2DPHA

Crystal structure of formaldehyde dismutase
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
398
structure length
398
Chain Sequence
AGNKSVVYHGTRDLRVETVPYPKLEHNNRKLEHAVILKVVSTNICGSDQHIYRGRFIVPKGHVLGHEITGEVVEKGSDVELMDIGDLVSVPFNVACGRCRNCKEARSDVCENNLVNPDADLGAFGFDLKGWSGGQAEYVLVPYADYMLLKFGDKEQAMEKIKDLTLISDILPTGFHGCVSAGVKPGSHVYIAGAGPVGRCAAAGARLLGAACVIVGDQNPERLKLLSDAGFETIDLRNSAPLRDQIDQILGKPEVDCGVDAVGFEAHGLGDEANTETPNGALNSLFDVVRAGGAIGIPGIYVGSDPDPVNKDAGSGRLHLDFGKMWTKSIRIMTGMAPVTNYNRHLTEAILWDQMPYLSKVMNIEVITLDQAPDGYAKFDKGSPAKFVIDPHGMLKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Formaldehyde dismutase
publication title The X-ray crystal structure of formaldehyde dismutase at 2.3 A resolution
pubmed rcsb
molecule tags Oxidoreductase
total genus 123
structure length 398
sequence length 398
chains with identical sequence B
ec nomenclature ec 1.2.98.1: Formaldehyde dismutase.
pdb deposition date 2006-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2dphA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2dphA01
3AI2A 1T1RA 2V7PA 2PZKA 4CQLA 2HCTA 5TC4A 1HYEA 2EGHA 4YAGA 3RFVA 3BXXA 1D8AA 4YQYA 4BGIA 4O0LA 1YQXA 2YHIA 3BHIA 4A27A 1IHYA 4QEDA 4CMGA 1Q0QA 4AJLA 1E3WB 4IDAA 4DIBA 1LLCA 2XXJA 4ONEA 3WGGA 1C1DA 2F1KA 6ADHA 3UCFA 3GZNA 1PS0A 1ZVMA 3BMNB 1O5IA 1UXIA 3KSUA 3MCVA 1ZXBA 2X8LA 3MEQA 2G1UA 5KVCA 1L1FA 2PTGA 1D3AA 1LDBA 1R6DA 4R5HA 1PGNA 3ZU3A 1PJ2A 3AFNA 4GVLA 1ONOA 4RL6A 1IOLA 4YJFB 3STHA 1DXYA 1W73A 2WM3A 1I30A 1R0SA 3T7CA 3WMWA 3RAJA 2YYYA 3ZU5A 3ZW8A 4CM9A 4MJLA 3OBBA 3E5RA 3NGLA 4RLSA 4XYMA 5CG2A 3KOUA 4MVJM 4FJ1A 2JCVA 3GGOA 5F21A 3DC2A 3L9WA 2Y99A 4I9NA 3DAFA 4ZHSA 3RC7A 5DOZA 2DT5A 2WD7B 3N74A 2GDZA 3I9KA 1HZJA 4IMRA 3I9OA 2RHRA 3D64A 2VYVD 4FPXA 3KUXA 2Y0CA 4JX8A 5CEEA 1NBOA 1Y5RA 2Y05A 4R68A 3GG2A 1JVBA 3QWHA 2FRDA 4D79A 4J6FA 1YDEA 1R15A 2OP0A 1Y8QB 2V6MA 3DONA 3PJEA 4MKXA 4GX2A 4J4HA 1LA2A 3JQ7A 3RC9A 4PZEA 4BKUA 3LYLA 3OQ6A 5EN4A 3R6DA 3D1LA 2PGDA 1HLDA 4EGFA 2PZJA 4FSHA 5MGBA 1I3MA 1E92A 4CM6A 3WSWA 2X5JO 2X9NA 3INTA 3K9QO 4CQLB 3QWIA 1QYWA 2I65A 2VUUA 4XJSA 1C0IA 5H81A 3TZQA 4MDHA 4P4LA 2CFCA 1P31A 1KBZA 4OKNA 5BNIA 2D5AA 4Z0HO 3ZV3A 3U62A 4B8ZA 2D59A 2Q1UA 4CM8A 2V6GA 4YRDA 4MINA 3DBHB 2EJWA 4RF4A 1C14A 2VRBA 1GZ6A 4FGSA 3ZI0A 4M55A 3LF1A 4YPOA 1Q1NA 1EK5A 1VSVA 1XG5A 1X0VA 2VT3A 4TRRA 2PH3A 4HNGA 5JCJA 5IZ4A 1UP6A 1DC6A 3IJRA 3NT2A 1LDYA 3MJEA 5K6AC 1H2BA 5BNTA 2EHDA 4GVXA 3AK4A 4JGBA 5I8ZA 3ANNA 3NV9A 4CV2A 3NDIA 1PZGA 1ZK1A 5I7VA 4K1LA 1U4SA 3BMCB 4FGWA 1P1FA 4J9VA 1YJ8A 4PIVA 2HUNA 1RM5A 1SEVA 1Z7EA 2ET6A 4YAJA 3TPCA 3JYLA 4BNGA 5IN4A 1BXZA 3WLFA 4QO8A 5K0ZA 1R4NA 1YE3A 1NPTO 4PRKA 2B37A 1B16A 1ZK2A 4MIOA 2Z5LA 4WEOA 3DWFA 3NYWA 2Q45A 3EC7A 4B4WA 4OYRA 4NJMA 3QE3A 1E6UA 1NQTA 4UUPA 1LQTA 5KVSA 4BNMA 2GN4A 4FFNA 3A06A 3F1LA 2EWMA 4GPD1 2AA3A 3U3XA 2DAPA 2Y1OA 3W4JA 1NFFA 5BSGA 3CKYA 4R69A 4GKBA 5I9NA 3BMQB 1W0CA 1EVZA 2ZKLA 3DFUA 4M49A 1YVEI 2DTDA 4N5MA 3PWSA 3A28A 1P77A 2JHFA 1J4AA 3CH6A 3N58A 4CQMB 2E6UX 1F06A 4Q39A 3PLRA 1ONNA 1DIBA 3GFBA 2IE0A 4FCCA 4J2OA 2YFHA 4GH5A 3GGGA 3JYQA 1GV0A 3PTZA 1GPJA 3CSDA 4J2HA 1U3VA 3E18A 4L9RA 2X7HA 4BNNA 4GMFA 4H3VA 5COAA 5A9SA 4BNXA 3GVCA 1JDJA 1UDBA 4R3WA 2NVUA 3DZHA 3IS3A 1IL0A 3OQBA 1Q7CA 4P22A 1HKUA 2O7SA 1XWFA 3FNEA 1ZJZA 1XYGA 1XCBA 1MP0A 2Q3EA 3JQ9A 4ZRMA 3DZBA 2O2YA 1I3KA 2JFGA 3I5MA 4CLOA 2DU8A 3UCEA 4A10A 3WWZA 1VL0A 3I3OA 3EUWA 3KZVA 2PD3A 3EK2A 2WDZA 4UVIA 3ANLA 4WE3A 3ROMA 5ADHA 3FRJA 4UUOA 1H5QA 5I9LA 3S8MA 2QYSA 3H2SA 2FSVA 3V1UA 1WP4A 1GTMA 3HHPA 4WJZA 4TROA 2OZPA 1Z7BA 2W90A 3QRWA 4G5HA 3JQ9C 2WYVA 4J90A 3DOJA 1KEVA 4NDNE 4CMEA 1LLDA 2PLAA 1PSDA 4E2WA 3O03A 3L6OO 4FFLA 3PJFA 4HX5A 3TDKA 5CEJA 4H15A 3TSCA 4TKMA 3AM3A 1TXGA 1VRWA 4OXKA 2CY0A 3G1TA 2BI7A 4DMMA 1HL3A 5DZSA 2E4AA 3RUAA 1FDSA 1PWZA 5HTOA 3QA9A 4XR9A 4ID9A 4WPGA 3H9GA 3EZYA 4PG5A 9LDTA 3I4FA 4UUNA 4XDZA 7ADHA 5KKAA 3S55A 1PR3A 2HMVA 3MTGA 3VVCA 3DAPA 3RSHA 4G81A 1IUKA 3HQ4O 3DO5A 2Q2WA 3UICA 4NU6A 3EY4A 4TRMA 4CUZA 1ZSYA 3PXXA 3CPSA 4RO0A 2QZZA 3PDJA 2OMEA 3OIFA 4BKOA 1GYQA 3KBOA 3GY0A 1E7YA 3GMSA 2E82A 4D44A 1YRLA 1DLIA 4B4OA 4RF5A 4GLLA 1JA9A 2WTBA 5THQA 4OMUA 1EQUA 4BKQA 1KEPA 4ALNA 4XQ9A 4Y8VA 4AG3A 4BNYA 4NPCA 1MC5A 5JDCA 1Y1PA 4CV1A 5JE8A 1LSOA 5L7WA 4URFA 1N2SA 2UVDA 1N1GA 1KIFA 3Q9UA 3I6IA 1UXJA 1JKFA 1VC2A 4J1NA 4CMBA 4AJOA 3FR8A 1LRLA 4O63O 3ST7A 4AJNA 1QLHA 2Q50A 3DQPA 1P1JA 4QX6A 1HSOA 2AMFA 2NWQA 3OQ1A 4CLEA 2CDBA 3AOGA 2HO5A 1PZFA 5CP8A 4BO9A 3ASUA 4P8RA 5JDCC 1DRWA 1BTOA 1ZW1A 2J5QA 4BMNA 1LXCA 1T26A 3NAQA 2DUWA 1ISFA 4XX0A 3PQDA 3OJLA 4JP3A 3PZBA 3CE6A 5IFLA 2DTEA 5H82A 1WPQA 3G79A 1KVRA 4Y6PA 1NHGA 3ZWVA 3C7CB 3SX2A 5HBRA 4IPTA 2NSDA 5CFZA 1MG5A 1VJ1A 1WZEA 3ZDFA 4XZ3A 2VQ3A 3GOHA 3LT4A 4PN3A 2OFPA 4L74A 3G0OA 3JQEA 3JSAA 4DIFA 3ZU4A 5JO0A 5ENDA 4ZQGA 4Z6KA 4PLTA 4N5NA 3Q2KA 4HBGA 4U7WA 4R9SA 4IDDA 1OI7A 2J5KA 3TOXA 5JCJD 4G2NA 4KUHA 4LRSB 4K6FA 3JQCA 4J16A 4L4SA 5CPBA 1UXKA 1VKOA 3G49A 4MVJA 4EDFA 1KYQA 3I6QA 4B4VA 3I83A 2C20A 1Z6ZA 4RPJA 5BT9A 4A73A 5B4VA 4AJ1A 1R12A 1ZEJA 2YV2A 3V1TC 1QP8A 4BNUA 4L75A 5EL0A 1C1XB 4DTIA 1HLPA 3GEMA 2W4QA 3H9UA 1UXHA 2HK7A 1GCUA 3PLNA 4GQAA 4JNKA 4KDEA 4TSKA 4D42A 1IZ9A 3ZV5A 3NDJA 2J5RA 1LC0A 2PNFA 4UREA 2FR8A 1TLTA 1LBEA 5EIOA 4B3JA 1ZJYA 2GERA 2ZTLA 2P9CA 2YUTA 3VZQA 2DBQA 3OJEA 3TQHA 3JYPA 4WCFB 3B70A 1XR3A 4ND1A 1ZKMA 3BTSA 4XRGA 5B1YA 2V6FA 1KC3A 4XQEA 1GL3A 3D7LA 1F8GA 3W8FA 5F1OA 4BGVA 4D3DA 2W8ZA 4R1UA 1OFGA 4RCVA 1K89A 1XEAA 2ZB4A 1X14A 3WBFA 3V5NA 5L53A 2ZYAA 5HWSA 1R0KA 1U3WA 4W9NC 4LCEA 4Z0PA 4R41A 3D3WB 1GZ3A 3CMCO 2UV8A 4KMSA 2VZ8A 1ZUD1 2IDZA 2P5YA 4BNZA 1V9LA 1WMBA 2FZWA 2J6IA 4LSMA 4NU5A 4NBTA 3R3SA 1KVSA 3GNSA 3H8VA 4P4GA 1F8FA 4YT2A 1XQ6A 3TFOA 4FFMA 2X5KO 4YQZA 4PFJA 4BNKA 2Y93A 4YTEA 3M2PA 1UDCA 1X13A 3QV1A 3ZWWA 3IKTA 1NAHA 5IG2A 4RQTA 4ALIA 1ZIDA 3BIOA 1RJWA 2IZZA 4XYGA 5H83A 4DPMA 1KOLA 3HG7A 2GN9A 3GVIA 1HEUA 1YB1A 5U4QA 4CM4A 4LISA 3ZH2A 4Q3BA 1GU7A 4AICA 2ZCVA 5JFOA 3ZNQA 4ALKA 1Q2XA 2VN8A 3EVNA 3N7UA 3GAFA 4J49A 4RPLA 1V0JA 3RFXA 1HRDA 1BGVA 2GASA 3LVFO 3LU1A 3VZPA 3F4LA 4PLZA 2C5AA 1NWHA 3B1JA 4K6CA 4B4UA 2AG8A 2HRZA 4II3A 4DLBA 1IHXA 3DEYX 3GAZA 3JYOA 4NR0A 3SBOA 3TZKA 4GI2A 3OP4A 3LF2A 2XOXA 3HUDA 3TZ6A 3KB6A 3OIGA 1P1RA 5TGDA 2P9EA 3EDMA 4N18A 1ZCJA 4U8GA 2QHXA 4ZA2A 1BG6A 3HB5X 3GT0A 4XKJA 1EE2A 1Y8RB 3Q0EA 2X22A 1LX6A 1FDVA 3MTJA 2EXXA 4BO5A 4Z9XA 1J49A 3H5AA 4S1VA 1UZLA 3VZSA 5AXCA 3KYBA 1F0YA 1I33A 3JQBC 3TWOA 3OSUA 3PIIA 4WASA 2X4GA 1N9GB 2VOEA 4L8VA 2YHUA 4M1QA 4J1SA 4IM7A 3ULKA 4FOSA 4I1IA 4CR7A 4OAQA 4YAKA 3ANMA 1YBMA 2B83A 2GUGA 3VPHA 2GO1A 4CUKA 2FWMX 5IDXA 1ZO8A 4AJ2A 3M1AA 3K2BA 2GLXA 4ZD6A 4WOJA 3DDNA 4IIUA 1DLJA 2WJPA 4KQWA 4II2A 4YJHB 5BSFA 2WWRA 2QQ5A 2I5PO 1Q7BA 2P68A 4YT5A 3ROPA 3F46A 3DHEA 3S2GA 3ZWPA 2Q99A 3NKLA 2NU6A 1CWUA 4IXWA 3KVOA 1JAYA 1UAYA 1WDLA 2E37A 1E3WA 2G5CA 1H93A 3UW3A 1CIVA 1PJCA 4NHEA 4TVBA 4NIMA 1BHSA 1YBAA 2O4UX 2LDBA 4CM5A 5JDIA 1PWXA 3BMNA 1OAAA 1ADFA 5T8KA 2GZ2A 2BGLA 4DLLA 1E3IA 5DT9A 1YONA 2BMAA 3EMKA 4R51A 2YW9A 2JCYA 3HN7A 4NBWA 2SCUA 1C0KA 1NAIA 4YJFA 4OL9A 5F1PA 4I8XA 4RDHA 3GH3A 4YAIA 5LDHA 3PP8A 1NFQA 2O3TA 4IINA 1E5LA 5GZ3A 4PLHA 3RVDA 4AJIA 3JQDA 4YJDA 3ZHYA 5B12A 5ICMA 1V6AA 1DFHA 5G4LA 4R4JA 3FNHA 4IJKA 5JDIC 3QP9A 4DC0A 3ZWCA 2VYNA 5T8KC 4EUEA 1HDGO 3OA0A 3G17A 5JLAA 3JCZA 4MOWA 1NR1A 2VHYA 3DOCA 5TX7A 3ZU2A 1UP4A 3RUCA 2IXBA 1QR6A 5CDUA 3WMXA 1UAGA 3HZZA 3ZHZA 4AJEA 4ND2A 1PS8A 2FR1A 1JN0A 3WYCA 2Y1CA 3I9LA 3PHJA 4MVJD 4JQCA 2VWHA 1NTOA 1RYDA 4RPKA 5T6BA 1ZXLA 5JC1A 1Y8QA 4M86A 1H2HA 2WE7A 2BFPA 1T2FA 2NU7A 3HNPA 4DA9A 3WDSA 1NQAO 3AOEA 3ENKA 1V8BA 3DTYA 1KVQA 1ISGA 1A7KA 4UEJA 4B8WA 3VPXA 4RVGA 5JNLA 3DBRB 4CMHA 1QKIA 2JD0A 5DNAA 3WIDA 1M2WA 4CLRB 2B4RO 2RIRA 2DBZA 1LDGA 2QX7A 5TSDA 4CMCA 3GZ4A 1Z73A 3GDGA 3RBXA 5FF9A 3V8BA 1EUZA 5ITVA 4GMGA 3DBHA 4HADA 3AY7A 3KO8A 1MV8A 3I9JA 1DIRA 3GA0A 5IDWA 5CHEA 3DB2A 4PLCA 3GF4A 2BRUA 1BRMA 5AYVA 1PJSA 4ALJA 4D45A 3ADOA 3WBBA 3QW2A 4ZVVA 4KDFA 5HS4A 1QRRA 1UH5A 4L0QA 4F6LA 3UH1A 2GZ1A 2ILTA 1M75A 2DUUA 4PZDA 4BKPA 2DVMA 5KTKA 2IYOA 4CM3A 1SOWA 1WNTA 2Q1TA 3BMCA 2C5EA 4LK3A 3FNFA 3ZHBA 1FMCA 1YL7A 2AQ8A 1B15A 5TT0A 1VL6A 1SNYA 2DPHA 2OUIA 4C7JA 1NVMB 3NDRA 3FN4A 2X6TA 2VOJA 4PLWA 3V2UA 2PK3A 4UVEA 4PLYA 1W6UA 4U6SA 4Z3DA 4BL5A 3ASVA 1EVIA 4J9UE 3B1FA 3WNVA 4B7XA 1HT0A 3QVSA 1KY5A 4TZTA 2P4HX 4J4TA 4KWHA 1Y81A 4XYBA 5JMWA 2GN6A 3AU8A 4RF2A 5LC1A 3BMQA 3U5TA 5CAEA 2O3RA 1YXMA 1GQ2A 2FP4A 2HMTA 3GDFA 4L76A 4WEQA 2X0IA 3RFTA 1E3EA 2NQ8A 2O48X 4CQMA 3NTQA 5KJEA 1T2AA 3AUUA 1NWCA 2BH9A 1ZMTA 4RVFA 1MC4A 1DC3A 1SPXA 2NU8A 3WQRA 4XR4A 2HRBA 1QLJA 2I67A 2CDAA 3AUTA 3VDRA 2OXIA 4FB5A 3VKVA 1VM6A 3W4IA 2Y1FA 5A5FA 3RKUA 4DGSA 1K0UA 2NTVA 4C7KA 1RKXA 4JN6B 3P5SA 4R5MA 3FTPA 3RBZA 2X1HA 1Z74A 5IZCA 1YQGA 4WECA 1EDOA 1XQ1A 3RI3A 1IULA 3AI1A 4RJTA 3RBVA 4W4TA 4QSMA 1DOHA 1ADCA 5ER9A 1V3TA 4DPLA 1IY8A 1Y9AA 3EAGA 3UXYA 4JBGA 5TS3A 3W8DA 2PGLA 4LSWA 3KSDO 1YB5A 2CNBA 1M6HA 3RIHA 3PGXA 4GX5A 5U1PA 5C7LO 3Q2IA 2DQ4A 3NJ4A 3OHSX 2AG5A 4OQYA 2BFOA 3ETEA 3Q6IA 1O0SA 4E6PA 1O6ZA 4N7RA 4IMPA 4N5LA 5G0WA 5IZCC 1DAPA 3ZWNA 4IJWA 1MG0A 3NTOA 5TT1A 1PR9A 3K73O 2B4QA 1N7HA 3RU9A 2O50A 3ITKA 3JD2A 4HFJA 2O3SA 3DL2A 1ZSVA 4CLHA 1PJLA 4EJMA 4J7XA 1LC3A 1U4OA 5CG1A 3NGXA 3FR7A 4NH4A 5DCUA 1UZNA 5BSEA 5THKA 3WXBA 2YQ4A 3QVWA 3KSZO 3WYEA 1GUZA 4CV3A 3ROQA 1HXHA 4PG6A 3VH3A 3SLGA 3ICCA 5K9ZA 5AXAA 4E21A 4Z9YA 1WZIA 3AJRA 1KY4A 4LMRA 3FWNA 3G3EA 4ND5A 2O2SA 4WUVA 4ZQHA 3VTFA 1K2WA 5ES3A 4EJ6A 5A1TA 1WLYA 2C59A 1CQJA 3GVXA 4A5OA 1DB3A 2QIOA 4U0KA 1OC4A 4I5GA 3ORFA 4YXFA 3DFZA 4H16A 1DPGA 1P1HA 4BO6A 2NUAA 4M8SA 2JFHA 3GMDA 4CM1A 2VYND 3AFMA 3K6JA 3ONDA 3Q3CA 3U0BA 4CR6A 3IUSA 3JQGA 1I5RA 4B3IA 3RUFA 3LDHA 5A04A 1WDKA 2EKQA 5EESA 2Z95A 3OJFA 5A3VA 4J43A 5ER6A 1LDEA 5TJHA 3WJAA 1N7GA 1U1IA 4IJUA 4K28A 1P0FA 1UP7A 3O38A 4ROSA 4ZQEA 2WYWA 3F1KA 3OJOA 4CL8A 1YL5A 2IEDA 1EZ4A 1E1KA 1PL8A 2QG4A 4YBZA 5G4KB 5JXWA 3HJAA 4BGUA 1B3BA 3QVTA 3I4CA 4BNLA 1YDWA 1ZZEA 4NFSA 4J4BA 1ONPA 4JXKA 1R4MB 2W2LD 3IDSA 4BNVA 1NX6A 4MP6A 4E4YA 4D0SA 3TFQA 3INGA 1UXGA 1GQQA 1Y9EA 2RCYA 2OL4A 4NFHA 1LRKA 2C82A 3H65A 4WLUA 4KZPA 1EUDA 4NJOA 1DHTA 4UAGA 2B0JA 3TOZA 4KWIA 4YR9A 3SVTA 1QSGA 4J7CA 4BB5A 1MUUA 2BD0A 2FSSA 1YL6A 5DDIP 5DULA 4U0JA 2VZ9A 3FWZA 5G0VA 5L40A 1BDMA 4B7CA 4RZIA 2AQKA 3B20A 4IBOA 3T4XA 4XRRA 2VT2A 4NI5A 4YT4A 2A9FA 2PH5A 4DYVA 4BMSA 4L4RA 2ZJ0A 1TI7A 1JTVA 1GADO 1LNQA 4CODB 4CMEC 3KETA 2OHXA 3SC6A 1EBFA 1XU7A 1B8PA 4WGGA 1ZK3A 3GGPA 3DMTA 3IKVA 1AGNA 1WW8A 3R0IA 4IXTA 4OGWA 1XLTA 3TNLA 4IGEA 4BHTA 1YBVA 4HKTA 1RYEA 3D5QA 4IQ8A 5T57A 2P9GA 1T4DA 3IP3A 3X2EA 2JD1A 5AQ1A 4CM7A 3SEFA 2EP7A 3H9JA 3RUEA 2PV7A 1GPDG 3OM9A 3E6AA 4Q9NA 4YT8A 2BF7A 1C1XA 1GUYA 3A14A 3JQGB 3UF0A 4OM8A 4EEXA 2O7QA 3LSYA 5BNFA 4GGOA 5LDGA 1DBVO 4LRTB 3DMTC 3COSA 1PTJA 1HE3A 3P2YA 1LQUA 4LGVA 5GY7A 1DIGA 3GLQA 1IPFA 3EVTA 1WDMA 1P9LA 1M6WA 2DPGA 2JAPA 4RF3A 3RCBA 1B2LA 1TVEA 5HS6A 4WCFA 4PG4A 1C0LA 3GVPA 3HDJA 3HDQA 4CPDA 2DM6A 1P0CA 4J0FA 3KEQA 4PLFA 4W82A 1X7DA 5TF4A 5KCZA 4ILKA 1PQUA 1SEPA 1GAEO 1PGJA 1OZAA 2J3HA 2YDXA 1NR7A 3DBLB 4GSKA 4OSPA 5CPFA 2R00A 2GNAA 1PL6A 4CQMD 4R01A 2AEJA 1M76A 4HY3A 4IQ0A 4DQUA 5U9CA 1DIHA 4RLHA 3W6ZA 4E12A 2FPGA 5JW6A 4DQXA 1RPNA 1U5AA 3IQDB 1GV1A 1G0OA 1I8TA 4RVDA 4YACA 1J6UA 3D3WA 4F6CA 2OBYA 5I7FA 3LLSA 3QHAA 1BMDA 4E5PA 4YEDA 5IAAA 3FD8A 1JQBA 1B8VA 1O94A 4E5NA 3W6UA 1ULSA 4G65A 1UR5A 4OH1A 3VH4A 2D5CA 4E32A 1ENZA 1HWYA 2R00C 2VNSA 3X2FA 4GWGA 3S2EA 4MP3A 4FD3A 4YJGB 4BV9A 1VI2A 3F6YA 1K6IA 2UDPA 3ZNPA 1U2GA 4AJHA 3HSKA 5KKCA 3F3SA 1E6EA 4ND4A 1BXGB 2H1SA 3O8QB 3RUDA 1GZ4A 5EMHA 5JYDA 2FPIA 2D3TA 1KVUA 2OP1A 3PHHA 5G0TA 3P7MA 1X7GA 3WTCA 3IAHA 3KHUA 3L6EA 3NRCA 4IDBA 4OJNA 1AN9A 1AXEA 3U4DA 1FJHA 1PU2A 1XGKA 4YAEA 5KJFA 5L7TA 4GBJA 4X54A 1JWBB 1ZEMA 2EG9A 3MWEB 3WOHA 2Q49A 1HE5A 2CD9A 2DFDA 4FN4A 2GN8A 4JJGA 4LVCA 1SBYA 5JY1A 4OOEA 3JD3A 5L3ZA 4FDAA 3V2HA 4BO1A 2Q2QA 3UHAA 3ZZNA 4CLXA 3PDUA 1ZBQA 1D7OA 1A7AA 1E77A 1E7RA 1X0XA 4OIMA 1E3SA 1TEHA 1YGYA 1I2ZA 1I36A 4J1TA 1BW9B 3GEDA 2YDYA 2FN7A 4FQ8A 2D0IA 4MVJE 1R66A 3HN2A 3D4NA 2EW2A 2Y66A 4I5FA 1SB9A 3A4VA 3EGOA 3OMLA 4PG7A 4E5MA 1IB6A 3E8XA 2HMSA 4XGNA 3OFSA 5F5NA 4K26A 3B1KA 1Y8RA 4A7PA 4XB2A 4ZQFA 7MDHA 4Z0TA 3CZRA 3RUIA 2X23A 1MB4A 2ZATA 1GFSA 1V3VA 2GR9A 3KM0A 4JIGA 1P44A 5EJ2A 4XWYA 1GEGA 2P4QA 5AXBA 5C7IO 1PJTA 4QUKA 3WB9A 2O3UA 1N9GA 4TZKA 1D1SA 1X7HA 4GGPA 2JJYA 3CZMA 1I3NA 2CVQA 3WFIA 1DC4A 4LW8A 5A02A 4YCAA 3GR6A 3IMFA 3PZRA 4Z9FA 1KEWA 1QV6A 3UFXA 1DFIA 3KXDA 3OJ0A 3MJVA 3BMOB 3RJ9A 4NG5A 1DRUA 3FI9A 3V2GA 3JQFA 2A94A 3TZCA 3DAGA 4YJHA 3QWFA 4FIZA 3W8EA 2G82A 2P91A 3DOOA 3LT1A 3RC2A 1SB8A 3JV7A 1VJ0A 1FDWA 1ADGA 4E2ZA 3QVXA 4F46A 2BELA 1BVRA 3K96A 3PPIA 1GQYA 1PX0A 2G17A 3H3FA 4IDFA 4ZU3A 4HUJA 3S2FA 3VKUA 3ITDA 3GK3A 3BZUA 1HE4A 4E3ZA 2XPCA 4PCVA 3QQPA 1SZJG 3ZHXA 3O4RA 2VTDA 3WSVA 3H6KA 1A71A 6LDHA 4GLOA 4XYLA 5F5LA 3ZCXA 3GRPA 4FC6A 1MA0A 3JQFC 2I99A 3VPSA 3U49A 4AL4A 5DN9A 4XEHA 4ALMA 2UUOA 1H9AA 4HFRA 1MLDA 1YWGO 3ON5A 3PYLA 3UN1A 2JD2A 2Y1GA 2ZQYA 4ZGWA 4WNIA 2Q4BA 3PQEA 1UZMA 3I9NA 5L4SA 4GL4A 2WYUA 2DLDA 3AY6A 5T5QA 1LI4A 4QT0A 3ROKA 1XIVA 2GPTA 3NT5A 4UEKA 4ZRNA 2QZ9A 2Q2VA 3P2OA 1I24A 4I5DA 4JCOA 4BO7A 3NT4A 4TVOA 4GKVA 3PQFA 2HK8A 4DIOA 1NVTA 1ZMOA 3NEPX 1E1LA 3H5RA 5MDHA 1E6WA 4E2YA 3PVZA 4WLEA 1DSSG 2NLOA 2ZQZA 1JWAB 3L4BA 3SXPA 2NM0A 3OETA 4J91A 3FBTA 5HM8A 5DBGA 1E7QA 2G76A 3LLVA 1P1KA 2IZ1A 3K31A 4PLVA 1Z45A 2AE2A 3VZRA 2Y0EA 5A4DA 2I3AA 4R1SA 3LC1O 1EFKA 4IDGA 4HV4A 4UVDA 1ISHA 3GC6A 4TMFA 4D41A 4IS3A 5DCWA 4M87A 4W7HA 3M2TA 1DFGA 1GYRA 1RM4A 5CDYA 3E9NA 3E82A 2H63A 5IJZA 1R0LA 1TT5A 3I1JA 2VHZA 1LJ8A 4FW8A 3BTVA 3VTZA 3L4BC 3DBRA 1HDOA 4OO3A 2GYYA 4BNIA 2GCGA 4ND3A 1E1MA 4CLRA 4LVUA 3E48A 1F17A 4N54A 2HJRA 4BNFA 4CMJA 3L0DA 4J7UA 4ZICA 1BSVA 3VOSA 5J23A 4OKIA 4DQVA 3MWDB 1A5ZA 4YA6A 5EPOA 2GZ3A 2HLPA 3RWBA 3WLEA 3R1IA 3QVOA 1GCOA 2Y68A 4R16A 1ZNQO 3VPFA 4E33A 1I2BA 2PFGA 4KTTE 1JAXA 1PQPA 5FEUA 1ZSNA 3KLPX 4WLNA 1QMGA 4RGBA 5K1SA 3WICA 1NFRA 3BHMA 3MJSA 5KWEA 4DBVO 1P45A 3HDYA 2JHGA 3FNGA 2E48A 2C29D 2AQIA 4PG8A 3D5TA 1MXHA 1T2DA 1H6CA 5KIAA 3D0OA 4R9RA 4WLOA 5EQDA 4XIJA 4OXYA 3ZWXA 1X1EA 4IJVA 3BYZA 2GRAA 1GUFA 3KEOA 3KYDB 4IDCA 4QFCA 4BO0A 4DBZA 2DBRA 2E49A 4IS2A 4J3FA 1QYXA 4WLVA 5L7YA 3AY3A 3PK0A 3DZKA 4DMLA 3D4OA 1S6YA 5KJ1A 3F5SA 1DJNA 4KUEA 1MFPA 3NUGA 5JAMA 1YH3A 5IXYA 4ZQBA 2I3GA 4E5KA 1CDOA 5AXDA 1OBFO 2EIHA 3MOGA 2EW8A 2VHXA 2PZMA 4CMIB 4JBHA 3JD1A 4EEZA 2PR2A 2WE8A 5A3JA 2J3JA 4CUJA 3C8MA 4DL9A 1DO8A 4XQCA 4CR8A 1O9BA 3JQ6A 1HETA 2ZB7A 3C7AA 3KV3O 2W2LA 3UUWA 1B7GO 5GZ1A 5L95A 2YZ7A 5JCXA 3TZHA 3MZ0A 2H5LA 1TT5B 2BFAA 2C0CA 5AOVA 4BIIA 3WGQA 2J3KA 2EV9A 4QXMA 4DREA 2YJZA 1Z75A 3CEAA 3ZNNA 1AE1A 1LUAA 4W99A 4JBIA 2VHWA 4BO8A 4YDRA 1X1TA 3ONEA 3OECA 4GWKA 4E30A 1W8DA 3GDOA 4PLPA 1DAOA 2BGKA 2VWPA 2VRCD 1HE2A 1YJQA 1E7WA 3NJ8A 2W2KB 3AOEC 5JYEA 3H7AA 2B36A 1FXSA 1F12A 1QYVA 2VZ0A 2QRLA 3IL2A 4MPDA 4IZHA 3F4BA 1B3RA 4XA8A 1PZEA 1KVTA 2NU9A 1TA4A 2Q4EA 3M1LA 4WOKA 1PGOA 3ZNOA 2CDCA 1O8CA 3L77A 5KJCA 1NM5A 1OMOA 1U9JA 2D1YA 2GD1O 3CUKA 3DXFA 1EE9A 1WVGA 4MIYA 5ENVA 4EYEA 5DP2A 3RD5A 1DJQA 1H6DA 1EUCA 2EERA 1BDBA 3SLKA 3ZWYA 2A92A 2V65A 2EP5A 2B4TO 4ITUA 3WR5A 5A5EA 1JVSA 2EF1A 3VVBA 1ZH8A 2R6JA 2CF5A 1P1IA 1T24A 3I9MA 4RV9A 2EKLA 4ALLA 3GHHA 1N1EA 3FHLA 3ZW9A 3TF5A 5CDGA 1PEDA 2DC1A 4JK3A 1SMKA 4TWRA 1U28A 4D46A 3JD4A 2BKAA 3S1LA 5EINA 1BXKA 4P38A 2IODA 2O23A 2ZK7A 2AQHA 4J1QA 1F14A 4DPKA 3PHGA 4DYDA 1YOVB 3T4EA 1KEUA 3GHYA 3I52A 2NVWA 1CJCA 1WMAA 1JKIA 2F00A 2RH8A 3OIDA 4GX0A 3E03A 1U2DA 4NBVA 2DTXA 3JTMA 2C07A 1K5HA 1HDCA 1I2CA 2J3IA 3IUPA 1SCUA 3OH8A 4YRAA 2Z1MA 3U4IA 1NXQA 4EW6A 2OORA 5L4NA 4YYZA 3C1TA 3FSRA 4AFNA 4D3SA 4R1NA 1SO8A 4W6ZA 3JD0A 2Y1DA 1EDZA 2X58A 4XDYA 1HYHA 2DKNA 3VH1A 4NZ9A 2QRJA 5G2OA 3K30A 3VC7A 4OOFA 4PLGA 2XF8A 1MXFA 4RQUA 5DOVA 5G0SA 1W4ZA 1ID1A 2NTJA 2YQ5A 4AJJA 4I5EA 3C7DB 3FF4A 1DDOA 1HTBA 2BFMA 2QW8A 2HJSA 2BHLA 1UJMA 2ZTMA 4INAA 4OQZA 3RUHA 3ZWAA 5K6AA 1Y6JA 4CJXA 3UCXA 4AJ4A 4QTZA 2CMDA 2X0RA 2NNLD 2YHIB 3TRIA 5TRTA 3PRJA 1LSSA 1BVUA 3ABIA 1ULUA 1UDAA 3HE3A 3H3JA 5G4KA 1O95A 4JJIA 1C1DB 1CEQA 2B69A 4CMKA 4CL3A 3GZNB 2UUPA 4E2XA 3OF2A 3VDQA 1R4MA 1U7TA 4EI2A 4MVJP 2NQTA 1L7DA 5T64A 3VPGA 1H6BA 3WIEA 2RHCA 2WD8A 2CSUA 3VAZA 4ZJUA 1LTHR 3P19A 4EITA 2GSDA 2D4AA 5B4UA 4R1TA 4UUMA 5ILGA 3DHNA 1ISIA 1HZZA 1CETA 4XCVA 1VL8A 3QLJA 5FFFA 4IQGA 1DIAA 1A9ZA 1QYCA 5JPIA 3PJDA 1WWKA 3NTRA 3GN1A 3BHJA 3E9MA 4XGKA 3WNQA 4MIEA 3RASA 4FC7A 3AI3A 1XSEA 3QSGA 1T25A 2I6TA 2WMDA 3QWBA 4MVJG 2Y0DA 2AW5A 3L4SO 4B79A 5L4LA 1L7EA 5A9RA 2H9IA 3GPIA 3NX4A 4Y9DA 3WX0A 2PD6A 3ZN2A 4JJFA 3AWDA 4FR5A 4LCJA 1PGQA 4MVJH 1LRJA 1LU9A 1D4FA 1AHHA 3AUAA 4BMVA 3DHYA 1S7CA 3D3EA 3GUCA 9LDBA 2D2IA 3I23A 5JAIA 1U5CA 3QWAA 4FOOA 1T1SA 3F9IA 2FOIA 2A4KA 4FFRA 4IUYA 1AUPA 4E31A 2EEZA 1GDHA 3JQ7B 3SC4A 3C85A 1HDZA 3VH2A 5TNXA 4BNJA 3BTOA 2BLLA 1SAYA 2AXQA 4MO2A 5AVOA 3UKOA 1HF3A 1MFZA 2Y1EA 1U3UA 2O4CA 3AM4A 1Q0HA 4XIYA 2X9VA 2H6EA 4YRBA 5I7EA 1A72A 1EVYA 3OA2A 1HYGA 4ZN6A 3U4HA 3RU7A 1B8UA 1I0ZA 2YV3A 4NFYA 4A26A 3IOYA 1VPDA 3W1VA 3K8ZA 4CM8B 4FJ2A 3VHRA 1B0AA 1FF9A 4E0BA 3LC7O 1LDMA 1VSUA 1WAMA 5BR7A 3E9QA 3ONFA 4BQRA 1KETA 4MP8A 2A35A 3FPLA 4XJTA 2D8AA 1PL7A 1ZFNA 3DBLA 2NADA 2NV6A 3GQVA 3QY9A 3QIVA 1NASA 5TLSA 5L51A 3CINA 1K6XA 2FZEA 2JAHA 5CDSA 2HMWA 3O9ZA 1NP3A 3EZLA 3GFGA 4D0RA 3GNTA 5A06A 5ITWA 3LC2O 4UULA 3WGIA 3IJPA 5I7SA 2HQ1A 2JCXA 4RPHA 5IDYA 1PJ4A 3PFWO 4JLWA 4PVDA 3BA1A 5CDTA 3Q9NA 2I66A 4NBRA 4GSLA 3GG9A 4UVGA 5COBA 3PWKA 2LDXA 3ICPA 1K6JA 1R4NB 2X9GA 1JLLA 2VWGA 3DR3A 1IE3A 3CMMA 3L6DA 4BB6A 4IDEA 3WS7A 2HK9A 5C7OO 3WGZA 1CRWG 4NJMB 1E7SA 3WJ7A 4YJGA 1H9BA 2AE1A 2G0TA 3GNQA 4DXHA 5C3MA 3Q1LA 1GYPA 2CVOA 1NPYA 1CQIA 2IXAA 1BXGA 4A03A 3WYBA 2X0JA 3O8QA 4A0SA 1WXDA 2FY8A 1E7MA 1U8XX 4O6VA 1CERA 3KRTA 3WGTA 4XGIA 1A4IA 4Q3AA 5C5IA 1A27A 1ORRA 2CF6A 4AVYA 2ZTVA 5HRUA 4O59O 3ZWOA 1KS9A 2EJVA 3WGOA 3L07A 3M6IA 3A9WA 3FCOA 3HWRA 3HDHA 1G6KA 1RM3A 5I8WA 3ZWBA 2OO5A 3IC5A 1VLLA 5DF1A 3U9LA 3WQSB 3O26A 4LN1A 3ENNA 1QXSA 1J0XO 2Q1SA 2WEKA 2RAFA 3FTNA 2AEMA 4QO7A 5IN5A 3MJTA 3LK7A 3OEWA 4FBGA 3V1YA 3HADA 1E3JA 1Q7GA 4O1MA 5IF3A 3ADPA 3U4CA 1LLUA 3TN7A 2ZB8A 4CM9D 2Q1WA 1ZK0A 3SJ7A 1BW9A 4Q3DA 4Y67A 5JAQA 4GX1A 1PIWA 1XU9A 5GMOA 3HFSA 5A9SB 1I10A 3WGYA 1MX3A 4BNTA 2NVUB 3F47A 4EUHA 1EEHA 2TMDA 4IY1A 4KTVE 4BVAA 2B5WA 4TKLA 3RKRA 4XB1A 4EBFA 2NVBA 4OSOA 1A9YA 2WSBA 4CLDA 5DBIA 3WGHA 3MOIA 3AU9A 3G1UA 5T67A 1SOVA 4QQRA 4MVJF 2NTNA 5GZ6A 4CLOB 4CMAA 1H6AA 4WCDA 4B7UA 3TL3A 4XYEA 3K2EA 1VJTA 2YV1A 4NQZA 3AW9A 3L9XA 1IYZA 2PA3A 3C24A 3ZWMA 3JQ8A 2PWZA 2XAAA 1EQ2A 1HDRA 1AHIA 1N92A 4WCFC 4B3HA 4KP7A 4HNHA 4I08A 3GRKA 4I9HA 3MJCA 3WTBA 3K5PA 2ZYGA 2VUTA 1OC2A 3DTTA 2FR0A 4L4XA 4BUCA 5L9AA 1I3LA 2OGUA 1ENPA 5JMPA 1GEEA 3JQAA 1G1AA 4AJKA 4NK5A 2HSDA 2C7GA 3PIDA 4NK4A 3KTDA 2O3JA 5KNLA 3BMOA 2VNAA 2BI8A 5KOIA 4LMPA 4RVUA 4IGFA 1ISJA 2X5OA 3DMYA 4O5OA 1N8KA 4HWKA 4R3NA 4ESOA 1V35A 2JL1A 2I76A 3BTUA 1QV7A 3PWZA 5DP1A 2P2SA 3Q11A 1UUFA 2JFFA 1C3VA 3E1KA 2ZYDA 2VTEA 4M54A 1QORA 3MJ4A 1FDTA 1ARZA 4DRYA 1ML3A 2IRWA 2EGGA 2FPPA 3C3XA 5BQFA 1U8FO 2YY7A 2V6BA 4Y98A 4WK6A 3AM5A 4YWJA 3T7EA 4BO4A 3JYNA 2PY6A 4RVSA 5KVVA 1YS4A 4TRNA 1PS9A 5TJ9A 4BOYA 5DCYA 4Y6SA 4DC1A 1LEHA 4TRJA 3IP1A 1LSJA 1YB4A 5TQVA 2J8ZA 1DRVA 3TL2A 4UEOA 4CV0A 1EBUA 2P5UA 1VE9A 5A05A 8LDHA 2VRCA 1JKJA 3PYXA 4HFNA 1LDNA 3PI7A 3H4VA 4D3FA 1Y5MA 1R37A 1V3UA 1M66A 2XXBA 3DBVO 3DZIA 4NBUA 2DBVO 4U6QA 2HU2A 1NQOA 5ILOA 4XD2A 4RVHA 1KERA 3CIFA 5LCXA 4C4OA 4Q3NA 1U7HA 3S2IA 5F1KA 3FBGA 5G0UA 1NQ5A 4W7IA 4W9NA 4BO3A 2I9PA 2ZB3A 5FWNA 5L45A 1FK8A 3PFFA 4BGEA 3JQ8B 2QYTA 1Z82A 3ETGA 4RPGA 2VUSA 5I9MA 1J5PA 4DWVA 1DHRA 1CYDA 4EZBA 3JQAB 1OOEA 1M67A 1HDXA 2QRKA 3F5QA 4H7PA 4IIVA 1Y7TA 4MKZA 3AUSA 3HB4X 3H2ZA 1G0NA 1P3DA 2W98A 4JROA 4RORA 3GN2A 2PZLA 4FJ0A 4D7AA 5A03A 1X15A 2CUKA 3DZGA 4HXYA 1XDWA 2GF2A 1PGPA 1P33A 1IZ0A 3KYCA 4P4NA 1EK6A 4S3MA 4BQPA 3WQQA 1YQDA 1FDUA 1JU9A 3PEFA 4OHUA 3UAGA 1PJBA 1HDYA 1ENYA 3UVEA 1DEHA 2ZCUA 1I32A 4BNWA 1E0DA 2VYVA 4WKGA 1Q0LA 1XKQA 1NVGA 1CF2O 3H5NA 3OEYA 1TB4A 2Y67A 3D4PA 2OOSA 4D43A 1A4UA 4A2CA 3GEGA 3OICA 5KVQA 1LLQA 3GVHA 4HP8A 1GD1O 2ZTUA 8ADHA 1PZHA 1GY8A 2RBEA 1ADBA 2AEFA 4YB8A 2NACA 1H94A 1JW9B 5HA5A 1EVJA 3E5MA 3RQSA 1KC1A 3FPCA 1ENOA 3KYDA 4RZHA 5IXSA 1NHWA 4Y6RA 4UVHA 3PGJA 4KQXA 2O3QA 1MGOA 1ZK4A 1IPEA 5IDQA 3PHLA 2HMUA 3K92A 4Q3CA 1E1NA 1LSUA 1HSZA 5TIIA 1PJQA 4DUPA 4EUFA 5EQFA 3JQBA 4NMHA 1RWBA 1YKFA 4FS3A 1P74A 2IEBA 4CMIA 1XELA 3TJRA 1N5DA 2VWQA 1SC6A 5B4TA 4BO2A 1RM0A 2FMUA 4FFOA 1GR0A 3PYMA 3WWYA 3H9QA 3DZFA 4RDIA 2TMGA 1I01A 5JS6A 2IYPA 2X0NA 5FI3A 3A1NA 5BSHA 2VHVA 3BAZA 4QECA 3KLMX 4BNHA 2CZCA 3C1AA 4FFPA 3LQFA 2Q46A 2CVZA 3B6ZA 5A9TA 1NYTA 5CEFA 2ZJ1A 3ZGYA 4KOAA 2UAGA 2BGMA 2C2YA 2PKRA 4BKRA 3KYCB 4BS9A 1E3LA 1XHLA 2PGJA 3HFGA 4NNJA 4WNCA 2JKVA 1NPDA 2C7VA 2C54A 5JSFA 4KUGA 1R16A 2ZIZA 4MVJI 1U3TA 4M89A 3WFJA 4F3YA 2W2KA 2HAEA 3EYWA 3ZV6A 3EHEA 4BV8A 1VKNA 1BWSA 1K3TA 3PHIA 2EKPA 5FYDA 1T4BA 3QJ5A 5KJ6A 1QG6A 5EERA 4E5YA 2Z1NA 1T2EA 2HDHA 2X86A 5FI5A 4CM4B 4DLAA 2IZ0A 2UYYA 4PGFA 1ISMA 4JP2A 3RC1A 3W4KA 2DFVA 4Z3KA 1YO6A 1B26A 4R54A 4TQGA 3PJGA 1EFLA 4PZCA 2B5VA 2RH4A 4U5QA 1XA0A 3U09A 3ETDA 2PKQO 4GAEA 4I9UA 3WG9A 3JQAD 5COQA 5B37A 4DVJA 5C37A 2AHRA 4EJ0A 5ICSA 4J0EA 4K9DA 4PVCA 3C1OA 2FHSA 4MKRA 1O89A 3CTMA 1EMDA 3UGKA 1NNUA 3ZV4A 5F3RA 3UOGA 2PKQP 5JBIA 4IZIA 1T2CA 2OBNA 1QYDA 3GUYA 1YOVA 4HFMA 4AJPA 4WLFA 4E13A 4PRLA 3SJUA 3EW7A 2POQX 1E5QA 3RROA 2GGSA 5JC8A 3DZJA 3R3JA 2WD7A 3H9EO 3LT0A 1D1TA 3GPDG 3INRA 2VCYA 1C0PA 4QFDA 2HKIA 4F45A 2YFQA 3LZ6A 5JO9A 1PJ3A 2B35A 4OXNA 4Q3EA 1H0KA 3IIEA 5DBFA 3RJ5A 1B14A 2PD4A 2C2XA 3LT2A 2R2GA 1TT7A 1AXGA 5JAZA 3CXRA 4L73A 4YVFA 4XQGA 1PQWA 1DC5A 5JY6A
chains in the Genus database with same CATH superfamily
2FAXA 3Q72A 1T1RA 1AKWA 1KI6A 3JWEA 2PZKA 2HCTA 3IUMA 2YWGA 3CW8X 1RYZA 5JTUA 1AKMA 1N6NA 2JVIA 4JLSA 3BXXA 4MR9B 4XCXA 2F3RA 3RFVA 5IH7A 1W36D 4MQUA 1E1DA 1X7WA 3T3IA 4K7JA 4TM7A 5JECA 5DMXA 1ZMXA 4O0LA 1WZNA 4PXSA 1VIVA 1VCOA 2NU6B 4A27A 1Z7WA 2P6OA 4DJTA 1SVKA 1GAXA 4DCGA 3FOBA 3QH4A 1Q0QA 1ZS9A 2Z1DA 4AJLA 3HGMA 5JANA 2C5SA 5K0CA 4W1RA 5E7MA 3FIJA 2F1KA 6ADHA 3IEVA 3T7RA 1GZ7A 3GZNA 2V5UA 4MEJA 4C9BA 1UXIA 3ISTA 2X7XA 1ZXBA 1Z25A 3MEQA 2G1UA 1BWPA 3LBNA 1AKRA 3N2LA 1T1IA 1JNYA 3E4CA 3RYIB 3PI6A 3HJBA 3LW8A 1THMA 2PX6A 4DA4A 2VHJA 1ZGBA 2BEUA 3HVIA 1WPGA 4YJFB 3UOAB 4HZGA 4F93B 3UA3A 1CNEA 4RTSA 1I30A 1T4CA 5CVVA 3T7CA 3WMWA 3VHLB 2YYYA 3Q9LA 3ZU5A 5IPFA 3GLVA 3WBKA 1IXKA 2ANCA 3DCYA 1RYMA 4TYNA 2CLFB 2VJOA 4HDNA 2GFIA 4MJLA 4U2BA 3OBBA 2IHNA 3NGLA 5C31A 3PEVA 4XYMA 2WIBA 2WKRA 2Q5IA 3DTNA 5CH3A 2ZTHA 5BUSA 5FPKA 1J70A 4MWZA 4FMDB 2EW1A 3PGLA 5BMVF 4XLTA 5CURA 1SWWA 3MILA 2KBEA 4HK4A 2JI8A 5G41A 3UJ8A 1S2DA 4BQNA 2Y99A 3D2LA 1T9AA 2OHIA 3FE2A 5CB4B 4JAVC 2B30A 4EO7A 4ZCIA 4B71A 4DG9A 2RHRA 1MEOA 2QL9A 3BGDA 2Y0CA 1NBOA 2BFEA 4BLOA 1VPLA 3ZTWA 2AVDA 1PRYA 2H3EA 2FRDA 1A8HA 4J6FA 2H1OA 2OENG 4L27A 3UWDA 2ZBGA 4QE3A 1Y8QB 2V6MA 4DBLC 4MKXA 4J4HA 2Q4RA 5J2TB 2HN9A 1LA2A 4RVNA 3RC9A 1TVKA 4NENB 1FS5A 3UPTA 4ZAXA 2I1VB 3PR3A 4J76A 5JXHA 5JEDA 1ODTC 1ZOIA 2GPAA 2XKAA 2IY7A 4KXWA 4FSHA 1RRMA 4ISBA 4EJSA 5MGBA 3VKWA 2VJDA 1KXJA 1F1JA 4EW3A 4JOQA 4PSAA 3WSWA 1TQ8A 2X9NA 4ANFA 5DLDA 1KI2A 2RARA 2I65A 1Y48E 2XNCA 2VUUA 4MRVA 1C0IA 2EIXA 2MSCB 1H0SA 2C99A 2FRDC 3PPYA 1X7WB 4P4LA 1RWOA 2DHRA 4ZV4A 4GPIB 5BNIA 2YYSA 1NONA 1QG2A 1ST2A 4QAJA 3ZV3A 1OREA 2Q1UA 2YS6A 3BQNB 4KSYA 1O4WA 2OGSA 4FBMA 3TMKA 1C14A 1S89A 2CMHA 2VRBA 4XVQA 3R7NA 4BP8A 4FGSA 3QKRA 1CZRA 4M55A 3LF1A 1CUSA 4MLDA 2ZJ3A 2GBLA 1EK5A 2JIZA 3CC8A 5TVGA 3KS9A 2ZSKA 4KMRA 5J4KA 3JQRA 1TJNA 4ZEXA 4S12A 2P5TB 5F7JA 4RKYA 5JCJA 1FP2A 1DC6A 1BX1A 3ICWA 2IYLD 1VECA 1LDYA 2AOVA 4BLPA 1EX1A 3L1VA 2B82A 3TYXA 3L7LA 2WHEA 3NDIA 1OFTA 3U4QB 3KPUA 2DBYA 5AVWA 5AM3A 3DZDA 2QJOA 4G5OA 1UWVA 4FGWA 3TPFA 2BFCB 1SR8A 3EMVA 4O25A 4QVGA 1JE0A 4QT4A 3HJCA 3NETA 2HUNA 1FXUA 2ET6A 1O1YA 3O4JA 4RTMA 2IUSA 3P94A 4OUDA 1W59A 3WLFA 2GBLC 3PFCA 4WY5A 1KIAA 2A8YA 5J2UA 1X77A 1XLUA 4BCCA 1GPUA 4W5WA 3IXLA 1B16A 1QQ5A 5K3CA 4KRGA 1G64A 1ZGHA 4UUPA 1E6UA 1GVNB 1QIKA 4XSHA 5EIXA 4BNMA 4A15A 3F7MA 5EOVA 3V00A 2A67A 4LGCA 4LRYA 4F1JA 3P9SA 2EWMA 1ZINA 2JLRA 5E2IA 1VBKA 4BMXA 2OYSA 3PC8A 1D6MA 3STXA 1G8HA 1NU6A 3UQZA 4FUTA 2GD2A 2Y1OA 1V11A 3O2NA 4HGNA 3W4JA 1UJBA 5DNDA 3CKYA 4R69A 4AKGA 2ECQA 5I9NA 1C3EA 1KHHA 4N3BA 1X1DA 2ZKLA 4N5MA 2CXHA 1F4LA 2BN4A 3P8ZA 4FR2A 5KU7A 1L6RA 1P77A 4P5PA 1VTKA 4G3XA 4FR0A 4LXUA 4C22A 2ZUBA 2QV0A 1ZH6A 2WU3A 3N58A 4KQFA 4QNNA 5FTWA 4EJSB 5JAUA 3WKBA 2E6UX 3LXXA 3FXAA 1F06A 2JIBA 3HKBB 3GLFB 1T9ZA 1ZR2A 4R8RA 1RQLA 8ABPA 4J2OA 5ALMA 3CISA 3L1KA 1E4VA 3MUEA 1MT3A 2FWPA 3JYQA 4Q9AA 1XAJA 4GMKA 3PC8C 4WBNF 5EUBA 5KSOA 1TJ3A 2G9UA 4L50A 5IMBA 4EATA 5ED4A 2HCRA 2NU8B 3BT7A 5ALPA 4GWLA 4B73A 1MRZA 2R6FA 4GMFA 1NJ2A 3CF4G 1VYTA 2C9YA 5H0IA 1CEXA 4PZUA 3GI1A 3FCSB 1HY3A 3LA6A 1UDBA 2A1UB 3QKRB 1ZVQA 4I6GA 2ZG6A 2ZRLA 1K7EB 3NYRA 4L4UA 4QYXA 5K3DA 3TNFA 1I94B 1BMTA 3DF9A 3OQBA 3J81k 1YJAA 1VE1A 4P22A 2O7SA 4RSMA 4Q9LA 2EFJA 3UUFA 2NP6A 2WU1A 4CNQA 4JUAA 2Y1KA 3P96A 4QBTA 2XVZA 5AIBA 5EWJA 3ORQA 5F2EA 1QQ6A 5AVZA 1XYGA 2WUVA 1XCBA 2Q0QA 3FMFA 1KE1A 3O5AA 3JQ9A 3V1MA 2X2OA 4KN8A 3S8YA 4PFKA 4H1WA 3I5MA 2JFGA 5FFMA 1JIVA 1RCUA 1ZONA 2X4IA 3CLRD 3EHDA 3L7IA 4RLFA 1BQ3A 1E9SA 1QZZA 1VL0A 2W00A 3BXEA 1YZQA 3FMGA 3LW7A 4IOMA 4L6IA 4RK4A 1XRMA 2XH8A 5JAOA 5LIPA 2EFYA 2CFTA 4RA9B 2PD3A 4DLWA 2V0GA 1TRHA 1QPBA 2O6HA 2X9LA 3LRTA 1KFEB 4OUDB 3BRQA 4TXMA 4AZ0A 5AVKA 4CU2A 2JG3A 4XE5A 2P6NA 3S8MA 4F4FA 3LVQE 4M0MA 2PL9A 2OT3B 1W19A 3QX9A 2Q5CA 1R3UA 2OZPA 1NUSA 4NU8X 1J2TA 1Z08A 4G5HA 1NMYA 3S29A 3MWKA 3JQ9C 2WYVA 2FWAA 3E58A 3LUHA 2PMEA 5KX5F 2GKGA 4FZRA 1L4YA 2KI5A 3QX8A 4YDSA 3TVYA 2J0VA 2GILA 2G88A 4M1ZA 1IM8A 1KO8A 3KPYA 4NOMA 4B33A 4AZ3A 2D1SA 1QIJA 3AFGA 2GNPA 3JZDA 2IP4A 2Z83A 2AYXA 1A04A 3OZXA 3L7DA 3EXEA 1M72A 4Q4JA 4Z4IA 4LHSA 1HL3A 3K1AA 5DZSA 1FDSA 2CXOA 2I71A 3QA9A 4XR9A 2RC5A 1R88A 3H9GA 1KPGA 4C20A 2DPLA 3I4FA 4XDZA 1MW8X 1FB5A 2I7XA 4OFWA 3BRCA 1PR3A 5FP0A 2AFHB 4B17A 2WYHA 3RSHA 2FPLA 1L4KA 3JTEA 4JT2A 5ECDA 3UICA 2ZIFA 2R6AA 4RCYA 4CUZA 3F6SA 3DT8A 4RO0A 2GFHA 3JWJA 2QZZA 3PDJA 3VVLA 4CKBB 3OIFA 4BKOA 2C4HA 1GPLA 1CQJB 3U31A 3GY0A 1E7YA 5LXTF 4D44A 1JR6A 3K9BA 3ND5A 1E2UA 1S2LA 3ZOKA 1WUTA 4NYMQ 2XODA 2IXEA 1EQUA 5CLLA 1HTTA 3RARA 2ISQA 2OO5C 3Q87B 4Y8VA 4AG3A 2E5LB 1VDZA 1TYZA 4X64B 4ARVA 3V1NA 4U1RA 4R8VA 3LWNA 1Y1PA 3JASA 2XTJA 3RGWS 3V4LA 5L7WA 3HBNA 1H1TA 1J06A 3WYAA 1XCMA 2QVGA 4JR2A 1TKBA 4R7ZA 2RG1A 1MF7A 4H0CA 1YBFA 3AUYA 3O75A 4L78A 3AF0A 3RYFA 4ZT7A 5KOJB 1UXJA 4LYHA 4OU5A 4CMBA 3V4FA 4J29A 3FR8A 5E1OA 1LRLA 4IQ4A 3ST7A 1Y3DE 3QLUA 3KJXA 2Q50A 3DQPA 3GA7A 4TV9B 4IJMA 1MRSA 1YQTA 3I8XA 2NWQA 4NV3A 4QUEA 3OQ1A 3S27A 3PNLA 4AZ0B 4CLEA 2CDBA 1I7SB 5DK6A 2I7TA 1XJWA 3ENQA 4FZ5A 1SUIA 1G8YA 4HAVA 1WD7A 1ZW1A 2QF7A 2WIFA 3DQZA 5ALQA 3RSZA 4BMNA 4D8UA 3B52X 1U1DA 3LWZA 2DUWA 4G0XA 1M34E 4OEHA 3Q98A 3HRKA 4HOYA 5D2CA 1UFQA 5F1YA 1KJJA 4AF8A 4DOMA 2QBYA 4DS3A 3CJRA 4UOZA 4O4LF 2DTEA 3QVGA 4AY2A 3CG4A 1KVRA 3NWJA 1NHGA 2WICA 4C0SA 5CUQA 1QF7A 4EG4A 4KN6A 1V4BA 4ZAWA 1R4ZA 2NSDA 4FNGA 1MG5A 1T0UA 2GFQA 2DZDA 3CX8A 1NMSA 3EGEA 3AHDA 1WZEA 3ZDFA 4G0VA 2VQ3A 4WTOA 4MAMA 2C4TA 4OLAA 2V5AA 5FOTA 4LF8B 3B8EA 2D5IA 4HGOA 1QP0A 4LYEA 3VBEA 3TM4A 4ZQGA 3N2EA 1B6SA 3KJEA 3RTBA 3OC0A 5FNVF 4IIBA 3ILVA 1EWQA 1WU8A 5DE3A 1HFWA 4IDDA 3FMPB 1GITA 2J5KA 2WLSA 4KUHA 5BV1A 4Z99A 5JEEA 4EHNA 1XVVA 2CL6X 2YZKA 3K72B 4Z1MA 4L4SA 2YX1A 3ANTA 2C9ZA 4MVJA 3ROTA 3L4KA 7MHTA 1QJCA 2VAPA 3QG5A 2G9VA 1Z6ZA 3OFJA 3M89A 5MHTA 1IN1A 2DPMA 5EIBD 5I9SA 4EUNA 4KQCA 1YDMA 1GTG1 1YQWA 1M6YA 4PYQA 3UJPA 3V1TC 4D5EA 1QP8A 2PL5A 4DIMA 4I3HA 4BNUA 5JFOA 3AF6A 1OZ0A 1Z36A 3V4OA 4CXMA 1HLPA 1U0GA 2C2ZA 1GGMA 2W4QA 3GOQA 1FVFA 3IPCA 3PT5A 3Q4GA 4GQAA 4TPKA 1QF9A 4XIIA 2CE2X 2A7QA 1CJKC 2QSYA 3QU4A 4UREA 4NCKA 2UKDA 3F8SA 3W9BA 3EIOA 1A2BA 2AG1A 4E11A 1L4BA 1LF0A 3CUWA 1OROA 1USWA 5BVHA 1T5TA 3OQJA 3THRA 2WW8A 2Q8NA 3AVQA 1DC7A 5M5BA 2JGNA 1NLFA 1G6HA 1O5TA 2ZW9A 4LDZA 4QRIA 2JAXA 3BTSA 4AZSA 2PPLA 1A2OA 5HGJA 1KC3A 1NYRA 2FQYA 5FUXA 1I5EA 4XQEA 1GL3A 4DDHA 1NJ6A 2QNBA 5D01A 4EJ2A 1O2DA 4Z51A 3CF6R 5LNK1 1W2HA 1AMNA 1T13A 1U8EA 1A9PA 3BXFA 1KWGA 1HK7A 3HVKA 3E9YA 1BN6A 1CUBA 1LPNA 4RCVA 5GV8A 2VCHA 4BVGA 3L1JA 4JIMA 1XEAA 2JEOA 3QI7A 3KSAC 2IYSA 3HR4A 3GUZA 4GR5A 3DVLA 2ZAIA 4KGXA 5LZ5A 1R0KA 2L0XA 4W9NC 4MW7A 4MRSA 1GFZA 4Z0PA 4R41A 1AU9A 3CMCO 4K3UA 1FU7A 3B7GA 2VZ8A 4UDOA 1KY2A 4A8JA 3AM1A 5DKFA 1V9LA 5G3YA 4KREA 3PDIB 2ID9A 1EYZA 4YRSA 4L95C 2PX2A 4ENPA 3R3SA 3H8VA 1WXFA 4N0EA 3W5JA 1XNGA 4KYVA 1T9CA 4JKYA 4KI0A 4YT2A 3TFOA 1SU8A 4FFMA 3UMGA 2E4WA 4NCIA 3G9QA 4PFJA 1EJ0A 5F98A 3BJMA 4M1MA 2B7BA 2CSXA 4OY3A 2ZXEA 1OLXB 1SPBS 3U3MA 3CWZA 3EUFA 5B6IA 3PGA1 1PTKA 1ZIDA 2PM8A 2DULA 3O0DA 1EE1A 4M0EA 2EX1A 4PWZA 3OPYB 4XPZA 4A8JC 4AG6A 4DPMA 4OH7A 1NJFA 1OQAA 5CVJA 4DGQA 3EVDA 4DHWA 3SKYA 3C6YA 1GU7A 2FVYA 2ZCVA 5JXJA 1N1MA 2CLCX 4HXEB 3N7UA 3GAFA 1A9XB 1VKRA 5IKOA 1V0JA 3RFXA 1QBGA 3RHFA 2JIQA 3DD5A 5BXQC 2GASA 1JECA 3LVFO 2AFRA 2JIMA 3M34A 1X6VA 1E5DA 3DE0X 1D07A 1XALA 1NLYA 3HUTA 4ZYUA 4OPMA 1TYCA 3VXKA 1DOAA 2ZEJA 4ETMA 1WCV1 4II3A 4OJKA 1U7WA 3T06B 1IHXA 3KUDA 4QPDA 1II9A 2BTQB 3GAZA 1Q1GA 3AETB 2WJ4A 3TZKA 2WTXA 4YHHB 2KJQA 3OP4A 3BICA 3H0CA 1YIDA 3KB6A 3E7DA 3H1GA 4TSFD 4JQOA 3R8CA 4H7DA 1P1RA 2OB2A 5CK4A 4EY5A 2JK0A 3AHHA 1P29A 2PZGA 5TGDA 2P9EA 3EDMA 1HT3A 1ZCJA 2WOJA 1Y3BE 2CL5A 3GT0A 3K9HA 1CEEA 1AKEA 3C41J 4BS9A 2GD6A 5DYYA 4S0ZA 3JR7A 1NNLA 3MJRA 2QTBA 1T6YA 2XUDA 3MTJA 3UAVA 1W34A 4EGSA 1VJ5A 5CFRA 1KRXA 4Z9XA 2J9FA 3H5AA 1UZLA 4FI3C 1BWRA 2V5VA 1ITZA 2AOUB 2HB6A 5SZHB 4ADSG 3G88A 3Q7EA 2D2FA 1JSCA 3CB4A 4M98A 4F4JA 4AS1A 2WG0A 3KXKA 1YZYA 3A7EA 2FKNA 3V8VA 5FV4A 4JSTA 2YHUA 4M1QA 3J7AC 1X8XA 4I1IA 4XDHA 4RIFA 4QHTA 5AOAA 2AKYA 4CCYB 4CR7A 4YAKA 3FW1A 3SZMA 3ZGXA 3BH6A 1YBMA 5HFNA 3D4BA 2G25A 2AZMA 2VTBA 4NABA 4F6RB 5IDXA 2HXSA 1C4OA 1CKEA 1VG1A 2R97A 4HUQA 3JATB 3K2BA 1G38A 4KQGA 1AXRA 4LMBA 4ASUA 1RMQA 2VP4A 2VYCA 3V3KA 4ZDWA 3SSMA 3E4DA 1OCEA 2Z6QA 3PU6A 1CR1A 2EG5A 5DTEA 1DBSA 3L49A 1QMPA 5BSFA 4YJHB 2WWRA 3ANYB 2QQ5A 3UJ7A 3V55A 1F8YA 2P68A 3ROPA 4TMWA 4YT5A 4FVTA 1N5KA 3AY0A 3DHEA 4ODIA 4Y2YA 3S2GA 4QUBA 1RC8A 2OK8A 5HF9A 4G09A 4HN4B 1X9IA 3G8BA 5J4LA 3CZ4A 1TCAA 2AMVA 2I6XA 2J9XB 2XD4A 3AEQA 4NHEA 3VOBA 4W5OA 2GJSA 1YBAA 2D62A 5DTMA 4EELA 2PU5A 4ZHQF 3OQNA 1CUUA 5DM1A 4K8OA 3FTDA 5JSYA 3O95A 3NO4A 4QC2A 1HMYA 1YONA 2BMAA 2NX2A 2VNKA 4YJ2F 3NPAA 2YW9A 5GM1A 4DV1B 4NBWA 1QU3A 3T38A 2MJLA 2I2WA 5LLSA 1JH8A 1PUIA 4OL9A 1JHYA 4L6AA 1TCBA 4I8XA 5AKZA 1JJIA 5LQRA 5LDHA 1ADJA 3V3TA 4YRGA 4EVRA 2A33A 3RTGA 4U00A 3PFKA 3JQDA 4YJDA 1QZUA 3EB9A 4RTPA 5B12A 2I8CA 1KZ4A 2BFNA 4RDXA 1KBOA 2UYCA 2G8NA 1DFHA 5G4LA 4IHKA 4IJKA 3LUPA 4Q4DA 2C84A 1RZ3A 1V48A 3QP9A 4L5CA 4MMZB 4IRXA 4NZZA 2FQ1A 3ZZ1A 2Y0PA 4KEAA 3G17A 3L7YA 1CZOA 2G06A 2BMJA 1YCFA 1U3DA 2JJMA 4IIGA 4YO7A 1V1RA 3DOCA 4NBKA 4X90A 3TM5A 1TNDA 4UUAA 5CDUA 2OFXA 2IXBA 3IEXA 1ZD9A 2YZGA 1BWQA 4RTJA 4DDKA 4GDFA 1VXRA 2Q6IA 4LY6A 5EZ6B 4BFWA 1QTNA 4XWAA 3TRJA 1TQ6A 4YV7A 2FR1A 2XE4A 5A4AA 1JN0A 1WA5A 2MR6A 2Y1CA 4HNSA 1Q95A 5AESA 4KXXA 3D6NB 5FOQA 4HG2A 1A8SA 3DGEC 1EFPA 4KWEA 2VJKA 4RPKA 5DLYA 3T34A 1V47A 3FAZA 2ZSAA 4C2BA 4EA9A 2GF0A 2W2PA 4M86A 3ITEA 1H2HA 5KWVA 1A7JA 1GG2A 5AM2A 4CEIB 1H22A 1T2FA 3PUJA 3ZW7A 3RBAA 1KP3A 1R8JA 4NL4H 3WDSA 3QEJA 3DTYA 1GN9A 1UMCA 4UEJA 5EE3A 1E8NA 2ZIWB 3P0IA 4RVGA 3BJEA 4K9KA 4RHCA 4CMHA 1QKIA 3OP1A 3W7AA 2Q5FA 1UBJS 3O1JC 4PU0A 1XTTA 5J4HA 1ANKA 1RLIA 5CTAA 3EQ6A 1WZ2A 2DBZA 3SBDA 1FFEA 3ZD7A 1LDGA 1OPRA 3DXYA 1G3IA 3CNNA 4ZO7A 1Z73A 4DMCA 3FYDA 3D5EA 4UPEA 3DTVD 1EUZA 2FK8A 5AVSA 5EIEA 3DBHA 1ZD5A 3T52A 3FA2A 3O83A 4RMJA 4GXQA 3OZ7A 1IU9A 3H0KA 3M0EA 5EPUA 4K40A 3ZU6A 3O1IC 1M6VB 1N0VC 1EG2A 3SZUA 3OT1A 4DDTA 1BRMA 4UCQA 3UZUA 3SICE 4B6QA 4OHXA 4ALJA 4AN4A 3ROXA 4QD3A 1H4QA 1BS1A 3S2SA 1DARA 4JVMA 1QRRA 4QGFA 5LBUA 4EMBA 2WAMA 1KSGA 2IKQA 3SE7A 4YP7A 3K15A 4WZAE 5DJ5A 2CLDX 4MQFA 2GZ1A 2BT4A 1M54A 1PVDA 2ILTA 2SHKA 5LMZA 1A88A 1M75A 2DUUA 3OC6A 2FPXA 4RSGA 2DVMA 1FFGA 1RTKA 4URYR 4MQBA 3GLHE 4I2NA 3VR4H 2OVFA 4PX2A 4WA7A 2ORVA 4FB4A 5B36A 5LBTA 2AQ8A 3K8QA 1WXXA 3BCUA 4BKMA 4NS4A 1NVMB 2ODTX 3KAKA 3NDRA 4EG0A 4FXPA 1QG0A 1O6GA 4MUNA 2JAWA 4O2BF 3EN0A 1JXQA 4DR3B 2AV6A 3PQ7A 2C5LA 4U6SA 5LIRA 5LD2C 4OSEA 4B0OA 2O8EA 1N3YA 4GKKB 2QN7A 2UYQA 4RCZA 2FQWA 1NUHA 4EX7A 4PYJA 3D6FA 1EVIA 4J9UE 4DJEC 1COZA 3QVSA 4HQ0A 1DEAA 3QPVA 2D2VA 4DY4A 5JMWA 4V1CI 1E2PA 2QE7A 3BMQA 4JLVA 5IJ9A 3VAYA 2O3RA 3AR5A 1RHMA 2FP4A 1RRGA 3CLVA 3OTQA 4V24A 3T7AA 2WUEA 2JLUA 2FV8A 3IBTA 2I0FA 1YFKA 4JKOA 1IDOA 3DCNA 5DNVA 4NYJR 4FHGA 4U7PB 5LBIA 1VFNA 1Z8DA 4R1QA 1GDTA 2QRVA 1KKUA 1XTVA 5LP1A 2WOOA 1IN4A 2ZR9A 1E0SA 5EMJA 1BCSB 4U3JB 3IJEB 4RVFA 3C3EA 4QBHA 2IX9A 4X66B 1ZJJA 3NTUA 4LJ8A 3RU3A 1SPXA 3BZBA 3H18A 4ARSA 1J8QA 3HXTA 1G19A 4Q03A 1SU4A 4RMIA 3ZGNA 4OHOA 4BTEA 4DW8A 1ZAYA 5LQCA 2QU8A 1VM6A 2H0RA 3W4IA 1CTQA 2C5GA 3R6GA 4Q7EA 4GOLD 3JVIA 2NOAA 3ZE1B 4DGSA 1RKXA 3FCAA 3RFCA 1AF4A 2A5DA 4EG6A 2ZUTA 2X1HA 1Z74A 4GNRA 4KYTA 4Q02A 5GAJA 1RP7A 3R9IA 5IZCA 3KSMA 3ETLA 4LQDA 5ERXA 5LYJF 5DM0A 4GXNA 2VJQA 3AI1A 3HKCA 3UPDA 3JZIA 1P75A 4RJTA 1L1RA 1M7GA 4QSMA 1M8KA 1ADCA 2GPYA 5EP3A 3WGKA 3LP5A 2QLBA 5ECGC 2WHYA 5CU7A 3MJHA 3EAGA 3IHWA 1JA1A 1EIZA 1G8GA 3LCRA 4Q1DA 4L8WB 4P80A 3E5HA 3M5DA 1YRAA 4B43A 5U1PA 3TNYA 5C7LO 4ESEA 1D2GA 2HJGA 2BFOA 2P1DA 1G8JA 3Q6IA 1O0SA 4M0UA 1O6ZA 4IMPA 1OH8A 3ZIUA 3FF1A 4K88A 4ZAFA 5IZCC 5GONB 5BW4A 2NXWA 1F0PA 2FW0A 3BREA 4FS8A 2FF5A 1TK2A 1BE8A 4B75A 3NTOA 3FJYA 3TZLA 2O8EB 3UIEA 1GKUB 3P9IA 1UJ4A 3K73O 2HF7A 4IFBA 3ZZMA 4A8HA 3RU9A 2O50A 3ITKA 4LBVA 3IURA 5FCDA 1OYWA 1ZGAA 3SSAA 3MK31 1NZDA 5H4HA 1PJLA 4DLTA 4GS5A 3FFXA 4J7XA 2IKSA 1MT0A 4Q3KA 3UKJA 1ZICA 3A6KA 4FFWA 1JQ5A 4L7QA 4RGVA 4G4GA 3FR7A 1Y7HA 2EP8A 2NO7A 3O1HB 3WWDA 1U9CA 1WSAA 2XGMA 2A3RA 3WXBA 3TLGA 5BSEA 3OHPA 4YK7A 5CXXA 5IFKA 1H8EA 5KZMB 4IFIA 1KYIA 1DKPA 1HXHA 4KQJA 4PG6A 2PVSA 1SOMA 3SQOA 1WVMA 2RDMA 5AXAA 4E21A 1Z2NX 4LMRA 1NSFA 4TWIA 2QRVB 2QRMA 2VKQA 4ZQHA 2NIPA 1L3IA 3SJBA 4D57A 1K2WA 3GLTA 3FYHA 3TNDA 1QZXA 5KNBH 4FFBB 5IULC 4I4TF 2R8RA 2ONJA 4D6PA 1YK0A 3AUXA 1C30B 3S1SA 1OC4A 2IHJA 3ORFA 4GM4A 3L40A 3BL5A 2XKJE 2J0UA 5BN4B 4AKTA 4UTPA 3K9FC 1DPGA 1DJMA 4BO6A 4B48A 1GGHA 4X3CA 1K3UB 1U7UA 2JFHA 3GMDA 4GZ3A 4M8SA 4CM1A 1H23A 1N5MA 1ZMBA 4ENVA 4WA8A 3U0BA 4F4CA 1QHHA 3JQGA 1I5RA 1KK2A 4EF5A 5A3RA 3AP1A 3RU2A 4C6TA 1GCGA 3LDHA 2BDUA 2FX5A 3NFYA 1NVDA 1UEJA 2OCLA 4WD3A 3OJFA 4FOLA 4BBJA 1OD6A 2REBA 5I48A 4F7WA 3M82A 1JLMA 1H8HD 4DJJA 1U1IA 1TU3A 3KKLA 3DW3X 4MI3A 2ZIXA 3BORA 3F1KA 4ROSA 4OJMX 3RTAA 1YL5A 1MO5A 5C37A 3DW1X 4Y2SA 5HX7A 2FFJA 3R3WA 2QG4A 2QSZA 4YBZA 3ZZ0A 4BGUA 3A37A 2D54A 2CK3D 3B6MA 1COWD 3QVTA 2JEYA 3F73A 1M2OB 2JCGA 4J4BA 5SY9A 2C4WA 5A1JA 1R4MB 1W52X 2A0UA 4GPEA 1FNMA 2WUGA 1VG9B 4C4AA 3W1WA 2V7EA 4Q05A 1AMUA 5FBZA 3I6MA 4MP6A 5FL7A 4E4YA 1DX6A 2PSEA 1OZGA 2VFAA 3INGA 1UXGA 4EHAA 1Y9EA 3KQLA 1JZQA 3LVRE 3IQHX 3NHJA 2WAOA 2HWXA 4KDCA 4UM5A 1V8ZA 2CXSA 4MGYR 1ECPA 1KORA 3JAKA 5K2MA 4WLUA 4UFOA 1EUDA 2ZS8A 4IUBS 2ERCA 2OV8A 2WKWA 3CJQA 1FS6A 4UW9A 3HO1A 1J0BA 4G86A 5AKLA 3GJ5A 1UDXA 1C7RA 1RYNA 2ZE5A 3B3QA 3NBYC 3TVDA 3DEJA 1XXLA 3SVTA 2G7ZA 1MUUA 2BD0A 3GDWA 5CFQA 1MEEA 3H9BA 1P5ZB 2R6ZA 1LFAA 4J7AA 3FDFA 4NTZA 3EZ2A 2I3BA 1BDMA 1EZZA 3VSDA 4B7CA 2QY9A 3VR4A 2FSFA 4V0MA 3B20A 2JIRA 3KOXA 5DHPA 4XRRA 5LKRA 4MUGA 3EODA 2IYUA 5FBHA 4CIDA 4UBOA 4A0GA 3AF1A 2PH5A 3SKVA 4FYJA 2UYHA 1TI7A 1JTVA 1LNQA 2BR5A 3KETA 3ZVKA 1TAQA 1XU7A 1N77A 1CG6A 4LWOA 4WGGA 3A1WA 3UO8B 1AGNA 1WW8A 2AC2A 3PUKA 3R0IA 1XLTA 4OGWA 3T7SA 2H5EA 3TNLA 1XZPA 2VDJA 5KYTA 4GMXA 4MWDA 3HTXA 3A7DA 4WCVA 5LYYA 4L3VA 2ID8A 2EZ8A 3QLTA 3D5QA 1L5LA 1SC4A 1IWPB 4IQ8A 2P9GA 1T4DA 3X2EA 1KY3A 1XQVA 2J0UB 4EPRA 2EP7A 3GLKA 4J3JA 3D3JA 4MW0A 4ENTA 3DOEA 1F5SA 1V7QA 1GZDA 4FXOA 1Z15A 2LZ0A 4JJAA 1GUYA 4Q9NA 4WN3A 3C14C 3ILYA 1H2EA 3JQGB 3UB2A 4JBWA 4AXBA 1UFKA 1V2GA 1VRVA 3N8GA 4OM8A 2PANA 1EJ2A 4X65B 7ABPA 2OHGA 1M1ZA 5YASA 3BD6A 3COSA 4XD7A 3P2YA 3VI4B 2F7SA 3WLLA 1XLTC 3EXFB 1LQUA 3TZBA 5BXYA 5GY7A 3B1ZA 1EHIA 1CDZA 4MA4A 1XZ8A 1IPFA 1PCXA 3HYTA 1G4AE 1LK5A 4QBFA 1QIEA 3V2IA 3ZGLA 4E1AA 1QFZA 1M6WA 3GPBA 3N5CA 3VNAA 1QVZA 3UENA 2V1UA 3T9CA 3DSRA 1TVEA 5IUNC 3SMVA 4OAOA 3CBGA 3IUBA 4HH4A 4QWMA 1C0LA 3D8BA 3IQXA 3HDJA 4WCFA 4Y1GA 3ZZUA 5D86A 4CPDA 4EO4A 2FZ4A 5LJLA 3CEHA 6Q21A 3KEQA 2EWWA 2X40A 3HCOA 5BSTA 4H0NA 3THYA 2YXNA 1VKZA 5AK4A 1JMVA 1R8YA 1PGJA 1SEPA 2B5OA 2D5LA 2NSHA 2ROQA 3DBLB 3HJUA 5ULLA 3WRVA 1VPWA 4ARIA 3NLLA 2O8BA 4CQMD 1IWOA 1BQ4A 2AEJA 2GPWA 4TS4A 5GJBA 1RPJA 2C9BA 4F85A 5B30A 5A71A 4RLHA 3P0EA 4ABTA 5HFAA 4EG8A 3FZGA 4ENSA 3PFBA 3I1IA 3HMKA 4QLAA 4TMVA 4DQXA 5CRIA 1U5AA 1UT6A 3FFTA 1DTSA 1I8TA 4U2CA 4RVDA 4CKWA 3J81A 1J6UA 2IU4A 1WLSA 2O2HA 1TQHA 2PEYA 1GILA 3SF0A 2OBYA 4F97A 5K01A 1N33B 4E5PA 5A0TA 4YEDA 1TFRA 1VIYA 3A3YA 4UTOA 5IABA 4NCJA 1E62A 3L8MA 1EG7A 1IK6A 1JLLB 3W6UA 4C7BA 3VH4A 5ALGA 2I4RA 3OPNA 1X19A 4LJAA 2VNSA 1YZ3A 3D7RA 1VPVA 1KJQA 1CDEA 3LL4A 4IOKA 1VI2A 3F6YA 1TZMA 4LWPA 1QH8B 3CS3A 3IUYA 5CLIA 4AJHA 4JI3B 3KZXA 2XVAA 1BXGB 1O54A 3B3FA 4X1IA 3O8QB 5EMHA 5AUOB 1TLFA 1RPTA 5JZMA 4C2UA 3BFJA 3H4TA 3LHKA 2FG6C 2XYQA 3P7MA 3TLYA 5JFGA 3U48A 2IZ7A 1JDUA 3GJQA 1JFFB 4XWGA 3JVEA 3IAHA 4NICA 1L5VA 1DZ3A 3SG0A 4YIHA 1U8CB 1JIQA 1LK0A 1MO2A 1XXHE 4IDBA 4RKWA 3GP5A 2GN2A 1AUXA 1OLOA 2H92A 3QU5A 4CYMA 3T0GA 1P5RA 1CJMA 2FZCA 2HF2A 5DCLA 1Y3FE 4YAEA 2AN3A 4LF4B 1EFDN 4DLRA 3AVVA 2EG9A 3HR7A 1C9YA 2Q49A 1HE5A 2A86A 2BZSA 4N65A 4FN4A 4JJGA 2GN8A 3GD7A 4TLMB 5LP6B 2BKXA 5L3ZA 3V2HA 2Q2QA 3VV2A 1FPQA 1SCDA 1RHKA 3QVLA 3PDUA 4NOLA 1D7OA 2H57A 5J5CA 3GLIB 1X0XA 4MUEA 4QSHA 2G40A 5GQSA 1T2NA 1I2ZA 1I36A 1R64A 5KI6A 1BW9B 3Q2OA 2YDYA 1A9QA 4PO9A 2W9XA 1VL2A 4ZGGA 3KZCA 3VSEA 3CLUD 3P2JA 1ZA1A 2C0QA 1PFKA 2F1IA 2RI0A 5JADA 3OJWA 2O8DB 1VHQA 3O84A 2YL2A 4RLQA 1XRNA 1M34B 4NMMA 3E8XA 4PG7A 5F5NA 1YE5A 3B1KA 4UFNA 1IJFA 2AMJA 2IT1A 4XB2A 5AW5A 1DV1A 2R47A 1E2JA 3AIMA 2PJZA 4AIRA 4ZQFA 7MDHA 3CX6A 5JMTA 3B82A 4RZ2A 4KHZA 3UJNA 3CUSA 5ECYA 4D26A 1DAEA 3C3AA 4Q1FA 1TA0A 3T5MA 4QZVA 3H13A 4FDVA 5C7IO 2O1EA 1XRPA 2VPQA 4EFNA 1MN6A 2O3UA 4IFTA 5FWXA 2H1WA 4NC9A 3JPYA 4L5AA 3LZCA 3ER8A 1D1SA 2XKBA 1OBHA 4KPUB 1CR4A 1JHVA 1V5FA 3ZD9A 3ED1A 3IEUA 4D9KA 1N9KA 5C4GB 1DC4A 2B8WA 4NEHB 3MMZA 3TLJA 3PZRA 1MZPA 5FWYA 4HN2A 4LDJA 3UFXA 1RQRA 2BKLA 1CUHA 2J9YB 3C3KA 3KXDA 3OJ0A 3SHTA 3RJ9A 1W88A 9ATCA 2CHFA 4DIEA 3W3AA 3LUGA 4CF5A 4JHXA 1TRKA 3V2GA 2HIGA 4EW1A 2P9YA 3Q0TA 4IIJB 4KFTA 4UXHA 4MQ4A 1YU9A 4CQJA 3QWFA 1TTTA 3P4XA 4OMCA 2G82A 3FKSD 2H06A 2OC4A 1SB8A 1XKXA 1Z35A 2I33A 5HHTA 1ADGA 1U0BB 3QVXA 2DH6A 4HEA6 2EZTA 5LU8A 1PX0A 2G17A 4IDFA 4AYXA 1LF5A 2QX9A 1CHNA 4HUJA 1Q6ZA 3C7KA 4YFVA 3VR3A 5CX1B 1HE4A 1NBIA 4PCVA 2V8BA 2Z5GA 4OQDA 2X8JA 3DFIA 3R40A 5IU6A 1LZKA 4GLOA 4LEIA 5NULA 3LP6A 3IX7A 3GRPA 3LUJA 1MA0A 4FC6A 5EMMA 1J0EA 4BJ3A 4AL4A 5DN9A 4XEHA 3I8OA 4JL5A 2XB6A 3MLAA 5LUAA 1C9NA 4JL6A 4L3WA 4OHPA 4L2IB 3PYLA 1VOTA 3CGGA 2BKVA 1QO0D 2ZE7A 4U9IS 2JZNA 3RQIA 1FZTA 4LECA 5M3BA 1ZL0A 4HYEA 2QJFA 3IBFA 1JKJB 1XDDA 2IU6A 4MS4A 1LI4A 2EQAA 4QT0A 3B6JA 5F4ZA 5T5QA 1XIVA 4D0GA 2NMVA 5JSUA 1NRXA 4ZRNA 3EIFA 4FFVA 3L84A 2EBUA 2SKCA 2H0AA 1JT2A 4QOEA 3IUJA 1UWKA 2WA1A 4W6QA 5HUHA 1EAMA 1CUYA 3W2HA 1EGMB 5FA5A 1X8JA 4DJAA 2GB4A 4O4HB 4A1FA 1XJCA 1E2EA 4Y9RA 3PBKA 3Q7QA 4BC0A 2TYSB 2WY2D 1IBKB 3PVZA 1BJTA 4H60A 3K94A 2AJCA 1UWLA 3SXPA 3DLBA 4GRAA 2B1RA 3MHTA 3RYTC 4ZOLB 3CNQS 2CKMA 4NS1A 5FEMA 1VG0B 5AK5A 4BE7B 2I7VA 3LLVA 2G76A 2IYRA 4AM8A 1Z45A 4DSOA 1VBMA 3W5VA 3QPDA 4G0WA 4TL9A 4L85A 4I66A 4KFCA 4Y1EA 1OLSB 1YI8A 1ISHA 3PWTA 3R5HA 3OE4A 2WFMA 3AR9A 5HZGA 3O8BA 3HUEA 3K8OE 4IS3A 3DH0A 3Q5EA 4M87A 2AMYA 2WWGA 1GYRA 4DAOA 4WZ6A 5CDYA 1E3TA 5HXAA 1SK8A 2LP4Y 2OCIA 3B13B 3CR8A 3PQ2A 5DGHA 1PT6A 2W6QA 1TT5A 4M37A 2VHZA 1IOVA 1QAOA 2WVAA 2BJWA 3NBMA 4FW8A 4JGIA 4ILEA 3DBRA 4Y2TA 4IHQA 4RH0A 5CX4A 1HDOA 1W6RA 3HKDB 5AMXA 2LW7A 1RAEA 2GYYA 2GCGA 4ND3A 1LJLA 3H8SA 4BNIA 1E1MA 4CLRA 4N54A 4A8PA 2HH9A 1XCLA 2WJGA 1BOOA 2ONYA 4OKIA 4TTAA 2WKQA 3F5FA 2ZSEA 1M1XB 1VMKA 5FUYA 1XMVA 5E3JA 3TW8A 3EXHA 3W5UA 1KJ9A 1JAIA 2W0SA 3F3MA 3RWBA 221PA 1XTZA 1J24A 3R1IA 3UUEA 2P8SA 2CEKA 1ZNQO 2C78A 4LX8A 2QIPA 2RFLA 1I2BA 1CUWA 1PQPA 3VYWA 4CI9A 4FSXA 3KLPX 4PCAA 2C5HA 4OATA 1EFTA 4WLNA 1QMGA 2XKKA 5K1SA 1N8NA 3R6TA 5KWEA 4MDEA 2NAPA 3HDYA 5AVUA 3VHXA 4DMLA 4D5GA 2C42A 2IZOA 1W4RA 1YUMA 3FNGA 1XD9A 2YTZA 5B3JC 1NLMA 3SP1A 2F67A 5BV8A 3D5TA 2R6DA 3M70A 5D3QA 3WWOA 5JVDF 5KIAA 1T15A 2AFIA 5FA8A 4HNAB 1HI9A 3EXHC 4R9RA 4WK4B 4WLOA 3TMYA 3STVA 1FRZA 4OIFA 4XIJA 1P2SA 3SZGA 3C48A 3PFGA 2VPWA 4HB2A 4MS4B 4Q5IA 3MG9A 3T0FA 4AO8A 3LECA 4BBZA 3BYZA 5F9HA 4IDCA 4QFCA 5AFSA 1QVVA 5KQLA 4RV4A 1NSTA 4QPCA 1NQUA 4N49A 4EHLA 4WLVA 3QFCA 5L7YA 4HVCA 2FEKA 1HDEA 2AN9A 2QSJA 2RHTA