2ZB3A

Crystal structure of mouse 15-ketoprostaglandin delta-13-reductase in complex with nadph
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
345
structure length
345
Chain Sequence
IIQRVVLNSRPGKNGNTVAENFRVEEFSLPDALNEGQVQVRTLYLSVDPYMRCKMNEDTGTDYLAPWQLAQVADGGGIGVVEESKHQKLTKGDFVTSFYWPWQTKAILDGNGLEKVDPQLVDGHLSYFLGAIGMPGLTSLIGVQEKGHISAGSNQTMVVSGAAGACGSLAGQIGHLLGCSRVVGICGTQEKCLFLTSELGFDAAVNYKTGNVAEQLREACPGGVDVYFDNVGGDISNAVISQMNENSHIILCGQISQYSNDVPYPPPLPPAVEAIRKERNITRERFTVLNYKDKFEPGILQLSQWFKEGKLKVKETMAKGLENMGVAFQSMMTGGNVGKQIVCIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for catalytic and inhibitory mechanisms of human prostaglandin reductase PTGR2.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
molecule keywords Prostaglandin reductase 2
total genus 120
structure length 345
sequence length 345
ec nomenclature ec 1.3.1.48: 15-oxoprostaglandin 13-reductase.
pdb deposition date 2007-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF16884 ADH_N_2 N-terminal domain of oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2zb3A02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2zb3A01
4R3NA 1GTMA 2O3RA 3ZWMA 2GN9A 1HRDA 4D0RA 1JTVA 1NWHA 4YXFA 4YJFB 4MP8A 3M2PA 5K1SA 3H8VA 5KCZA 5B4TA 3LT2A 4YT8A 4RVDA 1QRRA 3RUEA 1ULSA 2OOSA 1EK5A 2RH4A 2ZK7A 5I7FA 5JMWA 4FOOA 1U3VA 3KZVA 4PG8A 1EUZA 1SZJG 2WYUA 5TGDA 1BRMA 3M6IA 4YAIA 2NU6A 4FFMA 5DCYA 3ZU5A 1E3IA 4FPXA 4KWIA 4QX6A 4XD2A 4HNHA 4QFDA 1NVTA 4Y67A 1LRLA 5BSEA 5B1YA 4W99A 4MKZA 5KKAA 3DAGA 3MWDB 4YCAA 3SJ7A 2F00A 3WFIA 4JX8A 3ZWAA 3RFVA 2PD3A 4FJ2A 3BHJA 4ND1A 2IYPA 4DPMA 4RDIA 2QRLA 3QWAA 1R12A 1P74A 1FDTA 1U4SA 2C20A 4E2WA 1R4NA 3F4BA 4WLUA 1YJ8A 1GPJA 3GRPA 2WWRA 2HRZA 2V7PA 4J1SA 5IG2A 5JAIA 1RYEA 1AHHA 1PJQA 2J3HA 1IHYA 3CH6A 1JKFA 3AY6A 4K26A 4CQMD 1LDGA 3ZWNA 2VWHA 3W8DA 4ALMA 3ZWYA 3HDHA 4AJOA 3I83A 4P22A 1E6WA 4CQMA 3NDIA 3JQAB 3G1UA 4RPGA 1ORRA 2P4HX 3D0OA 1PQWA 3M1AA 3RBVA 3RU7A 1CF2O 4CL8A 1LDEA 1YQGA 3OJEA 4GAEA 3B6ZA 3HJAA 2QYSA 1B7GO 1FDWA 2A92A 2YV2A 3PHLA 4R54A 3ZWOA 1LUAA 4I5EA 1P1JA 1PZFA 1QXSA 2GSDA 4YT4A 3GR6A 1PGOA 4E5YA 3HDJA 4FR5A 5EESA 4R16A 5TC4A 1DIRA 1SB9A 1VLLA 1IPFA 4ALJA 2GDZA 5DZSA 1L1FA 5K0ZA 1A7AA 4PG4A 2DTEA 3V1TC 1OZAA 3O9ZA 4BMVA 3D4NA 5JAQA 1V35A 4MDHA 4IM7A 2C7VA 3DTYA 4RORA 5CHEA 2BFMA 5LDGA 5ILOA 1KEUA 3DBHB 3AU8A 2A4KA 1UH5A 1GZ4A 4IMPA 1GV1A 3HB5X 3PZRA 4FW8A 3WGHA 1ZZEA 4A73A 2GUGA 4D42A 5GMOA 3CPSA 2P4QA 2X8LA 3WLEA 2I5PO 4A7PA 1P1RA 2WD7A 2A94A 3OMLA 4BL5A 1T1SA 4E2YA 1NQOA 1NXQA 2PWZA 3ZN2A 3UUWA 1LSUA 3DBLA 3QRWA 4NDNE 3DZBA 2BFOA 4HFJA 1YOVA 3TPCA 1IHXA 4YAEA 1Q1NA 5HTOA 3VC7A 4MJLA 1XYGA 1F8GA 4YEDA 4ALIA 4GKVA 1EFLA 1EDOA 1NASA 3N58A 5L9AA 3RIHA 4DQXA 4I5DA 4Z3DA 3RAJA 3MZ0A 4CMEC 1Y6JA 3ICPA 4IS2A 4GX5A 3K5PA 4I08A 3ZWVA 4CMHA 4PG5A 1X0VA 4AFNA 3AI2A 5L95A 2UYYA 3F1KA 4OSPA 3IC5A 1OI7A 1Y8QB 5JDIA 1YQXA 1HL3A 1ADCA 1E6EA 1T2FA 1XA0A 2JHFA 4XIJA 4D0SA 3RU9A 1SB8A 3I9OA 4L76A 3RC7A 3BHIA 2UUOA 3JQ9A 4YTEA 3UVEA 1PJBA 4M8SA 3ZDFA 3PWZA 4OL9A 1H2HA 4PZDA 1PTJA 3T4XA 4QT0A 4PLPA 1KETA 2NQ8A 3D3EA 5F5NA 1D4FA 3MWEB 2P2SA 3C3XA 4KQWA 1XIVA 2OFPA 3H7AA 4CLHA 5EIOA 3C7DB 4Y9DA 2CVOA 4XWYA 5HM8A 3PLRA 3WYEA 3EW7A 3DMTA 2G17A 1D1TA 3RWBA 4ZQHA 1GAEO 2ZCUA 2X22A 2GNAA 3TWOA 4MVJD 5L7TA 4CMKA 3PTZA 2QYTA 5ENVA 1CETA 3GMDA 5BNTA 4E6PA 4BNUA 3OJFA 3OSUA 1NQAO 4HBGA 4CQMB 2GERA 3O8QB 3PI7A 1I5RA 5DP1A 1A4IA 1N1GA 3JQBC 4D3SA 1ENPA 1H93A 2J3KA 4RLSA 1MG0A 4DYDA 1E7QA 1ZMTA 3V8BA 4MVJF 5DBFA 5IF3A 3E03A 3GZNA 2VUUA 4OXNA 2NVUB 5DOVA 3NGXA 1VKNA 1C0LA 5HWSA 3GNSA 1MGOA 3KXDA 3GVXA 4H15A 6ADHA 4XIYA 2PZKA 1NM5A 1V3VA 3UFXA 2HJSA 1E1NA 5T8KA 3VOSA 4CUKA 5C7OO 1GYRA 4CLOB 2BMAA 4CM9A 4B79A 2CUKA 2IYOA 1E3EA 2W2KA 4BKPA 3K30A 4YJDA 4XGKA 1B2LA 1YS4A 1KY4A 4MIYA 7ADHA 1I3NA 4BKQA 1XGKA 4GI2A 4NU5A 3DZJA 1FDSA 5A5EA 1RWBA 3F4LA 1I24A 2B36A 4Q9NA 3B1FA 4NH4A 4AICA 4C7KA 2Q1UA 4C7JA 2AE1A 3QVWA 2JCVA 2Y0CA 3UKOA 4Q3EA 2HAEA 1CDOA 3WOHA 5BSHA 5TLSA 3EMKA 3GH3A 5KWEA 3G49A 1ZW1A 4BGIA 5A9SA 1IZ9A 2O48X 3EZYA 3H3JA 3E48A 3OM9A 3JQEA 4UUPA 1JWBB 4CMAA 5CEJA 2Q1SA 4TMFA 2YQ4A 1Z7BA 2Y1OA 2HMUA 1U3UA 4NR0A 1GZ6A 2Z95A 5HS6A 4BNTA 2ZB4A 1BMDA 3WSWA 1Z73A 4ZQFA 3WQQA 4LMRA 4U7WA 3KSZO 4FBGA 4AJ2A 4KOAA 1ADBA 4OAQA 2PTGA 3O4RA 1P1FA 4OSOA 5L45A 1EBUA 2BI8A 4OH1A 4EGFA 4PN3A 1NTOA 4B7XA 1G1AA 4W7HA 2EKQA 1T25A 3BIOA 3FNFA 1AXEA 1NX6A 3ANNA 4WUVA 3GDOA 3LF1A 3ZWWA 4JLWA 2OXIA 4WLFA 4BNXA 1OC4A 1DC6A 2QQ5A 4M1QA 5T6BA 3TSCA 4BNLA 3MJCA 1ONOA 4Y6SA 2PD6A 4OJNA 1T26A 3NT2A 3H9EO 4B3JA 4WOJA 4R69A 4WCDA 3G17A 2X0JA 2B35A 1V3TA 5B4UA 2EKLA 1LBEA 2I66A 5K6AA 1BXKA 2HSDA 1R6DA 1ZJZA 2XPCA 3U3XA 2IXAA 4FFNA 4DL9A 2XAAA 5ICSA 1P1KA 3VTZA 4O1MA 1JLLA 4D45A 2X4GA 4BGEA 5IZ4A 3KLMX 3QQPA 4FOSA 3HG7A 1R4NB 3V1UA 3C24A 4N7RA 4DA9A 3WTBA 3AK4A 5DN9A 4FCCA 4GSLA 4PG7A 3I5MA 2G82A 3KETA 1R15A 1PS8A 4TVBA 3DHYA 4BB5A 4XYMA 1E7YA 3QP9A 2Y66A 4QO8A 1C1XB 1PJCA 1Z82A 3DOCA 3WQRA 1NBOA 1Y9EA 2FZEA 3QA9A 3JQAA 4WKGA 5JNLA 3CMMA 4HUJA 1B15A 5TT1A 4Y6RA 3WNQA 2J6IA 1G0NA 1J6UA 2OBNA 4CM8B 3KSDO 1DB3A 1YRLA 2E82A 4G65A 3BA1A 1UDBA 3A1NA 3O26A 2I3AA 3GZNB 1EUDA 2NVUA 4HXYA 3Q3CA 5G2OA 2BF7A 4AJHA 3UICA 1R0KA 3GEMA 4MKXA 4BV9A 4AJNA 5JCJA 4Q3AA 1E7RA 2LDXA 2SCUA 2XXBA 4ZQEA 5IDQA 2WD8A 3HE3A 4K1LA 1A27A 1SAYA 2ZKLA 3FPLA 3EDMA 1CJCA 1I10A 3DB2A 3C1OA 3GAFA 5T5QA 3IKVA 3FBGA 3NUGA 3NTOA 4B7CA 3NTQA 3HHPA 4UVIA 1HZJA 4URFA 3UHAA 4BO6A 2NACA 3AY3A 2NVBA 1W4ZA 3ZU3A 1KVQA 3JSAA 1TXGA 2ZTLA 4HKTA 5JYDA 1N92A 2WD7B 1U4OA 1Y5MA 1TT7A 2BD0A 2CVQA 3GDGA 4IGFA 3HN2A 3LVFO 3NDRA 5JO0A 2PLAA 3W8FA 4LRSB 3ZHXA 2OUIA 5GZ6A 4XYLA 1GYQA 2V6GA 3DHNA 3F47A 4O59O 4J91A 1BVUA 4E31A 2B4TO 5LDHA 2V6FA 3CSDA 3E5MA 3GUCA 1PJ2A 2VQ3A 2Y67A 4P4GA 4TQGA 1E1MA 2G1UA 5AXAA 2Q50A 3FN4A 3FNGA 1H6AA 4XB2A 4JXKA 1BSVA 1ZBQA 2CVZA 3LQFA 1BXZA 3ZGYA 4DLLA 1NHGA 3BYZA 1EE2A 1WNTA 4BO5A 2VWGA 3EHEA 4IXTA 5EN4A 2HLPA 3EZLA 1DC3A 3UCXA 5HA5A 2GN8A 3CIFA 3OBBA 1YXMA 3QIVA 1Q0HA 4LVCA 1QYDA 3FBTA 4XR9A 4ROSA 2ZQYA 1DFHA 3PGXA 3PHHA 3DR3A 2BGLA 5T64A 4MIOA 4YB8A 4A0SA 5HRUA 2DM6A 1YL7A 4ZHSA 5CDGA 4R01A 1I2CA 1Z75A 4RCVA 4TRRA 3U4CA 4Z6KA 2VYVD 4F45A 1IE3A 5DNAA 1YGYA 3AUSA 4XGIA 4YBZA 4CR7A 5IFLA 3ASVA 2IODA 1JN0A 3PHGA 2ZATA 3A06A 3IKTA 2Y05A 3NX4A 5TJ9A 5JCXA 4BO2A 3TZKA 3ASUA 5A03A 2WJPA 2X9GA 4MOWA 3H4VA 2AA3A 1CYDA 4Q3BA 1VJ1A 1PJSA 3ON5A 2HK8A 2Q99A 2EIHA 4L8VA 1V9LA 1HYEA 3DBRB 4YRBA 3OQBA 1Z7EA 4II2A 3P2YA 4BNIA 3JQGA 5JXWA 1F17A 4GGPA 4IINA 1QSGA 3INGA 2ZQZA 1TI7A 4R68A 4ESOA 2FPPA 2ZB8A 3DFZA 1WWKA 3HUDA 2YUTA 3WIEA 2Q49A 4CUZA 4EJ0A 4BNWA 3JCZA 3QV1A 1HSOA 1Q7BA 1K6XA 3WGOA 1V0JA 2RIRA 5FI3A 4UULA 5KVQA 5I7VA 5ILGA 1JKJA 4DMLA 1DSSG 2GLXA 2JCXA 3PYLA 4B8ZA 4R3WA 4W82A 1AHIA 4XA8A 2YDYA 3AM5A 5KJCA 4TZKA 4XQCA 4LISA 1GQ2A 2OZPA 3AUUA 1S6YA 2Y0DA 5T67A 2AQ8A 3KYCA 3QHAA 3GHYA 1QYVA 1A9YA 3GZ4A 1SCUA 1WMAA 2ET6A 4DIBA 4BQPA 3PYXA 2O7QA 1R0SA 4ND2A 4NBUA 2J3IA 4XQ9A 4ZQGA 4FFPA 5KVCA 3H6KA 4OKNA 4B4OA 5ITWA 4CUJA 2JHGA 3Q9NA 4RVSA 1DBVO 3PGJA 3C1AA 1MXFA 3ZV5A 3FD8A 5BQFA 1UXIA 5KJFA 2YFQA 3ETGA 4GWKA 3AM3A 5F1OA 1KEPA 3U4DA 3VVCA 1R37A 2Q1WA 3D1LA 9LDBA 3PFFA 5A3VA 2C59A 4K6FA 3C8MA 4KTVE 4PGFA 4RVGA 3L6OO 2ZIZA 1PS9A 3WWYA 3GAZA 3GC6A 4RF2A 3ZV6A 4EJMA 1PL6A 5JSFA 3L6EA 1KS9A 4ALLA 3JD1A 3BXXA 4XZ3A 3L0DA 4BKUA 4E21A 3AOEC 4CM4B 4J7XA 3DQPA 1ISIA 5KKCA 4MVJE 1LXCA 4RPJA 5JS6A 1KC1A 4CM7A 5FWNA 3INTA 3K31A 3ONFA 3FTNA 1K6JA 1N2SA 3P7MA 3QSGA 4KDEA 3DAPA 3RJ5A 4RJTA 3JYOA 5COBA 1MLDA 1PZGA 1J0XO 4IZIA 4MVJA 3WS7A 1VL0A 2HQ1A 3ONEA 1O0SA 4TZTA 1ENYA 2J8ZA 3GQVA 4HADA 4PLVA 1NPYA 1VSVA 1NYTA 3QW2A 1M6WA 1T2EA 3GG9A 1LNQA 4HV4A 1O9BA 2POQX 4HFRA 1GEGA 3AY7A 4UAGA 4UEOA 1X15A 2DBQA 1ISMA 2QG4A 1R0LA 1ZK1A 3AU9A 4PLYA 4U5QA 4W4TA 3DBVO 3HB4X 4B4UA 1LLQA 4AJIA 5H81A 3KEOA 1K89A 2JL1A 2H6EA 4Q3DA 4CMIB 3INRA 3GRKA 3Q2IA 4J90A 3L4BA 4XJTA 1H6BA 3KYBA 4CM3A 3V2GA 1YQDA 1NFRA 5AXCA 1FF9A 1CIVA 3S2GA 1YO6A 5C7LO 2YYYA 3DAFA 4BGVA 1U3TA 3VH3A 3E9QA 3WMWA 5DULA 1DOHA 5L4LA 2W8ZA 2YV1A 1QG6A 3H5RA 3OF2A 3IIEA 3K9QO 4J0FA 5TS3A 4I9NA 4E2ZA 4LGVA 5B4VA 3PIDA 3BMOB 3AOGA 3A4VA 4FC6A 2BHLA 4CMBA 1DIHA 1H0KA 1NFQA 4PRLA 4WNIA 4YJGA 3NEPX 4RQTA 2R00C 1U8XX 3H9UA 1UXJA 5DDIP 3HFGA 3I3OA 1EBFA 3V5NA 4HFMA 4WCFB 3D5QA 1E3JA 4J4BA 1NQTA 3PVZA 1U5AA 4DPLA 3COSA 5A02A 3IUSA 1HE2A 3F3SA 1PR9A 1DAPA 2E49A 4RF4A 5BSFA 3UW3A 4M55A 3OICA 4G2NA 2GD1O 3PIIA 5A5FA 3NDJA 2EV9A 2DUWA 3PK0A 3JD2A 1KC3A 3R6DA 2E6UX 2VT3A 5BT9A 4XKJA 3ETDA 5A06A 3K8ZA 4RF5A 1E3LA 1GZ3A 2D4AA 4BOYA 3UN1A 3ZHZA 3BTSA 1UXGA 4JQCA 2GN6A 2UV8A 3Q9UA 2D1YA 4XDYA 2YDXA 1G6KA 5A04A 5IN4A 3SX2A 3E18A 4CM9D 4NU6A 4EDFA 5CPFA 5ITVA 3RSHA 4CM8A 3ORFA 2VZ9A 1B8PA 2NLOA 2AHRA 2Y1DA 1H5QA 3VZRA 2IZ0A 3S1LA 1KEVA 1GY8A 3K6JA 2VRCA 3GN1A 2EGHA 4IQGA 3B20A 1KVTA 3ROQA 3IMFA 3I9LA 4QXMA 3LF2A 4JBIA 3TFOA 1F06A 2PKQP 1O95A 4OIMA 2GN4A 2HKIA 4CM1A 1MV8A 2V65A 4IIVA 3KUXA 2EERA 4N5MA 1SEPA 4J4HA 4QECA 1YDEA 3FNEA 2LDBA 2OORA 1SMKA 4R51A 3UGKA 4PLGA 3JTMA 4KUGA 3VPFA 3ZNOA 4F3YA 3T7CA 1T2DA 3FPCA 5TSDA 4BNYA 4TSKA 1OAAA 4NI5A 1CEQA 4FIZA 3FTPA 4J9UE 2WDZA 4JK3A 1PGQA 3HZZA 2R2GA 3L77A 1E6UA 3F6YA 1LSOA 3LSYA 4KP7A 4KQXA 3PJFA 4GLLA 5JY6A 2ZYGA 3R1IA 4YJHB 2B0JA 3OECA 4WEOA 5A9TA 4LRTB 3PXXA 2O7SA 4FDAA 1ZCJA 3DMYA 4J3FA 3LYLA 4J9VA 1FJHA 3WGQA 2DFVA 3QVTA 4CL3A 2O23A 3K2BA 3KVOA 3DZIA 2C5AA 2O3QA 3H5NA 3MEQA 2P9EA 1DLIA 3D3WB 3I6QA 4TRNA 4CMCA 2YJZA 2GZ2A 1JQBA 1V8BA 2Q2VA 5B37A 2H63A 2G0TA 2RH8A 3NKLA 5DF1A 1UZMA 2Q1TA 1N7HA 3GFBA 1GUZA 4UUMA 2DQ4A 5KJ1A 5JDIC 5COQA 4XQGA 1ZSNA 4YJFA 5HS4A 3C1TA 1HEUA 5CDYA 3RUDA 1Y5RA 4BIIA 5JYEA 2VHZA 4ALNA 3UCFA 3ROMA 2BFPA 4TROA 2TMDA 3QWBA 1T4DA 4GPD1 2JCYA 3A14A 3QY9A 2C2XA 1J5PA 1VM6A 4FJ1A 4EUFA 2CZCA 2GO1A 4RPHA 4PRKA 1E1KA 3BMCB 1PSDA 5J23A 4MVJG 4AG3A 4WCFA 1ONNA 1N1EA 1ENOA 2OO5A 3WX0A 1MB4A 1XG5A 4IUYA 3W8EA 4FFLA 4GX0A 2P9GA 3OEWA 3ROPA 3OIFA 4YPOA 1ARZA 4ZJUA 3STHA 4OGWA 3S55A 3GA0A 3GVPA 3KYCB 5ER9A 3PDUA 1EZ4A 3K2EA 4WGGA 3M1LA 3UXYA 1IPEA 5G0UA 2QHXA 4KDFA 4GKBA 3SXPA 2CMDA 4NJMA 4MINA 4YT2A 4XX0A 2A35A 4BO3A 2NUAA 4TRJA 1ML3A 4J7UA 3GF4A 3PFWO 1KVRA 2Y1GA 2EG9A 3F1LA 3VAZA 1I33A 3WJAA 2EXXA 2X0RA 4H16A 1UUFA 4GL4A 4Q39A 1YH3A 2AQIA 1PGNA 1SO8A 5DBIA 3GG2A 3H3FA 1N9GA 1LLCA 4YAJA 4CQLA 4D43A 3R0IA 4BO4A 4TWRA 1DAOA 4K28A 3RJ9A 2Y93A 4UVGA 1D1SA 3LK7A 1J49A 5G0VA 3LU1A 1M76A 2HMWA 3VZSA 3JQFC 2CDCA 4EI2A 2X9NA 5EERA 4IJVA 2BELA 3ZHBA 4ZD6A 4R41A 3NJ4A 4WCFC 1ISGA 3P5SA 4YAGA 1N7GA 3PJGA 1X7HA 1E7MA 4U6QA 5I9MA 3TDKA 1MXHA 1H6DA 3O03A 1P0FA 4EBFA 1NNUA 1P9LA 3QE3A 2DBRA 1ISJA 1N5DA 1U28A 2ZYAA 2ZTMA 3AI3A 4KTTE 4UVEA 3ZH2A 3W4JA 1ZFNA 2VTDA 3ZWBA 2DUUA 2BLLA 1XEAA 1I36A 1R4MB 2X58A 4J2HA 1KIFA 5JMPA 1V6AA 2YHIA 3OQ1A 3S2FA 2WM3A 1CWUA 4FGSA 5BR7A 5I7EA 3FNHA 1HYHA 3RC2A 1CQJA 4MP6A 2EW2A 1LX6A 1P0CA 1X0XA 3G0OA 1B16A 1HWYA 5JAZA 3RFXA 1ID1A 2QW8A 1MC4A 4N54A 5EJ2A 3WTCA 3MOIA 4XCVA 4EITA 1DIBA 4BO1A 4WASA 1A5ZA 2RCYA 2C0CA 3VHRA 4A03A 1HE5A 3D4PA 1PGJA 3GT0A 4I9HA 2VTEA 3TRIA 5COAA 3DZGA 1DHRA 2GYYA 2VRCD 1ADGA 4PZEA 1ZXLA 3H9QA 2EWMA 4HY3A 2I67A 2Q3EA 4YYZA 3OJOA 5THQA 5EL0A 4BO0A 3AUAA 3MCVA 4MVJM 2O4UX 5DCWA 1VE9A 3HN7A 3S8MA 5CDSA 3U5TA 3L9WA 1WLYA 3FF4A 4JBGA 3FHLA 1Z74A 3CXRA 1K6IA 1U8FO 1YKFA 4ND5A 4YRDA 3VH2A 4UREA 1ZVMA 5IXYA 1VJ0A 1NFFA 2J5KA 3CE6A 1QMGA 4IPTA 1H9BA 1LDYA 1B14A 1BDMA 2QZ9A 5ADHA 1MUUA 1JVSA 2BH9A 1A9ZA 4BKOA 2D0IA 4BS9A 3D64A 4E12A 3C7CB 4BO8A 3O38A 5T8KC 4RVUA 2IEDA 3T7EA 3VKUA 3VTFA 2VHYA 4NFSA 2NQTA 2XF8A 4D44A 9LDTA 5L4NA 4RGBA 3MTGA 2YQ5A 4FFRA 4XYBA 3KYDA 4J0EA 4N5NA 3ETEA 3IJPA 4KUEA 4EW6A 1P44A 5L7WA 3ANMA 2PKQO 1PS0A 3PEFA 1R16A 4U0KA 5IZCA 3TFQA 2D3TA 5CPBA 3S2IA 4CM6A 2JFFA 4ZRNA 2NTVA 3PP8A 4NFYA 3JQBA 4BNNA 3EYWA 1T24A 2PZLA 3IS3A 4JN6B 2O2SA 3ZU4A 4ND3A 1DC5A 1CERA 1MX3A 3TL2A 2UUPA 3OETA 1VSUA 1I2ZA 4R5MA 4PLFA 2DKNA 3WYCA 3VH4A 5FF9A 4OHUA 3NRCA 1VI2A 3VZPA 1TVEA 4WLVA 5L51A 3GVCA 2I65A 3AWDA 5IN5A 4Q3NA 1QYXA 2Y1FA 1MP0A 2HK7A 5IZCC 3RUIA 2C5EA 4P4NA 4Z9FA 1UP7A 2X5JO 4D3DA 1GQQA 3GEGA 3PPIA 1NR1A 2NSDA 4FD3A 4N18A 4DVJA 3TZQA 1AE1A 3WR5A 4DQVA 4Z9YA 4CV3A 2WMDA 4MVJH 4AVYA 1A71A 1O89A 2WE7A 3Q11A 4BQRA 1YONA 4S3MA 1B8UA 3JD0A 5JC8A 1SEVA 5IDYA 1UXHA 3RC1A 1GU7A 3CKYA 1HDRA 4RL6A 1XU9A 3E8XA 3JQ8A 4TRMA 2FR0A 4I9UA 5TT0A 1E3SA 4I1IA 4XEHA 2VWPA 4R1TA 5I8ZA 2PK3A 4CMGA 1FK8A 3JYPA 1JWAB 1D7OA 3BTUA 1EK6A 4ONEA 4QEDA 2FP4A 3ICCA 5DP2A 1GFSA 3UCEA 5EPOA 3JQDA 5AXDA 3KB6A 1UDCA 2Q2WA 2VOJA 1C14A 2YY7A 3I9NA 4DIOA 2NTNA 1VC2A 8ADHA 2H1SA 1YL6A 4ZICA 2EF1A 1XKQA 1O94A 2V6BA 4OM8A 3OH8A 4R5HA 4JJGA 2PD4A 4J6FA 4YJHA 1YE3A 3QVXA 1P3DA 4EUEA 1LRKA 1ZXBA 1DJQA 1ZKMA 4WEQA 2YW9A 3HQ4O 5U9CA 3H2ZA 4D41A 1KEWA 2FR1A 3F46A 1HSZA 3ZV3A 3ITDA 4J1NA 3NAQA 3DOOA 1XSEA 1AXGA 5F1PA 4DC0A 4R1UA 4W9NC 2NVWA 3JYQA 4I5GA 1YBAA 4JIGA 3QVSA 3I52A 1C0KA 1RM5A 1BXGB 5JFOA 1Y8RB 3EVNA 3ONDA 3V2UA 3ENNA 5F3RA 3KHUA 4INAA 3I9JA 3U09A 3PRJA 5G0SA 1ZMOA 3FI9A 1D8AA 2J5QA 2VNAA 2IEBA 4CLRA 2DBVO 4YVFA 3ZNPA 2Q4EA 3GPDG 3OQ6A 2NNLD 2FZWA 4I5FA 1PQUA 4Q3CA 2I76A 1ZK2A 2EJWA 2Z1MA 5TF4A 5JC1A 3B1KA 1VRWA 1V3UA 3BMQA 1UP4A 2C29D 3IL2A 2DTXA 2QRKA 3RBXA 2HU2A 4UVHA 1WDKA 3U4IA 3VDQA 1VPDA 4FJ0A 1GUYA 1WAMA 2VHVA 1GADO 2PKRA 3O8QA 1NAHA 3CUKA 5L40A 2O50A 2W90A 3ROKA 1YL5A 4RDHA 4BNVA 3C7AA 1I30A 4I8XA 2X5KO 5DCUA 4J1QA 3KO8A 3TOXA 1EQ2A 5CFZA 4JCOA 4GMGA 4NMHA 5JO9A 1P31A 2AXQA 3LZ6A 1GCUA 1LDMA 4JBHA 3JQ6A 3BTOA 4IDAA 3PWKA 2HMVA 2DPHA 4ZQBA 3RBZA 1DDOA 1DRWA 1LLDA 2D59A 3W6UA 4CM5A 4K9DA 1ENZA 3DL2A 4UEKA 1E1LA 3AJRA 2AEMA 1XR3A 5KVVA 4GWGA 1M75A 1BG6A 4R9SA 5I9NA 4MP3A 3OA2A 3GMSA 4IJUA 2JD2A 3ZHYA 3WBBA 1NVMB 1XELA 1RJWA 3V2HA 2Y1EA 1E5QA 3CINA 1DHTA 2O3TA 4J4TA 3LC1O 1JAXA 4CV0A 1NPTO 4A26A 4ALKA 3JYLA 5GZ1A 1KERA 1M67A 1QORA 1WXDA 3JQ7B 3WXBA 4NZ9A 3P19A 5GY7A 1MFZA 2CDAA 3WFJA 1PZEA 2VZ8A 1GD1O 3GN2A 5KTKA 1U2DA 3OFSA 1TT5A 1GR0A 1I3MA 5IJZA 3L9XA 3ZWCA 4RLHA 1SOWA 1TEHA 3HADA 5L3ZA 5IDWA 1U9JA 4Y8VA 1AN9A 1JKIA 1SNYA 4D79A 1YOVB 3HWRA 5T57A 2CD9A 2Q45A 2HRBA 1U3WA 2X1HA 1LTHR 1PJ4A 2HMTA 1DIAA 8LDHA 4ITUA 4O6VA 3X2FA 2E4AA 2FMUA 1D3AA 3LLSA 4GSKA 2ZJ0A 3KLPX 4BB6A 3ZCXA 1WW8A 2PGDA 1XQ6A 3RD5A 4BKRA 4DBZA 5CEEA 4NK5A 3EVTA 1WMBA 1Y7TA 4B4VA 4CODB 5DT9A 4OO3A 3E5RA 3GUYA 3BTVA 3LT0A 4DPKA 4E5NA 4CJXA 4YR9A 4CLEA 2JKVA 2OMEA 2G5CA 4XQEA 1JA9A 2X6TA 2WSBA 3KSUA 4WLNA 3PYMA 3HDQA 1HT0A 3JQ9C 3PLNA 2C2YA 4J49A 4CLXA 4BO7A 4L75A 3I1JA 3U9LA 3SBOA 1DFIA 4J16A 3VPSA 3FWZA 4MO2A 2IRWA 3RCBA 1QLJA 4M86A 3D7LA 3TOZA 3T4EA 1C0IA 1TA4A 3NV9A 1ZSVA 2A9FA 3EUWA 3DXFA 4J43A 1GDHA 3KOUA 3ENKA 4NG5A 4QO7A 4Z0HO 3DONA 4BHTA 1O6ZA 4EJ6A 2JFHA 2OP0A 2B83A 2VT2A 3NGLA 1BHSA 1JAYA 4P38A 3DOJA 2BGKA 4ILKA 2ZJ1A 4W7IA 1UAYA 3N7UA 4IDEA 4U0JA 3H65A 4A2CA 1P45A 1FXSA 3KYDB 1FDUA 4YDRA 1E92A 2EEZA 2FOIA 1PJLA 3PQEA 1DC4A 2OHXA 2HO5A 1IULA 4BNKA 4X54A 2I3GA 2CNBA 2UVDA 4E2XA 4II3A 1EUCA 1KVSA 4PVCA 4D3FA 1G0OA 2VUSA 4E5MA 1I8TA 3I23A 4BNMA 1P1IA 1GCOA 1HDYA 3GDFA 1RM4A 4TKMA 3TJRA 4E30A 3QJ5A 1UDAA 2ZTVA 2IXBA 3FR8A 3W1VA 1QYCA 5A4DA 3SJUA 2Z1NA 4XR4A 2Q46A 3OIDA 3WSVA 5CG1A 4W6ZA 4GVXA 5H82A 4RV9A 4E33A 1YB1A 4MVJP 5AVOA 4JROA 2W2KB 2NV6A 2PH3A 3DFUA 4GLOA 3WG9A 4F6LA 2J3JA 1R4MA 4J1TA 1KYQA 5FEUA 3SLKA 1T2CA 4WJZA 1ONPA 1M2WA 2CY0A 4R1NA 4DUPA 4Z3KA 3CZRA 1E7WA 4OYRA 1HDOA 4IIUA 3PZBA 3UH1A 1O8CA 2XXJA 4M54A 3PHIA 1B0AA 1DRUA 3DC2A 1C1DA 1DIGA 1EVIA 1HDCA 2D5AA 2P9CA 5CP8A 2AG5A 1YJQA 4WLEA 3GGPA 2HCTA 1Y8QA 2W2LD 3H2SA 1UJMA 4A5OA 5C5IA 1LSSA 3CZMA 4WE3A 4KWHA 4UUOA 1HLPA 3B70A 5JE8A 3WB9A 1DFGA 3IP3A 4ZN6A 2AQHA 3KBOA 4R9RA 4M89A 1Y9AA 2PV7A 2ZTUA 2VNSA 3WYBA 1XWFA 3RI3A 2VZ0A 1U5CA 4DLBA 2WEKA 2Y68A 3GOHA 3IP1A 2EGGA 1ZSYA 3GPIA 4OOFA 1ISFA 1QKIA 5KJ6A 2OGUA 1BTOA 1Y1PA 2EP7A 2VRBA 1PWXA 3BMNA 4XJSA 3DEYX 4CMJA 3HSKA 2OP1A 3CMCO 2VOEA 1DRVA 3KV3O 5HBRA 1F0YA 4L4RA 4LSWA 4BNJA 2W4QA 1NVGA 2VYND 3VPXA 3OIGA 4MIEA 4XRRA 1HDGO 1IY8A 4TKLA 3NJ8A 1KOLA 3VH1A 4PZCA 5BNFA 3ZW8A 4NPCA 1GUFA 1MA0A 1JVBA 3VPHA 4IJWA 5ES3A 3WIDA 4NFHA 2X23A 4PCVA 4BVAA 1EVJA 4IQ8A 1EDZA 1HKUA 4HFNA 1KY5A 4E13A 3DTTA 4H7PA 2X5OA 2VN8A 4WK6A 3ZWPA 1VJTA 2FR8A 4LK3A 4CMIA 4DGSA 4J7CA 4PLZA 1C1XA 3D4OA 1U7HA 4HX5A 3VKVA 4S1VA 5I7SA 3ULKA 4IDDA 4IQ0A 3W4IA 2QZZA 1E3WA 2XOXA 4L4SA 2FRDA 3RROA 1PEDA 3W6ZA 3EK2A 3M2TA 4IXWA 2JAPA 2VYVA 4GBJA 1ADFA 3LLVA 3F5QA 3TF5A 2PZMA 4DIFA 1PGPA 3IOYA 4NNJA 3MJ4A 4C4OA 2PH5A 4AJEA 1I2BA 4O5OA 2AG8A 4NBTA 2VUTA 3QWIA 1AGNA 3KRTA 4AJPA 1EMDA 3G79A 4NIMA 4EUHA 1KBZA 3BMOA 3WJ7A 5CG2A 4QFCA 3SLGA 5JCJD 4XYGA 3ZWXA 4CM4A 5MDHA 4HP8A 3TZ6A 1LDNA 1NPDA 3BMQB 2NADA 4CLDA 3WWZA 3I6IA 4IMRA 2DFDA 2D8AA 1NR7A 2PR2A 2Y0EA 4EZBA 3BHMA 1LA2A 4KZPA 1ZO8A 4PG6A 1GV0A 4WLOA 4LMPA 5K9ZA 1I0ZA 3TQHA 3I4FA 1C3VA 3WGGA 5JPIA 5LC1A 3RKUA 3SC6A 3ADPA 3QLJA 3GVIA 3L4SO 1WPQA 1J4AA 4LN1A 2AMFA 5EINA 2Q4BA 1T2AA 2HK9A 4UUNA 1QV6A 3A9WA 3DMTC 4ZA2A 5BSGA 1ZJYA 3ITKA 4D7AA 1W73A 1OBFO 3D5TA 3FR7A 3K73O 3PHJA 2Y99A 3SEFA 2ZYDA 2D2IA 2I9PA 1RM3A 1T4BA 5FI5A 2FHSA 1K2WA 4DYVA 4XRGA 1QR6A 1W6UA 3HNPA 1UP6A 5TNXA 2J5RA 5L53A 1MG5A 1BVRA 4NHEA 5G4KA 4HNGA 2AEJA 3Q6IA 2UAGA 2Z5LA 1N8KA 2ZB7A 2GASA 1DJNA 1MC5A 3TZCA 5GZ3A 4L0QA 5CEFA 1UAGA 4P8RA 4OQZA 5G0TA 3U62A 2B69A 3GNTA 3BAZA 5CDUA 2C54A 4BNHA 3RC9A 2RAFA 2ILTA 1LRJA 3RUHA 4RVFA 1GYPA 3BZUA 3ADOA 4Y98A 1TT5B 3FRJA 4YJGB 3Q0EA 1Q0QA 1X1TA 4EYEA 1X7GA 3R3JA 1LI4A 5FYDA 1YBVA 1E5LA 3VVBA 5ER6A 7MDHA 4GGOA 2YV3A 3U0BA 3TN7A 5A1TA 4LVUA 4BGUA 3JQFA 1EVZA 1QLHA 1UZLA 2GR9A 3GGOA 3L4BC 4BUCA 1H9AA 3G1TA 1U1IA 5F21A 4E4YA 5B12A 3WGIA 1PU2A 3EC7A 3KM0A 3EY4A 1JU9A 1ZK3A 1YWGO 1SBYA 2X86A 1YDWA 3FWNA 2FN7A 4GVLA 3E82A 5L4SA 2CSUA 3NT5A 3TNLA 3GGGA 4OQYA 5I9LA 3FCOA 5DOZA 2BRUA 3I4CA 1LJ8A 4BMSA 1FDVA 2YHUA 1OOEA 2BGMA 2GZ1A 3ANLA 1HETA 3EGOA 1F12A 3MJVA 4IDBA 3RUFA 1F14A 4AJKA 4UVDA 5ENDA 3IUPA 2HJRA 5H83A 1CRWG 4PIVA 1UR5A 1EE9A 4PLCA 3IAHA 4OOEA 1P77A 3L07A 3PQFA 1LQTA 4ZVVA 1HXHA 4AJLA 5AXBA 2F1KA 1PJ3A 5EQDA 3MJSA 1SPXA 2RHRA 2GPTA 1BW9A 2O3SA 3LC7O 4E3ZA 1W8DA 3L6DA 3ST7A 4RPKA 4RVHA 1A4UA 3I9MA 4R1SA 5JW6A 1QYWA 1YBMA 1SOVA 4ZU3A 3DBRA 4OKIA 3PWSA 3LT4A 4RF3A 1WZEA 2PNFA 2BKAA 2VWQA 4WOKA 4A10A 3B1JA 3ZI0A 3JD4A 1YVEI 1BGVA 2FPIA 4YACA 1LSJA 2FSSA 4CV1A 4BO9A 5TJHA 1H6CA 2JJYA 2DBZA 4XDZA 1XQ1A 3P2OA 2JAHA 1HF3A 3H5AA 2EHDA 4PLTA 1SC6A 1XHLA 2CFCA 4JJFA 1VL6A 3U49A 1ZK0A 1Q0LA 1B26A 3MJEA 2FPGA 4DREA 1S7CA 3RQSA 2B37A 1IYZA 3CEAA 4RPLA 5C3MA 4G5HA 1ZEMA 3WQSB 3KTDA 2O3JA 4E0BA 2B4QA 3S2EA 4U8GA 4B3HA 1AUPA 4FN4A 4NJOA 5TIIA 5C7IO 1ISHA 3WBFA 2IZZA 3DBHA 2P5YA 5MGBA 3RUAA 1HLDA 4F6CA 4W9NA 3UOGA 1PIWA 4PFJA 4B3IA 3Q1LA 2PA3A 1NP3A 5I8WA 2E48A 2EW8A 5K6AC 1O5IA 2GGSA 4L4XA 4RQUA 2RBEA 3WLFA 5THKA 2CDBA 2DVMA 4OXKA 4PLWA 1LU9A 4AJ1A 1KVUA 2HMSA 2B4RO 5A3JA 3EAGA 1F8FA 1K0UA 4AJ4A 2YZ7A 1WVGA 2O4CA 1BDBA 4E5PA 4P4LA 4MVJI 3DBLB 2HUNA 4BMNA 4E5KA 3GEDA 1PJTA 1JW9B 3R3SA 4ZGWA 1P33A 1E0DA 1TB4A 1OFGA 3GFGA 3GHHA 3NTRA 1UXKA 1X13A 4IZHA 3AW9A 5U1PA 1PL8A 1EEHA 1WDLA 3DO5A 4BNFA 4F46A 2X7HA 5EQFA 1IZ0A 3RASA 3PDJA 5DBGA 4AL4A 2H9IA 4YT5A 3WGYA 1WZIA 4IGEA 3RFTA 1T1RA 4XYEA 4OMUA 1PWZA 1PL7A 2X9VA 4HWKA 4B7UA 3QVOA 2NU9A 2IZ1A 5JDCC 2DC1A 2W98A 2NU7A 5JBIA 2WTBA 1IB6A 3BMNB 1ZK4A 2QIOA 5LCXA 4D46A 1A7KA 3UAGA 1HDXA 4JNKA 4DRYA 1PQPA 1YB4A 4DC1A 2OL4A 4L73A 4CMEA 3OEYA 1M66A 4E32A 1HE4A 4MKRA 1QV7A 4DLAA 4Z9XA 4J2OA 2GF2A 1ULUA 1NWCA 5KNLA 1DXYA 1XCBA 3BMCA 4M87A 4XGNA 5IAAA 1VKOA 2PGJA 3CTMA 3OHSX 1DEHA 2P5UA 1X1EA 4B4WA 3N74A 1OMOA 1PR3A 1DO8A 1OC2A 4JGBA 3WGTA 5AYVA 2G76A 3IQDB 5KJEA 4LW8A 2PFGA 3OP4A 1PX0A 3LC2O 4LSMA 4LCJA 2R6JA 3GNQA 3GVHA 3E1KA 2EJVA 3JV7A 1U2GA 4TVOA 4IS3A 4DMMA 2CF5A 2CF6A 2IE0A 4QQRA 4EEZA 3TZHA 2P68A 4JP3A 1M6HA 1A72A 5JY1A 1JDJA 4EEXA 1RYDA 5ICMA 1U7TA 3E9MA 4WNCA 3OJLA 1EFKA 1TLTA 4A27A 5KVSA 4CR8A 2GRAA 2DLDA 1ZEJA 1BWSA 3NT4A 4M49A 3FSRA 2JD0A 3SVTA 4WECA 1N9GB 2GCGA 1HZZA 3AI1A 3ZNQA 2NWQA 4FS3A 5AQ1A 1LEHA 2BFAA 2FWMX 3WNVA 2O3UA 3AFMA 4JP2A 4K6CA 4R4JA 1C0PA 1ZNQO 4GX2A 3DDNA 5G4LA 1K3TA 4FFOA 3JQ7A 3DZKA 4NBVA 3E6AA 3IDSA 3V1YA 3PJEA 1ZH8A 1WP4A 1X7DA 1Z45A 2NM0A 1XU7A 4DQUA 5G4KB 2VHXA 2H5LA 3WMXA 4U6SA 4PLHA 1WDMA 1RPNA 1Z6ZA 1LQUA 3F9IA 5FFFA 4WPGA 4ZRMA 4NK4A 5TX7A 4YRAA 2UDPA 1P1HA 3AFNA 5BNIA 2R00A 3G3EA 5C37A 1HYGA 4DXHA 1MFPA 1W0CA 4OXYA 4RZHA 2I6TA 4RZIA 3LDHA 2EP5A 2YHIB 2NU8A 1L7DA 4BNGA 3U4HA 2E37A 2IDZA 2WE8A 1DLJA 2DU8A 3H9GA 3AUTA 4KUHA 3MOGA 3QWFA 1RKXA 5IXSA 3PQDA 4DWVA 1B3RA 3JD3A 4XB1A 4IDCA 1H2BA 5U4QA 2C7GA 1X14A 5IDXA 3TL3A 2D5CA 3DZHA 4Z0PA 3ZNNA 2DAPA 1EVYA 5F1KA 1DPGA 1E3WB 2NTJA 2X0NA 3ZU2A 4GQAA 3RKRA 2VYNA 3K96A 4FC7A 3E9NA 2AE2A 4H3VA 1I3KA 3NYWA 3RVDA 1HE3A 2PZJA 2ZCVA 4L9RA 4O63O 1I32A 1QP8A 3GY0A 3VZQA 1EQUA 2X0IA 2HDHA 2YFHA 4YQYA 4IJKA 1IUKA 3MTJA 5G0WA 4GH5A 1GPDG 2GZ3A 1RM0A 3ZZNA 4GMFA 4MPDA 1I3LA 5A05A 4YAKA 4PVDA 2C07A 3X2EA 2QX7A 1Y81A 3JQGB 3QWHA 1CQIA 5JLAA 3F5SA 3Q2KA 3HFSA 5EMHA 4FB5A 2C82A 3GK3A 2RHCA 1LC0A 4CLOA 4O0LA 1NQ5A 1Q7CA 5CAEA 2I99A 3PJDA 3UF0A 2O2YA 4ND4A 2VCYA 3JQAD 4YWJA 3K92A 3VPGA 1NHWA 2Q2QA 4CLRB 2B5WA 1B3BA 2FSVA 2V6MA 3MJTA 4ID9A 4DTIA 4B8WA 2OBYA 2Y1CA 1GQYA 2JD1A 3HDYA 1VL8A 1E7SA 3VDRA 3OJ0A 5AOVA 2QRJA 3ZW9A 4IBOA 4YQZA 6LDHA 5A9SB 1LC3A 4L74A 4NBWA 4QUKA 2AW5A 1ZIDA 3DWFA 4BNZA 4QSMA 1XDWA 4KMSA 5CDTA 3AOEA 3LT1A 4RO0A 1XLTA 1R66A 4FQ8A 4CV2A 2DT5A 2WYVA 3WICA 4N5LA 3H9JA 1YB5A 3GLQA 2DPGA 1LDBA 2W2LA 4QTZA 4Z0TA 4JJIA 4BV8A 2AEFA 3WGZA 5JAMA 1GEEA 2B5VA 3I9KA 2PGLA 5F5LA 2FY8A 1GL3A 3ZV4A 1NAIA 5TQVA 1PZHA 3W4KA 1IOLA 3ABIA 2ZB3A 3RUCA 2DTDA 3DZFA 3KEQA 4IDGA 4FGWA 1Q2XA 1BW9B 4DBVO 3IJRA 1HTBA 1ZUD1 3DHEA 5TRTA 5KIAA 4NBRA 4Y6PA 3A28A 1C1DB 2TMGA 1BXGA 1E77A 2EKPA 3JQ8B 1Y8RA 4IY1A 1Q7GA 1FMCA 3C85A 4FSHA 4UEJA 4NQZA 4LCEA 4NJMB 1HDZA 2BI7A 3JYNA 4AJJA 1UZNA 3D3WA 3OA0A 2AQKA 4YA6A 5L7YA 4IDFA 3WDSA 2WYWA 2PY6A 3AM4A 3SC4A 4GX1A 4CR6A 1H94A 5A9RA 5KOIA 2JFGA 2P91A 1IL0A 1B8VA 1L7EA 2VHWA 4CPDA 5JDCA 1K5HA 4CQLB 1I01A 1LLUA 3JQCA 4G81A
chains in the Genus database with same CATH superfamily
5FJJA 1GTMA 3BJMA 4DLRA 3F6BX 1HRDA 2V3WA 3HGTA 2XDQA 3DTVD 4YXFA 2WIBA 5EZQA 5FWXA 2EATA 5K1SA 3H8VA 3B9BA 1CUSA 3U3ZA 1GNPA 4YT8A 1E5TA 1O96B 2QN6A 2H65A 3GUHA 4BFXA 5C8YB 1NNEA 3AHIA 2RH4A 4RA6B 1QQBA 1U3VA 4HLUA 4PG8A 5F4BA 2QE7D 1TGYA 2WSMA 3K32A 4IG9A 1QJCA 4TLMB 5FQOA 4YAIA 2NU6A 4FFMA 3GEEA 3EDRA 1RFLA 2H2IA 1OLSA 1Z63A 2B92A 3SOPA 4LY3A 4QFDA 3SBXA 3GLGA 1V3QE 2XZOA 1E8DA 5BSEA 4W99A 13PKA 1LF5A 2OE2A 1CLEA 4D9NA 1R6UA 2R6GA 1VSTA 3ABSB 2F00A 1ND6A 3MWDB 4YCAA 2YJ3A 3THOA 5EJFA 2XMRA 2IIVA 1BGWA 3LUBA 4I5IA 4MUMA 2JDIA 4RSGA 1NP7A 2QRLA 2BZ0A 3H2BA 3P9NA 4OGLA 3UGTA 4U6NA 4ZVNA 2XWJI 1TMGE 4Q3KA 4ZHQB 1FCJA 121PA 4Y3UA 1ESCA 3RV4A 5E2AA 3ZHRA 3OFKA 4E2WA 3CC8A 3V7UA 3I42A 1JDSA 5IG2A 1OH7A 3N2EA 1NF2A 4U63A 2Q5JA 3U3JA 2VJYA 1RYEA 1AHHA 2HR1A 3U7QA 2ZRQA 2HT1A 1WHSA 1IUPA 1HQCA 1JKFA 1F3LA 2XQGA 3CH6A 3HZOA 4LHWA 4U2GA 4K40A 3HK2A 5KSYA 2A1UA 1LDGA 2B8TA 1GVHA 3B7WA 1YCDA 4BMYA 1G17A 3JWIA 3L46A 3H2GA 3AEKB 1E6WA 3WOVA 1TECE 4CQMA 3V32A 4R9NA 4C06A 2R96A 4E51A 1L9KA 3Q7QA 4N9QA 1MJ5A 3CVXA 4RPGA 1ORRA 3K1ZA 2QTNA 3WLSA 3M1AA 1PCXA 4B6JA 3RU7A 1CF2O 4CL8A 4D3YA 2HWKA 2VTKA 5B6JA 2VT6A 3B6ZA 2P3SA 3ZE6A 4N76A 1B7GO 2V0NA 1T2UA 1I4EB 5K4GA 4B6QA 4R54A 1NUSA 2EBWA 1TC1A 1K6EA 1TL7C 1XL0A 2ZZKA 5CFOA 3FOWA 3O4HA 3PX2A 1GSOA 3BK1A 3HSYA 3GR6A 2HLDA 3VYTB 4YT4A 1BMFA 2B2XA 5EESA 1KZGB 1NJ1A 3GI1A 4R6WA 1RLJA 3NETA 1DJOA 3KAQA 4YV2A 1W30A 4CF5A 1SB9A 3Q4GA 4ER3A 5K0SA 3SE7A 4ALJA 2FPPB 2Q9AA 5DZSA 3U4MA 1L1FA 3DDHA 1A7AA 2FSIA 5JATA 1SFRA 1QMPA 4KSYA 3SYNA 4BMVA 2JH3A 4KAXA 2OYSA 1RYHA 1V35A 3A7DA 4MDHA 3G68A 1DXOA 1OWNA 2HZBA 4QXPA 2XTNA 3NG1A 5CHEA 2B4KA 3CEHA 1Y98A 2HHCA 3WLHA 3GH1A 4C0AC 3AU8A 3FUVA 3CO5A 3K9LA 3PD7A 4FNOA 3PZRA 5JSKA 4NXNB 5JJCA 1ZZEA 1YZHA 2GUGA 2W2XA 3NTUA 1BYUA 3R0VA 5GGXA 5AH0A 3T94A 5IFKA 3CPSA 2NGRA 1DT5A 1HFJA 1I2DA 3RB8A 1XJQA 3WLEA 3EXIA 4A7PA 1P1RA 1A69A 2WF7A 3I9V1 2XX3A 4F5WA 3PNKA 2GN1A 2QMZA 3TB6A 3MQ2A 2HXSA 4PWZA 1T1SA 5JSZB 1EU1A 3I5UA 5FBLB 1E18A 1KEEA 5K0TA 2RJNA 4E2YA 5P8WA 1NXQA 2CKDA 2XE7A 4OP1A 3NHSA 4RTJA 3HYCA 3T9DA 4XPZA 3TDNA 1LSUA 3DBLA 3QRWA 3NHPA 4G5RA 4HFJA 4IR7A 16PKA 4GZ3A 4MKHA 3IMGA 2OSVA 4NARA 4WN3A 5AQEA 3RANA 4F9TA 4JLBA 2ZLBA 1V1RA 1RSZA 4MJLA 4P4SB 1F8GA 4MYDA 4GKVA 5CXQA 4Z49A 3KKPA 5KNCA 1EFLA 2D1QA 1U0HC 1UK8A 1OI3A 2Z4TA 3ABRB 3Q72A 4DMGA 4G3XA 1MIOB 4Z3DA 3PL1A 4I2VA 4LGCA 3WAGA 1SXPA 1H3EA 2BR4A 4MVWA 1Y6JA 3ICPA 2QL6A 2X40A 2H52A 3UHAA 3WFZA 3JAKA 5LMCA 1QCYA 3AF2A 2R6R1 1EFDN 4KI0A 4AFNA 2NZYA 4ZCSA 5FOTA 3F1KA 5CVCA 3QVGA 4ZAFA 3IC5A 4MICA 2A9VA 1Y8QB 2BJWA 1YQXA 1ADCA 1C50A 1E6EA 3AQ4A 2VPIA 2SNIE 4QASA 4HQ0A 3BDAA 5DGXA 4EUNA 2R79A 3JQ9A 3UB3A 1PWYE 1RJ9A 4YTEA 1E5DA 1AQUA 2VLBA 4M8SA 1M73E 1KXJA 1I0IA 1H2HA 1PTJA 5FPYA 2V0CA 2ST1A 1TKRA 2XUPA 2NQ8A 3K3PA 4GT1A 2DECA 4FYXA 3DF7A 4PYMA 5AM3A 1VYHA 1XIVA 1NDHA 2J0VA 1Y6GA 3H7AA 4TUYA 2EVWX 3TTXA 2XRFA 2UVPA 4M9UA 4Q4DA 1UFVA 2I4NA 2J09A 3SR0A 4P7GA 3ENZA 4KO1S 5FPSA 5HIMA 5BN3B 4P3NA 2B1GA 1D1TA 3EA4A 4W63A 3N70A 3LBYA 3H11B 3RWBA 2NPIA 2QN9A 2EAUA 4C0BA 3BL5A 4MWEA 4RC9A 1AKUA 1EFCA 1Q14A 3TIVA 4JX9A 1KEZA 4NBLA 5IDVA 3WLRA 2ZR0A 1GQOA 2VHQA 3OCWA 4I8DA 4UDYX 5L7TA 2BDEA 2QYTA 2R8XA 1CETA 5ENVA 4E07A 3AVWA 1T3SA 3C70A 2G9ZA 1K7XB 1X8XA 2GERA 3M6FA 1WU7A 3GLHB 1OFUX 3BWDD 3KS9A 3PI7A 3PR1A 5LYJA 3T7TA 3LDGA 4GBED 4E03A 4TT3D 3REOA 4MB2A 5LNK1 1REQA 1ENPA 2OHOA 5K3BA 1USGA 2V96A 3MJHA 3RK1A 2Q6VA 1FRNA 3JXEA 4DYDA 4RMJA 3CEPB 2DLCX 1KIMA 1ZGJA 1ZMTA 1V9SA 2PSJA 4FQ5A 3V8BA 4YMVA 3GZNA 2PBLA 4HDAA 2NVUB 1MHTA 4ZVOA 3BM5A 4YGYA 1YULA 4N3BA 5HWSA 4P5DA 3VZCA 5DM70 3VU9B 4Y6GB 1YV9A 1DRKA 3GVXA 4DKXA 2Q3HA 4F4CA 3VNRA 1ONBA 4QDZA 3UK0A 1N75A 1E3DA 2HD4A 4MLDA 1V3VA 3LNCA 1NV8A 2QMUA 2J9RA 5T8KA 5I51A 3IT2A 3R40A 2R11A 3IELA 2XODA 1T15A 3LH5A 4WNAB 1XZIA 1NX9A 3SYRA 2NZ2A 3MHPA 4H3SA 1PW7A 3AP2A 4B79A 3ZS8A 4CFYA 4QGSA 1QPBA 3G2OA 1IMOA 2W2KA 2WJ6A 4BKPA 4EG7A 5BSVA 3JYHA 1D4AA 4XGKA 1QS0B 3LRTA 1M2GA 4PYKA 4MIYA 4B3CA 5IABA 5BSTA 4MO9A 4BKQA 4G4SP 4NU5A 2LIVA 3AIMA 3E3AA 4QBTA 2Q0QA 1VMKA 1ZGCA 1QDLB 4Q9NA 3B1FA 1JUDA 5ECDA 2CHQA 2QLFA 4GLBA 3UKOA 4NZOA 3PXCX 1EVLA 4CIXA 1AB5A 1CDOA 3WOHA 5TLSA 2HBRA 2R86A 4TMWA 2MOKA 2VP4A 3EMKA 3EZGA 2NXCA 1GA1A 1PFUA 1RRFA 1T5DX 2G63A 2ZIUB 5DMHA 3UQYS 4ZCTA 5A9SA 3CVVA 4L6CA 3H3JA 1YMQA 5HQ3B 2FX2A 3K0BA 1VL2A 4KYUA 5AD1A 3K6SA 2PUJA 1Z7BA 4MUGA 2EDCA 1UF9A 1AS2A 3RH0A 4A4DA 2J9GA 2F64A 3LUCA 1ZISA 1Z73A 4FR0A 5KTRA 5G02A 3WQQA 1V39A 5D85A 5I7AA 3COJA 5DIZA 1ADBA 4DCPA 2PYIA 3DE5X 4G4JA 3H7IA 4EKDA 1P1FA 1KQ3A 4OSOA 1MQ9A 1TAUA 1EBUA 1EGVB 2BI8A 3HCNA 4OH1A 4RIHA 2ORIA 4G1BA 4PN3A 1G1AA 4TTJA 1N3BA 2EKQA 3RT1A 1JLMA 1MB9A 1JHVA 1T25A 3L49A 4JZYA 5AK4A 1NX6A 2X19A 4Q12A 1RC0A 4DBLC 1TEXA 1TM1E 3NVMB 3LF1A 3Q41A 3CNQS 4WUVA 4YRRA 4N49A 4WLFA 8OHMA 2JI8A 1Z0KA 1L4NA 2ZB2A 1TUIA 5DGTA 1WXFA 1C4KA 1JR3E 2PD6A 1T26A 4M9RA 3Q5DA 1RQGA 1VLJA 5LL6P 4B3JA 4WOJA 3UWOA 4PSVA 2BUCA 3COPA 4WCDA 5A3QA 5A0TA 3HEBA 1NATA 1KEKA 3AVOA 2EKLA 2EQ5A 1CZKA 3Q7PA 1R0WA 1XRSB 5DFAA 3TSAA 3FMOB 2XMSA 4FLFA 3EXEA 4DSOA 1TOAA 2UUCB 2QDXA 4Z4EA 5JS2A 2HSDA 2OK8A 5JEEA 3USZA 4DLWA 1CUJA 2XPCA 3AVTA 2ZBPA 2Y3IA 5AI9A 3U3XA 2ZSJA 2IXAA 3HM2A 4FFNA 4DL9A 3DH0A 3SZUA 2GZAA 2HOQA 5ALNA 3WJ2A 2X4GA 3UW1A 1B00A 1LVHA 3CR7A 3GXOA 4QBFA 4RL4A 4BGEA 4C4PA 2GXUA 2QT1A 5D8DA 1XLWA 1I4LD 4RIIA 3ZDCA 1R4NB 1IN6A 2IPXA 1LS1A 4DA9A 4P32A 1V5EA 5L6MB 1PI3A 3EODA 3CU5A 1T9BA 3A9TA 2FEAA 1KO7A 4GR9A 3W3AD 4EDHA 3KETA 3W8RA 5HP4A 2OD7A 1E7YA 4XYMA 1KE2A 4RYLA 1C1XB 2VQ6A 4G07A 3C6MA 4LHYA 4Y2SA 5L3QB 2WLTA 2FZEA 5AW7A 2O2DA 5DX1A 3CMMA 4OU5A 2QTRA 4A3SA 4FGLA 3L82B 3WNQA 4BJHB 2J6IA 1G0NA 2WIDA 4ACAA 1ECLA 2MDTA 2WSYB 4X60A 1RXIA 1TCUA 2WTNA 1WPXA 2X8JB 5IAGA 5IU6A 4HEHA 3PPXA 1FFYA 1JDVA 1M1YB 3VM6A 3ADKA 3BA1A 5A7FA 2J6BA 1S96A 2O5CA 2XB2A 1UDBA 2OXTA 1NKVA 4O4HB 4UHCA 2I3AA 1YB7A 4WY2A 4MCJA 3RRZA 1EUDA 1JKJB 5JS7A 1T4CA 2ZU0C 3CVJA 1JPVA 1R0KA 1AKNA 1CNEA 1JBEA 3CJQA 5KAPA 3HVJA 5JCJA 4ANFA 1OXUA 2HA6A 3NR2A 2ZRBA 2XXAA 5HJ2A 5EIBC 4M98A 3UFXB 1O58A 1FNMA 4HDQB 2XXBA 3V8MA 4RZ2A 5CVUA 2WD8A 4CTNA 1J9EA 4HXEB 1IM5A 3OIYA 4BVHA 3A4NA 3FPLA 1JIQA 4CE6A 1A9XB 2Z56A 3RSZA 4RGVA 3DB2A 1I10A 4IVQA 3C1OA 3GAFA 3LZDA 3VO9A 8ABPA 3FBGA 6REQB 5DYNA 3AO0B 1KOGA 1XJ5A 1GRCA 1E69A 4J03A 3AF0A 2HA4A 2ZRGA 3HHPA 4FD2A 1XJ0A 3LQYA 4O33A 2NACA 2A0KA 5H02A 2PANA 2B4AA 1ZWLA 3DLPX 3ZW7A 4F2DA 5KU1A 1T5HX 1DKRA 4EFDA 2WD7B 1OFUA 4KREA 1JHXA 3HR4A 3V8NA 3OEED 2V7TA 4D6PA 4DWJA 4L22A 2PMBA 2O54A 1ZD3A 3CW2A 4BQNA 2HFJA 3TD2A 3W8FA 4C0XA 2QF7A 2V6GA 5B2EA 2JF0A 2ES4A 1MV5A 1U02A 5PGMA 2MWMA 2V4ZA 4HLUC 4C21A 4E31A 5JWRA 2V6FA 3GUCA 5AKZA 4F96A 1G66A 1VCNA 3HLYA 5CLIA 5CNJA 3AZQA 1CHDA 4AZ3B 5AXAA 4MEAA 2IIPA 4GPIB 3GJ3A 2XAUA 3I62A 4FFBB 1KKMA 2Z9DA 4D2IA 4JXKA 5J63A 4XJXA 3LQFA 2CVZA 2OZEA 1BXZA 4N65A 5J4LA 3I28A 2HU5A 4EMTA 4BO5A 2PRZA 1O6GA 3UXMA 2VWGA 4NBSA 5FPHA 1R4ZA 1JFLA 3EHEA 3L7IA 1CJBA 3T3EA 3QLTA 2ZYWX 2E5FA 2QRVA 3DYIA 1AK9A 3PDHA 4Q05A 3QVKA 5FBQB 2DHEA 1DC3A 4JA2A 3BWYA 1U7OA 3OBBA 4A92A 1YOBA 1Q0HA 3DKIA 1QYDA 3VX4A 4G6ZA 4AQYB 4R0MA 3PGXA 3THRA 3TSYA 1GT6A 4KK3A 5IM4F 4BFZA 1J2JA 1VKJA 2BGLA 4FEGA 4FE3A 3ZOZA 5JJKA 1QHHA 3GDHA 5HRUA 3ELYA 2GRUA 4GMKA 1AKTA 5CDGA 3BXHA 3ORHA 2X6RA 3B1ZA 3ND7A 2WW8A 4Z6KA 1WTAA 1SD5A 5GM2A 5DNAA 2Y92A 2FEXA 1T43A 4CR7A 2Z04A 3ASVA 2C2HA 2PUVA 3BK7A 4LOIA 3ZYCA 3R9KA 2QL9A 3HNOA 3L7JA 3PHGA 3VC1A 2ZATA 4FYVA 1GNLA 1N2GA 3A06A 5T7BA 3OOJA 4R83A 3FNRA 4OQXA 4QDUA 4BO2A 1I14A 4DCSA 3QMPA 3UMVA 2NZ8A 2WJPA 4X1IA 2X9GA 1C30B 2XQIA 3G2KA 2AA3A 1CYDA 2PLFA 3R5HA 3BPSA 4Q3BA 4UD6A 3VU0A 2C7RA 3ON5A 2IBSA 5HOQA 3NNNA 3SN6A 2AZXA 2EIHA 1RAAA 3NHYA 1YRAA 3DBRB 4P3KA 3M33A 2YRFA 3WNBA 4BNIA 2V7VA 5I9SA 2IH4A 2C4VA 2NZJA 2XMPA 5E7JA 5GOTA 3I92A 2QJRA 3IVXA 2XMGA 4H6PA 5LB2A 1KQOA 2ZQZA 4GRAA 4NENA 4RV5A 3O3MB 1G9SA 2ZB8A 3IX7A 2OAEA 2HN9A 1SVNA 3HUDA 4M1OA 3H5WA 4YECA 1DCTA 2I55A 2Q49A 1DUVG 4NCIA 3WIEA 4CUZA 4B3RB 1IXZA 1HSOA 3G8BA 3QIAA 1K6XA 2X4IA 3OZBA 4PCAA 4Q00A 2VQFB 2RIRA 10MHA 2IX9A 1U2SA 2Q5HA 3STWA 5JPDA 2MSKA 4LJ5A 4UULA 2BF4A 5I7VA 3ELWA 3PC3A 1NA5A 5ILGA 3U4AA 5EIEA 2PQMA 1G19A 2P5TB 4R3WA 3IE2A 1AHIA 5LM3A 4EA8A 5ALUA 3OC6A 2OHIA 5LOVF 3MYRA 1RPZA 1DG9A 2B2CA 2HJHA 4XQCA 5A3RA 4LNUA 4PGGA 2P77A 2AOUA 2OLEA 1Q77A 3T6KA 2QSUA 4MS1A 3OPYB 2ZWPA 4CKYA 5KWIA 5JBQA 3UAZA 2AC4A 5IAKA 2PRJA 4G0NA 1JZTA 1T2NA 1YK1A 1EXMA 4K05A 4LRXA 3RFCA 3CN9A 3PYXA 4ND2A 1R0SA 5EFOA 1SIOA 2J6CA 4X7RA 1P7CA 2FW7A 5ESRA 4ZQGA 1JQ5A 2LE0A 3L05A 4B4OA 2I7XA 2B3DA 4CUJA 3T1NA 1HMYA 1OKKD 1QUFA 2D2EA 2ZJBA 2BE9A 4R1PA 3PGJA 3C1AA 3T5DA 1KYYA 4B7AA 4GWKA 4QGBA 2DWCA 3GA7A 4C87A 4JUAA 3VVCA 1RHRA 4UHEA 2O8BB 1Z4MA 2OILA 5A3VA 4ZZ0A 2C59A 3C2QA 4K6FA 1CF9A 1TK3A 3KV1A 4KTVE 1MU0A 1XMSA 4MQFA 3EFEA 4PGFA 4ZPXA 1U2ZA 4RVGA 5T3YA 2ZIZA 1PYDA 3CN7A 1KI4A 1C7FA 1YR1A 2OCAA 4LHSA 3S70A 4ALLA 3JD1A 4B82A 2GAIA 2WU0A 1IHPA 4XZ3A 4G1UC 3WAKA 4CM4B 4H1WA 1P7VA 1W1UA 1E1DA 2Z2XA 2QJFA 4BZZA 1KC1A 1SVUA 3AFGA 2C96A 2BKEA 4CM7A 5FWNA 1D5CA 3K31A 5HKAA 2WHXA 1IN1A 2GEUA 5F3DA 4LQ4A 5IJ9A 3ZS9A 2PUCA 3P7MA 4NP6A 3ZE9A 3WDLA 3QSGA 2P9BA 3QV2A 1YBFA 2H4HA 4RTOA 2A7QA 3WS7A 4AYXA 2VXOA 2XF2A 2RAVA 5EKSA 2HQ1A 3O92A 1JQDA 3C4QA 4Q9HA 2NUTB 1FRQA 5DEIA 1V8OA 1VSVA 2ZAYA 4TTSA 1QDUA 1KKLA 3GG9A 3CLTD 2ATVA 1O9BA 2OPHA 2POQX 4BX8A 3QU4A 3KJNA 1SXQA 5JCOC 1V48A 4JC8A 3ETNA 1YZTA 3E3LA 1XP5A 3V1MA 1X15A 1Q0PA 2DBQA 3OX3A 4QXRA 4WFKA 5CIQA 5BVHB 1XTRA 2ASVA 4DDWA 2FYTA 3A6LA 1I4TD 3ANTA 4AJIA 4LWQA 4CKBA 5H81A 5E9JA 1QZUA 4Q82A 1T8RA 4CMIB 5SICE 1JBQA 4Y30A 3GLIE 3L4BA 2KW5A 3AF4A 3AINA 2D2XA 3N7AA 5BR8B 4LI0A 5FEMA 3V2GA 3OX4A 2WJ3A 1DWUA 3BEOA 5CYGA 3MS7A 1SURA 3COWA 3H1FA 2H8GA 4PAQA 2V4UA 2XHEA 1YZKA 1E58A 1G60A 4LZZA 1CIVA 2QVXX 1YO6A 2X5XA 2ZUWA 3T7DA 2YYYA 4QJ3A 5C7LO 1V5FA 2D00A 4UMVA 4V0LA 4JEIA 3FYUA 3BIJA 1DOHA 1N5OX 2O5RA 1GKUB 1WSAA 2VJQA 2W8ZA 2VJMA 2RHWA 3P0FA 1RMQA 4HSGA 4AB1A 2WBLC 3MWYW 3A6GA 1HL7A 1NW3A 1T1EA 4MI3A 1GFZA 3OF2A 4S1TA 3ZXIA 2QTTA 1ZUNB 1T9DA 5B4VA 4IOJA 2C2OA 3BMOB 4NC9A 2OGWA 3E53A 2I6FA 4P5PA 4NOKA 4EFNA 1XTJA 3DCJA 1DEAA 2Z6UA 3OZCA 4HNSA 5CFMA 5KX5B 1RWWA 4YRIA 1KFBB 2YVQA 1VGVA 4FOLA 4YUYA 3U3KA 1I4OA 2QYOA 1JXAA 3E15A 3L7OA 5A7HA 3L8HA 4PPQA 4F9FA 2XBLA 2YYZA 4Z51A 4CU5A 1BJKA 3AVPA 1U5AA 2M9MA 1W96A 3COSA 4YCJA 1HE2A 3OZUA 4CTMA 1PR9A 1VDMA 4LHVA 4LQLA 4RF4A 3VMMA 1BC5A 2CFSA 4Q1FA 3UW3A 4EW3A 2NIPA 2IKQA 3SNHA 1A88A 3UQZA 5IWAB 5A5FA 3HDGA 2G9NA 2EV9A 2I6SA 5KC8A 3O0TA 3WGNA 4UHKA 2W43A 1GDTA 2AMJA 1Z7YA 3ML1A 2OMKA 2H4XA 1DAGA 4DCTA 4U2KA 5LN1A 3R44A 1SKAA 1YQQA 2ZOSA 3N2IA 4NCJA 1U2DC 2AJBA 2FOXA 2FX5A 5A06A 4GOXA 2J9FB 2FN4A 3BL6A 3EPPA 1E3LA 1GZ3A 2D4AA 1IAVA 2WB4A 3GP5A 3OZDA 3PVSA 5G53C 4BOYA 2YJGA 2IDMA 3B53X 3NHMA 5LQRA 2PX0A 4GKAA 4H6VA 4OHKA 2GN6A 2XBUA 4XDYA 2BGIA 1L5GB 1RZUA 2WMNB 2Z5VA 3EIUA 4R98A 1DWQA 3HCPA 4G4GA 3E18A 1MGPA 2VHTA 1X7ZA 1D6NA 3ECCA 3FJYA 4LS3A 2GEJA 4BBAA 5CPFA 4EDFA 3N2ZB 4OAOA 1ANKA 3KE9A 4JT4A 3RSHA 4CM8A 4CHGA 4C7XA 2W22A 5DHRA 1R9JA 3KFLA 4X6XA 4UD2A 4IJ6A 4JBYA 3UK2A 1FP7A 1Z4PX 2XWPA 3BICA 3ESXA 3GJQA 3USCS 4E94A 2IZ0A 3RQIA 1OXVA 2VRCA 4GPZA 3PEYA 5ABPA 1T8PA 1BAPA 1KVTA 2IU6A 3IOMA 3G9ZA 4UNIA 2ZUVA 4QXMA 3RHZA 4W6QA 1B4DA 1Y5NA 3F96A 3MBKA 1O95A 2HKIA 2XUHA 1U4NA 5IJ0A 2EERA 2FG5A 3NHKA 2CFOA 4MKGA 4N5MA 4OJQA 4L5BA 2GCOA 4I3HA 3IT1A 2RK6A 3FNEA 2LDBA 3BB4A 4MS3B 1K1EA 1SMKA 3T9CA 3QFHA 3HKEB 4HH1A 4M8LA 3UIEA 4PLGA 4KUGA 5LIPA 1QGUB 1T2DA 3LECA 1TF7A 4OU4A 5GJWC 4BNYA 4F5EA 4KXUA 4DA4A 4LE2A 2O7VA 5HUQA 3OTWA 5BUZA 3FTPA 2HBQA 4J9UE 2WDZA 2ILVA 4CVNA 5C5EA 3AETA 4M7PA 1YJ5A 3HXTA 4WK0B 3F3MA 1GU0A 4JLPA 3UWPA 3E84A 1IC6A 3R1IA 5BWLA 2N9UA 4XARA 3BJIC 3HP4A 2B0JA 1V25A 3OECA 5JZVA 1MAHA 4WEOA 2WJIA 1M6NA 4GM1A 3A05A 2ZR8A 4J9VA 2DFVA 2XD9A 1WV0A 3GPBA 2C5AA 2O3QA 3H5NA 3MEQA 4S0XA 5CRIA 3GLUA 2P9EA 3D3WB 4OQMA 1JQBA 1V8BA 2FLVA 5ALWA 2P4UA 1MDFA 2G0TA 2GBGA 3BFPA 1U9IC 1Z4QA 3G5TA 3W2FA 4RY0A 4V2UA 1CJVC 3VR2D 1T36A 2Y6UA 4ME6A 2F3QA 4F5DA 4BJ3A 4WLUA 2NUPB 2DQ4A 3MPUA 4CNBA 1N2JA 2BFCA 1JIXA 3H4TA 1U8AA 3QELA 1ETUA 5JDIC 5COQA 5H59A 1YHYA 4MVYA 4F21A 1KRWA 2JGDA 4HWSA 1E3TA 4YJFA 1YDFA 1BCRA 3RUDA 3ZQ4A 2VSOA 3DL4A 4LOKA 1HTWA 3JAWB 1KYZA 8MHTA 3E27A 5CT9A 1W0JD 5DU2A 1E2QA 2IU0A 1Q44A 1RKUA 1DOAA 2QTBA 2XNHA 3UCFA 1KDVA 4V38A 4I50B 5REQA 1SUIA 1EWRA 2FSFA 2TMDA 1BX3A 4HG2A 4NZMA 1S01A 2M6KA 1I1QB 1TO1E 3R3WA 3FVQA 1J5PA 1VM6A 2DFLA 5FNVA 4CW7A 1CIJA 1K9SA 2C4NA 1G8KA 4LJ7A 3SZLA 3KALA 4MVJG 1G21E 4OBEA 4AUEA 4WCFA 3FNIA 2QAIA 5DT2A 1WSBA 1N1EA 3BILA 1DO2A 2IYYA 1GLNA 3WX0A 5LBTA 2ODQA 4MYSA 3LVBA 4GX0A 1XDBA 1AO0A 2PKWA 4NOLA 3BT7A 4JBXA 3RTAA 3AYXB 3ROPA 5E9QA 2R1UA 4IGIA 4RENA 3STHA 1Q0SA 1SWWA 1V71A 1ZVKA 1GPNA 2XIJA 3C1UA 1FFCA 1RRCA 2ZSAA 3KZOA 1JIKA 1C7QA 3PDUA 1EZ4A 1SWVA 4YCDA 3LWZA 3G2PA 2Q5EA 3M1LA 3TW0A 4U2FA 1GLGA 4JGIA 4KDFA 1NI4B 2H54A 3SXPA 1Z16A 4HDNA 2CMDA 5JVDA 3C45A 4NJMA 4MINA 1HNZB 4LSGA 4TRJA 2J7PA 4D4GA 4IILA 4X24A 1N0VC 4HBZA 3PFWO 1KVRA 3HJGA 3RF6A 2DHCA 3HCCA 1E9VA 3CKLA 2EG9A 5KTSA 1IRXA 2X0RA 1YH3A 2ECKA 2JJ2A 1U0EA 1ZHFA 2AQIA 1YA4A 4BWGA 3GG2A 3AJ9A 3RVQA 3U7JA 2Z08A 5EE3A 1N3YA 1EM8A 4G67A 3EXAA 4AMYA 5C3UA 4DXDA 1RIFA 2K2QB 2X8WA 3ELDA 3HMKA 4K28A 3RJ9A 1I1OA 4CN9A 1FXUA 1RXYA 1RWXA 1O6FA 1J0BA 3LU1A 3TOSA 1Z2CA 2VEOA 3VZSA 4AS2A 3AVVA 2G9RA 4NS1A 1IQUA 3HCRA 2CDCA 5AKYA 3W5SA 3CJTA 2X9NA 1LY1A 3WLOA 3C16C 5EERA 4EIWA 1KS2A 3TQQA 5IYZF 2J7KA 1CB7A 4LRQA 3P5SA 2E89A 4QWMA 2VYQA 1SC9A 1IJEA 1X7HA 4I19A 4EPXA 1E7MA 4JGGA 4U6QA 3VSDA 1D9ZA 3K0AB 1J7JA 4AKHA 5BUQA 4IJMA 4AY5A 1K7CA 1P9LA 4TM8A 1XTUA 3N2KA 1GPUA 4MUNA 4TYPA 2XOKD 4FB4A 1OY1A 3ZH2A 1P9RA 1ZFNA 3OKCA 5TB5A 2DUUA 1LFDB 2BLLA 2M1ZA 2ADFA 4BZWA 4BB9A 4OLBA 2CW5A 3OQ1A 3TYXA 3B9QA 3NLLA 3KPVA 1E89A 3KOMA 1GTJ1 1PV4A 1ODLA 1SQ5A 4MR7A 5FI1B 1IJFA 3RC2A 4G1FA 3T41A 1XAGA 3KCQA 2CNWD 2EW2A 4Y9SA 5D5HA 6NULA 1Y5IA 3U61B 3CLTC 1ZN7A 2JIZD 1AZSC 2G5PA 4LX0A 1DQNA 3G0OA 2H1FA 1B16A 4MR8B 5HCUA 2Q6LA 3GCZA 2AX3A 1E9EA 4MW9A 4C9BA 5B7PA 3HKCB 2PMWB 3H16A 2C57A 3EC1A 3RYFA 1MQSA 1QANA 2CZGA 3BE4A 1BGXT 1G20E 2CXXA 4KI7A 4AO7A 2CC2A 4OA5A 4BO1A 1N32B 2RCYA 1J99A 2WZQA 3VHRA 2H17A 3AGPA 4MAFA 3GT0A 4JT8A 2FU5C 5AIAA 5TS2A 2QROA 3ZXYA 1O0BA 4L28A 1XVVA 1N2XA 1V6SA 2GPNA 2GD2A 1G4HA 1DHRA 2QW1A 1SIWA 2VRCD 5GONB 3UUFA 1QLWA 2ZREA 5KQLA 4YXWD 3UPDA 1JEJA 3KQNA 1DCKA 1I13A 1ZH6A 5THQA 4BDSA 5DNUA 2REQB 4HB2A 1TD1A 4HD8A 5E9WA 4IIBA 3TBFA 3FWKA 3MCVA 3ZK7A 2Z8YA 3TLMA 1VE9A 2RK4A 1TCVA 5B1HA 5BY2A 5CDSA 3U5TA 2TMKA 3BXOA 3L9WA 1Z4JA 3PCTA 4IV5A 5BW6B 1CUHA 2VA9A 3ABZA 3DVAB 1OZHA 2FN8A 4HN9A 4DV6B 2QUZA 3TQSA 1K6IA 4R2WA 3I2FA 2GHIA 5FTMA 2G09A 1KK0A 3JY6A 2G08A 5BWMA 4UREA 1ZVMA 3M6XA 4Z7QB 5IXYA 1NFFA 2J5KA 3PUJA 1MOSA 1QMGA 4YCMA 4URVR 3FGNA 1RCUA 1BDMA 4UM9D 1IIBA 4L95C 3VVMA 4BKOA 2D0IA 3HXQA 1XYYA 3MHTA 1JSRA 3D64A 3F74A 1JXOA 2VG8A 4E12A 3Q7RA 4GQBA 5T8KC 4RVUA 4AMGA 2IEDA 3PCRB 1XT6A 4XFKA 4OQDA 4NFSA 3VKUA 1JNXX 2XF8A 3G88A 4F4UA 1I7QB 1QYRA 3IAXA 4P33A 4TSRA 4XASA 2A3NA 3SM3A 3WHIA 5A6SA 2PUWA 2P9JA 4N5NA 4HDMA 1SN7A 1MA3A 2GTIA 1M8JA 1A4RA 1VMDA 4Z4QA 5J3JA 5LYYA 3KOXA 3TTVA 3SBDA 2VXBA 5FORA 2PH7A 5IZCA 4FILA 3VV3A 1IG0A 2QNBA 3LS2A 3OOWA 3SNKA 3X1XA 2GOYA 2B25A 1XMXA 1CR0A 2BT4A 3L0SA 2BLNA 2NTVA 4OHVA 4QZVA 1GNSA 3ER6A 3OCCA 1L7BA 2CDNA 3EYWA 2VBCA 3SKYA 3T5BA 1YMVA 3KJGA 3LTEA 3NGMA 3AEYA 4RHXA 1PR4A 4AZTA 1H2RS 5FL3A 3WKBA 1YR3A 3UJNA 5ESDA 3OLZA 1CY7A 5ERXA 2QTWB 2XNDD 5J2UF 3I04A 4ZO8A 2C31A 4XTRA 1LW6E 5GONF 3WYCA 4TV8B 4C07A 1FA9A 3NH6A 5KYGA 3LBAA 4YAWA 3VZPA 5L51A 1Q19A 4FCVA 4MRMB 1XZPA 4G86A 1AZTA 2Z8XA 2OY0A 4YK7A 2W71A 4Z9FA 1UP7A 1P5HA 4D9FA 4D3DA 1MEJA 2WKRA 2AFHB 4FD3A 4N18A 4ZXFA 2LR0A 2ICAA 4KWCA 3WR5A 3W5UA 2QW0X 2YZMA 5TMBA 4ZCIA 5B7QA 4N8SA 4BDTA 1GZVA 5FO0A 1A71A 1BS9A 1E2DA 4GMHA 3UG6A 3S8EA 1WXQA 5LOVB 5IX8A 5JS1A 2XCIA 2IYVA 3QJYA 3LVRE 5HQ3A 2GFQA 1SEVA 3NWEA 4EB8A 3JU3A 3RC1A 1GU7A 4BMCA 1VJGA 3C5EA 1HDRA 1DTEA 1XU9A 1M34E 4OQEA 1NF9A 4TRMA 3T0FA 2DY0A 3ZYZA 2Y4NA 3IV6A 3KB1A 3LPLA 4I1IA 4R1TA 5JADA 3P0HA 4KFUA 1R64A 5DP2A 4F97A 5HDQA 2Q6TA 5EPOA 4B35A 4CU2A 3UJHA 5CVEA 1R2QA 1C14A 4DIOA 8ADHA 4MCAA 4ZT2A 4ZICA 3FPJA 1E3MA 1HE8B 1O94A 2H16A 1M6VA 1Z2DA 3QVXA 3C6ZA 5AI6A 3GLIA 1AV6A 1OT5A 3UATA 4H1TA 2ZJ5A 5CJ2A 3RHSA 2ZITA 4U1RA 3H2ZA 4JS0A 4QUEA 2FR1A 3Q9LA 3ITDA 2JDID 1QB8A 5D00A 4ZYZA 1AXGA 2C2GA 4R1UA 1QCZA 2ZYSA 3SYKA 2NVWA 5GJCA 5HRAA 4ZAYA 5FTNA 5KSZA 1V7QA 2QP3A 1CUDA 2XQKA 4PFSA 4GM0A 1AOXA 1T5BA 1C0KA 1PZXA 4OHOA 3T7RA 3STVA 4EGSA 1BH6A 2IV2X 2YBDA 4JT9A 4C4XA 1RM5A 2O8VA 2EF0A 3PA8A 1XQ9A 2PXCA 3V8EA 1V11A 3OG9A 4V0RA 1Y8RB 3EVNA 3V2UA 4I1OA 3Q8XB 1KJ8A 2ZVQX 4KX3A 2QPTA 3GRUA 2F9MA 2IYXA 1N2CE 5EMLA 4EW2A 3LQ4A 3FB4A 2EZTA 1PV1A 4P84A 3V33A 3U09A 3EXG2 1GCIA 1D8AA 1X42A 2IEBA 3SZRA 3UAOA 3L18A 1JI3A 2Q4EA 4B2PA 4M1SA 2H1OA 2NT3A 3WHLA 3L0PA 3KPUA 4RKQA 4I5FA 4Q3CA 4QDKA 4BUJA 3E35A 2AFIB 5K1ZA 3PDCA 2OUKA 5HXAA 3A32A 2PA0A 1ZK2A 2EJWA 4YJKA 5TF4A 2WOJA 4OUKX 1P4RA 1GVNB 1VRWA 1VIVA 1KPGA 1E3QA 3MWJA 4RMIA 1XVTA 2DTXA 2QRKA 1CQPA 1QBGA 2Q5FA 3KR0A 3RBXA 1B6RA 2H51A 2DKOA 1CSEE 3HBLA 3RTCA 2HU2A 4UVHA 5FWXB 2HF7A 4KQIA 4JLMA 3N0WA 3U9TA 1QHFA 3E70C 3EJWA 2HWYA 1O96A 1Y6RA 4DUGA 4REQB 2VF8A 3VDQA 2E1PA 1WS6A 3IILA 5ELXA 4XUGB 1YRYE 1KDYA 4WK4B 2VHVA 1OTYA 2PKRA 3O8QA 5D5PA 5E8RA 3LAWA 5L40A 3I01A 3FCCA 3ROKA 1YL5A 4C08A 1U7UA 2JW5A 3B8EA 3EAFA 3NPAA 3HWWA 5CB4A 1I30A 4MEJA 2XYRA 4I1RA 2WUGA 1KR2A 2X5KO 1J9ZA 2VKQA 5D3KA 3QE9Y 5F9HA 2V8OA 3KJZA 3HPRA 4KR0A 1AGYA 2O06A 4IYJA 4NEHB 3TOXA 3FROA 4G8JA 3NEAA 1BD4A 3LZ6A 1JTEA 2KYRA 2Q3DA 3ZVNA 3JQ6A 2PGIA 2HU8A 2HMVA 2DPHA 3PWKA 3EHDA 3WRXA 1DDOA 3OZEA 4KMRA 1DRWA 1LLDA 2XE4A 3DCIA 4ZHQA 1ZW6A 3I5XA 1JSCA 1ZY2A 2QTVA 1JG2A 4CM5A 2J33A 3DL2A 2F8LA 3WIOA 4KXQA 1RBYA 2YWFA 4E11A 1CP2A 4MYTA 5EVCA 2JG3A 4JEUA 1R8QA 1M75A 1MIHA 2X5NA 2IS2A 1WQ1R 1GTVA 5I9NA 1G6HA 4TT8A 3GMSA 2F9LA 1QZZA 4HUTA 2XUGA 1GIAA 4AMUA 5JSQA 1XELA 1RJWA 2MINB 2Y1EA 1E5QA 3DDZX 3V2HA 1TVKA 3RAEC 5LWHA 2GHTA 2HM7A 3LC1O 4Q9JA 4DQKA 1RDFA 4JI0B 4D6XA 4Q4JA 1D03A 1JIIA 4ALKA 1Y1LA 2N42A 1QORA 2JA1A 3O93A 4CODB 5C9ZA 2HDWA 3PXBA 2I9KA 1MFZA 3SX4A 3ZI7A 4LJSA 3C6XA 4EG3A 2AMLA 1VIYA 1F2DA 1FSSA 1PZEA 2IVZA 2VS1A 5JYBA 3Q3GE 4OHPA 1KNXA 2IBMA 2JB9A 5KTKA 5IJZA 1GR0A 5EXEA 3LOQA 4YHBA 4RLHA 3ZKWA 4B6EA 3LUAA 3WV4A 4C2UA 5IDWA 3LHKA 1RTTA 3EFBA 1F8UA 3OZXA 1FSZA 1AIPA 4TMTA 4ZO9A 1SNYA 3R3VA 1HI9A 4A0HA 4BTVA 5E1DA 4X3PA 2YR0A 4DMCA 3BWVA 3AB3A 5AMXA 5ESWA 2IHNA 1FP6A 1IPHA 2HYIC 2WP0A 2HMTA 3MF4A 2DUMA 2X13A 3LCRA 2QU7A 1J39A 4TTPA 1G42A 1GGNA 3B89A 4ITUA 4IYRA 5BNWA 3X2FA 3CH7A 3UEOA 3VHXB 3KSBC 1D3AA 4MQEA 4HLCA 3IPAA 5JXHA 1Q21A 2AOTA 1J42A 4FP9A 1MB2A 2FG6C 1OX4B 1XQ6A 3RD5A 4BKRA 4GIBA 3CNNA 4DBZA 3EVTA 1KR5A 1WMBA 2ZVDA 1HX7A 3TLGB 1ID8A 3MBIA 3ESQA 3AMVA 3R77A 4BEVA 4OO3A 2P90A 4DJDC 3G8AA 4DPKA 1CLUA 4R7TA 4KV9A 3O8LA 2BSQA 3MELA 1U8ZA 1VBNA 9GPBA 2L0XA 2OMEA 2G5CA 1R6AA 4PBTA 2IYAA 2R25B 5DSTA 3TEMA 7REQB 3KQQA 2H92A 3LUHA 3JQ9C 1SXJB 3P4XA 1XP8A 1SKUA 2WT8A 3PYMA 4RPCA 3T3HA 2GXAA 4J49A 4BO7A 1ZUIA 4L75A 3CCBA 3I1JA 4N6GA 5SYNA 3BH7A 1E2HA 2AC2A 4N7JA <