2DPHA

Crystal structure of formaldehyde dismutase
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
398
structure length
398
Chain Sequence
AGNKSVVYHGTRDLRVETVPYPKLEHNNRKLEHAVILKVVSTNICGSDQHIYRGRFIVPKGHVLGHEITGEVVEKGSDVELMDIGDLVSVPFNVACGRCRNCKEARSDVCENNLVNPDADLGAFGFDLKGWSGGQAEYVLVPYADYMLLKFGDKEQAMEKIKDLTLISDILPTGFHGCVSAGVKPGSHVYIAGAGPVGRCAAAGARLLGAACVIVGDQNPERLKLLSDAGFETIDLRNSAPLRDQIDQILGKPEVDCGVDAVGFEAHGLGDEANTETPNGALNSLFDVVRAGGAIGIPGIYVGSDPDPVNKDAGSGRLHLDFGKMWTKSIRIMTGMAPVTNYNRHLTEAILWDQMPYLSKVMNIEVITLDQAPDGYAKFDKGSPAKFVIDPHGMLKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Formaldehyde dismutase
publication title The X-ray crystal structure of formaldehyde dismutase at 2.3 A resolution
pubmed rcsb
total genus 123
structure length 398
sequence length 398
chains with identical sequence B
ec nomenclature ec 1.2.98.1: Formaldehyde dismutase.
pdb deposition date 2006-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2dphA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2dphA01
3EAGA 4P8RA 1B14A 2GASA 1EK5A 4ZQFA 2J5QA 4MVJE 1GADO 2NU6A 2O3SA 2VHVA 4YT4A 4U5QA 1LDEA 5A9SA 1UXKA 2EHDA 3RC2A 4L4SA 1X0XA 4B3HA 4YAJA 5JAZA 5TIIA 1ZJYA 4AICA 3NUGA 1IYZA 1P0CA 3H9JA 2EERA 2EWMA 1JQBA 2NU9A 3W4IA 1B7GO 1D8AA 4W9NC 3NYWA 3VZPA 4BNYA 4PLCA 3X2EA 4ZRNA 1H93A 1I3MA 1GR0A 4U8GA 2O4CA 4BQPA 3E48A 3ZNPA 3D5TA 1E7YA 1XELA 4FD3A 4BQRA 2I3GA 3QWBA 2YDXA 3Q1LA 3DBRB 2PA3A 4GLOA 4Z0TA 3WGHA 3TWOA 3ROPA 3MJ4A 1QORA 4D46A 1VC2A 3GVCA 1KYQA 3O4RA 3PQFA 3EY4A 1XLTA 2ZTVA 1BW9B 3FI9A 2JAPA 3PJEA 4M86A 4PLVA 3GOHA 5ADHA 3F6YA 1VL0A 5B4VA 2P4HX 4BNWA 3JQGA 5FYDA 4DC0A 4CMBA 1NAIA 1K89A 1PGQA 3JQ6A 3GRKA 5T57A 4Z3DA 2IE0A 3RIHA 4ZJUA 1GPJA 4NBUA 5L53A 1PZGA 1A9YA 2YFQA 2BHLA 5AYVA 1FXSA 3I23A 4GGPA 2AE2A 2WD7B 4GKBA 4IIVA 4Y98A 3WLFA 4BNVA 4R9SA 5TX7A 5KVQA 3RSHA 3DL2A 3WFJA 1DIGA 1NBOA 2DBQA 1NX6A 3F4LA 4TRJA 2NSDA 1XR3A 2I66A 4LISA 1C0KA 1V3UA 1D7OA 4CL3A 3JQ9A 1YBVA 3H6KA 1SB9A 3PDJA 4R5MA 4Q3BA 9LDBA 4E30A 2JFHA 4BB5A 2W2KA 4WCDA 3DHYA 2HK8A 4OMUA 1V35A 2BI7A 2Q2VA 5EINA 3R0IA 2EP7A 4E5PA 4OHUA 5JMWA 1AGNA 1NQOA 2EIHA 3ZDFA 4QX6A 4FGWA 3R6DA 1JWBB 3KZVA 1DRWA 4XA8A 4Y6RA 1CF2O 3ICPA 3P19A 3KSDO 1VE9A 1U9JA 1LJ8A 4QFCA 1MG0A 2YV2A 3DOCA 3RBZA 1ZBQA 1DIBA 1OOEA 3KYCA 4PG6A 3RWBA 3BTSA 4BV8A 1WZIA 3GNTA 4QSMA 3DBHA 3EGOA 2EW2A 2Q2WA 5CPFA 5AVOA 1E1KA 1SEVA 3JQBA 1ZH8A 2B4TO 4ZVVA 1B2LA 1MP0A 1BXGA 3F47A 1LI4A 3WS7A 4PN3A 2V6FA 1YBMA 2R00A 2X5KO 2UDPA 2IODA 1BDBA 5DCYA 4NBRA 4A27A 3RUHA 3O03A 3OQBA 1SEPA 4HBGA 4RDIA 4WUVA 1DFHA 4C7JA 2BFOA 3JQFC 3BHJA 5JY1A 3ON5A 3GVPA 1ULUA 3ZWAA 4M54A 1LUAA 1R12A 3BMCA 4XB2A 1I5RA 1BMDA 3I6QA 3TZ6A 1ZCJA 2P4QA 1LBEA 4JP3A 3VDRA 2ZB3A 3RBVA 3NTOA 2OL4A 2Y1CA 5DOZA 1O95A 2E48A 2DC1A 4E31A 3L4BC 3PK0A 2B35A 5AQ1A 1CEQA 1HF3A 1U7TA 2CUKA 2GO1A 1J5PA 1Q7BA 1Q1NA 4D0RA 4RPKA 4CM9D 1AUPA 1U2GA 2Q49A 2QG4A 2W2LA 3PXXA 3GGGA 3W4JA 3ENNA 3HB5X 2W8ZA 3DAGA 2VWGA 3H4VA 3MJVA 2FWMX 3QWFA 2FSSA 4K9DA 1A7KA 2X86A 1BDMA 1ENPA 1E7WA 4LK3A 5H83A 3WB9A 2HQ1A 1Z6ZA 2I76A 3OIDA 4CMEA 1NAHA 3DOOA 3WNQA 1C14A 3WGIA 1T2DA 3DOJA 1AHHA 2NNLD 4ITUA 1R4MA 2H1SA 4DLBA 3NT2A 3VPFA 2DPGA 3WSWA 1I10A 3O38A 3KBOA 5C5IA 4BNLA 1C1DA 1W6UA 4QECA 1QSGA 5FI5A 2C2XA 2DUUA 2J5KA 1L1FA 1SBYA 3AU8A 1P1KA 1T26A 4RO0A 1QMGA 2Q1WA 1QLJA 1WDLA 2PH5A 4XQGA 5EESA 4A0SA 4A26A 4AFNA 2P2SA 1EFLA 3JD4A 3GGOA 3CEAA 5I7FA 4P38A 2ZIZA 1QYVA 3AUUA 2CMDA 4NU5A 1OI7A 1O94A 1LLDA 1KEUA 2POQX 3U09A 4IXWA 1KEPA 4NG5A 3WGTA 1TT5B 1T4DA 2Q99A 3GK3A 1ZO8A 3GHHA 3M2PA 5JYDA 1DFIA 4GPD1 1EVYA 3ROMA 3Q11A 2FR0A 2PV7A 4AJ1A 4CUJA 5TC4A 3H3FA 1LDGA 1MV8A 3ZW8A 4DQVA 2VOJA 4NI5A 5A5EA 3GVIA 1J4AA 1IE3A 4YEDA 2EKPA 3RFTA 2AEMA 2AG5A 3WWYA 4J1QA 5CEEA 1ML3A 4XGKA 3ZWCA 4DL9A 3FN4A 1KC3A 2BGKA 3TF5A 3KYDB 1UXGA 3QWIA 2WYUA 4WLFA 4XIYA 3D0OA 3CXRA 3TZKA 4CLRB 4E5KA 2RAFA 3D64A 1O8CA 3TSCA 1ZK2A 3L0DA 1PIWA 4DXHA 1E3WA 2HLPA 3DHEA 5JC8A 1X7DA 5CDSA 2QQ5A 3ADOA 3JQEA 2HU2A 3OECA 4RVDA 1UZMA 1MFZA 3UFXA 2JJYA 1TB4A 3S2IA 3FWZA 3ETGA 4RL6A 4YJFA 3VHRA 1MB4A 1X15A 4YVFA 4EJ0A 3VKVA 3VZSA 1ZEMA 1DAOA 1YJQA 3W4KA 4BS9A 4R16A 4FW8A 1G6KA 2AXQA 1C0LA 3OETA 4WECA 3ZCXA 4R51A 3DZKA 5IZCC 1GZ4A 1J6UA 4RCVA 3TFQA 2C54A 5JDIC 1P1FA 4ZD6A 1FDTA 1P44A 3OP4A 3LK7A 2GCGA 4Y6PA 1R37A 5EPOA 4J9VA 4YB8A 3HDJA 3FNHA 3E9NA 4IS3A 4R1NA 3WMWA 2OO5A 3NAQA 4GAEA 4BO0A 4XYBA 2PGDA 4RPJA 4DIFA 3D5QA 1B8VA 2GUGA 2JCXA 3K30A 1KETA 1LLUA 3GVXA 5A06A 2DFDA 3I6IA 5DCUA 4IINA 2BD0A 4BNHA 3B70A 3LF2A 2AQ8A 4II2A 4B4WA 3ZU5A 4KMSA 1U5CA 3OM9A 5JXWA 2R6JA 4NFYA 4M89A 5EJ2A 1EMDA 1YJ8A 1Z73A 3JD1A 1D4FA 1BVRA 1ADGA 1NVGA 2WEKA 4ND2A 3DTYA 4RPGA 4YJGB 4KQXA 4OH1A 3VH2A 5I9MA 5JPIA 3QP9A 1DJNA 2O2YA 2PK3A 1QLHA 4RQTA 3T7EA 1ZK4A 4EEZA 4R54A 3ST7A 2G1UA 1XQ1A 2HRBA 3I83A 4RZHA 4FJ1A 3ZWOA 3ZWVA 5IXYA 3NV9A 1U4SA 2GLXA 1U3TA 1N1EA 4BV9A 4E4YA 3FPCA 5KWEA 4EJ6A 5THKA 1JDJA 4AJEA 3SBOA 1X1EA 5G2OA 3OFSA 4F6LA 4MJLA 3V5NA 1M2WA 5U4QA 2YDYA 3UHAA 2YHIA 3JQAA 3WTCA 2Y1GA 1PZEA 3ONDA 4J16A 2QW8A 3DBLA 1PGOA 4S3MA 1P77A 4TRRA 4WOJA 1Y8RB 4WASA 1EDZA 4RV9A 1QYCA 3V1TC 3BXXA 2C82A 1PQPA 2DLDA 4YQZA 1IPFA 3ONEA 1GPDG 2VTEA 3LDHA 3JTMA 5L4LA 4NBWA 2P5UA 5F3RA 1NHWA 2DBRA 5C7IO 1N9GB 2Y1OA 3DTTA 3V2GA 1EBUA 4J7XA 5T8KC 4U0KA 3JQ9C 1GL3A 1XU7A 1HYHA 5EQFA 2EGHA 3TPCA 1U3VA 3WIDA 1NM5A 3H65A 5G0TA 4D7AA 2X0NA 1MX3A 4OO3A 3CZRA 3PGXA 4R3WA 4M1QA 1DHTA 2Y05A 3WDSA 1I8TA 2YFHA 4YQYA 2ZTLA 4YAGA 5MDHA 3PHIA 1LSJA 1M76A 2Q1TA 1RM3A 3RUDA 3BTVA 1DBVO 4L73A 4DPKA 1H9AA 4N18A 4XQCA 4XKJA 2YY7A 1H94A 4A2CA 3QY9A 3VAZA 1DLIA 2QZZA 3AUAA 1VL8A 4BHTA 2YJZA 2BKAA 4LSWA 1ONNA 5KVCA 3GG9A 4TRMA 2EKLA 4LGVA 4AL4A 3PGJA 3NDJA 4GX2A 4J1SA 1N2SA 3H9QA 1YDWA 2R00C 4UUNA 1U5AA 3ZV6A 5BQFA 1DIAA 3SJUA 2EXXA 2I99A 2A94A 1UDBA 3LQFA 5A3VA 3T4EA 3NJ8A 4MVJA 2DPHA 5LDHA 1C0IA 3ZWMA 3E9MA 4M55A 4GMFA 1JKFA 1PJQA 4Q3CA 5JYEA 4NBVA 2EW8A 4GX1A 1U4OA 1CRWG 4JXKA 3CMMA 1TA4A 2PZKA 2FY8A 3PJGA 2FHSA 1PJBA 3BMQA 2QYSA 1O6ZA 4A7PA 5EQDA 2NQ8A 3GA0A 4FFNA 2CDCA 4CM8A 2C2YA 1DC5A 1YB1A 3PFFA 1VSVA 3O9ZA 4I5GA 1E0DA 4FOOA 1QV6A 1I2BA 2GRAA 4F45A 5L95A 1P1IA 1HYEA 1NR1A 5DBFA 4BNXA 3C1OA 1DC6A 1UP7A 3E8XA 2EF1A 1WMBA 2HMSA 4FS3A 1H6CA 5B12A 4CMEC 4CUZA 4E2XA 2J3IA 4MINA 1EFKA 4J1NA 3WLEA 4Z9YA 1LRKA 2D2IA 1KY4A 2BRUA 2FR8A 4EDFA 3STHA 4J2OA 1DPGA 3UW3A 3NX4A 1LSUA 3BMNB 3OSUA 3BAZA 2PTGA 2DKNA 3R1IA 1H9BA 1WLYA 3AM3A 3PDUA 1PGNA 4BNIA 4QEDA 3ZV3A 1YL7A 2E82A 4UEOA 5TNXA 2CNBA 4W4TA 5TSDA 2TMGA 4OQYA 3WICA 3AY3A 1C1XB 1ZMTA 1D3AA 1GTMA 5CG1A 3QVWA 1ZK0A 4NR0A 2AE1A 2PY6A 1ZNQO 2IRWA 4Z9XA 3RCBA 3X2FA 1VSUA 1FMCA 1PZHA 2X4GA 1DEHA 5B4TA 3NTRA 4OL9A 4IXTA 4TRNA 4NZ9A 3ZWXA 1P45A 3PP8A 4YTEA 1LEHA 3QLJA 2ZB4A 4M87A 4BNKA 3RUCA 1QV7A 4IY1A 1WNTA 4CPDA 3DZFA 5COBA 5JE8A 3IIEA 3K31A 5JCJA 1ZW1A 3IP3A 3CPSA 4OM8A 3HFSA 4R69A 4R41A 3MTJA 5ER9A 2O48X 1YH3A 3P2OA 3KSUA 2VYVD 4EI2A 3PWZA 2BFPA 2GDZA 3JQ8B 4DIBA 3ZU2A 3RQSA 1U3WA 3NDRA 3C7AA 1B0AA 3PLRA 5CG2A 4FFPA 4DLAA 3CTMA 2D3TA 1BW9A 4CMCA 4DMMA 2CF5A 3D3WB 1E6EA 1UDCA 2HSDA 3VH4A 5T5QA 4LSMA 2A35A 2HDHA 1SOWA 2F00A 1NP3A 3NGXA 3VPXA 2VOEA 4PVDA 3ZWBA 1G0NA 4MVJF 4YJHB 4YT8A 5I8ZA 4YCAA 4E32A 4EUFA 3NGLA 1DRUA 5CEJA 1XA0A 4HUJA 4N7RA 2NWQA 2PZMA 3OIFA 4Q3DA 3WYCA 3IDSA 5DT9A 4WLEA 4GX0A 1VI2A 3WJAA 4HNHA 3V2HA 1ZSVA 3PVZA 3WBBA 4PIVA 1TXGA 1A5ZA 3R3SA 2HJRA 3TZHA 3UICA 4ZICA 1AE1A 1E7SA 3ONFA 3RVDA 3MEQA 3IP1A 4NHEA 1SCUA 2JAHA 3JCZA 3WGOA 4Y6SA 5JC1A 1F14A 2ZJ0A 4RF4A 3PIDA 4CV1A 4OOFA 3HADA 2JD1A 4ND5A 3ICCA 1SMKA 1I01A 1PJ3A 1B15A 1BGVA 3GPIA 1ISMA 2HMUA 4LCJA 2VHZA 4LW8A 1HL3A 4IGFA 4O6VA 2AA3A 3NDIA 1E6UA 2YQ4A 4CM7A 1SOVA 2FP4A 1E5LA 2BF7A 5DDIP 2J6IA 4B8WA 2SCUA 1V0JA 4AJNA 2NV6A 2Z95A 3UUWA 5KCZA 4YBZA 5MGBA 3WNVA 1TEHA 2I5PO 4Q3AA 2NU8A 3ZI0A 3UCFA 3BA1A 5H82A 3ETEA 1YQDA 4E21A 2ZCVA 4RPHA 4CQMB 4TROA 4ONEA 3ZHXA 4JJIA 9LDTA 2BLLA 2VWQA 3F5QA 4RVHA 4H15A 4ZHSA 2DM6A 3DAPA 2O2SA 3EYWA 1PJLA 3ETDA 3PYMA 1KVTA 2Z1MA 4DUPA 5L9AA 3DMYA 3I52A 3HDYA 4ZQHA 3GF4A 5JBIA 4FPXA 5C3MA 3WX0A 1I36A 1QYWA 1ZVMA 3OEYA 2VRCD 3K8ZA 3KEOA 5DP1A 3B6ZA 4FOSA 4OSOA 4UUOA 1ZZEA 2AEJA 3WSVA 4YR9A 2I6TA 1LC3A 1V3TA 3FR8A 3DQPA 1V3VA 2G76A 4IPTA 3FRJA 4GSLA 3JD0A 4K26A 4MKZA 3ZWYA 3JQDA 4KP7A 3JYQA 2FPGA 3SLKA 2O3TA 2A4KA 3DMTC 5KJEA 3NRCA 3S8MA 4BNNA 3M2TA 2WMDA 4UREA 1OAAA 4L4XA 1RWBA 2DTEA 1EEHA 3CMCO 1RPNA 4XB1A 3WGZA 1YXMA 2V7PA 4L76A 4DQXA 4CR6A 3IKVA 3AY7A 3OJOA 3MWEB 1JW9B 3O8QA 3BYZA 4CJXA 2NTJA 4ZQEA 2B4QA 2OUIA 1CYDA 3DEYX 2DAPA 1NFFA 4CM4A 1YBAA 2VWHA 4BVAA 5CDGA 4BNUA 3K92A 1C3VA 1PJTA 3ZNNA 4DC1A 4OKIA 5TT0A 3VKUA 1PU2A 3FTNA 2O3UA 4JROA 4NK5A 5CHEA 3QA9A 6LDHA 4CMIA 1HLDA 1Z75A 1NPYA 3D4NA 3AFNA 4B7UA 5CDTA 1IB6A 3OA0A 4J43A 3PFWO 1U7HA 4CQLB 3ANLA 1BXKA 4J4TA 2QIOA 4UULA 4W7IA 3PYLA 4YPOA 2WE8A 1EBFA 2RBEA 1UAGA 1R4NB 1PR9A 3Q9NA 4JBHA 1HDRA 1UH5A 4TQGA 1C0PA 3DHNA 5DOVA 3PQDA 4OAQA 1W73A 2NVBA 3OJ0A 1BG6A 4IDFA 2GYYA 3MJEA 1EVZA 1E1NA 3VDQA 3I1JA 5ENDA 1M6HA 1PJSA 4EUHA 1MC5A 4J7CA 3ZH2A 2B36A 3DXFA 4XRGA 3SC4A 4WLUA 3PQEA 5AXAA 3F3SA 2C5AA 4WEQA 5L7YA 1X13A 3GEMA 1Y81A 3AU9A 2Y1EA 3VPGA 1OMOA 1LX6A 3W8FA 4CUKA 3KYDA 3LYLA 3V1YA 1PQWA 1NHGA 2PKQP 4MKXA 3CKYA 1BSVA 4CLRA 4GGOA 1T24A 1D1SA 5HTOA 1UJMA 2AQKA 1ADCA 3KYBA 1ZXLA 1NFQA 1IZ0A 4FFMA 4AVYA 2OZPA 2PGLA 5JCXA 5A9SB 1DFGA 2JKVA 2RHCA 3LSYA 3AOEA 1Y5MA 2WYVA 4R9RA 5DZSA 1LXCA 2NUAA 4YT5A 5J23A 5ITVA 4ALLA 4BO9A 4S1VA 4J49A 1PL8A 3UN1A 4NJMA 1WWKA 1XQ6A 4PGFA 3GN2A 4HP8A 4PLZA 1E3LA 2JD0A 5C7LO 1HXHA 3EVNA 4MKRA 4E2WA 1QG6A 5ITWA 1NTOA 4AJ2A 4JP2A 1UR5A 1E6WA 3L4SO 2NM0A 1XKQA 2WDZA 3KLMX 1R0LA 3PPIA 5T64A 4BGIA 1ISHA 3ANMA 4LRTB 1RJWA 3F9IA 2HK9A 1YL5A 1VL6A 2QRLA 5JDCA 2X9VA 1P74A 4CM9A 3EZLA 2X22A 4DGSA 2C29D 2I67A 2RH4A 3D7LA 3RJ9A 1X14A 4WCFA 4MVJH 2V65A 3U49A 4DRYA 5JNLA 3JQGB 4YT2A 4BNZA 4XD2A 3GC6A 2H63A 3UAGA 3TN7A 1ENOA 3HG7A 1JKJA 4RZIA 5IZ4A 5FFFA 4J0EA 3VTZA 2O7QA 3VH1A 1RYDA 4BKRA 4YAIA 4HFNA 5FWNA 4CR7A 4CV0A 3OF2A 2DVMA 4WNIA 1TVEA 3INGA 2XPCA 4TMFA 3HNPA 2TMDA 5CEFA 1WW8A 4MPDA 1GU7A 4MIYA 3WG9A 2ZQYA 4HV4A 4O63O 4O1MA 4RPLA 3P5SA 3V2UA 3WGGA 4YRBA 3AI2A 5TS3A 4BMSA 4YJGA 3HN2A 1YOVB 2HMVA 1ISIA 4UEKA 2Y93A 5GZ6A 3IMFA 3MWDB 3TL2A 4HKTA 3ZV5A 1YGYA 5AXCA 4PVCA 4A10A 1LA2A 1E3IA 1NYTA 4YWJA 4Z6KA 2V6BA 3RC1A 4BNFA 1GV1A 1MXFA 1VJTA 5IDQA 4DQUA 3PHJA 1MUUA 5GY7A 4FIZA 2Q4EA 3GDGA 4GI2A 5FI3A 1FDUA 1UUFA 2Y66A 4PG8A 3IQDB 1JAYA 4BO3A 2I65A 4CLEA 4KOAA 4OXYA 4PZDA 1WDKA 1PZFA 3H7AA 1W8DA 2VN8A 1QKIA 1ZFNA 2G0TA 2NTVA 3KYCB 4OYRA 3NTQA 4PFJA 1YO6A 2GERA 3PI7A 2FZWA 3DBHB 3I9NA 4AJLA 3K2EA 3ZHYA 3GAFA 5JAQA 1H2BA 1RYEA 2J3JA 5U9CA 5BNTA 2PWZA 1V6AA 4IMRA 2D5CA 1MFPA 3GFBA 1T4BA 4A03A 2B4RO 2UYYA 4W82A 1DSSG 3F1LA 4ZQGA 3OMLA 5IXSA 3RC7A 2IZ1A 1I24A 3TOXA 3MJTA 1CIVA 3GMDA 3GGPA 1B3BA 5U1PA 5A02A 2CD9A 4YJDA 2OFPA 5G0SA 1ZK3A 2WE7A 3V1UA 4MP3A 4E33A 3EVTA 4HWKA 4D42A 2R2GA 2HCTA 4PLWA 4BUCA 2BELA 3BMCB 5HS4A 1HDZA 4FSHA 4FR5A 2A9FA 3Q6IA 4PLHA 4PZCA 3FBGA 5JMPA 4QO7A 5THQA 4C4OA 5DP2A 1YQXA 3G79A 1UDAA 4PRLA 1U8XX 5K1SA 5DULA 4P4GA 2Y67A 3SVTA 5LC1A 4PLPA 4N5LA 3OHSX 5KJCA 2FZEA 1YS4A 3VOSA 3WQSB 1JVBA 1HE3A 2QRKA 3PWKA 1H6BA 1YB4A 3KETA 3TZQA 4WK6A 4EBFA 1HDXA 4P4NA 1JTVA 3IAHA 3H9UA 4WE3A 2NADA 1I3LA 4DBVO 3CUKA 3HUDA 3FHLA 3E5MA 3RBXA 2X0JA 3Q3CA 1DIHA 1R4MB 3N58A 1CETA 4RVGA 3U62A 1F0YA 2NU7A 1E5QA 5IDWA 2GZ2A 1X1TA 2AMFA 1H6AA 5HS6A 4YAEA 4R3NA 3VPHA 3GQVA 1YONA 1MXHA 1SAYA 4CLOA 3E03A 3F5SA 4JN6B 4PLGA 5G0WA 1L7EA 1Q7CA 1HDGO 2WYWA 3QVTA 4FBGA 5LCXA 2HAEA 3RROA 2X7HA 3ZWNA 2DBZA 1GYQA 2CF6A 2NTNA 5IDYA 4FFLA 1B8PA 3K5PA 4H3VA 4MO2A 4XX0A 1KVRA 2Q45A 4EUEA 1P1HA 3ROQA 1P33A 2C0CA 5A5FA 2FMUA 1NFRA 3AI1A 1DAPA 1Z7EA 5G4KB 2WTBA 5L4SA 2JCYA 4WLVA 1MA0A 1GEGA 3GNSA 4XIJA 4BO1A 4RQUA 4NQZA 1LRJA 1ZSYA 3JQAD 4FFOA 5FEUA 1Y5RA 2X5JO 2DT5A 2EJWA 2IXBA 4BGUA 2F1KA 3H2ZA 2DQ4A 4J4BA 2X0RA 5F1OA 4IJVA 3ULKA 2ZTUA 4I1IA 3VH3A 4D0SA 3A9WA 3AWDA 1DDOA 3ZNQA 1I3NA 2FPIA 3K6JA 2Z5LA 3UKOA 3UVEA 2GF2A 2G82A 3H5AA 2RHRA 4ZU3A 3MJSA 3CIFA 2OBYA 4RORA 2NVUA 5EIOA 4HY3A 3E18A 4IS2A 4BKOA 1LDMA 1A7AA 3OA2A 1WXDA 3DZGA 5JLAA 4GBJA 4TVOA 4NBTA 1J0XO 4BNJA 3ENKA 1LLQA 2Q2QA 1FK8A 1K0UA 1OC2A 3OJFA 5A1TA 1P9LA 2ZKLA 1HRDA 2RCYA 1Y6JA 1HKUA 1T2CA 3O26A 4FQ8A 1DC4A 5L7TA 1R6DA 1HT0A 3L07A 1EE2A 1PL6A 2DBVO 5HWSA 4CL8A 4IGEA 1CJCA 2OMEA 1XHLA 3GPDG 2JHFA 3JQBC 1XEAA 1NPDA 4U0JA 4XR4A 3F46A 3AW9A 4TWRA 5KJ6A 3D4OA 3LT2A 3TFOA 3A28A 5BR7A 2O23A 4II3A 5A04A 3DR3A 4DA9A 2E49A 1E1MA 3IJRA 1NVTA 5I7EA 2IZZA 1X7HA 3FSRA 3JYLA 4BNGA 2AG8A 4P22A 3DZHA 2PH3A 3KEQA 1DRVA 1B16A 3TRIA 4R68A 2J3KA 4DPMA 2C20A 3NJ4A 4MDHA 2ZJ1A 4K6FA 4O59O 2ZTMA 4IQGA 4NMHA 4L9RA 1N1GA 4J6FA 4DYVA 4JLWA 1KBZA 3HZZA 1UXJA 3I9OA 4URFA 2HMWA 3C85A 4H7PA 3AM4A 3IKTA 1N5DA 3DFZA 8LDHA 1UZNA 3JQ7B 4B79A 4CM5A 3OEWA 2CDBA 1EDOA 1RM4A 1JA9A 1H6DA 1R66A 3BTOA 4ZA2A 4UVIA 4UVGA 1Y8QA 4I5FA 5JDCC 1MLDA 2OHXA 3QW2A 1WDMA 3I3OA 4Q3EA 1Q0HA 2P91A 1IHYA 4L4RA 3ZZNA 2Q50A 2O3QA 4TKLA 4WCFC 2VWPA 1P3DA 3DZIA 4DREA 2OORA 3I9KA 3IUPA 1LQUA 2G17A 5DBIA 2Y99A 4MP6A 3VPSA 2EKQA 1WPQA 5CDUA 4CQMD 3D3EA 3LF1A 3JQAB 1TT7A 2Y1DA 4E2YA 1KY5A 3DBLB 3UGKA 1KVQA 3L4BA 2QHXA 4BOYA 4XR9A 5IJZA 3B1JA 4Z9FA 4JJFA 1EE9A 3EC7A 5TRTA 3H9EO 5ER6A 5IDXA 4FGSA 2X0IA 2E4AA 2QX7A 4FFRA 4G65A 5IAAA 3GRPA 3NT5A 5A05A 3MOIA 1I3KA 3KSZO 4MVJI 4PLYA 5L7WA 3PWSA 1V8BA 2HMTA 4JIGA 2PFGA 2P68A 4CM3A 1A4IA 1BVUA 3B20A 4NJOA 4XJTA 4B3IA 3U3XA 3FTPA 1KVUA 3GR6A 3KUXA 2JL1A 3M1AA 4BO6A 1NR7A 4E2ZA 3ABIA 4ALKA 4IDGA 5B4UA 3OICA 4W6ZA 5F21A 4BO7A 4YXFA 3G49A 3GMSA 4N5MA 4QT0A 3OQ6A 4NDNE 1HZJA 2VYND 2VZ9A 4UVEA 4EEXA 3TOZA 1M67A 5DBGA 1GUFA 3ZW9A 3RKRA 1F17A 3WYBA 2X5OA 2ZYDA 3DBRA 1OFGA 4XYEA 1XSEA 3UH1A 2O3RA 3G1TA 4PZEA 3H5RA 1K6IA 1KERA 1PJCA 4BNMA 1HEUA 2GN9A 4R4JA 1E92A 1CERA 4W7HA 1QXSA 1W0CA 3GEGA 4QO8A 4BB6A 3IC5A 2UAGA 3SLGA 2VYVA 1IL0A 2RIRA 1R0KA 4BL5A 4U6QA 4J1TA 1H0KA 1VKOA 4ND1A 3BMOB 4TKMA 2XOXA 2GNAA 4D3DA 4EZBA 2C07A 1NPTO 4M49A 1PEDA 2WD7A 1HDYA 3QSGA 4Q39A 4ZQBA 5DCWA 2JFFA 3GLQA 5BSHA 1PS8A 2B0JA 1GUZA 7MDHA 2LDBA 3DZJA 5G0VA 1Y1PA 1B3RA 2BGMA 4GWKA 4DPLA 4DTIA 3EMKA 2VZ8A 3EDMA 4XQ9A 3EUWA 3BMQB 4XEHA 4IZIA 4RLSA 2VHWA 4DMLA 2B5WA 4NNJA 1WMAA 1QYXA 1I32A 5BT9A 4CM8B 1Z7BA 1NQ5A 3HJAA 4EYEA 3ORFA 1GD1O 4CMJA 2UVDA 4OKNA 2PR2A 2VCYA 3RU7A 2RH8A 3MTGA 1PR3A 4Y8VA 5ILGA 4HFRA 4E5NA 5I7VA 2BFMA 1LDNA 3HN7A 4HFMA 2YV3A 4TVBA 1M6WA 3BZUA 3HWRA 1Y9EA 1SPXA 4B7CA 3R3JA 2B69A 2DTXA 4IM7A 5JW6A 4LMRA 3C24A 1P1RA 1IY8A 3TQHA 2ZB8A 1GEEA 2P9EA 3UF0A 1U1IA 5ES3A 2PZLA 3U5TA 3RD5A 3PRJA 4BO4A 1I33A 1JU9A 3WYEA 1KEVA 3PEFA 2C5EA 3CZMA 3PJDA 3FNGA 2NVWA 3PZBA 2JD2A 1LSOA 3ZU3A 4FC7A 2VQ3A 1YVEI 4A5OA 1HSOA 4FCCA 4WPGA 1EUDA 5BSFA 3AM5A 5L4NA 4ID9A 3KRTA 5KIAA 1A9ZA 2ZATA 4RDHA 2VRCA 3LT0A 1ISGA 2HRZA 2P9GA 2PZJA 3OBBA 1PL7A 5CAEA 4OSPA 3I9JA 1CDOA 1SNYA 1ZXBA 4IDCA 5KVSA 5TJHA 2X58A 5B37A 5KJFA 3AUSA 1PS0A 3QRWA 5I9NA 1ARZA 5A4DA 4E5YA 4AJOA 4EITA 2WJPA 4B7XA 1TI7A 3CSDA 4KWHA 3GZNB 3OJEA 2X1HA 1PTJA 5IN4A 2CVQA 4J2HA 1LTHR 3V8BA 1MGOA 2XXJA 4EW6A 3H9GA 5C7OO 3IS3A 3OIGA 1GZ6A 1GCUA 4LRSB 1P31A 3DFUA 3QHAA 1ZMOA 1ZUD1 2GGSA 1P0FA 4WJZA 4PG4A 3ZHBA 5CDYA 2PLAA 3BHMA 1HYGA 4ALMA 3MZ0A 1FDVA 3GNQA 3MJCA 3LLSA 1QP8A 2IYPA 3FD8A 4C7KA 2P9CA 2O4UX 2AW5A 5K6AA 3DWFA 1JLLA 5K0ZA 5B1YA 4LVUA 2BMAA 2HJSA 1T1SA 1G1AA 1NVMB 1PGPA 3S1LA 4ZGWA 1TLTA 2VRBA 2LDXA 3AUTA 2Q3EA 5HA5A 3L6DA 2IZ0A 2BI8A 1YKFA 3RUIA 1GDHA 3C7CB 3LC2O 4E13A 4D79A 3H2SA 4KZPA 1L7DA 1YOVA 5T8KA 4RJTA 1E3EA 2NLOA 1TT5A 1YL6A 3TL3A 4AG3A 3SX2A 2DUWA 3E5RA 4GKVA 4H16A 3RUEA 3LT1A 1EUCA 1ONPA 1UXIA 3JD3A 3QVXA 2BFAA 4JK3A 1ISJA 2X9NA 3HSKA 4WNCA 1LU9A 1HTBA 1GYRA 1DB3A 1NASA 2CSUA 3LZ6A 4DLLA 1DHRA 3T4XA 3ZU4A 3W8EA 4GL4A 3U4CA 1GQYA 3RUFA 3RAJA 1F06A 4Y67A 1PSDA 1Y7TA 4BMNA 5KJ1A 4WGGA 4Z0HO 4NH4A 4D3FA 4ALNA 5COAA 2Q46A 2HK7A 1GQQA 5FF9A 2FOIA 1T1RA 1HSZA 2X8LA 5IF3A 1SZJG 4CLHA 1ZK1A 1T2FA 3QVOA 1GQ2A 3M6IA 5L45A 2GZ3A 2O50A 4CLXA 1HDOA 3ROKA 4R1TA 4AJIA 4EJMA 5ILOA 4BO5A 1NNUA 3D1LA 2C7GA 3RU9A 2H5LA 3GN1A 2EV9A 4INAA 4R1UA 4IQ0A 2CY0A 1HLPA 3GUYA 1DXYA 1RM0A 3EZYA 4PLTA 4D45A 2PNFA 3QWHA 3BHIA 1N7GA 1P1JA 3FNFA 3ZHZA 2Q1SA 1O9BA 2VNSA 1PX0A 4KUGA 3FF4A 2IXAA 2WM3A 3GDOA 4J3FA 1E7QA 1VJ1A 1D1TA 1UXHA 2W2LD 1ZEJA 4ZRMA 5L51A 1Q0LA 3AI3A 2D59A 2E6UX 2FN7A 3ANNA 2GN6A 3KXDA 2JCVA 4GVLA 5A9TA 2W4QA 3RI3A 4WEOA 5TLSA 1H5QA 4KTTE 5ICMA 3G3EA 1R0SA 5DNAA 2VHYA 3I4FA 3NEPX 4XQEA 4JJGA 4O0LA 4I08A 3PHGA 4I9HA 5JO0A 1T2AA 1ZSNA 2Y0EA 2P5YA 4IZHA 2E37A 2CVOA 3Q2KA 4GX5A 1ZKMA 4FJ0A 4G5HA 4GWGA 4L0QA 3S2EA 4BKUA 4AJ4A 1HE2A 1Z74A 3O8QB 3WIEA 4QUKA 3S2FA 5TGDA 2CVZA 1MG5A 2ET6A 1LNQA 3WWZA 3PTZA 1K2WA 7ADHA 1VM6A 4CM4B 4KWIA 2QRJA 2FPPA 2I3AA 2UV8A 3GAZA 4FC6A 2X6TA 4RF5A 4TSKA 5IN5A 3ZGYA 1KS9A 4RF2A 3JYOA 3HQ4O 5TJ9A 1EVIA 4D44A 1I0ZA 1KEWA 3K2BA 4UVHA 5I7SA 1ENZA 3A1NA 1CQIA 1IHXA 2VT2A 3LU1A 1KC1A 3B1KA 4CMIB 4WKGA 3WGYA 2PKQO 2QZ9A 2W2KB 2Y1FA 3HDHA 3E6AA 1PGJA 4B8ZA 3HE3A 4JNKA 1F12A 4EGFA 3JQCA 3KVOA 1S7CA 2OOSA 3KV3O 4Q9NA 3PZRA 3VTFA 5K9ZA 1WAMA 4NU6A 1DC3A 2XAAA 2H9IA 2W98A 3DC2A 3EW7A 3L77A 4XYMA 4E6PA 1BWSA 3IOYA 3T7CA 1W4ZA 3WXBA 4RGBA 4ZN6A 1DOHA 3GVHA 3UXYA 5L40A 1K5HA 1OC4A 3QE3A 5HBRA 5G4KA 2AEFA 3RFXA 4BO2A 3A14A 1YQGA 2IEBA 2VUTA 1Y8RA 4QTZA 3DBVO 2PGJA 4J91A 3FBTA 3GUCA 2V6MA 3U4IA 3D4PA 1N8KA 3C1TA 4ND4A 3AK4A 3K73O 5EMHA 3U0BA 2B37A 5HM8A 1BXGB 5JFOA 4OXKA 2A92A 2J8ZA 1X0VA 4KUEA 3GFGA 4CM6A 4MOWA 4RVFA 1HE4A 1DO8A 2OP1A 1N9GA 3BTUA 2YHUA 3B1FA 4I5DA 1Z45A 4KQWA 4MIOA 2JFGA 2YQ5A 4JCOA 1HWYA 2ZK7A 4KUHA 5BNIA 1B26A 2UUPA 4YRAA 3S55A 3OH8A 3UCXA 1JWAB 3GY0A 4JQCA 4KTVE 1EUZA 2CZCA 4X54A 5JO9A 3ZWWA 4UAGA 3DZBA 3CE6A 4LN1A 3W1VA 2NACA 4R5HA 4QXMA 1VKNA 4E3ZA 3DDNA 1I2ZA 1QR6A 3COSA 4R1SA 1YB5A 4WOKA 2ZB7A 3S2GA 1EVJA 2GPTA 1IPEA 2Y0CA 4GSKA 3RC9A 2O3JA 3C1AA 2C59A 3JYPA 5COQA 4BIIA 3DB2A 1ULSA 3KO8A 4NJMB 4JBGA 3W6UA 2FRDA 1HZZA 4OXNA 1GFSA 2Q4BA 4FDAA 4LVCA 4CMAA 5AXDA 1LC0A 1O89A 2O7SA 2X9GA 4GLLA 1ORRA 4IDDA 4CMKA 3KLPX 4CR8A 4CV3A 4UVDA 1PQUA 3JD2A 4GQAA 1M66A 4PRKA 4YACA 1U2DA 3U4DA 2VTDA 4D41A 4M8SA 1YWGO 2D1YA 2D8AA 3KTDA 3SEFA 4CMGA 3P2YA 5H81A 4Z3KA 2FR1A 1JKIA 3C3XA 4CMHA 4K1LA 3K9QO 1VLLA 1FJHA 1XCBA 4XCVA 4AJKA 2ZCUA 4IJKA 3KB6A 5JAIA 4YYZA 3L6EA 4WCFB 3A4VA 4Y9DA 2PD3A 1I30A 1XYGA 2WWRA 4QQRA 1IULA 4CM1A 1YRLA 1XWFA 3GG2A 1C1DB 5DF1A 1XGKA 3KHUA 2GR9A 2VUUA 4I5EA 1NXQA 1PS9A 4HX5A 3LLVA 4DYDA 1SO8A 5EL0A 3OQ1A 2OXIA 4ROSA 4XDYA 3C7DB 4WLNA 1PJ2A 3U9LA 4YDRA 5A9RA 4UUMA 3QWAA 4DBZA 2EP5A 1E7MA 4K28A 1O0SA 3BIOA 1E7RA 1GV0A 3SXPA 2BGLA 1K6XA 3JQ7A 4RVSA 4RF3A 1GY8A 1AXGA 4DVJA 3GT0A 1YDEA 4UUPA 4GVXA 4BO8A 3QIVA 1LDYA 3GHYA 4MVJP 5GZ1A 3L9WA 1RM5A 5JY6A 3FPLA 1KOLA 1IZ9A 4MIEA 1XDWA 2GN4A 4JX8A 5F5LA 4PCVA 4W9NA 1LQTA 1NQTA 5AOVA 4B3JA 4A73A 4Z0PA 1H2HA 3H5NA 3NKLA 5TT1A 4NFHA 3LT4A 5KNLA 3E82A 3PHLA 1ZJZA 4F3YA 2GN8A 3WMXA 1MC4A 5JS6A 3BMNA 4KDFA 4IMPA 5KKCA 3GDFA 3F4BA 4UEJA 3SC6A 2WSBA 1QYDA 3DMTA 1A4UA 2H6EA 3WR5A 2DFVA 5K6AC 3TJRA 3PLNA 4RLHA 3IJPA 4XGNA 4OIMA 3RASA 3FCOA 1R16A 2Z1NA 4TZTA 1E3WB 1Q2XA 5GMOA 1C1XA 2CDAA 2OP0A 2PD6A 1M75A 1G0OA 4QFDA 1LDBA 5EERA 5G0UA 1N7HA 2D0IA 3EHEA 2EG9A 5ICSA 1AXEA 3IL2A 2YYYA 1ADBA 1GCOA 3UOGA 3VC7A 1HE5A 1YE3A 5G4LA 1A27A 2EEZA 4MP8A 1I2CA 3F1KA 5F1PA 5F5NA 2HKIA 4NFSA 4JGBA 1GZ3A 4YJFB 4GMGA 1IUKA 4IDEA 4D43A 1PJ4A 5GZ3A 1AHIA 1HDCA 1K3TA 3LVFO 2AQIA 4N5NA 3INTA 3WJ7A 2VUSA 5JSFA 3DAFA 5LDGA 2AHRA 4IDAA 5I9LA 3NT4A 1F8GA 3AFMA 3WFIA 3OJLA 4IIUA 1KIFA 4GH5A 2BH9A 3JQ8A 1DJQA 1ZIDA 2OGUA 4HADA 2EGGA 3AOGA 4I9NA 1X7GA 3D3WA 1PWZA 1VPDA 4G81A 1DLJA 2VT3A 4MVJD 3L6OO 3AOEC 3WTBA 2YZ7A 4MVJG 4YJHA 3PJFA 4G2NA 1J49A 1GUYA 2C7VA 2IEDA 3I9LA 3BMOA 2CFCA 2J3HA 4R01A 1SB8A 4NIMA 3SJ7A 1V9LA 4PLFA 1NWCA 4XYLA 1UAYA 4B4VA 3UCEA 3Q2IA 4L75A 3U4HA 4LCEA 1WZEA 1S6YA 3RJ5A 4RVUA 3ZN2A 3VVBA 1UZLA 1QRRA 2ZYGA 2D5AA 3AY6A 3VVCA 3ZWPA 4HXYA 4IUYA 3ZV4A 3Q9UA 3INRA 4OOEA 4CLOB 5C37A 3GH3A 3PIIA 4AJHA 4IBOA 3CH6A 4F46A 1LLCA 3W8DA 1NQAO 3I4CA 3PYXA 3JQFA 2ZYAA 3WQQA 2W90A 4J90A 3G17A 2B5VA 3QV1A 4OQZA 4HNGA 3IUSA 1Q0QA 1EZ4A 1KVSA 4ND3A 3JSAA 4AJPA 4DWVA 3FWNA 3ADPA 5AXBA 4XYGA 2QYTA 2YHIB 3Q0EA 5BNFA 4XRRA 2YW9A 4XGIA 2OBNA 3L9XA 2FSVA 3ASUA 3G0OA 4I8XA 5A3JA 4XWYA 1EQUA 2I9PA 3VZRA 3H8VA 2HUNA 1F8FA 4CQMA 4IQ8A 4B4UA 4BGVA 3WOHA 1ENYA 5CP8A 2V6GA 2DTDA 1T2EA 3HDQA 4PG5A 3AJRA 5DN9A 5BSGA 2D4AA 1AN9A 4ILKA 1PWXA 5HRUA 1BHSA 2YUTA 2ILTA 4AJJA 5IG2A 2HO5A 6ADHA 1E3JA 4PG7A 2VZ0A 2ZQZA 3W6ZA 4E0BA 3ZNOA 1E3SA 1FDSA 3N74A 2NVUB 4F6CA 3JYNA 1IOLA 1K6JA 1FDWA 4OJNA 1UP4A 1R15A 1SC6A 4LMPA 1DIRA 4NPCA 5JAMA 4FJ2A 3ASVA 3MCVA 3KM0A 5TF4A 4HFJA 3HFGA 4J9UE 3VZQA 4YRDA 3WQRA 3HB4X 4IDBA 4K6CA 1NWHA 4FB5A 5JCJD 3JV7A 2UUOA 3TDKA 5A03A 4IJWA 4CV2A 2VYNA 3HHPA 4FN4A 1U3UA 2PD4A 2Y0DA 2YV1A 5ENVA 3WBFA 1E1LA 1U28A 1UP6A 4KDEA 1OBFO 3K96A 4YAKA 4L74A 5L3ZA 3MOGA 2G5CA 1EK6A 5IFLA 2PKRA 1CWUA 1ID1A 3GZNA 5CFZA 5T67A 4XZ3A 3E9QA 3G1UA 2GSDA 3RKUA 3I5MA 3CINA 3E1KA 3FR7A 4N54A 5TQVA 4ESOA 3RUAA 5KVVA 4W99A 1B8UA 5EN4A 2JHGA 1VJ0A 4D3SA 4U6SA 1FF9A 3ITDA 1WVGA 3H3JA 3WGQA 4I9UA 2XF8A 4BKQA 1JN0A 1XIVA 3KOUA 4OGWA 4BKPA 1VRWA 4JBIA 4YA6A 1A71A 2VNAA 3QVSA 2GD1O 4O5OA 2EJVA 1HETA 1E77A 4BGEA 3LC1O 3EK2A 1ISFA 4MVJM 2NQTA 5T6BA 3TNLA 3QJ5A 3P7MA 3RFVA 1JAXA 8ADHA 4CQLA 1CQJA 2VHXA 3DO5A 3FNEA 4ALJA 4B4OA 4XJSA 1ONOA 1WP4A 4IJUA 5I8WA 3LC7O 2GZ1A 1A72A 1RKXA 5CPBA 5KOIA 4BNTA 1JVSA 4BMVA 1T25A 4J0FA 1R4NA 1LSSA 4L8VA 1U8FO 1LRLA 3ITKA 4Q3NA 4U7WA 3C8MA 4XDZA 4TZKA 1Y8QB 2IDZA 4CLDA 5F1KA 2J5RA 1GYPA 1BRMA 2XXBA 1GAEO 2IYOA 1Y9AA 3QQPA 4CODB 1ADFA 1N92A 2X23A 3GZ4A 4P4LA 4E5MA 1Q7GA 4J7UA 4E12A 4DIOA 3DONA 3I9MA 1OZAA 3PHHA 3TZCA 5IZCA 1BTOA 1EQ2A 3A06A 4WLOA 3M1LA 2AQHA 1O5IA 5JDIA 5BSEA 2WD8A 2Q1UA 1XU9A 5KKAA 1Z82A 3GEDA 4ALIA 1BXZA 4J4HA 1XG5A 3N7UA 2B83A 5KTKA 2Y68A 2DU8A 4NK4A
chains in the Genus database with same CATH superfamily
3EAGA 3BH7A 1X1RA 4MMZB 4K9OA 2GASA 4YMWA 2XQGA 4ZQFA 5SICE 1Y6RA 4G0WA 4MVJE 2WF9A 3KUKA 1GADO 1GOTA 4QHSA 3BWYA 2VCHA 2WZCA 4U5QA 3EEFA 3GT7A 4YT4A 1SG9A 2OZVA 4L4SA 3O4HA 5JAUA 1X0XA 1KF0A 3BT7A 1CUBA 5ECDA 4L5JA 5LQMA 5TIIA 1YB6A 4H6WA 1ZJYA 4ZVKA 4LF4B 1KWGA 1SQSA 2C7PA 4BMDA 3DUWA 5B1EA 4FONA 4GLBA 1Z6YA 2O1SA 1VJDA 3PQ8A 4FIDA 3MTEA 4KFCA 3M4JA 2EWMA 2NU9A 3GH1A 4W5WA 3RYIA 4G0NA 1B23P 2WM9B 3JAKB 2LE0A 2PRZA 4UMDA 3BWXA 3CF4A 1D8AA 3AESB 5JCOA 1RYMA 3NAGA 1D09A 1B0PA 1JFLA 1S1CA 3GCDA 1BCRB 1PV4A 2ZWAA 4LTDA 5DTMA 3C3YA 1I9CA 1WBBA 1WETA 2O4CA 2QNIA 3ZNPA 1EG2A 3D5TA 4EI9A 1T9DA 4L6IA 4BQRA 1UPAA 2R1ZA 2Q6OA 1V8PA 2N0SA 3X1YA 2H0QA 2P1RA 4D1YA 4FKBA 1S3IA 2PA3A 2QMOA 1GVHA 4X5OA 4Z0TA 3V48A 1SXGA 2IA5A 4NZPA 3TWOA 4F5ZA 2C57A 1QORA 1EG7A 1FLNA 2BY4A 3P96A 4BNDB 4D0NA 1KYQA 3O4RA 4F0JA 1A9SA 2VDUE 3U80A 1Z83A 2XUDA 5JPDA 1F7UA 1BW9B 1KK3A 1L4HA 4ESEA 5IYZB 1OROA 3F6YA 1KSJA 5B4VA 3KJNA 2POCA 3D2CA 4DC0A 3O8NA 4CMBA 1K89A 5ECWA 1PGQA 2XQFA 2YMPA 3JQ6A 3RTAA 5T57A 4A92A 3AI7A 2G9RA 3MA0A 3T3PB 5IMSA 2PUGA 4NBUA 4OHFA 5L53A 2BSQA 4ZGBA 3H5VA 5C18A 5CB8A 3QY0A 4JI1B 5IXJA 1E9FA 2BHLA 3PNKA 4K9MA 1N0UA 1FXSA 2PSDA 4ER3A 1P9OA 4PAQA 1I1NA 1K98A 3I23A 4GGPA 5BP7A 1Z8FA 4Y98A 4C4XA 4DIKA 1X92A 2DFKB 5FOUA 1C3OB 4BNVA 3ZJ4A 4R9SA 5KVQA 2YX1A 2AJCA 2IU3A 4I3GA 2GBFA 4Y2HA 3G9TA 3JX9A 4P7BA 3ELUA 3L0IB 4B46A 4ESVA 1G8FA 1ST3A 2N1BA 5ARCA 5A3QA 3O8OA 1GCIA 4CL3A 1YBVA 3H6KA 4BRZA 5B7GA 2PUEA 1JL3A 4R5MA 1B42A 1O97C 2HF9A 2JFHA 2MHCA 2B1IA 2FFJA 1G16A 1ZRHA 3MLEA 3K70D 2BYTA 3ETNA 3CSSA 4P7GA 5EINA 2E3JA 3R0IA 4E94A 4OHUA 4EG8A 3ZDFA 2EIHA 4AZ0A 4ARSA 4QX6A 4YCCA 4FGWA 2NTYC 3R6DA 5CVUA 1JEYA 5H7XA 4MKHA 1XOIA 1X1CA 5KWSA 1JLKA 2YWRA 4QPZA 3ESXA 3W78A 4GO1A 4I3FA 4Q4AA 1VE9A 3HRHA 3TTWA 1WPRA 2OZKA 1MG0A 3DTNA 2YV2A 3N1UA 1ZBQA 1DIBA 3LLUA 4B2LA 2N9UA 5IKEA 3RWBA 3LWDA 4IRXA 4LGYA 3GNTA 1V5EA 3TLXA 4ASUD 2BH2A 3H13A 4HF7A 2GZMA 1MU0A 1ISRA 1LBIA 2PZ8A 2EW2A 5CPFA 2AX4A 3NOXA 4IIYA 2OCYC 2FZLA 1NNEA 3GDWA 1WPGA 4FHZA 3F47A 4JXZA 1LI4A 2ID8A 1DT3A 3FDFA 4XPIB 1NYLA 3KPYA 4EY4A 1I9GA 3OEHD 2PRKA 1FFXA 1IHPA 3QKUA 2IDKA 2Z8ZA 3FM9A 2Y4NA 1O77A 1BDBA 4Q66C 4NBRA 4A8JC 2LZ0A 5BN1A 1O6BA 2HN9A 1G98A 1SCDA 2BW0A 2CJYA 3TXYA 4EF4A 1QHIA 5GJCA 3WLJA 2YN4A 3HVKA 5JZMA 1ZNZA 3RODA 1HEYA 2O57A 2PMFA 3CBQA 2BFOA 3M82A 1XDGA 4CCAA 3BHJA 4BE9A 4F2GA 2VH2A 4EY3A 1OJ7A 3NHKA 1ULUA 3U3JA 3ZDCA 3DF9A 3ZWAA 4AURA 1E4YA 4QHTA 5TQ2B 3P0JA 3RFUA 3BMCA 2ODAA 2XTZA 1RJ9A 1T4MA 4HDSA 4WN9B 1ZCJA 4BP9A 2DCUA 1Z2OX 4DLNA 1LBEA 4MI1A 4MGZR 3SQXA 1BWPA 3BC1A 2IP2A 2CMKA 4F04A 2RE8A 3I5AA 4UBJA 2Y1CA 2ZR8A 2NXWA 1JQAA 1W94A 3DLTA 3MAJA 1TCVA 2E1RA 3HCFA 2DC1A 3LQQA 2C04A 5CAEB 3TSYA 421PA 2QBYA 2Q8PA 3L46A 3R8CA 2WUGA 2CUKA 2GO1A 4M9CA 4OF4A 2WFMA 1J2RA 1E0KA 1Q7BA 5E4YA 4EZEA 4RPKA 3RVQA 1U2GA 2Q49A 3IBSA 4TYQA 4CM9D 5BYAA 5AW6A 1ZXXA 2QTVA 1KI2A 4L51A 1HT3A 5JROA 1AA6A 4S04A 3OAAD 4GGMX 4TKVB 1VYVA 1B4DA 3UBTA 1X42A 2DLNA 2FUG6 2QG9A 1Z8NA 4PO3X 1JT2A 4K9DA 3UW1A 2Y4OA 4MEBA 3O1IC 4B82A 3PL5A 1P75A 3AKCA 1E7WA 2ZS7A 3EOZA 2CLHB 2JAOA 2I76A 2VVTA 3NPMA 3OIDA 4XSVA 2WHRA 3M4ZA 3DOOA 1C14A 3WGIA 1T2DA 4GZ5A 3DOJA 3AVQA 4JDPA 3UAOA 3YASA 3BF7A 1DC7A 2LKDA 2ZU0C 4HGZA 3WGKA 1GZSA 4Q01A 1OWOA 2YW2A 1MCZA 3AHDA 1WD7A 3O38A 1KZ4A 4I1RA 4ZOCA 5LXTF 3S40A 5HJEA 3CTPA 1Z26A 4BNLA 4LBYA 2JI6A 2C84A 3GT4A 1D4ZA 2KLHA 4O02B 5JSZA 2NUBA 3PU6A 4YDHB 3EIQA 5KNBH 2DUUA 5JS2A 1KP2A 1SBYA 1Y3HA 2JDID 1IUNA 4BLOA 2PT5A 1PSWA 2WJWA 4RO0A 1QMGA 2WHPB 4YP7A 1QLJA 1TA9A 1WDLA 2PH5A 4IKPA 2YUIA 3C74A 1NRXA 5LZ2A 4A0SA 2RHTA 2W6MA 1O5TA 1UBUS 4F9GA 1O3YA 3GGOA 4HATA 2IYEA 1WX1A 3CONA 4OP2A 1AKVA 4XTCS 4EHLA 5L3QA 2I7XA 1QYVA 2ZSBA 2AN3A 3KAJA 4COKA 5JAHA 5BNZA 2CMDA 4MUGA 5MN4A 4D25A 2YCBA 2GRJA 3V7UA 3PTAA 2A0YA 1LLDA 5FULA 1PWYE 4JB0A 2POQX 3U09A 4IXWA 3EG9A 4NG5A 5AW1A 3GK3A 3PE6A 3GHHA 3S2SA 5JYDA 2DERA 3W9YA 1EVYA 3BUSA 3PFCA 3ROMA 2PV7A 3VO8A 1N4AA 3H3FA 1LDGA 5GM1A 4XXHA 3ZW8A 4NI5A 3VYUB 4CTJA 4EPWA 5A5EA 5HZMA 3CZ4A 5K8TA 4AS2A 4OX9B 1V1RA 1J4AA 1V16B 1BEUB 1IE3A 2ON6A 2YIMA 4AKIA 2NT4A 4YEDA 3VVMA 4K8RB 1GIAA 5H59A 3DDCA 3T34A 3NGMA 1W581 4J1QA 5EHXA 1V7CA 4LDNA 4HPWA 2PGXA 3FN4A 3ND6A 1TC1A 1NVWQ 5B7NA 4M0MA 5IJAA 4QJ4A 1RTTA 2FE4A 4RD0A 1UXGA 5JZ9A 2WYUA 4G9GA 3D0OA 4LX0A 1YBFA 4TWJA 3VNSA 1BD4A 2DHQA 1DWUA 2CNOA 1SQFA 1JHMA 3G0CA 2BTQB 3Q3GE 4LF5B 3CA8A 4HQ0A 4OGLA 1O8CA 2VPYA 3TSCA 5AUNB 1ZK2A 3L0DA 1N0IA 1N8TA 4DXHA 3DHEA 4OATA 1QJCA 3SVLA 1Z17A 3FI0A 5KOJA 4LFAB 1NI5A 2EG5A 1XQ9A 2VBFA 3TVTA 3OECA 2Y3IA 4H7HA 1UZMA 3L7AA 4ZOAA 2JJYA 1U0NA 2OHGA 3ETGA 5HOQA 5H0IA 1W5EA 3H87A 3VHRA 3GYBA 4DUGD 5C51B 1HM5A 4TYPA 4YVFA 2G4LA 2JEYA 4FDTA 5FOSA 3VKVA 1JF8A 2GN0A 1ZEMA 5B6PA 3OQIA 1YJQA 3W4KA 1AKMA 2W2XA 5AUPB 4BS9A 1V2GA 2AXQA 3HM2A 3MJRA 1TYDE 2ZXUA 3QVGB 4R51A 1OLUB 4GXNA 1V8OA 3DZKA 3ZCXA 3HDTA 1ZY2A 1MIHA 1V3QE 4ISCA 3DVAA 1LZKA 3BILA 2VH1A 3C6KA 3F3KA 4IDQA 4RCVA 1G5RA 2BBSA 1E2MA 2C54A 3SDSA 4ZT6A 3TFQA 4ZD6A 2A9QA 3F9CA 2V3WA 3AIOA 4JLNA 2XW6A 1XK6A 1KJNA 1OV4A 2BMWA 2RDMA 1R37A 1FZQA 2XD9A 4YB8A 5EPOA 4OQFA 1FPMA 2BI4A 2ASEA 2C9MA 2XMCA 3D1JA 3FNHA 3OZGA 4XYBA 5T4HA 3JVUA 4CF6A 2HLNA 2R1UA 3O7MA 4DIFA 1KQPA 1DJPA 2GUGA 3A3PA 5DWQA 2QNRA 1XMOB 3S28A 1KETA 3MT0A 5DGIA 1LLUA 2MSCB 1GJRA 3SOPA 4UM9B 3ZEIA 3SX0A 1W9HA 4CKWB 4ENTA 1ECJA 3VUFA 3HA2A 4BFZA 3G2IA 3IODA 2FMKA 2ZRJA 3HU2A 3LF2A 5FA8A 4B3FX 4V1CB 5FR2A 2BCGY 2SKDA 1K7EB 3ZU5A 3I58A 4R1OA 1MQ8B 5A62A 3TQRA 4UMVA 1ZD8A 2OHHA 2FSGA 2YVKA 2WZQA 2HBRA 1MRSA 1WMEA 1MX1A 1YJ8A 1G64A 4NRDA 3NBYC 5AVJA 3ZOKA 1S2IA 3JD1A 5C5CA 2WFLB 1BVRA 1UC9A 3NRBA 3T3MB 4CN9A 3DTYA 3DM5A 5B4UA 3X2SA 2ZUTA 2JA2A 5F35A 3U3DA 4GNRA 4OH1A 4FI3F 3VH2A 4QDUA 1TAQA 3NYQA 2ZJ4A 4JKIA 1DJNA 3HGQA 1QLHA 2Y1WA 1JHOA 1E4EB 1ZK4A 1LPOA 3CRW1 1R6AA 3RSCA 4TYMA 2R8EA 1S2DA 2G1UA 4RZHA 3TQIA 3WGLA 4AIRA 4FJ1A 3ZCSA 1PNTA 5C81A 5IXYA 1OPXA 1RABA 1U4SA 3BD6A 1B1CA 4LRWA 5JNRA 4C7OB 2PUTA 5DNDA 3N0WA 3ZDAA 2R44A 5KWEA 3OPYI 4LG1A 3TW0A 1MVLA 3SBOA 1KAHA 3DEHA 2WJAA 4F6LA 4MJLA 5L40A 1XN1A 2I8LA 4OGKA 1J25A 2BC9A 3FLAA 5U4QA 3NJRA 5DLDA 1AKTA 3JQAA 2IY7A 1M7HA 1GPWB 2QW8A 3GZTB 1PGOA 1NDUA 2PN1A 4J16A 4ZARA 2FPLA 1ZCAA 4FUTA 4WOJA 4BV3A 4WASA 3Q8KA 1EDZA 1C3JA 2WINI 1O57A 3G88A 3V1TC 2O06A 1PQPA 2DLDA 3R5XA 1X87A 4JC0A 3EXFA 1T0HB 4WT7A 1IPFA 2FETA 3VHXA 1GPDG 3LDHA 3JTMA 2NV2B 2XNHA 2OESA 3KJFA 2P5UA 5F3RA 4LV5B 2F43A 4TTVA 5C7IO 1ZP6A 2Y1OA 4AZVA 1L1QA 3QYPA 1X3SA 1G5FA 3JQ9C 5KS2A 4S1NA 1GL3A 2A59A 3AIMA 5EQFA 3TPCA 4QG7A 2ADFA 3H65A 4RKWA 5DIFA 4QFBA 3WGJA 3RADC 2X0NA 2JLAA 5AI0A 1GPAA 3T7JA 3A6GA 3OLXA 1Y3FE 2FCRA 4JYMA 4RX1A 2XOEA 5ALUA 2Y05A 3A31A 3CJTA 3I42A 1QTIA 3V7WA 3MUNA 3TKAA 3FVVA 2ZTLA 3T0FA 4X24A 4Y6OA 1ODSA 3LCUA 2RKBA 3UAVA 2R48A 3WVNA 4PAMA 4LYDA 3N2EA 4YRMA 1L5KA 2CCGA 5MN5A 1GQRA 3BTVA 4OD0A 3M6AA 1N9KA 1BCSB 3C3PA 3HLYA 1HY3A 4LFCB 3WRYC 4F6RA 1DQPA 4JIMA 1L7MA 4QOGA 4XKJA 1U8CB 1H94A 2MYTA 4M9SA 1L5QA 4MUJA 3RT7A 3VM6A 4Q6BA 1HDIA 3S8YA 3ILXA 4WSOA 3ADKA 4BHTA 2YJZA 1YU9A 2C4VA 1PAUA 2FSIA 4D4KA 2ZXFA 4QG3A 4L2IB 3CS3A 3KT0A 3MRXA 1MOPA 3JR7A 3IVAA 2B8WA 4GX2A 2DSTA 1N2SA 3UH0A 1NGSA 2R00C 1K5GA 4UUNA 1EX9A 2I1VB 3SJUA 2GA9A 2I4OA 2IHYA 2EXXA 3NAMA 2I99A 1PBNA 3E58A 4G41A 3WHLA 3HABA 4PO9A 1XKLA 2P8SA 4EPTA 3SYLA 5DSTA 4EEKA 5KAMA 2P9YA 3USES 4GL2A 2DPHA 5LDHA 3KTAA 3TEMA 1QLWA 3GUZA 3I09A 2HLHA 5B7QA 3WAKA 4TMXA 5AVWA 2UXBB 3HKEA 3O4GA 4ZPJA 3ER8A 4DQ0A 5H4HA 4CEJB 4JQSA 4PNEA 4M8IA 2NO6A 5JNUA 3E9CA 1SWWA 3FAKA 2FHSA 3OZAA 1FFCA 1XRQA 3A25A 3NM4A 3PQCA 2PS1A 4RVNA 3FMOB 2V5AA 2ONCA 3NVAA 3VX3A 2PWBA 2QR3A 1RIIA 3BBLA 3RVLA 3T7RA 1WTCA 4N4AA 1B0UA 3PFFA 4DA7A 4JSYA 1N5MA 2VSQA 4G97A 5E0KB 2MIIA 4D8TA 3TDMA 1GL9B 2BVNA 4V0QA 4N5DA 1BMTA 1N2CB 4NEGA 1QV6A 1YMUA 1KIMA 1I2BA 2GZSA 2QU7A 3R0XA 2QMQA 2UZ1B 1YNSA 3FPJA 4IRMA 3ZS8A 1HYEA 2BCEA 4M0LA 3FTFA 1QZZA 5DBFA 3L8FA 1GQFA 3DUFA 3NDPA 1H42A 4J0HA 1J1UA 1E96A 3B8HA 2IHUA 3GQBB 3HR4A 2E21A 1KO1A 4MDEA 2IPNA 4DG8A 5F7XA 1UPBA 3MTDA 1ST2A 4CMEC 2G09A 4HNVA 5B55A 1ZAYA 4HQNA 4YWHA 3K6SA 4KQCA 4YMHA 3OP1A 4EJ2A 2G4VA 2J3IA 1XMIA 3EEQA 3FHTA 1VOTA 2NAPA 3WB2A 3QMPA 1EFKA 4O2BA 1HFKA 2Q5QA 3W7VA 4RUKA 1QGYA 2WIKA 1SCJA 3DT9A 4Z9YA 4P58A 3WLQA 3HJCA 1G38A 5HZGA 2H08A 1MAAA 3OFNA 1Z47A 1JEJA 1G1MA 3BGSA 4F86A 1CUVA 3STHA 1XMQB 2YV5A 5IBQA 1TLFA 2DWPA 3NI2A 1HRKA 1UMDB 2V7TA 3RVBA 4JI0B 3OSUA 3KCNA 2UYHA 1XTKA 2P2NA 3O4JA 3VPDA 1TO6A 1H9BA 2L82A 3H1AA 1R74A 4WVLA 1HQDA 2O2CA 1Q74A 2VEOA 4QYIA 1SBCA 2NW6A 3FJ1A 1UEIA 4D4GA 1QUEA 1OXSC 3JY6A 4PHHA 5LMZA 3W04A 4EFKA 1SIWA 4ZVLA 3R7BA 3VJRA 1ZMTA 4R0MA 4ZC1A 1D3AA 2EDAA 1GTMA 3UJ6A 3QVWA 4EGCB 3AKYA 4HGPA 1JPJA 4D02A 1JHQA 2CNKA 2PY6A 3L18A 4H6PA 4C08A 5C53B 4Z9XA 4TLAA 2PKYX 2OHVA 3SFZA 3EPHA 2PH7A 3LPMA 1A82A 1FMCA 4KR3A 1ETUA 3LIPA 5B4TA 2FEPA 4IXTA 1M1NA 5KKNB 3NM5A 4ZYZA 2F1JA 2WJHA 3THYA 4M87A 3I92A 1WNTA 5CTJA 5GQSA 1UM9B 1Y7PA 3A27A 4YLEA 3IIEA 3ZZMA 4R83A 1N2CE 5JCJA 1ZW1A 3BD8A 1PT8A 3CPSA 3HFSA 4OM8A 2R7KA 3MTJA 4R41A 1C3LA 2P3QA 5ER9A 4EG7A 1CD5A 3A9SA 2QR5A 4XIIA 2VYVD 4D9MA 4R2LA 4EY5A 2BFPA 4RVCA 4B4DA 2GDZA 3M3HA 4DIBA 3K0BA 1U3WA 4J0IA 4KWCA 3RQSA 2HCBA 3S70A 1CRLA 5FUXA 2ZETA 5AHKA 1DVRA 1E60A 2HSDA 3S0JA 3LUBA 2PUFA 2HDHA 3RG8A 2GF9A 3AW8A 3DE4X 1WF6A 4C87A 5BRJA 5M7EA 1IZZA 3VPXA 1Z6GA 3CZQA 4PVDA 1P81A 4H17A 3RS0A 3KUUA 5ICEA 4EUFA 5KOYA 2QVXX 3EOAI 4YAOA 2A14A 4IVPA 4HN2A 3OPVA 2PZMA 3WYCA 5DT9A 1XDSA 1FEZA 3EVZA 4HNHA 5IDVA 3VGJA 4GM1A 3HHEA 2XJ9A 1W2HA 1MO4A 1Z33A 3P9NA 4I1PA 3NONA 1ULBA 1FS6A 1U3DA 2LCIA 4JOQA 4C78A 3TZHA 2GFHA 5KVAA 2X42A 4F5WA 1MRNA 4I4TA 4L5CA 3RVDA 3RS2A 4AMZA 2VPPA 1XQXA 1SCUA 4CEIA 1AB5A 3WGOA 1K6EA 4N9WA 3WK6A 4TSRA 2Z3WA 2G63A 3EVBA 4A8JB 3OOYA 4OOFA 1DAEA 1US8A 1E9RA 2OE2A 3HADA 3RS7A 3DKPA 3ICCA 4X93A 4NCBA 1T9GS 2QEQA 3L6RA 4PQGA 1C1YA 2C97A 5AW7A 1NLYA 2OCGA 3GPIA 3CNBA 2XA9A 2VBCA 2ONKA 1HL3A 1KFKB 1QYRA 2P6PA 1GQSA 2AA3A 3IULA 2QPOA 2FWRA 3CWQA 1E6UA 2WRZA 4E14A 2EARA 2QL9A 1MJNA 1SOVA 2FP4A 1JT9A 2XUAA 3MIIA 4FGKA 1ES9A 1NJFA 4PQYA 4EG5A 1YT5A 4G5SA 3Q15C 4MS3B 4YLGA 4AJNA 5EIWA 1UBSB 3UUWA 3Q40A 4KV7A 5AW8A 3WNVA 2PUBA 1W4AA 5TQ0A 1P7CA 3ZE1B 3H1EA 4QYMA 5K0JA 4HN9A 3L7KA 2NU8A 3MWLA 3BA1A 1CDDA 3ETEA 1CXZA 3VSEA 3HRKA 3T3HA 1CY4A 2F8SA 2PFSA 1W9MA 4AF6A 2JPDA 3D31A 5I7RA 3UANA 2OQIA 1RFLA 2BLLA 3GPCA 3QUSA 3R2JA 4EARA 4ZHSA 4F92B 4MW2A 1QF9A 3PUZA 5AOBA 2OYRA 5SY6A 3SBDA 1M83A 1KVTA 3IB6A 1EE1A 1V43A 3DCIA 3QFTA 3ZGVA 2GESA 2CL0X 3DMYA 3I52A 2IFTA 4ZQHA 3MS7A 5ALEA 5BWOA 5C3MA 1KDYA 1QIEA 2ORYA 3F5DA 2Z2IA 4KPUA 1XTIA 3VDXA 3K8ZA 2RGRA 4EAAA 2HHJA 4NAHA 4BWGA 1RDFA 1KOGA 1RXYA 4OSOA 3B1VA 2BONA 1PDOA 2AEJA 2P9JA 3MTAA 3WSVA 5LD2C 2QLBA 3P94A 3EFBA 1LC3A 1V3TA 2GCPA 3FR8A 3ISVA 3QBDA 4GR4A 4IPTA 4MJ3A 2F9LA 5D3MB 5GAJA 3W5BA 1EI9A 4N3CA 2ZAOA 2AOXA 3JQDA 1Y82A 5IH3A 5C1DA 5HQ3B 2R96A 3GJ0A 5K0FA 2FPGA 4F9TA 2O2XA 3LCMA 2A4KA 1NT2A 3DMTC 4GEKA 1F7VA 3ZGZA 1XMJA 4LJ7A 1X8KA 4Z3OA 4BNNA 1VP9A 2I87A 1BEEA 1HE8B 1KEEB 3FMFA 1VPEA 2DUMA 3N8KA 3LOPA 4K40A 1S4QA 4OXIA 2WMDA 4C01A 3H9BA 5BN5A 1RWBA 4LQCA 1TIPA 1EEHA 4ZQCB 1XPRA 4JL5A 1YVPA 4G0MA 2E7ZA 3CMCO 4YRNA 4XB1A 2IVZA 3AUKA 1MJFA 1T9GR 3G8AA 4C0LA 2ZBQA 3HEMA 4L76A 5AJYA 2NP7A 4LJ8A 3AY7A 4TS9A 3VOBA 3FOZA 2HPVA 1PL0A 2W6ZA 3BYZA 5CIQA 5LXTA 1P4RA 2X8BA 1USVA 1VHDA 2B4QA 3CH7A 4MRMA 4MCIA 1YBAA 2KM1A 2W2PA 4BVJA 4D8XA 1H22A 1PJTA 2NP6A 2W6PA 3ZJ5A 1B76A 2HWXA 2WJ3A 2R1TB 1PU2A 2R6CA 3MGAA 2EBFX 3EEYA 4JROA 4U7HA 4EYKA 4DNXA 4YAUA 1OX4B 4MIKA 1G9SA 4PHTA 1ZAKA 3NO4A 2JEZA 4CMIA 3G1WA 2IOHA 1HLDA 4HNSA 1Z75A 3U19A 3ZJVA 1EZZA 4ZI5A 5AI8A 1CB0A 2ZAGA 4KE6A 3OA0A 4JOCA 2Q3LA 4J43A 4P53A 4CHTA 4OG2A 1CQJB 1BXKA 5GONF 3V4OA 4J4TA 3SE0A 1V6SA 5DPMA 1JQJC 4FT4A 5LVAA 4UULA 4W7IA 1TM7E 5DO9A 5F52A 1ECPA 1V1MB 1R3DA 4YPOA 1TKAA 2V7EA 4Y18A 1I7NA 3IIJA 5AVQA 3SKXA 1R4NB 2DKFA 3M1YA 1X80A 3P2IA 2WZDA 4Q48A 4DCJA 5IH7A 1V8ZA 2CV2A 3O1LA 4CBVA 2R7MA 5IF9A 5NULA 4YRJA 3WA7A 1WLSA 3PQDA 3IQXA 1W73A 1ZJ6A 4JY7A 1BG6A 4WNYA 2GYYA 1M1YA 1R0YA 1JI0A 2M1XA 4IFBA 1RWQA 3U4GA 2EZTA 1DT5A 3SF0A 1T3SA 2QGZA 3CPEA 1DBIA 3ZV7A 1GCAA 4UD6A 4X84A 3KL4A 5IP5A 2IWRA 2D0DA 2IU0A 6YASA 1I7LA 2CYBA 2WT9A 2C5AA 5L7YA 2YWJA 3I1FA 4X7MA 1LX6A 3EVEA 3A6LA 3AHFA 3QBVA 1JR3D 1PQWA 1ZHFA 3D8NA 4Y9UA 3PNVA 1BSVA 5C8YF 621PA 1IVNA 3TO5A 4E5UA 2H4YA 3Q4GA 3EASA 5ABPA 3AR3A 2XF2A 3KYBA 1ZXLA 1NFQA 4XIGS 3NEYA 2HJGA 3PT5A 2XY4A 1A2KC 5A9SB 2JKVA 4PWYA 1F4LA 3ZQJA 4RMNA 2WYVA 3HA5A 1QO9A 2ZREA 3G89A 5DXAA 1LXCA 1M34E 4DQLA 4QODA 2ORED 1AJEA 3IEMA 2C2GA 3GFFA 4RIGA 2BEKA 1VDMA 3UN1A 3VYSB 2QIPA 4AO8A 1J8VA 1J9ZA 4CWAA 4BLVA 5IJWA 1C0EA 1E3LA 1ZVQA 5C7LO 2FSVC 4IO0A 1L4UA 3AC0A 4EI8A 5ITWA 2QUJA 4WBSA 3T3GA 1C50A 1CUZA 2PBRA 2YJ3A 1SC3A 1TC2A 1LWOA 1XKQA 2QD5A 1KAGA 4MAAA 3SEQA 3ND8A 4BGIA 4BYMA 1ISHA 2ZSUA 2BEWB 1UBKS 1Y3CE 3GJQA 5LBIA 1ODKA 2ZT8A 1UQTA 5EIHA 3T12A 4PSCA 3WLRA 4B6PA 2FGKA 3HU1A 4EYGA 4MV5A 3BGVA 2I1QA 3D4IA 5LB2A 4I2VA 4N48A 2DCMA 2Z9BA 4BP8A 2B7BA 4DGSA 2I67A 1PZXA 2NG1A 1FUEA 4HB3A 2RH4A 3FW1A 4JU8A 3TBFA 5BSVA 4B2YA 4F4UA 5HX7A 3L1VA 4MVJH 5P8WA 3GLIB 5ESXA 2V65A 3ZD7A 1U7WA 2HU7A 3GJ7A 2Q7OE 2UZIR 2W6NA 5J2UF 2CEAA 1BX1A 2R8RA 3B6KA 4KNYA 3NBZC 1VL1A 5FFFA 4D6XA 3JWGA 4OV6B 3ZYZA 2XCRB 3VH1A 5DNVA 3WLAA 3NFYA 1Y4ZA 4FEAA 1GP2A 3EA4A 4N82A 1VMAA 4Q4HA 2GZRA 1BNCA 1DADA 1QGAA 1TVEA 1W4LA 4KXYA 3INGA 4US2R 2XPCA 1EFRA 3FPAA 4TMFA 5KAPA 2R87A 1W75A 1R9JA 4FKZA 4F5YA 5I7UA 4II7A 4RL4A 3EFOB 3J81A 2TMDA 1AS3A 3ZVNA 3BXEA 4MPDA 3N7AA 2ZQYA 2JI7A 1NX9A 4IIXA 4AM8A 1FJXA 3UWMA 3VU8A 2HHAA 3D0QA 2OTCA 3AVPA 2AI2A 5EQTA 2FSPA 5FHQA 4MUMA 1Z9BA 3CEJA 4UOQA 2HMVA 3G0HA 2QJFA 2RHWA 3I8SA 3L8CA 1WP9A 2B94A 3U3MA 3VNVA 4DJTA 3TL2A 3HPQA 3WP0A 3AJEA 3OFVA 1DELA 2PWYA 3ZV5A 5D2CA 2ZBRA 5K05A 5AXCA 1HOXA 1E3IA 4YWJA 3H1TA 5FBVB 1JSXA 1G3QA 4RYDA 4MS1A 3RC1A 1H5NA 1Q57A 1VJTA 3VX4A 3PHJA 1MB3A 4DQUA 3I37X 4QXOA 4EAQA 4F4FA 4RELA 5FI3A 1OA1A 1C7FA 1NZFA 3I9FA 4UBIA 3EWNA 4GEGA 3KOYA 2FPKA 5FPKA 3L1HA 1GPYA 2R7AA 4ARZB 1DP4A 1E18A 4NG4A 1QKIA 3NTQA 1F3LA 1ISPA 3EW9A 3W3AA 5HJ2A 3GP3A 4O4LA 3DBHB 3H04A 4MHTA 1TOAA 1YR9A 2QN9A 3AXSA 3GEPA 1RYEA 2A9OA 1AY0A 4KJZA 2J3JA 1B74A 3E61A 2HB6A 4GM0A 5BNTA 1QFYA 3L7IA 1MFPA 1YUMA 1T4BA 2H52A 4A03A 3GLIE 4OGFA 2ZI7A 4BJ6A 2LIVA 2GEJA 1DSSG 2UYYA 3LKDA 2HBYA 5AKZA 3AB7A 2R68A 3F1LA 4EIWA 5CLFA 3OMLA 4TXNA 4YCJA 1ZG3A 1E3DA 2Q3DA 1I24A 1DBWA 8ATCA 4Q7KA 1NUSA 3GMDA 2A33A 3GGPA 4GMKA 1B3BA 1IUPA 4C14A 3W5SA 1Q1ZA 1DU4A 4RMGA 2P4EA 5EIXA 4YP1A 4DR3B 1LF0A 2OKCA 1YNOA 3P0IA 3COVA 3CB4A 4FX5A 1OF1A 3NHMA 4GPTA 2CHVA 4RPIA 4D42A 2HCTA 1PBTA 1YZFA 4ZTUB 2FW6A 2XUPA 4DE5A 2XB6A 1HDZA 3BSWA 3FOCA 3LL4A 4F6RB 4G1EB 1YZQA 3SYNA 5B30A 3O31A 2DFLA 2OQRA 5G53C 3HKCB 1OTHA 5AHWA 5ALHA 4QO7A 4KLNA 1L8AA 2YJTD 4TV8F 5DP2A 1RMYA 3G79A 3M4YA 3A2NA 1XK7A 2RGBA 1U8XX 3SKYA 3W1EA 3KVYA 3WI7A 5DULA 3B12A 3TSZA 1F38A 4PX3A 3CUWA 4N5LA 3G8CA 2C3YA 2CL7X 1Y8AA 1YC2A 1YS4A 2A9KA 2I1LA 3KZNA 3WLKX 3ZX5A 4EYQA 1HE3A 1LV8A 1TUBA 1UM8A 4RTKA 1VE7A 3HI4A 1FP4A 3WL3A 4DLZA 3Q3EA 4G36A 3TZQA 4YIHA 3UATA 1D07A 4JT8A 1TK9A 4AG6A 1HDXA 1YRBA 2FXIA 2R97A 2XGMA 4O4IB 4QUDA 2A7XA 1CUDA 4WE3A 2G88A 3K1TA 3ZQ6A 3HUDA 1XVAA 2CLMB 3W79A 2X0JA 1DIHA 1G5QA 1GZ7A 1K7CA 2PJUA 3VXKA 1A98A 2O54A 3LC0A 4AZTA 3OZWA 2ZQ5A 3ZLJA 4ZT2A 2GZ2A 3BFPA 2I2FA 1BO6A 2HXSA 4L8FA 3WBKA 4QA9A 4JP1A 4M7WA 4R3NA 5IBPA 1YONA 3DEJA 5D5HA 4EG3A 4WBXC 1I2AA 1NQVA 5DLEA 3E03A 3F5SA 4FCTA 5G0WA 1JR3E 4POOA 5CU7A 1T36B 4KXXA 5K8LA 2O1WA 1JALA 3KD3A 4OHZA 4KRGA 3ORYA 5LPNA 1P60A 2CF6A 3RTDA 3U1TA 5EI5A 2XCLA 3LJKA 4QD3A 1NVVQ 4HEJA 1PR1A 4HUQA 1A4RA 4TLCA 1B8PA 2F6RA 3PQ5A 4MO2A 5KINB 2Q45A 1CBUA 4OJTA 2HNBA 2DR0A 2F1IA 2ISSD 2WF5A 4KLZA 3ROQA 4R40A 1CR4A 2OGWA 1Z2EA 1VIYA 3DE0X 3AI1A 4IWYA 4LOIA 1RJDA 2WWIA 4GR9A 2DGDA 4WLVA 3GJZA 3V1MA 5SYNA 3GNSA 3JQPA 1ZGZA 3E9YA 4WMLA 2NZUG 3R74A 2Q4TA 4RQUA 1C8KA 2PLWA 3QKSB 3U3OA 4AS3A 2XCTB 3DMNA 1BE1A 3EZ9A 2C3UA 2I80A 1GSOA 1Y5RA 1YQTA 4BGUA 3H2ZA 1LJUA 1POXA 1U1CA 3HKDA 1IXYA 2ZE7A 4P34A 4RFSB 3NHUA 1VLZA 1II9A 4QTTB 4X66B 3N5CA 3LWZA 1A5AB 3PE4A 2XNJA 1U0RA 4CU2A 1UPCA 4HYYA 1OH7A 4BCDA 2Z9DA 1JDPA 1KFCB 3FBWA 1YR8A 3ZNQA 2FPIA 1MORA 2BTOA 3K6JA 5ECGC 3UKOA 5FO0A 5F3DA 3HN6A 3FDJA 2VDQB 8ABPA 4LJRA 3FPSA 5AT1A 1F1JA 4ZU3A 1XQYA 4OPMA 4O4HF 3CIFA 1Q3KA 3AZOA 3E5NA 1DCKA 5F2NA 5HBRA 5HVNA 4MRAA 2VHEA 4MICA 4P54A 4DEXA 4MZDA 2O20A 5JNSA 4BKOA 1E94E 1LDMA 2O7RA 1A7AA 3NG1A 4C2AA 5IC4A 1WXDA 1C8BA 2AC7A 5JLAA 2C5BA 5GGYA 4TVOA 1VPWA 4TPKA 4UM7A 1E1RA 1Z34A 1ZOSA 2IYRA 1S5PA 4ZODA 4MPPA 1IZ8A 3RHTA 4JGIA 5C80A 1RQRA 1KAEA 4EFDA 1PG2A 5DHRA 5A1TA 1ELOA 2LCFA 3OPYB 1QO0D 2ZKLA 5AKKA 5K7SA 1HKUA 1P2FA 3F90A 4G9EA 5KU1A 4FQ8A 5L7TA 1WSAA 1X7ZA 1R6DA 1PL6A 1Z4JA 2A84A 3KQSA 4CL8A 1MO6A 4ZAGA 2GPAA 1SVKA 4PYNA 2I22A 5KSYA 1FQWA 3TIXB 1QE0A 2D2FA 3I2GA 4XR4A 1JJVA 4A36A 5EFZA 3S4YA 1MN6A 1X7WA 1KZGB 1U0LA 1TMKA 2R7NA 1W25A 2MSLA 3D4OA 4WACA 1L2TA 4G0UA 1N3YA 3T9AA 2ZUUA 5JHHB 4RK4A 3L6CA 4JEUA 1WSDA 4C07A 3KJEA 1J0CA 2O23A 4II3A 1CUCA 4F7DA 1G2PA 1SKUA 3DR3A 1WEKA 2ZWVA 3AZQA 1QHHB 1E89A 5FX2A 3OZFA 3FSRA 3OCCA 1H4QA 2CE2X 1LFAA 1J1ZA 1RS0A 1FUKA 5BWMA 4BNGA 2VSYA 2HREA 1WV0A 1EA7A 1WB4A 3H5OA 3C4VA 4MMXB 4RWZA 1L5LA 1T6XA 3V9AA 1XP5A 5EHQA 4OGGA 4QBHA 4QVIA 4R68A 4M53A 2IYNA 4DPMA 4JI3B 4CG0A 2BFDA 4RA9B 3H2IA 3U44B 1WEHA 2ZJ1A 4K6FA 1IK4A 4O59O 3KKLA 4YALA 5FB3A 2IWHA 5IVPA 1WW2A 1N1GA 2PMKA 3TK1A 4OJKA 3VR2A 5EWLB 5K51A 1KBZA 4YUAA 1UOOA 4Y7CA 3HUEA 3C2QA 5LMCA 2OGSA 2XMSA 3RYFA 2Y76A 3U7QA 3CLRD 1Y1TA 2Q5FA 4EW2A 5DNCA 3ZCUA 5IHPA 4LC0A 3IT0A 2ZWMA 1H69A 3ZG6A 4B79A 2JATA 2ENUA 4F5DA 4P4SA 3MCWA 4WXHA 3P27A 1BVYF 2HHHB 1R66A 3TLZA 4EG0A 3IP9A 2F3UA 5CLJA 1IWBB 2Q0QA 2XE8A 1G291 2QDXA 1VKJA 1GXSB 2XXAB 3V8PA 3DDOA 4NV0A 2AZXA 2FDRA 5JDCC 3V4ZA 4IHJB 1E98A 2OHXA 1WDMA 2ZW9A 1YCHA 4RA6A 6CHYA 1Q0HA 4Q7LA 1SVIA 2WWXA 4O3FA 3DQQA 3GGDA 1A97A 1E9BA 4HB2A 2Q50A 5E4FA 5C5EA 2XKKA 4TKLA 1N2HA 1J8YF 2VJMA 3R3HA 4G5GA 2ERXA 3L1IA 4LZZA 2ZRFA 2AZTA 2G17A 4RE6A 1VECA 3NCHA 4XD7A 1CJUC 2EKQA 3TZBA 1WPQA 5CDUA 1AF4A 4CQMD 4BE7B 5CFRA 2W48A 3SM3A 5CB4F 5BW4A 2PDAA 1QR2A 3GGCA 3NIWA 2QHXA 1MAWA 4BOYA 2XUZA 1J0DA 4Y6QA 2P0EA 3KU4A 4Q16A 2C0QA 3NP9A 3ZE7A 4DWOA 3B9QA 4JJFA 1EE9A 2VDRB 3KEGA 4M1TA 5ER6A 4GZ3A 1TFRA 2QX7A 1D0SA 1O6CA 4G65A 5IAAA 3D7SA 4P32A 1L9XA 4B71A 1WPXA 1KMNA 3Q8LA 2HMTA 4PZUA 4JIGA 1U81A 1W1UA 2ODPA 1T5DX 1P4GA 2NTEA 1OXUA 1X74A 3AJ9A 4RETA 4DSOA 3OTIA 4W5RA 3F78A 4B3IA 1NUTA 3IALA 2GM3A 2IE8A 3IERA 3MGBA 1C4XA 5JZBA 2P65A 3WL8A 4FYHA 4BO6A 3D3QA 3C43A 3UHFA 1L1EA 3OICA 5DT2A 2XGJA 1X7XA 1L5ZA 3G49A 4Y6GB 1S8OA 2BKEA 3BWMA 2FJPA 5HFNA 3U4AA 4CRWB 4A2QA 1DIOB 1JJFA 1PKEA 3OQ6A 1JA1A 4NDNE 4I9FA 5DBGA 4E03A 1H1LA 4PBTA 1XXHA 3CLUC 3EIEA 3QXSA 3WYBA 2ZGVA 1YD7A 4G6ZA 1OFGA 4XYEA 1KHTA 1LVHA 5H70A 2JARA 3HCOA 3CWZA 1GGVA 4K0RA 1K6IA 2O05A 3V8VA 4DT1B 2ZS8A 4ERNA 1Y6QA 3L7DA 4EA6A 4P08A 4R4JA 3IT3A 4ZI7F 4I7EA 4N0PA 4W7HA 2Q9CA 1F5SA 3ICWA 4BLPA 2UAGA 3SLGA 2H06A 2OD7A 4FLFA 1Z2AA 2V03A 4Q47A 2WWVD 2RIRA 1ZH2A 3C6XA 1WXHA 2TECE 4BWYA 4BL5A 1XLUA 3B36A 1G55A 2CXRA 4UNQA 2F3RA 1A8PA 1I6KA 16PKA 4IX9A 5BW8A 5AVXA 5KPJA 2XOXA 2GNAA 2A9PA