4A0SA

Structure of the 2-octenoyl-coa carboxylase reductase cinf in complex with nadp and 2-octenoyl-coa
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
445
structure length
445
Chain Sequence
SSLSRAVLDGASAAEIEAAPVPDTYLALHLRAEDADMFKGVADKDVRKSLRLGEVPMPELAPDEVLVAVMASSINYNTVWSAMFEPIPTFHFLKQNARQGGWATRHDQPYHVLGSDCSGVVVRTGIGVRRWKPGDHVIVHPAHVDEQEPATHGDGMLGTEQRAWGFETNFGGLAEYGVVRASQLLPKPAHLTWEEAAVSPLCAGTAYRMLVSDRGAQMKQGDIVLIWGASGGLGSYAIQFVKNGGGIPVAVVSSAQKEAAVRALGCDLVINRAELGITDDIADDPRRVVETGRKLAKLVVEKAGREPDIVFEHTGRVTFGLSVIVARRGGTVVTCGSSSGYLHTFDNRYLWMKLKKIVGSHGANHEEQQATNRLFESGAVVPAMSAVYPLAEAAEACRVVQTSRQVGKVAVLCMAPEQGLGVTDPDLRARLGEDRLNPLRGLTAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords OCTENOYL-COA REDUCTASE/CARBOXYLASE
publication title Unusual carbon fixation gives rise to diverse polyketide extender units.
pubmed doi rcsb
source organism Streptomyces sp.
total genus 162
structure length 445
sequence length 445
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4a0sA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4a0sA01
4G65A 4RCVA 1CIVA 5EESA 1TT7A 3I23A 4AJIA 3W4KA 2YFHA 2GERA 2Q3EA 3GVIA 4KDEA 4UEJA 4DBVO 1UP7A 2AHRA 4RPKA 2VYVD 1CWUA 1I2CA 1D4FA 3RVDA 1DO8A 3ETEA 1ISIA 1F12A 3T4XA 1P45A 2ZB7A 3CTMA 3A1NA 3FR8A 3VDRA 3TN7A 3WYBA 5KVSA 4O5OA 3HFGA 4KTTE 1ZFNA 5A03A 3AI3A 3GVXA 4BNHA 5DDIP 4RO0A 2NVUB 1HDOA 1SEVA 3JQ9C 3JQGB 2UDPA 1R0KA 4O0LA 2YUTA 2B4TO 1RM0A 4AFNA 4MVJI 4FJ0A 4GVXA 4IDFA 4UUOA 3FD8A 4ILKA 5A3VA 1YL7A 1JW9B 1YJQA 4LMRA 3JD1A 4A10A 4CM9A 3HN2A 2IE0A 1Q1NA 4CV0A 1VKOA 3LC1O 1GADO 3FWZA 4RVUA 1I24A 1H6AA 4OKNA 4IZIA 3DHYA 2IXBA 3DEYX 3ONFA 1A27A 3U9LA 1S7CA 4N18A 2GN6A 4IIVA 3WYEA 2RIRA 5JO0A 3GRPA 3ZN2A 2QRKA 2DPGA 3GVCA 1EUCA 1GUYA 2C20A 1I36A 4LGVA 1H94A 2Q2WA 1DC6A 4JQCA 2OGUA 3MJCA 3TZ6A 1TT5A 3WGYA 5ITWA 3BTSA 2HUNA 3GPDG 5KWEA 5DULA 1NASA 3CMCO 3TQHA 4CQLA 4KUEA 3BMQB 2VYNA 4BO7A 4ZRMA 1UXJA 3JSAA 4BQPA 4QTZA 5L7YA 1NXQA 4DWVA 1BXKA 5F1PA 4Y6RA 5IAAA 1QMGA 2I5PO 1T1SA 1GD1O 2O48X 1PX0A 3IS3A 4IDDA 5IXSA 4KWHA 3NKLA 1DOHA 2PGLA 1P44A 2GD1O 4JBHA 4PG5A 4BNVA 5DBIA 1LJ8A 4DTIA 3TL3A 3SLGA 3PDUA 2VTDA 1KC1A 3KO8A 5JAQA 5F1KA 1LSSA 2E49A 1JDJA 1DJQA 4H7PA 1AXGA 3OIFA 4R41A 1QG6A 3RKRA 3W6ZA 4RF2A 3A06A 4D3DA 5I8WA 2X23A 4MVJH 3ZU2A 3MCVA 3WIEA 2O23A 5JSFA 2PWZA 4ZD6A 4J9VA 4J0EA 1BHSA 2O3UA 3K96A 5TJHA 2CF6A 2C7GA 4CMIB 1HYEA 1KYQA 3VPXA 1P1HA 1SO8A 2HRZA 3GVPA 4CLRA 3MJVA 3DAPA 3DBHA 2Q46A 1RKXA 5KIAA 3WGQA 1RM3A 2EJWA 4ZQFA 1QYCA 1LXCA 1YBAA 1E3LA 3GF4A 3JD0A 4GVLA 3OEYA 3EY4A 4LN1A 4BNXA 4DPLA 1PQWA 3KYBA 4Y6PA 4KP7A 3RUFA 3GEGA 4BMSA 3K2EA 5K6AC 4EZBA 3VPHA 4ALIA 4CMHA 3U0BA 1EK5A 3LQFA 2WDZA 3H9EO 1U9JA 2DM6A 5EJ2A 4MIOA 4IJWA 1CRWG 1ZH8A 2Q2VA 1E7YA 3GNSA 1DHTA 5I7VA 4KOAA 2FZEA 2VWGA 2X0IA 4LCJA 3ZW8A 4B4UA 1FMCA 2XXJA 4ESOA 4NZ9A 5IN4A 5HM8A 3I4CA 4O1MA 1D8AA 2EP7A 2WE7A 4TMFA 1KOLA 1PJQA 1UUFA 4ZA2A 3ZHZA 4J1NA 2D8AA 2UAGA 2WYUA 4J1SA 5THKA 1TB4A 3Q11A 4GI2A 1BMDA 2NVWA 3QWFA 1QXSA 1XLTA 2AG8A 4RVSA 4J4BA 4OIMA 1HDZA 3JQBA 2GO1A 2NM0A 1AGNA 4MJLA 1JAXA 4J4TA 5T57A 3QVOA 1V3VA 1YKFA 5C7OO 4Q3NA 4R68A 4TVBA 4YCAA 4N5NA 2YZ7A 3UFXA 4P38A 5DCWA 3CZRA 1BW9A 1U5AA 3WGGA 4E0BA 4NJOA 3ZWMA 1VKNA 1FF9A 1E3WA 4NK5A 4BB5A 3NT4A 1K89A 5A5FA 3PLNA 2QQ5A 1YVEI 1P74A 3ULKA 2RCYA 2IZ1A 3P5SA 4HXYA 2Y05A 3INRA 1LI4A 4HFNA 4M89A 4J91A 1I33A 2NU9A 3KLMX 2CVZA 3OHSX 1B8PA 1KVQA 3C1OA 3I6QA 3JQFC 1NHGA 3L6EA 3PI7A 4NR0A 3ROQA 4CODB 5ILOA 2DTDA 2FPGA 3KTDA 4ND5A 4PLZA 3RC7A 3DZGA 2HSDA 5F1OA 1NPDA 2IYOA 3GPIA 3I9JA 1IPFA 1N1EA 2PLAA 3SVTA 4RVDA 1I3KA 3RC1A 3H7AA 2VZ0A 3I9LA 4IDGA 4RF5A 1MC4A 3JQ6A 5ENDA 3VTZA 5KJCA 3OF2A 5EN4A 2NU6A 1XHLA 4ND3A 3GG9A 1YL5A 5BNTA 1K3TA 3U5TA 2AQKA 4BS9A 1BRMA 4R1TA 4IM7A 1XELA 3KYCB 1EEHA 3LT4A 3OA0A 3PIIA 3PJFA 1PS0A 1OMOA 1OC2A 5LDHA 1JA9A 5TS3A 3I52A 3AU8A 1P1IA 5I8ZA 4OSOA 1LQTA 4IBOA 1D7OA 1PJ4A 1H2HA 3B1KA 2JHGA 1ENZA 3TNLA 3RUIA 3ETGA 1E77A 2EG9A 3DMYA 1QYWA 4JN6B 2HLPA 4MO2A 3FHLA 3PYXA 1E7WA 3I4FA 3WS7A 1PWZA 1WDKA 4EEXA 2CY0A 2J3IA 4ID9A 1DC3A 4D0SA 2HDHA 3RC9A 5L4SA 2JCXA 1JU9A 2X9GA 1NPYA 3LSYA 5IJZA 5JYDA 3L0DA 1HDXA 3HE3A 4XRGA 1KIFA 3LLVA 5G0UA 1LC3A 3KEOA 3DBLA 4CLOA 1I3LA 3RUDA 4I9NA 4URFA 1JVBA 4DPMA 1N7GA 5F3RA 3L77A 1PGJA 1PGPA 4LCEA 4FJ2A 1HYHA 5G0VA 1H9AA 2B69A 3PEFA 2O2SA 4R1UA 1O5IA 5U1PA 5ILGA 1IL0A 1E3JA 4AJ2A 4RDIA 3AU9A 4A7PA 5HTOA 2IRWA 3BTVA 4XB2A 1TLTA 3LU1A 1HDRA 3M1AA 4BO9A 2W98A 1ZO8A 1C0PA 4PLFA 4RVFA 1V35A 4GQAA 1DBVO 1X1EA 4TRNA 4YRAA 2JD0A 4U5QA 4I5FA 4BGUA 3LT1A 3TF5A 2H9IA 4YA6A 5TRTA 1YQXA 3F3SA 1NFFA 4DYVA 2VUSA 3EHEA 1PZHA 1NQTA 2C2XA 4HV4A 4GSKA 4LMPA 2VUUA 3D4NA 3JYPA 4CM5A 1PR3A 1IULA 3SX2A 1GR0A 2QX7A 4BO1A 3KSUA 3G49A 4K28A 5JMWA 4GX2A 3C24A 3K92A 3UW3A 4E32A 5F21A 5GMOA 3NTRA 4I08A 4CUJA 2JJYA 1GV0A 5CDYA 5L9AA 2V7PA 1E7MA 1DPGA 2X5OA 3CPSA 2HK9A 4GLOA 3F6YA 1ADBA 1PS8A 5T6BA 1LU9A 1PJLA 2BLLA 2NVBA 1U1IA 2VWPA 1UH5A 3KV3O 4IMPA 4K6FA 5AXAA 1H93A 4WLNA 2X5KO 3B1FA 5G0WA 2GGSA 4BNYA 1TI7A 2GR9A 3U62A 4GX1A 3SJUA 3TL2A 4Z9FA 3ZWYA 4AJOA 2WWRA 4L73A 5CEJA 4C4OA 1I2BA 1WAMA 2JFHA 2YV1A 5JYEA 2V65A 3KZVA 3VC7A 3LLSA 1QR6A 4YJGB 4FFLA 4EW6A 1VSUA 2A4KA 3H65A 2DFVA 3QVWA 1B8UA 1P1JA 2NU8A 3WMXA 3HSKA 5HRUA 4WLUA 1N8KA 3NX4A 3ZU5A 4L74A 4XDZA 4CMEA 3A28A 1ZJYA 2VOEA 2PZJA 3QVTA 4JP3A 1YJ8A 4WPGA 3AM4A 1VI2A 3ZU3A 4RJTA 3BHIA 1H6DA 3GR6A 1PWXA 4Z9XA 5J23A 2GN4A 3FN4A 1HKUA 1GYRA 3FBTA 3O8QA 3I3OA 1LDGA 3I1JA 3DHEA 3OM9A 2J5QA 2YYYA 3ON5A 1C1XB 2PNFA 4GGOA 1X13A 4FFMA 1JN0A 2DFDA 8ADHA 4PGFA 1PTJA 5FEUA 2GASA 3VH3A 5G4KA 3OEWA 1DEHA 1N2SA 3Q0EA 1KETA 1VSVA 3H3FA 4MINA 4OL9A 3AM5A 4YB8A 1H9BA 3GDFA 3ICPA 3LF2A 5B1YA 3D5QA 4MP8A 4P4NA 4M49A 3U3XA 3JTMA 4EJ6A 3D3WB 5BSEA 2DBVO 2J6IA 2PD3A 2X8LA 3N7UA 5JAZA 4CQMB 3K73O 5EERA 5A1TA 1N9GB 4B7UA 3PWKA 3CZMA 4OQZA 4Q3CA 3QWIA 4YXFA 3LC7O 4QFDA 4A0SA 2VYVA 1U7HA 1P1RA 3ZHYA 3OA2A 1BDMA 1R4NA 1VLLA 4M54A 2D4AA 2G17A 2V6FA 4UAGA 4E2XA 1LX6A 2WYWA 4D0RA 3E1KA 1L7EA 1U7TA 2P5YA 4JLWA 3FSRA 3BHJA 3BHMA 4DPKA 1CDOA 1JWBB 4U7WA 3PRJA 4YAJA 1VL0A 3VVCA 4GL4A 2Y0CA 1H6BA 4BHTA 4P8RA 3HG7A 6ADHA 3IQDB 4K1LA 2V6MA 2LDBA 3SXPA 3QE3A 3PDJA 2UUOA 1B0AA 1EVYA 4DQUA 5CFZA 3GG2A 4JBIA 1C0KA 2F00A 3BMNB 4XQCA 2Q1WA 3F5QA 3I83A 3S8MA 1B26A 4DGSA 2ZIZA 1AN9A 3WTBA 4XQGA 3HDYA 3QWHA 2P9GA 3WQRA 1E6WA 5LC1A 4ND1A 1KEWA 1RM4A 4NDNE 4WCFA 3ZHXA 4AJHA 3DAGA 3L6OO 5U9CA 1ISMA 3ZV4A 4CPDA 4OH1A 4YJHB 2B35A 4BV8A 3GZ4A 7ADHA 4CM8A 2D1YA 3JQ8B 3ICCA 2ZK7A 3L6DA 4IGEA 4NBTA 1F06A 4BV9A 3RSHA 3DFUA 3NYWA 3JD4A 3P2OA 4E5YA 2EKPA 1Z45A 4CM4A 3ZNNA 4E5MA 2B36A 2VT2A 2HJRA 2H63A 1A71A 3GK3A 1IPEA 3E18A 3JQEA 4TRMA 1MXHA 3GC6A 3H8VA 4I5EA 2ZYGA 3W4IA 3OJOA 3H9JA 4R3NA 2PD6A 3U4CA 3DTTA 4PVDA 5JO9A 4BB6A 4J7CA 1I10A 1PJ3A 2WJPA 3WQQA 2RHCA 2EIHA 2YHIB 4XGIA 2WTBA 4YQZA 3VZRA 2ZTVA 3AOEA 2VZ9A 4J90A 1YONA 3I9KA 2PKRA 1MG0A 4UULA 2OP0A 1ML3A 1NTOA 1HEUA 3BXXA 3CMMA 1ZSVA 2ZTMA 1R6DA 2C2YA 1D1SA 2GNAA 1HSZA 3FF4A 2CZCA 3VZQA 4FBGA 2IODA 1YDWA 4CLDA 4OM8A 1X7HA 3VAZA 3IP3A 1BWSA 4BO2A 2Y1OA 4NPCA 5BNFA 3KLPX 1Z82A 2VZ8A 4XEHA 1KEPA 1ARZA 3O9ZA 4RV9A 3PJDA 1ONNA 4EUEA 4A2CA 1B15A 4B8ZA 1AE1A 4U6QA 2R2GA 2I67A 4FC6A 5L7WA 3VZSA 2DUWA 1Q7GA 1R4MA 1H2BA 2Q45A 4HUJA 4F6CA 3FI9A 2POQX 4WKGA 3C1TA 5K0ZA 4K26A 4CMBA 3GGGA 3ZWOA 1HF3A 3EZYA 1V8BA 2HJSA 2Y1FA 3OSUA 3GQVA 4CLXA 3ZH2A 1FK8A 2NWQA 2VHZA 3E9MA 3EZLA 5MDHA 3NTQA 1NQOA 4S3MA 1VE9A 1B8VA 5IG2A 2Y1DA 4XIYA 1LUAA 4JJGA 5B12A 1UDCA 2G82A 3G1TA 1GQQA 2AEFA 4B4WA 1R66A 3LZ6A 4R5MA 4Q9NA 5KKAA 1N1GA 1KVRA 3CSDA 2O7SA 5FYDA 4HWKA 3ENKA 2B83A 1JQBA 2B5VA 3QWAA 5C7LO 1PIWA 3GNTA 5KVQA 4R4JA 1Z7BA 4PZCA 1B3RA 1QLHA 1GU7A 1R37A 1Y5RA 2WSBA 4HFJA 3H9UA 1SPXA 4JNKA 3VZPA 3L4SO 1ADFA 4FN4A 4ZQBA 5G4LA 2EW2A 3BMOA 4Z0HO 4GMGA 3C7AA 3WFIA 4P22A 2GSDA 3WXBA 4IIUA 2CNBA 4YYZA 3HB4X 2CF5A 4EUFA 4GMFA 4E3ZA 4E6PA 2PD4A 1GPJA 9LDBA 4YR9A 5DCUA 5JLAA 2O7QA 5DP2A 3TOXA 1SAYA 3P19A 5JMPA 3H5NA 1AHIA 2VRCD 5JDCA 1ZSNA 4AJLA 4FB5A 4NK4A 3C7CB 3WGZA 2HO5A 4YACA 4E5NA 4MVJD 4YQYA 4PLPA 4E31A 1EDZA 1SBYA 4W7IA 2YV2A 2Y68A 1HZJA 4CR7A 1K5HA 2HRBA 4WLVA 1ZK2A 3KVOA 4A27A 4E4YA 4E33A 1T25A 1ZZEA 1IZ9A 1JVSA 4PRLA 4E2YA 1I32A 2EGGA 1YB1A 1YS4A 1ONOA 2FR8A 3K6JA 4M87A 4QEDA 1Q2XA 2AXQA 1VL8A 4XD2A 3INTA 4J7UA 1I0ZA 1I3MA 3WBBA 1TA4A 1YE3A 3GEDA 1NBOA 1TVEA 3DZBA 4OGWA 3AOEC 4D3FA 2B0JA 5ER6A 2J8ZA 5G0SA 2D5AA 3GHYA 4FW8A 2VHVA 1DRWA 5KCZA 2QG4A 1SOWA 4U0JA 3MTJA 4FOSA 3VH2A 1SMKA 1E3IA 2OHXA 2X22A 2V6BA 4CQMD 1E6UA 2ZTLA 9LDTA 2I9PA 1LSJA 2C59A 4PLHA 5COAA 4HNGA 4WGGA 4EBFA 3FTPA 1BTOA 4HKTA 4BQRA 5JY6A 2QRLA 1QKIA 2DC1A 4W82A 2ZQZA 1HLPA 1SB9A 1V3TA 2SCUA 2C0CA 1JWAB 3GHHA 4Y67A 3WTCA 4DLLA 5L40A 3N58A 3V5NA 3KUXA 2UV8A 1GUZA 2FY8A 3PZRA 1NWHA 1TEHA 2EGHA 1ENYA 4WNIA 4TQGA 1DDOA 1KERA 1E1NA 2H6EA 2IEDA 1I3NA 2P9EA 3CXRA 4X54A 4BGVA 2AE1A 2NVUA 4OYRA 3PWSA 2A92A 3RFXA 1EE9A 2WYVA 2PZLA 3OQ6A 3RIHA 2DUUA 2NV6A 1GEEA 2VWHA 2DLDA 4QX6A 1YDEA 3V1UA 2BGLA 4BO8A 2W2LD 1Y8RB 3D0OA 3X2FA 4R16A 3DZKA 1GCOA 3CKYA 3GAFA 4IQGA 4OO3A 1I01A 3F1KA 4O63O 2W90A 1PJCA 3FPCA 3PGXA 2BGKA 3GZNA 3PYMA 1BVRA 1PGQA 2JD1A 1EVIA 2V6GA 3OJEA 4IY1A 2FSVA 3F1LA 3O4RA 4TZTA 1A9YA 1ZK1A 3D64A 1Z75A 3OMLA 2X5JO 4L76A 5A9TA 3EDMA 1M75A 3PXXA 3CEAA 3ZCXA 1QYXA 2HK8A 3UAGA 5CDTA 4N5MA 1U3UA 1A4UA 4S1VA 4H15A 4J0FA 4I8XA 3RUHA 3IUPA 4R5HA 1JKIA 1KEVA 2FHSA 3JV7A 3KXDA 1X0VA 2PZKA 1KC3A 2DPHA 3ADPA 3MJSA 4CLRB 1D3AA 3IUSA 3STHA 2X0JA 3LT0A 5KKCA 3NUGA 1KVSA 3ZNQA 2AQHA 3Q2IA 1B16A 4IDEA 4FSHA 1WZIA 2J5KA 3PHJA 4B3IA 2Z1MA 4AJNA 4DXHA 4PLCA 3QRWA 4BNUA 2BHLA 2VOJA 1ISFA 3OJLA 4XRRA 1UXKA 3WQSB 1KEUA 4IQ0A 5JCJA 3DQPA 1LLUA 2IDZA 2PKQP 4EITA 5ICMA 3E9QA 4CL3A 2P2SA 2G5CA 4JCOA 3ZWCA 1XGKA 2NACA 3EUWA 2FN7A 2GPTA 3GLQA 5DT9A 1SOVA 1ZCJA 4MDHA 2B37A 2O3JA 5TNXA 3ANLA 4YT4A 2JFGA 1YBVA 4L0QA 4BO0A 4NIMA 4E2WA 3BTOA 1NPTO 2I3AA 2CVOA 2W8ZA 1DAPA 3A14A 5CG1A 3WLFA 3HFSA 2TMDA 2RAFA 3NJ4A 3ZDFA 4TKLA 4TZKA 3S2IA 1F8GA 3UN1A 4FR5A 5A04A 4P4LA 1MV8A 3ORFA 3V8BA 1LDBA 1YL6A 3AY7A 1XYGA 4OXKA 5A3JA 1O95A 2X0NA 4W99A 4DREA 1Y9EA 2YW9A 4I1IA 1EQ2A 3ZWPA 2PKQO 5C37A 4FFRA 3ZWXA 1NVMB 2J3KA 4RL6A 1U8FO 4BGIA 3NGXA 2E48A 4BO5A 3C3XA 3GT0A 3UH1A 1L7DA 4GLLA 4MKZA 4UREA 5K9ZA 1DIHA 3OH8A 3ZWBA 1GQYA 1GZ4A 3DONA 3KYDB 3ZHBA 3DXFA 4Z9YA 1BW9B 3B20A 1ADCA 2VT3A 2XPCA 4ZJUA 2I66A 3RFTA 1W8DA 4PLWA 2BFPA 4AJ4A 3W8FA 1E3WB 3Q6IA 3RBXA 3IDSA 1V9LA 1CEQA 1T2EA 4DYDA 3WB9A 1T2DA 3JQAA 1D1TA 4FOOA 3OIDA 2PZMA 1ZUD1 1MUUA 1ZKMA 2Y1EA 3RROA 5H82A 5TIIA 3PWZA 1P3DA 1HL3A 1LNQA 3VPFA 1ZSYA 2Y99A 3DDNA 1T2AA 2P91A 1F8FA 3GN1A 4I9HA 4O59O 4WLEA 4NNJA 2CFCA 4CLEA 3UKOA 4BNGA 4YVFA 4HX5A 3RUCA 3UXYA 1NR1A 4WEOA 5DOVA 4QUKA 2E4AA 4II3A 3TSCA 4N54A 4EJMA 1ISJA 2H5LA 3G0OA 3MWEB 2OMEA 5A05A 2QZZA 1Y8QB 1YOVB 1SB8A 1K6IA 2B4QA 4H3VA 3PPIA 4UVDA 1B14A 4CMJA 2DKNA 3IKVA 2CSUA 3D3EA 4K6CA 3BTUA 3SBOA 3U4DA 4E30A 4CM6A 1VJ1A 2VHWA 4F46A 5THQA 4Q3BA 2W2KA 4ZU3A 2OXIA 5B4TA 1EVZA 4GX5A 4FD3A 4GX0A 4JJIA 1WDLA 3GY0A 4XR9A 1NAHA 4DIOA 2E82A 4XJTA 5DNAA 2AQ8A 4D42A 3EAGA 3AFMA 4BKQA 3PP8A 4MP6A 1U28A 4BNJA 2Y93A 4ND4A 1O89A 1T4BA 4YJDA 4EJ0A 5F5NA 4INAA 1GY8A 1LA2A 4Q3EA 4Q3DA 4NHEA 2AEMA 4CM9D 3S2EA 1XU9A 3D1LA 5IZCA 2R00A 5TJ9A 1ULSA 2PA3A 5AYVA 3AFNA 1DLIA 1PQPA 1PGNA 3L9XA 3PQDA 3DWFA 1MP0A 2WD7B 1VJTA 2OFPA 3H5RA 4M8SA 5I7FA 3MOGA 5KVVA 1UZLA 4XYEA 1OFGA 4J43A 2X0RA 4GBJA 2H1SA 1MFPA 3VPSA 3KYCA 3I9OA 3ZV3A 1DFHA 2YFQA 4IINA 2PH5A 4CMKA 4XZ3A 3UICA 2YQ5A 4U6SA 5L51A 5TGDA 1C0LA 1O9BA 2WE8A 4FQ8A 1NQ5A 2NADA 3ASUA 1IB6A 3SEFA 4J9UE 4WLFA 5DZSA 3F46A 1FJHA 1X15A 3NDJA 3DO5A 4G2NA 1PL8A 1GAEO 1YO6A 2EWMA 2A94A 5H81A 3ETDA 1FDWA 1RYDA 3H3JA 2YDYA 3F5SA 3GUYA 3PIDA 4NU6A 5JW6A 1B3BA 4FGSA 4YJFB 3GAZA 2EP5A 4JBGA 3DOJA 4PVCA 1DRUA 2PH3A 3QP9A 4CLHA 3JQ7A 4IUYA 3WICA 3TPCA 1NX6A 3DZJA 1W6UA 2O50A 3JQBC 3DZHA 3TZKA 2BD0A 4WEQA 1ZXBA 1O6ZA 2I65A 3DAFA 2X4GA 3LVFO 3UUWA 4CV1A 1IUKA 4YEDA 2QRJA 3BMCA 2P4HX 3QWBA 4IDAA 4YT5A 1WZEA 4JIGA 1LRLA 4DC0A 4QSMA 5EMHA 2A35A 4W7HA 3I6IA 1TXGA 1M67A 3O26A 5I9LA 4E2ZA 4AICA 4DQVA 3NV9A 1YRLA 3UCEA 4ZICA 1LRJA 4BNKA 4QXMA 4NU5A 4CR8A 5COBA 3WR5A 1DLJA 3GGPA 4ALKA 3OBBA 5HA5A 5F5LA 3MJ4A 2G0TA 4DIBA 4ZRNA 5EL0A 4CJXA 2PFGA 4QQRA 1ZEJA 4GAEA 5T8KA 2VNSA 5B4VA 1ZW1A 4B79A 2P4QA 5FWNA 4G81A 4RLSA 4XQEA 4A73A 1NR7A 2DU8A 4RQUA 3H9GA 5TT1A 4ROSA 4LISA 2O3SA 2CUKA 5CHEA 2CMDA 1E1LA 4ITUA 3WNQA 1QV6A 3O8QB 1P0FA 2RH8A 4XB1A 4F45A 1AXEA 1IE3A 1T1RA 3EGOA 3HN7A 2FZWA 3H9QA 4C7KA 1RJWA 3E5MA 3MTGA 1LC0A 5IXYA 1E7RA 1WDMA 1JAYA 3ANNA 5AOVA 4A5OA 5T5QA 5JFOA 1NP3A 1V0JA 5DBGA 1BXGB 3L07A 3H4VA 3PGJA 1ZVMA 3WWZA 1RWBA 2DTXA 4F3YA 3RBVA 3QJ5A 2Q49A 4GWGA 1XDWA 1KVTA 2R00C 1HE5A 4RGBA 4CUZA 4PLTA 1AHHA 1EFLA 4YJGA 1IY8A 2Q4BA 5G0TA 4K9DA 3JYOA 4L4SA 3AUSA 2DTEA 4AJ1A 5AXDA 1Z7EA 1S6YA 2CD9A 4J6FA 3ZGYA 4B7CA 4UEOA 2OORA 1K0UA 2A9FA 3QSGA 2Y0DA 4YRDA 1ZEMA 3VKUA 2W4QA 1E92A 1EZ4A 2JL1A 1GL3A 2GDZA 5AXBA 3TFOA 1M2WA 3UGKA 1C1DA 3OJ0A 1Z6ZA 5EINA 4YWJA 4D79A 4R3WA 2VUTA 1C1XA 4FFOA 5BSHA 4AJJA 1LRKA 3RKUA 3EVTA 5DBFA 4FS3A 3S2GA 5AQ1A 2ET6A 3F47A 3FCOA 2TMGA 2FPIA 3V1YA 2HQ1A 4DLBA 5FFFA 3D3WA 4M1QA 2Y1GA 4ALNA 3IJRA 3E48A 3FNHA 4WE3A 4TRRA 1GEGA 4D43A 1Q0LA 1EUZA 3PJGA 5LCXA 4L75A 3ROMA 4CM8B 2JKVA 4IDBA 4M86A 4U0KA 3WIDA 1N7HA 1P31A 4JJFA 4QO7A 1Q0QA 1ZMOA 4LK3A 4N5LA 3PQEA 5C7IO 2D0IA 3K5PA 4JGBA 3NTOA 3TZCA 1SC6A 4J1QA 4JROA 5IF3A 4XYLA 2I6TA 3AM3A 5FF9A 3C1AA 4BKUA 2ZCUA 4DVJA 2GZ2A 1VM6A 1UAGA 3FNFA 4XR4A 4RF3A 1BGVA 3WGOA 5A4DA 1PL7A 1CQIA 1G0OA 1BDBA 1QSGA 1XSEA 3I9NA 3L9WA 3SLKA 2DBRA 1BXZA 4MVJM 1MA0A 5DN9A 3IKTA 3LYLA 3DTYA 1YQGA 1HYGA 4I5GA 4M55A 1Y81A 3QY9A 4Z3KA 3BMNA 4GSLA 2EERA 3C7DB 1SNYA 3IOYA 3LDHA 4XWYA 4RORA 5T8KC 3R3SA 4XIJA 2HU2A 3DBRA 3TWOA 2D59A 1A5ZA 2YDXA 4TROA 2O4UX 3QVXA 4IJVA 3VDQA 1GPDG 1GV1A 3JQ8A 4IDCA 3O38A 5TF4A 5BR7A 2VHYA 3H5AA 2BKAA 3B1JA 5IN5A 4CMEC 5A5EA 4BNIA 4NFYA 4IZHA 3HDJA 4PIVA 3DOOA 4AJKA 4UEKA 5JY1A 1O0SA 1ZMTA 4PCVA 4BNTA 1R0SA 4DQXA 1M6WA 1Y7TA 4HP8A 3GFBA 1XR3A 4RF4A 3OIGA 3SJ7A 2HCTA 2PK3A 1J5PA 2ZB8A 2NTJA 3JQ9A 5GZ3A 1NWCA 2AA3A 2Q2QA 5KNLA 1ID1A 3NT5A 1HETA 4DLAA 4OOFA 3W6UA 3RI3A 2NLOA 3ZV6A 2IXAA 1M6HA 2YHIA 2OZPA 2ZJ1A 1DHRA 1UJMA 4DL9A 3TZQA 1X7GA 4R1SA 1FXSA 2WMDA 5L95A 4IJKA 2UUPA 2IEBA 1UR5A 4Q3AA 4WASA 4RPLA 4LVCA 3MOIA 4CV3A 2DT5A 2EJVA 3FRJA 1CF2O 1LTHR 1PQUA 3MJEA 2BFMA 1XA0A 1A7AA 2NQ8A 1VPDA 3DOCA 3PK0A 2EXXA 4IS2A 4BNNA 3M2PA 5A9SB 2C07A 3NJ8A 2VTEA 5HWSA 3NRCA 1CJCA 4UUPA 1MC5A 1XCBA 4PG8A 1KS9A 3RCBA 1G6KA 1FDSA 4OMUA 3KHUA 2J3HA 1RM5A 3HWRA 3QVSA 1F0YA 5L7TA 5I9NA 5A02A 4R69A 2QZ9A 4Y6SA 4KMSA 3TOZA 2WEKA 4CMCA 5A06A 2HMSA 1DC4A 3HHPA 1QP8A 5KTKA 3MJTA 1ORRA 5JC1A 3TFQA 4ALMA 1ISHA 1WP4A 4W6ZA 3C85A 4NJMB 2DAPA 4WCFC 5I9MA 5TC4A 4DA9A 4BO3A 2OUIA 1DSSG 5EPOA 4GGPA 4PG7A 3ROPA 2X86A 3WDSA 1E5QA 1PR9A 1ZXLA 1ZNQO 2NTVA 2DBZA 3GDOA 4ZQHA 4TKMA 3E9NA 3GOHA 3ZWNA 2GRAA 3Q3CA 2C82A 3AOGA 1SCUA 2YJZA 2QHXA 4BGEA 4KTVE 3WGHA 2HMWA 1HE2A 2IZ0A 3NT2A 3E82A 1P1KA 2BFAA 3F4BA 3VH4A 2GCGA 3F4LA 1HDGO 2J5RA 4IMRA 4DUPA 3GEMA 1QLJA 3JD2A 4BIIA 2C7VA 1W0CA 3DBVO 2BI7A 2NNLD 4UVHA 2B4RO 2OO5A 5KJFA 1A7KA 1UDBA 2NSDA 3AJRA 3E5RA 4HY3A 3S2FA 4Y98A 1M76A 3HJAA 4BKPA 3EVNA 1A4IA 3BYZA 1B7GO 2FSSA 1NFRA 5KJ6A 2ZJ0A 1ZK0A 3K30A 4NBRA 3ST7A 1Y5MA 5I7EA 2C29D 2HMUA 3DFZA 4Y9DA 1PJTA 3PLRA 2FR1A 3WGTA 3WMWA 1F14A 2OL4A 2Q4EA 2VNAA 5K6AA 4EI2A 3OQ1A 4XJSA 2VHXA 3CIFA 3NAQA 1EQUA 2EKQA 1T2FA 3KETA 2C54A 4FDAA 3U4HA 4AJEA 4NMHA 1LSOA 4OQYA 5JPIA 4XGNA 1W73A 5BSGA 3KB6A 3KSDO 4LSWA 1PGOA 3T7CA 4O6VA 1TT5B 4ZHSA 5BQFA 4BKOA 1N92A 1LLDA 3KEQA 4CQLB 2FPPA 2I99A 2OP1A 4CUKA 4ZN6A 4LRTB 3RFVA 3P2YA 3JQGA 3V2GA 4R9RA 1HLDA 3COSA 4IGFA 1O8CA 5DCYA 1EMDA 1KVUA 4KUGA 1U5CA 4XX0A 3UOGA 1K6JA 3GZNB 1CERA 2F1KA 3GUCA 1LLCA 4YBZA 2I3GA 5AVOA 4IXWA 1LEHA 4WOKA 1DIBA 1EFKA 4R54A 1GCUA 1OOEA 3GH3A 4W4TA 2X9VA 1IZ0A 1U4OA 3VVBA 3VTFA 4LVUA 2VCYA 1PSDA 4FFNA 4HFMA 2BI8A 2NTNA 1FDUA 1E0DA 3EC7A 4OOEA 1HE4A 1DC5A 1N5DA 3JYNA 4EGFA 5BNIA 2P5UA 3GRKA 4WNCA 3KOUA 5BT9A 3OQBA 3V2HA 4BO6A 1U3VA 3NGLA 2PY6A 3HNPA 4AVYA 3DZFA 3H2SA 3HZZA 4RPGA 4GWKA 1MG5A 4OAQA 4YAKA 2NUAA 1BVUA 3GVHA 3IJPA 3JD3A 3QA9A 2UVDA 4FJ1A 3EK2A 4Y8VA 3JQFA 3PZBA 4W9NA 4TVOA 3BMQA 4ALLA 2E37A 4YTEA 1Y1PA 1Y8RA 5CAEA 3ROKA 2Z95A 2YY7A 3DZIA 4NI5A 2AW5A 3DBHB 1MB4A 1I30A 1M66A 3VHRA 1OI7A 1JTVA 5K1SA 1H0KA 1ZK4A 2ZYDA 4GKVA 3I5MA 4U8GA 4J4HA 3CH6A 1LQUA 4AL4A 1VL6A 1Y6JA 4PLVA 5JDCC 2CDBA 1AUPA 1FDTA 2QYSA 3ITDA 5L4LA 4JXKA 2YV3A 4MKXA 1UXHA 3FTNA 1PL6A 1WMBA 4BVAA 3F9IA 4EEZA 1ZIDA 3IAHA 5CEFA 4NFHA 3HUDA 1BSVA 4A03A 1C0IA 3A9WA 2PGDA 4R1NA 5DF1A 1MGOA 4UUMA 3CUKA 1LDMA 2ILTA 1P0CA 3HQ4O 3U4IA 4PG6A 4FCCA 1DB3A 2BFOA 5IDQA 1Q0HA 3HADA 5HS6A 4B3JA 4MIYA 1I5RA 2ZCVA 5CDSA 3DB2A 5T67A 1WPQA 1HDCA 4QO8A 2FRDA 4CM3A 2UYYA 3BAZA 4CMIA 3OICA 3IL2A 5GZ6A 4XQ9A 4IJUA 3JCZA 1YXMA 1UXGA 3KRTA 4ONEA 3UCFA 3GMSA 3NDRA 4I9UA 2C5EA 1PJSA 4I5DA 3AW9A 2OBNA 4YAGA 5CPBA 3PFWO 2CVQA 1BG6A 2QIOA 3W1VA 3JQAB 4CMGA 3T7EA 1ZK3A 4BUCA 4WLOA 1NQAO 4OHUA 2CDCA 1WNTA 4E5KA 1LSUA 1A9ZA 2Y0EA 2P68A 2Q1SA 4CV2A 2X7HA 2ZQYA 1QV7A 1YBMA 1PS9A 4XA8A 4HFRA 1R0LA 1PJ2A 4BOYA 1EBFA 2D3TA 3WX0A 3AK4A 4OXYA 4YDRA 5CDUA 3RAJA 5CP8A 3BA1A 2QYTA 2RBEA 3HDQA 1O94A 1PZGA 2EKLA 3UF0A 5IFLA 1UZMA 3OP4A 5LDGA 4OXNA 1CETA 2EHDA 3DC2A 4IPTA 5GY7A 1IHYA 2X1HA 3Q9NA 1E3EA 2PR2A 2FOIA 2IYPA 2FWMX 3QV1A 3ZWAA 1GFSA 4YPOA 1J0XO 3ITKA 3KYDA 5TX7A 1LDNA 1Z73A 2AE2A 1RPNA 1PZEA 2J3JA 2VRBA 2XOXA 2W2KB 4ZQGA 5FI5A 1NFQA 1XWFA 3PQFA 3RUAA 3ZNPA 4KQXA 3GN2A 5HS4A 3PFFA 2P9CA 4BMNA 2JFFA 2EW8A 5TQVA 1OZAA 2EF1A 5KJ1A 1H6CA 2BRUA 4WJZA 2JHFA 4PFJA 5KVCA 2GZ3A 3BIOA 4QT0A 4OKIA 3TJRA 4BMVA 4Z3DA 1A72A 4UUNA 2X6TA 5EQDA 2ZB4A 3IC5A 1PJBA 4D7AA 3K9QO 1HWYA 3LK7A 4W9NC 5CG2A 2JCYA 1E6EA 1P77A 1XU7A 1X0XA 3Q9UA 2GZ1A 4IS3A 5TLSA 3TDKA 1NYTA 4AJPA 1JKJA 1T24A 5EIOA 3OFSA 2Z5LA 1WMAA 4KQWA 1Y8QA 1YOVA 3Q2KA 2GUGA 2RH4A 3DBLB 1Q7CA 3M2TA 1EUDA 1XEAA 4CLOB 3VPGA 1ISGA 1B2LA 1CQJA 5L45A 3ONEA 1NAIA 4DC1A 4LRSB 1E7SA 3LF1A 4XGKA 6LDHA 4YRBA 4MPDA 4B4OA 4IXTA 4R01A 1GUFA 2AEJA 5B4UA 5MGBA 3ZV5A 5JBIA 5L4NA 1EBUA 4MOWA 2X9NA 3PHHA 2GYYA 3RASA 3IP1A 4NFSA 3QHAA 2JCVA 1ULUA 2X58A 3ENNA 1DXYA 3AWDA 5C5IA 3N74A 2R6JA 4PN3A 5ES3A 4ZVVA 2VYND 4J1TA 4MVJP 1RYEA 2HAEA 3VOSA 4C7JA 5ENVA 4B8WA 2VQ3A 2OBYA 3JQ7B 3K8ZA 4BL5A 5DP1A 1IOLA 1DFIA 4BNLA 2LDXA 1OC4A 5IDXA 3ZWWA 1NNUA 1HSOA 3BMCB 2AQIA 3UHAA 1I8TA 3RWBA 3NEPX 4L4XA 4J7XA 2WD7A 3WWYA 3PYLA 5G2OA 2Y67A 3W8EA 1DIGA 3Q1LA 3C8MA 5BSFA 4FPXA 1ENOA 4TWRA 3CE6A 1MLDA 3GGOA 4DBZA 2JD2A 3D5TA 1CYDA 1Z74A 3PTZA 4J2HA 3RUEA 3WOHA 5I7SA 1IHXA 2HK7A 1HTBA 1Y9AA 4OJNA 4XKJA 2BF7A 4EYEA 1G1AA 3QIVA 5ADHA 3X2EA 1DFGA 1PEDA 3FWNA 3CINA 4YJFA 5JNLA 3LC2O 1SZJG 1EE2A 1PZFA 2IZZA 4YT2A 4E12A 4RZIA 2G1UA 1LDEA 3ZU4A 4FFPA 1EK6A 1WVGA 4E21A 1E1KA 3FPLA 4RQTA 3D7LA 3JYQA 3RJ9A 1I2ZA 1UZNA 5U4QA 4DMMA 3GDGA 4XYBA 3JQCA 5JCJD 4JP2A 5CDGA 1HE3A 4LSMA 5JXWA 1F17A 3PVZA 3PHIA 4CL8A 2E6UX 3T4EA 2YQ4A 3V2UA 1LLQA 1MXFA 3W4JA 1UP6A 3HDHA 5COQA 4FC7A 1GZ3A 4JX8A 5B37A 2ZB3A 2DBQA 1ENPA 3QQPA 4PZDA 4NBWA 3G17A 1GYPA 2XAAA 3DR3A 4MVJF 3U49A 4MVJG 1YB4A 1OAAA 4D44A 5G4KB 3SC4A 3GA0A 1E3SA 4GKBA 1YGYA 5KOIA 5IDWA 4WUVA 4Q39A 2EEZA 4IQ8A 3OJFA 5EQFA 5JC8A 5JS6A 2NU7A 1UAYA 4HBGA 3AUAA 2QW8A 4B3HA 3RBZA 4D45A 3DL2A 5IZCC 1EDOA 2B5WA 3L4BA 1GTMA 2Q50A 1QYDA 3DHNA 1DJNA 4G5HA 3HB5X 3PHLA 4JK3A 2VRCA 3ADOA 4NBUA 4BNWA 3S1LA 3WGIA 4J3FA 4MKRA 4XYGA 3KSZO 1R4NB 1U3WA 3JQDA 1QRRA 4MVJA 4PZEA 1GYQA 1C1DB 3WBFA 3ZNOA 4QFCA 1YB5A 1VC2A 3K31A 3M6IA 4PLGA 1LBEA 1MX3A 1GDHA 1XIVA 4ZQEA 1W4ZA 3P7MA 4H16A 4AG3A 4PRKA 3JQAD 3ZWVA 4RLHA 2O3QA 1BXGA 5L53A 1R12A 4Z6KA 4UVGA 3RC2A 3W8DA 8LDHA 1IYZA 4TRJA 5CEEA 5JAIA 4CM7A 1T26A 4DIFA 4NBVA 3IIEA 1T4DA 2BMAA 5H83A 2D2IA 1J49A 3AUTA 1U4SA 4J16A 4RVGA 4J49A 1FDVA 3WFJA 1YH3A 2G76A 2O3RA 4WCFB 4E5PA 1R16A 5JDIA 2JAHA 3H6KA 3WJ7A 4CQMA 5JAMA 1K2WA 1J6UA 1EVJA 2XF8A 1N9GA 3H2ZA 4EUHA 1V6AA 3ANMA 4NH4A 4RDHA 1G0NA 5KJEA 2PTGA 2Y1CA 1UP4A 4EDFA 3GFGA 3RJ5A 4D46A 4ALJA 1DIAA 4UVEA 3ABIA 2ZYAA 4II2A 1U8XX 4UVIA 4KZPA 1NVGA 4CM4B 4BNFA 3IMFA 2AMFA 3RD5A 3UCXA 3DMTA 5FI3A 4D41A 3EW7A 2NQTA 1P9LA 1QORA 3A4VA 4NQZA 5TSDA 2VN8A 3AY6A 2FR0A 4L9RA 2O4CA 3I9MA 4ZGWA 4XCVA 1H5QA 1C14A 3FBGA 7MDHA 4DMLA 4F6LA 1OBFO 1YQDA 3B70A 2ZKLA 4RVHA 3PHGA 4FIZA 3DBRB 1YWGO 3FR7A 1HZZA 5C3MA 4WK6A 1ADGA 1WWKA 4OSPA 2W2LA 5AXCA 4CR6A 3G3EA 4BNMA 3WLEA 2HMVA 1XKQA 3VH1A 2HKIA 4P4GA 4DRYA 5IDYA 1XQ6A 1L1FA 3WJAA 2GF2A 1HRDA 4L8VA 3RU9A 1KY5A 3ASVA 4MP3A 2AG5A 2Y66A 4YJHA 4GH5A 4B4VA 3ZI0A 1VJ0A 2WD8A 4YAEA 5L3ZA 2YHUA 2BH9A 1X7DA 4TSKA 3G79A 2EV9A 4N7RA 4BKRA 3EYWA 4BO4A 3LT2A 3S55A 1SEPA 2BELA 1V3UA 3INGA 4L4RA 2C5AA 4ND2A 3JYLA 4WCDA 1R4MB 5ITVA 3R0IA 1PU2A 3UVEA 4YAIA 3MWDB 5ICSA 1NM5A 3R6DA 4RPHA 3WYCA 5CPFA 4E13A 3FNGA 3RQSA 4KWIA 1UXIA 1XG5A 4KDFA 1WLYA 2HMTA 1GQ2A 1LDYA 5T64A 1E7QA 3L4BC 3WSWA 1U2GA 2Q99A 1HXHA 1GZ6A 3RU7A 2PV7A 2PGJA 3ZZNA 1NHWA 4B7XA 1P1FA 2Z1NA 5IZ4A 3OETA 2DVMA 2Q1UA 1U3TA 3K2BA 4A26A 4CM1A 1UDAA 1R15A 4PLYA 1ZBQA 4R51A 1T2CA 3QLJA 5ER9A 4HADA 2FMUA 3NDIA 4LW8A 3D4PA 3TRIA 1E5LA 3KM0A 3U09A 3AI1A 1DIRA 1KBZA 3ZW9A 3BMOB 2GN9A 3FNEA 4FGWA 1WW8A 5DOZA 2O2YA 1QYVA 2JAPA 2VWQA 3E6AA 4QECA 1DAOA 1ZJZA 2O3TA 3G1UA 2I76A 1K6XA 4MIEA 2ZATA 2OOSA 1KY4A 3ONDA 5JDIC 2DQ4A 4Z0PA 1HDYA 4XYMA 3TZHA 4YT8A 3E03A 4R9SA 1ONPA 1XQ1A 5TT0A 3B6ZA 4XDYA 1P33A 1U2DA 1JLLA 4HNHA 4RPJA 4J2OA 1X1TA 3BZUA 3MEQA 3VKVA 3R3JA 3AI2A 5JE8A 3PJEA 3WG9A 3M1LA 3WNVA 4KUHA 2ZTUA 3OECA 3DMTC 2CDAA 3SC6A 3KBOA 3MZ0A 4CMAA 5A9SA 3R1IA 1MFZA 3E8XA 1NVTA 1J4AA 5A9RA 2RHRA 4D3SA 1X14A 3EMKA 1DRVA 2Q1TA 1VRWA 3AUUA 4RZHA 3WSVA 4NG5A 4BNZA 1E1MA 1WXDA 3QW2A 1HT0A 2BGMA 3GNQA 3O03A 5JCXA 3GMDA 3V1TC 1JKFA 2XXBA 4PG4A 1Q7BA 2FP4A 4GPD1 4MVJE 3D4OA 4WECA 5HBRA 1C3VA 2WM3A 5GZ1A 2GLXA 4NJMA 3AY3A 4WOJA 4Z0TA 2GN8A 2D5CA
chains in the Genus database with same CATH superfamily
4G65A 1W75A 4WADA 1AKYA 4EGCB 1JA0A 1MJGM 2AZDA 3TRKA 1KO5A 5E1DA 4AZ3A 3AMVA 3PLAE 3ZCRA 3LX6A 3SR4A 2YY5A 3VPAA 2H92A 2Q3EA 3BFXA 3D0RA 4MEAA 2OZLA 1C29B 3A25A 4ENPA 2F4NA 3RTAA 1CWUA 1D4FA 3RVDA 1DO8A 3W06A 1F12A 3T4XA 4GL2A 4F8EA 2WAAA 5GGXA 3EGDA 3A1NA 3DW3X 3C3BA 1XXLA 3FWPA 4C0LA 4ZT2A 2HHCA 2I4RA 3PT9A 1JHYA 3WYBA 3HFGA 5BW6B 5MN4A 4Q4HA 1ONBA 1JPNA 1SJ9A 3K0AA 4GIBA 1NM5C 3WHKA 4B48A 3HVJA 1EWVA 4JV5B 4X3OA 2IEYA 1HT3A 1HDOA 3JQ9C 2WJJA 2FUG6 2UDPA 4QHSA 2JK0A 2YUTA 4QUJA 3KDSE 2QVCA 1AQLA 3OE1A 3TK1A 2VDVE 4NMXB 2GEJA 3OZDA 4FJ0A 4TMTA 3AKDA 4KCGA 1IRIA 1M6VB 3LXUX 4HEA1 2Y71A 1QP7A 3C3PA 1UBMS 2HSWA 1KYYA 2RGGA 3FCEA 1TQ4A 1YDGA 3MCUA 2OSVA 3KWJA 1JHUA 3KX2A 3VJLA 1W87A 2R1TA 4CQJA 2ZUCA 4YCCA 2Q21A 3NBXX 2WI8A 3P9RA 3RS2A 3LDGA 5FLYA 2PRSA 4AN1A 4OKNA 4CKCB 3DHYA 3RODA 3ONFA 3T1OA 4BC0A 1CLUA 1W581 4XVCA 1YAJA 3AEUB 2PGAA 3SZOA 1NBMD 1XXHB 4AWAA 4B80A 2ANCA 2CZQA 4WDRA 1U1EA 2J0EA 2OV6A 1VYUA 5HBGA 1ZLYA 2A7XA 3GVCA 3NM6B 5BW5A 1GUYA 2MWMA 3BOSA 1FNDA 1T3ZA 4LGVA 3WE7A 2Q2WA 5CCXA 2UZ3A 5CT4A 2OD7A 2JFVA 2OGUA 3ZQJA 3TNFA 3IP9A 1TT5A 4GYYA 3OTOB 1GSHA 3ILSA 2PZFA 1GLVA 5ITWA 2RHDA 3CF4A 2DETA 3COYA 5DULA 1NF8A 4CQLA 3BGDA 4KUEA 1FOEB 1C7IA 1M1NB 2BR5A 3SD7A 1VJ5A 4QUHA 3AI7A 3VR6D 3O4FA 4QTZA 2Y0BA 2ZR9A 3HZOA 4S0ZA 1NSTA 4EJSB 1F6BA 2NUBA 1BXKA 3WHPA 4PSUA 5IBCA 1J9GA 2VJNA 4P54A 2IXGA 4WFQA 5IAAA 3U7HB 3HB9A 1NIPA 2I5PO 4GU5A 4OV6B 4JR0A 2WMNB 2OM2A 5CDFA 4L8GA 3IS3A 3WZLA 4QQNA 4UE3S 5AW7A 5IXSA 2G5GX 4KWHA 4QA9A 3VU9B 3A0RB 1P44A 3M70A 4MLDA 3DF9A 1XWWA 2OSBA 4DTIA 4JC4A 5AUQA 3SLGA 1ZICA 2GEKA 2VSFA 1E69A 3PDUA 4KX5A 4N9WA 3NHRA 4PANA 4HTFA 3HU2A 1P4SA 3L40A 3TMYA 3K71B 1DJMA 2H85A 1ID8A 3ECCA 4GP7A 4LS3A 3OIFA 2DLCX 3OEEA 4AO6A 1ZVQA 2X23A 4NECA 5A6SB 4OUKX 3ZDEA 5KPJA 4EELA 3OTGA 1RXEA 2O23A 4E4TA 3L2OB 521PA 1ECBA 2HZ7A 1WCXA 2A0UA 3EW9A 4KJXA 4DR4B 4GBMA 1DXOA 1L4GA 1Y3BE 1EFVA 2GCOA 4IH4A 1SVKA 4QQ8A 2QZJA 1J8QA 1Z0FA 2VAWA 3BERA 3DMRA 4JI3B 1X1CA 1TJYA 1I6MA 1TLFA 5TQ0B 1EZZA 2I6XA 1Y42X 2Z57A 4R8VA 4X7MA 2CMGA 4UQOA 3DAPA 3DBHA 3RS8A 2BCGY 3OO0A 1UZUA 1RKXA 2X6RA 4HWRA 2AK2A 4X9XA 4RZSA 3HXTA 4LYAA 1M7GA 1E3LA 2M6KA 1MDBA 1CE8B 4HC4A 2XQJA 3RRYA 1UBUS 3V80A 2QL9A 2CE7A 4G0YA 4XE5A 4N0EA 3GEGA 4BRSA 1EHCA 4A6XA 1DP4A 1S3GA 2RKBA 5GM1A 2FA9A 1RFGE 4CMHA 3AETA 3ZC3A 1V2GA 1J22A 1P2UA 1U9JA 3LCRA 5GWXA 4UPVA 2QM8A 4M0DA 2L2QA 1E7YA 3GNSA 4BFYA 1DHTA 5AM5A 5I7VA 1MABB 2FZEA 4HDOB 1CP2A 1IEXA 1TF5A 4PAQA 4R6WA 4LCJA 4B4UA 4CFZA 1COWD 1FMCA 3JPYA 3STYA 4NZ9A 5IN4A 5HM8A 1J7KA 1UWKA 3FWHA 1D8AA 1PEAA 3TIFA 2WE7A 1GGEA 3Q9SA 4YRKA 1NW9B 1K63A 2R8XA 1MBZA 3QITA 3QKRB 3CA8A 4ZP1A 3PC8C 4B45A 2GBCA 4KR7A 1NLZA 3V9PA 3Q11A 1JFFB 3O90A 4UHFA 2ENWA 4MLPA 2C9CA 5FOTA 3EMVA 1EVQA 1Y1LA 2QXUA 1BA2A 1XLTA 3N53A 2VKTA 3UXMA 2AG8A 2R1UA 2R7KA 2ZIWB 2Z5FA 4D80A 4HLDA 4J4BA 4K05A 1KY2A 3CWCA 3JQBA 3VSCA 3TR6A 5T57A 5IKXA 2HU5A 1GLGA 1FRQA 4ETWA 2VDOB 3AUYA 4Q3NA 4TVBA 2VPWA 4N0QA 2YVLA 4PC2A 2QQGA 2YZ7A 1P91A 1FFBA 5FBZA 3HLTA 1JIUA 5EJ9A 3O31A 4UKDA 2B30A 3CZRA 1SHJA 5E7IA 1N2ZA 1VJDA 3G5UA 1YFKA 5DM70 3HTXA 2X42A 2F8MA 3OZCA 3EXG1 1RMQA 4CG1A 3KUUA 1BMTA 1WBBA 5AFSA 3ESRA 2M6LA 1SVNA 3S2SA 4AULA 2XMBA 3CUSA 3V2IA 4BEBA 4JYAB 1BFDA 4HXYA 1RHJA 4JUDX 1LI4A 3CLHA 3SYMA 4AXXA 4BEJA 3AF3A 2DHCA 2NMVA 1P5RA 5L3RA 1PEKE 3WFZA 2PKCA 3GELA 3RSZA 4ZKEA 2CVZA 1SRQA 4DANA 3SIXA 3OHSX 2G7MC 3JQFC 4D99A 4CODB 1NHGA 3DCYA 3L6EA 1Q0UA 2DTDA 3L82B 3KTDA 4PLZA 3RC7A 2WOOA 3DZGA 1E8NA 5EKTA 5F1OA 1XE3A 2FSHA 2CJXA 1V45E 1IPFA 2WV7A 2PLAA 4JL8A 4KIWA 4DBLE 4IIDA 3UK7A 1Q17A 3NQ41 1FE8A 1STOA 1GQSA 1LV8A 3AKEA 1MC4A 3PB3A 2BEUB 3R8CA 1NBEA 1VZ2A 2A1IA 3OPVA 5DNDA 5EN4A 3ZDZB 2OO3A 4MITA 1XHLA 2XQKA 3I01A 4MS4A 1UMCB 1EX1A 3GG9A 4GM4A 3AHIA 4OLJA 3R7LA 4O4LB 4RK4A 2AQKA 2PS3A 4OHCA 2QRMA 1XELA 2CFIA 5DHPA 5IW8A 4GR4A 5ALHA 2WSIA 8MHTA 4CIWA 3P27A 4GZ5A 2QTTA 1II8A 3GLHB 5BV2P 2LP4Y 2BMWA 4R71A 5LDHA 1AMOA 1AG9A 3KLBA 3RS0A 5J4LA 3T0GA 3UWDA 2FZ4A 4P36A 5KYXA 2PH7A 1IWBB 1DX6A 2ZAGA 4KHPB 1MAAA 1X7ZB 4NMMA 4OJQA 3VU3A 5I48A 2A9QA 1HG1A 4YV2A 1XEXA 1U02A 2CLOB 1R74A 2AXEA 3B1KA 4FNOA 4WZBA 3WLQA 4O02B 1WLSA 2B6HA 4C4ZA 4D4HA 4HEHA 5HKKD 1XBTA 1YQQA 1HT1E 3Q7TA 4GI1A 3OZAA 4ZAWA 2Y4OA 2NXEA 4MO2A 4AN4A 3PYXA 1E7WA 1J7JA 3I4FA 4UZFA 3WS7A 4EEXA 4LF5B 4B6GA 1SBIA 2CY0A 3USES 2QMOA 3CCFA 5L4SA 2JCXA 3G02A 1JU9A 2WM2A 1NPYA 2X9GA 3LSYA 5JYDA 3L0DA 2D1FA 4XWGA 5FBWB 2V0NA 1BX0A 3VX4A 4DV0B 2ZT8A 4YMUA 1RJ9A 4BMYA 3TXXA 4RK6A 4DPMA 1N7GA 1ND6A 1QUFA 2P0YA 1L8LA 4LCEA 2K7FA 1HYHA 4XWKA 2C8LA 1TF7A 3P94A 2W2TA 4IOKA 4OFXA 3GD7A 2FEWB 3KHKA 3MTIA 4EFKA 5CDFE 1EXMA 3WZ2A 2O2SA 3S5UA 1NVBA 4FKMA 2K2WA 2XA1A 1E2PA 5D7NA 4AJ2A 4QQFA 2Z6VA 4JJZA 4IIEA 4XM2A 3VR5A 3LJKA 3CH7A 5EEHA 3JASB 3BTVA 4S1WA 1TLTA 4XB2A 3LU1A 3QGMA 1HDRA 4Q21A 5ALRA 1COZA 1XB2A 4AF7A 4BVKA 2ZRLA 4E31A 4YRIA 1C0PA 3SWWA 4H1TA 4YRAA 1QKJA 5A2GA 4U5QA 4BGUA 5JQGB 4BU1A 4DSAA 1UFQA 3INYA 4C03A 2Q62A 4CU2A 1KZYC 3UENA 1FP6A 1YR7A 4ZYZA 3NHAA 2RG7A 1R0ZA 1V41E 4MQEB 1PZHA 4PWZA 2C3YA 5JASA 1NQTA 2BEKA 3LIPA 4CKEB 2XQVA 4HV4A 4LMPA 4V1CA 2VUUA 2ZETA 3IOBA 4C6TA 5BV7A 3QU5A 1NMXA 2VXYA 4OMFG 3SX2A 2IUEA 3A7EA 3S28A 5I45A 4KREA 3IBCA 3O82A 2QX7A 3UK2A 3KSUA 3PXDA 4K28A 2PH1A 2P75A 4K9MA 4R31A 5BSUA 4LE0A 2ZBVA 4WZAA 2V7TA 2Z4RA 1ZM3A 3OCVA 1H0SA 3NVMB 4P6VF 4UNSA 2C8KA 2JJYA 3HB1A 5EZSA 3CF6R 2XGSA 1KO1A 3A4LA 1U2TA 5I01A 1GGVA 3CZ5A 2BM9A 2ODBA 4PO1A 1NQVA 5JNSA 1VKHA 2ZJYA 1Z6XA 2HK9A 3CPSA 2N42A 3F6YA 4BZWA 4BEWA 4JYZA 2BCEA 4ER7A 5A2QA 1VG0B 4G1VA 4RJLA 5FBLB 1PS8A 3P9IA 1V26A 2MSDB 1LU9A 2X9LA 16PKA 3HFRA 4RD3A 5JVDA 1UH5A 1D1PA 2NVBA 2UZ0A 4K6FA 1H93A 4GEGA 2X5KO 1PR4A 1J21A 4B84A 3M9WA 1SUIA 2IS1A 4BJ3A 2WWRA 1H2WA 4JJAA 4L73A 5CM2Z 3UT5A 3CPEA 5LQSA 1QX4A 1ZKDA 3ZEAA 2B1GA 4C4OA 2JFHA 3C8DA 3AEQA 3NFRA 2JASA 3HJRA 4FFVA 1GKLA 1NVVR 1VJCA 1QFJA 4RDCA 2PQ6A 4YJGB 4EW6A 5CUQA 3O4HA 2R5NA 4IH9A 1NVAA 3H65A 1O6FA 3QVWA 4LZZA 1B8UA 1GVNB 1DEXA 1QAQA 2I2DA 1RAEA 3SPXA 2BMDA 4MCJA 5D00A 2FFAA 3NX4A 3ZU5A 2C0PA 4CEJB 4N5HX 1TZKA 1BEEA 1VECA 1SM4A 1YBHA 2OR3A 2PZJA 3A28A 4G1BA 3W90A 5KMGB 2P2ZA 4EB8A 3AM4A 1N2CA 3NEAA 5K0JA 5GJVC 4AKEA 3DYBA 3GR6A 3DNFA 5C80A 4ZCLA 3FN4A 3UMSA 1GYRA 3FBTA 3I3OA 3RYHB 1LDGA 5I4BA 2CV0A 2LRHA 2RMKA 4RA9A 1WIWA 3U48A 2YYYA 2G63A 1ESDA 5LLTA 2UZ4A 3GU3A 3ITNA 2CLSA 1SKYE 1V8DA 2YFKA 4GGOA 1JN0A 4NWIA 5D1HA 1PKEA 1PTJA 4IILA 5AKKA 5FEUA 5G4KA 2J5XA 1DEHA 4NLLA 3Q0EA 2PSSA 3KQVA 5F7OA 1TKRA 2FPIB 3H3FA 4QRDA 3F71A 1ZDMA 2NXCA 1VP3A 3JAWA 4YB8A 5HOQA 1H9BA 5B1YA 1NI5A 4OB6A 3T5MA 4C0BA 2GO7A 3FCXA 2P6NA 4EJ6A 3CKKA 4HAYA 5I9SA 5JAZA 1M7HA 1E89A 4QJIA 4GPEA 4LZWA 4QEZA 2J46A 3QPWA 1TGVA 5KYWA 3CS3A 5JWHA 5CA1F 7MDHA 2J9ZB 2JLRA 2ZREA 1ZUHA 3I6BA 3LC7O 3PVSA 4MUEA 4R40A 4KR6A 1U7HA 1QGZA 1GGJA 2VA8A 3FDIA 3MGCA 3NONA 4IIYA 5ES4B 3GLFE 1Z18A 2JA2A 2WTUA 4XIIA 1ZVJA 1BDMA 1R4NA 1M0EA 1VFPA 5E1OA 2UVPA 4MS3B 2PQMA 3NVDA 3N39C 1WQ4A 4JLWA 2WSSD 4LC0A 2H5IA 3BHMA 3HVIA 3IDOA 1NLUA 1KI9A 2YJNA 1G9XA 3TD6A 3MAJA 1IBKB 5KQSA 3TCNA 5C1OA 3MF4A 1KRWA 3MERA 3T3GA 1QVZA 1BE1A 1CQIB 2Y0CA 3DO8A 3ENQA 1DAMA 1K7EB 2CLLB 4WDQA 3QXSA 2LCQA 4EHNA 4EF5A 3L8YA 5M3BA 1S2OA 3FHOA 1B0AA 2GHTA 3T9FA 4KW7A 4YUAA 1L5HA 2ZQ5A 2X1MA 4YMLA 3O8OA 5BYBA 1RLOA 1E1CB 3LY5A 4BJ1A 2A59A 5SY4A 1PDVA 3ZTTA 4AAYA 2PX4A 3S8MA 1MF7A 4CCYB 2P2DA 1B26A 4DGSA 2HW8A 1JG1A 2FZLA 3WLTA 3AERA 2XTMA 4JT8A 4XQGA 4CKWA 2ECPA 4YCMA 3WQRA 1P7ZA 2HA5A 3KCQA 4ND1A 2D54A 2PZAA 5EZYB 1W1WA 2Q5OA 4NDNE 5FFMA 3UK0A 3ZQ4A 1DWPA 4AJHA 3M6XA 4LF6B 4R0VA 3T0FA 1WNFA 2G1AA 3IT0A 5CH8A 2HMAA 3VKWA 3MJDA 2D1YA 3H1EA 2HJ9A 3JQ8B 4MGIR 2UUCB 2ZK7A 3B7PA 1V9CA 5ALMA 1XQWA 5LA6B 3RSHA 2QAGA 3IPAA 4M1MA 3JD4A 3L8HA 1ABFA 3P2OA 1JZTA 4TPKA 4K6KA 2AVNA 4NE2A 4E5MA 1OWPA 1RWPA 3LUPA 4L78A 2H63A 4E1BA 1XJ5A 4U6NA 3B7GA 1YS9A 4NV3A 2AMLA 3WLPA 4EYOA 3PUYA 1DBPA 1YIAA 2ZYGA 3W4IA 1ZUNB 4R83A 3H9JA 3BQ9A 2PD6A 3U4CA 3DTTA 2UZ1B 4ZI5A 1G4HA 1CR0A 3PL5A 3L93A 1I10A 4J7CA 4GQBA 4PZZA 4CGYA 4CGZA 2XMCA 4Y0AA 1FPQA 2YHIB 1DKLA 1LK5A 4I0WB 3VZRA 2FK7A 3T8YA 2VZ9A 1TIBA 1VBKA 2IKQA 4P83A 4PZPA 4BPBA 1QRUA 1G8HA 1HEUA 1MEJA 2G77B 2ZTMA 1AA9A 1NOIA 1R6DA 3GP5A 3KTFA 2XDYA 3L1JA 4XUDA 1P0PA 1Z4IA 1OH6A 1UC9A 2CFSA 4FBGA 3EG9B 5EXDA 1Z68A 2WDPA 5KBYA 5LJLA 3KOZA 3IP3A 1NURA 1GPYA 2Y1OA 4M88A 2VATA 3MRTA 2B0CA 4Q1CA 4LPKA 1Z82A 4N9QA 3KT6A 3EGVA 4J29A 2Q2NA 5AKXA 1H8HD 2VZ8A 2K6GA 1IC6A 4YFVA 3PGLA 1KEPA 1MA3A 3PJDA 3ECSA 2VNJA 5FD8A 3S29A 2CJYA 4EUEA 5FBKA 4V38A 1EAYA 2PT5A 3N2IA 4U6QA 2QX8A 2QJWA 2R2GA 3LHIA 3CUEF 1TJNA 3V4VB 2VK2A 5LQRA 1VIMA 2OENG 3TCKA 1UQRA 3W2FA 2DUWA 4DUGA 2ZDHA 4LBWA 1KP2A 3TQQA 4NYIR 1PFQA 2Q45A 3KT3A 5SYAA 5IBRA 1NBAA 2C5FA 4QYXA 4A6PA 4UCXA 1Y4SA 3EF1A 3C1TA 4NICA 5K0ZA 3NW9A 2DWPA 1DC8A 1AU9A 1HF3A 2OFXA 2P79A 3EZYA 4ZAFA 4JLBA 4ZV9A 2Y1FA 2OXCA 2TSYB 1QX3A 3ZYCA 5IFKA 2ACWA 3GQVA 2OMKA 1JGTA 2VHZA 3EBLA 1SCNE 3BJRA 5ELLA 1U0NA 1Q12A 2VCEA 2OAP1 5AW5A 1NQOA 4S3MA 5K0SA 1VE9A 5IG2A 2Y1DA 4A2PA 3KT0A 4XIYA 1LUAA 2R87A 5AVVA 2GAIA 3VJRA 2GFIA 4AQ7A 1GQQA 4HVAA 2Q1XA 1V1MA 4BVFA 1AC5A 1NYLA 4HNUA 3LZ6A 4DR1B 4Q9NA 1U0SY 4X41A 4KXLA 4O4IB 5EZ5A 3CSDA 1O0BA 4MW9A 2O7RA 1ODTC 1FMLA 1DQZA 1LPBB 3OZGA 3VVLA 4A1FA 4XUCA 5TPWA 1SCUB 2OWEA 3CLRD 2NPFA 2SKCA 1I6KA 4QXPA 1Z7BA 5BOVA 4FGJA 2P0EA 5DE3A 3QVKA 2J9FA 1QLHA 3KHSA 2MTBA 1F6DA 1R37A 2QUIA 2WSBA 3BIXA 4FINA 3UHPA 3ZLTA 4DJAA 2ZJBA 1L5MA 2QX9A 3CR3C 3O91A 3UMCA 5AUOB 2W2QA 1WU8A 2R751 1GRQA 4ZQBA 2ZUTA 2ODAA 1DJLA 4NS4A 3KLOA 2HIHA 4GMGA 2PNJA 3D2BA 3WFIA 2GSDA 3WXBA 4W5WA 2TMYA 4BVBA 3KXPA 2CNBA 1E9BA 3C3WA 3JVDA 3RHTA 5K20A 3COWA 3NG1A 2H3EA 5AI9A 1Z34A 4GFDA 2JJ2D 1GPJA 4OJTA 2B8TA 9LDBA 1Z4MA 2BGUA 3UIEA 2HRQA 2O7QA 3NOXA 2SNIE 1M6NA 5DP2A 5MGBA 2P1ZA 2HPZA 1Z5ZA 3ZDCA 4MW2A 3ZDAA 2VDLB 4G0VA 3F4KA 4F6RA 4QOIA 3WGZA 2R68A 3C7CB 4EFNA 1T8WA 4YACA 5GONA 4EX7A 4YQYA 5F12A 3BEOA 1EDZA 1XUOA 1HURA 1EIZA 1Z5UA 1YFLA 3I2KA 4J0CA 1HZJA 4N0DA 2KX7A 4DC9A 4NCAA 4PHCA 1ZK2A 4A27A 1JI0A 2J33A 1F7UA 1KJQA 1T25A 1D0IA 1LWOA 3RVLA 1E9VA 3WIUA 2EGGA 1E9AA 1Z08A 5KOJB 2H2WA 1T9BA 1ZD8A 3TRHA 1U1CA 2AXQA 1Y63A 2HNKA 3INTA 3SGLA 4YDSA 3D6VA 3WBBA 4EFMA 4Z7QB 1WETA 1NBOA 2FPPB 5LB2A 1YCDA 5BW8A 4F2HA 4JT2A 3KWMA 5I9TA 3CJTA 2YIJA 3GHYA 3UYLA 2ZZKA 1IG0A 1QH0A 1N34B 1A95A 1U63A 2AR9A 2ZJOA 2C78A 3LQ4A 3ONWA 3MTDA 5EWJA 5KCZA 1N6NA 1UDXA 4KXWA 5AJHA 5EGNA 5FULA 3UV3A 3D8TA 2XMRA 4EHLA 2WP0A 5KU7A 1W1UA 1ZRHA 2X1VA 5AHRA 4UNPA 2XB2A 3ZOKA 2FWPA 3VU1A 3CW8X 3FJYA 3BCHA 1IQPA 2XEDA 5KQRA 1I4EB 4CXMA 2I9PA 2QVGA 4KK3A 3UO8B 1XMJA 2I2BA 4EBFA 5K3OA 1PLJA 3CF4G 1J56A 2ZJAA 1GGHA 2X3FA 1QKIA 2EOAA 1H1LB 1TLLA 2WUFA 1TUIA 3AESA 3CKLA 2FZCA 3EZGA 1E5TA 1JDBB 3PFGA 2BWJA 4DOMA 5HP4A 1N2XA 4OX9Y 1V3TA 2HCFA 3WTCA 1JWAB 1GUBA 3ZE8A 3KUXA 1XRSB 4E1AA 3JVUA 4Q03A 2QS9A 3QEOA 1XMVA 2HJWA 3LLCA 1TEHA 3N8HA 2VYCA 4M1EA 2V45A 4WNIA 3W7AA 2FF7A 2ZWOA 1E1NA 3ZCTA 2P9EA 1KO4A 3EGXA 3I76A 3JW8A 4HX9A 3W6OA 4BGVA 3COPA 4CKYA 4FDLA 1PK7A 1YJCA 5BWNA 1ULTA 3E22B 3EOAI 4I99A 2V59A 2WYVA 3RIHA 2DUUA 2NV6A 2QM0A 4ZEWA 2VWHA 4EMSA 5JAOA 4AMUA 2BGLA 4LY6A 3I9FA 3RANA 3RBAA 3D3NA 4BO8A 1VI6A 1YQ9A 3D0OA 3THYA 2DP4E 4NEQA 3DZKA 1GPKA 4R16A 4RIEA 4MRNA 4EX6A 5TMPA 4OO3A 1EM8B 2NSLA 2WKSA 3F49S 1I01A 4BLSA 1LVGA 1XZIA 1JG4A 2VP9A 1VMAA 1ZCAA 1YZQA 4REQB 4M83A 3GZNA 4KXQA 1BVRA 1NVVQ 2JD1A 1E4EB 4AZ0B 2I7XA 2EKZA 2QMQA 1C3OA 2FSVA 1O57A 1U2DC 1WW2A 2AN4A 2QG6A 2V6GA 2ZBGA 3O4RA 4G8CA 4LNUA 5DV9A 5DM2A 4BFCA 5IYZA 1T2NA 1CUVA 1Z75A 2Z5VA 3D64A 3NFYA 2COEA 5LU9A 1C1HA 1QH8A 1W96A 1M2GA 1SUDA 3K2QA 3CJRA 3IBYA 3EDMA 2GVZC 5EJEA 3P97A 5KQLA 3MTAA 2VG8A 3N8DA 1KZ6A 4NABA 2EATA 5CDTA 1VA5A 4QJ5A 2WVHA 3RFUA 1JEQB 5IC4A 2PTHA 1KYIA 4S2UA 1ZC3A 2O2HA 3JU3A 3K32A 5EYPB 1L5NA 3QF4A 5ELXA 2GVNA 5E3HA 1J0AA 1X0VA 4CLRB 2FFBA 4MR9B 1CVLA 1CV2A 5KDDA 2X41A 4KXFB 3LT0A 2P6PA 4C88A 2HHLA 3V7FA 5H4GA 5JALA 5F2EA 4A8JA 3A6HA 3NDBB 2FLWA 3MUNA 4IDEA 4XVUA 4TYMA 4IGKA 1O8BA 3THXB 5JSUA 1GOTA 5KWVA 3EE6A 3QXGA 3BRCA 4GRIA 1KZGB 3VSDA 3H16A 4OYHA 1LI5A 1XHFA 1XZHA 4OYLA 3IEUA 1YZ3A 3GGCA 1D9XA 3H7IA 1KEUA 2WFZA 1D0SA 3GIDA 1ECPA 4LDNA 1KEEB 4UAUA 1B00A 1SC3A 2IDZA 2IUTA 3FGPA 3TLGB 3D43A 4EITA 3OFVA 2IZ7A 1SBHA 2MYTA 3H1GA 2NACA 1EFPB 5TNXA 5JNVA 5D51S 1L5VA 1R4AA 1T6ZA 1I6WA 1IBRA 3CZAA 3E61A 4BUJA 4F5WA 1KFJB 2I3AA 3FJOA 3WJ1A 3ELDA 1X74A 2OILA 1A96A 4Q4DA 5CURA 4KFCA 4Z4FA 4KIFA 2LPMA 2P62A 4QL3A 4ARVA 3GWZA 3PX2A 2BKLA 4KN6A 1L5WA 3CURA 1KWGA 3UN1A 5DXFA 5A04A 4Q37A 3H42B 3TMKA 1JDZA 3H18A 3TAXA 3AY7A 4OCZA 4YJKA 1X7WA 1U65A 3ELYA 2YW9A 4I1IA 4JI6B 3W7BA 2GN1A 3ZWPA 3O8RA 1USIA 3LOQA 5C37A 3LVQE 3DKKA 1P17A 4BGIA 3HKEA 2QRHA 4FSXA 3NGXA 3RVJA 2WV9A 3C3XA 3GT0A 3U4MA 2QLFA 3VBCA 2GHIA 2YXEA 1BZYA 1RFLA 1UBEA 1UMDA 4UREA 1DIHA 4XDHA 5AI6A 4UQLA 1GQYA 4EGJA 1GZ4A 2IYAA 4IX9A 4DMRA 3DONA 3EG5A 4WFKA 3FSGA 5FO0A 1J23A 2CCGA 4PC6A 1F4VA 3C4VA 3U44B 2R6DA 3B20A 3JPWA 5CJPA 3R7WA 1J2RA 1Y6RA 3IIJA 4FU0A 1PYDA 3CN7A 3QVVA 1C7EA 4JQYA 3Q6IA 4ECAA 3TQIA 3RBXA 4QUEA 5CFRA 3FZYA 4PZLA 4LF7B 3G88A 4N0MA 4Q4JA 4R98A 1T2DA 2Q6IA 3JQAA 1Q11A 3ENVA 2CJWA 4K9LA 4EVIA 4K3VA 3KPWA 3DMGA 5AKIA 1KZ4A 1D6JA 4MV0A 4PFKA 2PZMA 3JRXA 1ZUD1 4Y30A 5ALQA 3H4TA 3RROA 4F97A 3SJBA 1ZSYA 2FXVA 5FI0B 4DV3B 1AMNA 1MIOB 2COKA 4I9HA 5A0VA 1UKYA 4WLEA 1AKQA 1WSDA 2CFCA 3OZEA 5CFQA 1OA1A 1PW7A 2AD5A 3D0QA 4C06A 1JEYB 5C52B 1T10A 3OKPA 4A8TA 2A5GA 3T99A 1Y1RA 2C4VA 3LLMA 1KZ9A 1WPXA 2HQSA 2H5LA 3A10A 3EGWA 3MWEB 3N3AC 4QDUA 2OMEA 5DN6A 2DWUA 2QZZA 1Y8QB 5IP5A 1NW4A 1BFUA 1GKUB 1K6IA 1U9IA 4NY1A 1XVLA 5DGIA 1W19A 3MYYA 1VLZA 2C92A 4H3VA 2HT1A 3PPIA 1N8SA 1WXHA 4D0NA 1GGFA 2QORA 1ES9A 3BTUA 1H2RS 3FZGA 5B1DA 3IBGA 3SBOA 4HXGA 1VJ1A 2RAUA 4H18A 3U13A 1OBVA 1X94A 3QI2A 3ZKWB 4ON9A 4ZU3A 1CFJA 4GECA 3ZWKA 4QU9A 2GXAA 4GX5A 4JJIA 1P9WA 3KQPA 1FMFA 1IXKA 1E2QA 2AFHA 1MPXA 4RMJA 1LPAB 5IUJC 1T34A 4D42A 3AFMA 3VZCA 3PP8A 2IYQA 3OI7A 1V1RB 2Y93A 3CLVA 4L72A 4D9KA 3DE3X 2FZ5A 3T35A 4YJDA 1C9NA 3WK5A 4NYIQ 2J0UA 1X1DA 3PCTA 2PSFA 2YWHA 2CMHA 1T9DA 4Q3DA 2N47A 2AEMA 1XU9A 2GDJA 2YOFA 1JBQA 2R00A 2QRQA 5TJ9A 1IBSA 4FWIB 1IJBA 1DUIA 3BM5A 5A5DA 2BMJA 2WMOB 1N5KA 4CF4A 2X5XA 1JDPA 3P0IA 5B2EA 3LWZA 2HXYA 1PQPA 3UWPA 1JV2B 1X6VA 4JX9A 1PGNA 3L9XA 4YP5A 1N5LA 3DWFA 3L7MA 4GOND 5KX5F 5KVVA 2D8MA 5TQ2B 4ZTZB 1OYWA 3INNA 5T3UA 1B0UA 1NV9A 1OFGA 4R7GA 1MV5A 3OVMA 3BFJA 4I50A 3I9OA 4F8JA 2I7CA 1UT8A 3ZV3A 3TVTA 2GPJA 4RBNA 3WL5A 4CMKA 3J7AC 1KY3A 4XZ3A 5F4ZA 3BE8A 3UICA 5L51A 2FUG1 1T9KA 1Q7EA 1R88A 1ZPDA 2BGJA 2I4TA 3HI4A 2GD2A 2XAUA 4FQ8A 4CF5A 4C2UA 2NADA 2Y3IA 1X80A 2XA9A 4J9UE 3SEFA 5B1EA 1QRSA 3VR1A 1XF1A 3F46A 4PHGA 5M04A 1FJHA 4F5YA 4P3OA 1RU3A 1TQHA 3DO5A 1PL8A 4AMGA 2A94A 2VYQA 1T8SA 3ETDA 1G21B 3SZ3A 1FDWA 1W44A 2YDYA 3P52A 1JJ7A 1SXJA 3UJ7A 2ATCA 3FRIA 4ZCPA 1XC7A 3AJ8A 4ADSG 3GAZA 4E03A 1KMHA 2EP5A 4JBGA 4KQKA 5DMXA 4AMYA 5AJUA 4B43A 3PX7A 3CRQA 4BLOA 2RHMA 3O1JC 3R7AA 4F4UA 3U16A 4PVCA 5EUQB 1WCWA 4N6NA 3GT3A 5LXTF 2VBIA 5HFJA 1NX6A 1QHIA 1W6UA 3GGDA 4A4DA 3P9PA 4WEQA 5LQJA 1ZXBA 2QGFA 1O6ZA 1S01A 2NV0A 2JBAA 4MAAA 3WLOA 1IUKA 1SHLA 1ZH6A 3RRNA 3FPHA 4IDQA 2VO1A 4YH1A 3RTCA 1LI7A 1L5YA 2IWRA 4DC0A 3CUTA 1G2PA 3T5GA 3PDIB 4KR3A 2FWAA 2A35A 4W7HA 2QZSA 1G18A 3BS4A 1TXGA 3SZUA 1PZXA 4TTTS 3ZH9B 1Z9BA 3I61A 3DDHA 4V0KA 4RZ3A 4ZICA 3UCEA 1GPUA 1LRJA 2QSJA 2WC1A 3AB3A 3BQMB 4J94A 4QXMA 4BNKA 4DT1A 1JPVA 3H19A 2QTNA 4UTPA 1S1MA 1OXKB 1DLJA 3OBBA 5CK4A 5LXTA 2W4IA 2AYXA 2Y2VA 2G0TA 4DIBA 3LFTA 1SG0A 1VLVA 1KP3A 2WHEA 1X7YA 4EYKA 3DGEC 2PFGA 2R5WA 3TSZA 4QQRA 3OT5A 4HUQB 1R6TA 4B0OA 2VNSA 4WY2A 4PBSA 2NU8B 1LY1A 2FQXA 3CLTD 3TGPA 3U7IA 1HFEL 1G6HA 2DU8A 5DPMA 1U04A 4A6EA 4C78A 4LISA 2O3SA 3RRZA 2CUKA 3KPUA 5CHEA 1E1LA 5CX1A 3C45A 3WNQA 3OE4A 1WE2A 2H4WA 5IXJA 1YACA 1P0FA 1PNQA 2FQWA 2Y2UA 3O8QB 4HXEB 2RH8A 1KSFX 2D1SA 3VKGA 1AXEA 1VG1A 8ATCA 2YBDA 2BFCA 3HGMA 5AK0A 2H00A 1P29A 5DHUA 3EISA 2HLNA 1RJWA 3HI6A 5A4AA 2I34A 3ANNA 3IXQA 4H08A 3L0PA 2G09A 2WG2A 5AVTA 5JFOA 1T0UA 5LM3A 4NCIA 1ZUWA 2NG1A 4D6PA 4HVLA 3IFSA 1PHPA 1DT5A 4Y1EA 1H9CA 4F93B 2W48A 1RWBA 3UHFA 1SUBA 3ZVMA 1A8QA 1AQUA 3QKSB 1M2NA 4WXMA 4OSEA 5BWBA 5KPDA 3AF6A 2KLHA 5BY2A 2BFBA 3G0HA 3AV0B 1C4KA 2XVZA 2OV3A 1GG8A 4NCNA 1RKUA 3LBIA 2G5PA 3HM2A 4LJAA 2ODWA 1U6KA 4PCAA 1P39A 4PLTA 3ZIDA 3JWJA 1NW7A 1IY8A 1R5BA 3M4JA 3PE6A 5G0TA 5KNCD 5AUPB 4GNRA 3A26A 1HT2E 1I1OA 2IFTA 2KBEA 1VHWA 2YYZA 3BB3A 1ZM9A 3BDIA 3KZMA 2DTEA 4Q82A 2WHQA 4H3HB 4I4CA 4M0UA 5EXPA 4ZCSA 4WWHA 3SBEA 3T0IA 1CEYA 5AXDA 4J6FA 4D8VA 2J4FA 2YYSA 1NUUA 2A9FA 3PHCA 3QSGA 4JLJA 4RLFA 4ZYVA 5FPKA 3OQOA 2EWVA 1E92A 3AFIA 1TCAA 3A9SA 4L4ZA 3OIYA 4AS3A 1KYWA 1C1DA 1YRBA 1I7NA 2WU0A 3GCDA 1UBJS 1HY3A 1C1XA 2FN4A 1G6Q1 4BU0A 5CITA 4I9GA 3RKUA 2EWWA 5FBRB 5LP6F 5DBFA 5U4XA 3S2GA 3FCOA 4Y6OA 3KPVA 2TMGA 1Z06A 3DDSA 3IMEA 4XPZA 5JSZB 4I4TB 1JFSA 1CZHA 4ZDIA 2JGJA 4MW0A 6GPBA 2JFOA 1JPUA 2O8VA 2XBUA 5FFFA 2ONJA 5IJ0A 3TW0A 1RSZA 4CDNA 4M1QA 2Y1GA 2N3ZA 3NBMA 4GO1A 3NHBA 3FNHA 4JP1A 4D43A 4TRRA 4DUYB 3SIWA 1YA8A 1Q0LA 3PFKA 5LCXA 2GRJA 2ADFA 4HDNA 3D1JA 1C81A 3GBVA 3L7BA 5F1YA 1Q0QA 2JGEA 4JI5B 4CG0A 2QJFA 1B93A 1ZMOA 4N5LA 5C7IO 5TQJA 3K5PA 4JGBA 3OU2A 4GPIB 1ZMRA 2P67A 3QX8A 4QOHA 3BD7A 1FP4B 1L5LA 2I6TA 3ZR4B 2O54A 3OCWA 5LP6A 4IIGA 4DVJA 3G0GA 1AD2A 2A0WA 1O03A 3A2LA 1I4LD 4XR4A 1Y5NA 2D1QA 3WGOA 1BGVA 1G7TA 1RT9A 1DZIA 2YC2C 3O94A 2WWFA 4FYKA 3BK2A 3HRIA 4HPWA 1QSGA 4I1VA 4YCDA 2ZVDA 1BXZA 3ICVA 2NIPA 3ZD6A 2NSYA 3LYLA 3DTYA 1YQGA 4JQOA 5K0TA 1PT7A 3N2NA 2VRWA 1UK9A 1XZGA 2ECQA 3A0UA 1Y81A 3I4LA 4FFDA 4I55F 4M55A 3I1IA 3BMNA 4GSLA 2EERA 1NUSA 2FJ0A 2A1UA 1Y48E 3F90A 2VPXA 4BZQA 5BVGA 3C7DB 1BE8A 1MMFB 1SNYA 1YR9A 3IOYA 1GTSA 1QZZA 4DMFA 1WMDA 4X92A 5LUAA 5T8KC 1NW6A 1DRJA 2R1VB 2VJAA 2WBLC 3R3SA 2CLMB 1ZISA 2XUDA 3FVWA 2DMRA 1SGWA 3ODPA 4XTCS 5FO1A 1A5ZA 1SIOA 4KNVA 1U9CA 4CDRA 4HQKA 1CW2B 1JHQA 2FPXA 2YDXA 4MAFA 2O4UX 4ODIA 4TROA 5CJ2A 5ECDA 1W52X 1U7ZA 3QHQA 3CWZA 1P9NA 1GPDG 2E2WA 2FEKA 3DM9B 3DVAA 4CDMA 2CHUA 2PJDA 3O2JA 3ESAA 5KOHA 4YY3B 1J1IA 1N3YA 1YZYA 2VHYA 5EFZA 3ZG6A 2WJVA 3W3ZB 4F06A 1QDEA 3DVQX 4ICIA 3KQSA 4UCFA 3KQUA 1W7AA 1KHHA 4I55A 4RWZA 1K8QA 2IHBA 4IFIA 2XE4A 4PNEA 5JY1A 1L9KA 2VZLA 3EXG2 3MFYA 1D2RA 4BNTA 2JLZA 3NASA 3OTIA 4KWCA 3T54A 1Z4KA 2PS1A 1VPTA 4H17A 3SJCA 5BN4A 3W5BA 1ZH2A 5A0TA 3GFBA 4WV3A 1IATA 5AVKA 2O1SA 2HCTA 1UMBA 3HUEA 4Q7EA 3HSYA 3SF0A 3JQ9A 3T94A 2AA3A 3RV4A 3DV0B 1XZ8A 3W8RA 4LOKA 3V34A 4OOFA 5FOUA 4HJRA 3I6ZA 2JKYA 2RHBA 3EXEA 3RSGA 1KFKB 5J2TB 2BHTA 3NH9A 3TLKA 1V5IA 4QEKA 3MWDA 4JXZA 4DL9A 4PZAA 4FP9A 2OAQ1 1E79D 3GROA 4H77A 3REQB 2NOAA 4IJKA 2UUPA 2E4UA 5FH9A 1EP9A 1RRMA 4DWWA 1SUPA 2BBOA 4Q3AA 3VR4D 3HC7A 4LVCA 4RPLA 1SA0A 2Z3WA 3E8SA 2P1RA 3IB6A 4GDMA 3TD2A 4EVSA 1CJKC 5EE0A 1L5FA 1LTHR 2EL9A 3OPYB 3SHWA 1Y3AA 1GPBA 1XA0A 4OLHA 3UMMA 5JSHA 2Z08A 3H1AA 1TZMA 2D5LA 4CLRA 4L02A 1G8KA 1VPDA 2RGNC 3DOCA 4J0GA 3FCUB 3C5EA 3PK0A 4EO7A 1XD9A 1BEZA 3ZDRA 4BNNA 3M2PA 3N75A 2C07A 1X2EA 1QIGA 2LKDA 4IWYA 5AH0A 1MC5A 2FPUA 2C3UA 2XE6A 4N12A 3SBDA 1VRCA 4L6IA 4M6WB 1DCTA 1COWA 1S9DA 3Q3VA 4I1PA 1FDSA 4K2AA 4OMUA 1VIVA 3RF7A 2H65A 4ML3A 5IUNC 2J3HA 2R48A 1RRCA 1ITZA 3QVSA 4U00A 5L7TA 1LJUA 5I9NA 3QLTA 4R69A 1QIFA 1EVEA 4K0KB 2QN9A 3L43A 4DUGD 4KMSA 3NBAA 1AS3A