1U3WA 3EVNA 3RC9A 3ROKA 4R9SA 1HE4A 3OSUA 1EMDA 1I8TA 1UXGA 5EMHA 1XWFA 5CPBA 4S1VA 5DP2A 4BNZA 4Z6KA 1MC5A 4XA8A 5LDHA 4GKBA 4QO8A 1T25A 3UUWA 3W8FA 4K28A 1YDEA 5T6BA 3CKYA 3OP4A 1A4UA 4I9UA 2DUWA 3WJAA 1J4AA 3GVHA 3GR6A 1KVTA 2NLOA 3WMXA 5ES3A 2D1YA 1ZVMA 1E7SA 5HA5A 2I67A 2OORA 3RAJA 3L0DA 3GEDA 4G2NA 3FNEA 1T4BA 3KOUA 4PG7A 1HDRA 3C7CB 2VQ3A 4P4NA 2NTVA 3JQAB 2RH8A 3GZNB 3JQ6A 2NWQA 2BGMA 3H3JA 4FOOA 4IDGA 2GGSA 1ZK2A 2OBYA 2PKQO 4CLEA 2V6BA 2Y66A 1VSUA 4O0LA 2DBVO 3WGTA 1C14A 2DQ4A 2BFPA 4CMCA 3UOGA 1U8FO 2PD4A 2WWRA 4CJXA 1XCBA 3PQFA 4DLBA 3WGQA 5K6AA 4PLFA 3Q1LA 3GUCA 2E48A 4B4WA 4WLNA 4PZCA 1IPEA 2NV6A 3BHIA 3U5TA 2ZIZA 4FGSA 5JDIA 5A5EA 1XR3A 3L4BC 1K6XA 1N9GA 3QWHA 1ZMOA 2FZWA 2IE0A 3E9NA 3WMWA 2AQ8A 1HDYA 1ULUA 2Q3EA 2VOEA 4XYMA 5A9SA 1UDCA 1NVMB 3OECA 4LW8A 2JL1A 4E30A 4RF3A 5EN4A 5COBA 3SXPA 2E49A 3RD5A 2GDZA 4ZQBA 4IS2A 1C0KA 1EVIA 1F8FA 4IDBA 1I33A 4P8RA 4XEHA 3CINA 3IP3A 1H6AA 1RPNA 3HDQA 4D7AA 4RVFA 1H5QA 3BHJA 3ZH2A 4NPCA 4UUMA 4O6VA 2H6EA 1GD1O 1I24A 2WMDA 1GQ2A 4II3A 4DREA 4OHUA 3VZPA 3IAHA 1WP4A 3QJ5A 4AG3A 1OOEA 4J90A 1IZ0A 5G4KA 3QVTA 3MOIA 4K9DA 2AHRA 2ET6A 1LEHA 5ILOA 4XDYA 4IUYA 3DBLA 5HS4A 5KVQA 3HZZA 1H6DA 2CDCA 3LF1A 1Q7CA 4IIVA 1YBMA 2HMVA 4MP8A 5EL0A 1NPYA 5CDYA 1AHHA 5IDQA 4RF4A 4GVXA 5BQFA 2ZTVA 4N5NA 2D5AA 1JA9A 1YS4A 1P33A 1PL7A 2EP7A 4DPLA 2NVWA 2A4KA 3SLKA 4JGBA 3T7EA 1D1TA 4RF2A 1ISMA 2ZTMA 3AFMA 1FDUA 4G65A 4GH5A 2O3RA 3QWIA 5AOVA 2X5KO 4DMMA 1X7GA 1LC0A 3PTZA 3PK0A 3C7AA 4E5KA 1HETA 1GL3A 3OJOA 3PVZA 1B16A 1E6EA 2Z1MA 3WNQA 3WFJA 4AL4A 4D3SA 4XYBA 3UN1A 4BQPA 4FFLA 4WE3A 4K26A 2X0JA 1MXHA 3IKVA 2JD2A 1DDOA 2Y67A 2NTNA 3RUHA 4ALJA 4EGFA 3VZQA 2P68A 1OMOA 2O3UA 1Y1PA 1W0CA 3KTDA 4LMPA 4HWKA 2G0TA 1VJ0A 3OQ1A 1IL0A 3AUSA 3B1KA 3WYBA 1R4MB 2D59A 3JQDA 1ZXBA 4A2CA 3HADA 5KOIA 3RVDA 4CM8A 1NNUA 2IYOA 2WD7A 4MVJM 2O2YA 3I9OA 3BMNB 1JKFA 2P9EA 3PIDA 3GVXA 1EDZA 5THKA 4RF5A 4YYZA 3X2EA 4UEJA 1VC2A 3RWBA 1N1GA 3LF2A 5FYDA 5H83A 3BTUA 2CFCA 2PLAA 3HE3A 1I01A 1IYZA 1YL7A 2QW8A 3ZNOA 1GPDG 4P22A 4BMVA 4R51A 4OYRA 4PG5A 5CEFA 4EUFA 4DIOA 4YB8A 1W6UA 4QECA 4C7JA 1N8KA 5IDYA 4CQLA 1F8GA 3DEYX 3ZW8A 3I9MA 6LDHA 4MKZA 5B4UA 4R01A 2B35A 1M76A 1P1IA 3QVWA 4XYGA 3ZDFA 4E2XA 2PGLA 1KVSA 4BMNA 3B70A 3SC6A 1HL3A 1VE9A 1U7HA 3SJUA 4E5NA 1VM6A 4IJVA 3ZZNA 3O8QB 1T1SA 4XYEA 4BNGA 3OBBA 1DSSG 2DFDA 4FR5A 4XQCA 4MIEA 1T26A 5JDCA 3WJ7A 3ASVA 4AJ1A 3DOCA 1UAGA 1Q7BA 1LQTA 3AUTA 2B37A 3QIVA 2O50A 2H5LA 4Y6PA 1PEDA 5MGBA 3GMSA 1HKUA 1P0FA 2R00C 1A7AA 1YB4A 2O3JA 5K0ZA 1FF9A 3AOGA 1J49A 3FNGA 2P5YA 2C5AA 1V0JA 3H65A 2YUTA 3RUAA 4CM9D 3ONEA 1CRWG 4CMGA 1PJBA 1XG5A 5A05A 1KVUA 1NHWA 1U1IA 4H16A 3RFTA 2EKQA 4UUPA 1V3UA 4PG4A 3L77A 5FI3A 3R0IA 3LZ6A 2GASA 3KYCA 2PA3A 4TROA 4Z9XA 5FFFA 3FSRA 2RCYA 4BL5A 1GYRA 4DMLA 2WYWA 5JAIA 4AJIA 3UHAA 4Z3DA 3DAGA 2NSDA 3FHLA 3GGOA 4Y98A 1JWAB 3ZNPA 1C0IA 3OHSX 3U3XA 3PHJA 1WW8A 5C7IO 2C82A 5EPOA 1E3WA 1XEAA 2Q45A 1E1MA 1D8AA 1E7QA 1LU9A 3PLNA 1N9GB 5T67A 3LDHA 2FR8A 4OXKA 1LX6A 4ID9A 1ZKMA 2WM3A 1U3TA 3I23A 1QP8A 4YT5A 2HRBA 3F5QA 5JAQA 2IODA 4TMFA 5A9SB 1HYGA 2EP5A 2G17A 2Y68A 2Z95A 3FNHA 3WFIA 4DXHA 1U4SA 3DMTC 3TF5A 1DIAA 3W8EA 1E3IA 1O5IA 2ZB7A 2IEBA 4R16A 4R9RA 3EDMA 4B3HA 1UXJA 4B3JA 4R54A 1PIWA 1XYGA 4AVYA 1AXEA 3P2OA 3TFQA 4MVJI 4RJTA 3NYWA 3MJ4A 3MJEA 4K6FA 1CQJA 4P38A 1ZSYA 5G0UA 3FWNA 2CD9A 2CVQA 1PWXA 1ZEMA 2OO5A 4BNYA 4PLTA 5G4KB 4J0EA 4BKOA 3H2SA 3JQFC 2XXBA 1YJQA 3ADOA 1PTJA 1P77A 5CP8A 3TL3A 1NQOA 1F17A 4BS9A 1JVSA 8ADHA 2GZ1A 2X9VA 3K30A 3M6IA 2BFOA 4BGUA 1X0VA 2ZJ1A 3RBVA 4YJFB 2A9FA 2BRUA 3PHLA 1NBOA 3SVTA 5I9LA 1UUFA 4EJMA 1GEGA 4D44A 1XU9A 3RKUA 3I9KA 4NJMA 3ZCXA 3C1AA 1E5LA 4QFDA 3WGOA 3VAZA 2FPPA 3WBFA 2Y05A 3WG9A 2X9GA 4HX5A 1C1XA 2YW9A 4TQGA 4ALMA 3CZMA 3LVFO 4FFPA 4HFRA 3L4SO 1UP4A 1LJ8A 3WWZA 4BOYA 1YO6A 2XF8A 2F1KA 5AQ1A 2VWPA 3DHYA 1KEWA 4LSWA 3AI2A 1NYTA 1E77A 2WJPA 1LTHR 4OKIA 4U8GA 3PYMA 5K9ZA 3LC7O 5AXCA 1LDNA 4L9RA 4RV9A 3WQQA 2HK7A 2DC1A 1NPTO 1OAAA 1HDCA 1P1RA 1E1NA 1PZEA 3TQHA 1EE9A 4JJGA 2IRWA 5CPFA 4DQVA 5I7EA 1KY5A 3ZW9A 5KKAA 3AOEC 3NJ4A 3AK4A 3GN1A 3B1FA 4OXNA 4RVGA 3WSWA 4E5YA 3DMYA 4NFHA 4H3VA 4CMIA 4CM8B 1PGJA 4LK3A 4CM1A 1UZNA 3B6ZA 3HDYA 4PLGA 5THQA 1ISGA 1P44A 1R0KA 1SCUA 4Z3KA 2DU8A 2VOJA 1BMDA 3JD0A 3LSYA 4IXWA 5BNIA 5T64A 2ZK7A 2X4GA 5F1PA 4XRRA 4K6CA 3ST7A 5GY7A 1K6IA 2Q4BA 4ESOA 2ZCVA 4CV3A 3TPCA 2IXAA 1B14A 2X6TA 2VHWA 4IQGA 5GZ6A 4UREA 1GQYA 4JX8A 2ILTA 3CE6A 5LCXA 4U7WA 2CY0A 4E31A 2P4HX 2WYVA 3GRKA 4M86A 4B3IA 2G5CA 4Q3DA 1E3LA 1UDBA 3CEAA 4EJ6A 3GDOA 4EYEA 4BNJA 3OQBA 3BMCA 4CM9A 4FN4A 3DDNA 1Y8RA 2HMWA 4BHTA 4NFSA 5L7WA 4MJLA 2GD1O 3OJ0A 3BHMA 2IZ0A 3VPXA 2IXBA 2BELA 2EF1A 3MWEB 1I36A 2I5PO 1ZCJA 3PDUA 1GTMA 1Y8QA 1HYHA 1CETA 3IQDB 5L7TA 3FI9A 3N58A 4BO3A 1UP7A 2HMTA 3K8ZA 5A3JA 1DIRA 4L75A 2B4TO 3ZWMA 3PJFA 1HDXA 2GZ2A 1ML3A 3ITKA 5U4QA 2FWMX 3A06A 4M49A 1NP3A 3VH4A 2IZ1A 3ICCA 5G2OA 3DZJA 3DZHA 1DXYA 5TS3A 1BVRA 1DHRA 4JBIA 4CLOA 3H9UA 1CERA 3AUUA 5DT9A 5F1KA 5TC4A 3RUEA 4GVLA 2X1HA
chains in the Genus database with same CATH superfamily
3QKUA 2RGXA 1UKCA 3OP1A 1RRFA 1I2BA 4CTNA 5JHGB 3FR7A 2H7YA 5KX5A 2XNSA 1T3LA 1ST2A 4EB3A 1HY3A 3HCNA 3ZIAA 1MAUA 4MUIA 1QRRA 1Z68A 4HN2A 1H9BA 4ER7A 4LF5B 1PGPA 2R1ZA 2WZQA 2IS4A 2CLCX 3NEPX 3WLLA 1T3GA 2IF2A 2IHUA 5ALHA 1G42A 1MFPA 2I7TA 2JAXA 3JVUA 4ENWA 1M2OA 1X1DA 3TH5A 3ZV5A 1K92A 3FFWA 3P71T 1R9GA 2HFKA 2XXAA 3NHFA 3CRRA 3O8RA 3T35A 1CRZA 1Q44A 5LBTA 3JQEA 3RKSA 1QIDA 1Z0IA 1E3WB 4IJKA 1WXWA 1PR0A 2CLOB 2CC2A 2VWGA 4IY1A 3WRXC 4BLSA 1VLVA 1QAMA 2CFSA 2DT8A 2H63A 3DPSA 1VJDA 4UULA 3TEJA 4JEHA 5L3VA 1FS4A 1P91A 3TMKA 1NZDA 1C1DA 4Y67A 1GGHA 4MXDA 4M0MA 3BICA 4EGJA 1ORHA 2QN7A 4ZO9A 2PX2A 1LV7A 4GU5A 1QZZA 3D7LA 4NEGA 2WQ6A 2RHDA 1CQZA 4P3NA 4RSRA 5ICSA 1RKQA 4LC9A 1LA2A 2IP2A 1NXQA 3PE4A 4M89A 4WOPA 3ZNQA 4TL9A 4D3FA 4ZZ3A 5FLYA 1JHYA 3ILXA 3OZEA 4JLAA 5A1JA 1OTHA 4FSHA 4AY4A 3L92A 4ZK6A 2NZ8A 2EW2A 5GGXA 3IXQA 3VC3A 1R00A 5TNXA 2JLCA 2YV4A 5FBRB 2R4QA 3DR3A 1TMYA 5CT5A 1YI0A 3W2HA 8ABPA 3D1VA 4S1OA 5FBVB 4LNUB 3RGGA 4NMLA 1YB5A 1XVUA 3PVCA 3EVCA 4H0CA 4FWIB 5F3RA 1H8EA 1DRKA 4M1QA 3C3PA 3A6LA 1J1UA 5FBKA 5JMTA 2BI4A 4IICA 4QTXA 2JZCA 1Q0HA 1X7ZB 1Z6AA 2VA9A 3G7NA 2IIPA 4DWWA 3BYZA 2Q99A 4I9FA 5CCBA 2WNSA 3K1YA 2AZ4A 4B81A 1PLLA 1JMKC 1LF0A 3HCWA 3PFCA 3PFKA 3PGVA 4EGCB 4E5VA 5SYAA 3PFNA 3TXAA 3DS8A 3ECAA 5I9MA 2R2GA 4L76A 5DF1A 3UWPA 5K0GA 4CKBA 4ENRA 4W5OA 2QMOA 1IZ7A 2GTHA 1TD9A 3A2MA 1DKLA 3I4FA 3FXAA 2ZUCA 1TM7E 2DOKA 2JAWA 2XCRB 2GFQA 4L57A 2Z2JA 3I52A 1EQAA 1UEXC 2C1EA 4JITA 3G5LA 1E8DA 4JB0A 4YCDA 5EWLA 1HFJA 2W2TA 4JR0A 1TCBA 4DNPA 4Z49A 4XUEA 1BKDR 5LP6C 5ELXA 3A6FA 5JCJA 4UPEA 2EZTA 2NADA 3WKEA 3R3HA 1VLJA 3R41A 1IY0A 2FPPB 3LP5A 4ZYTA 2Z5FA 1ECGA 4C7VA 1C1XB 1J07A 1VXOA 4C0WA 5KZMB 4U2GA 1DNPA 5JO9A 3AT1A 1ZK4A 4M0FA 2DH6A 4HDNB 4F3RA 2PZMA 2AFHE 4Q3BA 3F5MA 1SUBA 1A69A 5JTTA 4O4HB 3IR6A 1KEPA 4CR6A 1I80A 2R6FA 1SUDA 2PAFA 2WUWE 1KP3A 4C88A 4QGHA 1OTYA 1TB4A 1ZKDA 4D74A 3N05A 5JD4A 1DJLA 2EWWA 3GEHA 2O1SA 2L18A 4GXNA 4MYCA 1ODCA 4W5HA 1TQ8A 3OCCA 3Q0EA 3QOWA 3RNLA 1KU6A 4JDUA 4X3OA 4J16C 4X1KA 5A3QA 2I8AA 3JQBC 3WWDA 4DUYB 3C41J 4Q16A 3IOYA 2PFKA 3H2GA 1UC9A 5HDQA 4CV0A 1J8YF 3LHFA 1MABA 4ZHQB 5BW4A 3SQWA 1E5XA 2ZJ3A 3TECE 1JLSA 1XQ1A 5GMOA 1PKEA 2P90A 4WMLA 3DZBA 4G4SP 1M34A 3RUIA 5I4BA 5F23A 1E4VA 1AMOA 3ZS8A 5K0FA 2QLJA 1T2VA 1EJ2A 3K71B 2WOOA 3BRQA 1COZA 4PZUA 1FJHA 2NNWB 5G0SA 3ZD7A 3R7AA 3RC1A 4LV8B 1GAQA 3FA2A 5LUBA 3M1IA 1UQTA 3NU1A 3AEUB 4HK4A 1A95A 1W88A 4RTNA 2PT9A 1FUUA 1KH1A 4GI7A 3RVKA 2RGCA 2Q7XA 1N0UA 3HB4X 2KLBA 3E2MA 1RS0A 2JGDB 4P3KA 4R5MA 1GV0A 4DA8A 2Y2VA 3R5FA 3K5IA 5IFLA 3TPFA 5G4LA 7ADHA 4JXXA 2V0CA 2VF5X 1G8KA 1MLDA 4QUBA 1U94A 4LXGA 5AW0A 2NU7A 1OROA 3C5WP 5TMBA 1TIPA 2IEDA 3HJFA 3H84A 3IOMA 2NZXA 1GNPA 3AETA 3FH0A 4Y1GA 5F12A 5IRCD 1FP4B 3OQIB 1C0EA 3UFBA 2P77A 2XR1A 1IWPB 4HI0E 1L7AA 1CY0A 2FEWB 4XWAA 4Z9YA 1YHNA 5J59A 3C5EA 4H4DA 1B7GO 1G5FA 4LDNA 3ZW7A 4BQEA 2R6CA 4J6EA 4RDIA 3O8QA 1G8GA 1O5OA 1FUIA 3BRCA 4OA8A 2C78A 1T2FA 2GLXA 5F21A 4YRSA 5ANRB 1D6SA 2RHBA 3EOBI 5KOHA 4FSDA 1CU1A 1EZZA 1KAQA 1T4CB 2P6OA 4GLBA 4L27A 5JE8A 3VI3B 4BMOB 2V65A 2AOTB 1P9RA 3ZGXA 2IXEA 621PA 3QSYA 2GKGA 4DQXA 1GADO 1WBDA 4CLOB 3IUBA 4RYDA 4QFCA 2C58A 4DN6A 3NHKA 3SDBA 3VR4A 3GP3A 3LM8A 2GK7A 4MZDA 2GYWA 3ZHZA 2JK1A 4ER5A 1ULBA 4UTVA 5BSGA 1QIEA 1WZ2A 4I55A 4MW4A 4KXXA 4C3ZA 5K4HA 5GIPE 4RLSA 1P1FA 4RAQA 5G1NA 4MEAA 3W2EA 2R48A 1JTVA 4EQZA 1E0JA 4MPDA 1DDGA 1MTZA 3JRWA 4OUDA 4EITA 3H2JA 4I1PA 2DJ5A 1JR2A 2Y77A 3OZDA 3QNWA 2JCVA 1QOPB 3LZDA 1EVEA 3R0JA 4PVDA 3WMRA 4AJ4A 1OH8A 1V5WA 4QBFA 4J4BA 3DE3X 2G1UA 8ATCA 3PWKA 5DK4A 2C07A 4BUZA 3NUQA 4HR7A 3Q5EA 4U8HA 1R6BX 3F1LA 3C6QA 5IKOA 1ZMBA 2HRZA 3OIFA 3FFAA 2IYSA 4QVIA 4DVGA 3KWJA 3VHRA 1C0LA 4FB5A 5CBPB 5LDDC 2IKQA 3HN2A 4CKEA 1CUZA 5ECDA 3RBAA 2BR4A 3PCTA 1MQSA 1W0JA 2JHFA 4PVCA 1T2AA 3RYIB 2IF0A 2YY5A 1A77A 2IUFA 3HNRA 1T0IA 5IC5A 4BNDA 5K20A 4C4TA 3LK6A 4U7JA 2QMYA 3D3WB 3L0IB 1PW7A 1JG3A 2H18A 2FPIA 2X0RA 3E53A 4DSZA 3FJYA 4ZEXA 1WMAA 2PMKA 3OQNA 4NCNA 3MWDA 4HUJA 3SQDA 1AKTA 2VYVA 2I6GA 2X8BA 3MNFA 2AN5A 1WXFA 1FYVA 3P2IA 4G81A 5CU7A 1GRVA 2R62A 3RT9A 5KINB 2JI9A 2CHEA 3N1UA 4NHOA 3Q11A 2GAIA 221PA 5K8UA 5JBNA 3F9IA 1X19A 3ANXA 3BRSA 2E4ZA 2MYTA 4NENA 4HTFB 1BG6A 3QMWA 5CLLA 2AQIA 2D2FA 3C24A 3L7CA 3L6RA 4JJFA 1DBIA 1RYHA 4WY2A 1NQXA 5C31A 4O2LA 4ARBA 3RJ9A 1AD2A 1UC5B 2GESA 5JH7F 1QC5B 3JXEA 1O95D 1E7WA 4AT1A 1WHTA 3O8CA 1NJ5A 3VU9B 4JEUA 2O7SA 4RZUA 1JJFA 1E94E 5FUVA 4AJ9A 1UK7A 4WA7A 4A5OA 4N8DA 4DDUA 3NHLA 2L42A 3FLBA 1DC4A 3HACA 3BJEA 3IHWA 3KXIA 4OM7A 3IPRA 4P0TA 2A0WA 1BHSA 3KKZA 4PC2A 4YMLA 2D1TA 2D06A 4Q0MA 1TJYA 1VJCA 4WZAA 1MAWA 3NAMA 4K1LA 3KZVA 3EN0A 1NQ5A 4LJSA 4KAJA 4NYJR 4BC0A 3ORRA 3PDIA 2HLPA 3H8WA 4XLZA 4WJKB 3TIFA 1A2QA 4ONEA 4F0JA 2OEPA 2OQ2A 3HB0A 3OX4A 3LX4A 1FFXA 2X8JB 4YJFA 2W42A 3RARA 2BHRA 3QKSB 2Q1YA 1NQVA 4IGKA 3GBVA 3MD9A 5CFQA 5HRUA 3COYA 1XMOB 4PFQA 4IR7A 2HH9A 3VTFA 3LCMA 1G41A 2WP8J 2CSXA 4RELA 4D0GA 2EW8A 4RIEA 2I71A 2IEAA 3CH7A 3Q7SA 4FYHA 3ZHBA 5FHQA 3DMTA 4M8KA 3U6BA 1KZ7B 1JIXA 3MJTA 3BF8A 3VPDA 1PUXA 4ZZ0A 5LN1A 2C4VA 5ESXA 2YNMC 3K8YA 3KBOA 3KOZA 1RQLA 1SVSA 3P2JA 1UJCA 4P4GA 3K1JA 2GBCA 1MOQA 2RGEA 1R6UA 2BHLA 3G2PA 3E15A 1T34A 3B5IA 2ODQA 4QDZA 5BR8B 1BRMA 5D2CA 3PQEA 1QYRA 2HCBA 4JT8A 1QRAA 4BDSA 4E1BA 1PJLA 1WW2A 2EEPA 1Z6YA 2FX5A 3CEJA 2VPYA 4MW5A 3S3TA 1Z6ZA 3EAFA 4CN8A 4E7OA 4EEKA 1V95A 5IS2A 3CGWA 1NF8A 5A4IS 3OPNA 3OJFA 3D6AA 5L53A 1W19A 3VVMA 5CTJA 3PX3A 1U28A 2ECFA 3BJRA 3EHEA 3IOBA 5DHRA 4U2DA 4IKPA 4BUJA 3JRXA 5KC9A 1R0XA 1JHDA 1UJ6A 4RPGA 1TEHA 1AB6A 2ONKA 2XVXA 4JYCA 2EJVA 2DUMA 3T5AA 1SA0A 2WC1A 1DMRA 1NMSA 1P5JA 3AHCA 1T1RA 1T8PA 4I9HA 1S0UA 3N0RA 5IJ0B 4CFZA 1ADJA 2YXPX 4P81A 4Y6GB 5DASA 5EVCA 3DOHA 2I7DA 2AXQA 2FSUA 4MI9A 4UUQA 3GEIA 2OL4A 3NH9A 1NBEA 4IX1A 2JFZA 4AJPA 5AKJA 4E11A 4DG8A 1J8DA 4W7HA 1OGYA 3IKLA 4DLZA 3EVEA 2QL7A 2W2LD 4XUCA 3AVPA 3SM3A 2ASVA 2FA9A 4QPCA 2AMJA 2VDWB 2OMEA 1ZHHA 2II6A 2GPSA 3QE2A 5FXMA 4Z99A 4M0UA 3UJ3X 3WIBA 4U39A 1MJNA 3FJOA 2Z9CA 5E38A 3UMBA 3A1CA 4RHTA 3QSGA 1RQ2A 4A92A 3PR2B 4RZSA 1FVHA 2FZ4A 5TF0A 3EAQA 4FMDF 3SLGA 1VL1A 2C31A 2V74B 2YJ4A 4MUHA 2I62A 1HEUA 2PT5A 1IY8A 2BZ0A 1OFVA 1GR1A 3IRVA 1DRUA 3L1IA 4QJ4A 5F4BA 5B4VA 3CSDA 3FNRA 1DEXA 2R79A 3NWPA 1AKRA 1C81A 1CQIB 4NYJQ 2HSDA 2X0IA 4P9NA 3HKCA 4G4IA 4YXWA 4QM7A 4F06A 5ADHA 4R0MA 1T9DA 1RWNA 3WK7A 1JYFA 3H5LA 5AJHA 2AKEA 1VL2A 2VSYA 1RQXA 3K2IA 3FCUB 3ZDRA 1N3YA 3SQOA 4I4TA 2NW6A 1NF2A 4C7XA 3SHVA 2YHAA 1R6TA 2QTMA 4ITVA 3TOZA 2Q2OA 5JDIC 4FHDA 4E0BA 3BD7A 3K9NA 1UC8A 4LJ9A 2B21A 1ML4A 3NTVA 3H87A 4U0KA 2J0VA 4W1RA 5J1TB 4O4JA 2SICE 4MLDA 3STUA 1YE3A 3NDJA 3D4PA 3QHPA 1MO4A 1OSNA 1EK5A 1S2GA 4NZPA 2YH2A 4R1UA 3T4EA 2DEUA 3LDAA 3PWSA 1IWOA 3C1UA 4GX1A 1M0WA 4LC0A 3M5CA 3NZEA 1X7XB 1D2GA 1M1XB 2NU6A 1RZRD 5IG2A 5CNJA 1DKNA 2ONJA 3K1TA 2OOKA 4KRYA 4TV8B 4G89A 1FU8A 1UBKS 3SSAA 5AFSA 4BO6A 3TBFA 3T1YB 1WW3A 3HN6A 1YBAA 1XEXA 1K4KA 3EIHA 5E7JA 4AXXA 3KJEA 1WCXA 5GZ3A 3MILA 1Q95A 3WSTA 3I53A 1JTFA 4CQMA 2I2BA 1A4XA 1C3OA 2IKSA 2MINA 3U13A 4FYKA 2GJ9A 4JSYA 1CR4A 4C9BA 4K5QA 3WIVA 2FP3A 5IF9A 2COKA 4NOLA 3RPEA 2B3TA 4BV2A 3MM4A 3QKRB 4YRLA 2QUKA 5CVDA 2VSNA 1C9YA 3SBXA 1YGPA 5B5SA 4CQNA 1NBAA 3OE5A 3SQMA 5I8WA 1GCUA 3X43A 2BWJA 4CEHA 3VI4B 2Y6UA 1YHZA 2ECQA 5HKKD 1OQAA 3JATB 1P6QA 3WICA 5EHXA 2X4LA 1Z2PX 4MKFA 2XNCA 4BEVA 1H22A 2ZUBA 4UMEA 2ZSKA 3AC0A 4FQ5A 5F2KA 4M0KA 3T06B 3UO8B 1RJWA 3GLVA 3HLTA 4JVNA 3TLEA 5KNDH 4MLZA 2FDCA 3G1UA 4MWDA 5KREA 4RKRA 4TVKA 1BE1A 1I2CA 3QKWA 3DM5A 3FZQA 1GA4A 5LWHA 1EM8B 1Z5OA 4PLVA 4O25A 2VBFA 3EAGA 2PS3A 1CUIA 1LZLA 3E70C 2CVPA 3OIYA 1ONNA 3QPVA 4OMDA 4JVOA 5DIZA 4MRRA 5FUYA 5K3FA 4BLQA 4CM3A 1PG0A 4JQCA 1IZYA 1KF0A 2W0SA 3H1GA 5LOVA 4QDUA 1HFWA 3LFTA 4RIIA 2XNJA 1ZH4A 1FSPA 5C2JB 3NTOA 3WBKA 2QLFA 1OAOA 4L5CA 1XB2A 3H16A 4NPAA 1EBBA 4I6JA 2JIOA 3SFTA 2GD6A 2QN3A 3DW1X 5DHUA 2NU8B 2QRQA 3PDJA 1I7DA 2NO6A 1H4TA 1CDOA 3COZA 3JWGA 2BFBB 4Q9NA 5ARCA 1XZNA 3FYHA 3PEUA 4I3GA 5LBUA 4N6NA 5IAAA 2X4IA 4DA4A 4PO8A 1RC0A 5HCNA 1EX6A 3V7YA 4OAOA 1UJNA 1Z82A 4QDXA 3ROPA 1MC8A 2BKAA 1FFSA 1ZRHA 2O8CA 4KBYA 5IN4A 2V7QA 6AT1A 4RIFA 3NWBA 4YDRA 5IANA 5JLJA 2JFUA 4IPTA 2HK8A 3D3EA 3HC7A 4XR4A 1XOIA 4KU4A 4XIJA 5COQA 1F1BA 2WR8A 4YONB 2VYQA 4MKGA 4XWKA 4H7EA 5LQKA 2XHEA 3T9DA 1QR2A 3FMGA 3AI1A 1L4KA 2HHLA 1PSZA 1YUMA 2I9PA 2GEDA 1BA3A 3EF1A 1QRDA 4D25A 4MYSA 5L6MB 3DXXA 2GK3A 2YOHA 2D4AA 1S4MA 1YVDA 3AG5A 3C3YA 3KLPX 3NETA 3NJRA 1J90A 3GA0A 3ESZA 5AUOB 4QOIA 1L7EA 1QG4A 4XE5A 3WC4A 2PUVA 3BGOS 2SECE 1WKCA 3D0RA 1T0BA 3IILA 4UEOA 5KPJA 4GRAA 2RGYA 5TQVA 3FUCA 3AY3A 1NR1A 3PC6A 2WWIA 2EVWX 4BNLA 4BNVA 5K8LA 2DB3A 2PL3A 2XDQB 3DEFA 3E7DA 3RLFA 3M9XA 1ZAYA 1Z0SA 3CPJB 4DA9A 3NM4A 2OM6A 4GOJA 5EFZA 5EXPA 3WZLA 3QXXA 3AEXA 2BE7A 3QLUC 5BT8A 3GGGA 4NCXA 3RTGA 3QXSA 2FEAA 4R8VA 4WNIA 1LI7A 4GE3A 1IBLB 1ZJZA 1O7JA 5T4BA 1C3EA 2ZTHA 1DJMA 1P7ZA 1H0RA 1YDMA 2V5VA 3H86A 4MYDA 4YMSA 1C2TA 2W6MA 4BGIA 5DE3A 1TJ3A 4O0MA 1IVNA 1VCMA 1DXQA 4PC6A 1Z25A 2P2LA 3ZDZB 3NGLA 4G8CA 5EMNA 2G88A 1L4MA 2CE2X 4BATA 4LZOA 4MUXA 4N0DA 3U61B 4N5LA 4CIAA 1YR6A 2AG5A 4R84A 1KI8A 5L45A 3AL0C 1KK1A 4IOLA 1NNLA 3RC3A 1PUJA 3OLXA 4JJIA 5EWJB 5F4ZA 1ZGCA 2DG2A 2GYVA 3BMQA 2DCUA 2FMHA 4Y2GA 5MFZA 1M5RA 4RHCA 3I9V1 4RPHA 1LJUA 1U0NA 1A5ZA 2WDPA 2A88A 1MENA 2YOGA 5CGZA 4TN1A 5LIRA 2AYYA 1L4EA 1JSXA 3DZCA 1VLMA 4ZVLA 1JFVA 3IBGA 1I14A 3FKQA 1PL6A 3NBUA 4DMKA 3MCTA 4AUKA 5AJVB 4AP9A 3GYGA 4D3DA 1K7SN 2R8PA 3N3AC 1GTRA 2IOQA 4YQZA 4YV0A 1QP4A 1T15A 3HPRA 3K2QA 2VTKA 2ZRGA 3AIKA 3LIPA 3N8IA 4YVFA 3T0GA 4G9BA 4P4UA 2O3TA 3VDQA 1AKVA 4R1QA 7REQB 4LWOA 4BGEA 1SC3A 4PX9A 4DKXA 3EE6A 1TEVA 3F7MA 2F3SA 4F4UA 4X65B 1SMKA 2JLBA 1FDOA 4W1SA 1K8QA 2JCGA 4L74A 1B76A 4IDNA 4MVJA 1Q15A 2GEFA 4MYHA 4LHWA 3GNSA 3TRJA 5EIEA 5KSWB 1XNGA 2JARA 4GAEA 4NK4A 4DANA 3IQFA 2FZEA 1V5GA 2YFKA 3T4XA 2C1XA 1F5NA 1ZCBA 2KWIA 2YNMD 4OLBA 2G07A 4QJ5A 4LRWA 1I4WA 4BP1A 3R23A 2J3LA 2QN2A 4QAQA 1WX1A 2I2XB 4HDCA 4LN1A 4W6ZA 4RDCA 5FOTA 4CZ2A 2TYSB 4OHYA 1PAUA 3S1SA 1R7RA 3ML1A 2IDZA 3MLBA 4MUFA 5TQ0A 2EL7A 1DAGA 5COAA 4G4SO 4HWGA 4OLFA 1XLTC 4XPIA 3TWOA 3THYB 3S40A 5H9VA 3TXYA 1DAPA 3H3FA 1L4HA 2R5FA 3QLVA 4JELA 1ZSVA 2PMFA 5LA6A 3A4TA 3MTJA 2YMMA 4QT4A 3IMCA 2R7MA 1LBTA 3KB2A 4Q1DA 2C4KA 2W2KA 3GW8A 3HGTA 5BSEA 2FHSA 3PI7A 1SBZA 1UR5A 4NJEB 3UGJA 2YXLA 1V8FA 3HO8A 3QU4A 3B2EA 4YALA 1D3AA 3UWMA 3ZWPA 3T5PA 2W6QA 3EUWA 2VJKA 1GPLA 3DTYA 4F6LA 4QARA 3FDFA 3V34A 3DAPA 1YZHA 3EZ9A 4TWZA 1PTJC 3R0ZA 1W75A 3BIJA 5E6UB 4N65A 2K87A 5AVQA 4LOAA 3HCPA 1M6VB 4TSRA 5L3QB 5L4LA 1DS6A 2JDID 1M0SA 3A4NA 2A9RA 2ZSDA 2FR0A 4L08A 4ZQHA 2C8KA 1EUZA 2Y0CA 3OLWA 4QHYA 1S3GA 2B4RO 1LTQA 2ZVJA 2Y1FA 2AJDA 1E2JA 3PEFA 2XCOA 3QMVA 2CLMB 1Z88A 1N8SA 4IDHA 1GUBA 1P1KA 1PO7A 2NN3C 2VH1A 3HN7A 3SZRA 5JSHA 3LRPA 1MP0A 1PW5A 5JY1A 1DJOA 5H59A 3DT8A 4ZPJA 2R6GA 4P7GA 5CM8B 4OL9A 1M2VA 5TMEA 1P8AA 2M98A 3SQNA 2RAVA 3MB5A 1EYZA 5DRTA 3R5HA 1KDZA 3TEMA 3B1ZA 3IDAA 5D51S 4WN3A 3X2SA 2QSZA 3HBJA 5C0OE 1OKKA 4HKTA 5C5CA 2X7XA 1YC5A 2XDYA 2EATA 2ZRDA 3GAZA 4B4UA 2QUIA 2VHZA 3O83A 4UAUA 1GQFA 1QP7A 4AMVA 1SXJB 3BJZA 5DXFA 5GOZA 2YJNA 3BBLA 5HKLA 5JIBA 1JDZA 4YP6A 2C57A 5ALZA 3RQSA 1L8QA 3R0QA 2GVDC 3SIWA 4DCMA 5JSUA 3IT3A 2IH2A 1Q12A 2XZOA 5EA2A 2IW3A 1RIFA 5CA0B 2DWQA 4DJDC 4J2HA 1OFIA 4DMCA 2JGIA 5F76A 1JFLA 2C2HA 3H18A 1N2GA 4EF5A 4O3FA 1XKXA 2H65A 4KO4S 3NV9A 3I2FA 2VJPA 2UUOA 4HS4A 4BVGA 2L19A 2ZZKA 1NC1A 2HU2A 3Q1KA 4YR9A 1SCAA 1FFGA 3PEVA 1YMVA 3KCQA 2VJAA 1KBZA 4BJ5A 3QUAA 3V4FA 5HDBB 4CLHA 4DC0A 2Y9PB 1S89A 3BEDA 2Z1DA 4G23A 1LI4A 1W4RA 1BSVA 2EJTA 4JLMA 4NY1A 4YHBA 3VR4H 1LPMA 4A8JB 5A0VA 2Q2WA 2VHXA 4RAOA 3EH1A 3AGQA 1JXMA 3CMCO 3G85A 4XB2A 4D0RA 4DIBA 4X6XA 3EEOA 3DR5A 2BFWA 4JI4B 5DBFA 2C3MA 2O3QA 5J5AA 1ZC4A 1SVOA 3ODPA 4PO3X 4RZ3A 3I2KA 5FX2A 3O4GA 1BJKA 1IDOA 3UV6A 4BFTA 4N39A 1NR7A 5FJJA 4N0EA 2FFAA 3IP7A 2Q8NA 4AJHA 4UBOA 1BMFA 3F67A 4U7FA 3DBHA 4P80A 1T1IA 4S24A 3BS4A 2AXEA 2VZ0A 1J09A 2WAAA 4KQFA 5AM0A 5CDFA 1CUFA 3GMTA 1IVSA 2DPXA 2E9SA 3IPYA 1R0YA 4OA5A 5DM4A 5DYYA 3T1OA 1KZ4A 1U4OA 1XZGA 2WFMA 1MORA 3PCXA 2AGVA 2P0EA 2YV3A 3PENA 4E3WA 1ENOA 4G09A 1QIJA 3L0ZA 2Z8XA 2G8NA 1JPNA 1BCSB 2JEZA 4XDZA 1H3FA 4I9NA 2R8OA 3IP8A 3A05A 2H51A 4NG4A 2IW1A 4TKLA 4UUAA 3KRTA 3F2VA 2J0EA 3Q0IA 2QIPA 1F2DA 1R6VA 2FPGB 2HA4A 2JGMA 1GFZA 4GI2A 3SXJA 1JTEA 4HO1X 4QQ8A 4N18A 3WYEA 3C8ZA 4CPDA 5JXWA 1SULA 4YROA 1L5VA 5D85A 1HMYA 5BMVA 4L9SA 3H0CA 2X9NA 4H7HA 2P7HA 1MJGM 2IXGA 3O4RA 4MMXB 1GCOA 2IHTA 5CVUA 3FYUB 4KFTA 3HCRA 4NV1A 4QFMA 5HWSA 1YOBA 4ND8B 3TN7A 4ZI7F 2NQ8A 1OU0A 1PJ3A 2VTVA 9GPBA 5CLHA 4GNRA 5LM3A 1NRIA 5KPDA 1F6BA 3Q7RA 3BA6A 4WLVA 3LKVA 1P45A 3GD7A 1M1NB 3U3RA 1Y4DE 1L1EA 3ZGLA 4ARUA 3G17A 1G21B 4B6RA 5FA6A 2TMGA 3I6IA 1DO0A 1DRJA 4BE7B 3WLJA 4G0PA 2QRGA 4YJKA 1NE7A 3GXBA 5DNUA 2FWRA 1E0AA 3CPSA 3MIZA 5AVZA 1PJQA 1Z0DA 1F9EA 2F6RA 2BLLA 3AJDA 3IEIA 4C30A 5KTTA 3EFBA 3K0SA 1Q17A 4G41A 1GQSA 1VPVA 3JCZA 4ZYLA 1WBBA 3WRWA 1TM3E 4WEQA 2J8ZA 2CL7X 5I6DA 4GICA 1N6RA 2LKDA 4M0PA 2PWBA 2NGRA 4TMWA 1I7SB 1M2FA 1XLUA 2ZBGA 4IIJA 3PQ7A 3R09A 1EQ2A 2X15A 2G40A 1FVOA 4MS1A 3NXSA 5D1HA 3CRZA 1SWWA 1GAJA 1JZTA 2QPLA 3T7JA 2X5NA 2ZAIA 5EUMA 3N2NA 5JWHA 1YKFA 3N87A 4BVKA 2IYWA 2PZGA 3E03A 1GZ3A 1EFLA 2M1ZA 1L8XA 2IZZA 1UBFA 3DSRA 1NW6A 1TUBA 3O8BA 5ALUA 4DDVA 1K7EB 5JASA 1AA9A 4H1VA 3ZI7A 2G0NA 2MYUA 3EOAI 4TUYA 4YUWA 1H5UA 2KHZA 4UE2A 2IUTA 4Q82A 2ZIAA 2V4MA 1SUAA 1BEZA 3I6BA 4UNSA 1GQQA 3LAWA 4GD3Q 3TXXA 4YUAA 5LYJF 4LX8A 1FMTA 2NIPA 3RVQA 2OG1A 4AKSA 1M10A 2O7RA 3RVNA 3HKEA 3R6TA 1J2JA 1XTIA 3MT9A 1JPJA 4YCMA 4B9AA 2W70A 2DUUA 3WQBA 2QHXA 2WUDA 4HYQA 2VC2B 1KSGA 3S7TA 1R4ZA 1T5OA 2ZJ4A 4WK2B 3OZXA 5MGNA 1W29A 3LOQA 5THXA 4H7KA 3A3PA 3AWDA 3UB2A 5U1PA 2KPOA 2UYQA 3VGJA 2JVJA 2WSMA 4LJAA 2AXPA 4NONA 3RIGA 1EUQA 1UDAA 5TR9A 3D6VA 5JPIA 1NUTA 1TK2A 4NF2A 1AM4D 4TV9F 1JQ3A 5HJEA 5LOVF 5HFNA 2ORVA 2NZ2A 3FVRA 4YCJA 5DX0A 4YAIA 1RYFA 3LVBA 3G49A 3TLZA 3KNZA 4U6SA 3HCDA 3BWDD 1H6BA 2BGTA 4HDQB 3KXKA 1QV9A 1KWGA 4YCNA 4BV3A 3WZMA 5A4DA 5K8JB 1Z4PX 1TE2A 5JJIA 3PLRA 1JR3E 5F2OA 5M2QA 1SK9A 2CMKA 3TZBA 2R00A 2RJOA 2RHJA 2Z2YA 1K9VF 1MQ8B 3ZY2A 1EFUA 1Q57A 3GN2A 3U2QA 2X5OA 1G8HA 4ARZB 1QBKC 4WSOA 1SU7A 2J3EA 3F1KA 3T3HA 3NIDB 1IH8A 4M54A 4DLLA 1F7VA 5BV1A 5AKZA 4P3PA 4V1CB 1UT8A 3QUBA 4PTYA 5IAGA 3HP1A 3NW9A 1BDBA 1DPFA 1XJ0A 4QDJA 5FOSA 3EZGA 3DLBA 1J5XA 3SYTA 3P27A 4NCAA 1UKVY 2GZHA 4AMGA 3RW9A 2DGDA 5B1YA 2Z83A 3V42A 3ZHXA 5JMOA 5LWQA 2EFGA 4Z4EA 2XGSA 3TYXA 2GOYA 4NARA 1VPTA 2BT4A 3QFCA 5CX1B 1V8ZA 5JC8A 1A0OA 2XDAA 2FETA 4ZWNA 3ZGNA 1EBUA 1UF9A 2RG1A 4JLUA 4DM3A 2I4IA 1Q6YA 3Q10A 3O4VA 2J9XB 1FLNA 4HWOA 4KAFA 4E08A 3WMGA 4EHKA 2JF0A 2WB2A 2QUJA 3VYVA 5BV8A 3PR1A 5TQ2B 5TT0A 1PX0A 4LOKA 2JJQA 2XQJA 1UKAA 3PLAE 4MAFA 2RAPA 4RSMA 5EJFA 4MUBA 5C7YA 3IRUA 5HK8A 3JWIA 3S29A 3L01A 2FG6C 1S8NA 4FEAA 4BNUA 1PR4A 1WCYA 2BCGY 4U00A 2PUFA 2FUKA 3QEMA 2UZ3A 3AR5A 4KDCA 5CRIA 4AO8A 1WXIA 4FDTA 1OVMA 1US8A 2A9JA 3C5VA 4G01B 1C4WA 1ECBA 1U6KA 3JARB 2HB6A 4BZXA 3RIYA 3R7DA 1ONSA 2F8LA 2P9JA 4CEIB 4X6UA 1ND5A 4XM1A 5GP1A 5LKAA 4TYWA 5K1SA 3GV0A 4UZSA 2QRVA 3ZWWA 1RMTA 5E3JA 1MJFA 1ZNWA 2D5CA 4ZZIA 5BVHA 4UEKA 1J2EA 5IM5A 3I6ZA 3QI2A 5ALRA 3UEOA 1YQGA 4JCCA 1OXMA 4EVSA 5TRTA 2G67A 5BRAA 4G0UA 1DBSA 3ZN2A 2FE1A 1TC1A 2G7ZA 2MMGA 1ODLA 2VP2A 2R1UA 2W7TA 3JQ9C 1EG2A 4JH0A 3FWYA 4QEZA 2QYSA 3RNOA 3WDKA 4B9EA 1IUPA 1EP3B 2OXFA 4ZIRA 1E2UA 1ZZGA 2F90A 5JVDF 3FNFA 1XTKA 3TO5A 2CNDA 4GGMX 4I0WB 1LK5A 2V6MA 4OHPA 1P3Y1 3A9SA 4US1R 2WF6A 4A6XA 5GTDA 1ZUD1 4W9RA 1YB1A 4EKYA 5EIWA 2XWJI 3ADPA 1JG2A 1EDOA 4O4LB 3WK6A 4ARIA 3R9XA 1N75A 2D74A 2HDWA 1CEYA 3TLKA 1QWOA 4C08A 1NBME 3DTTA 1RE1A 4KVZA 1ESNA 3F9RA 3RYFA 3ZCQA 1RQRA 1Y6RA 4ML3A 3K0FA 1CHDA 3W90A 2QTVA 3PIIA 3I37X 4N6OA 2HSGA 3ETLA 2PKQP 3V7NA 3UXHA 3CVJA 3L84A 4Q1AA 4RD1A 4KYTA 2LDBA 1P4AA 2YV5A 1WD7A 4KB5A 1TCCA 4UEWA 1CIPA 3G8CA 5AVRA 6Q21A 3DBOB 3I64A 1WZUA 2XOXA 3G82C 2OD2A 1DQRA 3KU4A 2OORC 3GIDA 4OHWA 2WD9A 2R1VA 2YC2C 1X38A 1ULHA 4X1YA 3LGXA 3U4QA 2VCHA 2O14A 4KLNA 2ZUTA 4LQLA 2IEGA 3LW8A 4K03A 4BIIA 2PS1A 2VWQA 5AXBA 1IJBA 5LXTF 5I45A 2AJBA 1D2NA 1TI7A 1KIMA 1UFVA 4KO3S 5I9SA 4LSZA 1UPTA 1NVWQ 1KK2A 2R6AA 3AEQB 1ABEA 3K1AB 3MYRA 2P6MA 3K53A 3RK0A 1NGSA 2XUIA 4HDKA 4M38A 1Q0SA 4XJXA 1EUDA 2NAFA 1OF1A 4HWTA 2RBGA 5EKSA 2WFLB 3EUAA 3RRFA 3M49A 3KP1A 3H97A 3NHSA 2AUTA 5MDHA 3BRWD 2O2DA 3U0BA 1QH9A 4H1TA 3E5RA 3LUGA 3PQ2A 1X8XA 4KG7A 1KH2A 5DJ5A 1L5GB 1Q7GA 4ZT5A 1U3FA 1RR6A 2WM8A 1KKLA 1PJAA 3BM5A 4R0NA 5TPWB 3CQ9A 3R0XA 2XUQA 1FTWA 1GHTA 3KHUA 4J03A 4ZAGA 4TOIA 2B25A 1LBIA 3EIWA 1DWUA 3SOZA 2FUG1 2X58A 1V41E 4BWYA 3N8GA 5B12A 1YS2X 2GPJA 1SXQA 4JBXA 2X40A 2Q6IA 4QGGA 2R8YA 4YJ2B 5CLJA 5LKRA 4X54A 2AOXA 3GJSA 4MR7B 1A9YA 1XD9A 1JIIA 1BTOA 3G88A 4L3WA 4ACAA 3D8NA 3RHFA 2VL7A 2D3TA 2PRIA 4MA5A 2RGNC 3UMSA 5GVSA 1KQ3A 1XA0A 1IWBB 2OFPA 3H5VA 4P5PA 1JQDA 2PZEA 1MRSA 4KMRA 5BO5A 4PNZA 5BSWA 2QY9A 4WXPA 1ECFA 2VNSA 2UYYA 5AVKA 2QB5A 3CPEA 1IBSA 2Q3MA 3JW8A 1PT6A 3KR9A 3LPNA 4W7IA 4DIEA 2R65A 1GV1A 1V3TA 5AT1A 2REQB 3AHHA 1B4DA 4U2FA 2BYTA 3ACDA 3DZIA 2YIJA 4F84A 2WYHA 4NCKA 1O95A 1JS1X 4UM9B 4N0QA 2UVPB 3F3MA 3HL4A 4XD7D 2CJYA 3GP5A 1V8BA 1WG8A 4LBYA 5BMOA 2XQVA 2V97A 4N5MA 4XTRA 3CVOA 2O1WA 1KI9A 1VRWA 3CE9A 4WKGA 5HBRA 4X62B 1M3SA 1V1MB 4P92A 2F67A 4S1TA 1LNZA 1N2OA 3CUKA 3F96A 1R18A 1MIOB 3JAWB 1YI8A 4HAVA 4O59O 3P2YA 2ZM5A 1QGUA 2YC4C 4KNWA 4MW2A 5H8WA 3T38A 4OB7A 1QIMA 5DHTA 4IL5A 1CD5A 3H05A 1KU0A 4RENA 2I6SA 3DDSA 1TJ5A 1J0BA 2JGRA 1CS0B 2EBFX 3QOFA 4Y0NA 1SC1A 1CS4C 4YQEA 2JGFA 2YRXA 1XBTA 4I2NA 3L1VA 2QQFA 4MJ7A 1WZEA 4FGWA 3B13B 1WULS 1UBSB 4OBXA 2P4SA 5CT9A 4X20A 3SKVA 1UODA 3KEMA 3C4JA 3GJ4A 4HPXB 5JATA 1Y6GA 3DONA 4KLZA 3WRYC 3M2PA 4A27A 3BCUA 4JL6A 2WP0A 3FE2A 2HR1A 1XF1A 2GLTA 3OZIA 3S44A 2MDTA 1VKOA 3CHYA 3H5TA 3URKA 3ICPA 4KXVA 1L7BA 3U16A 1ZINA 4RPJA 2KM1A 4WOBA 3OFNA 2DVMA 1ZBQA 3T7SA 3ZY4A 3DFUA 4Q4LA 2XWSA 4KQ6A 3Q7IA 4AC9A 1VRVA 3HCAA 4YTEA 1XCGB 3WLOA 1DTWA 3M4ZA 1U2DA 3WWPA 3SYRA 4DTIA 2VPTA 4G86A 4UD6A 2QG9A 4F6CA 1KDTA 3IGFA 5J23A 5DM2A 3DMHA 3EA0A 3AFGA 3ICOA 3KKKA 1NT2A 2ZB4A 2PL1A 5C5IA 3EXEA 1DE0A 4HXYA 4M1OA 1I7NA 1Q3HA 1B3BA 4M0CA 3QMMA 1AXGA 3CV3A 4BLOA 3DWEX 2TS1A 2XMSA 3KZXA 4MVJH 5EZYF 4EI7A 2XITA 3AY0A 1HG0A 1MG0A 2W2OA 3ZWCA 1I9GA 5H16A 5IZCA 2DE0X 3A3YA 1CR1A 1DX9A 2I66A 4NBKA 4OHVA 5E0OA 5LB4A 4ASUD 3ZCTA 3BE4A 4Y9UA 2XUOA 1Y9JA 3A1NA 3LWBA 4HVTA 2CYAA 3O9ZA 1O03A 1DAOA 3QLJA 4LXIA 4V1CA 1UJBA 4M1TA 3CKMA 4M9QA 4RA9B 5JSZA 2ZPAA 3N2KA 3OT1B 4TXNA 4KDFA 3BSFA 3IVCA 2CBXA 4PS1A 3AVWA 1JVBA 1YR2A 5M29A 1AHPA 5JQGF 3O26A 3RF6A 2HV9A 1BN6A 1SHLA 3L8HA 2NXEA 3DOFA 1X80B 1MRZA 3D8RA 4DGQA 3DVAB 1W5TA 2JATA 3ND7A 2W2LA 4OMUA 1B2LA 4HC4A 1ZH6A 1J0XO 1DL5A 4GDMA 2EKPA 3FB4A 3A37A 1KZGB 1WLSA 3EXG1 3F5SA 1TGVA 4E2WA 5ICGA 2GKSA 5JNSA 4MDFA 1E1YA 1QCCA 3LY5A 3SP1A 4CV2A 3IEXA 3PEWA 1LPBB 3GB9A 1DMSA 4RO0A 1P5ZB 3T1QA 2R8RA 2I2FA 4QODA 3PGJA 1XTRA 1VIVA 4EB0A 1RHMA 3MCWA 4LXUA 3I1FA 5AJYA 4BP9A 2Y0EA 4L8FA 2B2XA 3JYPA 5C9ZA 3EQ7A 4ODIA 1L5HA 2GEUA 3CX8A 1BKYA 1E2KA 1HBJA 2FZGA 4PAWA 4RVDA 3NDIA 4TWJA 2YYAA 5DI3B 3FD8A 3O90A 1AVTA 1LQUA 2C8VA 4IOMA 4ZOBA 6PFKA 2A0XA