2DPHA

Crystal structure of formaldehyde dismutase
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
398
structure length
398
Chain Sequence
b'AGNKSVVYHGTRDLRVETVPYPKLEHNNRKLEHAVILKVVSTNICGSDQHIYRGRFIVPKGHVLGHEITGEVVEKGSDVELMDIGDLVSVPFNVACGRCRNCKEARSDVCENNLVNPDADLGAFGFDLKGWSGGQAEYVLVPYADYMLLKFGDKEQAMEKIKDLTLISDILPTGFHGCVSAGVKPGSHVYIAGAGPVGRCAAAGARLLGAACVIVGDQNPERLKLLSDAGFETIDLRNSAPLRDQIDQILGKPEVDCGVDAVGFEAHGLGDEANTETPNGALNSLFDVVRAGGAIGIPGIYVGSDPDPVNKDAGSGRLHLDFGKMWTKSIRIMTGMAPVTNYNRHLTEAILWDQMPYLSKVMNIEVITLDQAPDGYAKFDKGSPAKFVIDPHGMLKNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Formaldehyde dismutase
publication title The X-ray crystal structure of formaldehyde dismutase at 2.3 A resolution
pubmed rcsb
molecule tags Oxidoreductase
total genus 123
structure length 398
sequence length 398
chains with identical sequence B
ec nomenclature ec 1.2.98.1: Formaldehyde dismutase.
pdb deposition date 2006-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2dphA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2dphA01
2GN8A 5IN4A 4MVJD 4YJDA 1ONPA 5C5IA 2HMSA 1LDGA 3F4LA 3AY7A 1HXHA 1UXHA 3EHEA 4J0FA 2VWGA 1QRRA 3NGXA 5CP8A 1NQOA 1PGJA 2BRUA 5ER9A 1NNUA 1N9GB 1XU7A 4TVOA 2RBEA 2VHWA 1ZW1A 2HO5A 1MGOA 3DOOA 4CUJA 3GN2A 1DBVO 2Q1SA 3FN4A 1ZKMA 2C2XA 4D46A 1U8FO 3FNGA 1I0ZA 2DM6A 1LLQA 3KO8A 2PGDA 3GMSA 1QV7A 3CXRA 4CLRA 1ULUA 2CDBA 2DFVA 1ENYA 3CPSA 2GN9A 3AFMA 1P45A 4L73A 1BXZA 3ZWCA 2Y99A 3IQDB 3I9MA 1O0SA 2PGLA 1Q1NA 2VWHA 2CVOA 4J1NA 4QXMA 1GPDG 1EBFA 4YRBA 3IJPA 4MVJG 3JYOA 2Z95A 4WOJA 4D44A 1H0KA 4ITUA 3CKYA 3E6AA 3KRTA 4U6QA 1F14A 3UFXA 1ISMA 2Q2QA 1E6WA 1HWYA 3BMCA 1HE3A 1W4ZA 3I9KA 1BXGB 2PK3A 2GUGA 4FFOA 2FMUA 3GDGA 5H82A 5TNXA 3WGZA 1VLLA 3TDKA 3UW3A 3WLFA 1SNYA 1GQYA 3ANNA 2R2GA 3HJAA 1E3SA 3E8XA 4WGGA 1DEHA 4RQTA 3BMQA 1HKUA 3EZYA 9LDTA 3GGGA 4ALIA 4U0KA 4F46A 5A9RA 1H6BA 2DBQA 1XGKA 3JQBC 4YDRA 2YHIB 2QW8A 3IP3A 2VT3A 5A05A 4BOYA 1BTOA 2YUTA 3VAZA 1X7DA 4M55A 3JQAB 2DPHA 4IMRA 1DAOA 1ISIA 5A1TA 5B1YA 3BHJA 3RFTA 4NFHA 3AUTA 1P1KA 4G81A 4QT0A 2C82A 1WMBA 3GEMA 3F1KA 2AEJA 4ILKA 5K6AA 3PFWO 3SXPA 3DFUA 2OGUA 1ISHA 4P8RA 4H15A 4CQLA 1T26A 1VJ0A 1KIFA 3DTYA 1ID1A 4W99A 3IMFA 1K3TA 1GU7A 4CMIB 5A5EA 4PLZA 3GVCA 5TJ9A 4B7UA 2QHXA 1VPDA 4HUJA 3U09A 1E0DA 2DLDA 5CEFA 1R12A 3LZ6A 3OFSA 6LDHA 1A7KA 1JLLA 1DIGA 3D64A 4R1UA 2VOEA 4BNFA 3W8FA 1LLCA 2G76A 3AU8A 1Q0QA 2PY6A 2C59A 1MXFA 2WTBA 3GAFA 2VYND 1GEEA 5JNLA 3KETA 3OETA 4XGIA 1HT0A 4PG4A 4E33A 1DIAA 4YT8A 1XG5A 1AHIA 4Z0PA 2GPTA 5BSEA 4RVDA 4C7KA 4W9NA 2IODA 3D4PA 4HXYA 1Y8RA 1JAXA 3TZ6A 3ZWWA 2EJWA 3C3XA 4BGUA 1A27A 5GZ6A 5C7LO 3VVBA 1MC4A 4YJGA 3W4IA 1PS9A 2VNSA 4DPLA 3C1OA 3G1UA 1ZK4A 1X7HA 1EUZA 1R15A 3OF2A 3VTZA 4RZIA 1JDJA 4HV4A 1E1NA 3PLRA 5JMPA 4FPXA 4KMSA 1HRDA 1GTMA 1JKIA 1PTJA 2RAFA 4UVEA 3WOHA 5JCJA 4LSMA 4XYLA 4XRGA 2QX7A 3PLNA 5T8KC 5KJCA 1PGNA 2NTVA 1DPGA 2NUAA 4GL4A 4HKTA 2D8AA 4FCCA 4YACA 5B4VA 2DAPA 1FDVA 1ENPA 4TQGA 5T64A 2NU7A 3JQEA 1ISJA 1ZVMA 2EXXA 1HDGO 3DBLA 2O3JA 4TSKA 2ZQZA 4ZQGA 4LGVA 5JY1A 2PD4A 4E2YA 1HLDA 5CFZA 5IZCA 2NLOA 3H5AA 5AQ1A 3C24A 1HZZA 4Q39A 4B4VA 4FGSA 4D0SA 2C54A 4GKBA 4L75A 1VL6A 5G0WA 3UGKA 1C1XB 1E92A 3L6DA 4J43A 3RU9A 4UVDA 1U1IA 5GY7A 2VHYA 4BGIA 2ET6A 4XDYA 4FJ0A 3I3OA 2B69A 2QZZA 3HZZA 1SC6A 4I5GA 1GFSA 1O95A 1OZAA 2RIRA 4D43A 5TT0A 3UF0A 3KOUA 3RUFA 3GRKA 3P5SA 3WBBA 3ABIA 3WJ7A 4KQXA 1PJ4A 2AW5A 1E3WA 4F3YA 1ENZA 1XIVA 3WSWA 3WICA 2XF8A 4GAEA 4MDHA 4CV1A 4TVBA 1B8VA 4IGEA 1EQUA 5JDIC 3JYQA 1X15A 2FR1A 1XA0A 1QXSA 3KV3O 2GERA 1JA9A 5DCUA 5JFOA 3L77A 3QVWA 4MKZA 3IS3A 4LK3A 3KSDO 1MA0A 3V5NA 1GUFA 4IDBA 5KJ6A 4N7RA 2O2YA 1TT5B 4NFSA 5F1PA 2D5AA 5IDQA 2WWRA 2ZTMA 1IZ0A 1IUKA 4L0QA 1HYEA 4RF3A 3GGOA 3U3XA 5JAIA 3NUGA 3ONFA 2Q1WA 3KUXA 4MVJA 3NKLA 5DNAA 1Z6ZA 3VDRA 1QG6A 5U1PA 1PR9A 1JKJA 1KVRA 4NU6A 2V65A 4PFJA 3K73O 4FJ2A 2H6EA 4B79A 3QP9A 1SAYA 1T2AA 4WASA 4KTTE 1VRWA 2B5VA 4RV9A 1KYQA 3G3EA 4KOAA 8ADHA 3R0IA 1KVTA 3FPCA 1PZHA 3A06A 4DWVA 1D1SA 5CEEA 3ZI0A 1EK5A 4MKRA 4A5OA 4CMCA 1N1EA 2H1SA 1V6AA 2C5AA 4PRLA 5IG2A 2X22A 1EFLA 1G0NA 2YDYA 4I5DA 1E3JA 1MLDA 4JROA 4GMFA 3GN1A 4CPDA 5JSFA 3UOGA 1EE2A 1RM0A 1E1KA 3PRJA 4ND4A 3TSCA 4H3VA 1NYTA 4J91A 3GZ4A 3L6EA 2WD7A 4YCAA 3I5MA 4D41A 2X0RA 4XD2A 4AICA 1A5ZA 1PWXA 1QLHA 3WTBA 3B1KA 4QX6A 5JBIA 3TL3A 5I8ZA 4OHUA 4I9NA 4YQZA 2J5KA 1PGOA 4O63O 3DHNA 4CM3A 4J49A 4K28A 4P4LA 4DTIA 3FBTA 4A7PA 1VSUA 4NJMA 3KBOA 1K6XA 1ML3A 2J8ZA 1KY5A 3B70A 3IUSA 2IEDA 2JHGA 1XQ6A 2QG4A 1UZLA 3BMOB 3NDJA 3ZNOA 1NFRA 1EUDA 4RGBA 1ZJZA 4JNKA 5ICSA 1I10A 1ADFA 2WYWA 5AVOA 2AE1A 1FXSA 3L4BC 4QFDA 1U28A 3JQ6A 3DZKA 4XB2A 4GBJA 6ADHA 1HZJA 1I2BA 3BA1A 3H9QA 4AG3A 3K2EA 4U8GA 4OL9A 4GGPA 2V6BA 3H9EO 1V3VA 4B4OA 3ITKA 4BMVA 2F1KA 3RU7A 1KEWA 4DQVA 2HMWA 4CR6A 4ND3A 2NM0A 2IE0A 1GV0A 3I52A 3IJRA 2I6TA 3GEDA 3FI9A 4PLCA 2G17A 3PFFA 5EL0A 1T4BA 2AXQA 1GAEO 1QKIA 4RPLA 4DQXA 2O2SA 3GLQA 3O26A 4R41A 4BHTA 2B5WA 1XR3A 4DYVA 2HMTA 4JJFA 1FDTA 2YFHA 1E7QA 3PZBA 2VTDA 5G0SA 2P68A 5EJ2A 2FP4A 3JV7A 3UUWA 4CLRB 1T1RA 3LLSA 3CIFA 2VYNA 4R4JA 3V2UA 1Z7EA 3PHJA 1DLJA 1HLPA 1NASA 3ZWVA 4MOWA 1VSVA 5THKA 2O3TA 2VT2A 1B8PA 3FWNA 1MC5A 1LQTA 1W8DA 1ZIDA 2CVQA 1ONOA 4GWGA 2YZ7A 2HK9A 4Y8VA 4A03A 4A27A 1E7WA 4CMEA 1OC2A 4HBGA 3DOCA 4ZRNA 1KVUA 3BMCB 4W7HA 3WQQA 1Y1PA 2X1HA 1M6WA 4NU5A 2OZPA 3NDIA 4RL6A 1NVGA 4MKXA 1ZBQA 1ZSNA 3EAGA 4GX5A 4MINA 3OM9A 3H5RA 5EPOA 3OMLA 5IAAA 2FWMX 2I66A 4U0JA 4KWHA 5G4KA 1L1FA 4CMAA 4GX0A 2Y0DA 3KZVA 3BMQB 4RZHA 4YAEA 1PWZA 2Y0CA 1B2LA 5HS6A 4B4UA 1AGNA 4HWKA 1K5HA 4ND2A 1T2FA 1S7CA 2YV2A 2OBYA 4CLEA 1LRJA 3C8MA 3U5TA 1LTHR 2X58A 1VJ1A 3D4NA 4BL5A 4CLHA 3WYCA 1LRLA 3K31A 3AI3A 2OOSA 2ZTUA 2VZ8A 1MB4A 3PWKA 4PLTA 3WG9A 4MPDA 3EW7A 4R9SA 1DFHA 4CQLB 4R5HA 5AYVA 4DMLA 1GYQA 2F00A 3AUUA 5IDXA 1NHGA 5JE8A 3H2ZA 3ZV6A 1DHTA 2D5CA 2POQX 4RORA 4OO3A 4ZQEA 5CAEA 3DZJA 3E1KA 3ENNA 3LF1A 1CIVA 2RCYA 4IY1A 1NPDA 4BO2A 3K5PA 4J2HA 1QORA 3PHLA 4NIMA 4D45A 1YXMA 4PLFA 2NACA 3ZU3A 4CL3A 1UAYA 4NHEA 3DAGA 3N74A 1O8CA 1Y8QA 3OJ0A 5L3ZA 3COSA 3S2FA 3E9NA 3RBXA 3WLEA 3VPHA 4FSHA 4AJOA 1XEAA 4ZJUA 5L51A 3I6IA 4L4RA 1ISGA 3D5QA 4WLEA 4PCVA 1EK6A 3E5RA 2HJRA 4EJ0A 4WLOA 2X0JA 4KUGA 4CM9D 2NV6A 4BO5A 1A9YA 5BNIA 3WGIA 4J16A 2O50A 3NRCA 4A0SA 1Y8RB 4BB5A 2Q1UA 4TZKA 2Y1DA 4BO1A 3PYLA 2O3QA 3KVOA 4YJGB 3EY4A 5TQVA 2R6JA 3SBOA 5U9CA 1I3MA 4XQCA 3JQFA 3WGTA 4JP2A 1Q7BA 4II3A 4FDAA 2NSDA 3ETDA 3ZW8A 3WB9A 3QVTA 4K26A 5A06A 5KWEA 3OIGA 2YJZA 3R3JA 4FOSA 4PG5A 4YRDA 1NWCA 1P1IA 2D0IA 2VUTA 4URFA 3TF5A 1V3UA 5GZ1A 2RH8A 4WCFC 4OXNA 4OYRA 4FR5A 4Q9NA 2OORA 1BMDA 3ZWBA 3L9XA 3H3JA 3DBHA 3C1TA 1FDUA 3UKOA 2X23A 4F6LA 3DMYA 3KYBA 3RFXA 3ZWYA 2PFGA 2QYTA 4BIIA 3GY0A 3DBLB 2NVUA 1UXIA 3OA2A 2VQ3A 3OEYA 1HDZA 3M2TA 4AJJA 1DRUA 4IJKA 3UVEA 3DMTA 4MVJM 1FDSA 1WDKA 1RM4A 1E1LA 2J6IA 3GAZA 4K6CA 3PQEA 4KDEA 1U7TA 1WNTA 2IYOA 4B3IA 4D3SA 4Y6RA 4OJNA 1E3EA 2W2KB 4MP3A 1QLJA 5I7FA 3H9GA 4ALKA 3DAFA 2O4UX 5IDWA 4YEDA 2HDHA 3HB5X 2C7VA 4OKIA 1H93A 1EZ4A 1GYRA 4FC6A 4IQ0A 1UZMA 5EQDA 1YBMA 2VWPA 3CTMA 3MZ0A 2IZ1A 3FWZA 5ER6A 3HHPA 3PHIA 1Q7CA 1QV6A 2UYYA 3G17A 1PX0A 5L4LA 4KWIA 4L4XA 2OP0A 3GMDA 3ZNQA 4BKQA 5G0VA 1E3WB 3I9LA 1ZK3A 1KEVA 4NMHA 3VZSA 1ZNQO 3ZNPA 4J9UE 1YQXA 4CR7A 4FFLA 3ZWNA 3JCZA 4OQYA 4XJSA 1U2DA 1XWFA 5CG1A 3V1YA 3ZWPA 1CWUA 1XSEA 5BNTA 4UEJA 4OXKA 5L9AA 2OO5A 4M49A 1KS9A 1NVMB 1PQWA 1Q0HA 4M8SA 3GH3A 1NQTA 1ZK1A 3E18A 2JCYA 3RFVA 1T1SA 3FF4A 4CQMD 3LYLA 1UJMA 4AJNA 2XPCA 1LEHA 2CD9A 3MTGA 1Z75A 2GF2A 2A9FA 4R5MA 1LC0A 4ZHSA 3OQ1A 1WPQA 3DEYX 3VKVA 1V35A 4LVUA 1J0XO 1DJNA 4EEXA 4AJ1A 1OOEA 4LRSB 1GCUA 1KBZA 4RJTA 4BNZA 4DMMA 1EUCA 3AM4A 4TMFA 5KVCA 3FNHA 4NBRA 3PQDA 2QYSA 3DBVO 5HTOA 5TIIA 1RM5A 1WZEA 4XRRA 4A10A 4RCVA 4DC1A 3MJTA 4AJIA 1B3BA 4BVAA 1Y9EA 4YJFA 3DAPA 2W98A 5CDTA 3TFOA 4CLDA 5BT9A 2JCXA 3N58A 3OIFA 4J9VA 1M76A 4ZICA 2B37A 4P4NA 2Y1FA 1WMAA 1KC1A 1Z82A 2GD1O 2ZJ0A 3DXFA 2AG8A 3Q2KA 4JQCA 3C7AA 3S1LA 1YDWA 5DN9A 4CM8A 3WFIA 2PKQP 2JL1A 1DLIA 4E5PA 4NJMB 3GVXA 1NAIA 1H2BA 4C4OA 4DBVO 1CYDA 5ITWA 4YJHA 4GVXA 1NHWA 4UUPA 4DL9A 5KTKA 2R00A 2VYVA 2Y66A 3NTOA 1PGQA 4PGFA 4QECA 1HL3A 2HKIA 4E30A 3C1AA 5J23A 3C7CB 3AUSA 4Q3AA 1UP6A 1UP7A 4BO7A 4R69A 4MIEA 2JD0A 4EI2A 3IKTA 4EUEA 3WJAA 3HDYA 3BTVA 2OL4A 5TGDA 3ST7A 4CL8A 4B4WA 3G0OA 1LLDA 3AWDA 2YFQA 1U3WA 2BFAA 1XKQA 2Q4EA 4Q3BA 1IY8A 4IQGA 2O48X 1CF2O 1PIWA 1MV8A 2AA3A 1JVBA 3DONA 3I6QA 4CMBA 2OUIA 1GZ3A 3KTDA 1YB1A 2X6TA 5GMOA 4XJTA 4Z3DA 5MGBA 5KVSA 2PR2A 1LBEA 4ROSA 3ANMA 3HN7A 2AQHA 2I99A 3NV9A 1HE2A 3F5SA 4XR9A 3AJRA 3U4HA 4W9NC 3ZU2A 4AJ2A 1MG0A 1X0VA 3HB4X 4N18A 1UZNA 2X9VA 5IJZA 4IQ8A 3JYPA 5L7TA 2GZ1A 4CUKA 3TOXA 1Q7GA 2EKLA 2P5UA 3ZU4A 4ALLA 3WDSA 4CM9A 3L9WA 1P1RA 3AY6A 1P9LA 4O5OA 3TJRA 4DC0A 2B35A 3AFNA 3RUAA 4DVJA 1G1AA 1I3LA 1I3KA 4HY3A 3RKRA 3NGLA 2RH4A 3W8EA 5H81A 1TLTA 1HDCA 3B1FA 5G2OA 2AG5A 3AOEA 1LQUA 5TC4A 4Q3CA 2BELA 3TL2A 2UVDA 4YRAA 3EMKA 1EBUA 2XXBA 4PLHA 1L7EA 5G4KB 5I8WA 2O3UA 5JPIA 4XQGA 2VOJA 2C7GA 5JDCA 2VRCA 3ZWOA 3S2EA 3HDJA 2BI7A 4XEHA 4NR0A 4XYBA 3IDSA 1ZMOA 4IMPA 4NBUA 1B14A 2NU9A 3KM0A 2C2YA 3OEWA 3ZGYA 2BD0A 3NEPX 3GR6A 4J90A 3I1JA 4BO3A 4JJGA 1DC4A 1HEUA 2DTEA 1PSDA 4CUZA 2ZKLA 1BRMA 4FBGA 3ROQA 4UEOA 2EIHA 2J5RA 2C07A 1D3AA 2AQ8A 5JYEA 2GZ3A 4JK3A 4CLOA 4WCDA 1T2CA 4D0RA 1BSVA 2BHLA 2GGSA 5IXYA 5AXAA 4LMRA 3W8DA 3F5QA 3WGYA 1F0YA 4CODB 1Z45A 3QWIA 2IXAA 2JFGA 2EW2A 2DKNA 2BMAA 3LDHA 3CMCO 4I8XA 1GR0A 1M66A 2WSBA 5TF4A 5G0TA 4BNUA 5I7VA 2P5YA 1Y8QB 2Y05A 4HFMA 4E2WA 2NADA 5HS4A 1ZSVA 1Z74A 3D3WA 4GI2A 3VTFA 3ZV3A 3HNPA 3Q1LA 4QTZA 4PZEA 2GZ2A 5FEUA 3RKUA 2PV7A 4GMGA 1D7OA 1LU9A 1F06A 2BF7A 4DPKA 1H6AA 3JQCA 3GHHA 3A9WA 2EKPA 4J0EA 1P33A 2DQ4A 3JYNA 3PYXA 2EGHA 2X0IA 4AJHA 2GLXA 3A4VA 1PZEA 3PJEA 3ZV4A 4LVCA 3MJCA 3JQBA 3D1LA 3ICCA 1GV1A 1WZIA 4B7CA 3LLVA 1LX6A 4B8WA 3WQRA 3HSKA 4IPTA 3W4KA 4BO9A 3IIEA 5EERA 3CMMA 4S3MA 1B0AA 1R37A 3ASVA 1YKFA 2IXBA 3OA0A 3GA0A 1JN0A 3D5TA 2E4AA 3ON5A 4CQMA 1LDYA 1IPEA 2WYUA 5FFFA 1NQ5A 4ND5A 1KVQA 1ULSA 1PJ2A 2HRBA 1EFKA 2ZIZA 5TX7A 2ZTVA 1R66A 1E7MA 3T4XA 4PN3A 3CEAA 5AXDA 2AQIA 1LSOA 5F5NA 1JQBA 1NR1A 3BHIA 3VHRA 4IDGA 1B26A 1YJ8A 3GEGA 4GPD1 4YYZA 1CJCA 1IZ9A 3DBHB 1O89A 1LSSA 3JSAA 1PJCA 3ETEA 4DLBA 4QFCA 2NVBA 2HMVA 1ADBA 1ZH8A 4LRTB 1PL6A 3TZHA 2UAGA 1V3TA 2V6GA 4XX0A 2GYYA 2OHXA 3K2BA 3X2EA 1OAAA 3OJOA 1LDMA 3JQGA 5TSDA 1JU9A 3RBZA 3M1AA 3GK3A 4IDAA 3KYDA 4W82A 4YQYA 5FYDA 1N8KA 3LU1A 4IXTA 5BNFA 1LDEA 1B3RA 5DOVA 4I9HA 5TT1A 2EGGA 3WGQA 4QUKA 4BKPA 1IULA 1O94A 4YVFA 3A28A 4WOKA 4CMHA 4H16A 1OMOA 1ARZA 1WDMA 3PPIA 5BQFA 1H5QA 1U2GA 3HN2A 3OJLA 5B12A 5CDGA 4GKVA 2B4RO 5T57A 4GX1A 3V1UA 1SEVA 2O4CA 4ALNA 1C1DA 1YL5A 3E9QA 2IRWA 4XYMA 4EEZA 5K9ZA 3RUIA 2J3JA 5A5FA 2HMUA 2TMGA 3GRPA 3VPFA 1Q2XA 4PVCA 1H6DA 5HA5A 4E12A 2ZYGA 4JJIA 3F6YA 1WW8A 1ZEJA 2Q45A 2ZJ1A 5LDHA 3K9QO 5JAQA 4XQ9A 1VKOA 2OFPA 3H9UA 3S55A 4UULA 3HWRA 1YBVA 3EDMA 3SJ7A 1KY4A 1PJ3A 3JQ7A 5TRTA 3W6UA 3S2GA 2CNBA 1E1MA 4BS9A 4BO0A 1IOLA 5T8KA 1AXGA 4FN4A 5EINA 3G49A 4HADA 2VWQA 1IB6A 1PS8A 1SB8A 3U4IA 4QQRA 4R3WA 2HU2A 3VH4A 3WGOA 4XYEA 3Q2IA 4R1TA 4HNHA 1MXHA 4IIUA 4XR4A 5C7IO 4RDIA 1YBAA 1CETA 3QE3A 4XQEA 1JWAB 1MFZA 1R0KA 2C20A 4DGSA 4N5NA 5ILGA 4U5QA 3JQ8A 3EVNA 3OHSX 1OC4A 3B1JA 4B3JA 3PIIA 4X54A 2AEMA 2QRJA 4IS3A 2Y68A 4EYEA 1EDOA 3MJEA 1G0OA 4FS3A 1VL8A 2LDBA 2NWQA 4B3HA 1FK8A 4IZIA 3PYMA 2DT5A 3RWBA 2A94A 4NK5A 4IUYA 1Y7TA 3GVPA 3WNVA 4E13A 4XB1A 4BO8A 4F6CA 2C5EA 4M54A 4TWRA 1KEUA 3FPLA 3DZBA 4MJLA 4DLLA 5ILOA 3TN7A 3TWOA 3VOSA 3SEFA 1QYDA 4HFNA 4YJFB 4E4YA 2SCUA 2HJSA 2AE2A 5C7OO 2V6MA 2YV1A 3KSUA 5DZSA 1E77A 5KIAA 3C85A 1YWGO 1A71A 2YDXA 3LVFO 4PIVA 2LDXA 3QJ5A 1NXQA 5T67A 5G0UA 2AEFA 2D4AA 2I5PO 2X9NA 2DUWA 3NYWA 5CPBA 3ROPA 4BGVA 1GDHA 1J4AA 1D8AA 2PH3A 4HNGA 3OQBA 4I9UA 5DBIA 4II2A 1P0FA 3WGGA 2CDCA 4MIYA 2QRKA 4YJHB 4RF5A 5A4DA 2BFPA 3BIOA 1TVEA 4KTVE 1A4UA 4NPCA 4UREA 2EP7A 3LQFA 2AQKA 3IUPA 1VC2A 3DOJA 2FPIA 4BO6A 1U3VA 5CHEA 1I8TA 3ZHBA 5I9LA 2UUOA 4NI5A 4XIJA 1ZFNA 4RPHA 4Q3EA 2BH9A 4W7IA 3AY3A 1EVIA 1ENOA 1LRKA 3G79A 2Q4BA 1PJQA 4CV3A 4YAGA 3PZRA 4DUPA 1DOHA 4BKRA 1GY8A 1Z7BA 5COBA 4FFRA 3M2PA 1MFPA 4TKMA 5AXCA 1BVRA 5COAA 1RJWA 3LT1A 2BLLA 4RVFA 1DIBA 3A1NA 3PWZA 7ADHA 4CM4A 4N54A 5HM8A 2VZ9A 2JD2A 4NBVA 1PL8A 3G1TA 2IZZA 1PL7A 1OBFO 3RQSA 5IF3A 3QWAA 1HE5A 4E2XA 3HUDA 2BFMA 1G6KA 1WVGA 3FSRA 3ZWMA 5IFLA 3VPSA 3QV1A 4YT2A 2CF6A 1EVJA 4DIBA 4NFYA 4D42A 4ZRMA 3D3EA 2A4KA 3WIEA 5I9NA 2P91A 1DIHA 3GUYA 4OMUA 3TOZA 3PJFA 3VZQA 2FZEA 3QLJA 4D79A 5LC1A 2FY8A 3RC1A 3L4BA 2JKVA 3N7UA 2C29D 4G2NA 2W4QA 1DDOA 2CF5A 3JQDA 4RPKA 2JAHA 3V2HA 3DDNA 2X5KO 3ZWXA 4KZPA 4INAA 4JBGA 5EESA 3ZDFA 2HRZA 4BNYA 3GF4A 3H6KA 4GSKA 4WE3A 1YS4A 3SVTA 2DUUA 4E5KA 1CQIA 4J4HA 1U5AA 2V6FA 1HETA 5CG2A 1QYCA 1BXKA 1O9BA 3Q11A 4AJKA 1I01A 2Q2VA 4PZDA 2GASA 2VCYA 1BWSA 1QYVA 1SBYA 2WM3A 4YB8A 5JS6A 3FTPA 3Q9UA 2ZCVA 2WDZA 1YQGA 5DDIP 5JCXA 5A04A 3JD4A 3V2GA 1E7RA 1HDOA 1O6ZA 1RYDA 4NNJA 3U4CA 5K1SA 3RJ9A 4CLOB 1SCUA 3PVZA 1VI2A 5EN4A 2OP1A 3W1VA 1C0KA 4N5LA 5KKCA 3NT5A 3VH2A 1UDAA 2NTJA 2O23A 3RIHA 5HWSA 4B8ZA 3NX4A 2I3GA 4AL4A 3VPXA 3V1TC 4WLNA 2W2LD 1GUYA 1ISFA 4R1NA 1E6EA 5B4TA 4ND1A 4J4TA 2EEZA 1PU2A 2PTGA 3D3WB 1FF9A 4XKJA 4JCOA 1B7GO 3WWYA 4TRRA 2PKQO 3AW9A 1YGYA 3GVIA 3D4OA 3FTNA 2D3TA 1HDRA 4EUHA 5L95A 4U7WA 1NFQA 5T6BA 1Y9AA 4Q3NA 1M67A 2Y1CA 5B37A 3RC7A 4L9RA 1H6CA 1YRLA 3E5MA 1P3DA 3DO5A 2PZKA 3UICA 1B16A 1EQ2A 3WXBA 4JGBA 4UEKA 4DA9A 5FWNA 4QO7A 4DLAA 3EYWA 3PP8A 3CZMA 4HFRA 2FPPA 1GZ6A 1U3TA 4G65A 1C0LA 4FFNA 1Y5MA 1YOVA 2FRDA 4BNLA 3LK7A 4I1IA 2FR8A 4EJMA 4IJUA 3DZGA 3AUAA 2X5OA 3HDQA 1P1JA 4AJEA 1LJ8A 3MOIA 3WS7A 5CDSA 5JW6A 2EG9A 1NQAO 1TXGA 1X1EA 2CMDA 1LNQA 4CQMB 2B0JA 3GDOA 5JY6A 4M1QA 1YO6A 5K0ZA 4RLHA 4IGFA 1HDYA 4P4GA 2E6UX 2VRBA 3LC2O 5COQA 1LA2A 4WKGA 3JQ9C 3TPCA 1WLYA 2ZB8A 4KDFA 2DBZA 3TQHA 1A9ZA 4AVYA 5L40A 5A3VA 3PDJA 3O9ZA 3DBRA 1DFIA 3VH1A 4IINA 4WLFA 4P38A 2VN8A 3PIDA 1U4OA 1IHXA 2EERA 4HP8A 4C7JA 1LDBA 3H4VA 1TB4A 1X13A 3EK2A 2OMEA 1Y6JA 5G4LA 4BNGA 4PLGA 5CDUA 1UXJA 5EQFA 4CMKA 3PHGA 4FB5A 5KNLA 3U0BA 2UDPA 3KYDB 1AUPA 2DU8A 4DPMA 3KLMX 3KHUA 3TNLA 2DBRA 1PEDA 1UDBA 2Q50A 3O4RA 2VHXA 4WEOA 3OECA 3ASUA 5IDYA 2BGMA 4UVIA 1PJLA 4DBZA 4DYDA 4J6FA 2I9PA 3KEOA 3ORFA 2YV3A 4MVJI 3BZUA 2HSDA 4J7UA 2EHDA 3OIDA 3F47A 5C3MA 3ONDA 5ITVA 1OI7A 3FNFA 4L74A 1DJQA 1F8GA 4OH1A 4E6PA 1C1DB 1TT7A 4BGEA 4AJLA 3JYLA 4KP7A 4LMPA 2YHUA 3MWEB 1YE3A 3NTRA 4DREA 4ZQBA 1ZZEA 3GG2A 3R1IA 4TKLA 3PTZA 1KC3A 2PZMA 3DZHA 5CDYA 2BFOA 2FZWA 4XGNA 3WSVA 3JQ7B 5L53A 3LF2A 5JAMA 3HDHA 2OBNA 1BVUA 4WCFA 3MCVA 5L7WA 2J5QA 1KEPA 1U4SA 4Y6PA 3O8QA 3T7CA 3JD0A 3PXXA 3ZV5A 3SC6A 5KCZA 5KVQA 1Z73A 5F1KA 2G5CA 2FHSA 3P19A 3Q3CA 1NTOA 1J49A 2DPGA 1ZK0A 4BNVA 2WD7B 1N5DA 3S8MA 3JQ8B 5FI3A 3RAJA 1SO8A 2G0TA 2JCVA 1NAHA 3U9LA 3KYCA 3LT2A 1NVTA 1R16A 1RWBA 2GO1A 3ZHYA 1RPNA 3P2YA 4RVSA 1P1HA 2P9GA 3UCEA 2B83A 1C0PA 3HFGA 5FF9A 3MJVA 4UUOA 5BSHA 4YA6A 3PWSA 4MP6A 3BMOA 4K1LA 4RVHA 3QA9A 5A03A 5KJEA 2PA3A 1CDOA 1M6HA 3FNEA 5K6AC 3NJ4A 1NWHA 4IZHA 4CMGA 1EEHA 3AI2A 1K2WA 1QMGA 1DXYA 5KJ1A 1LLUA 3WYEA 3BTOA 1GCOA 3VPGA 3AOGA 3BMNA 3LSYA 3ZWAA 2WMDA 2ZB4A 1NPYA 3DHEA 2ZB7A 1NM5A 2Q1TA 1I32A 1J6UA 1ONNA 3NT4A 3PEFA 2EF1A 1SZJG 5LCXA 1JVSA 4EZBA 3DTTA 1N2SA 3NDRA 3ZHXA 4EW6A 1GZ4A 1SOWA 1VM6A 1GQ2A 2PNFA 1B8UA 4J4BA 3QQPA 1DFGA 4BQRA 2ZYDA 4R01A 3QWBA 1P31A 3JD1A 3I9OA 2QZ9A 3ADPA 3UH1A 4UVGA 3K96A 4M89A 3VZPA 1EMDA 4CR8A 3I9NA 2HUNA 1XDWA 4H7PA 3H3FA 4EUFA 1XQ1A 5IXSA 1WP4A 3ENKA 1ZEMA 2HQ1A 1GQQA 4YT5A 3AM5A 4BNWA 1W6UA 1CRWG 1N92A 4BUCA 4FOOA 4UUNA 4EJ6A 4R9RA 3NJ8A 4ESOA 1CQJA 1EE9A 4UVHA 1OFGA 1UP4A 1JWBB 1QR6A 2HCTA 3ITDA 5AXBA 2WE7A 1UXGA 5JLAA 2P4QA 4S1VA 1HSZA 3FRJA 3FR7A 4L76A 5LDGA 2DTDA 1JTVA 2EP5A 4A2CA 2W2LA 5BSGA 4K9DA 3M6IA 4Z9FA 4CM4B 1SOVA 4E5NA 2EW8A 2YQ4A 3WX0A 3DB2A 3AI1A 4BNNA 3ZU5A 5BSFA 2FOIA 1FDWA 1HTBA 3FHLA 2I65A 4E2ZA 2VHVA 3Q9NA 5DP2A 3OJEA 2XXJA 5FI5A 4RDHA 2DBVO 1PQUA 3GPIA 3EZLA 1ORRA 3GFGA 2PZJA 3OQ6A 4J1QA 4CV0A 1SMKA 1XYGA 1YJQA 2E49A 3DFZA 4J7CA 1ZSYA 3PHHA 4MVJF 5IZCC 3I9JA 1E7YA 3BYZA 3MEQA 1P0CA 2HAEA 4LCEA 1JW9B 2HK7A 1R0SA 1DRWA 1GL3A 4CMJA 3DHYA 1YB4A 3PJGA 3KLPX 2X86A 4UUMA 4RF4A 3GVHA 1N1GA 4PLYA 4RPGA 2WEKA 1Y5RA 3ANLA 2J3HA 4MO2A 2UUPA 1FJHA 1H94A 1ADCA 3W6ZA 3LT0A 1NP3A 1R4MA 2QIOA 3H65A 4L4SA 4NK4A 4WUVA 2D1YA 3WMXA 1UUFA 4DIFA 3U49A 3JQAD 3QSGA 3EUWA 1D1TA 3B6ZA 3H5NA 3GZNA 1VE9A 4GH5A 1LUAA 1N7HA 4YBZA 4IBOA 5CPFA 3LT4A 4JLWA 3L6OO 3WTCA 4D7AA 5A9SA 5ENVA 1DC5A 3LC7O 3F1LA 3RC2A 3HG7A 3K92A 1SEPA 1P74A 2DC1A 5T5QA 3UCXA 1Y81A 3GT0A 3INRA 3GFBA 4PZCA 2QQ5A 3FCOA 3WWZA 2NQTA 2HLPA 4LN1A 3O38A 1DHRA 2PZLA 3RCBA 5ES3A 5F1OA 3DR3A 5KKAA 4E3ZA 3MOGA 2Y0EA 2EV9A 1C3VA 1UH5A 2FR0A 1GPJA 1LXCA 4ZD6A 3DZIA 1U3UA 2D2IA 4BMSA 2GN6A 3U4DA 3UXYA 1ZK2A 2O7SA 4AJ4A 3INTA 2JFHA 1E3LA 2XOXA 3RUHA 3VZRA 2CY0A 3TZKA 2X4GA 4R51A 5CEJA 2CSUA 4FFMA 3SLKA 3KEQA 4BNHA 3V8BA 5A02A 4O1MA 4DXHA 5GZ3A 3IAHA 1DB3A 1YOVB 3TFQA 3WQSB 2Q99A 4RQUA 5BR7A 1JAYA 4XA8A 2NVUB 3INGA 3WFJA 5JO9A 1X14A 2W90A 5I7SA 2W2KA 3ZH2A 4LSWA 1R4NA 5F5LA 2ZQYA 4J1TA 1ZUD1 3D7LA 1UXKA 1TI7A 3QWHA 2X5JO 5L45A 3IKVA 2VTEA 4NJOA 2I3AA 4BMNA 2BKAA 1QYXA 3KXDA 5I7EA 1F8FA 4GVLA 2I76A 4BNKA 1M2WA 2HK8A 1TA4A 3DBRB 3EC7A 1I33A 3DC2A 3ROKA 5JC1A 1S6YA 4L8VA 3SX2A 4FFPA 4YAJA 4DRYA 4Y67A 4EITA 5ADHA 2CDAA 1I3NA 3QHAA 4ZA2A 4OIMA 3BXXA 4B7XA 4BNXA 2FSSA 5THQA 4FC7A 3JD2A 4RF2A 1A7AA 1W73A 2PWZA 1AE1A 2E48A 1X0XA 4W4TA 4ZVVA 4BNTA 1LDNA 2WJPA 4J1SA 3E03A 1T2EA 3E48A 1RM3A 4BNJA 3IL2A 2YQ5A 3PK0A 4P22A 1XELA 3UHAA 2A92A 3UN1A 2O3SA 8LDHA 4WLVA 4OOEA 1AHHA 5DBGA 1XHLA 3ROMA 4LISA 1T2DA 1NR7A 2O3RA 3H9JA 4XCVA 4Z6KA 1QP8A 4MVJH 3X2FA 3PJDA 5F21A 4BNMA 2VNAA 4JP3A 2G1UA 4W6ZA 3WNQA 2XAAA 3B20A 4D3DA 4WK6A 2FPGA 2RHCA 3DQPA 3SJUA 5F3RA 4F45A 1KERA 1D4FA 3RUDA 4WEQA 1IL0A 2PH5A 2EWMA 4OXYA 4E31A 1ZXLA 3GHYA 1DC6A 3NTQA 2CUKA 1YQDA 4CMEC 4MIOA 1BW9A 1J5PA 1E5LA 4E5YA 4TROA 4WCFB 2NTNA 2GR9A 3PQFA 1KVSA 2PD3A 3WYBA 3QY9A 4XIYA 2IEBA 4Z0HO 1HE4A 3GQVA 1ADGA 3O8QB 3FR8A 4RVGA 2H5LA 3BAZA 3RI3A 5TLSA 4CM5A 3RROA 2P9EA 2AHRA 3UCFA 4OKNA 4GLLA 3L4SO 4R16A 2E37A 1LSUA 3ZHZA 3T7EA 2YW9A 5A9TA 2J3IA 1HYGA 4U6SA 5A3JA 5JDIA 3KYCB 3WGHA 2C0CA 4KQWA 4BV9A 3SC4A 3HQ4O 4Y98A 2GSDA 4CM8B 1N9GA 1AN9A 1BDMA 4JXKA 3Q6IA 3HE3A 3OBBA 2EKQA 4EDFA 3QVXA 4GSLA 3WBFA 2Q2WA 3L0DA 4ZQHA 4MP8A 4QEDA 3IC5A 1F12A 4Z0TA 3K8ZA 2WE8A 3I4CA 4ONEA 3FBGA 3GG9A 3EGOA 5I9MA 2DFDA 3MWDB 2GCGA 3BMNB 3HFSA 2OXIA 3GGPA 1U5CA 3RD5A 4E32A 4ZU3A 3ADOA 4NG5A 1EVYA 3K30A 5IN5A 3QVOA 1VJTA 4R68A 4IJWA 1H9BA 1L7DA 3L07A 4OOFA 4HFJA 5HBRA 4R3NA 1BDBA 1I24A 1C0IA 3WR5A 1MP0A 4M87A 4KUEA 1UDCA 4BQPA 3QW2A 5DOZA 1BXGA 4LW8A 4IS2A 2VHZA 5IZ4A 5DT9A 1MX3A 4JBIA 5L7YA 5L4SA 1P44A 1R0LA 5MDHA 4XZ3A 2Z1MA 1YONA 4K6FA 4Z9YA 4JN6B 1E6UA 4JBHA 3JTMA 2P4HX 1E5QA 1IHYA 4YR9A 4PLVA 4NDNE 4E5MA 3JD3A 1EVZA 1NX6A 3AU9A 1PJTA 1RKXA 3O03A 4OSOA 4OSPA 2Y1EA 3RUEA 1I2CA 1DC3A 2YHIA 1X7GA 4ALJA 1WAMA 1K89A 3OP4A 4OAQA 1GEGA 3JQAA 5L4NA 4PRKA 2IYPA 3NAQA 4NQZA 4PG8A 1U7HA 4QSMA 3JQFC 2Y1OA 3AK4A 1V8BA 5AOVA 4J2OA 3BTSA 1DO8A 5DULA 1O5IA 3GUCA 4RO0A 1V0JA 1YL7A 1LSJA 1E7SA 3ZNNA 4NZ9A 4IM7A 4GLOA 3WMWA 2AMFA 3STHA 3GPDG 2WYVA 1BG6A 1GYPA 2GNAA 3CZRA 2Y1GA 3QVSA 4NH4A 4M86A 1YB5A 4CMIA 4FW8A 5HRUA 4BNIA 4I5EA 2B36A 4Y6SA 3P2OA 3U62A 1T25A 3GNQA 1CERA 3BTUA 2VYVD 1PZFA 3RC9A 1W0CA 2NU6A 1A72A 1VL0A 2ZTLA 3RUCA 2JAPA 2UV8A 4GWKA 1AXEA 3RSHA 4DQUA 1K0UA 3DMTC 5JC8A 2D59A 3CH6A 1XLTA 3F4BA 4G5HA 1PZGA 3VH3A 1GUZA 4O6VA 2VZ0A 1YVEI 1DIRA 3VKUA 3PGJA 4I5FA 1H9AA 1I5RA 3CSDA 3TZQA 1U8XX 3OSUA 4TRMA 5TS3A 1BGVA 1I2ZA 2Z1NA 4WECA 2Y67A 4FQ8A 2Z5LA 4RPJA 3IOYA 2CZCA 3ETGA 4IJVA 5DP1A 3CUKA 1PQPA 4YXFA 2PGJA 1PS0A 5EIOA 2ZCUA 1NBOA 2BGLA 3FD8A 5TJHA 3HADA 1R4MB 5DF1A 3H7AA 1ZO8A 5B4UA 1LC3A 3BHMA 2E82A 4ALMA 3VC7A 1H2HA 4WLUA 3T4EA 4A26A 1CEQA 4OM8A 3CE6A 4QO8A 2A35A 3R6DA 1YL6A 1DRVA 3AM3A 1M75A 2VUUA 5JXWA 4R1SA 2WD8A 1YDEA 3GZNB 2Q49A 1UR5A 4OGWA 2YYYA 3OICA 3GC6A 1A4IA 1R6DA 1X1TA 4IXWA 4XWYA 4ID9A 4PLWA 3GNTA 4EBFA 3NT2A 2RHRA 2CVZA 2JJYA 1T4DA 3E9MA 3PDUA 4N5MA 4PLPA 4XGKA 5A9SB 3MJ4A 2ZATA 4CLXA 1P77A 1XCBA 1NFFA 4IDFA 3GOHA 3OH8A 4GX2A 1HYHA 4IDCA 3RJ5A 2X8LA 4PG7A 2PKRA 2VRCD 2H63A 3F3SA 3EVTA 3UAGA 3R3SA 4R54A 1PJBA 3E82A 2NNLD 2DVMA 2Y93A 2DTXA 2O7QA 2GDZA 2I67A 3PI7A 1DAPA 2BI8A 5DCWA 1C1XA 3M1LA 4YWJA 3GDFA 2P2SA 2JD1A 1KETA 3D0OA 4O59O 4OQZA 2Q3EA 1MG5A 5C37A 1WXDA 3CINA 5KVVA 3W4JA 4IDDA 2P9CA 4DIOA 2FN7A 5ICMA 1SPXA 4TRJA 4PVDA 1E3IA 4I08A 4Z3KA 4J7XA 5JYDA 2JHFA 2G82A 4WJZA 3S2IA 3QIVA 1LI4A 2X9GA 3K6JA 1EDZA 3A14A 3ICPA 2CFCA 3PGXA 4FIZA 4J3FA 2NU8A 4ZN6A 1YH3A 3MJSA 4CM6A 4E0BA 4PG6A 3F46A 3H2SA 2GRAA 4NBTA 3KB6A 1ZXBA 4AJPA 2PD6A 2W8ZA 3ZZNA 1FMCA 3ZN2A 5JO0A 4YPOA 5EMHA 2TMDA 2PLAA 5JAZA 3I83A 1WDLA 1R4NB 3JQGB 4GGOA 4CJXA 5JMWA 2H9IA 4HX5A 3RBVA 4RLSA 4CV2A 3OJFA 9LDBA 1K6IA 2ZB3A 5KOIA 3SLGA 1UAGA 4BKUA 4BKOA 1TT5A 4WPGA 4A73A 4YTEA 4UAGA 1VKNA 2V7PA 3I4FA 3QWFA 7MDHA 1ZCJA 2R00C 1TEHA 4AFNA 2ZK7A 2BGKA 1U9JA 3LC1O 3C7DB 4XYGA 3MTJA 1BHSA 5JCJD 4CM1A 1IPFA 3GNSA 1QSGA 2IZ0A 2X0NA 2B4QA 4TRNA 2YY7A 3WIDA 2GN4A 2ILTA 1V9LA 1HF3A 4BO4A 4LCJA 1P1FA 1I30A 1HDXA 2NQ8A 2NVWA 3DWFA 1MUUA 1WWKA 1GD1O 2EJVA 2FSVA 3P7MA 5DBFA 3ZCXA 1RYEA 3Q0EA 4E21A 3ZW9A 4YT4A 1T24A 3KSZO 1NPTO 4NBWA 3ONEA 2X7HA 4Y9DA 1GADO 4ZQFA 4IDEA 1ZJYA 5H83A 4BV8A 1IYZA 5U4QA 3I23A 1QYWA 1KOLA 2Q46A 4Q3DA 3DL2A 4FJ1A 4EGFA 1Q0LA 3DZFA 1ZMTA 1F17A 1DSSG 1PJSA 4O0LA 1PR3A 5ENDA 1HSOA 2J3KA 4MVJE 2ZYAA 4JIGA 4YAIA 4ZGWA 1K6JA 1BW9B 2VUSA 3VVCA 3JQ9A 2JFFA 3TRIA 3RVDA 4D3FA 5KJFA 3F9IA 4BB6A 1JKFA 4CM7A 1SB9A 1B15A 1C14A 4KUHA 2B4TO 4WNCA 1I36A 3AOEC 3VDQA 2QRLA 3QRWA 5DCYA 1N7GA 4RVUA 3RASA 4FGWA 4MVJP 2IDZA 4TZTA 4JX8A 5JDCC 4Z9XA 1PGPA 3ULKA 3IP1A 4XDZA 1IE3A 4GQAA 4WNIA 3H8VA 4YAKA 3TZCA 4FD3A 4IIVA 1XU9A
chains in the Genus database with same CATH superfamily
3SR4A 3BWMA 3H13A 1FNCA 2VSQA 3GMTA 3PFBA 4NEHB 4QRIA 1VLMA 1TEVA 1Y1KE 5AHWA 1LDGA 1HXHA 5FQOA 2ZE5A 3NGXA 3PFIA 3C98A 3HLTA 1KEKA 1Z38A 3KR1A 4TVOA 1KKMA 1U2SA 2QUBA 1FZTA 2MINB 1N6KA 2IXFA 2J09A 1MGOA 3EEFA 3UMJA 2ZBGA 3DOOA 3FFTA 4AYWA 3SBXA 2Q1SA 4PR3A 4TYWA 1MQ8B 5SYNA 3ISVA 3WLOA 2G9NA 3HMKA 2DM6A 1LLQA 2A14A 3KO8A 3MSXA 3MD9A 1QJCA 3GMSA 3CXRA 1V9SA 4HDSB 1JB9A 2IXGA 5D3ZA 2LR0A 3NHKA 4OKSA 1O6BA 1P45A 1SVOA 3AUKA 2WJVA 4BMYA 4F4JA 2JLYA 4U39A 2QL6A 3H7IA 4B09A 2PGLA 3CT6A 2VWHA 1W0JA 2X7JA 3GOQA 1GPDG 1TE2A 2D7CA 3F49S 3K5HA 5E9JA 5EZ5A 3RTBA 1YU9A 4RA6A 2Z95A 4D44A 5A6SA 3U44B 5BR1A 2XT6A 3TPZA 4ITUA 4DE5A 1MZVA 1R9GA 1F14A 1XCGB 3UFXA 2JHCA 2OXFA 5IJ9A 1HWYA 1HE3A 1NBEA 1MABA 2GBIA 2PK3A 1EEXB 2VHJA 4RXTA 2R6FA 3QKRA 1P4JA 4X1YB 2YCLA 5H82A 4H6PA 3W6NA 3FOZA 3WLFA 3W05A 4UPDA 3L8YA 5C53B 3DE2X 4AUMA 4BAGA 4O2AB 3DQZA 2JFQA 2QE7D 3ANNA 4QUEA 4U9HS 4HDRB 5AJHA 3FLEA 5BOSA 5C80A 3AZOA 3VFDA 2A5FA 1A8SA 2Q4OA 3KQPA 3Q0TA 5TPWB 5G40A 1UZAA 1PFYA 1ESZA 2YWJA 3EZYA 4ALIA 2F1IA 3QPUA 3C8DA 4O5AA 5A9RA 1L4KA 2IE8A 4R2WA 1ZD8A 4ARUA 2PUEA 2YHIB 4HQRA 3IP3A 1NBWB 2Q07A 2FMHA 1LPMA 1AIPA 4MWZA 5C4GB 2W48A 1POXA 1CR1A 2IDKA 4BECA 1P7VA 2C2HA 1X1CA 3BHJA 1MB3A 3HYSA 4HNQA 5FWAA 1KK3A 1NXVA 1NI5A 1WB6A 2IFTA 1FPQA 3HYTA 1QIEA 1VMDA 5ALLA 3ZX5A 3HCFA 4G0WA 1YUNA 1KOJA 4ILKA 2PT6A 3V7FA 5K6AA 3PFWO 3SXPA 3PB3A 3K20A 1WQ1R 4P8RA 2B3DA 4CQLA 5D01A 3LY8A 1UODA 2G72A 3DTYA 4IMIB 1ID1A 4W99A 3EXFA 3IMFA 4E5VA 3QX9A 4DLXA 3EPPA 2GM4A 3IH5A 3GI1A 1NJ8A 3WLRA 1JG4A 3MWYW 1TM4E 4GMHA 2QHXA 4KN5A 4HUJA 1E0DA 1G21E 2G67A 4K88A 5IP5A 1MNQA 3RPEA 5CEFA 3AT1A 6ABPA 1T3GA 3P9QA 4GO1A 1FFGA 3DKPA 2F9FA 3GJ0A 1DIGA 2ENUA 2OQRA 5FJIA 3A1UA 2BAGA 2VOEA 4XSGA 2R8PA 3TLGB 3TLMA 4EENA 2Z08A 3BDAA 3E3LA 1DMSA 1EAYA 4F2DA 4DT1A 3IO5A 3R7LA 5I45A 3QFHA 1Q0QA 1MXFA 1QZTA 5F33A 3AEXA 2VYND 1WXGA 4ETMA 2B61A 1KI3A 3RLIA 2FPUA 3N53A 4E33A 1DIAA 1G20E 1KAGA 3ZBTA 3JALA 1W4AA 3CPJB 3OLXA 4Z0PA 1EWQA 2GPTA 1QQAA 3VR6H 2CD7A 1CK4A 3L7AA 2NUPA 4W9NA 5KCMA 5HFJA 2IODA 3PC8A 4FCTA 4U3JB 3VNSA 3PU6A 3A9RA 3I09A 4QIHA 2I4TA 1O6GA 1SUWA 1JLMA 2EJWA 5KO2A 1E1CB 1V5GA 4PYMA 5DLQC 1WXQA 3THSA 5F7OA 5LMCA 1M6VB 3G8CA 1N6LA 1IVNA 1O5OA 4KC0A 2ZWOA 5C7LO 3LCVB 1WHSA 2I2FA 3MWJA 3QBVA 1C7QA 2B94A 3W4IA 4BC1A 2UUAB 4R81A 1PFKA 4KGXA 3C1OA 1OXSC 2B2XA 2C3MA 5F5XA 1EAMA 1U65A 4PANA 3ZEIA 1OBHA 3OF2A 2OYSA 1X38A 2JBWA 1L3IA 2VP5A 4QBFA 4QXRA 1DWPA 1SXJD 4FPXA 3NUQA 2OVFA 3GRUA 5D8DA 1B2RA 1CUXA 4UVEA 1J20A 3BRSA 1GCIA 3AGQA 4XYLA 3N2YA 2R6HA 2R751 1V9CA 4XUCA 4XRGA 2QX7A 3DEHA 1DPGA 4GL4A 1HE1C 2TMYA 4ERXA 5HIKA 4MK4A 3PDIB 3I0NA 4F4FA 5LD2C 5FYQA 1JYEA 3F78A 1NKVA 4D9FA 2QJOA 4GLBA 4TQGA 2EX1A 3CBQA 5TXGA 2AK2A 2EXXA 4C4XA 2CCKA 4D98A 2V4ZA 5C51B 3LH5A 4O33A 4EY8A 3EASA 1AZWA 1CCWA 2PA0A 3KKPA 5JY1A 1UKVY 3CRQA 2PD4A 4X7PA 1CKEA 1AN0A 3ZY2A 1CR6A 5CFZA 1SWVA 6Q21A 2R1VA 1E94E 3K1YA 4NAUA 4M8IA 3U48A 1E5DA 3HA7A 3KR0A 4IIEA 2W6ZA 5B1HA 1AT1A 3VVLA 1S1CA 1Z6QA 5K3EA 1QGED 1S1MA 5G0WA 4E7PA 1C1XB 1N2CE 1E9BA 4RTSA 4ZFNA 2ANCA 1YE8A 4LZJA 1N5JA 1S9HA 1E8MA 4ZANA 1Q12A 4KQ6A 1Y5NA 3STXA 5A62A 3SP1A 2DHRA 3I3OA 2QK4A 3TFWA 1VG9B 1XJ5A 4DM7A 3CRNA 3MMSA 3A2MA 2AN9A 1TK3A 3U13A 3WRXC 3FFBA 4X64B 2ANBA 3KVNA 4QDTA 3W90A 3SYKA 4ZALA 4ZAWA 1YDGA 4M0PA 1GWNA 1VJRA 2OESA 3KOUA 4NZNA 4IHJB 3GRKA 3R3YA 3GCXA 1U2QA 3ABIA 3FYDA 4Y9RA 5EIHA 3WBBA 4WBNB 5KYXB 5IKXA 3H11B 1CQWA 1QP7A 1ENZA 2OBXA 2HL6A 4IJ6A 4V24A 2OAQ1 4B0OA 1THGA 1JU3A 4TVBA 1Z6XA 1B8VA 2VDQB 2QD3A 1USKA 1EQUA 1RZ3A 4KO8A 2RG7A 1KAEA 3JYQA 3ETNA 4G1FA 4LC0A 1XA0A 3SX4A 4EMSA 3KV3O 4FT2A 3FCYA 3S2SA 1WDWB 3HU3A 4RH3A 2OOKA 1UANA 4O29A 3X1MA 4UBOA 4PGAA 3DE6X 2CHGA 1LPBB 3IS3A 4MWDA 5B7QA 2G6TA 2ZPUA 5DB4A 3KSDO 1MA0A 3V5NA 1GUFA 1WCXA 1ISSA 4AWAA 5KJ6A 2O8FA 5AKEA 5LNK1 1COZA 4ARCA 5IDQA 3IAUA 2A78A 3DM9B 2NZWA 5F1PA 5FWYA 4PO1A 2C9DA 1LTQA 1TZKA 4QM6A 5J40A 1IG0A 1CS0B 3KEMA 3U3XA 1UKBA 4MVJA 1XNJA 3ECSA 1SOUA 2L69A 1QG6A 1V16A 1OB2A 3B89A 2JPDA 1GSAA 4MMZB 3RTEA 1GXSB 4G0XA 4GMDA 1Y6GA 4LF7B 3K73O 2QL7A 4QBGB 4UNIA 2XYQA 4FJ2A 4QDJA 1W44A 1GPH1 2JG3A 1WCYA 3TLYA 4WASA 4RK0A 2B5VA 1E79D 2QENA 3CY6A 5KNBA 2ZCJA 4OGGA 1EVKA 4MB0A 1D1SA 3CRW1 2JA2A 1MJGA 2RGNC 1EK5A 4DGQA 2Y0BA 4A5OA 1GTG1 1N1EA 2H1SA 4CL2A 3O94A 2X22A 2KX7A 1T15A 3MTEA 2WJYA 1G0NA 3HM2A 4MX8A 3WIOA 5HKOA 2FF7A 4UHBA 4WOCA 3OC6A 2JATA 4X3PA 3RF6A 3N8NA 4MB2A 4BB9A 2V97A 1KYYA 3H5IA 3SZ3A 3PRJA 4JEUA 1UMCB 1WP9A 2F9MA 4L2IB 2IDJA 4H3VA 4LJYA 1ODJA 4UHCA 4B81A 2C7OA 3GZ4A 1CQZA 4WERA 1DXOA 2ZRJA 2OAGA 4AICA 3H1PA 3GP5A 1A5ZA 4RKRA 3ZCTA 3WTBA 1NX9A 5K8CA 1Q19A 1QZZA 2IYSA 3T1VA 1DV1A 4AM8A 5JBIA 5ELXA 2XB2A 4ZK2A 2IUEA 4ETWA 1VHLA 2G0AA 2Y6VA 2YX1A 3AWIA 4OHUA 5I8ZA 2C2KA 4AO6A 1PGOA 1QGZA 3DHNA 1I9GA 1Y42X 3A6EA 4PBTA 2PL5A 4QEZA 1A69A 3IBGA 4PNZA 2ECKA 4Q7JB 5FADA 5EJ9A 3X0DA 2W8BA 4K28A 4P4LA 4EW1A 5DHPA 1A5TA 1VE3A 4NJMA 2BM1A 5EIAA 3EZ6A 4J0KA 5E3IA 4AAYA 2FG6C 3IUSA 3N0WA 4POAA 5E3JA 2JHGA 3X1KA 4RTRA 5DXJA 1Z0KA 4BXOA 4V0OA 3RQIA 1HQKA 1XZJA 1I10A 2IYNA 4C78A 5ICSA 3IPXA 3GFPA 2YXLA 1KO1A 4CCYB 2DXIA 3HABA 3JQ6A 1PK9A 1CU1A 1R5BA 3GJ8A 1QANA 4DEVA 1E6MA 1WG8A 4JDUA 4X7BA 4LECA 4AG3A 1G3RA 5DHUA 1OV4A 2CKDA 2DKOA 4EQZA 5KNCH 3R3HA 4ARZA 3G2QA 2O2ZA 1TO2E 3E5NA 3H9EO 1U0BB 5IBRA 4ZPJA 3RU7A 4PAGA 3K0EA 3RTAA 4I2NA 1GNPA 3UXMA 3WZ2A 3QKTA 4ND3A 4YMSA 2VA8A 4CR6A 3F4KA 4TWZA 8ATCA 3JWHA 2ZZMA 1GV0A 4XJXA 3IR7A 1JFFA 1FXWF 3VR4D 3IJRA 4O8CA 2I6TA 3KT3A 4QULA 3PFFA 5EE3A 1UMBA 2AXPA 1A88A 2FWBA 3BWBA 4PYNA 4RESA 3TIIA 1GAEO 1N6OA 4M7OA 4RD2A 5EVCA 3GLQA 1U0LA 3RYFA 4D3DA 4DQXA 1IN5A 1M54A 2HCFA 1FDTA 2HMTA 1E7QA 3PZBA 4JJFA 4PQYA 4CKYA 3COVA 2P68A 3HJGA 1ML4A 1S7GA 3HR8A 2OFOA 3RVKA 1QBKC 4MIKA 1ZY2A 5LOVB 3DO6A 1P0MA 4MW7A 1A2OA 1T1RA 3CLKA 2IHVA 2FGJA 1TYCA 4HGOA 3TQTA 1QTQA 1HFWA 3PHJA 4IV8A 3IAM6 2B0CA 3ZWVA 3H75A 4B6QA 1VSVA 1XRJA 3BN3A 1JLSA 2VP0A 3FWNA 1MC5A 2PGIA 4I4NA 1LQTA 1QHFA 1XBTA 1O57A 4B87A 4ZEVA 1YR8A 4TT3D 2EJTA 4A27A 1NN3A 2QSUA 5A6SB 1AKYA 5GJBA 4HBGA 3UFXB 3ND6A 4WKOA 2FB9A 1EQAA 3E5HA 1KVUA 4IHJF 1JE0A 4HJXA 3KYIB 5K1ZA 2VPIA 3QKRB 4LFCB 2WSMA 4HX9A 1W4CA 4RL6A 1DCTA 3MELA 1ZSNA 4UZSA 4BFZA 2GEFA 3EAGA 2WTUA 1CNFA 4D9BA 5KHOC 2I4LA 3H5RA 4B3MB 2NO1A 3OMLA 4UE6A 5BOSB 2JEOA 3G5MA 4CMAA 3O4IA 4KWHA 1XKXA 1I4OA 4Q21A 1QK5A 4ARSA 1L5RA 1UBTS 2NAFA 4QDOA 2XKBA 3N0VA 2V7WA 1B2LA 5HS6A 1QP4A 4GHWA 1EWYA 4HWKA 4LQCA 1YBFA 1T2FA 4X95A 1KSFX 3EPJA 2I8AA 1D0IA 3AKCA 3GAMA 2Q7OE 1LRJA 4NYIR 4H3SA 1BWQA 1LTHR 4HB0A 1VJ1A 1Z0ZA 2WAMA 2XVXA 3C3EA 3SEAA 3JAKA 4GE3A 3D8NA 3KE8A 3R3UA 1LRLA 1YA8A 1R6BX 2IIPA 3WYCA 3T0IA 4Z4HA 4BVGA 3T06B 3OCWA 1U8UA 1FLVA 3JVEA 1CUVA 1E4EA 3CLTC 4PLTA 1KO5A 3E3OA 4MPDA 3W5VA 3QYJA 3DD1A 1DQSA 3EQ2A 1OYOA 4R5HA 4CQLB 1GYQA 2EFGA 2WU8A 2XCUA 2GRJA 3PXBA 4MRSA 4PSDA 3FIUA 3EXFB 2ATVA 2I6XA 2D4HA 3B8HA 1DHTA 4RORA 1TC1A 2CJPA 4ZQEA 5JJIA 3E1KA 3GLTA 1Q91A 3LF1A 4IY1A 1VA5A 4HGNA 3UANA 5C4MA 3S3TA 4NIMA 2P30A 4D45A 4PLFA 5FEMA 3UBTA 4JC4A 1XVAA 3ID6C 3ZU3A 1UAYA 4NHEA 1G8YA 1Y8QA 2CLEB 4DT1B 3S2FA 4Y30A 3ZQUA 1IAQA 2W6CX 2ZIEA 2HDOA 4HSGA 3DW1X 5AM1A 4LF9B 6NULA 1RWXA 2I78A 3NWEA 3B13B 1R7RA 5K4HA 2HC9A 2Q41A 1EK6A 3IQWA 3B2QA 2KMLA 3SHVA 3TVYA 1W5SA 1NV8A 3OZXA 4AQ7A 5LB2A 1Z25A 4DMRA 4WLOA 4AYXA 2Q5OA 4LHZA 3JALB 1O0CA 4KHPB 3EGIA 2HV8A 2QM0A 1Y8CA 2WK1A 1KR5A 1JFVA 2NUPB 4O2BF 1JHYA 2O50A 2YUIA 2A5YB 2JGMA 4LF6B 1IJKA 5KYUA 2CYBA 1ZM4A 4G85A 5LPNA 1EFRD 4RD6A 2Q1UA 2GB4A 4TZKA 3WY9A 2WF6A 5AVJA 3PYLA 4Q1DA 2QLNA 2R6JA 5U9CA 4R1MA 1Z7YA 1QF7A 2WINI 4MGZR 4XQCA 1RXWA 4GMXA 4II3A 3AX6A 2B2NA 4BMDA 1AS3A 1LK5A 4F04A 2XVZA 3EJWA 3OTHA 3VR2A 4J76A 4D4HA 2JZNA 2A5DA 3JZAA 2C96A 4Q18A 1RWQA 4RJJA 4G1MB 4MLDA 4YRDA 5AW7A 1MOSA 3LSTA 1XD2A 2L2QA 1RJ9A 3AF4A 3M89A 4U6NA 5FBHA 2CV1A 2C5HA 1N6NA 3OQHA 4PTLA 5IABA 3FB4A 3OPMA 4ML3A 4WRRA 1G1MA 2H4WA 1TK9A 4WCFC 3QBDA 4OXNA 1QIHA 1V4VA 3O8DA 4JAVC 3B3JA 4OYRA 4PHTA 1BMDA 3PTLA 4Q9NA 5IKPA 2WUWE 1JAZA 1J1IA 3A3NA 3DBHA 3UKOA 1YZQA 3D7KA 5TV2A 1SG9A 3RFXA 3ADDA 3ZWYA 1YZTA 2ZR8A 3Q6NA 2NVUA 4OAPA 1P72A 1R64A 4QLBA 4CGZA 2PPVA 2WUEA 3FY4A 2Y1LA 3L7KA 4IJKA 3UVEA 1M34E 1SPBS 2Q29A 2ZRKA 5K0BA 1QHNA 2QLBA 4X84A 4ZOLF 1RM4A 2FA9A 2R1VB 3QM1A 5K0LA 3PNBA 5LOVF 1MIHA 1A1VA 5FPSA 1LS1A 2WSSD 4UQLA 5EMMA 5AVWA 5AVYA 3I8XA 1M74A 3K8QA 3AHHA 5I7FA 2JC3A 4ECAA 4IIXA 1GTJ1 4MQ5A 4MHTA 1PDOA 4YEDA 4K8OA 4YCSA 3HFRA 3RREA 2BCEA 1H93A 2YKGA 1GYRA 1LVUA 3GQBA 1AGPA 4FC6A 4F2GA 4IQ0A 1YBMA 2V45A 3CH5A 3HO8A 1EK0A 4L5CA 2LUOA 2J7PD 1C1YA 1XZQA 2BY4A 2JGIA 3T1OA 3KJGA 1Q7CA 3UHJA 3MERA 2PKYX 3B1VA 3TX2A 5MGNA 2GARA 3WZMA 1VYVA 3BD8A 1D0VA 4LY6A 4QD3A 4ZVMA 1CZLA 1GDDA 4E03A 3WL8A 4HH4A 3Q8MA 2VSXA 1ZK3A 1KEVA 1PDVA 2C9OA 3ZNPA 2GEUA 4TS1A 5M04A 3FUXA 3I1YA 1DBQA 2GXQA 2BN4A 1PT8A 4HTFA 4FEGA 2QQEA 3ZWPA 2W43A 1PV4A 1SBCA 2C9CA 4DCSA 1AF4A 1XSEA 1JDSA 5BNTA 1OUMA 1T9AA 3QKSA 2NG1A 4F2WA 4NNPA 3L05A 2DFNA 1L5KA 5MFZA 5IWCA 1D1QA 2OO5A 4M49A 5SY9A 1Q0HA 2BZ1A 4RMNA 2OCXA 3Q7QA 2O8FB 3A0UA 1U0TA 2COKA 3GH3A 4UW9A 4JVNA 1SELA 1NQTA 1B6GA 3MA0A 5FWYB 4I1PA 1OWPA 5E95A 3E18A 4CKCA 2HLNA 4FYJA 4TQAA 5IBQA 3OZGA 3RARA 1Z4NA 4J0JA 1N75A 1UOQA 2F48A 1KI1A 1V16B 4JJEA 5KDDA 3FYUA 4FHEA 3CT4A 2W6JD 2FLKA 4US0R 1XTVA 1I7SB 4HO1X 4FMPA 1IDOA 1GP2A 1N8SA 2XY4A 3COYA 1V35A 3VKVA 1Z0SA 1M7HA 1TKRA 1PR0A 3OCVA 1TO6A 1G63A 4RHEA 3ZY6A 1Z2AA 2C97A 1I4EB 2IUUA 1ZR2A 2KLHA 4I36A 4TZ6A 3ORSA 3HU2A 1B6TA 3EIFA 1NRJB 4MVYA 2KWIA 4UQOA 4ZYTA 2B20A 3KZXA 3P0FA 3BSSA 5HTOA 4L0MA 4XRRA 1U7XA 2C8VA 4PM4A 5TEWA 4RCVA 3WLLA 4A10A 1QHHB 2H59A 2G25A 4EHDA 1I6MA 3CX6A 2G6BA 3DAPA 3P9IA 2BMJA 5CDTA 3A10A 5JRDS 4DR3B 3NBFA 3KLNA 2XCOA 4O4JF 4HN2A 2JCXA 5L6LB 2TS1A 1BH2A 1XMIA 4G1CA 1GPMA 4OG2A 1M76A 2ZSAA 3KWFA 4I4TA 5CXQA 2OHIA 1UJ6A 1PW5A 2Y1FA 3O2NA 4YMUA 1KC1A 3TR0A 1HOTA 2ZJ0A 4Y2XA 4TMXA 4MUGA 3LBYA 4D9MA 1YE5A 3D2CA 1CFJA 4MI1A 1YDWA 4GZMA 4PZUA 3TRHA 1L1EA 1RQRA 1Z2OX 3EQZA 5AKXA 1PQYA 3WFIA 4GM1A 1C2TA 2W8BB 4ACBA 2JL1A 1X39A 1DLIA 1E3QA 1YVUA 2GS9A 1IMOA 3IJEB 4NJMB 1WO8A 3LK6A 1H2BA 4C4OA 5ITWA 3JR3A 1RIIA 4BXOB 4XI9A 4NOLA 1JKMA 5KTKA 1WXEA 2VYVA 4UTVA 1HL3A 3TMYA 3V6MA 3LE8A 2HKIA 4E30A 3C1AA 4MLZA 4ZYZA 4BQIA 1IEVA 3IQZA 2PL1A 2A5GA 4XLTA 4Q3AA 5BSTA 1DWUA 1VHDA 1PV1A 3AR3A 3DNFA 3ZWDA 2RKWA 3HEMA 3M4YA 1UC4B 3X1XA 2OGSA 3IKTA 1VIYA 1BD4A 2Z2ZA 4ARZB 2MSLA 4N65A 5LZ8A 3BTVA 2OL4A 4CL8A 4ZYVA 2WSLA 3G0OA 4PHGA 1BH6A 2OXCA 5CDFA 4AMZA 4QQNA 4XXHA 2ZJ7A 2YFQA 3AWDA 5I5GA 2BFAA 2UZ4A 1XKQA 1JFFB 3M8KA 4Q3BA 2BUCA 2O48X 2CLCX 5DMHA 2RGGA 3BL5A 4DCGA 4BEWA 3OEED 1MV8A 3DONA 1OBVA 1UMBB 3KQQA 5TF0A 3KT0A 3UWPA 2OUIA 2BKEA 5MGBA 1OVMA 5GMOA 3RYFB 1QWOA 3N8DA 3F7NA 4WSOA 1HT2E 2PR2A 4GRAA 1LBEA 2R79A 1J97A 3HN7A 3F5SA 3SZGA 5LKAA 3UHOA 1TU4A 4LS3A 3ZU2A 2O2DA 4GDFA 2RGBA 2O14A 1RU3A 3HVIA 4JT9A 4IX1A 4N5HX 4KVGA 3H99A 3AKYA 2PIAA 2DWPA 3R5TA 3NUZA 3M0EA 5L7TA 2VCHA 3FPKA 4H1HA 4A6PA 1ZN2A 5FLXA 1KQFA 1WOYA 2P5UA 5E0KB 5A3SA 3L7JA 4RLQA 1RYHA 1JILA 4INZA 1DBRA 4O5OA 3KC2A 3MIIA 4LDAA 2M98A 1N0HA 1ZISA 1NDQA 3TIXB 1G1AA 1FNDA 1IBCA 2RH5A 3GYGA 2NSLA 5E6RA 1JNXX 3W8EA 2O0MA 2GZMA 3CNEA 3JXEA 5E4FA 1OJLA 3B6EA 4A8JC 4RJIA 4I9GA 1J0AA 4B6RA 4C6HA 5LIPA 2FW0A 1NMXA 4MRAA 3T8YA 1AUQA 4YV1A 3PQ6A 5BV2P 2P4SA 3MQFA 5LZ7A 3W7AA 4OQNA 1EBUA 1DOAA 2CN1A 3T5TA 4US2R 1IHUA 2HRDA 5I8WA 1YI0A 1CUFA 2AW3A 2O3UA 2VOJA 2W4IA 4FSDA 5JDCA 1I51A 3DG9A 2P6RA 3HDJA 1V8OA 2BI7A 2LXNA 1MT0A 4XYBA 4L02A 3IDSA 1ZMOA 3VR5A 3W34A 1J24A 1AZTA 5CVEA 4FXOA 1HR0B 1PL0A 2O2JA 4LJKA 1O03A 2BD0A 1ZMRA 3ZGYA 3L1UA 1RWVA 4DA7A 3SQWA 2I2XB 4I2VA 4U02A 4C30A 3GR6A 4J90A 5H16A 2R65A 2VZLA 4CTKA 3JAKB 4RIFA 2O0HA 3CJTA 1P80A 4UMDA 2GJSA 2PUFA 4JP1A 2XEDA 2ZKLA 4Q9AA 2AJDA 2B98A 1IFXA 4CN9A 1C3EA 1KWGA 1E4EB 2EIHA 2ZB2A 1DAKA 2J5RA 1XN4A 4MUMA 4UEOA 3ZVRA 4LFBB 2Z0MA 1XRLA 2C07A 4DW8A 1JHAA 3THOA 1AA6A 2PUCA 2H1LA 5JYEA 3RRMA 2VI5A 2QV0A 3W77A 3QUCA 3MAAC 5LFAA 1MC8A 2XWJI 1BSVA 2ZRQA 5ELMA 1QJ4A 2BHLA 2W2TA 4D0RA 5AXAA 5KQMA 2GD6A 1N0UA 3P2MA 3ROZA 3SHWA 4F5EA 5I4BA 2B8TA 1G8HA 3MWFA 4AN4A 1F0YA 2A9VA 1KEZA 4CODB 4YK7A 3QWIA 4WXMA 3SD7A 2JFGA 2BMAA 2C0QA 1NVWQ 3BFPA 1TAGA 3CMCO 3IPYA 3KZNA 5CLGA 1GTSA 4I8XA 2PWPA 3GU3A 3CUTA 3ONWA 4BNUA 5CGQB 4DMFA 1GILA 1Y8QB 1YZUA 1D8TA 1IDN1 2QN6A 1Z74A 1UQTA 2XVMA 4YMHA 1GTRA 4WXRA 4KN8A 2IU6A 2O0JA 1I4TD 1NT2A 1X7WB 1XQWA 1NOKA 1X80A 2ZT8A 2ZRCA 5F1YA 4OLAA 2E87A 4X3OA 4DPKA 1H6AA 3FVQA 5A3RA 2EFEB 3A9WA 3K2IA 3Q2OA 4KE7A 3WVNA 2B3TA 5SY4A 3BGWA 3PX2A 4JLKA 1B8OA 3EVFA 3NHZA 2X0IA 2B1JA 2V55B 4FEEA 2GLXA 3F73A 1PZEA 1QHIA 4RMJA 3CZCA 1NSTA 1C9JA 2JFYA 1NLZA 3EJ6A 3MJCA 1KJZA 1B93A 1WZIA 1ODKA 3G2LA 3LLVA 1EP9A 2W2VA 4HDNA 4P2BA 1AXRA 3KDSE 1WLSA 1AA9A 1JQLB 4MGKR 4P36A 4C1NA 5J2UF 2BKLA 4JYMA 2CXPA 3KOOA 1B23P 1BMQA 3WZLA 3HSKA 4TTSA 4YMGA 3W4KA 2X76A 1VMEA 1J70A 4YRZA 3H3XA 1N3YA 3CMMA 5JADA 1ZLYA 1B0AA 1YJXA 1AM4D 1R37A 1YIAA 1YKFA 1WKBA 2IXBA 4MRRA 2PYDA 1ZH6A 4M60A 2P3QA 4XFDA 1YJCA 4BGDA 3UGJA 1QCDA 1RKQA 2CZGA 4JQYA 3D5TA 4LPSA 2B7LA 2E4AA 2FE4A 3ON5A 4G67A 1KORA 4JMLA 4PYKA 4PCUA 5TGZA 3SX0A 2BBWA 1ULSA 1XD2B 2HRBA 1RJ9B 1Y7PA 1V7CA 4WXPA 5DHFA 4X94A 3RHTA 1NE2A 1Y1TA 1R66A 4S1OA 3T4XA 4CXMA 4BMOB 4F8YA 3L0OA 3R5JA 1NVBA 1G8SA 1B26A 4CDNA 3CF4A 2C3YA 2YFKA 3IQGX 2UUBB 2R8YA 4O4HF 4RAOA 5FPQA 1CJCA 4ZC8A 3DBHB 2FVXA 1LPOA 1SK8A 1USVA 1T9HA 1OXTA 4QFCA 2Y9PB 3LZDA 2YXPX 5DGDA 1MB9A 4U1RA 5HCUA 4E3WA 2HMVA 4Q4CA 3DF9A 4C01A 5INTA 1PL6A 3BFXA 3VTAA 4XX0A 3OF5A 3OZBA 4S2UA 4O2RA 2GYYA 3Q7EA 2OHXA 4NBKA 5I4CA 3RU3A 1TM7E 4YMTA 4ZEOA 1GZ5A 1JU9A 3FUCA 2PJDA 3PD7A 2MR5A 3G2NA 5CT9A 1DJLA 1GKIA 1P5FA 2B34A 3L7NA 3L8MA 3QMVA 1EGHA 3EOBI 4QUKA 3SG0A 1TUBA 1PVOA 1E6KA 4H7HA 1V43A 4YVFA 4YO7A 1W34A 2LD4A 4JC8A 4WOKA 4CMHA 4DMHA 1JRLA 4WA8A 3T5MA 3HZOA 3QKWA 1T8UA 2P4EA 4MYSA 4Q4LA 3FSGA 3HN2A 3VYVA 2ZRDA 4JA0A 5B12A 5ECYA 2B4RO 2DMRA 2O4CA 4QELA 4DA6A 1BHQ1 4W9MC 1D2CA 2RGWA 2YBEA 2WPNA 1JLHA 4BWFB 4K9PA 5AM0A 1BVHA 4PZPA 1PUXA 2Q27A 3GRPA 1EFDN 4H2DA 2HJHA 1K08A 1U8CB 3SI7A 4JJIA 1NYLA 1I3OA 2JFUA 2FFJA 4HWSA 4O02B 5LDHA 3OT1A 4L5YA 1UC5B 3MHPA 1NV9A 3GP3A 2E55A 1WF3A 2OFPA 3K4HA 4WZ6A 3BJEA 4HTFB 4BLTA 2H0QA 4N9QA 1VL1A 1ZCAA 2EARA 1PJ3A 1HORA 1M1YE 2GBCA 3JQ7A 3QKSB 4TLBA 3SE7A 3S2GA 1I5OA 1PE0A 4HXEB 2CNWD 3VR3D 1P61B 1E69A 4JB3A 2K7FA 2WICA 4JELA 1NVVQ 5EINA 5BSWA 5C35A 2C61A 3IEXA 3U4IA 4YRKA 3LRTA 1QYRA 3NH6A 2CHVA 2H7CA 3N76A 4I19A 4XYEA 3VH4A 3O7WA 4CKCB 1DGQA 2IZOA 5D3QA 3ROXA 2HF8A 3LGSA 3IXLA 1MXHA 1TQDA 3GZTB 4XR4A 3FYUB 1G3MA 3PCRB 4HNSA 4NMXB 3TD6A 4AMBA 1BFUA 1I6WA 1JWAB 1F1BA 2W6NA 1NRWA 4DGSA 3DV9A 2PSHA 3JQ8A 3O0TA 3OHSX 1MQ9A 2X6QA 4PZLA 4QTXA 4MRPA 4P54A 4TXHA 1U0HC 3LKZA 4PQFA 5EFZA 1Y1LA 4JJAA 5AVKA 2V7EA 5AP9A 4EYEA 3MJEA 2YVUA 4KQ9A 4L9AA 4D0GA 4B3HA 3OE1A 3BAFA 4FWIB 4NK5A 4IUYA 3PWTA 5G53C 3WB2A 5IC4A 4R0NA 4E13A 2VT7A 2LKDA 3NHFA 3CZ4A 3TR5A 2V0NA 3EFOA 4OLFA 3WRXA 5AVSA 2B8WA 5AHXA 5F9MA 3W3AA 4MJLA 3CE9A 3AHCA 4JL6A 3CLHA 3LVQE 5ILOA 5F3DA 4ZOEA 3TN7A 3TWOA 1IRIA 3SEFA 3UK7A 3WHPA 4TMZA 2R6ZA 2BISA 3VO8A 4CNBA 3IX7A 4KFCA 2HY7A 1QQBA 3UH0A 4I4TB 3F8TA 3S27A 4GL2A 1JHVA 4MI3A 1GUDA 3LVRE 1QAOA 1Z0DA 4PIVA 3QJ5A 4ARAA 1GSIA 4U5XA 4DZTA 4GOOD 5CXXA 5G0UA 1UM8A 2D4AA 2QRZA 2QLMA 1SC1A 1OSNA 5I7RA 4K40A 4MAAA 4BEVA 4XOUA 3S99A 1V2HE 5EVJA 4BZQA 5EXXA 2D3WA 2PH3A 3HU1A 5JHHB 2Z5FA 4EPTA 4L9SA 1JHZA 4KWEA 3RVQA 1JHUA 5EIXA 2Z43A 1XRRA 3B9PA 1RFLA 1VZ2A 4PN7A 1ZRHA 2XUFA 2Y9MB 4KTVE 1G55A 2Q8QA 3QE0A 3D81A 3IOBA 4JQZA 1PR1A 4R8MA 3DOJA 2FPIA 2XCRB 1DZIA 3OE7A 4EKGA 4V1CA 2RJ3A 2PRKA 2K5UA 4NI5A 3DXYA 1A96A 1XEXA 1YULA 3I5UA 4RPHA 4DCCA 2NGRA 2OVBA 2LV8A 2JFWA 3DAHA 1P39A 4LMAA 1RAGA 5KOYA 2RGNA 1EVIA 3LHSA 2QA5A 3CPEA 2YN4A 4TVSA 1PJQA 4CV3A 4DUPA 1BOOA 2H2WA 1WBBA 1BKSB 4I14A 5CLLA 2QPOA 1GY8A 1G21A 2GCPA 3KPJA 1ECPA 2BFCA 4Y0NA 3HK2A 4ASUA 4IRUB 4FFRA 4KRGA 4LDRA 2CKMA 4MW6A 4L4ZA 5AXCA 1BVRA 3QA3E 4QWMA 4RETA 3X1DA 3PDWA 5DIFA 2BLLA 1ADJA 3AHGA 3ZNQA 4KQ2A 3NHBA 3DWIA 2O5CA 2BV3A 2YYAA 4OHCA 4A82A 7ADHA 1XTIA 2Z09A 4I1UA 4N54A 3A1EA 3OX3A 1RYYA 1SULA 1DDIA 1V25A 2JD2A 4UBIA 4DMCA 2ECFA 4KIJA 1PL8A 3I12A 3I53A 4NENA 1XHEA 3FUTA 1IHOA 5JS7A 2P3SA 1HE8B 5IF3A 4EFLA 2H4JA 3HUDA 3V3TA 1WR8A 4Y0AA 4NBSA 3BCSA 2IK8A 4AKHA 2ORIA 1NTRA 3QV1A 4GQBA 1QF9A 4FDLA 2CF6A 3O95A 4IAOA 4NFYA 1J9EA 3D3EA 2FX2A 2A4KA 4C4ZA 4DLKA 5KC9A 2IH5A 1ATIA 5AW9A 3OY7A 4KIFA 5E6RB 2WZDA 1UCFA 5CR9A 1JR3A 1JNYA 1YNSA 2QJRA 3KDAA 4OMUA 1Y0BA 4KK3A 4QASA 4FYIA 4ZGBA 3NHJA 4JODA 1ANKA 3R3VA 3ANXA 3GUHA 4A92A 1TVKA 5TVGA 5AVRA 2AEEA 2ZUWA 2PQ0A 3UJ6A 1HK7A 1UBRS 2C29D 3OE4A 4F5DA 5IPFA 1W7AA 1TJPB 1DDOA 1LS6A 2GN0A 4IO0A 3AFIA 5ALFA 3A4NA 3SY8A 4YV2A 2UVQA 4DM4A 3TW4A 4C7OA 3NBKA 3RV4A 3SM3A 2XB8A 4X7MA 4JBGA 1GG5A 1CF9A 2JFOA 2AFVA 4TTPA 5EESA 3R0ZA 4G0ZA 2WDPA 3EVGA 3GF4A 1NY5A 2Q9BA 2YHAA 4WE3A 4R2IA 4WKNA 3NFRA 4D96A 3VU0A 3K1TA 2V6FA 1HETA 2NXNA 4W63A 4ZDKA 9GPBA 1E2IA 1LK7A 4IUDS 3IGFA 4AJKA 4AXXA 4BN4A 4PZDA 1BOFA 2EQ5A 2GASA 5KYYB 1BWSA 2WM3A 4YB8A 1DBSA 3FTPA 3P9RA 2ZCVA 2WDZA 1YQGA 1ZPDA 2XMDA 3QKUA 4P4SB 5DDIP 1MAVA 2VK2A 4ENVA 2D1SA 1G5TA 5BQXA 1YQ9A 1K8ZB 2OZEA 4C1BA 2VDRB 1HDOA 4F3CA 2QVCA 3ROGA 3VX3A 2IF0A 2WIDA 2QVBA 3R5XA 3PC3A 4ZT3A 2C7BA 2GEVA 1VI2A 2I2AA 4C87A 1JHPA 5EN4A 1O8BA 3AG5A 1NXSA 4MQ4A 4N5LA 3WL6A 3ZD8A 1COWA 2QTRA 5FULA 3VH2A 2XMRA 5FBQB 2NTJA 5JANA 2I6GA 3RIHA 1TA9A 3M3DA 2Q0QA 1SZDA 1RWPA 3PPVA 3RAEC 3NFYA 3MBIA 4AL4A 1RVDA 3W8RA 3LQQA 4Q3LA 2IPOA 3OTIA 4XGQA 4WLNA 4EYQA 2W2LD 4RXMA 4WK0B 5FORA 3VU1A 2WPDA 4DSOA 821PA 4LOIA 3Q10A 4D3YA 3MTBA 1VPTA 2H1WA 3NVMB 1PU2A 2PTGA 4ENUA 3ZKAA 4D4KA 2F7SA 5J4HA 1CZHA 3PQ3A 2ZUVA 4KKXB 4TRRA 2PKQO 1X80B 2ON6A 3L1HA 1V8DA 1G9TA 1O2DA 2XB9A 1M1XB 1CUYA 4G5RA 4RGVA 1JHDA 4Q3NA 4V02A 4LSZA 4O4LA 1W36D 3BD7A 2A0KA 4OJQA 5BURA 2DFKB 4R3UC 4M4SA 5B37A 3L84A 4DLNA 2C2BA 3QXJA 1H6CA 1YRLA 3E5MA 3C6KA 1P3DA 3HJTA 3DEJA 2PZKA 5DHQA 4LY3A 3QVMA 1JMKC 4GPAA 2D5LA 4JGBA 1FYFA 4DA9A 4HDNB 3SVLA 4DLAA 2DQKA 3PP8A 1N5RA 2FMTA 1G19A 3WNCA 3HBJA 1GZ6A 2PUDA 5EZYA 4G65A 1C0LA 1WY5A 2I6UA 1Y5MA 1YOVA 3HDGA 5JZBA 1A04A 1M9NA 4AG5A 1C7JA 3GRVA 4C3VA 4YRMA 1B6RA 1WKVA 3AJEA 4EYGA 3C74A 1E0SA 1R27A 1P1JA 1N2IA 1VXOA 3FMOB 3WS7A 3P1JA 1F4PA 3LD9A 1NQAO 1XP5A 1X1EA 4FZ5A 4H3KB 5KX5F 5EIBD 3GDOA 2UXBB 1ZM3A 5AM2A 2IQ5A 5HZGA 4U9UA 3SSAA 1XL1A 4RLHA 5JASA 1ZIPA 4MW2A 2E6UX 4DB4A 1Z6TA 1L5ZA 2O2HA 3SZUA 1UZUA 2NNWB 5D6OA 1V39A 1RKUA 1KZGB 1GAWA 1VG1A 4ZVRA 2MYUA 3K0AB 3DBRA 3ZX4A 4IINA 5JD4A 1X9IA 1PFQA 4WLFA 3LP8A 5C7IO 3LUHA 4KRYA 1U4OA 2G8NA 4JB8A 4BZPA 3H2HA 2H1RA 5KMGA 1ZGCA 4XX0B 2EG5A 3EK2A 3OAAA 1Y6JA 1ODIA 1J2UA 1W59A 1XK7A 3P71T 3THYA 4LJRA 1F0KA 1EIWA 2PTHA 5TGTA 2Q4RA 1HFJA 3TS1A 5CDUA 3S1SA 1UXJA 5EQFA 4A6XA 5CGZA 1R0RE 1A2QA 1RQNA 3CZAA 4Q1AA 4CMKA 4PYQA 2GAIA 5FBRB 1PHPA 3KLMX 1S2GA 5CFNA 4KO3S 1PEDA 1Z47A 2JIMA 2DLNA 3D02A 3UWSA 1TUBB 5IDYA 3ND5A 2I55A 4UVIA 1PJLA 3ENZA 2BRUC 4J6FA 1B0ZA 3AV0B 2I9PA 4FGKA 3OZFA 4AT1A 3OTQA 4K8RB 3DFIA 3PD1A 1DKNA 3C43A 1OXMA 2EHDA 5ITVA 1K63A 3OKAA 1GKYA 3FNFA 5LMZA 3DA8A 1KI8A 2EU8A 2O7NA 4BGEA 3NEJA 5BYKA 3BB1A 3L1JA 1Q1QA 3ELWA 1TJ5A 3AIIA 4TLDA 4HT3B 1CUSA 5K7SA 5MN5A 4GOJA 2Q3HA 2YHUA 4Q4HA 4JYZA 2B25A 3OT1B 2XKJE