4A0SA

Structure of the 2-octenoyl-coa carboxylase reductase cinf in complex with nadp and 2-octenoyl-coa
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
445
structure length
445
Chain Sequence
SSLSRAVLDGASAAEIEAAPVPDTYLALHLRAEDADMFKGVADKDVRKSLRLGEVPMPELAPDEVLVAVMASSINYNTVWSAMFEPIPTFHFLKQNARQGGWATRHDQPYHVLGSDCSGVVVRTGIGVRRWKPGDHVIVHPAHVDEQEPATHGDGMLGTEQRAWGFETNFGGLAEYGVVRASQLLPKPAHLTWEEAAVSPLCAGTAYRMLVSDRGAQMKQGDIVLIWGASGGLGSYAIQFVKNGGGIPVAVVSSAQKEAAVRALGCDLVINRAELGITDDIADDPRRVVETGRKLAKLVVEKAGREPDIVFEHTGRVTFGLSVIVARRGGTVVTCGSSSGYLHTFDNRYLWMKLKKIVGSHGANHEEQQATNRLFESGAVVPAMSAVYPLAEAAEACRVVQTSRQVGKVAVLCMAPEQGLGVTDPDLRARLGEDRLNPLRGLTAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Unusual carbon fixation gives rise to diverse polyketide extender units.
pubmed doi rcsb
source organism Streptomyces sp.
molecule tags Oxidoreductase
molecule keywords OCTENOYL-COA REDUCTASE/CARBOXYLASE
total genus 162
structure length 445
sequence length 445
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4a0sA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4a0sA01
5L4LA 1UXKA 4A2CA 1E3LA 1WZIA 3H3JA 3JYLA 2Y1CA 4TVOA 5AXBA 1E6WA 2O50A 5JC1A 2NTVA 4CLOB 4FBGA 1BWSA 1YS4A 2GASA 4IDGA 1ZK2A 3ZNQA 1ZK3A 1EVZA 4QQRA 2CSUA 2DTDA 4U7WA 1G0NA 5ICSA 5ENVA 3FRJA 2Q2VA 3QA9A 1LLCA 4XIJA 4A27A 1NHGA 3AUSA 3NJ4A 2ZTUA 1ZBQA 1QKIA 4FGSA 2YZ7A 5DDIP 4LSMA 3JQDA 4BKUA 1W4ZA 1HT0A 1YDEA 5T8KC 2QRJA 5KJFA 1MFPA 5I7VA 2VZ9A 5EQFA 3SC6A 2V6BA 5DF1A 1T4DA 2G1UA 1LDBA 2BFAA 3KVOA 3MZ0A 2ILTA 4GWKA 3T7EA 5G0SA 4BQRA 3TL3A 1GQQA 1M2WA 1JU9A 1UP6A 5U4QA 2Y67A 3K30A 2D5CA 3OP4A 3A14A 2CVOA 4I1IA 1DIRA 3NJ8A 2RBEA 2ZATA 5H83A 4L76A 4GKVA 1GDHA 4W99A 1M6WA 1R0KA 3TFOA 4DPLA 4TRJA 4Z9FA 1PZEA 2AQKA 1BSVA 1E7WA 3D4PA 1X13A 2B69A 2PD6A 3AOEA 3GUCA 4RLSA 1RYEA 3VZRA 1HETA 2JAHA 2EW2A 4AJLA 2GD1O 1PWZA 2W2KB 3WR5A 5I8WA 4WJZA 1RM5A 4YT2A 2W98A 3O8QA 1NWCA 3ITKA 1WDMA 3CMMA 4AVYA 2X8LA 4AJ4A 1HSOA 2Z5LA 3AW9A 3PHHA 3QVXA 4J2OA 4M49A 5B4TA 1SBYA 1BXGA 3WGZA 2GF2A 4R16A 3I9MA 4ROSA 3WOHA 2NUAA 3BTOA 1T2CA 4O5OA 2AXQA 1SNYA 8LDHA 3ASVA 3QV1A 1ISHA 3I52A 2X9NA 4M8SA 3ADOA 3D64A 1MXFA 1K3TA 1PJ2A 4P38A 5A5EA 3RC1A 4BVAA 4NR0A 1E1LA 3ZWMA 4IDAA 1LSSA 4MOWA 1DIHA 4FN4A 3E03A 3M2TA 3ZV3A 4FFMA 5BSHA 3TZCA 5IFLA 1F06A 4OOEA 4UVGA 5DCYA 4II3A 4U0JA 5G4KB 2O7QA 4RZHA 1RM0A 3ULKA 4R3NA 2DAPA 3ZV6A 3WGQA 1K89A 1EK5A 3QHAA 4CL8A 2NWQA 1MXHA 1XYGA 1U2GA 3ITDA 4YDRA 2POQX 2XXJA 4G5HA 3ZHYA 4E33A 5A9SB 4UUNA 1YOVA 3ZWNA 4J9VA 1O94A 5HS4A 4YXFA 4ONEA 1N1GA 1V35A 5KNLA 1YQDA 4L74A 3DZBA 4DQUA 4NG5A 2JKVA 2GZ3A 3RCBA 4GWGA 2JFHA 1MC5A 2VRBA 4ZRMA 4E3ZA 1MC4A 2HKIA 3RI3A 3K96A 1OI7A 5CPFA 4AJJA 2FY8A 1PJBA 3GVIA 1A72A 5TLSA 2FR0A 2WM3A 3TJRA 3JD0A 4XJTA 4FGWA 5JS6A 3PJDA 4D44A 4CMEC 1NVTA 3BYZA 3ZHZA 2FPGA 4YRDA 1R16A 3I6QA 4ND5A 3RC2A 5JAZA 3A06A 4DUPA 4MVJP 5DBFA 3VOSA 1MP0A 3DDNA 1PS0A 4HY3A 4YT5A 4S3MA 3G3EA 1QYXA 2OFPA 1BW9A 3GF4A 3VH4A 1F8GA 5CEFA 3ZU2A 1UP4A 1LDGA 3DAGA 2HAEA 3PXXA 1L7DA 4EDFA 3JQ8B 4PG8A 2DTEA 5F1PA 2CFCA 1EK6A 2NU7A 3S1LA 3GVPA 4JX8A 2IEDA 3I1JA 2I99A 4KUGA 4A10A 1E77A 3NV9A 4W9NC 1ADGA 4GMGA 2UDPA 3WQQA 2IZ0A 4NMHA 2E48A 3C8MA 1NBOA 3GFBA 2D59A 1HKUA 3JQCA 3K9QO 3TZKA 4PLZA 1WDKA 1Y5MA 4N54A 1EVJA 1M66A 1MFZA 4ZQBA 2B4RO 2PH5A 1E1MA 1QYDA 3HSKA 3Q9UA 3E9QA 3PWZA 4ID9A 5IDXA 2BGKA 4BGEA 5C5IA 4MPDA 7MDHA 3WFIA 1NPYA 2OL4A 4XQ9A 4CM6A 4FR5A 2VZ8A 1YL5A 4PLCA 1YJQA 1FDUA 4WGGA 3FR7A 2HMVA 1YKFA 1I2BA 2RAFA 2ZTLA 1GU7A 3PGXA 4YYZA 5C7LO 3IJPA 1FK8A 4WEQA 4GLLA 1RM4A 4J7CA 1S7CA 4XR9A 1GQYA 1KVSA 2Q1SA 4PZDA 3VPHA 3FCOA 1J6UA 3WBBA 3NYWA 3ORFA 4P22A 3D1LA 1EE2A 2W4QA 3QVTA 3W1VA 2HRZA 5MDHA 3T7CA 3BMQA 2GN9A 3NX4A 3GUYA 4B3JA 3IKVA 1E1KA 1HE5A 1ZVMA 1YGYA 3OIFA 1SZJG 4YVFA 1NNUA 3CUKA 2FHSA 5DT9A 3P5SA 1JN0A 4H3VA 5KTKA 1EE9A 3ONFA 3G0OA 3WNQA 2BRUA 1CF2O 3HN7A 3ZWYA 5DNAA 1C14A 4Y67A 4PVCA 3TF5A 3E6AA 3WGYA 3I4FA 3W8FA 2NADA 5BSGA 2ZJ0A 2UV8A 1BHSA 3WG9A 4DIFA 3CTMA 5JPIA 1DHTA 4WLOA 1E92A 3GHYA 1Y8QA 1DHRA 4U0KA 2J3IA 1GR0A 2Q3EA 5KVSA 2NM0A 3TOZA 3DOOA 5L4SA 1PR3A 4L4RA 4TZTA 1GAEO 3NDJA 2LDBA 5IXYA 3OJOA 1Q7CA 1GFSA 4DBZA 1BDBA 1SOWA 2HDHA 4FC7A 3TWOA 1CWUA 1GCUA 1E3SA 2BELA 5IDQA 1X7HA 4FB5A 4ZQHA 1VJ0A 3BMOB 2VUTA 3CEAA 4IJVA 4BKPA 4XRRA 4EW6A 1LUAA 1V0JA 4CMHA 1QRRA 5C7OO 2OMEA 5THKA 3ASUA 4BS9A 3NEPX 2ZB4A 4CQMB 3E9NA 1DDOA 2CDCA 5ILGA 4XEHA 3TOXA 2AEFA 1Y81A 2V6MA 1GEGA 2FZEA 2PA3A 3KLMX 3U9LA 3N7UA 3AUTA 1VKNA 2FWMX 1J0XO 3I9OA 4BKOA 5CG2A 1ZH8A 2GDZA 2D5AA 1P44A 4BKRA 2GR9A 3I23A 1BDMA 1PJCA 4JXKA 1DJQA 4NJOA 3DZFA 4NBRA 2HCTA 4JN6B 3W8EA 1ZW1A 4CUJA 2AEJA 4EUEA 2WTBA 4RL6A 3DBLB 3O26A 1UJMA 5F1KA 4R51A 2O4UX 4YQZA 4YJGA 4PRKA 3ADPA 4JJGA 4BNTA 5A03A 3PZRA 3ROQA 4MO2A 1TB4A 1LXCA 1Y8RB 2V6GA 3R6DA 2HK9A 3RWBA 4NH4A 4PZCA 3PZBA 3K2EA 1ULSA 2I76A 4A26A 4HADA 3S2GA 3RJ5A 1YJ8A 5GZ1A 3PLRA 4OKIA 5KIAA 4QUKA 1M75A 3WGHA 5DOVA 5K0ZA 1ZNQO 4DWVA 4YAGA 1CQIA 2ZIZA 3WQSB 3LT0A 3R3SA 4L9RA 3R0IA 5L45A 5L7TA 2NVWA 3JQFA 4IDDA 4RVUA 4EJMA 2VHZA 3Q11A 2EJVA 2EP5A 4CM8A 3AY7A 2PGDA 1KC3A 1B14A 2C29D 4EUFA 1ZK0A 3AWDA 1E5LA 3TSCA 4XYGA 2X0IA 4XD2A 4JP3A 3MEQA 4AJ2A 3U4IA 4CV1A 2BLLA 3GVHA 1R4MB 5CDGA 2YHIB 4KWIA 1JVBA 2E49A 1Q0LA 4S1VA 1UDCA 3H9EO 3DAPA 2VT2A 3BHIA 2Q4EA 3IQDB 4W9NA 4MP8A 1P9LA 3RUIA 3HQ4O 1N8KA 2JD1A 1YBVA 4MKXA 3WFJA 5KKCA 1KVQA 3F4BA 3N74A 2O4CA 4WK6A 3VKUA 3DZJA 4RPGA 4CM4A 4WPGA 5ITWA 4JP2A 1ISFA 4KZPA 4WNIA 3RBXA 3S2EA 4KDEA 3DHEA 1UDAA 4BNLA 3EZYA 4PN3A 3OSUA 3I4CA 2JHFA 1HE2A 3WYCA 3ZWBA 3U4DA 3RQSA 2OP0A 2YFHA 3DC2A 1LC0A 4DQVA 1ZZEA 3SVTA 5FWNA 2HJSA 4EEZA 1G0OA 1NR1A 1YRLA 3KXDA 4IZIA 2IEBA 4TMFA 1I3LA 3ZWWA 5TRTA 3UHAA 1A5ZA 3GZNB 3ICPA 3LZ6A 4Y6PA 1IE3A 1U9JA 2YW9A 3WXBA 5JC8A 1X7DA 4R5MA 4HFMA 5G0WA 3C3XA 3MTGA 4B79A 4HFRA 5TS3A 4BNIA 1VJ1A 3QE3A 1DC5A 2NU9A 2B35A 3GDGA 4IGFA 4IDEA 5F3RA 3AUUA 4AL4A 4DRYA 2Q2QA 2WEKA 3GMSA 3NAQA 3CIFA 2HQ1A 1JKJA 4EUHA 4Q3NA 3WSWA 4OMUA 1BXGB 4LW8A 2NTNA 2VUSA 1GY8A 3SC4A 4ZVVA 3BMCB 3RROA 4YT4A 5KCZA 1NQOA 3FPCA 2A92A 4AJKA 4OIMA 3GNSA 3KBOA 3H9QA 4CODB 2C5AA 3FNHA 2FPPA 2J3KA 3UXYA 5TSDA 1QP8A 3C1AA 1ZXBA 1T2EA 2GGSA 3UCFA 1XLTA 5I7EA 4W7HA 1CDOA 2X86A 3D5QA 5EERA 1HTBA 4Y6SA 2FN7A 5JBIA 3D7LA 3KV3O 1IHYA 1KY5A 2EHDA 3B1FA 4GBJA 4YB8A 4BO7A 5JDIC 3B1JA 3BZUA 4IIUA 3RKUA 2NTJA 1R66A 2XAAA 5H81A 3OF2A 3WYBA 1BVRA 1KEVA 1NAHA 4GQAA 4UEOA 5TIIA 1B3RA 4CLHA 1ADBA 1RYDA 2HSDA 3KYCB 3OMLA 3R3JA 4JBIA 2CY0A 5LC1A 3WSVA 2YFQA 3S2FA 4Y8VA 2QYTA 4DPMA 3PHIA 4B4VA 2AQ8A 4N18A 3EVNA 5A1TA 2R00C 2ZQYA 4L4XA 1CRWG 4YA6A 1FF9A 4ZD6A 2VNAA 5U9CA 2Y1GA 5CPBA 4BO5A 3K73O 1ID1A 1HDZA 2ZJ1A 2GERA 3ETGA 3GNQA 2NVUB 4RVSA 1H6BA 4RVGA 1H2HA 3JTMA 3JD2A 4U6QA 3ROPA 3VC7A 2VCYA 1Y9AA 5A4DA 3GT0A 2X7HA 2GO1A 4J2HA 1KBZA 4D41A 2O2YA 1GPJA 3C24A 3INRA 4IUYA 3JV7A 4BNUA 2VYVD 1LA2A 3RUHA 3ST7A 4D42A 5LDHA 4ALJA 4PLVA 3IJRA 5A9TA 1KC1A 2ZB7A 5JNLA 2Y0EA 1DFIA 2H5LA 3IDSA 4YT8A 5K6AC 4BUCA 5FF9A 1DLIA 4KWHA 4CMGA 4PLGA 3ZW8A 2Y66A 5FI3A 4EBFA 4XQCA 3JSAA 5G4KA 4AJOA 2Y1FA 4FDAA 3ZI0A 1U28A 4UUMA 4PRLA 4LVUA 4CR6A 1MG0A 1HZJA 3OA0A 4FJ1A 3DWFA 1DO8A 3AI3A 1IZ9A 5JLAA 1XA0A 3HE3A 3A9WA 4CM9A 3JYQA 3FNFA 3TN7A 4R01A 1ENPA 3G1TA 2HMUA 3PVZA 2I66A 4RVDA 1I2ZA 1JTVA 3ANMA 2NU8A 1BW9B 3WYEA 4W82A 5DCUA 2NVBA 5HWSA 3Q9NA 4XYEA 3HN2A 3AY6A 4CMBA 4YJFA 1QXSA 3BMOA 4ZGWA 4IPTA 4MIEA 1ONOA 1BG6A 2QW8A 2VRCA 4JBGA 5AXCA 4IM7A 5HBRA 4BNYA 2C20A 1LDMA 2IDZA 2I3GA 5CAEA 4P4NA 4AFNA 3ZHXA 1VI2A 2PGJA 3NT4A 5LCXA 4GPD1 2A9FA 2EKLA 5J23A 1HLDA 2VYND 3H5RA 3PHGA 2Z1NA 3MJCA 3OQBA 3V1TC 3ZNOA 1Y9EA 2GZ1A 2QIOA 1N7HA 3HWRA 1ZMTA 4LCJA 4YPOA 1UAGA 4F6CA 3NTOA 2EGGA 5JCJD 3INGA 3PFWO 3CMCO 2DU8A 5EINA 4N5LA 5JW6A 3V5NA 1MA0A 4DL9A 1PZGA 4TWRA 4OSOA 4JK3A 1X0VA 1AXGA 4F45A 4A73A 3H5AA 4LMRA 1LNQA 2E37A 4KTTE 4B8ZA 5A06A 2A35A 3JYPA 3Q3CA 1SB8A 1U8XX 2FRDA 1T2DA 4YJDA 4FIZA 5L95A 1MGOA 4PLTA 5FFFA 2GLXA 3GFGA 3VTZA 4GGOA 1U8FO 4A7PA 3FR8A 5EESA 4IQGA 4Z0TA 3RFTA 3ZU4A 3ZZNA 1ISMA 3JYNA 4XRGA 3OJFA 4OH1A 4WASA 1WAMA 1BXZA 3Q2IA 2D2IA 2OHXA 4PLYA 5ES3A 3HB4X 3WMXA 1ADCA 1LEHA 4J43A 5G2OA 4J6FA 4CM9D 2Q1WA 1M67A 1JAXA 1FDWA 4Y9DA 4BO9A 4HBGA 1NFRA 4K6FA 4XR4A 4CPDA 2QQ5A 3VPXA 3FNGA 1XIVA 3AI2A 3EZLA 2Y05A 3TFQA 3Q1LA 1CQJA 1LDYA 2AHRA 3HADA 3VZSA 1HDGO 1Y6JA 2A4KA 1IULA 3OBBA 3S2IA 4UVEA 3VPGA 3INTA 3JQ9C 3QIVA 1HYEA 1I3MA 3DBRB 3PYLA 3ON5A 4FSHA 3JQAA 4RZIA 1HEUA 1T1SA 2JCXA 4JNKA 3K92A 3RBZA 4I9UA 1P45A 3WGIA 4J0EA 4GGPA 1PGOA 1QV7A 4XGNA 4YEDA 4BO1A 2AE1A 2VTDA 4TKLA 3ONEA 4NBTA 1N5DA 1H0KA 4HWKA 1EBUA 4WNCA 2WJPA 3PLNA 4Z9XA 2TMGA 5ER9A 3L77A 4NK5A 3BIOA 5BNTA 3ZGYA 3PK0A 1U3TA 1LJ8A 1P31A 2P9GA 3EW7A 1MG5A 3VVCA 3HDHA 2B36A 2VHWA 2AG8A 1ISGA 2HMTA 3GDOA 1N2SA 2HK7A 2X22A 4YR9A 3E8XA 1WLYA 2GN6A 3KTDA 5KVCA 1EUDA 3ROMA 2C7GA 2VQ3A 3AM4A 3FF4A 3RU9A 4KTVE 2GPTA 1I0ZA 4OO3A 1R4NA 1I24A 1U4OA 4IY1A 5CEJA 5IN4A 1VM6A 3HNPA 2DFDA 1QLHA 3PPIA 2Q50A 4BO4A 4NBWA 3LF2A 4QXMA 5TF4A 5TC4A 2QRKA 4DGSA 1OOEA 1HDXA 2GYYA 4K28A 5KKAA 3GNTA 5TX7A 2Q4BA 4C7JA 1UP7A 4WOKA 1LSUA 5JDIA 4PG5A 2OGUA 2XXBA 4RF5A 4FJ2A 4FD3A 3TZ6A 1YWGO 3ZNNA 3E18A 1Y7TA 3FI9A 4UUOA 3ZNPA 4DMMA 4E2XA 2DLDA 4MP3A 5IF3A 4J91A 5IXSA 3BTUA 4OHUA 4WCFB 4Z0HO 1KS9A 4GX0A 1K6XA 2DUUA 3H8VA 1Q0HA 2ZCUA 4ALNA 4B7CA 5BSFA 3RUCA 4EITA 5JFOA 1IYZA 4YJHA 1NVGA 4BO0A 1SB9A 2ZB3A 4CLRA 1JDJA 2WSBA 3QWFA 1F12A 4XX0A 3GY0A 3UN1A 4BO8A 4IDBA 2AMFA 4YAEA 4B4UA 1E7YA 4B4WA 1BMDA 4L4SA 4IZHA 1R4MA 3RBVA 4RCVA 4M55A 3WNVA 3C7AA 2XOXA 2LDXA 2J3JA 4UREA 1H9AA 4OGWA 3VHRA 1Q1NA 1Y8RA 4D3SA 3OEWA 3I9KA 1MV8A 2R00A 3FTPA 3A28A 1E1NA 3DBHB 3M1LA 1AHIA 2Y0CA 3SLKA 3VAZA 1RKXA 3VZQA 4NU6A 1Z73A 3RUAA 1R12A 4F6LA 3OJLA 1P1JA 3S8MA 3CH6A 2PKRA 3GEGA 4LVCA 4X54A 1TLTA 2YV3A 4H16A 2QX7A 4AJNA 1KVUA 4D3FA 3GGOA 5KJ6A 4EJ6A 3O8QB 1XKQA 1D4FA 2R2GA 4JLWA 3MJSA 1RWBA 3WJAA 3K2BA 5G0VA 3IL2A 2H6EA 1BTOA 4BO6A 3PJFA 4CM8B 4RVHA 5ITVA 1P1IA 2YDXA 4BNFA 1H6DA 1PWXA 3PWKA 5HM8A 3GGPA 5TT1A 1KVTA 4KMSA 1AE1A 2NQ8A 3JQ9A 3L6OO 1YH3A 4FFNA 3DAFA 1BRMA 3DXFA 4WLFA 1EQUA 4R9RA 3E1KA 4NFHA 4XYLA 2YUTA 4E13A 4CV0A 3IOYA 2EXXA 1N1EA 2C59A 4B7XA 1EDZA 3LT4A 5JDCC 1PU2A 5IG2A 4BNJA 4KQWA 1P3DA 4D0SA 1PQPA 5JAIA 1JWBB 2EF1A 3PJGA 1U5CA 2OOSA 3PYMA 3H9UA 4QO8A 5BR7A 3BHMA 3VH1A 3U5TA 2X6TA 5B1YA 2VOEA 1T24A 4PG4A 1P1HA 3QVWA 5L7YA 4KUEA 1WPQA 1YOVB 1GUZA 4NHEA 4OM8A 3V8BA 2DBZA 2EERA 3NDIA 1GD1O 1P1RA 4CM1A 1C0IA 1PJ3A 2PH3A 2Z95A 1V3UA 2P4QA 4B4OA 4GKBA 3IAHA 2OORA 3DONA 4E30A 1GPDG 4PG6A 3UFXA 1EQ2A 3K8ZA 1VL6A 1NPTO 4YAJA 1CEQA 4OKNA 3FWNA 4BNXA 1I2CA 1K0UA 2PZLA 2PY6A 4D7AA 1A7KA 1HYHA 4NIMA 4B3HA 1GZ3A 3ETEA 4FW8A 1GZ4A 4IQ0A 2X1HA 4R9SA 4AJ1A 5KJEA 4ZHSA 2GRAA 3DFUA 3T4EA 4CM5A 4J4BA 5AQ1A 9LDTA 2J3HA 2WWRA 3U4CA 1N7GA 2B4QA 2V65A 1DC6A 2CVZA 3JQAD 5JXWA 2P9CA 4TZKA 3D3WB 2IYOA 5AYVA 5JYDA 2AE2A 2JJYA 4I9HA 2HUNA 3U49A 3W6ZA 4TRRA 4E2WA 1V9LA 2NACA 3OECA 4MP6A 1GCOA 8ADHA 3LSYA 4CUKA 5K6AA 1IPFA 1ZKMA 1YO6A 4XZ3A 1D3AA 2PFGA 1A7AA 3STHA 6ADHA 3WGTA 1IL0A 1B8VA 2EIHA 4J0FA 2Y99A 1NASA 4D0RA 3GPIA 3SBOA 4C7KA 3W8DA 2JD2A 1TXGA 2CDBA 1NYTA 3F9IA 4HFJA 1EFLA 4PG7A 1FDTA 3DHNA 1HLPA 2O2SA 4ALMA 4Z6KA 1LTHR 2PV7A 5IZ4A 3ETDA 3EVTA 5F1OA 1UAYA 2HRBA 5TNXA 5CDTA 2BFOA 1B2LA 4YAIA 2Y68A 3U62A 2I9PA 3G17A 4IMRA 1GUFA 3M1AA 2JAPA 4NQZA 4OJNA 4UEJA 4IDCA 1E5QA 1OMOA 4GX2A 3RUFA 1HE4A 2OZPA 3T4XA 1E7MA 3IUSA 4CV2A 3DOJA 4ND4A 4RPHA 3LC1O 2CF6A 4BB6A 4XQEA 4DLAA 5B12A 2YHUA 3OJ0A 4LMPA 3PEFA 4D43A 3FTNA 1VC2A 1VSVA 5BNFA 1C0LA 3GN1A 5JE8A 4R5HA 1V3VA 5BNIA 4DVJA 3HDQA 4MVJA 1LBEA 4IJUA 4W4TA 4CMJA 4JBHA 4CQMD 1LLDA 3DO5A 1ULUA 4TQGA 4GSLA 5KVVA 5ILOA 1F0YA 5KJCA 3JQ8A 2PK3A 4U8GA 3GAZA 3JQAB 4ESOA 1FDVA 2O3JA 1CYDA 3BTSA 2X5OA 3I3OA 3TZHA 5JSFA 3BMNA 4INAA 2HMSA 4A03A 4MINA 2D0IA 4PVDA 5A04A 2ZQZA 3JQFC 4HKTA 1ENOA 4R69A 4YWJA 4XCVA 1JA9A 5DBIA 1HF3A 2RH4A 3AU9A 3KYDB 3UCEA 3F5SA 4BO2A 2P5UA 3Q2KA 4W7IA 4Q3DA 1FDSA 2IODA 2X0JA 2AQIA 5A9RA 4IXWA 3SJUA 1PR9A 2BI8A 4BNVA 4JQCA 3I83A 2ZK7A 3TDKA 1VE9A 2X5KO 4I5EA 4WCFC 1UR5A 3WGOA 4DTIA 3SLGA 2QZZA 2JCVA 3ICCA 4JJIA 2Z1MA 3L0DA 1C0PA 4QECA 1H94A 4J4HA 4J90A 1NVMB 3KRTA 2I5PO 3H6KA 4K1LA 3UGKA 1XSEA 3IC5A 3L4BA 3NT5A 4IIVA 4K26A 3QW2A 1L1FA 4PLHA 1GL3A 1WWKA 3DMTA 3U3XA 5BSEA 3COSA 2P2SA 4Z0PA 3F1KA 3ZW9A 1E0DA 1F14A 1Q7BA 4IS2A 1NFFA 1DRUA 3HHPA 5DULA 4DQXA 1PEDA 4IINA 1PX0A 4IBOA 3WTCA 1IUKA 3GEMA 3U0BA 4BNNA 1PQUA 4Q9NA 5C3MA 4XDZA 4HX5A 3BMNB 3IKTA 2HK8A 3KO8A 1W8DA 4MIYA 5CFZA 4LCEA 4KUHA 4R1UA 4QFDA 3K5PA 2G82A 3WMWA 1B0AA 1YONA 5TT0A 5T67A 1BGVA 3AK4A 4CQMA 4AJHA 1HDYA 1ISJA 1TT5B 1ZIDA 2GZ2A 4GH5A 4D45A 2O3TA 3MJVA 3E48A 2Q99A 4FFLA 3H5NA 3QVOA 4KP7A 3UICA 4JIGA 3UKOA 3EGOA 5CDYA 4NU5A 2WD8A 3D4OA 4BGUA 2WMDA 1KVRA 2JFGA 4B7UA 4PFJA 1P77A 2EWMA 5T6BA 4CLEA 5I7SA 4RDIA 3S55A 3EUWA 3H4VA 4D3DA 4PGFA 5DZSA 1EDOA 1TVEA 3ZHBA 5TGDA 2W90A 4E12A 1Q0QA 2ZYAA 3M2PA 1FXSA 3IP3A 5CP8A 2IXAA 1DRVA 2CNBA 3PHJA 4O63O 3DEYX 4KDFA 5GZ3A 4YJGB 4GL4A 4UVHA 1DEHA 1HDRA 3SJ7A 1VSUA 3LVFO 4M1QA 4ITUA 4A0SA 2W2LD 4CMEA 2BF7A 1SOVA 5T64A 5TJHA 4IXTA 1A9YA 3L6DA 3GZNA 4MVJM 2IZZA 4G81A 4DXHA 3NT2A 4N7RA 4A5OA 3NTQA 1EZ4A 2D4AA 2FSVA 5IDYA 1R37A 1B15A 1KEUA 1IY8A 4J49A 1QORA 2DBQA 1K6JA 4WECA 1IB6A 2IE0A 3IIEA 1UH5A 3JYOA 1VJTA 2PNFA 1KEPA 1PQWA 4OL9A 4CMIA 5JCXA 1YBMA 3PGJA 3ROKA 4DLBA 1M76A 2X58A 1QMGA 4DYVA 2PWZA 2VT3A 4R54A 5DP1A 1UZNA 1ONNA 3FPLA 2Q1UA 3I9LA 4I08A 1DLJA 1TEHA 1YDWA 1HDOA 5ENDA 1R6DA 3MWEB 1RPNA 1W0CA 4TSKA 4CL3A 1UXJA 1U3UA 2EKQA 1VL8A 1IHXA 3L9WA 3PYXA 1DIAA 4R4JA 1R4NB 3V2GA 2X0NA 4GX5A 4C4OA 1GADO 1GQ2A 2PGLA 3OQ6A 3LU1A 2DBVO 4R1SA 1SC6A 3GOHA 4ZU3A 3KYCA 5B37A 4RJTA 5CHEA 3EMKA 2V7PA 3AOGA 1H2BA 1B3BA 4I9NA 2C5EA 5CEEA 4UUPA 3E82A 1NX6A 1J4AA 4IGEA 2QG4A 1Z75A 4Q3EA 2YV2A 4NPCA 2I65A 4RQUA 1XU7A 2C2XA 1PL6A 4LN1A 2J5RA 2B0JA 2NQTA 2FOIA 1IPEA 1C1XB 2PKQP 4CR7A 2I6TA 2FMUA 3QWHA 4BOYA 1PGJA 3WS7A 4YAKA 3WLEA 1EVYA 3AI1A 1GYPA 2QHXA 2VHYA 3AUAA 4WCFA 4XGKA 4ZA2A 4ZQEA 3TNLA 3ZU5A 3JQBC 1HDCA 1LDEA 4NJMB 3QSGA 3Q0EA 5K9ZA 2X23A 3HDYA 2JFFA 2PZMA 3OM9A 1PJSA 4BV9A 2UAGA 2DT5A 2IYPA 2WE7A 3PP8A 2FP4A 4OQYA 3JD3A 4J3FA 2OXIA 4BL5A 4D46A 5EMHA 4FOOA 3QLJA 2WE8A 4PCVA 3VTFA 4CUZA 1ZUD1 3DZGA 4DMLA 2EGHA 1YQGA 4MJLA 2AG5A 4EI2A 2G17A 4FOSA 2DUWA 4OXKA 1OZAA 1U7TA 5COBA 2XPCA 1HYGA 3BMCA 1MLDA 3WICA 3GN2A 3V2HA 3KSDO 4RDHA 3VZPA 4BO3A 1SAYA 1R0LA 4QTZA 4Q39A 1JW9B 3GG9A 3ZU3A 1O9BA 3QY9A 2O3SA 3PQDA 3BXXA 2WD7B 1XQ6A 4J1QA 4RF4A 3VH3A 4RPJA 3GDFA 5G4LA 3TPCA 3KB6A 4BGIA 1N92A 5JMWA 5JYEA 3LT2A 4NBVA 4O6VA 2I3AA 1PZHA 5EN4A 3WJ7A 2PR2A 4YJFB 3QVSA 3WIEA 5JAMA 3FSRA 3FWZA 2P4HX 5GZ6A 4BKQA 1LC3A 1R15A 4CLXA 4BNKA 2NU6A 3UAGA 3RUDA 3W6UA 1LI4A 4WUVA 2UYYA 1AHHA 4XJSA 2B37A 1T2FA 1JAYA 3H9GA 4MKRA 4WLNA 3I9JA 3JD4A 4IS3A 1QR6A 4M54A 1O89A 2X0RA 1SMKA 3G49A 3OHSX 1D8AA 3DQPA 3WLFA 3SX2A 3F6YA 4MIOA 1ORRA 3CZRA 1LLUA 4PLFA 1ARZA 3MWDB 3QJ5A 4RGBA 4Y6RA 1DAPA 1EEHA 2AW5A 5IJZA 1LLQA 4E4YA 2EP7A 3C1OA 4QT0A 3UUWA 3WX0A 1XWFA 2X5JO 3RVDA 3RUEA 1PJLA 4WLUA 5DP2A 4Q3AA 3DL2A 4ZICA 1P1KA 3KLPX 2HO5A 4UVIA 3P7MA 3B70A 2G5CA 3V1UA 3VKVA 4CM3A 1V3TA 4UULA 1PL7A 4K9DA 5CG1A 3KYBA 5I8ZA 1YXMA 2J6IA 1NR7A 3RKRA 1Y1PA 4QFCA 4E5MA 5U1PA 5I9LA 4R41A 3DMYA 4XWYA 3VPSA 3HUDA 3KEOA 4NK4A 1UUFA 1VPDA 3ZH2A 3R1IA 1ZSYA 1Z45A 4U6SA 4BNHA 3UCXA 4BMVA 1O6ZA 3EC7A 2J5QA 4J4TA 3RFXA 2X9GA 1WVGA 1GZ6A 1DFGA 4TROA 1ZXLA 1ENYA 3C7CB 1H93A 1K5HA 4NNJA 4DYDA 4HNGA 3AFMA 3AOEC 3AU8A 3KHUA 3P19A 2NVUA 3BHJA 4ALLA 1XHLA 1SCUA 4PZEA 2UUPA 5BQFA 3MOIA 4I8XA 4JGBA 4LK3A 3RASA 3JQ6A 3QWBA 2PTGA 1VKOA 1XR3A 3U4HA 4BB5A 2ZTMA 3PHLA 4DC0A 3ZN2A 3KSZO 1DXYA 5IZCA 4RF2A 3G79A 1X0XA 3LDHA 3QWIA 2PZJA 1VLLA 2ZB8A 4ZQGA 1YB1A 4BNMA 4XB2A 1U3WA 3BMQB 1E7RA 2EG9A 4ALKA 1B7GO 1NXQA 1P0CA 3PDUA 3FD8A 3W4IA 2YY7A 1BVUA 3ANLA 1L7EA 3OETA 4J7XA 4R68A 3K6JA 3B6ZA 4G2NA 4GSKA 5EPOA 2ZKLA 2O48X 1LRJA 1QV6A 2Q45A 3LC7O 3NDRA 3O38A 5L9AA 2OO5A 1ZEJA 4MVJF 4ZQFA 4O59O 1B8UA 5L3ZA 5AXDA 1PGQA 1YB5A 4TRNA 1UXGA 2EKPA 2X9VA 4J7UA 3ZCXA 3ABIA 2JCYA 2CVQA 2FR1A 3P2OA 2H1SA 1S6YA 1IZ0A 2E82A 3V2UA 2QZ9A 2VN8A 1A27A 3KM0A 2VTEA 4N5MA 3H3FA 4IDFA 3VPFA 1ZSVA 2CF5A 2I67A 1YBAA 4CR8A 5AVOA 2JHGA 2Y1DA 4CJXA 5C7IO 4FFPA 3L4BC 4IJWA 5KVQA 4RQTA 1ENZA 1MUUA 1UXHA 4WOJA 4CMCA 2JL1A 3JQ7A 3O03A 1DBVO 3F46A 1A4IA 1O0SA 4I5FA 2Y0DA 1I32A 1AGNA 2VWHA 2A94A 3C7DB 2D8AA 4I5GA 4LISA 2Y1EA 2W2LA 6LDHA 1HXHA 2D3TA 4OAQA 4R1NA 3MTJA 4FS3A 2NSDA 4MVJD 3ZV5A 1B16A 3ENKA 4E5KA 5L51A 3K31A 1X1TA 2ZCVA 2P91A 3HDJA 4HUJA 4UAGA 2IZ1A 1JKIA 2DC1A 1E3EA 1N9GB 4DREA 1Y5RA 1B26A 3VH2A 1PIWA 1ZEMA 5ICMA 2VWGA 3PRJA 2VRCD 4CLRB 2C07A 2P9EA 1Y8QB 2HJRA 4XYBA 1JVSA 3LT1A 4FQ8A 3LF1A 3GA0A 3IP1A 4OOFA 3ZWCA 3AM5A 1EFKA 3GRPA 1PGPA 3KUXA 4ND2A 3GK3A 4WEOA 1QYCA 3DFZA 1TI7A 3G1UA 3UW3A 3LC2O 3GAFA 2H9IA 3RC9A 1E3WA 4F3YA 1Z7EA 1NQ5A 3GC6A 4FFRA 4P4GA 2PD3A 1K2WA 3FN4A 5DOZA 4QEDA 5JCJA 3KSUA 4DBVO 2BKAA 3LK7A 1H6AA 2RCYA 1PTJA 1DSSG 3GHHA 3NTRA 1T2AA 5FEUA 5DN9A 4G65A 2HMWA 2ZYDA 3H9JA 3FHLA 4E2ZA 1MB4A 3EYWA 3ANNA 3D0OA 4ZN6A 4P4LA 1E3JA 2X4GA 1WDLA 5COQA 4R1TA 5TJ9A 3ZV4A 1GYQA 4XYMA 2BFMA 4MKZA 4YTEA 1JQBA 1DPGA 1WW8A 4EZBA 3RC7A 4ND3A 4O0LA 1FMCA 1NQTA 4NBUA 3M6IA 3DBRA 1I5RA 3BAZA 1YB4A 3EDMA 4KOAA 1HWYA 5JDCA 1HL3A 1EMDA 4CV3A 3E5MA 5DBGA 1DIGA 1P33A 1RJWA 4H15A 4EGFA 3F1LA 5JO9A 4AG3A 5AXAA 1RM3A 1U7HA 4XIYA 3PJEA 3I5MA 2C54A 1EVIA 1X1EA 2GSDA 3AY3A 3TZQA 3DBLA 4J1TA 4WLVA 3QRWA 2YDYA 5ADHA 1GYRA 3AFNA 2NV6A 5KWEA 1KERA 3NGLA 3I6IA 2Y1OA 4IQ8A 2VNSA 3H2SA 4GI2A 4L75A 2RHRA 5T57A 1CJCA 3X2EA 4YJHB 2EEZA 4L73A 1QLJA 4TKMA 1ZFNA 3F3SA 2O3QA 4FC6A 2CZCA 3ENNA 4IJKA 3JQGA 3MJTA 1DRWA 2DQ4A 3I9NA 3OIGA 5IN5A 4RV9A 3RJ9A 4CM4B 1T4BA 3LQFA 5I7FA 5T8KA 3GPDG 2WD7A 4N5NA 4O1MA 1AUPA 1XCBA 4F46A 5I9MA 3SEFA 3PQEA 4RF3A 1JWAB 1H9BA 1SEPA 3V1YA 1I01A 1U5AA 3CINA 2WDZA 1XGKA 2VYNA 4BQPA 1Z82A 2Y93A 2ZYGA 2GN8A 2PLAA 5ER6A 2FR8A 4ALIA 4RO0A 1Z7BA 1P0FA 3DBHA 2DKNA 3L9XA 1ISIA 5F5NA 3U09A 2DPGA 3EK2A 3DB2A 2DM6A 1DC4A 3IUPA 4XGIA 1Q7GA 2B83A 2YHIA 3FBGA 2W2KA 3F4LA 3PDJA 2H63A 5COAA 1Z6ZA 2JD0A 1PJQA 4CMIB 2FZWA 1X14A 3NGXA 3H2ZA 1ZJZA 2EJWA 1H5QA 3ZWXA 3WGGA 5B4UA 5B4VA 4FFOA 2BFPA 1HE3A 5I9NA 4JROA 1WP4A 4DPKA 3EHEA 3RU7A 1OC4A 1UDBA 5G0UA 2YJZA 4PLPA 4RLHA 3RIHA 3OICA 4XDYA 1NAIA 4HNHA 1E7SA 5L7WA 3PWSA 3IS3A 3MCVA 3ZWPA 3E5RA 1GTMA 2AA3A 1KEWA 2DFVA 1P74A 3OFSA 4GLOA 4JCOA 4RVFA 1WNTA 1KY4A 3NKLA 1W73A 3P2YA 5FI5A 2E6UX 3JQEA 1PL8A 1OFGA 4QSMA 2FSSA 4BIIA 1U2DA 2DBRA 1P1FA 3RAJA 2GUGA 2PZKA 3DTTA 4MDHA 2CUKA 1CETA 4FJ0A 1F8FA 1I10A 4E6PA 1GEEA 2UUOA 4GMFA 1PS9A 3PFFA 2R6JA 5EQDA 3D3EA 4BHTA 2PKQO 1LSOA 1ML3A 1TA4A 4MVJH 1OBFO 4NJMA 3ZDFA 3GVXA 5C37A 1J49A 2C7VA 1SPXA 4P8RA 5L40A 2WYUA 2BGLA 2VUUA 5A9SA 3HJAA 3VDRA 2QRLA 3WBFA 5IAAA 4W6ZA 1WXDA 2CMDA 2EW8A 4M86A 4QX6A 4YCAA 4CLOA 4J16A 1C1XA 1E6UA 4DLLA 4PLWA 4OXNA 1PGNA 1ZK1A 3WIDA 5HA5A 1XU9A 4YRBA 2YV1A 5K1SA 5EL0A 2YQ4A 2QYSA 4LGVA 2EV9A 1O8CA 4HV4A 3F47A 2E4AA 4EJ0A 1XEAA 4ND1A 1U4SA 2O3RA 1E3IA 5JY6A 3L4SO 1LRKA 3OH8A 2OBNA 4KQXA 2VZ0A 3HG7A 5CDSA 5F21A 1ADFA 5A05A 3MJ4A 4E0BA 3L07A 2O7SA 3GLQA 1I3NA 1T26A 1R0SA 5FYDA 4BGVA 1C0KA 4ILKA 1G1AA 1WMBA 4EEXA 2DVMA 3GRKA 4ZRNA 2VWPA 3A4VA 3NUGA 3D3WA 1A9ZA 4E32A 3GG2A 5G0TA 4BMSA 3EAGA 5A3JA 2BD0A 1X7GA 2BMAA 1EUZA 1ZCJA 2OUIA 3HB5X 5JY1A 2BH9A 4YACA 1E7QA 2C0CA 2Q1TA 5T5QA 3O4RA 4E5YA 4CQLB 4LRTB 3PQFA 1A4UA 1I30A 4JJFA 5A3VA 2BHLA 3WWZA 4B3IA 1NPDA 1NM5A 3W4KA 3E9MA 2BGMA 4DIOA 3LLVA 3GQVA 4BNGA 1Q2XA 3DZHA 1AN9A 4E5PA 3OQ1A 4RPKA 3WDSA 1D1SA 1W6UA 4TRMA 4Q3CA 2RH8A 2B5VA 3BA1A 2YQ5A 1LQUA 3CZMA 1LSJA 2O23A 2VWQA 2UVDA 5HTOA 1OAAA 2G76A 5KJ1A 1LU9A 4R3WA 1XQ1A 2XF8A 4M87A 3VVBA 4URFA 1KYQA 3MOGA 4J1NA 4CMKA 1CIVA 1FJHA 4E21A 4U5QA 5JO0A 1VRWA 4QO7A 1ONPA 2HLPA 1DJNA 4UVDA 5H82A 1TT5A 2NNLD 1YL6A 1PZFA 1U3VA 1LDNA 5JMPA 3ZWVA 4TVBA 3TRIA 2DTXA 3F5QA 3MJEA 5GMOA 3TQHA 2Q49A 3GZ4A 1TT7A 3LYLA 1WZEA 2W8ZA 3KETA 3CXRA 3WQRA 5L53A 4WKGA 4AICA 4K6CA 3CE6A 2RHCA 3D4NA 1UZMA 1YL7A 4Y98A 1NHWA 4FPXA 1XELA 3FBTA 2PD4A 4Z9YA 1JKFA 4CQLA 1O5IA 4NDNE 3TL2A 5THQA 3UF0A 1J5PA 1E6EA 1NTOA 3UOGA 1H6CA 3ZWOA 1E3WB 4YQYA 2B5WA 3PIIA 1QYVA 3OA2A 3GGGA 5CDUA 1AXEA 3ONDA 3QQPA 1C1DB 4CMAA 4GX1A 1DOHA 3DBVO 2ZTVA 3WTBA 4CM7A 2Q2WA 3D5TA 1I33A 1NFQA 4E5NA 2DPHA 2IRWA 3JD1A 1QYWA 1I3KA 4UEKA 3H7AA 1NP3A 4LRSB 5LDGA 3SXPA 3VDQA 3CKYA 1DB3A 3DTYA 4II2A 1YQXA 2HU2A 2OBYA 3RSHA 4AJPA 2NLOA 3PIDA 4XKJA 4MVJI 1YE3A 2TMDA 1PSDA 3EY4A 4FCCA 5HS6A 1LRLA 3DOCA 1F17A 2CDAA 4NI5A 3JQBA 4BMNA 4HFNA 1BXKA 1C3VA 2B4TO 2C2YA 2VHVA 9LDBA 4NFSA 4RPLA 4IMPA 5A5FA 3L6EA 3O9ZA 4MVJE 3GEDA 2J8ZA 5DCWA 2C82A 3DZIA 2J5KA 1K6IA 3GR6A 1M6HA 1LQTA 3OIDA 4CLDA 1GV1A 3OEYA 4WCDA 4J1SA 1YVEI 1HZZA 1U1IA 3C85A 3DHYA 4BNWA 3KZVA 2P68A 4ZJUA 1SO8A 1O95A 3A1NA 1CERA 1NWHA 3KYDA 1PS8A 2BI7A 5HRUA 1XG5A 4YRAA 1I36A 3Q6IA 3RD5A 2AQHA 2ET6A 1V6AA 4Z3KA 4L0QA 4DIBA 2AEMA 3UVEA 1B8PA 4OYRA 1C1DA 1N9GA 1VL0A 3HFSA 1G6KA 2F1KA 4E2YA 3N58A 5BT9A 3LLSA 3KOUA 3AM3A 4L8VA 3QP9A 3JQGB 3IMFA 5IZCC 4H7PA 1OC2A 7ADHA 2WYWA 4DC1A 3HZZA 3W4JA 2OP1A 4I5DA 1GUYA 3PI7A 5EIOA 3DZKA 1A71A 2SCUA 2F00A 1ZO8A 5KOIA 1DFHA 3B20A 3WB9A 5IDWA 4J9UE 2GCGA 1MX3A 1QG6A 5TQVA 4AJEA 4B8WA 2GNAA 1ZJYA 2P5YA 3OJEA 4OQZA 4WLEA 1DIBA 3JQ7B 3NRCA 1KETA 3BTVA 1UXIA 2VHXA 4GVXA 1DAOA 1EBFA 1X15A 5MGBA 5F5LA 3WWYA 4Z3DA 4EYEA 4HP8A 1I8TA 4E31A 5EJ2A 4OSPA 4WE3A 1UZLA 2VOJA 1T25A 4D79A 1LX6A 1ZMOA 4M89A 1HRDA 1Z74A 3GH3A 1HSZA 2IXBA 5AOVA 1PJTA 5L4NA 3DMTC 2YYYA 1ZSNA 3ZWAA 1GV0A 4RORA 1DC3A 4GAEA 1KOLA 3FNEA 3CPSA 3KEQA 4Q3BA 4LSWA 1IOLA 2V6FA 3HFGA 3GMDA 4OXYA 1D7OA 3H65A 3X2FA 4XA8A 4BV8A 3AJRA 1NQAO 4XQGA 3PTZA 1V8BA 2O3UA 1SEVA 3B1KA 2Q46A 4GVLA 1ZK4A 2FPIA 4AJIA 4DA9A 1PJ4A 3JCZA 5JAQA 1KIFA 2WYVA 5GY7A 4XB1A 3RFVA 4PIVA 2VYVA 1WMAA 3QWAA 1T1RA 4NFYA 3GVCA 3C1TA 5A02A 4YBZA 3CSDA 1QSGA 2GN4A 4HXYA 4BNZA 4NZ9A 1XDWA 3UH1A 1D1TA 4MVJG 2G0TA 3DR3A 1JLLA 2RIRA 2D1YA 1EUCA 2CD9A
chains in the Genus database with same CATH superfamily
3O4JA 5L4LA 3LCVB 1WTAA 3OPYI 3GIDA 1JE0A 4ZVLA 3TSAA 3OCZA 1M1YA 1SVWA 1E3LA 2J9RA 5LJLA 3JWJA 2PSDA 3GL9A 4LTMA 3V7YA 2I9KA 2Y1CA 4TVOA 1Y34E 1XCPA 4H7JA 2CT8A 3E61A 1E62A 2YWGA 2OOKA 1Y1TA 3EF0A 4WCVA 1ZK2A 3UGTA 1J06A 1GT91 4QQRA 2DTDA 2PSHA 4EA6A 3ED1A 1VG0B 3HKBB 1AXRA 2BBOA 4G8JA 3VNVA 2BKEA 4DE5A 3WYFA 3OTIA 5ICSA 3DZDA 5K4HA 2GA9A 1LLCA 2WKQA 3NJ4A 2XB6A 2ZTUA 2CJXA 1CS4C 5LVAA 1SCDA 4DA4A 3WY9A 3LX8A 5BR4A 1FTNA 1OA0A 2NYVA 1YDEA 4QASA 5T8KC 2QRJA 5LP6A 1QQAA 4ZOQI 5EQFA 3V8EA 3TD6A 2JLXA 1T4DA 2ILTA 3HRHA 5FPSA 1J8VA 1I0LA 4FNGA 4TWJA 5FPYA 1OT3A 2Q7OE 1C9DB 3TL3A 1M2WA 1JU9A 1H2ZA 1NYQA 4GOXA 3S44A 2Y67A 3K30A 3LCCA 4Z4QA 3K09C 2CVOA 4I1IA 3S40A 3X1ZA 2MR5A 2ZATA 4JLUA 5CJJA 2PSSA 5H83A 5JH7F 1KXZA 1GDHA 2RJNA 1XZQA 2HLDD 3FWKA 3DYVA 4NPAA 3TMYA 1A9OA 1M6WA 4ZPJA 1TF7A 4TRJA 2P2LA 3H2GA 1GU1A 1W5EA 4DM4A 4XWKA 2XRMA 1E7WA 3NDPA 5CTAA 1QTNA 3Q7TA 4RLSA 4URZR 1DQYA 2VJOA 2EW2A 4AJLA 1PWZA 4JYCA 4LA4A 4HVCA 4G5FA 4N12A 4D81A 4HEHA 1T3ZA 1V96A 1XE3A 3WR5A 2HZBA 1PFUA 1NOKA 1UFOA 1K86A 4WJZA 1F0NA 4UDYX 5CURA 1WDMA 2I4NA 4PTZA 3WYAA 4AVYA 3L7JA 3PHHA 3QVXA 4M49A 1SXHA 3CZ4A 3A27A 1NNSA 1BE8A 4MROA 5B4TA 3T95A 1BXGA 5JPCA 1T8SA 3WGZA 1QHHB 2GF2A 1JR3E 3DEJA 4RGVA 3ZDYB 4XOUA 3CCFA 3G2OA 3C5EA 1G17A 5AKLA 5MFZA 4G41A 5K0LA 1ZY2A 3W6PA 2AXQA 1SNYA 1KO7A 5KAPA 5FO1A 3L04A 3QV1A 4GWLA 4I0WB 3W9SA 3OJXA 1VYTA 3LD9A 1JT9A 2IY9A 2WDPA 4TX1A 3VNAA 3D64A 5EJIA 2YWEA 1N2BA 5A5EA 4NR0A 1E1LA 4IIJB 3HO8A 4Y2SA 3AB3A 3RJMA 1TC2A 4FN4A 3M2TA 1SKUA 2I2XB 1OZ0A 4FFMA 4MUFA 3ZV3A 1V16B 5KU7A 5LOVA 3D8SA 1REQA 4KDCA 3E3LA 3FHOA 3VU0A 3P26A 2XDYA 4OOEA 4II3A 2VO1A 3AB7A 1SHZA 2DAPA 2IZOA 4OJYA 1LK5A 1VLVA 4F11A 2V3WA 1K89A 1OFUX 5KSPA 1Z4NA 1DXQA 1U2GA 1XYGA 3PSAA 1JEYA 3SQDA 2UUBB 3M9XA 1AZWA 2POQX 4G5HA 4RKYA 5JG7A 4IV5A 2WP8J 5AK5A 3ZK7A 4JGGA 5A9SB 1VIMA 2R68A 3HKDB 3GV0A 3E15A 5DM70 1XN4A 1WXWA 1Y7LA 2QENA 4JFRA 2AKAB 2R6HA 2ZTHA 4TTTS 2D54A 4G89A 5FDFA 2F9LA 1YQDA 2IHJA 3B5JA 4L74A 2ZSEA 3W34A 4DQUA 3RSSA 5GADl 3NFYA 3GCXA 4KVZA 2JKVA 1VKJA 1JDVA 3NVMB 2EQ5A 4HWRA 1FBNA 2W37A 2IXDA 2JFHA 1MC5A 2Y27A 4GWGA 1YS1X 1VECA 2DR3A 2FW0A 2IYSA 3K6KA 4P4TA 2HKIA 2XZDA 2K87A 5KX5F 5DNUA 2ACVA 2YC4C 1U1CA 1WSWA 5CBKA 2PRSA 3NOVA 5ESRA 5BYAA 1KJWA 1BS9A 2FR0A 2WM3A 3JD0A 4XX1A 3EJWA 3W3AH 1FIUA 5AWFC 3BEOA 1GUDA 3BYZA 2C2KA 5K4GA 1XZDA 2CB0A 3UXHA 3A06A 5DIFA 1XQXA 4ZYWA 4MVJP 5DBFA 5DWVA 1XN1A 2UVPA 3DDNA 1CR1A 1NVWQ 3ZUGA 4MQBA 3CQ9A 4QVGA 4BMOB 1WETA 3G3EA 1YUBA 3M89A 2GD2A 1QYXA 4L7VA 1POXA 1BW9A 2Q0SA 2AUMA 1IWPB 5CEFA 3Q85A 3AIIA 4QUAA 2W42A 3FOZA 1KQPA 4BQFA 1L7DA 1GGKA 3VDXA 3QPCA 5KYYA 5ESXA 1E1CA 4GM0A 4PG8A 5F1PA 2YIDA 1AKWA 2CFCA 4Y6OA 1PWHA 2ZRJA 3ER9A 4O4HA 2IEDA 3OE7A 4DT1B 3OWOA 1Q0PA 3WMGA 3I1JA 2OAGA 3G7UA 2I99A 1CZKA 4KUGA 3NV9A 2FI1A 2W70A 2C78A 3VKHA 4QU5A 5I7WA 1P5JA 1OCEA 5C8YB 3I6MA 2CMGA 3CA8A 1DVRA 4KREA 2IZ7A 4XTRA 2V9CA 1PR2A 2D59A 4KO2S 1Y6GA 1HKUA 2WLTA 1RI4A 3JQCA 1C3XA 3K9QO 3PKJA 5LNK6 4W5RA 4AS1A 1FLNA 1UEJA 1A9QA 1ZA1A 2YW2A 4N54A 3UNXA 3NHRA 2YXBA 2B4RO 1E1MA 4KXQA 1QYDA 2ZXEA 4M4SA 3Q9UA 1F5SA 3E9QA 3REQB 3PWZA 3A4LA 1NXOA 4K9LA 3KOWA 3QQ5A 4ID9A 5EIXA 2I22A 4BGEA 3FVRA 1M1UA 2DCMA 3KAKA 4FHGA 4MPDA 1GFIA 1P3JA 1JVNA 1NPYA 1Q95A 2W83A 3HZOA 3OZ7A 5DB4A 3F3YA 3FNIA 2VZ8A 3PR3A 5DVZA 1W85A 2PLWA 4X63A 1YKFA 2FX3A 3CEHA 1I2BA 4V0OA 2FCAA 5CLIA 1W49A 4U7PB 3UMVA 3PGXA 4YYZA 3AESB 4IOJA 4ZEWA 5C7LO 1W35A 4HTFB 5A3SA 3OURA 4ZODA 5CXUA 4WEQA 3WRXC 2ZZNA 2QYOA 4CIWA 4DG8A 2R1TB 1PLKA 3OFVA 2VJKA 1EK1A 1S7CA 2ZRFA 1ZWKA 5TQJA 1KVSA 3ZUPA 5LQNA 4Y2HA 1DCKA 1U94A 3VPHA 3FCOA 4DWJA 3VX4A 1PW7A 1DUVG 2UU9B 1ZC4A 3HGQA 3ASYA 4B3RB 1JPUA 1VE6A 5MDHA 2GN9A 4ZO7A 1YIAA 2ZI6A 4RKRA 1O97C 4NOJA 1Y1QA 2G28A 3V6MA 4NSNA 1E1KA 1MABB 1OPRA 3B3AA 3CG0A 4J03A 3TQFA 4CCWA 2BVNA 3CKKA 3AT1A 3QVUA 2C5FA 1Y82A 2QGZA 4YVFA 4EY4A 3P5SA 1KMMA 4FHEA 4H3VA 4KIJA 5KTKA 1IBMB 3E58A 3IAFA 4JLAA 7GPBA 3X3HA 3IR6A 1TVMA 2BRUA 2EZUA 3CRZA 3WYNA 2Q3LA 3AHHA 1FEZA 3HN7A 5FBWB 5KYXB 5DNAA 3C3AA 1RHKA 3L6BA 3ICQB 4PVCA 4RCYA 3WGYA 1P5ZB 1JEQA 1VXRA 2A0UA 2NADA 2YIJA 3I4FA 3BILA 4IDQA 3T52A 2WAMA 3PE4A 2UZ1A 3B7GA 3IVXA 2VVTA 3DEFA 3SEQA 4WLOA 4H9GA 1E92A 1QC5A 3NP9A 4Y2XA 3GHYA 3VO2A 1DHRA 1Q7EA 4RABA 5D51S 4LFCB 4JQSA 3ACBA 4GS5A 1FRQA 4LJ6A 4QQ8A 3EUEA 3E9DA 5DM2A 2NM0A 2CHQA 4Q34A 3DOOA 5L4SA 1M8FA 3PFNA 4Y18A 1PR3A 1TKAA 2DJIA 4YPVA 1RWNA 3K8QA 1W0KD 3NDJA 2J87A 3OLWA 5KMGA 5KWJA 3DEIA 5I5EA 2GK3A 1MZVA 2ZW9A 3RK4A 2Z0MA 1CK4A 1G8AA 4JJEA 3HA3A 1UFKA 4IZ6A 4DBZA 5CLJA 5KQRA 1SOWA 3N8GA 1WCIA 4FC7A 5E0OA 1CWUA 2IH4A 4J8PA 2JGNA 1E3SA 1ETUA 2BELA 3G6KA 3T38A 2R6FA 4FB5A 1QTRA 1UOPA 2ECFA 3KFVA 3OT5A 1KJ8A 4MSUA 4TS3A 4ND8B 1DEAA 1QCYA 4PQEA 1QQBA 1I7SB 1Z2PX 1LUAA 4CMHA 1QRRA 4U2BA 4NNPA 1TZBA 3NHUA 2FK8A 2JJ1A 2WIGA 3E5NA 4XB6B 2ZB4A 3FA2A 3KLOA 1A8QA 3CJQA 3AILA 1L5HA 3ZI7A 3FTFA 3I5XA 1NVAA 1UFRA 4Q5IA 3ZE6A 3U7QA 1Q6YA 4IXDA 5A7GA 4MS1A 2AEFA 2FZEA 1XPOA 2FEPA 1N8SA 1Q14A 3G88A 4BC1A 2JIQA 2ZSFA 4OHVA 2UUCB 2UYOA 1VKNA 5HR5A 1KBQA 2EHJA 4J07A 4RH3A 1QNLA 4M8LA 4B2YA 4F5DA 3AETB 4BKOA 3HEAA 1ZH8A 1F0PA 1L4YA 2D5AA 2W6QA 4WNAA 1YR6A 4M53A 4BKRA 1ULZA 5JIBA 3I23A 4LF7B 4AG6A 2J0QA 1UJ6A 3EBPA 4JXKA 4UM8B 1IN1A 4GU5A 3MLAA 1U99A 3AEUA 4NBRA 4ZTZB 2HCTA 1K4KA 1S1MA 3EPKA 3KX2A 4MUMA 3PPYA 3W8EA 3VYTB 3WQBA 1K06A 3DJFA 5FD8A 2WWVD 1BDIA 4JL6A 2LNDA 5HIKA 2AZ4A 5BUQA 3T1YB 1DBWA 4CT4B 1WB6A 2IUYA 3M6AA 3FYUA 4YJGA 4EUSA 2Q8PA 4PRKA 3BC1A 2EKZA 3ROQA 16PKA 3RWBA 4GHWA 2HK9A 3BD9A 4PZCA 3K2EA 2QTVA 5JCZA 4WD3A 3DE2X 5HIMA 5CITA 2YJ6A 5BN1A 1E2MA 3RJ5A 3V1NA 4HGRA 4OKIA 4PC2A 2Q6LA 1M6YA 4NLLA 1D07A 2MSNA 4HDSA 1AF4A 1TVKB 2FX2A 3J81k 4JR2A 3CKMA 2VJBA 5AK4A 3LNTA 4TM7A 1NY6A 4NECA 1SUEA 3QUBA 3LT0A 2JRCA 3PITA 4X71A 5T3YA 5KNCD 5L7TA 4IXNA 3DFFA 4AP6A 3CR7A 1DG3A 1RI3A 4EJMA 1X1QA 3Q11A 4FDVA 5TQ0B 3HK2A 2EJVA 1O1YA 4LQCA 1WV1A 3KDSE 4EOGA 6REQA 4DV1B 2W6ZA 4EL0A 1UKVY 1Y3BE 2R0QC 3P2JA 1Z4MA 3AY7A 4XM2A 1KC3A 1B14A 5K3AA 2YVLA 3C97A 3FNBA 4JUBA 221PA 1F3OA 1OXBB 4V02A 1VXOA 4MS3A 1ZK0A 3BJZA 3TSCA 4B4KA 3ZZTA 4DJAA 1GKLA 3CSUA 4I2NA 2ZP1A 5DGHA 4XD2A 4D9HA 2ZYTX 4XXHA 3RYIA 1UPXA 4XUEA 4CV1A 2HQRA 1ZVVA 2A59A 1SVSA 4ND7A 5CDGA 1XWIA 2UZ3A 3PHCA 4C2AA 1UDCA 3BHIA 2Q4EA 1DO0A 1P91A 3OT1B 4P84A 4RPIA 3R5HA 1RLIA 1NLUA 2PXAA 2W2PA 3HQ4O 1WKCA 2X41A 1N8KA 2YY6A 2N9UA 1G21A 2JD1A 4YUXA 5AVUA 3TGLA 1ABEA 1CQWA 3TRDA 2NO7A 5E4JA 3LS2A 2VHEA 1MBZA 3ESXA 5ETJA 1J42A 1TADA 3DZJA 4GMKA 2ENWA 3OE4A 4O1IA 3VKUA 1G41A 4CM4A 1KEKA 4JP2A 3CF4A 3G5AA 1ISFA 1GAXA 3AI7A 3VYUB 2QM0A 4WNIA 4DCCA 4PW0A 2ONJA 2JW5A 3RG2A 3DHEA 1UDAA 1ZCBA 1IN4A 1GZVA 4BNLA 3EZYA 3WIVA 1IZZA 2JHFA 1HE2A 3B1WA 3WYCA 2CCGA 3PG5A 2D3WA 5FBVB 4OJKA 3SGLA 5FUXA 2X2OA 3U4DA 1R0YA 2OP0A 2YFHA 4RMJA 4WN9B 5LQSA 2QVGA 3IODA 3O3MB 4BDSA 4EEZA 1NR1A 4KFUA 1TD1A 1QO9A 2JGDB 3HBLA 3KXDA 5FOQA 2IEBA 3OKPA 1E2IA 2FE4A 4LOKA 5J2UF 1A5ZA 4F85A 2PGAA 2H06A 2WM2A 5JR3A 1UIMA 1Y6FA 4E2FA 4G5SA 1SOMA 4G0VA 1SK9A 2I4OA 3ZV7A 1LZKA 5AI6A 5JC8A 5LD2C 3NBMA 4ZDJA 3C3XA 3MTGA 1FSFA 1U3FA 4AS2A 4C05A 5TS3A 2G08A 5LXTF 3DGEC 3PKZA 4B45A 2ZEJA 3GBVA 1UMCB 3CB4A 1VB5A 2B35A 2NU9A 3GDGA 4IDEA 4U7GA 3TLAA 5K3BA 3A4TA 2QORA 4DRYA 1S8AA 4RX1A 2XLCA 2RGNA 1TJYA 3RHSA 3CC8A 1E8DA 3WSWA 4EUHA 3CNBA 1BXGB 2I1VB 4EYQA 3UK6A 3NCTA 4PHFA 3ZYCA 4EZEA 3MB8A 2QS9A 1N8NA 1SZPA 3BMCB 4YT4A 2P9QA 2OWDA 5BR1A 4NULA 1ZN8A 5KCZA 3DDWA 2FG7C 3KBOA 3AHJA 1Z47A 2BCJQ 3H9QA 3NOOA 5AHXA 4W8GA 2FPPA 3UXYA 5FL3A 4E5UA 3EGXB 4XX0B 1T2EA 1A2QA 3QEKA 5I4CA 2Z83A 3IALA 5I7EA 1XF9A 2VT7A 1HTBA 2QL5A 2E89A 1ZGHA 3D5QA 3NH6A 2FN7A 5LR6A 3D7LA 4GKAA 1IHYA 1KY5A 3ZWOA 2QDKA 1NV8A 3WNBA 1EEXB 1KRHA 3B1JA 3BZUA 4JEIA 2NTJA 4KMMA 1XMPA 1AKYA 4LGCA 5LDDC 2OCAA 4EX6A 5LOVB 2JGRA 1BVRA 1NAHA 3OPYB 4R81A 4UEOA 5AW7A 3K9GA 1I94B 1B3RA 3R3HA 3CX6A 2HSDA 3EE6A 3OEED 1E2KA 4JT2A 2YFQA 5CDFA 3K72B 1VP3A 2OCLA 5HF8A 1DCMA 4DDKA 4DRXA 4ESHA 3U19A 2IS6A 5G1OA 1RVDA 4QVIA 4POAA 3EVNA 4PCAA 1H4VB 4GP9A 3FKQA 4BP3A 2NU6B 2Z9BA 4L4XA 4EO4A 4YA6A 1GJRA 3O3OB 4ECEA 1T9GR 1FF9A 4ZD6A 4O4JF 1K7SN 2RHLA 2WYOA 1N6LA 5IBPA 1TJPB 5E7MA 5E6RA 2HOQA 2ZJ1A 3LTEA 2GERA 4QG3A 4XFJA 4RVSA 2VSFA 2J0UB 4PR3A 4U6QA 4DAEA 3VU8A 2G40A 3UO8B 3CUWA 4L02A 1P18A 3LWBA 1V8DA 5KHOC 1UODA 1Y9AA 2JFVA 3EDRA 4KGVA 4UBKA 3U17A 4UCWA 1ADYA 3FOFC 1TZCA 2CFSA 2YBEA 2V74B 4J2HA 4N3NA 4W1RA 2O2YA 2V7XA 2O1EA 2Y2UA 2ZRDA 1GPJA 1FU8A 1IBCA 2BFCB 2CLLB 3UMCA 5JAUA 3B3GA 2IKSA 3MUNA 1JPJA 1LA2A 2IHBA 1P4HA 3N39C 1CUYA 4EG5A 3O2JA 1KC1A 2JBAA 1TD9A 3UAOA 1K7EB 1Q5PA 3IHKA 1H69A 1RJFA 3RVNA 3M81A 2XWJI 1DFIA 4PICA 4ZGBA 3A2KA 3D4IA 3AEYA 3IDSA 3CWQA 5LJIA 2BL4A 5AIBA 5BYKA 3V3TA 1G5IA 4UPEA 3W5BA 3D3QA 1JNYA 1WPXA 4BUCA 2J3MA 1DLIA 4CMGA 2PJRA 3VAYA 3W6NA 3KYJB 2WTNA 2XUFA 1X86B 1BJRE 2ZRKA 1GAJA 1C2TA 3WGLA 1KSFX 4UUMA 2W11A 3ZH9B 2F8LA 3QU2A 2IHKA 1E1QD 3IELA 4WA7A 2IA5A 3TW0A 3GEEA 1ZUNA 1FOEB 4FJ1A 3DM9B 1DO8A 3AI3A 3H1TA 1E60A 3EG9A 3L0YA 2E1RA 2HQSA 2G09A 5AI9A 2EL7A 5JNVA 3LP8A 2PKWA 4KXFB 3V00A 4CM9A 2G5TA 4KGZA 5I7RA 1FE8A 1ENPA 1FP7A 2HMUA 2OHOA 1CKEA 2I66A 1TQ6A 4IO1A 3AVPA 3I8OA 3ROFA 3SYTA 3SD7A 3VGJA 2X5NA 3ZCVA 3BREA 5KNCA 1GCGA 1FBTA 1C7QA 4EHJA 1RAEA 2R4QA 4HZIA 1PEYA 4M38A 4UNRA 2CXQA 2R47A 2PBLA 2WM9B 3HN2A 2TSYB 3M70A 1IY9A 4KEAA 3QPBA 1X1RA 1H2XA 4DDVA 5MHTA 2ZAOA 2JKZA 1ONOA 1EWRA 4IM7A 3LPNA 1LDMA 1DKLA 1IUNA 2WWHA 3MCAA 2O19A 3PDWA 4BV3A 1LVUA 4D4KA 2PGJA 2OLJA 1WPRA 3IKLA 2A9FA 1E5DA 4I1VA 4G4GA 821PA 2J1LA 2Z1NA 1BHJA 3LKDA 1JDUA 2OBLA 4GI7A 3ZNOA 1Z4OA 3BWEA 3A6JA 2RSLA 2GZ1A 5FWNA 1QJCA 1OYWA 1ZMTA 1RVV1 2P9YA 5IJ0A 4LCJA 4YPOA 2QN9A 1DE0A 2GUWA 2ZE6A 1T0UA 2REQB 2ZWMA 1U6KA 5A7HA 3UKDA 5LMUB 1UJBA 3FW1A 1VHTA 4U2GA 3EXIA 3RT1A 2WWYA 1XNGA 3LQ1A 2OAEA 2X4DA 3MUOA 3V5NA 2YQZA 1FQWA 1MA0A 1KZYC 3PGLA 4L5AA 3TD9A 4EFNA 5CLFA 3TIVA 4IDHA 2G0NA 3ZY4A 3B7PA 3N7AA 1SK8A 3H5AA 4LMRA 4EENA 1D0SA 5A06A 2GEFA 3TX2A 2UZ4A 4U7TB 3ONNA 1SB8A 1AU9A 2R44A 3LW8A 4MV0A 3SI7A 1T2DA 3F6CA 4OXQA 1EDDA 1W76A 1CB0A 4XAQA 4D9NA 1ZH4A 5HXAA 2C1XA 3KSRA 1GTZA 1SN7A 4DSZA 1Y5NA 1U8FO 2E4UA 3KKMA 3CNNA 3Q7RA 3UC9A 1E2DA 2HHJA 4PBRA 1H5NA 4IQGA 2FFQA 4Y2JA 1N2CE 1L5ZA 2JJ1D 2P4EA 3DQQA 3QKSA 1N4AA 3IUYA 3OMXA 3Q1KA 2L0XA 3RFTA 3VDNB 3ZU4A 5DYTA 4HNSA 1WAMA 1N5IA 4TSRA 4ZOAA 3QI2A 4D9CA 4QC2A 1IY2A 1THMA 5FQOA 2UZ1B 2XIQA 4BX3A 5BWLA 3F4KA 4R2IA 1RXSA 5G2OA 4MGIR 1E4VA 1U1DA 1JAXA 1U6IA 3DJYA 4DLTA 2GM9A 2QRHA 4BO9A 2DUNA 4HBGA 1QX4A 4K6FA 2HF8A 3VPXA 1QO7A 1XIVA 3QXCA 3BK1A 5JWHA 2VQEB 2ZI3A 1KKLA 3CRVA 1I4DD 1KYIA 4GZ3A 3EZLA 2Y05A 2DSTA 4MWOA 4DN6A 3Q1LA 3A3PA 1E1QA 3HADA 4TKVA 1HDGO 3ML1A 1DMSA 1JT2A 1OFHA 5GJCA 1WCWA 4HOYA 4UVEA 4LJLA 3FTEA 4MYRA 5EXEA 3DBRB 4FSHA 1ETHA 1RRCA 4MQEA 1HEUA 2JGJA 2RKOA 3UWMA 3SWWA 2F3TA 1GZUA 3R3YA 2YYZA 2JAQA 1P45A 1U0HC 4L2IB 1KR5A 2NNWB 3DKIA 1BHO1 3IQWA 3R5KA 4V3BA 1I9GA 3UWKA 4P5DA 3MELA 2HTEA 3RAGA 3ONEA 5FLKA 1N5DA 2R8ZA 3O75A 4FUQA 2X76A 1QZTA 3VPBA 3IE1A 3LC0A 2QUJA 2WJPA 1V5FA 2FPUA 3PLNA 4XE5A 1DXOA 5FNVF 5HNKA 2ZUWA 2DHCA 1KI3A 4OHWA 5AO9A 3BIOA 3PFKA 1WHTB 2M32A 4J0QA 1Z6QA 5I3ZA 4RMNA 3SFVA 3KKLA 3ZGYA 4OI0A 2V03A 1L4MA 3PNLA 3VO1A 3R40A 4NKRA 5GP1A 2F48A 3BEDA 3AHDA 2IQIA 2P9GA 4KACA 3UMSA 5CVTA 2B36A 3UJ6A 4TUYF 4UNQA 2HMTA 2R6AA 2CE2X 1TPYA 2X22A 1QR2A 4GYWA 4YR9A 1OJ7A 1KYTA 2G36A 2GN6A 2I34A 3E8XA 4PFSA 5KVCA 1CVLA 2FQWA 2C7GA 4KPGA 3QY0A 2HCJB 5MF6A 1SRQA 1GQSA 3G8BA 4NBLA 4R7TA 1E1RD 4BZQA 5EOVA 1VKZA 1Y98A 5CEJA 1VRVA 1T5LA 3HNPA 3VBEA 2UYCA 1CFZA 1IU9A 5TC4A 1CZLA 1EU1A 1P81A 1YV9A 2QRKA 2GN2A 2GXSA 1NV9A 1M2VA 1ONSA 3EXG1 4IEEA 4LUCA 1NURA 2RG1A 2W2OA 4K28A 1CUBA 3MN1A 5JS7A 1MZPA 3AX6A 3IUJA 1XD8A 2JAXA 1SCJA 1UP7A 2HDNB 3P1JA 1T9DA 4PG5A 2OGUA 4YRMA 1MEEA 2ANBA 4TTIA 4FD3A 4LSGA 2X2EA 1YWGO 3DEZA 4DCVA 5A3QA 3FI9A 4C01A 5CD1A 1TJ4A 4IMJB 1O57A 3U7GA 5KNBA 2BM9A 3NOXA 1UBRS 3G2PA 4KL8S 5IF3A 4J91A 3E23A 5LPNA 3BTUA 3GFQA 3QX8A 4PSCA 2FUNB 5GGXA 3W5SA 3HCWA 1KU6A 4O2AA 1ZIYA 2PAFA 1J25A 2UXDB 2YHBA 5BSFA 3RAFC 3RUCA 1SHUX 5FJJA 3VGPA 3FZNA 4X65B 4KO3S 1J8FA 2PQ2A 3QUQA 4IVPA 1HG1A 4V03A 1U0OC 4CLRA 4YCCA 1JDJA 2OYRA 3QWFA 4BBZA 3S0JA 2OSBA 4U7FA 4BO8A 4IDBA 4YAEA 2IGBA 4B4UA 4RCZA 4WERA 4X00A 5FWDA 4L4SA 3V80A 2IYZA 2PYDA 2VJMA 3CVXA 2J7PA 3G5UA 4OQFA 5UKDA 2W2QA 3EAFA 2FWBA 3C7AA 3CRW1 3WNVA 2F4VB 3BD6A 3CY6A 1UM9B 1FFXA 4RS3A 4QDTA 3GB9A 3QLUA 3E9RA 1E61A 1H9AA 1O9HA 4HGYA 2VTBB 5K05A 2IYVA 4RMHA 1Y8RA 1Z35A 2X0FA 1QVAA 5KO2A 4Q6BA 4IFBA 2VKQA 1CB7A 1W36B 3A28A 4JY7A 3W5AA 4RELA 1E6MA 1IG3A 4JFAA 3NBAA 2ETVA 4UBNA 4AU1A 3R20A 3TL6A 3AIOA 2F9MA 1JI3A 1R12A 3GBPA 5AOCA 4Z53A 3UY4A 2OTCA 1QU2A 1TECE 1JYSA 5C34B 1UKBA 2PKRA 2WU4A 2XUQA 4LVCA 4OI4A 5DNEA 3GLHE 4PO8A 4H16A 3EWNA 3MGKA 4JB0A 4YP9A 1KVUA 4AJNA 4D3FA 4QBKA 2MSWA 3W0LB 2W9XA 3CF6R 4F92B 5KJ6A 3EPRA 2R2GA 2EF0A 2C8LA 3PQ5A 4HI0E 3MTAA 4UKDA 5CUQA 5F1YA 4JLWA 5GQSA 1TIPA 1RWBA 2DF8A 2H1WA 3WJAA 4LZJA 1GUAA 1Q1BA 1EM8A 2H6EA 2YCLA 1TTTA 5LWQA 5K0TA 4KWCA 4RVHA 1BMTA 2CXSA 1P1IA 4Q7EA 1PWXA 4PU0A 2ACKA 3TIIA 2R79A 5JCOA 1KVTA 3UK0A 3H18A 3BK2A 3CE9A 3EZFA 3L6OO 2WKWA 2AOXA 2QRQA 5CIQA 4ZVNA 1XZMA 3DXFA 1YRYE 4YV2A 1JJFA 1EQUA 2XY4A 1X7WA 4M8KA 1G5QA 4YQEA 3U61B 3HO1A 3A25A 1MHPA 3BGIA 4ZO9A 1UT5A 2G7MC 5AKZA 3F8WA 4L7QA 4QDJA 5TMDA 4ZVSA 3PU6A 4EW2A 2EXXA 1N1EA 2AX3A 1N2HA 3GOQA 2EZTA 2H4YA 1EDZA 1XA3A 3LT4A 1FYVA 4JJKA 2YNMA 3LUCA 1GTJ1 3H13A 3KTAB 3TJZA 4AG5A 1KTVA 1RMTA 1QF9A 2QPTA 4F2GA 1PQPA 2YXEA 4DDWA 4BB9A 5JAIA 1Z62A 2IYWA 3PJGA 4LX8A 2DY0A 1PHPA 2O8NA 5T6MA 2GM3A 3PYMA 3TAXA 5BR7A 1K9SA 4D25A 4U7JA 3BHMA 4D42A 1T24A 1U9IC 1P1HA 3CPJB 4DZRA 3CNEA 4YI5A 4DF3A 1NXXA 1YJBA 2BOVA 1Z0FA 3AXSA 3EDQA 1N25A 1WPQA 4OLHA 3HVKA 4NHEA 4OM8A 1DKRA 3IO3A 2EERA 3NDIA 1ZNWA 3L6RA 4CM1A 4L07A 1CEXA 3JAMA 3IH5A 4WK4B 5HP4A 5JJKA 3D7NA 2X7JA 1V3UA 3P45A 3TLXA 1XDGA 1OU4A 4MVWA 1YZGA 1GPDG 4GP6A 4YPFA 2IU0A 3I8XA 1T6YA 1VL6A 4OYHA 2M6SA 4Q1AA 4BNXA 4URYR 3OCCA 5H16A 3REGA 5LBUA 4UZSA 4H1WA 1OXTA 2PY6A 4I14A 4PZAA 4A8JC 4B3HA 1MX5A 2Z3ZA 3AJDA 2R1ZA 4Q4LA 4WUTA 3ENWA 2Y8EA 3DTVA 2OFXA 1SXJB 3NWOA 4G8BA 5E8RA 1ILWA 3WGKA 1Y1SA 4HEA1 4AJ1A 4AT1A 2FZ5A 4RD6A 4P0TA 3T5CA 2GRAA 8OHMA 3DFUA 1I7PA 1RXUA 1VI6A 3QEJA 4V0QA 5AQ1A 3V7WA 1FSPA 1N7GA 2QTFA 4IVQA 5CJPA 2V65A 1C3LA 3JQAD 3A3OA 3QYAA 1QYIA 1MJFA 1WMSA 4TLBA 5J40A 5JYDA 4QT4A 2AE2A 2JLZA 4ZT2A 3D7KA 2JJYA 1FJGB 2BFBA 4EO9A 4TRRA 1C4WA 2PNJA 2HEGA 4MP6A 1QRAA 2DX7A 1GCOA 2Z08A 4FGUA 4GPTA 4BCBA 4DLZA 3II6X 3DW1X 2CLOB 5K6AA 3SHOA 4UNSA 5DBHX 5IUNC 3OQJA 4RIFA 3KZMA 4XZ3A 5EGSA 2C95A 4G6ZA 6ADHA 3IILA 1U7OA 4B33A 1NASA 4D0RA 3L40A 1I4EB 3I53A 2JD2A 2GNOA 5BQOA 3WQHA 4HFJA 4YROA 3DAYA 4PG7A 4ZAZA 4ALMA 3AKZA 2PV7A 1ZG3A 1YE8A 3K70C 2XZOA 1NMQA 2P9ZA 3A1DA 3M33A 4RVNA 2ZR8A 1XUOA 1B2LA 2C7BA 4YAIA 4V38A 3ASZA 3ZD7A 3U62A 4IMRA 3BWMA 4LWPA 4DNXA 3AM1A 4HYTA 2FQ1A 1XD2B 4UEJA 1DTWA 4IDCA 1YBHA 1E5QA 2OQRA 4ON9A 3RUFA 1HE4A 1SBQA 2QAJA 1S7GA 1TYBE 3C15C 3OF3A 4HQ6A 1RWMA 3WZLA 4KHPB 4XQEA 1G59A 4NBKA 4MDEA 4LMPA 5DPMA 3P2KA 4IAOA 4UZFA 4BBPA 2NUTA 1YKGA 1C0LA 3M6XA 3ROGA 1JRLA 1K5DA 3SM3A 3K9LA 3N9IA 3LM8A 4R5HA 1RYMA 3B9QA 4KAXA 1WSBA 2Q0XA 3G9XA 1LBEA 3HDQA 4IJUA 4A16A 1FDOA 4W4TA 1E2EA 2Q5HA 5DGXA 4E46A 2J3LA 5FPPA 1M34E 1UK8A 1BXRA 2ES4A 1ULUA 1PUJA 2NUPA 1Q44A 1ZGCA 3GPCA 3I01M 4TQGA 3ZLUA 3JQ8A 2J6BA 5LA6A 2YXPX 2PMCA 4WW0A 4KE9A 1KDYA 3SS7X 1Z5WA 1BYIA 3T1VA 1G4AE 2A6PA 2BAGA 3GUZA 1D9ZA 2XWPA 2ZT8A 1VHJA 3AQ4A 1R2QA 4PVDA 4YP7A 4GYYA 2JFBA 5AMXA 2BFFB 4R69A 3LXUX 2W4MA 3AKDA 3T5MA 4YWJA 3ELBA 2HDWA 4XCVA 2WPNA 2ZRIA 4Y2PA 3TSOA 5KWVA 2RH4A 1GG2A 3L7MA 1CRLA 2XT6A 1OYVA 1SFRA 3KYDB 1ZL0A 3UCEA 3FCAA 4MJXA 5DEOA 2Y9PB 5F98A 2P67A 4W7IA 3I2GA 3TMAA 4IKEA 4TMYA 1Q92A 1O97D 2C3UA 4MPPA 2O5VA 1HOXA 3KZXA 1MNAA 5A4KA 3I83A 4NATA 1PVDA 2ZK7A 2XR1A 4JOCA 5GJVC 3CZPA 3ZD6A 2PX0A 2Q5FA 4I5EA 2FQXA 3V1KA 2OUKA 2OZLA 4QEZA 3ICCA 4JJIA 4RW0A 3R4CA 4ZOLA 4QJBA 1H94A 4RHYA 5D6OA 1NVMB 3ZKWB 1Q6ZA 1PBTA 3IC5A 1M1YE 1UFVA 3D5EA 2WPDA 2XTZA 1GL3A 1CQIB 2HCFA 3DMTA 3LHKA 3R3ZA 1VJGA 2ZJOA 2PX2A 4JBYA 3WK7A 1K92A 3K2IA 4GRIA 1W75A 1OVMA 1SIBE 2IOQA 3F1KA 3ZW9A 1E0DA 1F14A 2NPIA 1Q7BA 3LPAA 3Q6MA 5KZMB 4Z0NA 1O3YA 1PEDA 5LZ8A 1C30A 4M3NA 3ZCRA 1TJ3A 4EY6A 2I2WA 4NZOA 2ZYVX 4BNNA 4WWHA 1IXZA 3VOAA 2ZRCA 2P30A 3L8HA 4Q9NA 5IM5A 3ZD8A 1QIFA 3N0WA 3U3KA 1OLXB 1UZAA 3L7LA 1O87A 4HX5A 4EHBA 3BMNB 1OXMA 4OTZA 1CVIA 3I39X 3KO8A 5CFZA 4K9KA 4LCEA 5KYTA 4Q47A 4KXNA 3FFTA 3ZGNA 2XTMA 3E22A 1RHUA 1N8TA 2HJVA 4BY9E 4GZ5A 3G0IA 2KB0A 2IYEA 4NE9A 1C5KA 1KL7A 1NUAA 2PS0A 2QNIA 2K5UA 3H2JA 2IYTA 4MAFA 3U7QB 4BQNA 3DDZX 1FRZA 2O3TA 2Q6TA 3MJVA 1RPZA 1V8ZA 4MEAA 3C14C 3E48A 4QXPA 4LYHA 4KP7A 5CDYA 1NW6A 4JIGA 3EGOA 4MWSA 4MYTA 2WJHA 2WNSA 1PFGA 4D9KA 1BEEA 3AETA 1D6SA 2AJCA 3ESRA 1VBKA 4L08A 4CLEA 5K0EA 1U2RA 3DKVA 4PX3A 5FOVA 4DR1B 3S55A 2OEPA 5C1DA 4LJKA 1FFBA 1M73E 1PE0A 3TB6A 3CTPA 3TNJA 2AT1A 2P3SA 3ENZA 3ETNA 4GNKA 5SICE 4N49A 2QBYA 1A9TA 1NN1A 5TGDA 2JAWA 4RNDB 2H2HA 2ZYAA 3BBPA 3KELA 2VRNA 3JALB 1Z2EA 2PV0A 1YVDA 3NPAA 3I6YA 4NU0A 3QG1A 4D5GA 3ZXIA 3N6XA 1SUFA 1U8UA 4P3NA 3R3VA 1L3IA 2HQOA 3FYUB 4YJGB 4UVHA 3E27A 4PX5A 1MB9A 4FHCA 3SJ7A 1VSUA 2VNHA 4M1QA 1XNRB 4ITUA 1GPH1 4CMEA 2BF7A 3BSSA 1SOVA 5T64A 4IXTA 5FADA 3L6DA 3N87A 2HR1A 4ZT6A 3AKCA 3NT2A 4DTCA 1M0SA 2C3PA 3STXA 1U8YA 2D4AA 3DFIA 1M6NA 2FSVA 1T15A 4KK3A 1E20A 2JLSA 1GLVA 1AKEA 4F5EA 3HYNA 3MFYA 4V0SA 1DBPA 1TO6A 2YINC 4EPRA 4J49A 1VBMA 3DLHA 1QORA 1SBNE 4US0R 4PPNA 3IIEA 3R5SA 5ERGB 4IRMA 4G1CA 1CTQA 1J07A 1X1DA 5AM0A 4CMIA 4O4LB 3FETA 3BJMA 1GQFA 3HKBA 2OR3A 1EWQA 2X58A 3EIOA 3LYHA 4ACBA 1J8YF 2VBGA 1JTFA 4HDOB 2ORYA 2Y9MB 5CTJA 5DP1A 4RE5A 3BK7A 1UBKS 2NYAA 2QG6A 2RHBA 4G0UA 1VLZA 1UZNA 1X8KA 1Y80A 4DBLE 2CHGA 2FMXA 3I9LA 4HH0A 7REQB 1CG6A 2ZUSA 1D2EA 4G0YA 3AINA 4XIFA 3SSNA 1PR1A 4LXIA 4TSKA 1UXJA 1U3UA 2EKQA 4LC9A 5F7XA 5EEHA 3VR0A 2IWRA 3L9WA 4UNPA 4HDNB 1XU4A 1CUEA 1R4NB 1FUIA 3EGEA 3MM4A 1E9VA 2E5WA 2ZSBA 3V2GA 5B64A 3HXQA 4ZAWA 1OAKA 1L5WA 1SC6A 3UHPA 4JSRA 1DCFA 1PI3A 5B6PA 4HEJA 3KYCA 3NWBA 3C6XA 4ENVA 1XA4A 3HZHA 3UUEA 3AOGA 3NHJA 2GJ8A 5FEMA 3QKWA 1MAUA 3TBFA 4AMUA 1XPUA 4KNYA 5B53A 1QZ3A 3MWYW 1V45E 1MR3F 3CISA 1HL7A 4Q3EA 2DWOA 3C3JA 4TN5A 5I3CA 1S02A 4F84A 2R96A 4Q3OA 2I65A 2OBBA 1FLAA 1XU7A 5G3ZA 3ZBTA 3Q0TA 1IRXA 2J5RA 3G7NA 2B0JA 4JEMA 2EP8A 2FOIA 2NQTA 4LE1A 5JHHB 2JJQA 5KSOA 1J70A 1B4DA 1W6RA 3L2OB 4W1PA 1PKXA 4ZAXA 4C1BA 4BGDA 2XCRB 2FN3A 2Q9CA 3KZCA 4WCFA 5JMOA 1KRWA 1OAOC 1Q3TA 2ZIXA 3QHQA 3L0BA 3T4UA 1P5FA 1P6XA 3TNLA 3JVIA 3ZU5A 5JXIA 2XB2A 1LDEA 4RZSA 1YR1A 4KK4A 3T0GA 1ZJ4A 1KE2A 5A71A 4X1KA 1BROA 2QI9F 2JFFA 3HDYA 1SG6A 2A7QA 2E1PA 3IDFA 3KSMA 4OQLA 4QODA 1DO2A 2XX3A 5FWYA 5J58A 2JIMA 2XECA 1QVVA 2HBZA 2QMYA 2UAGA 5KHAA 5DO9A 2DQYA 5EEGA 2DT5A 1KO5A 4QGAA 4BV9A 1DBSA 1Y89A 3DF7A 3PA8A 1XTKA 4QUJA 3RG8A 4BL5A 1Z29A 2N75A 5EMKA 4YR7A 3QLJA 2PFSA 1P6UA 1ZJ5A 2WE8A 3VTFA 4CUZA 3H8JA 3E5HA 1AQYA 1W30A 3IBFA 1AH2A 3F7NA 5HF9A 3HYTA 3OZDA 3TNYA 4DMKA 4KXMA 2RGYA 2G25A 4HDRB 3PD0A 4L3OA 4P34A 2AG5A 3LK6A 1J33A 4FOSA 4OXKA 1D5WA 1QHFA 1U7TA 3KE8A 1QGAA 3L82B 3OIUA 1Z15A 4KG7A 1KK1A 4P3XA 4A1FA 1E18A 1MLDA 3WICA 1RXYA 3GN2A 3BE6A 2WUWE 4L5YA 3RSZA 2QZ4A 3H6GA 3VZPA 4BO3A 1SAYA 3JAKA 4WZZA 4CKBA 1ZONA 3CNQS 4PAOA