2ZB3A

Crystal structure of mouse 15-ketoprostaglandin delta-13-reductase in complex with nadph
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
345
structure length
345
Chain Sequence
IIQRVVLNSRPGKNGNTVAENFRVEEFSLPDALNEGQVQVRTLYLSVDPYMRCKMNEDTGTDYLAPWQLAQVADGGGIGVVEESKHQKLTKGDFVTSFYWPWQTKAILDGNGLEKVDPQLVDGHLSYFLGAIGMPGLTSLIGVQEKGHISAGSNQTMVVSGAAGACGSLAGQIGHLLGCSRVVGICGTQEKCLFLTSELGFDAAVNYKTGNVAEQLREACPGGVDVYFDNVGGDISNAVISQMNENSHIILCGQISQYSNDVPYPPPLPPAVEAIRKERNITRERFTVLNYKDKFEPGILQLSQWFKEGKLKVKETMAKGLENMGVAFQSMMTGGNVGKQIVCIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prostaglandin reductase 2
publication title Structural basis for catalytic and inhibitory mechanisms of human prostaglandin reductase PTGR2.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 120
structure length 345
sequence length 345
ec nomenclature ec 1.3.1.48: 15-oxoprostaglandin 13-reductase.
pdb deposition date 2007-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF16884 ADH_N_2 N-terminal domain of oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2zb3A02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2zb3A01
4CR8A 1BVRA 1XELA 4XQEA 3E82A 3DDNA 3UGKA 1C0LA 1PL8A 1VE9A 1DRWA 2Z95A 3GZNB 3OIFA 3QVOA 2XXBA 3VVBA 2DTDA 4Q3AA 1HDRA 5K6AA 3HNPA 2IXBA 1IHXA 3DMTA 1PJLA 1U2DA 1LLCA 4R3WA 1QV7A 4IGFA 5TQVA 1A7KA 1HDZA 1VLLA 2SCUA 2BF7A 3MCVA 4HKTA 4O5OA 5ICMA 3RCBA 4BNJA 3PQFA 2GD1O 4NBTA 4EW6A 3RSHA 1SNYA 1BXGB 1TB4A 5EN4A 1PJCA 4E5NA 3QV1A 3WGQA 8LDHA 5TIIA 1YB5A 3RBXA 4WK6A 5I7FA 3UCXA 3O4RA 3BTVA 3B20A 3NJ8A 2NWQA 2OUIA 2FPPA 4JX8A 3OJFA 2DUWA 4O0LA 2P5YA 4JJIA 1WPQA 2P2SA 2FR8A 3DFZA 3QSGA 2IZ1A 4AICA 4Q3CA 2Q46A 4HUJA 3ZU2A 2DQ4A 3DBHA 4EDFA 1V3UA 4PG7A 5U1PA 3ZV3A 4B7XA 4RF2A 4HX5A 4YYZA 5CG1A 3OQ1A 4PVDA 1UAYA 3AM5A 3OBBA 4B4OA 2EGHA 4ZQBA 2CSUA 5FYDA 5CEFA 4HFNA 5KIAA 3VDQA 4MVJD 4YRDA 3QVSA 1VC2A 4YWJA 3ZV6A 2J5KA 4BV8A 5CG2A 1NQTA 4PRKA 3ZWXA 1SMKA 1Q7CA 3AI1A 2E49A 1EE9A 1VL0A 3KYCB 3TL3A 2TMDA 2WJPA 4R3NA 4DC1A 4ILKA 2YQ4A 4E5YA 1EBUA 2B4QA 4YXFA 4J16A 4FOOA 3I3OA 3ZHBA 3V8BA 3DZKA 4YT2A 5F3RA 1RM4A 3ASVA 2WMDA 2NU6A 1M6HA 4YT5A 5DCWA 3KXDA 5A5FA 3K9QO 3E03A 1Z82A 3ANMA 1ZK4A 3H6KA 3Q1LA 4CUKA 5CEEA 3EK2A 1TT5B 5IDYA 3VZRA 4R5MA 4B3JA 3JD3A 2Q50A 3WGHA 4BKUA 1R4NA 3R3JA 2ZYGA 3QWFA 4MP6A 3ST7A 3DOCA 3BMOA 4M8SA 2VRCD 5L40A 1JAXA 3KZVA 4PZDA 4UVHA 2BI7A 3QY9A 4YPOA 4BS9A 1A72A 3DR3A 4L75A 4Y9DA 2VHYA 3F4BA 1VSVA 4PFJA 4FQ8A 1X0XA 2OBYA 2W90A 1CJCA 3AUUA 3OICA 2JKVA 2A9FA 2JJYA 2NVUA 3VH3A 2JD2A 3PLNA 3DBRA 4DBVO 3H9JA 2CUKA 2DKNA 2DBQA 3VC7A 1DOHA 4OGWA 3IMFA 5ITWA 5L53A 1V35A 2YY7A 5A9SB 2DBVO 5B1YA 5BSHA 1LUAA 5JS6A 4K6FA 4IQ8A 1BDBA 4WECA 3PQDA 3ROQA 1XU7A 2FSVA 1VSUA 5AXAA 4CMHA 1DRVA 2NTVA 4R1SA 2VWQA 5JC8A 2JCYA 3SEFA 3ZW8A 1GU7A 3K31A 4TRMA 4YQYA 4LCEA 1V6AA 1E6EA 3PIIA 2OMEA 2Y0DA 1M75A 2J3JA 3KHUA 1LDYA 2WSBA 1NWHA 4QUKA 5DOZA 1M2WA 3QIVA 4G65A 5JSFA 1EFKA 1YL7A 4Z0TA 1B0AA 1H2HA 4GX0A 3E6AA 1QP8A 3F5QA 4DQUA 1IULA 3WQQA 2WE8A 3K96A 4PVCA 4O1MA 4Y6PA 4AJJA 4FC6A 4PCVA 4CMBA 2G5CA 5JAIA 4B8ZA 1W0CA 2FR0A 4GAEA 4DVJA 2O2YA 2P68A 3K2BA 2B83A 2X58A 1NVTA 1PZHA 1PZFA 2D5CA 2VYVD 4PN3A 1PQUA 1C3VA 5BSEA 2NQ8A 1KBZA 4XGIA 1JKFA 4XDYA 3PHIA 1DHTA 3Q9UA 3VVCA 4A73A 2POQX 3T7EA 1OAAA 1QMGA 1WLYA 3S2IA 2BFAA 4MPDA 8ADHA 5B12A 4OXYA 3TDKA 1HETA 4W99A 4TMFA 4CR7A 4KZPA 4XQGA 4MVJP 4J1TA 1N1GA 3WWYA 2YUTA 3HE3A 4KWIA 4P8RA 4I1IA 3HB5X 5KJ1A 4XYLA 3UH1A 1XYGA 4BGIA 5C7OO 4MVJF 3KYBA 4I9UA 4YBZA 3K5PA 1ONNA 1NBOA 3FCOA 4FN4A 3PGXA 5DN9A 4LISA 3JQAD 4DIBA 3INTA 4E0BA 4W9NA 3K8ZA 3D3WA 1DJQA 1B3RA 1G6KA 2NM0A 4OOFA 4R01A 4Y98A 4EEZA 5DP2A 4CUJA 2AXQA 5A05A 3GPIA 1ONOA 4JBHA 3U4CA 2IRWA 1YDWA 3SC4A 4XYEA 2PZKA 1U4SA 1U7HA 4K1LA 1ENOA 4II2A 2HLPA 4OKNA 3AOEC 2OP0A 3GG9A 1HYGA 1BW9A 4RF3A 5L45A 4XD2A 1GDHA 2P4HX 1E5QA 2JHGA 3HADA 1VL8A 3K2EA 4XIJA 4XX0A 1EVYA 2BLLA 2C54A 4ALIA 1ZMOA 3FWNA 1SB8A 4KTVE 4WLUA 1JLLA 4KUHA 1LSSA 5FI3A 3WNVA 2CY0A 4M54A 1E7RA 1YB4A 1I24A 3BTSA 1XQ1A 4CLOB 3RBZA 2F1KA 3HDJA 1GUZA 3OM9A 4ND5A 1DJNA 4WEOA 3KSUA 3OEYA 1LQUA 4XCVA 2ZJ1A 3TZHA 2IEBA 1IE3A 2AE1A 2PGJA 4CQMA 2FP4A 1D8AA 4CR6A 3D1LA 1HDGO 4BNXA 3W4IA 1M66A 3ABIA 3PFWO 3GF4A 5TJ9A 4ZN6A 1LI4A 3WWZA 4L73A 4A5OA 1BMDA 1UJMA 2X5JO 4NH4A 1ISIA 1RWBA 1KEUA 1NHGA 3IJPA 4FC7A 1Z6ZA 3TQHA 3NTRA 2E82A 2H63A 4FGWA 1YONA 1NP3A 2CVOA 4QTZA 3NV9A 5FWNA 1JQBA 5CDGA 2CVQA 1FF9A 1HE2A 1RM3A 2C07A 5L7WA 4XJSA 2X0JA 3CINA 1YL6A 4Y8VA 1KS9A 3OSUA 3I23A 4O63O 3DAFA 3FNGA 4ONEA 2GR9A 1EBFA 2JHFA 1I36A 2I65A 3KEQA 3GPDG 2BHLA 5LC1A 1W8DA 2GN8A 5KKCA 1ID1A 5CHEA 3AUTA 3RI3A 5K6AC 4NBRA 4CM4A 3GRKA 4RF4A 4AJLA 3DMTC 3TZQA 2ZIZA 5JMPA 1B16A 3HDQA 3PPIA 1PJ2A 3OP4A 2XAAA 1W73A 2QZZA 5T8KA 4IJWA 1X7DA 2WD7B 3MOIA 2UDPA 3MJ4A 3OFSA 2AQ8A 2YFQA 1G0OA 2X9NA 5G2OA 1J49A 3COSA 4BKOA 4MVJA 4IS2A 3R3SA 4B4UA 5JY1A 2W2KA 2O7SA 1MXFA 1GCOA 3JQFA 2OBNA 5ER9A 3PK0A 2XOXA 4LCJA 2Z1MA 1R12A 7MDHA 5G0WA 1O89A 4TRNA 5CDYA 4LW8A 4YB8A 3M1AA 5THKA 3DZFA 3GUYA 3PGJA 1X1EA 4BO2A 2IODA 3H5NA 4JIGA 2VN8A 2YZ7A 1UZLA 3FBTA 5DBIA 3Q2IA 4U0KA 1ZBQA 3DBLB 3MJTA 3WGTA 1KVUA 1DO8A 1NASA 1YL5A 5COQA 2EW8A 5HWSA 1K3TA 3PHHA 1E3LA 5CAEA 4IXTA 2B5VA 3I6IA 3PZRA 1P33A 3S2GA 1AXEA 5FEUA 4WCFA 4IDCA 3OA0A 3ITKA 1QSGA 3PYMA 4N54A 3UOGA 2HUNA 1U1IA 2B4RO 4M87A 2VRCA 2YHUA 4CQLB 3ADPA 5ENDA 3ZNOA 1K6IA 1E1MA 1RM5A 3E9QA 5JMWA 5I7SA 3WX0A 4MO2A 4AJKA 2GCGA 4NG5A 2NU8A 1BHSA 4P38A 5FF9A 4BNLA 1OI7A 1EK6A 1DXYA 4PLHA 4WASA 3JQ7A 2W98A 4YT8A 2D59A 4K28A 5I8ZA 2D8AA 3G0OA 1H94A 1YBMA 2H5LA 5T67A 5KCZA 1BXZA 1HF3A 3STHA 3U62A 4NJMA 3VKUA 4BO7A 1ADBA 4DUPA 4XRRA 3ZW9A 4PLVA 5AOVA 5H82A 5JAQA 3UW3A 3MZ0A 1Y8RA 2HK8A 1DSSG 1NWCA 1YGYA 1V0JA 1E6UA 3DZBA 3ICCA 5K9ZA 1AXGA 1TA4A 4C7JA 1WVGA 3KM0A 2E6UX 1P1IA 5AXCA 1AN9A 3IUSA 1DLJA 1HE5A 3BA1A 4HBGA 3I9LA 2DBRA 3WXBA 2VRBA 3ZWWA 3BHIA 4OH1A 3CTMA 3DEYX 4E5PA 4RCVA 4JBGA 3PHLA 1YBVA 2YYYA 3GNSA 1A27A 3RVDA 3S55A 4CM6A 1NFFA 4YACA 1GV1A 3FNFA 1NFQA 3GRPA 3JD0A 2DPGA 4EITA 4B7CA 2X22A 3TJRA 1U3WA 4B4VA 1Q0QA 4AVYA 2NVBA 2FMUA 2PA3A 3IS3A 1SEVA 3U4HA 1Y9AA 3EVNA 1C0IA 1YQDA 1OZAA 2HK9A 4HY3A 1JN0A 1P1HA 3HHPA 5CPFA 5A02A 4OXNA 4DPMA 4GKVA 3SJ7A 4IDEA 3A4VA 1R15A 1R4MB 2JFGA 3RC2A 1F0YA 5U4QA 4AJHA 1GZ6A 4QECA 3W1VA 4E6PA 4J2HA 1CIVA 1G1AA 2ZQYA 1PR3A 2VYVA 3R1IA 2ZCVA 2P9CA 4DA9A 1JU9A 3FR8A 3DZGA 4PLPA 3UF0A 2O3RA 4QFCA 4BNTA 5TNXA 4CMEA 2ZTMA 3TF5A 1ZO8A 1YWGO 3LC1O 3ICPA 4EBFA 2VZ0A 4RZHA 4Q3EA 5TC4A 1HLDA 3H5RA 1C14A 5EQDA 1HRDA 2DBZA 3PDJA 5TT0A 3WTBA 4J49A 5TSDA 3I6QA 4RDIA 4TQGA 5EINA 1HWYA 1R37A 1NXQA 1QORA 3I52A 2PGDA 4NZ9A 5IFLA 1LEHA 2VQ3A 3QQPA 4OJNA 3BMCA 3DBVO 4FCCA 3P19A 3JQAA 2R2GA 4UEJA 2D4AA 3NDJA 1GAEO 1TVEA 3LLSA 2ZYAA 2WYUA 3GEMA 4ZQHA 4ZRNA 4KDFA 3RJ5A 3ZWCA 4BKPA 1WW8A 3ONDA 1H0KA 1HZJA 4PG5A 4YJFA 4DQVA 1PEDA 4QEDA 3QP9A 1FDSA 1VJ0A 4I5GA 1O8CA 3RD5A 2TMGA 4L8VA 2NLOA 4GVXA 3D4OA 1XCBA 4HFRA 3VPGA 1NM5A 3H7AA 1CETA 3KEOA 3L07A 1PGPA 3JQ6A 1E5LA 2X86A 3M6IA 1EUCA 3HDYA 4IJUA 4R4JA 3KLPX 4OL9A 4IJVA 4BO6A 3KYDA 3V1UA 4MIYA 1AGNA 4AL4A 4NK4A 4W9NC 1XLTA 2O3QA 5JDIA 5A5EA 3AM4A 3KO8A 1BRMA 1ENZA 2O48X 3JCZA 1NAHA 3ONFA 4YJDA 4AG3A 4ALMA 1ZK3A 2FPGA 4XA8A 5MDHA 2Q99A 1KEWA 1P0FA 3ZHYA 2HSDA 1HSOA 5LDHA 2PKQO 1CQIA 4ND2A 4FSHA 2V7PA 1DIBA 2HMUA 1BWSA 2ZTVA 4RPLA 4BO3A 2DM6A 1IY8A 1M76A 4YJHB 3RUEA 4OQZA 3GN1A 4ALLA 4IDBA 1T2DA 3WB9A 1B15A 3GN2A 4FFRA 4YAGA 1D1SA 1YXMA 5KVSA 4MOWA 3RU9A 4CJXA 5ITVA 2A94A 3L77A 3U4IA 3IAHA 4ZQEA 1C1DB 1O94A 4E5MA 1ONPA 3DFUA 1FK8A 4MP3A 3LQFA 4AJOA 3PEFA 1G0NA 1GEEA 4IS3A 4MIEA 1E3WA 5AQ1A 4AJ2A 2B36A 1X13A 3K30A 5EIOA 1SZJG 3L9WA 5C7LO 1UZNA 3TRIA 4GGOA 3JQ8A 1ZZEA 4WUVA 3F9IA 3CIFA 4J4BA 4GMFA 4DIOA 4DPLA 1LNQA 1C0KA 3WIEA 4D44A 4U0JA 2X0RA 3ULKA 2YHIA 2GPTA 3G17A 3AM3A 3NJ4A 1V3VA 4GX5A 3SX2A 1ADGA 2YDXA 1WZIA 3RIHA 4XRGA 1KYQA 4J7UA 4IINA 1LX6A 1FDWA 3ZWBA 2Q4EA 1AUPA 1N9GB 4R1UA 4Z9YA 2D2IA 1KVSA 1ZJZA 4UUPA 5LCXA 2GN9A 1XR3A 4R69A 3ZNNA 2X1HA 3NT5A 3VH2A 3MTJA 3JQCA 3A14A 1LC3A 2Q3EA 4XB2A 3DOJA 3DXFA 3LF1A 5JXWA 1XQ6A 3SVTA 4ITUA 1QG6A 4MKRA 3V2HA 2OXIA 4RPJA 1DFGA 4E12A 1I2BA 3ZWAA 4DREA 1YBAA 1WP4A 2AEMA 3DB2A 3D7LA 3DTYA 3HSKA 3AW9A 4MIOA 3ZDFA 1TXGA 3ETDA 1NFRA 1VKOA 3PWKA 5T8KC 1OBFO 4NU5A 2YJZA 1MC4A 1XDWA 1P44A 4TRJA 4J6FA 5I7VA 1I2CA 1ISJA 4RPGA 3RC7A 4FB5A 3C3XA 2AW5A 3H9QA 4CM9D 1D4FA 4P4NA 2JCXA 1C0PA 3DOOA 3KB6A 3LK7A 2AEJA 4WEQA 2BGLA 3JQFC 3L6OO 4A0SA 3X2FA 4E2XA 3PJDA 5CDTA 5JYDA 3GGOA 4R41A 5HS6A 1LXCA 1EVIA 2HMVA 5F21A 2FOIA 1MLDA 3A06A 4J0EA 1I3NA 2WE7A 2QZ9A 4HNGA 1Y6JA 1T4BA 1QKIA 4PZCA 1X14A 3HFGA 5JCJA 2P91A 1H6AA 4E33A 1SCUA 5GMOA 2O4UX 5IAAA 1RKXA 3OIDA 2NSDA 2WD8A 3O26A 4ZHSA 4PG8A 2Y1EA 4I5DA 1KY5A 5DULA 2Q2WA 3CZMA 4JJFA 4E32A 1LSUA 2EJVA 3UKOA 1J5PA 2EV9A 2CFCA 3KV3O 4ND3A 3D4PA 3WOHA 3C1OA 4WJZA 4DWVA 3AJRA 3JYQA 5DBFA 1HEUA 2DTEA 1N1EA 5L95A 1QV6A 1H6DA 3LDHA 1XIVA 3WGYA 4ZVVA 3T7CA 5A04A 5EL0A 3WICA 1I0ZA 4M55A 3JQEA 5T5QA 1NHWA 1U5AA 3RU7A 1GYQA 3IJRA 1SO8A 3N58A 1NQOA 4PLWA 3GZNA 4CV0A 1R0SA 3NTOA 1E1KA 3ZV5A 5TX7A 4WPGA 3BYZA 3EUWA 4RVFA 3E8XA 4D3FA 5DT9A 4WLOA 3LSYA 1T2EA 5TGDA 5COAA 4EJ6A 5DCYA 4ZJUA 3WS7A 1A4IA 1S6YA 1ADCA 2HRZA 4D3DA 4E31A 1UH5A 5KNLA 4UULA 1SOVA 1BXGA 3LZ6A 4BO1A 4S3MA 5C5IA 4HV4A 4O6VA 1ZXBA 2XXJA 2V6FA 5G0UA 3MEQA 2NVWA 2VOEA 4BO5A 3BMNB 4J1NA 4L76A 4LVUA 3UXYA 1E1LA 5I9LA 4NNJA 1P1RA 5A03A 2PZJA 4KWHA 3ZZNA 1LLUA 5FI5A 2D3TA 2PWZA 5TJHA 1ZMTA 3LVFO 3BMQB 5LDGA 4AJPA 1PIWA 1V3TA 3JD2A 4YQZA 2VOJA 4CLXA 1IB6A 5KWEA 2QYTA 1LQTA 1PGNA 2EW2A 2PD6A 4RO0A 1LJ8A 3FTNA 2RH8A 1UP4A 4TRRA 1EE2A 3IDSA 1UZMA 3QRWA 1OC4A 3NDRA 2OP1A 4ID9A 4BGEA 3NGXA 2GLXA 1ZVMA 1OOEA 4RVGA 5B4TA 5EQFA 1LLQA 1YKFA 4C7KA 2JD0A 1GL3A 1LRLA 1Y5MA 2O3UA 3RROA 3EGOA 2WDZA 4EUHA 3M2TA 3AU9A 5KKAA 4M49A 4D0SA 2OGUA 3KYCA 3DQPA 1UXIA 1NX6A 1PS9A 1Z73A 2WEKA 1I3LA 2B35A 3AK4A 3G1UA 2WTBA 4IQ0A 4CM8B 1QXSA 3OQBA 3C8MA 4LN1A 3IIEA 1LDBA 2YFHA 1TI7A 4LMRA 1F06A 3BAZA 2O3JA 3ZV4A 1ADFA 4W7IA 4BNUA 4BB5A 1GZ3A 1UDCA 2PH3A 5G4LA 4M89A 2AE2A 3VPHA 3FBGA 4D0RA 3VZQA 4J7CA 3AI3A 1TT5A 3RKRA 4NBVA 3GAFA 3GEGA 1SAYA 4MP8A 4UUMA 4HADA 1R16A 4GLOA 1MG5A 3MWEB 4CM7A 2P9EA 2P4QA 1ZK1A 4ZQFA 5CEJA 2ZCUA 5JCXA 4IMPA 1K5HA 3IC5A 3HFSA 2IYPA 4QO7A 4RV9A 4M86A 3GFBA 4BNGA 3VAZA 2PD4A 4D43A 4JGBA 4J91A 2VYND 1HT0A 4JROA 3UFXA 4YJGB 1NYTA 4TKMA 1MV8A 2YV2A 1GQYA 1MA0A 1U8FO 3N74A 2NTJA 2DVMA 1DIHA 1DC5A 4FIZA 4RL6A 1PJTA 4BNNA 2PFGA 2E37A 1EK5A 4H3VA 1GY8A 1DEHA 3W4KA 5A9SA 3ENNA 1T2CA 3Q3CA 3FPCA 3TZKA 1Z7BA 3QWBA 1K6JA 4DL9A 2HMSA 5JO0A 1QYCA 1Y5RA 3GH3A 2RHCA 1T1RA 5J23A 5A4DA 3DZHA 3PZBA 3RUCA 1PZGA 3OHSX 4FPXA 1ZEJA 1YQGA 1N7GA 1LLDA 3HWRA 2WM3A 1ISHA 3I9KA 4XGKA 1DC6A 1KC1A 5BNTA 3BXXA 4NU6A 4KUGA 4UVDA 2W8ZA 2ZB7A 3SLKA 4K9DA 1B2LA 4FFNA 3GDFA 2PD3A 3E9NA 3UN1A 4U6SA 3PLRA 4EYEA 5JLAA 4CV2A 4IQGA 2PKQP 2JFFA 2A4KA 5T6BA 1YE3A 3QW2A 5AXBA 4CMKA 1NPYA 1MFPA 4GQAA 3RBVA 4MVJE 4ROSA 2OORA 1DRUA 1KOLA 3WYEA 3RUHA 4N5MA 3B1KA 1U3UA 5ADHA 1KIFA 4BO0A 4IZIA 1CWUA 3ZH2A 2X23A 2C82A 2C20A 2GRAA 2B69A 2EJWA 1U2GA 4J43A 3OH8A 3JYLA 3UCEA 3NT2A 4Z0HO 1A5ZA 2GUGA 3LU1A 5H81A 2IYOA 2PKRA 5KVQA 3PTZA 3PXXA 2VTEA 4JLWA 3CUKA 2JAHA 1GQ2A 2B4TO 4QT0A 5COBA 1EMDA 1X7GA 3PDUA 3NYWA 4CUZA 1ZSNA 2Y99A 1GD1O 5JFOA 2UV8A 1VKNA 3H9GA 5T64A 5DBGA 3D5QA 1L7DA 3E5MA 3PQEA 4R1NA 2EKPA 2CZCA 3VDRA 3EW7A 4KQXA 4BNMA 3PHGA 4WOJA 3F46A 3KUXA 2JCVA 1AHHA 3H8VA 4PLTA 2I76A 3NEPX 4FS3A 4L4XA 4ND1A 4DBZA 1QYXA 3IP3A 4DQXA 2NQTA 5KJ6A 4R16A 5G4KB 2FR1A 4RJTA 5HRUA 1XU9A 1XEAA 4BHTA 2D1YA 4OKIA 2PK3A 3PJFA 4CMJA 1MGOA 1ZCJA 1T1SA 4BL5A 2ZYDA 3TWOA 3QHAA 4DC0A 1EUDA 2EIHA 3AFNA 4XZ3A 1H9AA 5A1TA 5TLSA 4CL3A 1Q7GA 3KLMX 3WGZA 1RYDA 3WIDA 4IY1A 5B4UA 4CLOA 4B7UA 3PI7A 2OZPA 4W6ZA 4CMIB 1F8GA 3CH6A 4LSWA 3TOZA 3F5SA 4Q3DA 4GMGA 1QLHA 4NHEA 1CRWG 3ZHZA 4EJ0A 3OMLA 1K89A 3MJEA 4BB6A 4A10A 1X15A 4OSPA 1JVSA 3JYOA 4ZD6A 1U3TA 1YS4A 1IZ0A 1ENYA 2RIRA 3PJGA 2V65A 4R5HA 3JQBA 3WSVA 1NVMB 1W4ZA 3VHRA 2A92A 3WGOA 3ROMA 3UCFA 4J4HA 1K6XA 3WJAA 3AY3A 3ZNPA 5HA5A 1I8TA 5TT1A 3W6UA 1VJ1A 4NIMA 5JAZA 3CEAA 3JSAA 2JD1A 2EERA 3GHHA 3FR7A 2O23A 3GUCA 3W8DA 2FY8A 3NRCA 1GR0A 4XR4A 4RVSA 5FFFA 1P9LA 5JNLA 5BNFA 3I5MA 1QRRA 3VTFA 3HN7A 2BH9A 5C3MA 1I2ZA 3ZN2A 4YAIA 1N7HA 2Y93A 1E3EA 1CERA 3OJLA 4BQPA 4I9NA 2VZ8A 1YOVB 5DZSA 3MOGA 2Z1NA 3H2SA 4CMAA 2RAFA 2WD7A 1B8UA 3ZNQA 2R00A 4FGSA 3G3EA 3QVTA 4I08A 2I66A 2EP7A 2VNSA 5AXDA 3HUDA 3H5AA 3QLJA 1UAGA 4IZHA 4N7RA 4PLFA 1GFSA 2P5UA 1I5RA 4L4SA 1P77A 1D7OA 3SBOA 4EJMA 3LC2O 1EDOA 3O8QB 1PQWA 2FSSA 3FSRA 2GYYA 3HB4X 2GASA 1F17A 5T57A 3JQGB 4NJOA 1ENPA 1P3DA 3VTZA 4WKGA 4E4YA 1O95A 1PTJA 3EAGA 3RC1A 3L4SO 4BGVA 3WQSB 3OJOA 2RHRA 4LK3A 1YDEA 3F6YA 3GVXA 3U0BA 5EERA 1Y8QB 3O9ZA 3DBLA 1GPDG 4Z3DA 2Q4BA 1SPXA 3KOUA 1E92A 1EQ2A 1ZKMA 4DYVA 4XQCA 3UVEA 4N5NA 4TWRA 1LDEA 2Y68A 1GADO 3CZRA 2Y0EA 3ZWMA 4TVBA 3E18A 5IZCA 3WYCA 4CQLA 3DHEA 5HBRA 4F6LA 3Q11A 3L9XA 4JCOA 5JC1A 4I8XA 3DC2A 3WSWA 4IMRA 1PJQA 4HXYA 2X9VA 3I9NA 4R68A 3RFVA 4YT4A 4I9HA 3AY6A 5ICSA 2VHZA 2VYNA 4MJLA 4GWKA 4B3IA 6ADHA 1I30A 4BKRA 2GN6A 3ZU5A 1YVEI 2DUUA 3GMSA 2GZ1A 3G1TA 1DIRA 1MXHA 3D5TA 4F46A 1HDXA 1Y81A 2GSDA 4PGFA 3A1NA 1B8PA 1CEQA 4AFNA 4NFYA 2BELA 4DMLA 3IL2A 3P7MA 3NX4A 2J5RA 1CYDA 3VZPA 3O38A 3DAGA 2W2LD 3ZU3A 1PX0A 4UVGA 2HJSA 3H9UA 4PG6A 4Z9XA 3ZGYA 4B4WA 2X4GA 5CDUA 5I8WA 4YEDA 4Q3NA 5DDIP 3UHAA 4CLRB 1JA9A 4L4RA 3PFFA 2DT5A 3BHMA 1CDOA 1M67A 3LF2A 3RUIA 4OOEA 1ISFA 2BRUA 1FJHA 4A2CA 1C1XB 4G5HA 1LSJA 3EZYA 2CDCA 5IXSA 1TLTA 2QHXA 3L6EA 3WBBA 5BNIA 1HLPA 1O6ZA 4XYMA 2WYWA 4GKBA 3W6ZA 1P31A 4RQUA 3WQRA 3WLEA 3NDIA 3FN4A 7ADHA 4WLVA 3A28A 1R4MA 1U8XX 2DFDA 2IEDA 4RVHA 1YB1A 2FZEA 4R9SA 4DPKA 4Y6SA 3IOYA 4Q39A 5DCUA 4L0QA 3WBFA 4YCAA 4AJIA 2PY6A 3PIDA 5TS3A 1Q0HA 2ZB3A 4Y67A 2XF8A 1VPDA 4IIVA 1PL6A 2EP5A 5IZ4A 1BXKA 5JW6A 1NPDA 1J0XO 5L4LA 5F1KA 1KETA 1HXHA 4E5KA 1HE3A 2HRBA 3FNHA 3WMWA 2Y67A 3MJVA 4NR0A 2RBEA 4FJ2A 2HK7A 1P45A 4IDDA 3WYBA 2X9GA 4NFSA 2I5PO 4MKZA 4NDNE 2Q2QA 1PU2A 1OC2A 1X1TA 5CFZA 4GPD1 2OOSA 4WNCA 1HYHA 2AQIA 1O0SA 5ILOA 4NFHA 3L4BA 4IUYA 1B26A 4FFMA 3K6JA 1XG5A 5C7IO 4CV1A 5L4SA 3LLVA 4RZIA 4GSKA 2FHSA 4CLDA 4UUNA 4YA6A 3CKYA 4A7PA 1A9YA 3ZHXA 1PS0A 2QRLA 1T2AA 3DZIA 3OEWA 4RDHA 1EVJA 2XPCA 5JAMA 4OM8A 1KVTA 3SJUA 1DC3A 3Q6IA 4MVJI 1JWAB 2AEFA 4ALNA 3WJ7A 4BO4A 1U5CA 3WNQA 1JVBA 5IN4A 5K1SA 3HN2A 4LSMA 5F5LA 2JL1A 4XGNA 4J0FA 2IXAA 4D7AA 2CDAA 5ER6A 2G1UA 4J90A 1PJ4A 2WWRA 3TPCA 3TOXA 1KEVA 1GPJA 2A35A 2NU9A 3NAQA 3NKLA 4IM7A 3L0DA 2V6GA 4B79A 3NT4A 1UUFA 2PTGA 3L6DA 5GZ1A 3S1LA 1DFHA 1ZEMA 1ORRA 4BUCA 1JWBB 3LC7O 2P9GA 1ML3A 3LYLA 4MVJM 3AOGA 2GF2A 2QW8A 3RQSA 3RASA 4DLLA 3ROPA 3HDHA 4YDRA 3H4VA 1GQQA 2QYSA 3FRJA 3OECA 3C7AA 3RWBA 3ZWPA 1FDVA 1E3IA 2EKQA 5L7YA 5CPBA 2X7HA 3E48A 3GGPA 1ZK0A 1OFGA 2X0IA 2VHXA 3ZWNA 4YJHA 1Q0LA 1W6UA 3GK3A 2C2XA 3VH4A 4DYDA 1VM6A 2HAEA 3FTPA 1T2FA 4OAQA 4QQRA 2LDXA 3DBHB 4XDZA 3PRJA 5JE8A 4H15A 4DRYA 1RM0A 2PV7A 1C1DA 4XKJA 3NTQA 2HCTA 5JDCA 1FMCA 1ULSA 3ETEA 2IZ0A 4FDAA 3HJAA 5DOVA 1U7TA 1H93A 3F1LA 5I9MA 1BTOA 1R6DA 4KQWA 1EDZA 1WWKA 4CQMD 4YAKA 4JP3A 2QIOA 1L1FA 2OFPA 1KERA 4HNHA 4UEOA 5KOIA 2ZB8A 1ARZA 4E2WA 2Y1CA 4WLNA 4MKXA 1H6BA 3GDOA 2VWHA 4L74A 1F8FA 4OXKA 4BNVA 4CM1A 4RPHA 4E2YA 2ZTLA 3JQ9A 2VTDA 3EZLA 1A4UA 3B1JA 4K6CA 4URFA 1UR5A 3ROKA 1I32A 2Q45A 1N9GA 3I9OA 3B1FA 4FW8A 3W8FA 3JQBC 1JKIA 4QSMA 2Q1TA 4PZEA 1FDUA 3AY7A 2UYYA 4BMVA 3KSZO 2ZK7A 4BNWA 4AJ1A 2EWMA 4BMNA 2NADA 5U9CA 2Q1SA 2Q1WA 4RVUA 2ZJ0A 5B4VA 1HE4A 3V1YA 2UUPA 3ETGA 1LRJA 3KTDA 1P74A 4OO3A 4WCFC 4FFPA 4GLLA 1XGKA 1R4NB 3DZJA 5A9TA 3EDMA 5IN5A 4UEKA 1IYZA 2PLAA 1GUFA 1F12A 4CLEA 3BMOB 4ND4A 4BKQA 1P1FA 2NNLD 1PSDA 3F1KA 4L9RA 3LT4A 5ES3A 2O4CA 3X2EA 1E3SA 1SEPA 4P22A 2AA3A 5TF4A 2YV3A 3D64A 4BIIA 2CD9A 4UAGA 5MGBA 2GNAA 2R00C 3GR6A 4AJ4A 1HDCA 1R0LA 4RLSA 1PJ3A 2BGMA 2DFVA 2NVUB 3GFGA 4PLCA 4EI2A 4RPKA 3DBRB 4E13A 3KETA 5A06A 1O5IA 4F3YA 3MJCA 1I01A 3FNEA 3P2OA 4MVJH 4KDEA 3RAJA 2LDBA 1E1NA 3OIGA 3Q9NA 2UVDA 3EVTA 4DXHA 4RORA 3H3FA 4U8GA 2ET6A 3TSCA 3GEDA 1QYDA 1A7AA 4WGGA 2Q1UA 2EG9A 1UDAA 1NQAO 5GZ3A 3ONEA 1VRWA 2EF1A 3F47A 1B7GO 4J1SA 5KVVA 4IGEA 2G0TA 3OQ6A 4EZBA 2HMWA 2BFMA 3WG9A 3CPSA 3WTCA 1Q7BA 1O9BA 1ZXLA 3VPXA 3VZSA 3GOHA 5DP1A 2ZB4A 1EFLA 1RPNA 3K92A 4PRLA 3RKUA 3H3JA 1VJTA 1GCUA 4Y6RA 1GUYA 4LRSB 3QA9A 4II3A 2HKIA 1R0KA 4M1QA 4QFDA 4Z9FA 2GDZA 1E7MA 5BT9A 4EEXA 1WNTA 5EMHA 4CPDA 3DTTA 5BSFA 3PP8A 1IZ9A 5IZCC 3R6DA 1NAIA 5HTOA 3U3XA 2W2LA 4BQRA 3PHJA 5KJEA 1PS8A 2RCYA 4JXKA 1TEHA 3QWAA 2PH5A 1UXHA 4FFOA 4JP2A 4ALKA 1IOLA 1ISMA 3F4LA 1B3BA 1Y7TA 4INAA 3QWIA 4A26A 4CMEC 5A9RA 1PL7A 4FJ0A 1J6UA 4B3HA 3B6ZA 4Z0PA 4D3SA 5ILGA 4PLYA 2CDBA 3GMDA 4I5FA 3I9JA 1V9LA 4N5LA 3ZWVA 5A3JA 2YV1A 3V2GA 2NV6A 3PVZA 1WXDA 1E7YA 5BR7A 2J3IA 1LDGA 3INRA 1U28A 4H16A 1MX3A 2QX7A 2AHRA 4D79A 3KSDO 1KVQA 1MUUA 3BMNA 3GLQA 4EGFA 1L7EA 1ISGA 3W8EA 3GT0A 2FRDA 3ZU4A 1QYVA 3D3WB 2BFOA 2JFHA 4E30A 2EXXA 4FBGA 4IBOA 2C0CA 3BTOA 3BMQA 1DAPA 5JYEA 3WFJA 4J9VA 1E7SA 3GVCA 1WDLA 5K0ZA 1GZ4A 1H9BA 1YH3A 1PWZA 4NMHA 4BNYA 3RUAA 2Y05A 3ANNA 2Y0CA 4FJ1A 4TSKA 4ALJA 2Z5LA 3MTGA 1DIGA 4Q3BA 2OO5A 1DHRA 1BW9B 1WDMA 4AJNA 1RJWA 5L4NA 3OETA 4BV9A 4NBWA 4P4GA 3GA0A 2BKAA 3W4JA 1LDNA 1N2SA 4WE3A 1P0CA 1T26A 2FPIA 3H65A 1BDMA 3E5RA 4X54A 4TKLA 3GQVA 4BVAA 3FF4A 3G79A 3EY4A 2C5AA 3VPSA 4A03A 5JDIC 2H1SA 3KRTA 1PR9A 4MDHA 1HL3A 1PQPA 4XYBA 2DC1A 2UUOA 3LT2A 4XR9A 1E3JA 4CQMB 3AWDA 2H6EA 4CM8A 3AUAA 4CV3A 3RFTA 2EEZA 2Y1FA 2VUSA 1UP6A 4UVEA 1NR1A 1XWFA 4C4OA 4S1VA 3OJEA 1CQJA 1I33A 3D3EA 4ZU3A 1AHIA 1NTOA 4K26A 1QR6A 4MVJG 4J4TA 4KMSA 4MINA 3UAGA 4N18A 5IDQA 1BSVA 3BHJA 2DAPA 4YTEA 4BNHA 3Q2KA 4IPTA 2VZ9A 3CE6A 3GC6A 2QQ5A 1DC4A 4UVIA 4D41A 3L4BC 3V5NA 1VL6A 4OYRA 2GZ3A 4QX6A 1UDBA 3I83A 4FOSA 1Y9EA 2PR2A 3AI2A 1K2WA 3E9MA 3FI9A 2CVZA 3T4XA 2X6TA 1ZIDA 4NK5A 4EUEA 3ON5A 1ZNQO 4DIFA 3HQ4O 2YDYA 5CDSA 1DBVO 1PGOA 4CM4B 2CMDA 3ANLA 4YJGA 2B37A 3NUGA 2X0NA 1P1KA 2UAGA 5GZ6A 5IF3A 1EEHA 4GVLA 2QRJA 3QJ5A 2I3GA 5B37A 5BSGA 3BIOA 3EC7A 2JAPA 3IUPA 1CF2O 9LDBA 1IPEA 1JTVA 2AQHA 2C7GA 3PWZA 4E21A 4JN6B 4ZQGA 4JBIA 3AU8A 4CM9A 3WGGA 1IL0A 4CMGA 1QYWA 4TROA 4JK3A 2W2KB 2YW9A 1EZ4A 4BNZA 5IG2A 2PNFA 2Y1OA 4YR9A 2CNBA 3VKVA 1WDKA 1BG6A 1GTMA 2O2SA 2R6JA 1ZJYA 3C1TA 4WOKA 1IUKA 4CL8A 3UICA 3DL2A 1DDOA 1B8VA 5F1PA 1E7QA 3DWFA 4U6QA 2WYVA 2X5OA 3M1LA 2Q2VA 4GX2A 1H5QA 2VUTA 3FWZA 2BD0A 5G0TA 4W82A 5JDCC 1E6WA 1OMOA 1MP0A 1HDOA 2NUAA 3FD8A 5A3VA 5KTKA 1ZUD1 4GI2A 1M6WA 2AG5A 3T4EA 1ZSVA 4RQTA 1VI2A 3RUDA 4WCFB 3ITDA 1IPFA 1JDJA 4TZTA 1U4OA 1NR7A 1XSEA 2E4AA 1S7CA 5HS4A 4KUEA 4IDAA 2I9PA 4QO8A 5THQA 3QE3A 5CP8A 4BNKA 4BOYA 4YVFA 1DFIA 4F6CA 1E77A 1A9ZA 5BQFA 1H2BA 2DLDA 1SC6A 1HYEA 1I3MA 1Z45A 4JNKA 4CLHA 2PZLA 3JQ9C 4YRAA 1XA0A 3C7DB 3WR5A 4GX1A 5IJZA 3DHYA 1PZEA 3TL2A 4J3FA 3JQ7B 5DNAA 3TNLA 3I4FA 1N92A 3CMCO 1T4DA 1ZK2A 3TZ6A 2Y1DA 1UP7A 4NJMB 3QVXA 3BTUA 1DIAA 3SC6A 4J7XA 3P5SA 3U5TA 1BGVA 2B5WA 2GZ2A 1YO6A 1MB4A 1Y8RB 2HMTA 2J5QA 2VT2A 3PWSA 2HJRA 1LSOA 1ULUA 5F1OA 2C2YA 4WNIA 5L3ZA 2W4QA 3C24A 1GEGA 4O59O 1GYPA 1JAYA 3HG7A 3EMKA 4E2ZA 4NQZA 1Y1PA 2O3TA 5JPIA 3OJ0A 1HKUA 4PLZA 5G4KA 2NU7A 4Z6KA 3KVOA 4R54A 4WLFA 3H2ZA 5L9AA 1N8KA 3GDGA 1E0DA 2GERA 3B70A 2D0IA 5G0VA 2X5KO 3CMMA 3GGGA 1AE1A 5G0SA 3RC9A 5HM8A 1WAMA 1WZEA 3Q0EA 4RGBA 3ADOA 3PYXA 5AVOA 3JD4A 4ESOA 1LRKA 2FZWA 3V2UA 4IDGA 3VPFA 3ZCXA 5IDWA 3IP1A 4YAEA 2PZMA 1DB3A 5EESA 1NPTO 1LBEA 2O7QA 2VCYA 2VT3A 3TN7A 3GNTA 4CMIA 4Z3KA 3E1KA 4LGVA 3C7CB 3GZ4A 3TFQA 3PYLA 3GVHA 4WLEA 3I1JA 4CMCA 3U4DA 4U7WA 2BI8A 2O3SA 3S2FA 3OF2A 3SLGA 4OIMA 5JCJD 2FN7A 3GNQA 3S2EA 4J1QA 2C59A 1JKJA 2ZATA 3WLFA 2PGLA 4TVOA 4XEHA 4DLBA 4LVCA 3IKVA 3JQDA 2J3HA 3KBOA 1HSZA 4U5QA 6LDHA 1D1TA 1GYRA 3VH1A 2BGKA 1EUZA 3RJ9A 3G49A 4GH5A 1D3AA 4IJKA 3F3SA 2VUUA 4WCDA 3U9LA 3BMCB 2HO5A 1LTHR 3JD1A 4NBUA 3DMYA 3JQAB 1JW9B 4Q9NA 2VHVA 2IE0A 3JYNA 4R51A 1F14A 5ENVA 4HFMA 4RF5A 3N7UA 4GBJA 4BO9A 1TT7A 1J4AA 4YJFB 2B0JA 2DU8A 2AMFA 4RVDA 1HTBA 1PGQA 3JV7A 4BGUA 2Y1GA 4E3ZA 1YOVA 3WDSA 1YRLA 4DGSA 4PG4A 4XJTA 3SXPA 2NACA 2J6IA 4PLGA 2GGSA 2RH4A 3MJSA 4YAJA 5L7TA 3GY0A 3TFOA 2OL4A 2V6MA 4ZGWA 5IDXA 3D0OA 4GWGA 1DPGA 1MG0A 3ORFA 1SB9A 2CF5A 1B14A 3KYDB 4A27A 1ZW1A 4BO8A 1T24A 5DF1A 3O8QA 3UUWA 4QXMA 1LDMA 3DHNA 4NI5A 1PWXA 1ZSYA 3JQGA 2YQ5A 5F5NA 3WFIA 4R1TA 4FR5A 4DTIA 2O50A 1NVGA 2AQKA 4XQ9A 2I6TA 1ZFNA 4FD3A 2IDZA 2GO1A 3GVIA 1Y8QA 3ZWYA 4DMMA 2F00A 4B8WA 3DAPA 2QRKA 1BVUA 1DLIA 2ZKLA 3GHYA 3IQDB 4BNFA 4D46A 3INGA 4EUFA 4CM3A 2C7VA 1WMAA 5JY6A 4GSLA 1XHLA 2OHXA 4FFLA 4GL4A 5I9NA 4TZKA 3DONA 1UXKA 1U3VA 3C1AA 4OSOA 1Q2XA 1E3WB 4XIYA 1X7HA 2EHDA 2EKLA 3D4NA 4GGPA 4HFJA 3U49A 4R9RA 3EHEA 3S8MA 4IXWA 3JQ8B 2HQ1A 3LT1A 4LRTB 1I10A 9LDTA 4IIUA 1Z7EA 2YHIB 3WMXA 1PGJA 1HDYA 2VHWA 1KY4A 4G81A 3I4CA 2D5AA 2I67A 4HP8A 2H9IA 4PIVA 3HZZA 1FDTA 2EGGA 1EVZA 3TZCA 1FXSA 2NTNA 4JQCA 2DPHA 3ASUA 1HZZA 1N5DA 1X0VA 2IZZA 5TRTA 1KEPA 1U9JA 5KJFA 1KC3A 2VNAA 3OA2A 5L51A 1EQUA 4D45A 1ZH8A 2J3KA 2I99A 3GVPA 1MFZA 4OHUA 2ZTUA 3H9EO 4BMSA 3DO5A 3FPLA 4J2OA 2DTXA 3AUSA 4D42A 2HDHA 5IXYA 3V1TC 4XB1A 4CLRA 1SBYA 3QVWA 3AFMA 5KVCA 1DAOA 3LT0A 4P4LA 3ZWOA 5JBIA 1UXJA 3WGIA 4KP7A 2BFPA 1NQ5A 3VOSA 3BZUA 4ZRMA 2QG4A 1C1XA 3CSDA 4LMPA 4W4TA 4AJEA 3RUFA 1YJ8A 2Y66A 3K73O 4JJGA 5EJ2A 2E48A 4UUOA 5KJCA 3AOEA 2G82A 4YRBA 1LA2A 2GN4A 3O03A 2ILTA 2HU2A 3PJEA 3ZI0A 1LC0A 3M2PA 4OMUA 2CF6A 4F45A 4HWKA 1P1JA 2FWMX 3C85A 5C37A 2V6BA 1PJSA 4G2NA 4W7HA 4OQYA 2I3AA 2J8ZA 4RLHA 2X8LA 3I9MA 2ZQZA 1A71A 3JTMA 2AG8A 3R0IA 4DLAA 3FHLA 3NGLA 4XWYA 2VWGA 2VWPA 2C5EA 3EYWA 1R66A 3CXRA 3GAZA 5I7EA 4CODB 4IDFA 1YQXA 3U09A 1T25A 1LU9A 2C29D 4H7PA 1Z75A 2Q49A 5JO9A 2BMAA 4ZA2A 1H6CA 3P2YA 5H83A 3GG2A 4CM5A 1QLJA 1PJBA 1YJQA 3IKTA 1NNUA 1V8BA 1UXGA 4XYGA 1MC5A 1Q1NA 4UREA 1I3KA 1E7WA 1Z74A 1WMBA 5AYVA 4BNIA 1SOWA 2G76A 3ENKA 4J9UE 4ZICA 1XKQA 5GY7A 3RFXA 3MWDB 1GV0A 2G17A 3A9WA 1IHYA 1KVRA 4NPCA 4KOAA 5EPOA 3QWHA 4I5EA 4KTTE 1RYEA 1K0UA 3JYPA
chains in the Genus database with same CATH superfamily
2ISSD 5EP1A 2Z6QA 1J8YF 1G8PA 3GEHA 4XQEA 3DFFA 4FKMA 3AHHA 1PL8A 2C84A 3AR8A 4LHVA 2J0EA 3W6OA 5LB4A 4WSOA 1Q0UA 3PXDA 3LUBA 2WQZA 4TUYB 4EKNB 3EPJA 1AS2A 1HDRA 1NBEA 1U1DA 3RYIA 3G2KA 5LKRA 2CLIB 2ODAA 4B48A 4HQ6A 3SE7A 2FEMA 1QV7A 3G7UA 1YCFA 3OPYB 5TQVA 1HDZA 1AQ6A 3R3UA 4HKTA 4YALA 3O4GA 5ENZA 2DKOA 3UJ9A 3ND6A 1GAJA 1RACA 2JI8A 3RCBA 1YMVA 1Z68A 4G24A 2GD1O 3B1XA 1OFTA 2CE7A 1N2EA 3C4QA 1SNYA 1BXGB 1TB4A 3WGQA 1EM8B 4KSYA 2ZPTX 3QUCA 1XCMA 3C6MA 2XRYA 5IC5A 3N6RA 3KSAC 4FOLA 2TMYA 1J8VA 1P4SA 2OQVA 3HCAA 3CN7A 3KPUA 4OX9B 3B20A 2ZS8A 2F59A 5HKOA 1WXEA 5EWJA 4AS2A 6GPBA 3AVQA 4JX8A 3OJFA 2QP4A 1U0BB 1IQ0A 2PUVA 3BL5A 3VPDA 4BIMA 2VFAA 3EQ2A 4PPQA 5JD5A 3MUEA 4TV9B 1G6OA 1UBTS 4TXHA 3OAAA 1CR4A 3U48A 1AHPA 2E4WA 1WNFA 3A4TA 1Z0AA 3QU2A 2QNRA 4JENA 4YMVA 1FNMA 5AQEA 4Q3CA 3BXEA 4HUJA 5JRDS 4L9AA 5TV2A 2VP9A 3FMOB 2O1SA 4PG7A 3NWJA 3ZV3A 4G4GA 1KOJA 3A1CA 1ZD5A 3OQ1A 4HX5A 4KQIA 4P54A 1RAHA 1YOBA 5AJHA 3S40A 1UAYA 4B4OA 5E9QA 1RHKA 1YC5A 3MGKA 2EGHA 2Y3IA 1KFKB 3DEHA 2WUWE 5E4FA 1Y5IA 4EVQA 1OGIA 5DX8A 5IEJA 1SVIA 5KIAA 2NX2A 3VDQA 4YRDA 1FUUA 1VC2A 2B7LA 3ZV6A 3S8YA 1RLUA 2VH1A 4YFYA 1V39A 3E1SA 3VJMA 1UMBB 3WRXA 4JEUA 3AI1A 3F5MA 1EE9A 1RI5A 3AHIA 3LCJA 2CNLA 2FUEA 4UZSA 1FC0A 5DNEA 5JTUA 3CVYA 2TMDA 2RKBA 4BASA 1I7NA 2APJA 1ZNYA 1UZUA 2O2GA 1ZJ4A 4R3NA 4E5YA 1VPEA 2B4QA 3UYKA 4WZAE 3WZLA 5CRIA 4UC0A 2JLWA 2QRPA 2GESA 1Q17A 5C81A 3DOEA 4R9VA 2OV3A 3DZKA 5EZ6B 2EBWA 3V8BA 4YT2A 1MEJA 1CJVC 3H9BA 1D2AA 1WV1A 1DAMA 3LG2A 4L3VA 4RC9A 5LIRA 5LZ2A 4MV4A 5EZQA 1RRCA 1U02A 3HKCA 3GCXA 3IXMA 3USES 3KXDA 2UUAB 4M9SA 4PQFA 4TKZA 3LRTA 3K9QO 1YC2A 3E03A 4KAAA 3ELYA 3ZU4A 1I4OA 3PEYA 1A8UA 3B9QA 2V3WA 3R3ZA 3KKNA 3O8NA 2HEIA 3RYFB 3H0EA 3RSSA 3KSBC 3T3NA 5JLJA 3ABZA 1SXGA 3C5WP 4HDSB 4B3JA 3JWJA 2KM1A 3JD3A 1SCKA 2X1MA 4JQSA 2WWIA 3EFBA 4BKUA 4KN5A 1U63A 1U6IA 3R3JA 2Q6TA 2QI9C 4YP9A 5B58T 1E9SA 4QRDA 3KCNA 2MT9A 5BVHB 3HCOA 3KZMA 1CBUA 4Q82A 5GV7A 3RPEA 1JWLA 4PZDA 3QY9A 2XUJA 2XT6A 5IKXA 4L75A 1SIOA 1T3GA 2YW2A 2VHYA 3Q12A 3OX4A 3T8YA 1O6CA 3DZDA 4V0RA 5I7OA 1NUPA 1Z2CA 1DG3A 2UZIR 1X0XA 4QRHA 4WN9A 4XQ0A 2AN9A 3T0FA 1H5UA 3AUUA 4C2AA 2JKVA 1YFZA 2A9FA 2AYXA 3DDCA 4QPNA 3HEMA 1I7DA 3EA4A 3ZTYA 2RK3A 1Z5OA 3CX6A 2A0YA 4RZ2A 5JNRA 2PJDA 2QROA 3DNPA 4PQGA 3WMRA 1VMEA 1EA7A 2H9AA 4CKBA 2CHGA 3HVIA 4NZPA 4DLPA 1XTJA 2CKDA 4K6MA 1E4YA 1VCOA 1MQ9A 2YY7A 3CR8A 1Q12A 2D00A 4JJ8A 4V38A 5JVDF 3EWIA 1IH8A 1ZM7A 3MTBA 3WYGA 4E7PA 4IQ8A 3A2NA 4TSFA 1L7MA 4HH3C 2XW6A 1Y6RA 4XIGS 2Q9UA 4R1SA 2GETA 4B34A 4Q1FA 2W42A 1UMCB 3ZW8A 4TRMA 3K31A 4EHHA 5L3VA 1C8VB 1J70A 1P6XA 4B6PA 4ABYA 2A9PA 3DNMA 4TTAA 4AXXA 2XB6A 4ZWNA 3RKSA 3PIIA 3KHUA 2Y0DA 3B3JA 4P5PA 1KH1A 4BC0A 5EJ7A 1LDYA 5HOQA 1NWHA 2ZJ6A 2CEAA 3DLBA 1EFKA 4Z0TA 2V98A 2DWCA 4I9GA 1H2HA 2HRCA 5KINB 1X7WB 2YICA 1QP8A 1VMIA 4P4TA 1WBBA 2R8OA 5BOSB 2ID4A 1ZITA 3BIFA 5HKBA 1OYWA 5EP2A 5D7BA 2RK4A 4M0EA 3TLMA 4AJJA 4CMBA 4LDZA 2JIRA 3BN3A 3ENZA 2FPRA 3ZIDA 2Q6VA 4YHHB 4N9WA 2CLLB 2R8EA 1C4OA 4GAEA 4KXMA 3ZCUA 4QGFA 1VSBA 1P19A 2N75A 3I09A 2VYVD 4QODA 5E2AA 1N0WA 2QMOA 3IUQA 1UOOA 3PUVA 3R5KA 4PBTA 4Z99A 4XEUA 4FCTA 4MR9B 2C4UA 5BNTA 3DLPX 3HKDB 1E2BA 1C3VA 5BSEA 4D4LA 3QV2A 3H1AA 3H2YA 5BV2P 1DHTA 1WQ4A 4U00A 3K9GA 1AO3A 4A73A 3CV3A 4C0KA 4ZHQA 3CRVA 3RS7A 4NS4A 1A2QA 5BQPA 4BEJA 2XQGA 1WLYA 3S2IA 1JHOA 3EVAA 1CDZA 1GSIA 1ODLA 2IGTA 1G3MA 1YZKA 2ADMA 2OXCA 3SI7A 1MH1A 3JPYA 5ITZB 4KZPA 3FF1A 2A78A 3K6SB 4MVJP 1FB5A 1N1GA 2YJ3A 1HX7A 3JAKA 3MUOA 3NOOA 3ZY3A 4LVOA 3TL6A 4BZPA 1XZEA 3HB5X 5KJ1A 1ZJ5A 1ZD2P 2QM0A 3ZC3A 3I8SA 1U9YA 3KYBA 4FX5A 2BEJA 3TVTA 3PGXA 1Y8CA 3IHLA 4LISA 4FMDB 3LXUX 5JJLA 3INTA 4D9MA 1D2EA 2LIVA 3N8DA 1EFDN 4Q4DA 3WMEA 1GSOA 3BDVA 4YCDA 3ZLVA 5EIHA 3EN0A 3MWGA 4RKEA 4Y98A 3VOBA 4EEZA 3H4TA 3NI2A 2PYZA 2X41A 4PAOA 1A9XA 4P9NA 3I45A 4LV6A 1V6SA 3KOYA 4JBHA 2ZRQA 5JASA 1NXWA 4UAUA 3MF4A 3SC4A 4OXQA 4XYEA 5ELMA 1U7HA 2RGBA 4HWSA 4K1LA 1CFZA 4WXMA 4URHA 2GPYA 3RVKA 1GGJA 3HJHA 4S0XA 2XYRA 4UCQA 4R7ZA 2C31A 4K81B 5FULA 3C0KA 4HNAA 3GG9A 1HYGA 1BW9A 1PR0A 4XD2A 1Z63A 1GDHA 2QXUA 1E5QA 3G0GA 3HADA 3VR1A 5ALJA 1W4RA 2K4MA 4XJVA 3A10A 2C54A 1TFRA 4OI2A 2JIDA 4OHFA 4ALIA 1EFHA 5B64A 1JPUA 1CZOA 1U0TA 3ROZA 2CY0A 2R48A 1KMQA 3BTSA 1I24A 3EGCA 3N0VA 1ZC4A 1JIIA 2CCKA 2IOYA 4FE7A 1YT5A 3FVTA 2YIJA 1GUZA 3KHSA 1AUQA 3V4PB 4M9UA 4WEOA 1KSGA 4NICA 2IW3A 4ER3A 3ZOKA 2Y9MB 3RJTA 5K3OA 2WKRA 2Q27A 3KSUA 1DV1A 1LBQA 1GUDA 1P9NA 2ZJ1A 4RHYA 2IEBA 5J63A 1Q6ZA 4A8JA 1LWNA 4XLLA 5LQNA 1D8AA 4Y2JA 1QUEA 1HDGO 1IXRC 2QUBA 4F7WA 2I8CA 2PZFA 1K7YA 2PUGA 2WKPA 4ZN6A 5KQMA 3PE4A 4JLMA 3GH1A 3GAMA 4EUKA 1P5HA 1URPA 3BH0A 4TTTS 1RABA 5J5VA 5A0FA 1OPRA 4QULA 5EXPA 4U02A 3K2QA 5GVSA 5EKXA 1BMDA 1DCTA 2X5JO 1OZ0A 1AB5A 1ISIA 4NH4A 1NHGA 3IUMA 1WXHA 3TQHA 2UYHA 1JPNA 4GKAA 2ZIEA 3ZUGA 2AJ8A 3LX6A 2RARA 2OSBA 2VP6A 4OB7A 3RNOA 3FZQA 1EEXB 4IHJB 3NPAA 1JQBA 3H5VA 2IT1A 1CX9B 1JDNA 2CVQA 4WI1A 4ZT7A 4MTCA 4WV3A 2HL6A 2BLNA 1XI2A 5D01A 4IILA 4XJSA 3RSLA 1L5YA 4BVKA 4DV1B 1MVNA 2JCGA 4Y8VA 3HGQA 2PCLA 3HGTA 3ZHQA 1I36A 2AV6A 4YO8A 1W8DA 2WMYA 2GN8A 4MKFA 3SZMA 2CB9A 5CHEA 3AUTA 5KKCA 2YN4A 2WZQA 3GRKA 4J75A 2JGRA 2H7YA 3OTHA 2P4UA 2V4UA 1JIXA 4ACBA 5JMPA 1B16A 1XQXA 2I7CA 3EXG1 3NCTA 3DZ8A 3L7CA 2G09A 4O4HF 1WABA 2VKTA 2OE2A 3OZGA 1TPYA 1PSWA 1QYRA 3KPYA 3MJ4A 4X62B 3M4ZA 3Q3EA 4ZEVA 4CI9A 1G0OA 3H5TA 1SUIA 2D1TA 2P41A 5G2OA 1TRKA 2BTQB 3TTSA 1L7PA 4MICA 1E1CB 4R81A 1LS1A 2QRVA 5FOWA 5EIXA 3LYUA 4H7EA 3BH7A 3BICA 2B99A 2JBAA 1P0IA 1AG9A 4FFWA 4X6YA 3W77A 5CVVA 1R12A 4PGGA 3TW6A 4GM0A 4LX0A 7MDHA 2UUBB 2FUNB 1KK2A 3MCWA 4IWXA 3B6IA 4LQ4A 2PMFA 5CDYA 4LW8A 1PWHA 4YB8A 5THKA 3DZFA 5IK2D 2GK6A 1PUJA 3GUYA 4N8SA 2QIPA 1U1FA 1B41A 1KMIY 2HN9A 4F2GA 2IODA 2BISA 2CVFA 2J9GA 3TXYA 4F56A 3CH7A 1CY8A 4DUGD 3FBTA 3Q2IA 1U8EA 3SZUA 4EB0A 1ZBQA 1ODSA 4O2RA 4BE4A 4NABA 2B6HA 3EIXA 4QYIA 3GJ8A 4ZJZA 2EFEB 1EGQA 3U3MA 1VJDA 2IYEA 3B13B 1NASA 4YIHA 4PINA 4H3KB 3EG5A 3I01M 1XU4A 4BTLA 4TL7A 3TW8B 2Q7DA 4OQPA 3C6KA 2B5VA 4BVLA 3R09A 2W2XA 1YZTA 2X8AA 4IDCA 3QKSB 1L5HB 1MEEA 4JLOA 4WCFA 5CA0A 2Y1XA 2FA9A 5FNVF 4ENUA 5DTRA 4HG2A 2VRCA 5INTA 4G0OA 4WXEA 5KHAA 2QPAA 3ZNOA 3OZBA 1ES9A 2O59A 1LVGA 1L9KA 1E1MA 4WVLA 3RT1A 4CKZA 5LQKA 1CY0A 5I7SA 2GCGA 3QFRA 4TYNA 1AV7A 1ZISA 1G21B 5EOVA 4BNLA 5M04A 4U2BA 5IJ0A 4PLHA 1G41A 2LUOA 3BVPA 3JQ7A 3K1JA 4RULA 1Z3CA 4CFYA 2D59A 4Y2HA 1K5PA 2QAGA 4QYWA 5I8ZA 3WV5A 4FX2A 4C7OA 2XB2A 4DEYA 1CS0A 5EA2A 3HUEA 1FRZA 2MYUA 2PT9A 4DUPA 2GZRA 3PXAA 5A4KA 1D1PA 2PRSA 3DL4A 1NURA 1SUWA 1ZDMA 4CI0B 2HM7A 4UHJA 1N2XA 1BO6A 3GQBB 2PGNA 3HC7A 2HSEA 2CLOB 4Y2VA 1P1CA 1TA4A 1UCFA 3GEIA 5J3JA 2LKCA 3UQZA 4LXIA 5DHAA 4JQZA 1AN9A 3G89A 4JEHA 2HBQA 2NV2B 4Z8YA 2NUPA 1P4RA 4M46A 2DBRA 1EWTA 1P5RA 1RWMA 1X8LA 3EGXB 1ETHA 3AHJA 4HXGA 5AK0A 3OM8A 3I6YA 3JZIA 4Y1FA 1G20B 4E5PA 1COWD 4RCVA 4X85A 1VE6A 3NNSA 3GJ4A 4G0YA 1HTTA 2QQEA 2VNHA 1XVTA 4CM6A 3M6XA 4YACA 4HGYA 4PPGA 1GV1A 3FNFA 3GRPA 3JD0A 4ESVA 4FUTA 3VNUA 2C3PA 4O3MA 1DBWA 2IOFK 4FGKA 4LSGA 1CUGA 1PHRA 1U3WA 1EIWA 1W5EA 3IS3A 2ZSIA 1B00A 4ZV9A 3U4HA 1QRUA 2CN1A 1Y9AA 3DVAB 4HGZA 5DYYA 4A6XA 2INGX 4DNXA 1YQDA 3MD9A 2W7TA 3K4PA 1OZAA 4HY3A 2B21A 1T5IA 3HHPA 1PZNA 4RNDB 3WY9A 5A02A 4X5OA 4DPMA 4JJAA 4MHOA 4GR4A 4PWZA 1R4MB 2JFGA 1FTSA 1F0YA 4MQEA 5U4QA 4AJHA 2VPPA 4E22A 4ZJYA 4GI5A 2JG3A 3STYA 3W1VA 2CWWA 4LV8B 3DE2X 4LNAA 4J2HA 4YI3A 1EGMB 2MTBA 2ZQYA 1PR3A 1KPIA 2BEUA 4EA6A 3M4YA 1D4OA 4FEGA 3HVJA 1M83A 2FSVC 4EB3A 4H08A 3HPQA 4MJ7A 4KQMA 5HDBB 4J94A 4N7JA 1UEJA 3UF0A 1W1WA 3ZKWA 3BFJA 3H5OA 3WGLA 4DMRA 5TNXA 1P3Y1 3TF5A 1T5HX 5GGXA 3OHPA 1DP4A 2O8CA 4OIFA 1SG0A 3PDWA 3ICPA 1PW7A 1INLA 3FPBA 2X40A 1GNQA 2IIPA 5TC4A 1N6LA 3VPAA 1JBQA 1VG1A 1C14A 2IYFA 1MO3A 2CGEA 2Q3HA 3BCSA 3EDCA 3MAJA 1L4NA 3U3DA 4QT4A 3V1KA 1YHNA 2XRMA 2ZWMA 1SBTA 3CNNA 3PDJA 1V48A 3HYTA 4UHCA 5G3ZA 3SXUB 1Z5VA 2EJCA 1TC2A 3IESA 1O57A 5EINA 4MWOA 1R37A 2I2WA 3BXOA 1CIJA 2ZJBA 3T52A 1V4VA 2GJSA 1RBYA 4JB8A 1L5KA 1LEHA 1V37A 4MWEA 1L5SA 3CVVA 5DXAA 3QQPA 3X1ZA 3BMCA 3DBVO 1SQSA 2UVPB 1L5VA 3O2JA 2R2GA 2B92A 3QZUA 2MINB 1THTA 1EJ2A 2RGGA 3K0CC 3GO4A 4S04A 4B83A 2ZCJA 4IIHA 1GAEO 3TD9A 1IBKB 4K1XA 4ZQHA 4X20B 1QZUA 4B6OA 4I55A 3OEEA 1H0KA 1Y9ZA 3OKCA 1HZJA 4GZ5A 3QKRB 4F97A 2JATA 2O1WA 1QIEA 1WMEA 2ODQA 2Q0QA 3QFHA 3C7KA 4FYYA 4QEDA 4RZQA 2I7DA 5FPKA 3H2JA 1R6VA 4I5GA 5D86A 4UTOA 5IWAB 1YR2A 1XAJA 4G5YA 4HHEA 4UTPA 2F4NA 3LOPA 4IIFA 4NG4A 1NJ2A 3EXEB 1NW4A 3SIXA 3MGCA 4A82A 4BRSA 4IJUA 2X86A 2VAXA 1QGUA 3HDYA 3IEPA 4C6TB 1SUCA 4AWAA 2COEA 2BP7A 3V1UA 3OTGA 3WLLA 1AGNA 3IUEA 3HP1A 1QVRA 3RAFC 2VYQA 4F3CA 3GFRA 4XTCS 1ZBDA 4Z4EA 3AT1A 4NK4A 2BMDA 2WINI 2H31A 3VHLB 3U60B 1UOQA 4P08A 4X1YA 5JDIA 1VPLA 5H3LA 3TQSA 3VTKA 5E6SB 5L3QA 5MDHA 4B6FA 1ZK3A 1E6MA 4DCNA 1OFIA 5KKNB 1JQDA 4RCYA 4LOJA 1MPTA 2QPLA 3RTGA 2HSDA 1HSOA 4K0KB 4PE5B 2IHJA 1ZIYA 3BQMB 1E0SA 1QBGA 1XJ5A 2R6AA 1JDZA 3D6VA 3EMBA 5CB6A 5LQMA 4RPLA 4BO3A 1Z3IX 3D8TA 2O6LA 221PA 2X19A 3K0KA 5CVEA 5DM60 5KSWB 1IY8A 1VKRA 1YULA 5AK5A 3RUEA 2OECA 4LZWA 1TNDA 4OQZA 3VR5D 5KWIA 1IAVA 3VR5H 2OCKA 2UKDA 1C4XA 2BMWA 3GN2A 4QHYA 1RZ3A 1D1SA 2W6JA 4F12A 3WAJA 2XA9A 3NUQA 2O2HA 4CJXA 5F7XA 2F55A 4RPCA 2XUIA 4RY9A 1WZUA 3IAHA 3U4IA 4KWCA 4Y30A 1O94A 4KPUB 1ONPA 4MV9A 3RODA 2OGWA 5LWQA 1TMGE 3LQFA 2A5YB 2P7HA 1P2SA 4FT2A 4MIEA 1MJGM 5AQ1A 5K3EA 1YBHA 3K30A 4EY7A 4ZI7A 1EFRD 2OZLA 4G9BA 2JLZA 2AOUA 3JQ8A 1ZZEA 5C46F 3CIFA 4J4BA 3ZQ4A 4DIOA 5B2EA 1LNQA 1C0KA 1JT9A 1NNI1 3QOWA 4IDNA 1FP4A 4UTVA 2UUCB 2GPTA 1NV8A 2D74A 1VYHA 4H31A 4LF5B 3AM3A 1SPBS 4TUYF 3W0LB 3C3BA 3A1WA 3GRZA 3O3CA 1MZVA 3H1GA 1W48A 2CXQA 3AF3A 3R8FA 3ZDAA 2HZBA 2PJRA 3I72A 4TZ6A 2OQ2A 2F8SA 1CY6A 3OLZA 2QVZX 4BBZA 3ZWBA 3V4VB 2Q4EA 3OCZA 3O94A 2P1ZA 1N9GB 4R1UA 3ZZ0A 1FTWA 1Z88A 2O06A 1Q0TA 1M34E 2V6JA 3B1WA 2GN9A 4UUPA 4ZQCB 3T9FA 3V8NA 3ZNNA 1OAOA 2X1HA 1R9NA 2ODWA 3AKDA 4PZLA 2X2OA 1AH2A 2FW8A 2YWEA 3AIKA 2ZIWB 4KO8A 5EE9A 1D4ZA 3T95A 1DOAA 3IAAA 2ODTX 2C9MA 4LXGA 2Q3EA 2OFWA 2O2IA 3NVMB 3OQHA 4JA0A 2QS9A 3LF1A 4DM7A 4HATA 5JXWA 1XQ6A 1KDOA 4O4LB 5AKKA 4JC5A 5FRDA 3OWHA 4FEEA 7REQA 2O7RA 3OPXA 4R2HA 2JI4A 4MKRA 2OXIA 3F96A 3BWMA 1DFGA 5FLXA 1RW4A 2Z43A 4QUHA 1G5FA 1I2BA 1HE1C 3DM9B 1VE7A 4DDMA 1YBAA 4DREA 1EE1A 2AEMA 3HSKA 1BC5A 3VR6A 4MIOA 2AVDA 4OQXA 2Y0PA 1OJLA 1TXGA 3ETDA 3QOYA 2FHPA 4M37A 3K1TA 4RQAA 1VKOA 3PWKA 1EVLA 4O0MA 5T8KC 3FYDA 2QSZA 1WPRA 3SBEA 3H05A 4NZOA 5KCMA 5AJTA 2EHJA 3VRHA 2FFRA 2L2QA 2GI4A 1PR6A 4J6FA 4N0DA 3SVZA 4F7DA 1RWPA 3C3XA 4DV7B 3A3YA 4ZMSA 5CLIA 1D4FA 2AF4C 5PGMA 1JBKA 4WEQA 1FFGA 1N1MA 3RF6A 1L8LA 4URUR 3OOJA 2DH5A 4EATA 4EG8A 1DQNA 3OPQA 4A0SA 1RRMA 1UIMA 3C14C 3BOSA 1BWPA 2K7ZA 5AICA 3I32A 1YMUA 4I1SA 1Y1KE 1M6VA 4EVSA 2O5CA 2J9FA 1V1RB 5C7YA 1U2SA 5F21A 3W3ZB 4J0EA 1JJ7A 2ECPA 2W00A 4GYWA 4LQDA 4AZSA 4EW3A 4ITVA 2WNIA 1X14A 3L05A 1H6AA 3ESCA 4MVWA 1XEFA 2HLNA 1UBKS 1RKXA 2HLHA 1PNTA 4NYIR 3O26A 3EHDA 4ZHSA 2Y1EA 1OJ7A 3LHFA 1F6DA 3Q8LA 2XMZA 4MGEA 2GPNA 1AM4D 1R6XA 3OHMA 1WVIA 3A2MA 3KR1A 3ZQJA 3AJRA 4H1UA 3JYQA 4MVCA 3MWDA 5ALDA 1G55A 3LPCA 2P69A 1V1MA 4FW9A 4Z9AA 1VXOA 5HF8A 5E7IA 3WGYA 1LPSA 4A8TA 4ZVVA 1SXJA 3UMYA 1YJ5A 2GRJA 3GFOA 3T7CA 3KD3A 4I6GA 5EL0A 3WICA 5A04A 1M10A 1ZS9A 3FTQA 5FA5A 1XXHA 2CLKB 3X2SA 1VKHA 1RC1A 2FJ0A 3JQEA 4M55A 2W71A 5T5QA 2JNWA 3ZHUA 1LH0A 1LPPA 1ECJA 2HT6A 3FGOA 3IJRA 2H5IA 1QFXA 1NQOA 1FLVA 3DAOA 4MRPA 5DNYB 1R0SA 3O31A 3BRWD 4WPGA 4KBFA 4K9OA 3TKAA 1KI6A 5F4ZA 4FYPA 2VBIA 4UUBA 1RHQA 4RVFA 5FL3A 3IQFA 3WK5A 2CL6X 4BZQA 1NU6A 2C2HA 3TIVA 1F60A 4YRMA 4QQKA 4QWMA 1BQ4A 5JNUA 5K45A 2Y9PB 5TVGA 3WS7A 5LKAA 1II9A 2R60A 1JHDA 1H85A 1NBHA 3BWEA 3G7SA 4RLFA 4KXVA 5D6OA 5GPBA 5FAXA 1S6YA 3A6FA 4UPEA 1CJSA 4HJXA 1G8YA 5M29A 4KGZA 1ADCA 4M9CA 2HRZA 3E27A 3VHQA 3JS5A 1UH5A 3LY7A 3NKVA 2BMJA 3HCCA 5LQAA 4Y6LA 2E2WA 1IHOA 5ALHA 4S3MA 5F2NA 1YASA 1W88B 5ED4A 4FEAA 3D6TB 3IXLA 2V6FA 1FX0A 3O21A 2NVWA 5DM70 1UADA 3BMNB 1KU0A 3NIDB 4OQEA 3TOVA 3U4QB 2ODEA 4N8EA 4EB8A 1Z0KA 4AP6A 1ZCAA 4WY5A 1N5LA 3KHTA 2PZJA 1Q0ZA 1UBJS 4QTXA 1Z2AA 2PWZA 4LVNA 3KIPA 1GT6A 1YZGA 5TJHA 3TQIA 4K03A 5CNKA 4EDHA 5LDGA 3HEAA 4JB2A 1PIWA 3A4LA 5ICFA 4Z7NB 4YQZA 1KJQA 2PEZA 3N2YA 1DEKA 1JXMA 2VOJA 1T0HB 1JR2A 2J09A 2WPDD 2YRXA 4HPWA 4L4YA 4QQFA 4CLXA 1E1QA 2VF4X 4IUDS 1LQTA 2QYTA 1CVLA 3CGGA 5ECGC 1PGNA 1ACJA 2Q6OA 2EW2A 1XNGA 2PD6A 3A1FA 3AR3A 4RO0A 4BFTA 4AD8A 1UP4A 4DRXB 3GLGA 3PC2A 2VDPB 4TRRA 4EEKA 3TLBA 2O9JA 3UG6A 3QRWA 1ZGCA 1OC4A 3NDRA 5KSZA 3VNSA 1B6SA 3OLXA 1GG2A 2R751 3MLAA 4I2NA 4KVZA 4W6QA 1ZVMA 2R6DA 3G2QA 1X9GA 4NNOA 4PYKA 4RVGA 4IZOA 1TK9A 1XZCA 1KJNA 2WAAA 1Y5MA 2CK3A 2DWUA 2O3UA 3NALA 2O7VA 5CYFA 3RROA 5AHXA 4F4CA 3EGOA 1DO0A 2HEGA 2ECQA 2N0SA 3CN9A 2FPIB 3AU9A 4NVRA 5ERGB 4PHGA 3KYCA 1YRYE 4EHDA 3TTUA 2PO7A 1B1AA 1RXIA 1H1LA 2G4CA 2P3SA 2RK6A 2VCEA 2C03A 3BMXA 1GGKA 1PVOA 5FR2A 1U3GA 1N5JA 1ZH0A 2ONJA 1G18A 1S3GA 1XRJA 4IQ0A 1O95D 4CM8B 4BN4A 4V1CB 3VJKA 3C8MA 4Y2TA 3IIEA 3OX3A 5FL7A 1JA0A 1LDBA 2YFHA 4EECA 1Q22A 2G5TA 4TTIA 1Z5ZA 1T35A 3CLTD 3AG5A 5DTMA 3V48A 5KNBD 1JPVA 3JPWA 3SKXA 3CSSA 3DDOA 4LMRA 5KNBH 4IAOA 2O3JA 4LOHA 2RGYA 4RMHA 1QVAA 1UK8A 1PJAA 3O4JA 3S5JA 1E9BA 2AE2A 3E22B 1CUVA 4G3XA 4KMRA 5KTRA 3SBDA 4D0RA 1OA0A 3VZQA 5JOQA 4LKRA 3SQXA 3O4HA 4EKIA 2HFKA 3CGWA 1I4WA 3LTNC 1CUXA 2ZFUA 4UHKA 4FMDF 3WB1A 1VPVA 3ABQB 3QUAA 5AKZA 1OVMA 2C3YA 3KXKA 1SVKA 1KYVA 2P9EA 3C1UA 1Z56C 3KPVA 2GK7A 3DO6A 3EVEA 5H8WA 3KDSE 1DMSA 1K5HA 1ZJJA 2BPOA 2G9UA 2XHZA 3IC5A 4FHGA 4H7DA 3RLIA 4M9XA 4BNGA 2XY4A 2PD4A 1FVOA 2BFFA 1HT0A 5C1IA 3O82A 4YC7A 4QOGA 4CTNA 4EGSA 1YAJA 1FY2A 1NYTA 3GLFE 1NM5C 1GPUA 3IVMA 4LJKA 4I5IA 2DVMA 2P9HA 3GV0A 3NZEA 1DIHA 3DL0A 2CMFA 3BAFA 3CA8A 4RL6A 5DGTA 3TINA 2YKGA 4X0EA 4RA9A 3EC2A 4YAUA 4O4IA 2QTWB 1T0BA 4B3TB 3ENNA 1T2CA 5JZBA 4D8WA 2QVXX 4YMLA 1XLTC 2F1RA 3QWBA 3KQPA 4PXSA 4B6EA 3HI4A 1P62B 2I7TA 4WKPA 5AW5A 5C8YB 3FI0A 3GLKA 3PZBA 3I37X 5C1BA 3OHSX 4DNPA 3FKSD 7AT1A 4FPXA 1VRCA 1ZEJA 1YQGA 1LLDA 2N47A 1ISHA 1ZW6A 3T3IA 3I9KA 2GZMA 1EWKA 3HJNA 1XNRB 1QH1B 1MHPA 2GZDA 3IO3A 2FTKE 1UPUA 1B2LA 3Q3IA 5IVIA 3R7BA 1Q7RA 2XMDA 3RVRA 2B5OA 1GQOA 5P21A 1M3SA 5AW1A 1TM2A 3WWDA 3PLRA 4FDUA 1JLMA 4C08A 4V0MA 5CT4A 1MJ5A 2J3EA 4IHJF 3WNZA 2HV9A 2IUFA 1DXQA 4DA0A 5AXBA 1M2OB 2LKDA 1WM1A 1YSCA 4L28A 1NPYA 1XRNA 4GQAA 4EHLA 5AW7A 1NBMA 5ALVA 2YTZA 3JAMA 2OZVA 4RU1A 4GMXA 3L0BA 3JQQA 1KOLA 5LYJA 3B6MA 3RUHA 4J8PA 1M73E 3ZHTA 1U3UA 1Q14A 3KTFA 3TQCA 2DPYA 3TK1A 2VP5A 3GCZA 3PENA 3QLVC 4ZPXA 2ZDGA 2DUJA 5JSZA 2C20A 4ER0A 1Z25A 1IVNA 2QYOA 4KXXA 3GU3A 4MDEA 4QM7A 3M9XA 2XBMA 2B69A 3A6PC 4LUCA 4NZNA 2PX6A 5JCOA 3KKOA 3KQOA 2YVKA 2GUGA 3O6VA 4O2BB 3S7TA 3ITNA 5KVQA 5K5EA 2IEYA 2Z08A 5F5XA 2J3QA 4RTRA 3FCXA 2VTEA 3QOFA 1U81A 2G1PA 1RJGA 3AVPA 3OZWA 1UMDB 4ENWA 4KR6A 4LHEA 4QT0A 4ARZB 1NLFA 4FYWA 5EVJA 1LJUA 3HCEA 5COBA 1X7GA 1JMYA 3PDUA 3Q8WA 3ZXIA 1L4YA 3UXEA 2GFHA 1GNRA 1RHMA 2Y99A 3G8YA 4C5AA 2UV8A 5IVKA 3OQVA 1U8ZA 4B40A 3H9GA 2OHVA 3F0TA 2BAGA 4D9JA 1SBIA 1L7AA 3M3HA 1XCGB 5SV2A 1L1QA 3D02A 4QFBA 3H83A 1L4BA 4RE5A 2CV0A 1CZKA 4MZDA 4KLCA 4BNMA 4FEYA 4GPBA 4WOJA 4ADSG 1G1MA 5CB8A 3KQYA 1M0EA 3F46A 4IHQA 3TYXA 4Q7JB 5IUNC 2ZT6A 1DWOA 5K4GA 4DBZA 1FP2A 4QBTA 3IP3A 4GBGA 4RGYA 1L5OA 2NQTA 4DQXA 3C97A 4WMLA 3RRJA 3O0TA 2FR1A 2NU7B 2O2CA 4D1YA 3DYVA 1BS2A 1MGOA 1ZCJA 2C78A 2PX0A 2VR1A 2XYGA 3DC7A 3IGFA 4G4SO 2IFTA 4LEIA 4BL5A 3JAWA 2WVHA 4LNUA 5ICEA 2VQ6A 3AFNA 5AIAA 2O1XA 3V97A 5A1TA 1O0CA 1E1RA 3R3WA 3KLMX 1QDUA 2YHSA 1BVHA 2O2EA 1W29A 1LF0A 2R8XA 3WIDA 3CRRA 5E9JA 3OO0A 3NTLA 4IY1A 5ES4B 3GLHE 4IFIA 3PNYA 1DJMA 2B9VA 3PI7A 2IYSA 3R44A 1IFXA 2BKUA 2W43A 4MV3A 3KTOA 5CLQA 4EGAA 4B09A 5BURA 5IEBA 4HWGA 1SHZA 2JDIA 3HO1A 4CQNA 1SQGA 5DRTA 4LJ4A 2A4MA 2DKFA 1DJOA 1N6NA 1QLHA 1R0XA 3LGSA 4FCVA 3D1JA 3UW1A 4RKYA 3UFBA 4JV5B 3VR2D 1V45E 4EJSA 1K89A 4BQOA 2Q5OA 4A10A 3U4GA 4YREA 4BWGA 4LDQA 1NMEA 3TJMA 3KVRA 1X15A 1DGQA 1JVSA 4DMUB 2NZXA 3JYOA 2HPZA 3UAWA 5BV0A 3ESXA 3VHXB 3CONA 4DR1B 1U3TA 2XXAB 3SZRA 3AVUA 2RIRA 1J07A 3GLIA 1SZDA 4MPJA 2PMWB 2QN2A 3UBMA 3L41A 3QVMA 3WSVA 9GPBA 2BWJA 2WF8A 1WXFA 2Z2XA 4X97A 3WGOA 1U0SY 4PICA 1ZUIA 1DG1G 5HZGA 3AY3A 2PGOA 4GI1A 2BFEA 1UM9B 4Y2PA 1TCCA 1PDVA 2QSYA 1L4EA 1AKEA 1XOIA 4HUQB 3JSAA 3WGJA 4DLYA 1K88A 3IE1A 2FWNA 1OB2A 2OK7A 3G6KA 5LSAA 1HRKA 4MGZR 3FR7A 4FVTA 3WLHA 2PLNA 3W8DA 4W5RA 3DXYA 3HB9A 4EW1A 3NRCA 3C5CA 1G4AE 2EL9A 2VT6A 4AZ3B 4RVSA 5FFFA 1P9LA 2XKAA 4LC1A 5JNLA 2LWIA 1QRRA 1VJRA 3H8JA 3HN7A 4UUAA 4HEQA 1XAGA 3S68A 1Y9DA 3LHSA 4CF3A 4BQPA 2ZUSA 5FNZA 5FUBA 1XDSA 2DCUA 4UCWA 1BQ3A 1CB7A 3LPNA 1TJYA 1YOVB 2OHOA 2ZYTX 4QEZA 5IH3A 3VNBA 2GXUA 2Z1NA 4PZ9A 3U1VA 4CMAA 1QE5A 2J7PA 2RAFA 4M38A 1IEQA 4L2IB 1M7GA 4EMSA 2YJNA 4MS4B 4Q12A 4LJRA 4F96A 1UBGA 4FGSA 1GAXA 3RAPR 4Q9JA 2NUTA 3THSA 2I66A 5HR5A 4I9FA 5F73A 2Z6AA 3RVLA 3HUDA 3H5AA 3NVDA 3VYRB 4PFQA 4MKGA 1QZ3A 2AC7A 1P72A 1I5RA 1ZN9A 2Z2YA 4LY6A 2Q8QA 1XDGA 3KKQA 1P77A 4PNZA 4WTOA 1YR3A 2OY0A 1FSZA 1FQWA 1Q83A 4NBLA 2Y71A 1SXPA 4F2PA 3MW8A 4Q7KA 3DMNA 3RRBA 3RRNA 4BWFB 2GASA 2HCRA 4BLOA 3QE4A 4M0FA 1JR3D 1IPHA 1USIA 2FWIA 3IX7A 2OILA 3W6NA 1JZSA 4B85A 4KVAA 3UK2A 1SHJA 3Q3VA 3TD2A 1P4JA 3Q3HA 4IEEA 3AUJB 3C3AA 1EX6A 1IRXA 3U7FB 2Q5EA 4EJFA 3F6YA 4G5RA 3P4UA 3IKJA 3WISA 5FOQA 1KRXA 2IHTA 3UPDA 5LUAA 4FZVA 4S2UA 1QH8A 3DBLA 1CJTC 1F0KA 4LZOA 4Z3DA 1PK7A 4TTJA 3ZPXA 2F3SA 2R5NA 5DM2A 1R4ZA 1EQ2A 2IGBA 3F2IA 4OPMA 1ZKMA 4RTJA 1KRWA 5MFPA 1R6UA 3WBJA 4TWRA 3PNQA 2VEOA 2XDYA 3CZRA 1AGXA 3CLRC 1CR2A 2GXQA 3E2PA 4R31A 4B2YA 3I12A 3ZWMA 2CB0A 4EMUA 3I9V6 4B6GA 3KQMA 5JC1A 3Q11A 3CNEA 3DC2A 3RABA 3T9EA 2VVTA 4M0CA 3GGCA 1PUXA 2AN1A 3U6BA 3K6KA 1QU3A 4L6AA 1EGHA 1DCKA 2FLKA 2DFLA 3PKIA 4I9HA 4PBRA 3B38A 3UEOA 1MQAA 5KTOA 1TA9A 4ZODA 3AY6A 1K06A 3JQRA 3OIWA 1RKVA 2VHZA 2VYNA 3BORA 2AUTA 4GWKA 2H0AA 4B3IA 3ZHVA 2E55A 2GN6A 4BKRA 4RXUA 3P9PA 4RETA 3KQWA 3L0IB 3NP9A 1N7IA 3HA3A 3JY6A 1YVEI 3A9CA 4GEGA 1JAZA 4L57A 1E2NA 4GPEA 4MWTA 3HKEB 4YJ2B 3G1TA 1OV4A 2WHPA 1F1JA 3T1VA 4BYMA 4YMTA 4YCNA 5DHRA 4Y1RB 1KZGB 4C03A 2GSDA 4IDHA 4PGFA 4BTEA 1F8UA 1L9XA 3H7IA 4ZVMA 3CZAA 4P53A 2PT5A 1P9OA 2PYDA 3NX4A 4BXOB 4KR2A 1AA9A 3FKJA 1UKAA 3GCGA 4LFAB 1CYDA 3VZPA 2VSNA 3FSGA 4XW2A 3STVA 2G9ZA 4Z9XA 1ORWA 3MVEA 4ARSA 1JE0A 2ASEA 5CDUA 1PVVA 3RANA 4YEDA 3VYUB 3D5EA 4Q3NA 2NXNA 3UHAA 3UPTA 2WU8A 4L4RA 5E6RA 3KB1A 5J5AA 4BBAA 4RHEA 1P73A 1OXSC 2EARA 2YH2A 4BEWA 2JLVA 3EZFA 5ALQA 4LF9B 1CJKC 2B8JA 2BRUA 3MWFA 4A2CA 1O97C 1LSJA 3HU2A 4EQ6A 3EZYA 4HDCA 5JAOA 1CUZA 5BNIA 1XX6A 3UHPA 2IU3A 4KITB 1HLPA 1LI5A 1QJ4A 3A9VA 3KYJB 2AOTA 4XYMA 4D8YA 4EAAA 2WYWA 2NT3A 4GKBA 3WQRA 5AM2A 1SUPA 3REQB 1G5TA 4RELA 3L3BA 4DM4A 3LZDA 5A4AA 1U7XA 2RHJA 4Y6SA 4AQYB 4KK3A 2ZTHA 5IMSA 3E9DA 3FRIA 1S2IA 2GOYA 4NHOA 4YCAA 3V8VA 4FYXA 3VSCA 2P9YA 5EYPB 4I50A 2W6OA 4OFXA 3VO2A 4ZZ0A 1KJJA 1DJLA 1VPDA 3DZCA 4IIVA 4AS1A 2GVDC 3DTVB 2MSKA 1RE0A 1AKMA 1BXKA 2C9CA 1NPDA 5JW6A 2JEYA 3W2EA 4GO1A 4U2CA 3WL5A 1HYQA 1HXHA 1FBNA 4NE7A 1UBLS 2BI4A 1I1QB 3PQ6A 5ALXA 1RPTA 5TQ2B 3SAJA 5JBQA 1SKQA 3WMWA 3I8XA 5KMGB 4A2PA 1WJGA 2ZJ3A 2H0QA 4AULA 1I4TD 2H48A 3OIUA 1FFXA 3VX3A 5ADUS 4DV5B 4NFSA 3P94A 2PZEA 3FDIA 2A9JA 2GDJA 5IX8A 1L4UA 2J41A 3HUUA 1CVIA 2G4LA 1KKUA