2DPHA

Crystal structure of formaldehyde dismutase
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
398
structure length
398
Chain Sequence
AGNKSVVYHGTRDLRVETVPYPKLEHNNRKLEHAVILKVVSTNICGSDQHIYRGRFIVPKGHVLGHEITGEVVEKGSDVELMDIGDLVSVPFNVACGRCRNCKEARSDVCENNLVNPDADLGAFGFDLKGWSGGQAEYVLVPYADYMLLKFGDKEQAMEKIKDLTLISDILPTGFHGCVSAGVKPGSHVYIAGAGPVGRCAAAGARLLGAACVIVGDQNPERLKLLSDAGFETIDLRNSAPLRDQIDQILGKPEVDCGVDAVGFEAHGLGDEANTETPNGALNSLFDVVRAGGAIGIPGIYVGSDPDPVNKDAGSGRLHLDFGKMWTKSIRIMTGMAPVTNYNRHLTEAILWDQMPYLSKVMNIEVITLDQAPDGYAKFDKGSPAKFVIDPHGMLKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-ray crystal structure of formaldehyde dismutase at 2.3 A resolution
pubmed rcsb
molecule tags Oxidoreductase
molecule keywords Formaldehyde dismutase
total genus 123
structure length 398
sequence length 398
chains with identical sequence B
ec nomenclature ec 1.2.98.1: Formaldehyde dismutase.
pdb deposition date 2006-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2dphA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2dphA01
2O48X 4XRGA 3PHIA 1AXGA 4DQVA 1GUYA 2VZ9A 2LDXA 1YVEI 4IQ8A 1ZK4A 1U9JA 1P31A 5L7WA 3WLFA 4IDAA 5JPIA 5K6AA 2P4HX 1EEHA 1XWFA 3DOCA 4OL9A 2ZTLA 5COQA 2Q50A 1MFZA 2EWMA 4OOFA 2DBVO 3V1TC 4PLCA 3JQFA 4WCFA 1LSUA 1RKXA 4ZHSA 2X7HA 1BDMA 3I5MA 3CE6A 4YQYA 1KVTA 3KLMX 2PY6A 3TZHA 2HMUA 1HYGA 3FCOA 4CMKA 4XQGA 3MJ4A 1A27A 3AM4A 4NBRA 4BKUA 4BNNA 4BO8A 4EUHA 2XPCA 4CMAA 1LDNA 4E5YA 4XQ9A 2P9EA 2NU8A 2FZEA 1BG6A 1GQYA 1WNTA 1QYVA 3A4VA 2CZCA 3ZWYA 1R37A 2J3HA 1WWKA 1VM6A 4PLGA 1YWGO 4DLLA 3NKLA 4K9DA 4OKNA 1HDRA 1RM3A 1JKJA 2GLXA 3Q11A 3QP9A 1F0YA 2CY0A 3GDGA 4PLFA 4JX8A 3SBOA 3NEPX 4J1NA 4GQAA 1B14A 1KERA 4GWKA 4D45A 4OQZA 1AGNA 4L76A 5F21A 2Z5LA 1M75A 3JQ8B 1KYQA 3C7AA 4UVDA 4YT4A 5TC4A 4IMRA 1EK6A 2FPPA 5DCWA 1YL6A 2AA3A 1Y5MA 3C24A 4ALJA 1E1MA 3PZBA 4RVSA 1WPQA 3ZU5A 1DLJA 3OMLA 4KOAA 3BMNA 3ZU3A 4BO3A 2W2KB 2A92A 3PDJA 1DB3A 3A06A 1T24A 3TFOA 3K31A 2WSBA 3I4CA 3IKVA 1CWUA 2BGLA 2J5RA 3IL2A 3HZZA 1IZ0A 5TRTA 3ASVA 1LC3A 3QJ5A 5K1SA 3CTMA 3LT0A 3WOHA 3WYEA 1XEAA 2VUSA 1U7TA 2EIHA 1IZ9A 2DM6A 3CPSA 2QYTA 3ICPA 2HJRA 4IDGA 4J43A 1Q2XA 2ZYDA 1KC3A 2GZ1A 4WK6A 2X23A 1R4NB 3PIIA 3UOGA 4GWGA 3KLPX 3GUCA 4PRKA 3LQFA 4A03A 2V7PA 4B7XA 2O3SA 1GCUA 5KJ6A 2E48A 2PKQO 1V35A 1W8DA 4UVIA 2P5YA 3DEYX 4ND2A 3V8BA 4AJIA 1J49A 2AE1A 1E6EA 3AK4A 3OJLA 2D2IA 2NQTA 4BO4A 4E0BA 1I3MA 4GGPA 4J2HA 4Z0PA 4WLFA 4CMIB 4OMUA 1ZXBA 4YR9A 1GQQA 2PZKA 1ISMA 3OQ1A 4I9HA 1LQUA 4YJHA 1NAIA 3OECA 4TKMA 5BT9A 4E32A 3F4BA 2YY7A 2J8ZA 1R0SA 5AXCA 1H2HA 3PGJA 5G4LA 1H6BA 1R4MA 1P74A 1YOVA 4BQRA 1UZLA 3H9JA 2B0JA 4CUZA 1VJTA 5BSFA 1M67A 5FWNA 5IN5A 2C5AA 2H9IA 2VTDA 1O6ZA 3VDRA 4FGWA 4AVYA 1KEWA 5F1KA 5EJ2A 1YOVB 5A03A 3Q3CA 5AQ1A 3WDSA 1GDHA 4QX6A 1T2EA 1SAYA 4FFNA 2OMEA 5BSHA 2WYVA 3HHPA 2NU6A 3AY6A 4XGNA 4XRRA 2NUAA 4XGIA 5T8KA 1Q0QA 5MGBA 3CMMA 4D3SA 3RFXA 2PGDA 2ZYAA 2P91A 4GMFA 3RUFA 3DZFA 4I5EA 4L8VA 5U4QA 3HDQA 1IPFA 3GAZA 2O4UX 2V6FA 1YQGA 1VE9A 2Y93A 4R41A 4B79A 3QV1A 5I9NA 2YHUA 3IUSA 1UXHA 4CV3A 3C1OA 1EFKA 3VH2A 5JMWA 3BMCA 4P4LA 1UAYA 4IXTA 1N8KA 2AQ8A 1DRWA 2FRDA 5ENVA 5L40A 4IJKA 1FDSA 2VCYA 4UUMA 4BO6A 5CDYA 4GX2A 4GVXA 3RUDA 4BNHA 4CUJA 4OXKA 1K3TA 1NVGA 3FR7A 4JGBA 1F8GA 3ZW9A 2OHXA 4PFJA 4FFLA 2JAPA 3TZ6A 1PSDA 2AQHA 5I8ZA 5EQFA 4U6SA 4RPGA 3LSYA 2IZ0A 1KY4A 4MVJH 2G5CA 4R68A 6LDHA 3OP4A 3BMNB 4AJ2A 1UP6A 3R1IA 4CQLB 2Y67A 1O95A 1NFRA 2JFGA 1ZJYA 1XGKA 4R16A 3E9MA 2QRLA 2WDZA 2YFHA 1B8VA 6ADHA 3B20A 1CEQA 5A05A 5JSFA 2XAAA 3QWAA 3GG2A 2B5WA 1E3LA 3RIHA 3LT2A 2VWQA 2Q49A 3C1AA 2PKQP 1NPYA 1NP3A 4XB2A 5EPOA 1Y8QA 3LT1A 1DHRA 4KQWA 4YRBA 1UXKA 1CIVA 5FI3A 2H63A 1XIVA 3A9WA 1XLTA 1L7EA 3EUWA 1M2WA 3GFGA 5U1PA 1ISJA 4JXKA 2RH4A 3PFFA 4BNMA 3RKUA 2BH9A 1JVSA 4WLUA 2PH3A 3FWNA 4RF5A 3VVBA 3GZ4A 3IUPA 1C0PA 4ROSA 1BRMA 4UUNA 4NFYA 3VH1A 4PZDA 1EE2A 4LISA 4DMLA 3Q9NA 4BHTA 1L7DA 4Y6PA 3H6KA 5L95A 1RYDA 3K8ZA 1R12A 1ORRA 1GCOA 4J9VA 1YE3A 3DZBA 5T57A 3UHAA 1E7SA 2WD7A 2O2SA 4M49A 4YJDA 1DHTA 1LTHR 3GHYA 1EVZA 1PGOA 2Q4BA 3WTBA 5HRUA 1IUKA 4WLNA 2PZJA 4QFDA 3CIFA 2QRKA 2GZ3A 4NK5A 2NVWA 1GR0A 1OC2A 1U3TA 5DOVA 5DT9A 5B4UA 3FNHA 2Y1CA 3DBHA 4TSKA 5C3MA 3OJEA 2VWPA 3DBHB 1A4UA 3JQBC 2O3RA 3U5TA 1XQ6A 1I33A 4R51A 4DQXA 3B70A 1ZCJA 1IB6A 3WWYA 4C4OA 3GFBA 3EAGA 1E92A 4ZQEA 4ID9A 3U09A 3KYDA 5KWEA 4FR5A 1Q0HA 5L51A 1XR3A 1MG0A 2WYWA 3W8EA 3PFWO 5DBGA 3S2IA 3GMDA 3QWHA 3ST7A 4D3DA 3OA2A 2PD3A 4NI5A 4PIVA 4CM6A 4BQPA 3WGIA 4WGGA 1NQOA 4D42A 4EUEA 1XDWA 4NJMA 5A9SB 1XKQA 5HM8A 2D5AA 2ZB8A 2C7GA 5DF1A 4IQ0A 4I9NA 3RU9A 3HDYA 4URFA 1JKIA 1D4FA 1WP4A 4L0QA 3RVDA 3CUKA 1QYDA 4WPGA 5F1PA 5T8KC 3H3JA 3B1KA 3BHIA 1NXQA 4XR4A 5KOIA 4TRRA 1GTMA 1I30A 3MEQA 2EW2A 4LRSB 4KWIA 4NDNE 4J1SA 1KEVA 1R6DA 4NMHA 3VOSA 2JFHA 5CPBA 1GQ2A 2WE8A 3FNFA 4FFMA 1NQ5A 4ONEA 1Z45A 1VRWA 3AOEA 3ADOA 3GG9A 2O3UA 4B8WA 4MINA 1U3VA 2FWMX 4YYZA 4JIGA 4EEZA 3PLNA 1TVEA 2CF6A 4HFMA 1BMDA 3EK2A 1OAAA 3W8FA 2Y66A 3B1JA 4FFOA 4Q9NA 3TPCA 3ETGA 2YJZA 4PLZA 4NPCA 2P68A 5L7YA 4DC1A 3G0OA 1C1XA 3UICA 3LLVA 3PK0A 4CUKA 4PVCA 4HUJA 4M87A 3S8MA 1JLLA 4GH5A 2DU8A 3DHNA 5G0SA 2VHVA 3VPFA 4WLOA 3H65A 2X9VA 2NWQA 4DPMA 1YRLA 1Z75A 1HEUA 1VKOA 3U4CA 1SO8A 3WTCA 3ZHYA 5A02A 2XXJA 3PXXA 2X0NA 1MV8A 2H1SA 3CEAA 4QT0A 3AM3A 5ITVA 1I2BA 1LUAA 5IDXA 2X5JO 2FOIA 3VPGA 2SCUA 3Q6IA 3TDKA 5A4DA 4AFNA 4ESOA 1DIRA 3AUTA 4EZBA 1LRJA 2NNLD 3U4IA 2X4GA 1BVRA 2DVMA 2YHIA 1E3WB 2NM0A 3JQ8A 3DQPA 4U7WA 1Z6ZA 1VL0A 1K6IA 4IIVA 4W4TA 4YA6A 4C7KA 5TLSA 4HXYA 3B1FA 1NPTO 5K0ZA 4QSMA 1KVSA 1KY5A 3QQPA 3PHGA 1ULSA 4HX5A 4UREA 5ITWA 2Y1GA 2G17A 3MJTA 4CLRB 4EJMA 4J0FA 1Y8RA 1Z82A 2W4QA 3MOGA 2HJSA 3IKTA 1ENOA 4TWRA 3L4BC 2GN6A 2Q3EA 2J3JA 5TGDA 3E9QA 1FXSA 4GPD1 1EBFA 1I32A 1H5QA 1XQ1A 5G2OA 3OIFA 3PRJA 3GNSA 1C0IA 1A7KA 3UVEA 4XJSA 2DKNA 3RAJA 4BO5A 2HK8A 5IFLA 5TT1A 5B4TA 3F47A 2D5CA 2PFGA 1U1IA 4BMNA 2CF5A 1UR5A 4E31A 4CMJA 1G0OA 3HB5X 4K1LA 1PZGA 1D3AA 1T2AA 2IRWA 4PLHA 1NTOA 3WGZA 4HFRA 2ZJ1A 5FEUA 4N7RA 3JQFC 4WCFC 3WGQA 3T7CA 4CLRA 3KEOA 3M2TA 1HYEA 1OFGA 3K73O 4RPKA 4J1QA 1Y81A 1ZMTA 5JYDA 4IM7A 4KDEA 3W1VA 3QSGA 3S55A 3F3SA 1E3JA 2Q2QA 4ZD6A 3H5RA 4EUFA 4YAKA 1KEPA 3U0BA 3KYBA 5EERA 3CH6A 1MXHA 2B4TO 4E4YA 4LVCA 4XYGA 2H6EA 4OIMA 4GSLA 2J6IA 1DJNA 4XEHA 4BKOA 4CM9A 1MC5A 3PQDA 3WGGA 1YB1A 3C85A 1VI2A 2EW8A 1TLTA 3H5AA 4RLSA 2ZQYA 2R00C 2VWHA 3I9OA 3GVPA 5LDGA 4R1TA 1FF9A 4E2YA 2DTXA 1O89A 2W8ZA 9LDTA 1LJ8A 2C07A 3DOOA 4IS3A 3R3SA 3GT0A 4GLOA 4MVJP 4EGFA 1MFPA 2FP4A 2IEBA 2Y1EA 4IDBA 1G0NA 5T64A 4ZVVA 4XYEA 4DBVO 4ND5A 3K2BA 4LSMA 2R2GA 2RIRA 3DWFA 1A5ZA 3HFGA 3U3XA 3TSCA 2IODA 4GBJA 2VUUA 2EP5A 3EGOA 1GAEO 3R3JA 2HAEA 4BNIA 4IS2A 4Z6KA 5EMHA 4WJZA 5MDHA 5JCJD 4CMCA 3DTYA 1QLJA 2Q1SA 4LW8A 1KC1A 3AU8A 3PHHA 4W9NC 3ENKA 3UW3A 1LBEA 1E7MA 4DYDA 3HDHA 1J4AA 1JAYA 2O3QA 3DFUA 2EXXA 4FC7A 1JQBA 4IIUA 2XOXA 2V6GA 1I2CA 5HS4A 5JAMA 1XSEA 1OI7A 2R6JA 3TFQA 4N5LA 3LC2O 2E6UX 2IDZA 1UXIA 5DBFA 4J2OA 1UZNA 4P4NA 3RJ5A 5BNIA 4RPHA 1FDUA 2OUIA 2NLOA 1BDBA 5CFZA 2FSVA 3D4OA 1V6AA 3FR8A 5DDIP 2Z1NA 4PRLA 5TSDA 3SJUA 2Q2VA 4E13A 1P1JA 2V6BA 1GZ4A 2EHDA 2VRCD 3D0OA 3GVIA 4I08A 2JD1A 1LRKA 1VC2A 1NX6A 2ZQZA 2YQ4A 1SEPA 3EDMA 3KRTA 4BGIA 3ZHZA 3ENNA 4FJ0A 2AEMA 3ZWVA 1DC3A 4CLEA 5IXSA 3LZ6A 4QQRA 5KJ1A 2CNBA 3GEDA 4PG6A 4IGFA 5TX7A 1IOLA 4J7XA 1EVIA 3MJCA 4EDFA 3C3XA 3D3WA 2PGJA 3FTNA 3DAPA 3FNEA 1H6DA 3PYLA 1P0FA 3EZYA 2VOEA 3SXPA 4MJLA 2CVZA 2AXQA 2C59A 3NV9A 4E5NA 1LC0A 4OOEA 1ZIDA 1YKFA 4TQGA 3TL2A 1CQJA 3BHJA 4OQYA 1TT5B 2D0IA 2Y0EA 5ENDA 4ZQFA 3VHRA 3S2FA 1G1AA 3O26A 4QO8A 3WBBA 5BSGA 4YCAA 1N9GB 2FMUA 2VYND 1GPDG 3WGHA 1U8FO 4RF2A 3HFSA 1B15A 4NU5A 1UDBA 4KDFA 2F00A 4U8GA 5TF4A 5CDGA 2HK9A 4CMGA 1IY8A 5GY7A 4G2NA 5DCUA 2GD1O 1R0LA 2NACA 1DSSG 5THQA 4CMIA 4CM8B 4XIYA 3GNQA 1JN0A 3RU7A 3ONFA 4WLEA 5ES3A 5GMOA 3IP1A 4CM8A 5A5EA 1X0XA 5JO9A 1QYXA 3RUHA 4O0LA 2NQ8A 3IJPA 4AJKA 2D3TA 3DTTA 3GNTA 1N7HA 1JVBA 1PS8A 3KOUA 3NGXA 1D1TA 1HLPA 4HV4A 2D59A 5HBRA 3V2UA 1NM5A 1ONOA 3Q2IA 4PVDA 3TWOA 4D79A 1GV0A 2X5KO 3VTFA 2P9GA 5DZSA 4IUYA 5BQFA 1PJ2A 4Y6RA 4IJWA 1M6WA 4XB1A 4E2ZA 3H9UA 1N9GA 1H94A 5HTOA 3W4KA 3EVTA 5JDCC 1E3WA 2A94A 2YHIB 2EGHA 2EF1A 1HE3A 2GNAA 4RVHA 1XHLA 2I3AA 3ZZNA 5AOVA 4ALLA 1BGVA 3JD3A 5ICMA 1E7YA 2X6TA 4YJHB 5JDIC 4R5HA 1PWZA 1GYPA 2ZYGA 4RDIA 2W2KA 1PU2A 4CR6A 5FFFA 1WMAA 1U5CA 4LRTB 5L9AA 1HDOA 2YV3A 4O6VA 4PG5A 3GDOA 3SC6A 2C29D 2QZZA 3JQ6A 4GX1A 1HRDA 5EINA 3PJDA 4BB6A 1NVTA 3F4LA 1E1KA 2AE2A 5CEFA 1OMOA 1H6AA 3INTA 4IINA 1I8TA 5G0TA 2CMDA 4GI2A 3LF2A 2IXBA 4HKTA 4CMBA 3PGXA 3NUGA 3PIDA 4Q3EA 1ZEJA 1E3EA 4W7IA 2O50A 1QG6A 1QORA 1WZEA 1I01A 3FRJA 2I99A 5C7IO 2VZ8A 2PGLA 1IYZA 1WW8A 1AHHA 1ADBA 5B37A 1PJ4A 3FN4A 4CL8A 4W6ZA 3TJRA 5CDTA 2AHRA 1NWCA 1SB8A 3ZCXA 2VNAA 1T2CA 4HNGA 4HADA 5L3ZA 5DOZA 5BNFA 4J91A 4R54A 3DBLA 3KYCB 4RVGA 1HT0A 3V2GA 2HRZA 4Q3NA 1NPDA 2VYVD 3INRA 4RORA 1JW9B 4N5MA 1DPGA 1MP0A 3G49A 4NR0A 4AG3A 1X15A 3MZ0A 1A71A 2P9CA 1LU9A 5JAQA 3I52A 3MOIA 3AUUA 3ZU4A 1NYTA 1VSVA 2GZ2A 3NT4A 2EJWA 1TT5A 1I24A 1PJCA 2PK3A 4N18A 4JBIA 3ZV4A 3ANNA 1R4MB 4CV2A 4F6LA 1HDXA 2C2XA 3ZWAA 2X86A 3WQRA 4YWJA 4IGEA 2BKAA 1MX3A 3O8QB 1HZZA 1P77A 3O38A 4CQLA 1FDVA 1DFGA 1N7GA 1QMGA 4DIBA 4Z0HO 2YDYA 3H2SA 3RBXA 3HNPA 1DJQA 4L4SA 4E6PA 5U9CA 3ROPA 1E7WA 2GO1A 1SOVA 3G79A 3WS7A 3NYWA 3AI1A 1DEHA 3N74A 2ZTMA 1KIFA 2TMGA 3B6ZA 3CZMA 3JQ9A 4BGUA 1NWHA 3OIGA 4XKJA 3W6ZA 4B3IA 1LQTA 1ONPA 2EP7A 3ANLA 1SNYA 4B4VA 4NBTA 1QYWA 4WNIA 4DIFA 3JQ7B 4ALKA 1E6UA 2HMVA 2B36A 3DHYA 4KMSA 1FDWA 3K6JA 4RZIA 1CJCA 4CV0A 3BTVA 1NQTA 4LCEA 1DC4A 1E5LA 2G76A 4XD2A 1SBYA 2X0RA 2GR9A 1R0KA 3TQHA 4EEXA 2QHXA 2VRBA 1SMKA 3NAQA 3WR5A 4FFRA 2E49A 1ENPA 4U0JA 4M1QA 3GZNA 3KYCA 4RF3A 4ZQBA 4ZRNA 2C20A 3AM5A 3UFXA 3LDHA 3WMXA 3ZNPA 4EBFA 1SCUA 4YT5A 1GYQA 3KTDA 3IAHA 2OP1A 3K96A 1DOHA 1PGPA 2HSDA 3COSA 4I9UA 3PDUA 1R4NA 3DC2A 1LNQA 2YV2A 4FJ2A 1MXFA 4OM8A 2EV9A 1Y8QB 4PLVA 3OEWA 4C7JA 2X5OA 4NIMA 1ENZA 2DAPA 3C8MA 1GZ3A 1VJ1A 2VHWA 3BHMA 3OJFA 4X54A 4DMMA 3KO8A 3I3OA 3IQDB 1HL3A 1Y8RB 1FJHA 5A3VA 2CDCA 3MTGA 3LF1A 2H5LA 4J4TA 2ZIZA 4TRMA 1F17A 1JTVA 5G0WA 3PP8A 4KUHA 4N54A 2Q1UA 1P1FA 3WBFA 3BAZA 2B4RO 4ZU3A 3SEFA 5K9ZA 3QVWA 3VZRA 2HMSA 3ZH2A 3L0DA 2Y1OA 3ADPA 4F3YA 1D7OA 1QV6A 3JD4A 2DPHA 3NJ8A 1PJLA 1C0KA 1J0XO 5TS3A 3D5QA 1ZO8A 1H93A 4JNKA 2G1UA 3NRCA 2BFPA 4XYMA 2UDPA 4ND4A 5F5NA 3ABIA 5ADHA 3ZDFA 2VRCA 3DZGA 4MKXA 3VZQA 3O8QA 4UVEA 1MLDA 1RYEA 2WEKA 5G0VA 4BNYA 2X0IA 1C1XB 5H82A 2PNFA 2EG9A 2JFFA 2O23A 3AY3A 2BFMA 1E77A 3I23A 5ER9A 5JYEA 1YL5A 5KJCA 3DZIA 1DLIA 4PGFA 2WM3A 2CSUA 1PJ3A 2QYSA 2Q1TA 1NNUA 1LX6A 5KJEA 3QWIA 4J3FA 4JBHA 4NQZA 4YXFA 4CODB 1ZK2A 4OAQA 3WB9A 1AUPA 3D5TA 4CLOA 4II2A 4AJPA 4JBGA 4JN6B 3UCEA 4BS9A 5L4NA 1JKFA 3OQBA 3PWSA 5JW6A 1BXKA 3RFTA 3EVNA 2PR2A 2FPIA 3FD8A 1B7GO 2Q45A 2UYYA 3OSUA 1EE9A 2IZ1A 3OHSX 1Y1PA 1LLUA 3PYXA 4Z9YA 4DREA 3U4DA 3GVXA 3ASUA 4MP6A 1EDOA 4Z9XA 3VKUA 3RASA 4NBWA 2OORA 2GYYA 4AJOA 4CV1A 3EZLA 4BV9A 4A10A 1Y6JA 2ZATA 1WXDA 2BI7A 2GN9A 3JYOA 4Q3CA 2DBQA 1B8PA 1QP8A 1S6YA 4XQCA 2NTNA 1WDMA 1XCBA 1YQDA 3GOHA 4XDYA 1P3DA 1R66A 1Y5RA 2ZB4A 3KM0A 3HADA 2PD4A 1LDYA 1LRLA 2BI8A 2GERA 3H4VA 4DWVA 4AJHA 3ZWXA 3IMFA 3PZRA 3TN7A 4JQCA 3S2EA 5DP2A 3GC6A 1GADO 1P33A 1ADGA 4TMFA 1G6KA 2EERA 2HKIA 4H15A 1E7RA 4BNXA 1I36A 3RKRA 3D4PA 5KJFA 4FDAA 1IE3A 3LC7O 1E1NA 4MVJA 4WOKA 2RH8A 5B1YA 2OFPA 4EJ6A 2GPTA 3IIEA 4YT8A 1ZSVA 3EC7A 1ZH8A 1DRUA 1ID1A 1YQXA 2GSDA 5GZ6A 2ET6A 4LSWA 1RM4A 4BNUA 5BR7A 4PLPA 4PLWA 3UGKA 3E82A 1HSOA 1EUCA 1K0UA 4LGVA 2CVQA 4S3MA 3PJEA 4FJ1A 1W6UA 2ZTUA 1A9YA 4O1MA 3PI7A 3GK3A 4W82A 3WGYA 4Z3KA 3VC7A 3Q0EA 3ZNQA 4LMRA 5JE8A 1B16A 1GFSA 1V3VA 2WMDA 5TIIA 2FSSA 2VNSA 5EQDA 2QG4A 3UH1A 3PHJA 2AQKA 4J49A 3GEGA 3FTPA 1CRWG 2IEDA 3GHHA 4WCDA 3WICA 2RAFA 4JP2A 2W98A 4M89A 1DBVO 4OXYA 3UN1A 3JQ7A 4BNTA 3GRKA 3UUWA 1DRVA 3K9QO 5KVSA 4YJGA 4L74A 4KP7A 1R15A 1ADFA 3RUIA 1U2GA 2X9GA 4MP3A 3GR6A 4CR8A 1PR3A 4YAGA 5F5LA 2DFVA 4ZJUA 3F6YA 3GY0A 4UULA 3C1TA 4IDDA 5AXDA 3LYLA 3GN2A 4IMPA 3RUAA 5A9RA 5I7VA 3SC4A 1KVUA 2ZB7A 2NTJA 2HQ1A 1ZK0A 3LK7A 3UCXA 3NDJA 4D0RA 5CAEA 2RBEA 4IDCA 1A9ZA 2X1HA 2Y99A 3KBOA 4FD3A 1Z73A 3A14A 1ISGA 3AFNA 2C5EA 1NHGA 2OBYA 1GY8A 5EN4A 4YAIA 3JQAA 3RC1A 2VHZA 4KQXA 1DAPA 1S7CA 4RZHA 1C3VA 2OO5A 2EKPA 1NVMB 5GZ3A 1FMCA 1SOWA 5ILOA 3IP3A 1EMDA 3HWRA 2FPGA 2P2SA 1T4DA 2E37A 3ZNOA 1PIWA 2FN7A 5KTKA 1QSGA 4KTTE 4KZPA 1VLLA 4DC0A 4LCJA 4MP8A 4OXNA 3WFIA 4JK3A 3WLEA 1KETA 1Q7GA 3VZSA 4GLLA 4WEOA 1UXGA 4IZIA 4OO3A 4XCVA 1O0SA 1QR6A 3G3EA 4BNJA 1UXJA 3JQBA 5G4KB 2QRJA 1ZXLA 3DAGA 3MWDB 3NJ4A 4J16A 3V1YA 3KEQA 4BO1A 1HKUA 2RCYA 4FFPA 3I83A 4A27A 1PWXA 2CDAA 1MGOA 2D8AA 1ARZA 2DT5A 2JD2A 2RHCA 3DXFA 4PZEA 4D43A 1X1EA 3F5SA 2NV6A 4FGSA 1XG5A 2IYPA 2PZLA 4K6FA 2UV8A 4UUOA 1L1FA 3OM9A 5JFOA 4EW6A 3TF5A 2A4KA 1YL7A 4XZ3A 2Z1MA 3C7DB 3JYNA 5CDUA 1HE2A 1PS9A 3DZHA 2NSDA 1BW9A 5A9TA 3KSUA 4GX0A 3H9GA 4NZ9A 5TJHA 1WMBA 4IJUA 1N1GA 5H83A 5THKA 3TOZA 5DN9A 3HDJA 4PG4A 4OJNA 1I3KA 2C82A 4XYBA 1UP4A 3PWZA 2JHGA 4P4GA 5T6BA 3H8VA 3K5PA 2VN8A 3DAFA 3RC9A 5JC1A 2IYOA 3DMYA 3ICCA 4NH4A 4E5PA 1U4OA 4J0EA 4E12A 1HETA 1Z7EA 4ND1A 3QRWA 4HBGA 4UEOA 1KS9A 5A06A 2DUWA 2UUPA 4IZHA 4R5MA 1IHXA 4QECA 1Q7CA 1IHYA 1DFHA 4RLHA 3N58A 3FBTA 3AOGA 1E6WA 4YAJA 1O9BA 3WYCA 1EBUA 1B8UA 2X58A 1HE5A 4HY3A 5LCXA 1TB4A 5KVQA 4BIIA 2HUNA 5JY1A 3MTJA 1EQUA 4GAEA 2HRBA 1N1EA 1DC5A 1ENYA 3ROMA 4XX0A 2FR1A 3WIEA 1LDGA 3DMTC 1PQWA 1SC6A 1VPDA 1ZW1A 5KKAA 3TOXA 4D44A 1ZBQA 2B5VA 2R00A 1W0CA 1U2DA 2AQIA 3NGLA 1PGQA 2IE0A 1YS4A 1CERA 1ZNQO 2CUKA 2CFCA 4LVUA 1GU7A 1GD1O 3DBRB 1JA9A 1YB4A 3F5QA 3I9JA 5IAAA 5ICSA 1M76A 2F1KA 2I67A 4CJXA 5EIOA 3GAFA 3JV7A 5CPFA 4LK3A 2DBZA 1NFQA 1O94A 4WOJA 3S1LA 1H2BA 1NQAO 3ITKA 1LDEA 4Z0TA 3VVCA 3G1TA 4FCCA 4WNCA 4E5KA 5JDCA 4KUGA 4BKQA 2JCVA 4JLWA 5A3JA 1K6XA 3L9WA 4IBOA 3ZI0A 3DL2A 4DLAA 4OHUA 3GEMA 3JQEA 1PQPA 1CF2O 3RBZA 4OKIA 1PJSA 1U28A 2Q1WA 1YDEA 5A5FA 4PLTA 1LLCA 1YDWA 3I6QA 4GL4A 1N2SA 1WZIA 2PD6A 4QXMA 2C2YA 3GA0A 4BO0A 1GEEA 4FQ8A 3D3WB 3G17A 1V9LA 2BD0A 2JAHA 3CXRA 4MO2A 1DDOA 3DBLB 1QXSA 5F1OA 3SLKA 1CDOA 3GGGA 4LN1A 3TRIA 4FOOA 4MDHA 5CHEA 1Y9EA 4I1IA 3PTZA 5KKCA 3KHUA 1I0ZA 3VDQA 3VAZA 4CLOB 5JCXA 4WCFB 1I10A 2B4QA 3OJ0A 3OFSA 3BMOB 3D1LA 5CG1A 1BXGA 4F6CA 1ZK3A 3L6EA 3E6AA 2YDXA 4HFNA 4B7CA 1P44A 1QYCA 3GH3A 3ITDA 5HWSA 3D3EA 1MG5A 3ETDA 4XDZA 3WGTA 4BNZA 4BNGA 3QY9A 4E2WA 3AWDA 1ISIA 4A73A 2VUTA 2CDBA 1JWBB 4O59O 1YGYA 4XQEA 1VL8A 1W73A 4YACA 3ZV5A 2Q2WA 2WTBA 3E18A 4E21A 5L45A 3E5RA 3T4EA 2HO5A 3NDIA 4U5QA 2GGSA 1V3TA 1MB4A 1WLYA 3WYBA 3ZV3A 4K26A 2D1YA 1PX0A 1I2ZA 3FWZA 4J7CA 1ZVMA 2NVBA 3HE3A 2BHLA 2I5PO 4BNFA 3RCBA 5ILGA 3X2FA 1SEVA 3AFMA 5IJZA 5JS6A 5I7SA 3O4RA 5B4VA 5DCYA 3H7AA 5C5IA 4G81A 3JD0A 3OETA 4BKPA 1H0KA 4IY1A 4DIOA 4RCVA 1T1RA 3VTZA 3JD1A 3P2YA 4MOWA 3WQQA 4ALNA 4MIYA 2A35A 1RJWA 3ZV6A 2VYNA 4QO7A 1CQIA 4D7AA 1HZJA 5FF9A 1C14A 1AHIA 4UEKA 4EYEA 4WUVA 4E3ZA 4B4WA 1VKNA 4DQUA 2GASA 7ADHA 5LC1A 3VKVA 1MC4A 5CDSA 1ADCA 2BFAA 5I8WA 1PGJA 4E30A 5DNAA 2DPGA 2WE7A 1ISHA 2P4QA 3JYPA 4Z9FA 1IPEA 4BUCA 2PV7A 3U62A 3P19A 4ZA2A 3RBVA 3WX0A 4TKLA 4RVFA 4IDEA 3TNLA 1UDCA 4JJGA 3UCFA 3IC5A 1PZFA 4B8ZA 1U3UA 2PLAA 3PEFA 2I65A 4U0KA 1Y7TA 4BGEA 2NVUB 1A4IA 2O3JA 4XA8A 2NVUA 5IF3A 5DP1A 3BTUA 2AW5A 4NNJA 4DGSA 1LA2A 1ISFA 3D7LA 3GRPA 3FHLA 4Q3BA 5JMPA 1D8AA 2JHFA 3BMOA 4CM4B 4DBZA 4J4HA 1F14A 3PVZA 1J5PA 2ZTVA 2C0CA 4MKZA 1LSJA 4A7PA 2VT2A 1BVUA 2IXAA 1DIBA 2Y0DA 3QLJA 2W90A 4I5GA 3Q2KA 1U8XX 1TI7A 1TXGA 3QWBA 4ILKA 4OH1A 5I7EA 5JCJA 2VQ3A 1O5IA 2Q4EA 4RQUA 4YB8A 4PG8A 5EL0A 4J9UE 4FW8A 3MCVA 3TZCA 2I9PA 3SX2A 1PTJA 1OBFO 4BNKA 5JC8A 3Q1LA 1HDYA 2AEJA 2JD0A 3KXDA 1YB5A 5A04A 1YBVA 3RUCA 4MVJG 1RM5A 2JKVA 4A26A 2A9FA 2Z95A 1J6UA 4ALIA 4WASA 5I9MA 5TQVA 5LDHA 3ZNNA 4YAEA 3ZW8A 5G0UA 5IG2A 5CP8A 4L4XA 2I66A 1KVRA 3GF4A 4ITUA 1E1LA 3RQSA 4JP3A 4BMSA 5COBA 3KSZO 1C1DA 1WDLA 5CG2A 3W4JA 4Y8VA 1QLHA 4FC6A 4BO7A 1PEDA 1HF3A 2PZMA 3H5NA 4KTVE 1PR9A 1OC4A 3CZRA 1BSVA 3P7MA 2BMAA 1ZEMA 2IZZA 3F46A 4W7HA 4XIJA 4MIOA 1HDGO 2DTDA 2XXBA 5G4KA 1E3IA 3QE3A 5TT0A 1E3SA 4M54A 1XU7A 3E9NA 3WGOA 1Q0LA 4EJ0A 2YZ7A 3VPXA 3M1AA 1Y9AA 5A1TA 2JL1A 4B3JA 3PPIA 4NJOA 2VOJA 1YJ8A 3DFZA 4GMGA 1UUFA 2TMDA 3ZWOA 3R0IA 3ZWNA 5J23A 4XJTA 2PH5A 3O9ZA 3OICA 4NHEA 2ZKLA 1RWBA 1AE1A 4XGKA 5IZCC 2E4AA 4CM7A 1R16A 3HN7A 3BTOA 4EITA 2ZJ0A 4B7UA 4BO9A 1DIGA 1HTBA 1Q1NA 5AXBA 1LLDA 3UXYA 3VZPA 1XU9A 3QW2A 4Q3AA 3QVSA 1E0DA 5KCZA 1DIAA 1PGNA 4E5MA 4H7PA 2GCGA 3I9MA 4RVDA 4WEQA 5KIAA 4OGWA 3AI2A 3JQCA 1F06A 9LDBA 4H16A 4YT2A 3HUDA 4K28A 4BV8A 3CKYA 3K30A 2YFQA 5C37A 3TZQA 1H9BA 3S2GA 3I1JA 1MA0A 4R1SA 4FBGA 3WJ7A 1ONNA 4RDHA 4J90A 3U4HA 4QUKA 1T26A 1A72A 5TJ9A 3T4XA 3DHEA 3ON5A 4EI2A 3OJOA 1CETA 3AY7A 3WG9A 4RV9A 3GUYA 2HLPA 4IDFA 4BNVA 1NR1A 4R01A 2BRUA 1NR7A 3DBVO 3KVOA 3LT4A 5AVOA 3I9NA 4BB5A 1PJQA 1T4BA 3LLSA 1F12A 3GMSA 3NTQA 2VTEA 2J5QA 4Y67A 4PZCA 3VH3A 3BYZA 3I6IA 3WQSB 3FF4A 1DO8A 4BVAA 1ML3A 3KUXA 3JQDA 4UUPA 5HS6A 3WSWA 1BXGB 3ONDA 4D46A 2Q46A 3OQ6A 4KWHA 2WYUA 4B4UA 3AJRA 3RUEA 4BNLA 3NT5A 1D1SA 1DAOA 4YJFA 3ZN2A 1GYRA 4YDRA 2AMFA 3KSDO 3JYLA 4RPJA 3QHAA 3T7EA 3E03A 2JCYA 3WJAA 1U5AA 3E8XA 3BMQB 1Z7BA 4QEDA 3H2ZA 4MVJD 4A2CA 3R6DA 2QZ9A 3KYDB 2DTEA 1B3RA 3M6IA 2HMTA 2GUGA 3SJ7A 4WE3A 4ALMA 4BO2A 3L4BA 1TA4A 4MVJF 1V3UA 2B35A 4AL4A 1T1SA 5CEEA 3PJFA 3ROKA 1RPNA 3WSVA 4OSPA 3OBBA 5JO0A 2X8LA 5FI5A 3GLQA 2YQ5A 3L07A 4UEJA 4L75A 3EW7A 4HP8A 3LVFO 1PS0A 1U3WA 4II3A 3EYWA 4R1UA 1BHSA 5BNTA 5C7LO 4NU6A 4W99A 2HCTA 4YRAA 4NJMB 5A9SA 2VWGA 1UJMA 2ZK7A 4R3WA 5L7TA 4AICA 1EK5A 2BLLA 1HSZA 4I8XA 2BGMA 3W6UA 7MDHA 3ZHBA 4CQMB 4CPDA 3L4SO 4CMEC 2VHXA 4CQMD 1I3NA 2OL4A 1XA0A 3EY4A 4DPKA 3V5NA 1P1RA 1NFFA 1YO6A 4ZQGA 4G65A 3W4IA 2UAGA 3DDNA 1W4ZA 2OGUA 1ZUD1 2HMWA 2X0JA 3HG7A 3PQEA 1BW9B 2NADA 5L4LA 1ZFNA 4CM4A 4RL6A 5DBIA 4GVLA 1UDAA 4BKRA 2AG8A 2V6MA 2JCXA 4JCOA 2FR0A 2CD9A 1B26A 2UUOA 5JDIA 3ROQA 1M6HA 3E5MA 2ZCUA 3MWEB 3I9KA 4YBZA 4IQGA 3K2EA 4HFJA 4XR9A 3TL3A 1AXEA 3JCZA 4K6CA 4R9RA 2YW9A 1PJBA 3FPLA 1TEHA 1PZHA 1HYHA 4AJLA 4NG5A 2VHYA 4TRNA 4WKGA 1B2LA 1PQUA 1YONA 2XF8A 4GX5A 4MVJM 3Q9UA 5AYVA 3HSKA 8LDHA 5IDWA 5JXWA 2POQX 2OZPA 1ZSNA 3NTRA 2GN8A 3L77A 3L6DA 4AJJA 3OA0A 5FYDA 3QWFA 1QV7A 1PL7A 4FIZA 3KETA 4Y6SA 4ND3A 3U49A 3QVXA 1EDZA 1SB9A 4YPOA 2LDBA 3A1NA 1NASA 4R1NA 4F46A 4LMPA 1I3LA 1TT7A 1HXHA 1ULUA 3BXXA 3M2PA 4FPXA 3PYMA 4TRJA 3X2EA 2GRAA 3CSDA 4IJVA 1XYGA 1ZSYA 3EMKA 5GZ1A 5JAZA 3FPCA 4Y98A 4PN3A 3EHEA 4D41A 2J3IA 4B4OA 1EVYA 1OZAA 3BIOA 1JU9A 2EEZA 4PG7A 2PKRA 3IS3A 4P38A 3JQ9C 4CMHA 2V65A 2X9NA 4BL5A 4UVGA 1YBMA 3OIDA 2I76A 3ZWWA 2VZ0A 4TZTA 4AJ4A 4MIEA 4XWYA 4J6FA 3DB2A 4QFCA 3RD5A 3ZHXA 4D0SA 1YXMA 4Q3DA 4S1VA 3GGOA 1P1KA 3MJEA 3V2HA 3DOJA 4CQMA 1YJQA 3FSRA 3STHA 4E33A 3OF2A 3WXBA 2WD8A 4MVJE 3BZUA 4Q39A 1KEUA 3IOYA 2OBNA 1T2FA 4YJGB 3GDFA 4H3VA 4DPLA 3H3FA 1F8FA 1BTOA 4O63O 1K89A 3PHLA 2HK7A 1YH3A 1SZJG 3JTMA 2DFDA 1NHWA 3M1LA 3JQAB 3DO5A 3DR3A 1WVGA 1JAXA 2O4CA 4RVUA 4ZGWA 3BMQA 2B69A 4YEDA 2AG5A 2W2LD 1PJTA 1XELA 3RJ9A 1DIHA 3JQGA 4GSKA 4P22A 3FI9A 3DMTA 1U7HA 1IULA 3CINA 4L4RA 5CEJA 3JYQA 2E82A 3WNVA 5C7OO 1N92A 4B3HA 3P2OA 1PL6A 4GKBA 4L73A 5KVVA 1WAMA 4TVBA 3MJVA 4UAGA 4XYLA 3WIDA 4RPLA 3WFJA 5L4SA 3VPSA 4YJFB 3JSAA 2Y0CA 1X7HA 1RM0A 3NT2A 2QW8A 1DXYA 5AXAA 4CL3A 4A5OA 3DZJA 2O7SA 3TZKA 4RO0A 1GUZA 3LU1A 1LDMA 1BWSA 2DQ4A 1KBZA 3ONEA 5IDYA 2FZWA 1EUZA 3G1UA 2G0TA 4IXWA 4DUPA 3HQ4O 4AJ1A 4M8SA 4BNWA 1HWYA 5BSEA 2PTGA 1UAGA 4ZQHA 3WNQA 2ILTA 1E5QA 1FDTA 5IZCA 1EUDA 4QTZA 1K2WA 4TZKA 1P1IA 1V8BA 1WDKA 3AW9A 2QQ5A 3BA1A 2W2LA 3I9LA 3L9XA 3NDRA 3F1LA 2DLDA 2EKQA 1UP7A 1VL6A 3QA9A 3ANMA 1X13A 1EVJA 1PL8A 4OYRA 3WWZA 1Z74A 2VYVA 3GVCA 4J4BA 3W8DA 2YYYA 4JJIA 3RFVA 5HA5A 3RI3A 4CM3A 1VSUA 4YRDA 4DLBA 2Y1FA 1HDZA 5IXYA 1P0CA 1M66A 1V0JA 1LXCA 4Z3DA 3V1UA 3LC1O 2UVDA 4CR7A 2QIOA 3HJAA 2OP0A 4WECA 1ZZEA 3PJGA 4CLHA 3O03A 1EFLA 1LI4A 3QVOA 3RSHA 1C0LA 3ORFA 1DFIA 5L53A 4NBUA 5JNLA 1LEHA 1HLDA 3INGA 4R4JA 3IDSA 4TROA 1P45A 3A28A 4RF4A 4CLDA 3K92A 3RC7A 1B0AA 1LSSA 1O8CA 3GVHA 4IPTA 3C7CB 4HWKA 3N7UA 4N5NA 3HB4X 1KVQA 5KNLA 2OXIA 3FBGA 2EJVA 2DC1A 1HE4A 2O2YA 3ZWMA 1LSOA 3OEYA 2C7VA 1FK8A 3IJRA 4M86A 1T2DA 1P9LA 4CM9D 3AUSA 4JJFA 1GEGA 2Y05A 3ZWPA 3F1KA 8ADHA 1C1DB 1UH5A 3GGPA 3AOEC 4M55A 2DBRA 4I5DA 4BMVA 4L9RA 4NBVA 1AN9A 2BF7A 2O3TA 1GZ6A 3UF0A 1QKIA 4NFSA 3UAGA 1SPXA 1IL0A 4ZICA 1ZJZA 3ULKA 1NAHA 5JBIA 2GN4A 3DBRA 2Y68A 2J3KA 4G5HA 4FB5A 1Q7BA 3AU9A 4CLXA 3ZWBA 1CYDA 5I9LA 4HNHA 3RC2A 1GUFA 2BGKA 4FOSA 4DYVA 1X0VA 2ZB3A 3CMCO 2ZCVA 3FNGA 5JLAA 3PLRA 4I5FA 4NFHA 3HN2A 5ER6A 4DA9A 3QIVA 1EQ2A 3PQFA 1A7AA 3H9QA 3DZKA 4RQTA 2GDZA 2GF2A 5H81A 4GGOA 1HDCA 1K6JA 1U4SA 4RGBA 4CM5A 5JY6A 4MPDA 1BXZA 1JWAB 1VJ0A 4O5OA 4UVHA 5COAA 4NK4A 2NTVA 1P1HA 4ZRMA 3NX4A 3VPHA 2C54A 4DRYA 4TVOA 3KB6A 4E2XA 4MVJI 4BOYA 3NTOA 3SLGA 3F9IA 3E48A 1T25A 5I7FA 3U9LA 4R3NA 3ZU2A 5DULA 4DVJA 5KVCA 2WD7B 3GN1A 2VT3A 3WMWA 1X14A 3L6OO 1X7DA 4R69A 2FR8A 3D64A 2I6TA 2HU2A 4AJEA 2NU9A 1NBOA 2J5KA 3KV3O 5F3RA 2Q99A 4R9SA 3ETEA 3H9EO 3DONA 1K5HA 5B12A 1I5RA 2QX7A 4KUEA 3JQGB 4AJNA 1QRRA 4F45A 2DUUA 2D4AA 2Y1DA 2P5UA 4CMEA 4DTIA 4RJTA 2FY8A 4JROA 1ZMOA 4YTEA 3RWBA 1GPJA 1E7QA 1JDJA 1OOEA 3BTSA 3E1KA 2PWZA 3P5SA 4GKVA 4P8RA 3RROA 5TNXA 4BGVA 4DXHA 1ZK1A 1X1TA 1GL3A 1ZKMA 3AI3A 4W9NA 1PZEA 2BELA 1B3BA 4FS3A 1DC6A 4MKRA 3UKOA 4DL9A 5JAIA 1GV1A 1MUUA 4PLYA 5IZ4A 2EGGA 2X22A 4J7UA 2G82A 2PA3A 4U6QA 4WLVA 2RHRA 2CVOA 4OSOA 3VH4A 1KOLA 1UZMA 2BFOA 1H9AA 5K6AC 3AUAA 3JD2A 1YBAA 2B83A 5EESA 3QVTA 3GQVA 3MJSA 3GZNB 4J1TA 4PCVA 4A0SA 1LDBA 3JQAD 1LLQA 5T67A 5T5QA 2I3GA 4Y9DA 4CM1A 2B37A 4ZN6A 5IN4A 2EKLA 3ZGYA 3KZVA 1EZ4A 1H6CA 2OOSA 1N5DA 2YV1A 4FSHA 4YVFA 2WWRA 3OH8A 2AEFA 3PWKA 2NU7A 2O7QA 2YUTA 4INAA 4D3FA 3D4NA 4FN4A 2HDHA 2FHSA 5IDQA 3BMCB 2WJPA 3SVTA 3ZWCA 2JJYA 3I4FA 3GPDG 4YQZA 1X7GA 3GPIA
chains in the Genus database with same CATH superfamily
4F21A 1NA5A 4XRGA 2V9CA 5ALUA 1GUYA 4ZAFA 5IUNC 4TKVA 2MOKA 1KH2A 4OXIA 4ACBA 2YMLA 3SF8A 1ZK4A 3PCRB 3H5TA 5I4KA 2QP3A 1CRZA 2VF8A 4FMCB 5ICGA 1LNZA 4IDAA 4DCSA 3U4MA 4KXXA 3MB5A 3RYIA 3HXPA 3RS0A 2HYIC 3IA7A 2QMUA 4HWPA 5E0OA 4OL9A 3BIXA 3M3HA 1MIHA 1C8BA 1Z25A 2EWMA 4OOFA 3KTFA 3ZZTA 1F8YA 3G2HA 2DBVO 2Q41A 1LSUA 5BQ5A 3A6PC 4C7BA 1GG9A 1XZMA 3A9RA 5I6DA 4ZHSA 2W00A 1LNSA 3Q7SA 1T2UA 3G8DA 3I5MA 1N0VC 1YZHA 4YQYA 4DDWA 1TIPA 2FUNB 3A4TA 3TUJC 4CMKA 2K5UA 1NOKA 3MJ4A 4BNNA 2G9QA 2XNDD 2X9QA 4WK4B 2RGNA 4ZOEA 3N3AC 4CMAA 4E5YA 5AVTA 4NJEB 3BERA 5GGXA 1NMZA 5BVGA 2PPLA 3AF4A 4M0DA 2QD3A 1QYVA 2D1FA 3JALB 2WM8A 3ZWYA 1XQXA 3LDUA 5G53C 4AZ3A 2ZEJA 1U0HC 4PLGA 4DLLA 5ARBA 5BUCA 5K8JB 3Q11A 1FCJA 3QP9A 1P0PA 2G7MC 2I2DA 3QLEA 3GDGA 2CBZA 2WSLA 3K0CA 4HXGA 1AUVA 5C5CA 1V25A 3NEPX 4TUYB 2BJHA 1B14A 3RSOA 3D7MA 3RAFC 1A9TA 1CEEA 1OXMA 1X9GA 1APBA 2X8JB 3S99A 3JQ8B 2XHZA 1JJ7A 1TPYA 2P5SA 3LBFA 5HRAA 5JO0A 1EK6A 3D31A 1MO6A 1OI2A 4AMUA 2B7LA 5HRUA 4YN3A 4O4IB 3HU1A 4RVSA 3PR2B 4INPA 3SKVA 1NF9A 3H6HA 2ZUWA 1A5AB 3KJNA 4YFVA 1W8IA 3A06A 4V1CB 1S96A 3AR7A 4NS4A 2ZI7A 5LU8A 4JI7B 3LXXA 5KYXA 1NBEA 3LMKA 3G9UA 5M7EA 3M33A 1IZ0A 1U2TA 2PVSA 3RC3A 1NLZA 4N3BA 1ZDMA 3V8QA 2IHJA 4OLJA 1YQUA 4ZVOA 5K1SA 1X7WA 3CTMA 4QG3A 5KWSA 3NKVA 4K9RA 3WYEA 1XEAA 3ZK7A 1QO0A 3CUUA 3ZTTA 2DM6A 5HUQA 1DDGA 2PT9A 2QYTA 3CPSA 3KUKA 4IDGA 4M98A 3W90A 4HEHA 5HGXA 1KC3A 1PL0A 3WLPA 2NP6A 1FXWA 1QGDA 3GUCA 4MCIA 5ALXA 1WW2A 2P8SA 4DHWA 3RTGA 4KGDA 4RS3A 3SY8A 3U5ZB 1KMMA 2QLJA 1VP3A 4HS4A 4AAYA 4M1OA 3NV7A 4B7XA 4V0NA 1EPUA 4HDMB 5IJ0B 3OU7A 2E48A 2IV7A 1USUA 1V35A 1X92A 2GH1A 1W8DA 3ELBA 3CUSA 3NHRA 3NVDA 2VAVA 2GVDC 3OF5A 4OUDA 5DKFA 4ND2A 2ZGVA 1EIWA 4B44A 3PQ3A 4MR7A 2QRPA 1GKUB 2O1XA 3OWXA 3KOOA 4DV5B 1NJ5A 1YVRA 4G3XA 4OMUA 1RAAA 2PZKA 2P77A 1D2AA 2EW1A 2OGTA 3KT6A 1LQUA 3U7JA 5FLEX 2VHEA 1EKXA 3HYLA 4CU5A 3QOWA 3PX3A 4DZTA 2FN4A 3F4BA 3IDZA 4EGAA 2EFGA 4UTRA 1K2VN 3K0AA 3Q5DA 5AXCA 1H2HA 1TCVA 3GBVA 4AKEA 4CI0B 5I01A 2IDMA 4DMKA 1P74A 1IQPA 1WVIA 1B2RA 4C3ZA 3DJFA 5K05A 3I45A 3H9JA 1HFEL 4CIXA 5AW6A 4RS4A 2IHNA 2VDUE 1Y4DE 2ZI6A 5MHTA 1M34E 1V5GA 2E4WA 2OCPA 1VE5A 3HUFA 3JVVA 4FGWA 4OEHA 4U5XA 5EUMA 5F1KA 4BFZA 1L4YA 4TMWA 5BUSA 3L5KA 1NQVA 4ACAA 1SUDA 5L3SB 5A4AA 4CTOA 2PANA 4EW1A 5ITSA 1W0KD 3E9CA 4GYYA 4P82A 2OMEA 4EEKA 4IIHA 5AJYA 4ZGBA 2EFHB 1YS9A 4X20A 5FBLB 3AY6A 4RA9B 1QQ5A 4Q5IA 2WJYA 5EIHA 4B6EA 5H3LA 3CMMA 3DMFA 4AIIA 5KYWB 1XXHA 4NE2A 5A0TA 5ESDA 3T61A 1RKVA 2G6TA 3BT7A 4W5QA 4G4SO 3CKKA 2V3VA 2XOEA 4EG4A 5DTRA 2P91A 5MGNA 3FX2A 1AGPA 4OHBA 3ZDZB 3EVZA 2IL1A 3DZFA 4L8VA 3SBXA 1HQKA 1E2IA 5U4QA 1IPFA 2GXQA 2FSGA 2V6FA 2QROA 1YQGA 1TZJA 4MH0R 5DFAA 3WNBA 3DDCA 3MJHA 4B79A 2SBTA 4AULA 3J80A 2AZTA 4JV5B 2YHUA 1EFDN 3R5TA 2OA0A 1SUPA 1UXHA 5A2GA 4I1PA 5KQRA 3CB2A 3C1OA 1EFKA 4Q9KA 5AI9A 2IDJA 3EXEB 3QITA 2CMKA 4TLCA 5JMWA 4DUGA 5I4IA 3J7AC 1UAYA 1HGXA 1X1DA 4IXTA 1DMRA 2I4OA 2D2FA 3LHIA 1MW9X 1CR2A 2WVAA 3CNBA 2DHEA 4UUMA 4HQOA 3TRFA 4BO6A 5CDYA 1XN4A 1FUYB 1U1GA 2ZBEA 4GVXA 4GX2A 4CUJA 4OXKA 1NVGA 5KSWB 4JX9A 1EDEA 1LD3A 4WY8A 4C06A 3AZOA 2JAPA 4EABA 4ARIA 1LPAB 2OCAA 3DB1A 3GYGA 5EQFA 3RK1A 3T5BA 3T7SA 3EGXA 4GG1A 3WMFA 2BN4A 3LSYA 1TJ4A 1KY4A 1WIWA 4Z4HA 4DWOA 2LW7A 1NE2A 4PPFA 3BMNB 2HT6A 3LO5A 4AJ2A 1UP6A 2O05A 2VAWA 4HH0A 4UNNA 3VC1A 4CQLB 1AKUA 4EHAA 1ZJYA 3OZRA 1I6MA 1FMJA 1UBGA 5ERXA 3L1KA 1KYVA 2QRLA 2WDZA 3R4VA 4DADA 2GNPA 2GB4A 3PQ8A 4L0MA 4TS9A 4O8ZA 4TV9F 5EE3A 5EIFA 5A05A 1AO0A 1OTXA 4FIDA 3UUFA 4MGZR 3SBEA 2B5WA 1F3OA 1YULA 1WHSA 4RTSA 4PQEA 3IVGA 5EPEA 2OBLA 1Y6RA 2YWCA 4XB2A 2PKQP 1VG1A 1SVKA 3NHWA 1Y8QA 1DHRA 4RU1A 4AKSA 5E4JA 1ZITA 1CIVA 2G80A 1KO1A 1XZGA 4FYKA 4R2KA 1XLTA 1L7EA 3EUWA 1M2WA 3OQIB 3R0QA 4MAAA 1XZBA 4DOMA 4YRTA 4EKYA 4BNMA 1RBMA 2OFOA 4KLAA 5I5EA 2PH3A 3MPOA 4CCWA 2PRSA 4N0PA 1GLGA 2R0QC 1ZD8A 5HE8A 3PC4A 3ZCVA 1NW6A 1IWPB 3ZBUA 3S81A 1IBMB 1EB9A 1HM5A 4Y6PA 4JP1A 1DOZA 1L4GA 5EWJA 2FFQA 5I9IA 1XMPA 5KNBA 1XMVA 3GLIA 2XKJE 5EE0A 1C3JA 1FNSA 4GRDA 1ORRA 1QHEA 1NY6A 1G19A 3K20A 4KWTA 3PFCA 4LVNA 5CU7A 3MBOA 2WD7A 2O2SA 3ZCSA 5IYZF 1IQRA 1DHTA 1LTHR 3TIGA 5J2TB 4RKWA 2XCRB 2GM4A 3VOAA 5C46F 2PZJA 1G9TA 1JX6A 3I1YA 2YR0A 3P96A 4WXRA 4OY3A 1GR0A 2YBDA 2P9TA 4PAGA 3C70A 3X44A 2PIDA 1L7RA 4B3BA 3PX7A 3DBHA 4TSKA 1JHRA 3WB2A 4C2AA 4R9NA 3ZYCA 3WL4A 5BMVB 3R9XB 4J03A 4FWBA 3IIKA 4R51A 1IB6A 5AW9A 3WWYA 1RRCA 1PSWA 1SBIA 2WIGA 4HDNB 3EAGA 1HYQA 3ZWKA 3UWKA 2LWIA 5JS1A 5HNKA 3NATA 3TLBA 3OQPA 3BCUA 3U09A 1I1OA 2NYUA 4JC0A 2IGBA 3CLTC 2CBXA 4FR5A 4HQKA 3G02A 1CT9A 3DMHA 2G0AA 2A78A 4FNAA 4LQCA 2QBYB 3S1AB 3ZY4A 2V97A 4ZOLF 1Q1QA 4YRPA 1E2DA 1XALA 4CM6A 5KDDA 1RS0A 4XXHA 1J2RA 3AETB 3DYIA 4D42A 3SU8A 2WT9A 1XDWA 1YI8A 3QENA 4BJ5A 5A9SB 1V5EA 2D5AA 3RAPR 4JR1A 1TMKA 4YRLA 1DT3A 5DF1A 1AVTA 5IWAB 2J07A 2XQVA 4Q47A 5EGSA 1U3DA 4URFA 5DNYB 3VO8A 1WUYA 1TCBA 3I8SA 4L0QA 5DK4A 2C61A 3CUKA 1QYDA 1Q14A 3DTVA 1JQJC 3B1KA 3EDYA 3D8UA 1W9HA 4ZTBA 1NXQA 3BWEA 1M0EA 4NBNA 4QREA 2QM7A 3RVLA 3D6MA 4YGXB 4Z1MA 3QE0A 4M37A 1GTMA 3TE7A 1EWVA 2JFXA 2MIIA 1OPRA 2C4MA 4EF5A 3V1KA 4XVHA 1W0JD 1PK7A 1DVRA 1NVBA 2Z58A 4D02A 3SICE 3TR5A 3UEOA 5CPBA 2ZYWX 1EGMB 1GQ2A 5JVDF 2FK7A 3PFNA 2Y1KA 1RJEA 1JHAA 2AFHA 1W44A 2BKLA 2J0EA 2GF0A 2JAOA 3B3FA 1IBRA 2IYWA 1VRWA 4LQLA 4M9UA 2QYHA 1CY2A 1VBKA 4B87A 2OZVA 3AY0A 5ALPA 1U3VA 2FWMX 5FPPA 4EEZA 1P4HA 1E8MA 2VDPB 3QF4A 4XJXA 1J5XA 3UJ8A 1P0MA 4OL0A 4HFMA 4UHJA 3T7RA 2FEAA 1RPZA 1YI1A 3A3OA 3TPCA 3TTXA 1IM8A 2RGBA 3ETGA 3GLKA 3NWEA 1WXFA 5AT1A 1PJAA 4EA6A 3G9TA 1XDBA 1YZTA 4YCCA 1ZPDA 4TLLB 5L7YA 3OMWA 1Y9JA 2POCA 1C1XA 1O6GA 2WSIA 3DE5X 3LLVA 2AC2A 1DC7A 3PK0A 1XZ8A 1QDLB 4CUKA 4F1WA 2H4YA 2G5GX 1SBZA 2ODNA 1QIIA 2WKWA 3DHNA 5G0SA 5HF5A 4WLOA 3H65A 1JFVA 3AVTA 4GM1A 4DPMA 1IRIA 3O7WA 1HEUA 4MUHA 5EQJB 1SO8A 2MYNA 3DKVA 1C3XA 5GM2A 2PKYX 2WFAA 2X0NA 1DUSA 1YQTA 2F3QA 5ITVA 2XUPA 2YXLA 3AM3A 1LUAA 2GJ4A 4HJRA 3LYHA 3VPGA 1QGUB 1M2VB 4KQHA 2H9YA 3KU1A 3WADA 1A76A 2GD2A 4XWOA 1X6VA 1ZC4A 4NCXA 2QVCA 1XK6A 2NNLD 2X4GA 4ZT6A 1XVUA 1E3WB 2VP9A 2PBFA 3B52X 2FU5C 3NHAA 4TPKA 4XDHA 3RYFB 1VL0A 1K6IA 4FXOA 3B1FA 2DB3A 3R8CA 4QSMA 1B8OA 1KVSA 3NOOA 1CVLA 1XB2A 1JJBA 2QN1A 3PHGA 3QQPA 4HX5A 3K16A 1C7JA 3ANTA 4PX3A 4CLRB 3FAZA 4BFUA 3O95A 3RABA 4J0FA 1JSLA 4MK4A 2O06A 1Y8RA 1UC8A 1L7BA 1Z33A 3BKXA 2RHMA 2BUAA 3BGVA 3GJ5A 5CX4A 1ENOA 4LWZA 2QD4A 4X8LA 2J3JA 5TGDA 3NHSA 2BGUA 1G3IA 1P7WA 1VCIA 3DCIA 1YE8A 3SSAA 2QA5A 1N2CE 1V5IA 1JHMA 2RBGA 3R0ZA 1XQ1A 3CG4A 4RL4A 2WWVD 5G1PA 2GN2A 2IYQA 3OPQA 2FI1A 6ABPA 3NDBB 1UBNA 3TECE 2DKNA 4J0JA 2HK8A 1YNSA 4EB3A 2RGNC 3F47A 4WK2B 1A5BB 3DUWA 4P0TA 3OKFA 1YK1A 4B34A 2Q4OA 1RYHA 2JI9A 1W34A 2MJLA 1KRHA 4E5UA 2X41A 2ZAIA 5BR4A 2DFNA 3CA8A 2WABA 2CCGA 3N5KA 4CE6A 4QJ5A 2JCSA 1W85B 5AP9A 2PFKA 3D54D 4BP9A 5SY4A 3RDPA 2ZJ1A 8AT1A 3QHPA 3JQFC 1E9AA 3WGQA 4BVLA 3A9UA 1OFGA 3MSXA 3QJGA 1VCOA 3DTNA 5AQEA 4DRXA 2CMFA 2E7ZA 3W1EA 4N01A 4B09A 5JYDA 1WHSB 4H1HA 3W1VA 2PXHA 3N2EA 4IHAA 1JPUA 2VPPA 2P3LA 3EQZA 1G59A 4ZD6A 2Q2QA 4EUFA 1IONA 1KEPA 3KYBA 3CWZA 1ZVVA 4L5AA 3F3YA 2P2DA 4P3XA 4FI3C 1TJ3A 1U5BB 3MLAA 4E4YA 3FDFA 2WSYB 3VYVA 4LCBA 2H6EA 3WKBA 2LZ0A 2GESA 4Q34A 1BA3A 4ESEA 3NIWA 4B2PA 4XEHA 4BKOA 2YWXA 4RD4A 1NKVA 3L7MA 1MC5A 2QL5A 3G9QA 1E6CA 1TQ8A 2XI4A 5JG7A 1M7BA 6YASA 4BZQA 5CBPB 1Z4OA 3RS3A 3MN1A 2RSLA 4GP6A 3GVPA 5E9JA 3D1JA 2RE8A 9LDTA 2C07A 2K2WA 1FVXA 5EMJA 3Q1KA 4D4GA 2YX1A 4GSYA 3GT0A 4MVJP 5D00A 2CZQA 2RI0A 1L5LA 2OHHA 2QW0X 1N78A 1G0NA 1UPFA 4YNBA 2QAJA 4ZVVA 1BCSB 2J3DA 5CVEA 1JXAA 1JEJA 5ALLA 5IJWA 4Q16A 5ARCA 3WKDA 2R2GA 4HNRA 3BGSA 2EX0A 2RIRA 1N3IA 3HFGA 4CRWB 3H19A 2IODA 3DAHA 4HNAB 5A6SA 3VDXA 3QXHA 3FFTA 1QMPA 1QIEA 5IKEA 2HAEA 4NWIA 4BNIA 2XUFA 1U9YA 3G6WA 3FYUA 1NBMA 4FCTA 4F97A 2PAAA 2WNSA 4YDHB 4EW2A 4KL8S 5EMHA 1I94B 1WS6A 3WK9A 1RP7A 2G67A 1GRNA 3VV3A 5AW2A 5K03A 2RONA 1S1CA 1VIMA 3UT6A 4MS4A 4TQ9A 4Z8XA 3UW3A 4D8WA 1LBEA 4F2WA 5H68A 3HDHA 1X8JA 2HLDA 3IRVA 2XDAA 4HDAA 1JAYA 3UHJA 3VC3A 2RGUA 5CB4B 4X71A 4QGSA 5KINB 2XOXA 2O7RA 1TM5E 1RCFA 1IY1A 3AB7A 2P6UA 2R1VB 1HNNA 1XSEA 2IOFK 2VQDA 3O2SB 1DELA 1OI7A 4OJTA 3ZGVA 3HJGA 5FEMA 4W5WA 4TV9A 4N5LA 3LC2O 3CZPA 3TFQA 2IDZA 4WJLA 4M8LA 3FYUB 4HQRA 4L28A 4UD6A 4DTIA 4P4NA 2HPHA 2ZJOA 4QU0A 3VBEA 5KU7A 3BDAA 2HWKA 3SXJA 5K4AA 1OW3B 2A9KA 1K97A 4LYEA 5C4GB 5B5SA 5DDIP 1F38A 2Z1NA 2P9QA 1A50B 1J8FA 4FFWA 2VSXA 2HIMA 1MJGA 3SJUA 5AIAA 1SQSA 5DNVA 5KNCH 2Q4RA 4UU0A 4BX9A 2F64A 2VRCD 1I4TD 4KMMA 1NX6A 3EDMA 4P80A 4BUZA 3OMXA 3R7WA 1FW6A 3V48A 3BWCA 1KWKA 3ENNA 4CKBA 5EJ8A 5KDOA 4KZKA 2PJUA 1L4BA 2G25A 1DC3A 2JARA 3LZ6A 5P21A 4LG1A 1UJCA 2CNBA 1DRJA 3GEDA 4EHHA 4PG6A 3ZY6A 5EWMA 3Q3GE 2QMHA 1CS0A 4KSCA 4NE9A 2ZRQA 5KYWA 2ZCJA 2HU7A 4CGZA 2ECQA 2WUEA 3ONWA 3FNEA 2XUZA 2QRVB 4EPVA 3JRNA 2VOEA 2RAPA 3GJ8A 5IT5A 1NW7A 5LNK6 5J4KA 2J0UB 3L4EA 3WRYC 1ADJA 1ULTA 1FVFA 1GLNA 2W2TA 2Z8YA 3NV9A 1J20A 1DE0A 4KO3S 4OOEA 4Z1OA 3ZR4B 5AUOB 4RAQA 4BQIA 2QOEA 1DWOA 1TT5B 2D0IA 2PWAA 4OQYA 5HPYB 2AN9A 5IWCA 2AI2A 3PUKA 4MWSA 1XQVA 4ZQFA 5ENDA 3RE1A 1EX7A 1Z4NA 2WPNA 3KB8A 2OXCA 4N3AA 4PQGA 3VSCA 1KQPA 2DR3A 2MSWA 2WHYA 3HMKA 5BSGA 1USGA 4LDNA 3H1BA 1R2QA 1HNWB 4L07A 1VBFA 5CFMA 3ECSA 3ZD8A 2ZSEA 4CEJA 2B1RA 1VTKA 3R7NA 5BN3B 2D0DA 2H2WA 3HN6A 4WXPA 3QPCA 2F3PA 2A67A 3RU2A 2A1IA 4U8GA 5KQSA 3PTLA 5AW3A 1EAMA 2XQFA 1Z0JA 2HA3A 3KV1A 4B81A 1RBZA 2NACA 1DBSA 3N39C 1CJSA 5LJLA 3EBPA 5AKHA 4ZQCB 4X1IB 1KJWA 5ES3A 2NUBA 3KFVA 5GMOA 3SOPA 2GFQA 3SJBA 1OE0A 4R84A 5A7FA 1C4XA 2WTUA 5ALIA 4L9SA 3RUHA 1QOPB 3H4IA 5EZSA 3GFQA 4PO8A 3IJPA 5KTTA 2D3TA 4Q01A 1KYZA 2AYZA 4OHCA 5IJ0A 3GNTA 1N7HA 1JVBA 4R9UC 4UE3S 1D2HA 5E8RA 1ZH4A 3R7SA 2H11A 2IELA 5JS2A 2BFNA 2IHKA 4HV4A 3DLHA 5HBRA 5J9FA 1U8YA 3RJZA 1ONOA 4LY9A 3HH8A 4BMYA 2AOVA 1HNXB 1EFRD 4MVWA 1T9HA 2OXTA 3T3HA 4ZJYA 1UM9B 4IUYA 1D4ZA 2P40A 3JU3A 2OHGA 3BBLA 3EGWA 1N1MA 5J4VA 3FBWA 4AUNA 3H9UA 4M88A 2JFBA 3OCXA 4JIMA 3H2IA 5HTOA 1IY9A 2GT1A 3PGKA 1E2BA 2NXNA 3EVTA 2QTHA 4UDYX 5JDCC 2A94A 2YHIB 5IK2A 5WRFA 2HQSA 2G0NA 2EF1A 1HE3A 1CK4A 4DM4A 5JD4A 3OX3A 3ZZNA 4FE4A 3RVJA 3RWMB 2FCRA 3AKEA 3NBAA 5EWLB 3MUEA 5JDIC 4NXMB 4R5HA 3KWMA 1DCTA 2C7BA 1JDZA 2BR5A 2ZTSA 4WD3A 4RTRA 2D7JA 1ZOIA 2HXYA 5FFFA 3OKCA 3LYUA 4LRTB 2FGKA 2ZBFA 5K3FA 2CXNA 4RHTA 3NHBA 1HDOA 4PG5A 3GDOA 1W47A 2GXSA 3N7AA 3BGOS 1YZ3A 2CHUA 2GKOA 2NV2B 1BDJA 2C29D 2W6ZA 2QY9A 3T3IA 3WI7A 5AW7A 1OILA 3M49A 4M0FA 2C7RA 1FU4A 1VZ3A 4BB6A 4JJ6A 2R5WA 3ZDRA 2Q9BA 1OMOA 1LFAA 1X1SA 3BM5A 1PLJA 3INTA 3MLEA 2WJHA 4IINA 4IJQA 2O2DA 2GHQA 4JFRA 5EMMA 4G0XA 2XTAA 1RQLA 3TH5A 3T3EA 2XRYA 3TTYA 4A0FA 2IXBA 3OZDA 3PGXA 4PO1A 5TARA 4XASA 2Y6VA 1QQAA 1F8XA 4JYPA 4KWEA 3C7TA 3N86A 4Q3EA 1W25A 1KAHA 1ZEJA 1E3EA 1CQXA 2RHLA 3K6RA 2FPUA 1O94D 4W7IA 2I2FA 2A5FA 2C31A 1FQKA 3LFHA 3OLWA 3PU6A 1WZEA 1D7AA 3CKMA 2I99A 3FRJA 1WSBA 3H1GA 2ZJ8A 1IYZA 1WW8A 1AHHA 3QF4B 4O33A 3BPSA 1ND5A 2ZUBA 4P3NA 5CR9A 4FEGA 2NU7B 3EFBA 4DY4A 2QNIA 1EGHA 1GNLA 4W6ZA 3TJRA 5CDTA 1H1LA 5K7SA 4A6EA 1NWCA 4NOLA 3TD2A 1GPUA 4HNGA 1OFIA 1PAUA 3KFXA 4J91A 2V4MA 4R54A 4ZWNA 1Y1KE 2IQ5A 3U3JA 5GTDA 4RZ2A 3K6SA 2JGMA 5C0OE 3NPAA 5DHRA 4D57A 1V37A 5AVJA 3WZLA 1MN6A 3V2GA 3VAAA 5DO9A 3M4YA 5KYXB 3L7KA 2QVGA 4H3KB 1JW9B 2YNMD 3G49A 4NR0A 1JMVA 5EHNA 1JFLA 1QNLA 4AG3A 4CEJB 1NLMA 1GXSB 2G08A 2C9OA 4MULA 3CY6A 1LU9A 5JAQA 3PLAE 3UT0A 2GEDA 3FE2A 4MUFA 2RG1A 4NKRA 3QIAA 5M34A 3LUBA 1E9EA 1VSVA 2Q27A 3E22A 3NT4A 1AZWA 4HWSA 3DZDA 3KOZA 2PK3A 1S2OA 2PGIA 4R2JA 4OQMA 3KUUA 5DHAA 2YXDA 1R4MB 1N5RA 4XGRA 4N9WA 1JBKA 4EHDA 4F6LA 2PUVA 1KZ6A 1XWWA 3GAMA 3FUUA 3BC1A 5H83A 1P77A 4WADA 3ADDA 2BYTA 3KQNA 1CY1A 1WB4A 5FJJA 3WLMA 1CUBA 1FDVA 1LPPA 4CQLA 1QMGA 2H16A 3IP8A 4HZIA 2B6HA 5DK6A 1VIAA 4L4SA 2EZ9A 4RZQA 3W05A 3PRKE 4IHKA 4RJLA 2V9PA 3BWVA 5U9CA 5CAEB 1PKEA 3SZLA 1OU4A 4JQZA 1W36B 1Q3HA 3M83A 3AI1A 1U99A 2FF5A 3K7EA 2ZTMA 1N5JA 4XOUA 1QAQA 4CEIA 3KVVA 1LJLA 2IYNA 3LOQA 4XM1A 3CZMA 3HU2A 3SC3A 1PR6A 5K01A 4AP6A 4R2WA 4C2TA 4BGUA 1B4DA 2AKYA 5AJVB 2XMDA 1SC4A 3MCTA 2DGDA 1FDRA 3EEYA 3R4CA 4WZZA 4H0CA 2YZ2A 3EPHA 1LQTA 1ONPA 3RRNA 1QYWA 4WNIA 3ZJTA 5HKAA 2QR3A 4P7JA 2IYFA 2LUOA 4ENRA 2JJ1A 3K6JA 4ZYXA 2D0PB 4LHYA 4O08A 4B74A 4CV0A 2QD5A 4ZV4A 2B8NA 2PKCA 3BBPA 3T35A 2RHOA 2Q5OA 1I51A 3OOJA 3DLCA 4UBIA 4V0LA 5FUVA 4XD2A 4YK7A 4KXNA 3AP3A 4EBBA 1AUQA 2QPAA 3Q9SA 5AUNB 1OFUX 3QBJA 4RY8A 3THWA 4K1XA 4EEXA 2V8BA 3HDGA 3S2SA 1UIMA 2XZTA 3OPVA 4US1R 3NANA 4GI7A 3HZOA 2ZJFA 3C87A 4U9IS 2ACWA 1ENPA 2RMKA 1J0DA 1VJ5A 3BRQA 1WD5A 3TR6A 5D84A 5FBQB 4K9NA 4YT5A 1M1YB 3IAHA 1S2NA 3GDHA 1ECPA 4E88A 1PGPA 4PSUA 3COSA 1L4MA 1ST2A 5LQNA 4FJ2A 3H86A 4CCYA 1Y8QB 2QM0A 3BZBA 3W7BA 3M4XA 5DRYA 5EZYF 3OEWA 1R9MA 2C1XA 5PNTA 4DYHA 4M6WA 4Q4JA 4YJ2F 2D7DA 1G8SA 1GZ3A 1FU8A 1Z5PA 4X54A 5G3ZA 3I3OA 1Y8RB 3PKJA 4O4JA 1FFWA 3V8VA 5K45A 3ACDA 2CDCA 2V7GA 3GZJA 3M9WA 4M9CA 3RTEA 1FS5A 4DR6B 3DOHA 1CIPA 2H5LA 4KO4S 4Y18A 3VR4D 1JTVA 2W11A 3QKUA 5G0WA 3PP8A 5JS8A 4QOSA 2IIBA 1ZR4A 1ACLA 2V3WA 2W7TA 3BAZA 4RKQA 5H59A 4DGQA 3EZFA 2ALJA 1KEEB 3C6MA 1T5BA 5GIPE 1Z5NA 3VZRA 3R3HA 5EP4A 3ZH2A 3RTBA 8ATCA 3QNWA 4N03A 3P2MA 1DWUA 1E0SA 3KPYA 1DUIA 1EFUA 1YB6A 4Q9JA 3TRJA 4CN9A 4ZEMA 4Z7OB 1U1FA 3LKZA 5JAPA 4FHFA 1J0XO 3UB3A 1ZO8A 2CLOB 3UKJA 1S8OA 4XYMA 5F5NA 3EXHB 3ABIA 4JT9A 2O6LA 3VZQA 1V8ZA 5JROA 3L6BA 4DRZA 4KFCA 3UWOA 3EVEA 3UJPA 3RVRA 3CZ4A 5HK8A 2QLFA 1ZQ9A 1A9OA 5IBPA 1PV4A 5JYEA 1NDQA 1OXKB 3GARA 1QC5B 1Z8HA 2XCQA 4HK4A 4NPAA 5BNWA 1RYNA 1X8LA 2NTEA 1FTNA 4HWRA 3K9CA 3F8SA 4GW3A 2K7FA 2XVXA 5CLIA 3QWIA 4DCOA 4LUCA 3A4IA 1OHHA 1VLHA 1KKLA 4PSKA 1A8UA 1TYCA 3AB3A 3QG1A 1ZK2A 5CXUA 1AX9A 3LWDA 4B47A 2EVWX 2HN9A 2UYQA 3MOSA 4II2A 4RY0A 2ABWA 5C8ZA 1ZL2A 3OT4A 1EFPB 1M2JA 4EECA 13PKA 4Q7MB 4IV8A 1Y42X 3OZEA 1JKMA 1N6LA 1L8QA 1P4RA 3B2EA 3MB8A 3DV0A 2Y77A 2NXEA 3P9NA 1YKGA 2FZ4A 5TE9A 4FKMA 1ORTA 3H9CA 1T9GR 3BH6A 4BP1A 2Z57A 4DLUA 1Q6ZA 1EE9A 3CW2A 2NPOA 2CHGA 3DCNA 4KYVA 2ZIXA 4EHKA 1H1LB 5E7MA 4EYGA 3LX6A 1EJBA 4X66B 4UTXA 1BMQA 3H2HA 3U4DA 3AJDA 1W6RA 4E51A 3E58A 4O2AB 1AS3A 1ES9A 1ZU4A 4NBWA 4UNSA 2OORA 3C43A 4G1FA 4CV1A 4NZNA 3EZLA 1E2FA 4EYKA 1Y6JA 5HZHA 1UEIA 1WUTA 2XDQB 2O0HA 2ZATA 5JSKA 1D2MA 2O59A 1LZKA 1FJ2A 3WIUA 2I7DA 4B35A 1ECGA 1B8PA 1WDMA 4DC0A 2JGDB 4XDYA 1P3DA 2CXUA 2ZB4A 4AF7A 3QVMA 1ORVA 1RR6A 4J2TA 3CYFA 5C35A 5BRJA 1GL9B 4BQEA 1KAGA 1LRLA 4MV6A 2GERA 3L4KA 5LP6F 1RE1A 3QPVA 3GRAA 3GXBA 2ES4A 2LKDA 4JQCA 2WVJA 5DP2A 5LP6A 1ECJA 1U9IA 3DPSA 3WIOA 4DMLA 5ESWA 1L5VA 1KEKA 4N8EA 3X1WA 1ZL0A 3N0XA 4TMFA 1G6KA 2EERA 2HKIA 4TTPA 4YO8A 1KI3A 2ZJ6A 5EWLA 4QVGA 3C1UA 1FP7A 2ZPTX 5EGNA 3RKRA 5C9ZA 1O8BA 2QZSA 1K4MA 3D4PA 5BUZA 2HNAA 2WIJA 4FDAA 1XTJA 1EXNA 5K8TA 1DV2A 3LC7O 4Q1EA 4MVJA 2RH8A 2ZM5A 3D6TB 2JZCA 3FCUB 1FP4A 1ZSVA 1Q20A 3EC7A 4K6OA 2Q1YA 3T9FA 1ZH8A 5AD1A 3C3YA 1ID1A 2F9FA 1Z8NA 2LVBA 4ZO6A 2JHCA 3GRZA 4K9LA 4H7HA 1U9CA 3F96A 4KAJA 1RM4A 1U04A 2JANA 2QGFA 3M0EA 4R1LA 5BN5B 4BC1A 1DG9A 2PE5A 1XEWY 3EXHA 1R6UA 3UGKA 2VQFB 1CX9B 4Y3UA 2G6BA 4QTXA 2OZKA 1JYSA 2H18A 1PR2A 3F98A 1DO0A 2AX4A 2FJUA 3EVCA 4FJ1A 3SOZA 2D1QA 7YASA 2X1LA 4GQIA 5K3OA 3GK3A 4FHCA 4HWTA 3WGYA 4I66A 1XFDA 4Z3KA 3QUCA 1JTFA 2XZPA 2ZG6A 3O2QB 2XB9A 5JSZB 5JE8A 1QH9A 1GNPA 2WMDA 2PO7A 2PFSA 3C45A 3IMEA 1R5BA 3NBKA 4L27A 2CYCA 2X42A 5JR3A 1W7AA 2V5VA 2VNSA 4G01B 3S7ZA 3UH1A 5AOCA 4BZPA 3PUZA 1C1YA 4LF9B 5EQTA 2W98A 4M89A 1LVUA 2JFWA 5EPUA 3Q7QA 3DW3X 4U4AA 1WCWA 1K1EA 3NASA 1UC9A 1DRVA 1VG9B 5HF8A 3UUWA 4OP1A 1D03A 5CT8A 2LTAA 3CSSA 4JI1B 4OHYA 4JB3A 2BHRA 1WXHA 3UYLA 1FUEA 2H0QA 3M9LA 4MP3A 2DT8A 5DN6A 5CH3A 5JQGA 1P1BA 2O0LA 3C2QA 3DD1A 3LDFA 4ABYA 4YAGA 3V8PA 2DFVA 2X3UA 3HS3A 4UULA 5AXDA 4G8DA 3CEMA 3UAOA 1Z5UA 1WUJS 3E61A 4FYHA 3SC4A 2FXIA 1Q11A 1J25A 1ESDA 3UCXA 1BH2A 4D0RA 1X19A 2EBFX 4TTSA 2YOGA 3U4QA 3QE2A 4R2XA 3WLTA 3I1FA 2D00A 4ZCQA 5FQOA 1A9ZA 3FY4A 1SCJA 3KBOA 4YUXA 2EZUA 4BB9A 1DPFA 3A4MA 1KK0A 3AFNA 4CT4B 4YRCA 4QDOA 2WJGA 2MR5A 1GY8A 3FNRA 1VI6A 2CB0A 1P2VA 5EN4A 4YAIA 3H05A 2VUIB 1TKAA 5F3DA 1S7CA 3D7NA 1JEDA 2FTKE 3N8DA 2CLSA 3KAQA 5FOXA 4E08A 4JJ7A 1FMCA 3GRRA 3A1TA 1T43A 1SCKA 3HWRA 2FPGA 3T38A 2GHTA 3CJTA 2V74B 3BRWD 1H23A 2PA0A 3NOVA 4NSNA 4CHGA 1M6VA 4U2EA 1XAGA 1XCPA 1W49A 3QPBA 1TLFA 4GPAA 4KTTE 4MLPA 5EZYA 2EFYA 2AOUB 3T9BA 3FOEC 3INYA 1EFHA 1G5TA 3PFBA 4GT1A 2FYTA 2WT4A 5JJKA 3QJYA 4LIPD 4GLLA 1UXGA 4IZIA 4RIEA 3JPWA 4XCVA 1JI3A 1X80A 4DLNA 1W1WA 2JGKA 1QCDA 1FMTA 3BAFA 1ZJJA 3G3EA 4LA4A 2J4DA 3QQ5A 4YDSA 5G4KB 1XRJA 1ZI8A 1DV1A 4CU2A 1TZKA 3O3OB 3QHQA 3NJ4A 3V1YA 4YMTA 2XH8A 4EJSB 2WG1A 1L5OA 1HKUA 2QPLA 2Y3IA 1P2DA 1PG5A 4KQ2A 4KXYA 4LX8A 4X61A 2QGNA 4FFPA 3V42A 4EARA 5JLJA 4QWWA 1XJCA 1ZLYA 1FRQA 2CDAA 2R6GA 4NOJA 2ATXA 4POAA 5K8LA 3AVOA 2DT5A 2X0EA 2RI6A 3DXFA 2OFFA 3T1HB 2I4MA 3BA6A 4M21A 4LHZA 2C03A 5FB3A 5I7AA 4D43A 1X1EA 1WOYA 4DBLC 5CGQB 4WBSA 4BFTA 4DSAA 1IOVA 2W2OA 4I4TF 1I3CA 4DJ5X 3S68A 1RWWA 1OZHA 2PZLA 4KSBA 4WFJA 1J06A 3ZX5A 4MQLA 5C8DA 4O4HB 2AG6A 3DE6X 1B41A 3OM9A 3ITEA 3QUQA 3QXSA 2PUFA 3L49A 5LMUB 4KCGA 3IDFA 3V34A 3TF5A 1PNOA 3NALA 2JW5A 4XZ3A 2Z1MA 1P18A 4X1OA 2YQZA 3JZMA 3NRJA 2NPFA 1SKBA 5A9TA 3MVEA 4G56A 4GX0A 1HEYA 3FAKA 5TJHA 3KDSE 3SZMA 1YQEA 2P35A 4IJUA 1JHOA 2X0DA 1B00A 3OT5A 1BX1A 4QGAA 3HVRA 2EAUA 2Z6VA 3OG9A 3Q7TA 4PG4A 4W5TA 1PBNA 2JGIA 1I3KA 4GLJA 4JB2A 4N6GA 4XYBA 4EMSA 1L4KA 1ZH0A 3PWZA 4RKFA 4L8LA 4P4GA 1N2CA 2J4FA 4XVCA 2FPRA 4IJMA 3RC9A 1J2EA 5JC1A 1P7CA 2XKKA 2IYOA 3EA5A 3SDSA 4E5PA 2QS9A 4J0EA 4EHBA 2V0NA 4COOA 3KQHA 4A6DA 1Z7EA 5M2QA 3NP9A 5DT2A 2NZJA 3JSXA 1JFFA 4UEOA 4YJ2A 4A2QA 2XB4A 4AY5A 1PDVA 5A06A 2VXYA 3MGGA 4FLMA 3TGWA 4QECA 1Q7CA 5AVUA 3KELA 1X3LA 2VBIA 3C39A 1KPHA 3NP7A 4HB0A 4PR0A 4YAJA 2Q3CA 2R5FA 3VR5D 3SCZA 4HY3A 1HE5A 3EQ9A 4CT0A 4UOZA 1I1NA 3JZIA 4ESHA 3MTAA 4UBLA 1R0XA 5CX1A 5H16A 4INOA 3JRXA 5DH9A 3W7AA 1ZVJA 3AV0B 1ENYA 1FFDA 2XD9A 1UFQA 2ZDGA 1LDGA 1KMQA 3A6ZA 2X4LA 1SC6A 4HS9A 1THTA 4XVQA 5KKAA 3TOXA 4B6RA 4RAOA 1R0CA 1ZBQA 1TKRA 1ODJA 2IC5A 1HNZB 4ZMSA 1C41A 4KLZA 2TMKA 3TAUA 2FKNA 5FUWA 4E70A 3AVYA 2IE0A 1RC1A 1CERA 1JDVA 5ECWA 1ZNQO 4N4AA 2AV6A 4D25A 3KK0A 2ZSJA 2X8WA 2IYSA 1GD1O 4JP8A 3DBRB 4NU0A 1SK8A 5ICSA 1J21A 2A0YA 1HE1C 2V7QA 1M76A 1RKUA 3O4GA 1MVNA 1ABEA 2F1KA 3D2AA 4W63A 1YFJA 4RADA 3LI2A 2DBZA 4TL6A 4WOJA 3EJ6A 3S1LA 4LDPA 3STTA 2EZ8A 1U8EA 2ON6A 1L4FA 3LDGA 3ITKA 4W1SA 4DLVA 5FUMA 4DV4B 4MIKA 4FCCA 5JDCA 3ZOZA 4G0VA 4KUGA 2FPXA 3BOSA 4BKQA 4Q3OA 1K6XA 3ZI0A 3OHPA 4HB2A 3DL2A 1L9XA 1W52X 5DIZA 1NVFA 4PEVA 5EP1A 2VI5A 1U28A 3KR9A 2Q1WA 3AR5A 1QU2A 1Q1ZA 1YDEA 4H6XA 4L5JA 1YDWA 2FZVA 2GJKA 3QX9A 1WZIA 4QXMA 1RWKA 3BREA 1SQ0A 1GEEA 4GDFA 1M9NA 3PXGA 1VI5A 3JRWA 4P08A 4KVFA 5CM2Z 4EGJA 2JAHA 3PFKA 5JHHB 2XRMA 3PGA1 3SLKA 1GDDA 1DJOA 4LN1A 4PZUA 3TRIA 2ONKA 1MO4A 1ZGBA 2ODAA 3KJFA 2CHVA 3KOXA 4FOOA 3EWNA 4RTLA 5C1DA 3M4ZA 5DM70 3PSHA 1WETA 4ARCA 1C4OA 5BSKA 2HLDD 3TQRA 1LCIA 1L5WA 3A25A 3DYVA 4IIDA 2EG5A 3X1MA 5BURA 2BFCB 2ZZKA 4ZCLA 3OFSA 1TC1A 4PGMA 1WCIB 1WMEA 2OFWA 1SC1A 5LXTF 3WSTA 1KFJB 3OU2A 5CG1A 2VP4A 2C5GA 1ZM4A 3WBJA 4Y1RB 4FXPA 3WHLA 3EGEA 4Z0NA 5L3VA 3L6EA 2RGAA 3C8UA 3MJFA 5AW4A 1XROA 2YDXA 4Z8YA 3VKFA 1P44A 4BRUA 3M6MD 2WI8A 2VBCA 4R0NA 1G41A 4DJAA 3ITDA 2B1GA 1C4WA 2Y1LA 3MERA 5HWSA 1ZGGA <