1WLYA

Crystal structure of 2-haloacrylate reductase
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
332
structure length
322
Chain Sequence
VMAAVIHKKGGPDNFVWEEVKVGSPGPGQVRLRNTAIGVNFLDTYHRAPPIVVGFEAAAVVEEVGPGVTDFTVGERVCTCLPPLGAYSQERLYPAEKLIKVPKDLDLDDVHLAGLMLKGMTAQYLLHQTHKVKPGDYVLIHAAAGGMGHIMVPWARHLGATVIGTVSTEEKAETARKLGCHHTINYSTQDFAEVVREITGGKGVDVVYDSIGKDTLQKSLDCLRPRGMCAAYGHASGVADPIRVVEDLGVRGSLFITRPALWHYMSNRSEIDEGSKCLFDAVKAGVLHSSVAKTFPLREAAAAHKYMGGRQTIGSIVLLPQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 2-Haloacrylate Reductase
rcsb
source organism Burkholderia sp. ws
molecule tags Oxidoreductase
molecule keywords 2-haloacrylate reductase
total genus 111
structure length 322
sequence length 332
ec nomenclature ec 1.3.1.103: 2-haloacrylate reductase.
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1wlyA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1wlyA01
1XR3A 3P19A 1IPFA 3HQ4O 2HJSA 2X86A 4CM9A 5BSFA 3RBZA 5A9SA 3JQGB 3DBRB 3ETDA 1BXGB 3BIOA 3KYDB 3LF1A 3VDRA 2X9GA 3QRWA 3L6OO 5DDIP 4TRMA 1PQUA 1NAHA 3QWIA 1ZMOA 3VTZA 3H4VA 2O3JA 1NQ5A 4GAEA 3VPHA 4CR7A 2O4UX 3FTNA 4ZJUA 4CM7A 2X0NA 4QEDA 4J1QA 4R41A 1PJLA 1YJ8A 5TS3A 5ITVA 4ID9A 2EW2A 1C1XA 4R9RA 3BMCB 1WDKA 1N7GA 3NTQA 2CDBA 4MINA 3WGZA 1XU9A 1KOLA 3DMTC 4RF2A 2X58A 2VZ9A 2EG9A 4BKQA 1R16A 1V3UA 4NFSA 4YJDA 1VLLA 5JAIA 2C0CA 4GSKA 4CLRB 5JYEA 3CXRA 4PZCA 2UUOA 4R1NA 4GKVA 3FHLA 1DFIA 1KEUA 2D8AA 4MKZA 2AEMA 3IL2A 3GZNA 3H9GA 1B2LA 2UV8A 1WMBA 1I8TA 1EUZA 4JIGA 4RPKA 4A2CA 1FDSA 1HDGO 1D8AA 1LRLA 1PU2A 1V6AA 1E7QA 2HK7A 2Y67A 3PVZA 4W7HA 4A0SA 3IIEA 8LDHA 2I5PO 3RAJA 2GGSA 4MKRA 4ZQEA 3RQSA 3B6ZA 2HRBA 2YYYA 1MXFA 1BVUA 1EMDA 2P4QA 3W4JA 3L6EA 3FD8A 3IQDB 1DC6A 3RFTA 3E5MA 2NTNA 1O89A 3MJSA 1UXJA 1Z6ZA 1F8GA 2W98A 4R1SA 2Q46A 4IS2A 3GVIA 3ZWWA 2R6JA 5IDQA 4H7PA 4EW6A 3HZZA 1Q0LA 2CFCA 5JPIA 4R5MA 4JP3A 3ANLA 3IP1A 3VHRA 1ZKMA 2AQIA 1MG0A 4OJNA 2GSDA 5DT9A 4CL8A 1VSUA 4NBUA 5IXSA 2C7VA 4R1TA 3JQ9C 2HLPA 3GVXA 3V1TC 1GV0A 3PGXA 3OBBA 2WYWA 3ZHXA 3U4DA 3H9UA 1Q7GA 1SAYA 3C1AA 1RWBA 4IJUA 4I08A 1N92A 4RL6A 2RH8A 5I9NA 4W7IA 4L0QA 1R66A 4HY3A 3DFZA 3IAHA 2FR0A 1GQYA 4HXYA 5ICMA 5JLAA 1LA2A 4D7AA 2WSBA 1I3NA 2Y1FA 1TEHA 4J6FA 3AU9A 3TZ6A 3ADPA 5G4LA 4IQ0A 4C7KA 3UGKA 3B1FA 4PLZA 3ZNNA 4R1UA 3IMFA 1U3TA 3DTTA 2HK9A 1KY4A 1PJ3A 3JQBC 2YW9A 1LTHR 1XQ1A 5TNXA 4CPDA 4XA8A 4YPOA 1SB9A 1OC4A 3HSKA 3BMOB 3SEFA 3P2YA 4U6SA 2CY0A 1UDCA 3TDKA 3HUDA 4XQGA 1DHRA 3BTVA 5F1KA 6LDHA 2DTDA 1DBVO 3ZGYA 4UUOA 5IDYA 1R4MB 4IMRA 3AOEA 2VQ3A 1TT5B 1ULUA 2GZ1A 3O03A 3QY9A 4HBGA 4PLCA 4TRJA 1QLJA 4ZRMA 3WQRA 5L4LA 2Q99A 2BI7A 1MFPA 3QE3A 1ENZA 1YL7A 1QSGA 1E1MA 1XU7A 1YB1A 5HM8A 4XR4A 1GFSA 1TVEA 4JNKA 4Q3BA 3KRTA 1NXQA 1ZUD1 4GPD1 5A4DA 5I7FA 4O63O 1ZFNA 2CVQA 5C5IA 4S1VA 1BG6A 6ADHA 1E3WB 3MJCA 4L4RA 1A5ZA 2VUTA 4KOAA 1ID1A 3OH8A 5T8KA 1OI7A 1CQJA 4ROSA 1K2WA 1XIVA 3BMQB 3VH3A 4FOSA 3KZVA 2WMDA 5F3RA 5JDCA 4NDNE 2Y99A 2PKRA 2D2IA 1ZK0A 4UEKA 4YWJA 3VTFA 5K6AC 1Z75A 2P4HX 1GCOA 1NYTA 4CQLA 1C1DA 1LNQA 4E2XA 3GA0A 4PG5A 5THQA 1WXDA 1PL7A 3H8VA 2NQTA 4ZD6A 4L4SA 1WLYA 3D5TA 3NT5A 1V8BA 4W4TA 4BQPA 5DP1A 3QIVA 2HKIA 2QZZA 4KQXA 1IE3A 3EYWA 3R3SA 1U5CA 4YAEA 3WBBA 1XYGA 2HUNA 2QQ5A 3UAGA 3WJ7A 4M89A 2B4QA 1F0YA 4A27A 3O8QA 4N7RA 4WUVA 3ZW9A 1ZIDA 2LDBA 2CMDA 3QJ5A 3C3XA 4JX8A 3LT0A 3FF4A 4JLWA 3I9MA 1KVUA 5KJ6A 4MP8A 5A05A 3L77A 4ESOA 1DXYA 3HB5X 4L4XA 3TZKA 3JQCA 3LC2O 4FPXA 4B4VA 5B1YA 3TQHA 1J6UA 1DRVA 4FBGA 4RQTA 1NASA 5KKAA 3ZZNA 4YT8A 2IZZA 3Q9UA 5TT0A 4P4GA 1I3LA 4YEDA 5JXWA 3ZHZA 2EERA 3GDFA 3ICPA 1NNUA 3KETA 1X0XA 1NX6A 1WMAA 3K2EA 5TSDA 3AUUA 3AY7A 3AUTA 4LGVA 3G3EA 1HE5A 4GI2A 1VJ1A 5K9ZA 3IOYA 1JAXA 4IQGA 1AHIA 2O3UA 1IZ0A 4D79A 1B16A 2TMGA 3G49A 1F06A 3VZPA 4ILKA 1EK5A 4JBHA 4CMKA 1IHYA 5EJ2A 1NWCA 4DMMA 1JVSA 1VC2A 2POQX 3P2OA 2VUUA 5B4UA 1PIWA 4Q3DA 4E2WA 4PLWA 3DHEA 1Y7TA 2DBZA 2G82A 2Q49A 3NT2A 3SLGA 3ZWPA 3GHHA 4CODB 1QORA 1WP4A 5I8ZA 3M1AA 4WASA 3PP8A 5IZCC 1QR6A 5JBIA 2QW8A 2C59A 1GZ3A 1LXCA 1P1RA 3U49A 4CM8A 4RLHA 4W9NC 1NR1A 2Q1UA 5CEJA 4QFDA 4CM3A 4F6LA 3IKVA 1PEDA 2OP0A 3OJLA 1C14A 4DYDA 2ZKLA 4DPLA 1Z74A 2NVUB 2PD3A 2AG8A 1ISGA 4OQZA 2ZATA 4YAKA 1A27A 3PXXA 5ITWA 1PTJA 2HMTA 4ZHSA 2GZ3A 2X5KO 2C5EA 2DPGA 4M87A 1EEHA 1N5DA 3WIEA 1GUFA 4EEXA 3D5QA 3K6JA 2GPTA 2PLAA 4OKIA 4BKRA 4DBVO 4R4JA 4OXYA 4UUMA 1J4AA 4XWYA 2B69A 2VWPA 2W2KA 3JQBA 4YJGA 3EVNA 4QX6A 2J5QA 2C2YA 4R5HA 4RQUA 3NV9A 1PWZA 1NFQA 2CNBA 1VE9A 4CMIB 3W6ZA 4A26A 4DIFA 2QYTA 2WWRA 2PR2A 3RKUA 3Q0EA 1NWHA 3GFBA 3KEOA 4BNXA 3JTMA 3GNQA 3S2IA 2ZTLA 4OSPA 5BT9A 4QTZA 2OUIA 2PH3A 4IS3A 1PL6A 2GYYA 1N1GA 2I9PA 2B4TO 2Y66A 1PS0A 3FI9A 4FJ2A 4J2OA 2FWMX 2X5OA 2G0TA 3KEQA 3OETA 4FFPA 2H63A 5T57A 3RUHA 2X8LA 4XX0A 2H6EA 1PGQA 2JFFA 4C4OA 4WNIA 1U3VA 5G2OA 1IYZA 1YBAA 1U28A 4CMJA 1M76A 3FPCA 3DZJA 1TA4A 3KO8A 3KYCB 3OEWA 2E49A 1CERA 3HFSA 4D3FA 4O0LA 3MTJA 3OSUA 1C3VA 4KDFA 4YRDA 1AE1A 1QLHA 4RZIA 4Z9FA 3F1KA 3VVCA 5I7SA 2DT5A 9LDTA 2Z95A 1C1DB 2JJYA 3MZ0A 1NPTO 1KBZA 4BO2A 4DQUA 3OHSX 1E5LA 3DZKA 4HFMA 4IDGA 1D7OA 1DAOA 4LSWA 5ER9A 3GOHA 4DWVA 5H83A 4Z3DA 3X2FA 2IXBA 1G0OA 4FD3A 5F5NA 3A06A 2VCYA 3EAGA 1BXZA 2NTVA 3GMDA 4XQCA 1GTMA 3JQ9A 3W8DA 3E9QA 5CHEA 2DFVA 2Y0EA 1QYDA 1T2FA 2GUGA 3WDSA 4AJKA 3TWOA 3AU8A 4NNJA 4CMEA 3DMYA 1BXGA 1O8CA 3AFNA 2JCYA 1PZHA 1U9JA 3W6UA 1ADCA 2WEKA 3L4BA 2P9CA 1SMKA 4NU6A 4IMPA 2VRBA 3ANMA 2W90A 2YZ7A 4YAJA 2LDXA 3ASVA 2Y0DA 4HP8A 4WK6A 2O2YA 4F46A 1QRRA 3SJ7A 2FOIA 2O3QA 1VL8A 3PZRA 4BO1A 3ZWOA 3FSRA 4AL4A 2VWHA 5JY6A 1YGYA 5H81A 4PCVA 4PVDA 4UREA 2Q2VA 1B3RA 3LT1A 4LN1A 1LQTA 4BO6A 3RD5A 4BV8A 3EGOA 1UZLA 3I1JA 3BXXA 3T4XA 2I66A 3JQAA 1KERA 4B4OA 5T67A 3H7AA 1FDUA 1LU9A 4J2HA 5CDUA 5KVVA 3JYNA 4M86A 4FW8A 4GKBA 3VZQA 1YVEI 1M75A 3DZHA 5DBFA 4ND4A 1O95A 3DDNA 1KC1A 3HDHA 1X7GA 2O7QA 3FWNA 3JYLA 4IINA 1CEQA 1K6IA 2Y1EA 3EHEA 4BNJA 3DQPA 1LJ8A 4QFCA 4DIOA 2X0JA 1UP7A 3QV1A 2NU7A 5U4QA 4R01A 2QZ9A 4BB5A 3ZW8A 1FJHA 2E4AA 2WM3A 1JKJA 2HU2A 2ZQYA 1HZZA 3RC1A 3ZWNA 1ZEJA 1SB8A 2NU9A 2NACA 4J4TA 3KV3O 2OBNA 3GGGA 2JCXA 5TQVA 2JFGA 3QWAA 1WAMA 3DONA 1F17A 4Q9NA 5DCYA 2DBVO 4LW8A 2EW8A 1R6DA 3UN1A 3TF5A 4FC7A 2EGGA 2ZTMA 3ICCA 2I76A 1NBOA 1XQ6A 3Q11A 2YFHA 1UDAA 5ENVA 4BKUA 2B4RO 1PS8A 5A3VA 1EUDA 5TT1A 3JQAD 1X1EA 3ON5A 4JP2A 4M8SA 3H9QA 3RCBA 2D5CA 2Q3EA 1H6CA 3W8EA 3CH6A 3WTCA 4BO4A 5ICSA 2HMWA 2UDPA 1DIHA 2VT2A 5BSEA 3BAZA 3JYOA 1EE9A 3U5TA 4KTTE 1C0LA 5FFFA 4GH5A 1HE2A 3PJDA 4K6FA 5A02A 3A4VA 1D1TA 1IL0A 3DBLB 3OICA 4GBJA 2ZYDA 4RVSA 4NK4A 3DOJA 3RROA 5C7LO 3ENKA 4R68A 5JCJA 4PG8A 1E7SA 1WWKA 2DBQA 4YJFA 1F8FA 1YBVA 3DZFA 1LLCA 4EEZA 1Z73A 1LUAA 5IDWA 2NLOA 4XGIA 4CQMA 1ZO8A 3T7EA 1DFHA 3QVTA 1XEAA 3QP9A 2RIRA 2R00A 1SPXA 1DRWA 1RM5A 4YJHB 1X14A 4N5MA 1JKIA 4IDBA 2Z1NA 3QA9A 3ZV6A 4Z6KA 3CMMA 4HFRA 1ZZEA 4FR5A 3W4KA 2GN9A 5AXBA 1RM3A 2D3TA 2OORA 3LU1A 3C1TA 3PYXA 3H5AA 1ZNQO 4JN6B 1M67A 2BFAA 4R3WA 3DFUA 1I3MA 3GPDG 2P91A 3HFGA 5G4KB 3EMKA 4WCFB 1PZGA 1YB4A 2PZKA 3ZNQA 3GEDA 4MO2A 4AG3A 4JXKA 4Y8VA 3PHGA 4ZN6A 3K96A 4TKLA 3HG7A 4MP6A 1QYWA 3BHIA 1U7TA 3HE3A 4CJXA 1PJSA 3AUAA 1XCBA 4DVJA 4MVJF 2FP4A 2PA3A 4PFJA 4N5NA 4IDFA 3Q2KA 4F45A 5CPBA 3ZI0A 2QRLA 4DIBA 1NHWA 4RVGA 4GMGA 5F1PA 5IN5A 2I65A 2FHSA 1P1JA 4I5GA 1I36A 4YJGB 3I83A 4MVJI 4YJFB 2FSVA 2FR1A 2NQ8A 2J3JA 3BTOA 3EC7A 2NTJA 4JQCA 2X7HA 4LMRA 3E48A 4IJVA 3BZUA 2ZQZA 3KYDA 3C1OA 3GH3A 3QWBA 1E7WA 5AXCA 5KJCA 3MOIA 2OMEA 1H2HA 4BS9A 2H5LA 4B7CA 1DIBA 5L7TA 2H1SA 1T2CA 1V9LA 3GRPA 3L9WA 1SNYA 4Z0PA 5TJHA 3CINA 5L7YA 4GX2A 3E8XA 4Z9YA 1G0NA 2RCYA 3JQDA 1E1KA 3GFGA 1AN9A 2YJZA 5GZ3A 4PLFA 1DIGA 3ORFA 4HX5A 5A1TA 3LDHA 1MP0A 5FYDA 3L4SO 5BNIA 1K6JA 1K6XA 1CQIA 2ZB8A 4PG6A 1HTBA 3BMNA 3D4OA 2ZYGA 2VHYA 4OKNA 3SC6A 1H2BA 2AMFA 4AICA 4DUPA 5JY1A 3GUCA 2SCUA 3DBLA 5JS6A 3O26A 2FZWA 4Y6SA 4BB6A 4NU5A 2DBRA 4A03A 4RJTA 2WDZA 1I32A 3WGGA 5FWNA 2J5KA 4BIIA 4YB8A 4ZQFA 4L75A 3ROMA 1BHSA 3I3OA 5L9AA 4CM4B 2BGKA 2FMUA 1IY8A 2PKQP 2NVBA 4KP7A 1JU9A 2EP5A 1F12A 2GERA 5HS4A 2CVOA 4WEQA 3ZCXA 1PJTA 3RC2A 2TMDA 3RUDA 7ADHA 2FSSA 3PQFA 4XDYA 4BO5A 3FPLA 1R0LA 2V6MA 1CF2O 3KVOA 3JYPA 4BNYA 1Q7BA 1UXGA 1Z7BA 3EY4A 4FCCA 3HN7A 4XIJA 4BO0A 2O48X 4JK3A 4XB1A 2DFDA 1E7MA 4WJZA 2CSUA 1BTOA 1YWGO 1YL5A 4PLTA 2F1KA 4YAIA 1QXSA 1RYDA 3CKYA 1JKFA 2UUPA 5HTOA 1HZJA 4OL9A 2EF1A 1M2WA 2EJVA 2X0RA 5CDSA 5U1PA 1GUYA 1Y6JA 2NUAA 2CF6A 1CIVA 4XIYA 4CMHA 3LC7O 2G1UA 4XJTA 3DBHB 3E03A 4DQVA 1D4FA 3RFXA 3R6DA 4P8RA 1XGKA 1JTVA 4BNWA 1H93A 1MA0A 3MWDB 1I2CA 2DM6A 1R4MA 1ZEMA 3KLPX 1U2GA 1Y81A 3GEMA 3UVEA 5JCJD 2A9FA 2BMAA 2VRCD 5A5FA 3WYCA 3BMQA 3A28A 3FR8A 3G1UA 1VJTA 4MVJH 5IJZA 2D0IA 2FN7A 5DULA 1K5HA 5IXYA 2B37A 5KJ1A 3SVTA 4BOYA 4M49A 2DUWA 1VKOA 4PZDA 3PJGA 4CQMB 1U2DA 3B70A 3NDJA 2UAGA 1E0DA 4Y98A 3WFJA 1GV1A 2ZYAA 1V0JA 2DAPA 1MLDA 2HMSA 1IB6A 4XGNA 3JD2A 3OQ1A 1AUPA 5CAEA 5I7VA 2Q45A 3HADA 2BH9A 3W8FA 1RJWA 1ZBQA 3V8BA 2X9NA 3OA0A 1JLLA 1UJMA 5CPFA 1X0VA 5L45A 3U3XA 4BNZA 5DP2A 4QO7A 1YQGA 3D4PA 4CQMD 1T2EA 1EBUA 1T4BA 2UVDA 1B8PA 4OOEA 5IAAA 4LSMA 2PFGA 1Y5MA 1E3SA 3KHUA 1L7DA 4BNNA 3VH4A 1GUZA 4ALKA 4QECA 2YHIB 4IIVA 5F1OA 2Q2WA 3U62A 2HDHA 2O4CA 4H15A 1OAAA 4EITA 4BNKA 1U1IA 1J5PA 2HCTA 4FFNA 1JN0A 2IODA 3HWRA 3A1NA 1ISFA 4YVFA 3GMSA 3D7LA 3S2GA 2X5JO 4JBIA 3NTOA 3PYMA 3S55A 3PZBA 4AJ4A 4J43A 3KOUA 2AG5A 5IFLA 3NDIA 4B7UA 2C54A 1I01A 2VZ0A 4DREA 2OXIA 4DLAA 3DAGA 1B3BA 2NU6A 3MEQA 2QHXA 2EEZA 1IPEA 4LRTB 1I10A 2B0JA 3MWEB 2ZB4A 4A7PA 3OM9A 2GRAA 1NVGA 4BNGA 5C7IO 3ZWCA 2A92A 3GZNB 3UXYA 2O7SA 5ILGA 2DUUA 4E5YA 4RF3A 5JSFA 5LDHA 4IDEA 4NIMA 3W1VA 4DRYA 3U0BA 3EVTA 3M1LA 4FB5A 1T24A 1VSVA 3EK2A 2J8ZA 1DC5A 5KVCA 1HKUA 3ENNA 4FSHA 2CF5A 2AE1A 1YS4A 2O3SA 5HRUA 1T4DA 4IUYA 2H9IA 2I6TA 1I5RA 5JFOA 2VYND 4RPGA 1GEGA 4YAGA 1EFKA 4K26A 3ST7A 4OHUA 5ENDA 4HFJA 4MVJG 1HDYA 2V6FA 5DCWA 3RC7A 2HSDA 4O59O 4PLYA 2X6TA 1YBMA 3B20A 3CZRA 4FFLA 4JGBA 5DN9A 3U4HA 1KC3A 2E48A 5JO9A 4XDZA 1ZSYA 4BNUA 3D4NA 3V2GA 1GPJA 3DHNA 3OIGA 2PKQO 4RPLA 5EL0A 1BWSA 1B0AA 2FY8A 3VH1A 4CUKA 3N7UA 3NUGA 4UULA 4EUFA 4CLRA 4BGIA 4BNIA 1NVMB 2CDAA 1T2AA 1NM5A 3PDJA 1LRJA 3JV7A 2FPIA 4H16A 1DIRA 2Q1TA 1DAPA 5A9RA 1MC4A 3GAFA 1LDGA 4E21A 1H5QA 3V1UA 4NBVA 3FWZA 3HN2A 1ISJA 4R69A 4RPHA 1A7KA 2JKVA 4PG4A 1U4OA 1QV7A 4DLLA 3HDYA 1ISIA 3DZIA 4O1MA 3E9NA 2BELA 2NV6A 1MGOA 3WGQA 4BO7A 3RFVA 3ETEA 4J1TA 1D3AA 2GZ2A 3GN2A 3K73O 3OEYA 1O5IA 3UF0A 1P0CA 4BV9A 1UAYA 1GYRA 1JVBA 5THKA 1E3EA 1HRDA 4WCFC 4TQGA 2PGDA 1QP8A 2EJWA 3AOGA 5JC1A 4CM6A 5C37A 4ALNA 1DLJA 3JQEA 4B7XA 5FF9A 3VPFA 2RHRA 3MJVA 4YYZA 4IM7A 1Y8QA 1X13A 1YRLA 2CD9A 2EKQA 2E37A 4IDCA 3VKUA 1A72A 3NJ8A 4XYMA 2CUKA 3GLQA 3QHAA 1FMCA 4PLPA 2NVUA 4ONEA 4I5FA 4RGBA 4XZ3A 1A4IA 4F6CA 4BGUA 2VHWA 4CUZA 2GDZA 1U8XX 2P9GA 1GDHA 2WJPA 1DEHA 3DZGA 3IJRA 3MCVA 4J7XA 4P4NA 4XCVA 4AJ2A 5U9CA 1AXEA 2XAAA 4Y67A 2VYVA 1LC3A 1PL8A 2I3GA 3ZU2A 3RIHA 1V3TA 2NSDA 3AUSA 3NDRA 4B3IA 5CDTA 3U09A 3WGIA 3RKRA 4J0FA 4ITUA 2EKPA 1KY5A 2ZB7A 4HFNA 3PIDA 2X1HA 3PRJA 5JNLA 5AQ1A 1WZIA 1YDWA 4NFYA 1E3LA 3WICA 2VTDA 1TLTA 2V6BA 1HE4A 2JHGA 1A71A 5I7EA 1V3VA 4E13A 4AJJA 2VHXA 2A35A 4ZA2A 4GWKA 1P45A 4YRAA 2AHRA 1EBFA 1N7HA 1X15A 4D41A 4AVYA 2Y1GA 3PFFA 3WG9A 1E5QA 1C0KA 4K9DA 4KUHA 1HYEA 2V7PA 3NAQA 3ZV4A 5JE8A 4FN4A 5G0TA 4CV0A 3GVPA 4CQLB 1PGNA 3C8MA 3DBRA 5EINA 3ZWAA 4B4WA 3U4CA 5AVOA 3E9MA 4BUCA 5K6AA 1ZSNA 4HWKA 4OH1A 3DHYA 1LLUA 1E1LA 1E7RA 2GO1A 4I1IA 3BA1A 1V35A 3AK4A 1YJQA 4R51A 1DJQA 4M55A 4FFOA 3V2UA 4NPCA 1ORRA 4MVJD 4Y9DA 2E82A 3N58A 2VOEA 3AOEC 3PYLA 4JCOA 5CDGA 1HDRA 2BGMA 2VNAA 5BNTA 3ASUA 1A9ZA 3FTPA 1A4UA 3DOCA 4WLVA 4CV1A 1HDXA 1XA0A 1Y8RA 2NU8A 3CUKA 4YQYA 1NQAO 4C7JA 3L4BC 1P44A 3MJ4A 3PK0A 4L8VA 3INGA 5TLSA 3STHA 5A04A 2Q4BA 3JQFC 1NQTA 1HYGA 3DB2A 3EW7A 3PWZA 3ZV3A 1SBYA 4UVDA 2OP1A 2BFOA 4IXWA 5A5EA 4IXTA 5GMOA 4WECA 2ZCUA 3JQAB 3RBVA 2C29D 2I67A 3GVHA 4Z0HO 2C07A 3E82A 3F5QA 3H5NA 2X0IA 1ZXLA 3NJ4A 3RI3A 4ND3A 3GNSA 1W73A 1GADO 1MB4A 4MJLA 3Q2IA 2IRWA 1ONOA 2Q50A 3M6IA 3M2PA 3W4IA 3WMWA 4BQRA 1JA9A 4I5EA 4WOJA 4E12A 2FRDA 3GQVA 3ROQA 4D3DA 3QVXA 3PJFA 3D3EA 1X7DA 2EV9A 5JC8A 5KJFA 3QW2A 1NAIA 2GN6A 1DC3A 3ZU3A 3KBOA 2DQ4A 3RUCA 1EVIA 5MDHA 2RAFA 3GC6A 4GGPA 2G5CA 5BNFA 3I52A 4J91A 3VPSA 1P0FA 3F5SA 3JQFA 3ZWMA 5DZSA 1P1FA 1RPNA 3F47A 3G79A 4XQEA 4YA6A 4E30A 2YHUA 3QQPA 1H0KA 1HWYA 4Z0TA 4XRGA 4AJHA 3BYZA 1I3KA 3IS3A 4XYEA 4E32A 4OXKA 3I9OA 3LT2A 1AHHA 1NTOA 4ND2A 4ALLA 1DPGA 2W4QA 2GCGA 3QWHA 2PZMA 1YOVA 1MX3A 4FGSA 4E3ZA 2BI8A 4A73A 1OZAA 1I24A 1TXGA 1FDVA 4O6VA 1LC0A 4FC6A 1Y8QB 1W0CA 4YCAA 2AQHA 1F14A 1YO6A 3H2SA 4IGFA 2PH5A 1A9YA 3LK7A 4GL4A 1P74A 4CL3A 4E5NA 1PJBA 2GN4A 3F4BA 3SLKA 1YQXA 5EQDA 4P22A 5A03A 4DL9A 4WLOA 1BMDA 3LLVA 4KDEA 1H6AA 3PHHA 4I9NA 2CVZA 3OMLA 5FI5A 3F1LA 2VZ8A 1QG6A 2Y1DA 1NQOA 3Q1LA 2ZTUA 4NJOA 1KVTA 1U8FO 3MOGA 1U3WA 4NR0A 3TL2A 1B7GO 3CE6A 4J7CA 3U9LA 1LDYA 1J49A 1IHXA 1PGPA 3PIIA 4FGWA 5G0VA 1RYEA 3WLFA 5C3MA 2IXAA 4OQYA 1KEWA 4BGVA 4HNHA 1DHTA 5EMHA 5K0ZA 3ITDA 4KQWA 4PIVA 3KSZO 1K89A 3I4CA 2PTGA 3OECA 1H6DA 3PLRA 3KLMX 4KZPA 3SXPA 3UCXA 4NH4A 1BSVA 4IJWA 3IC5A 1A7AA 4Y6RA 2O50A 4ALIA 2W8ZA 1MG5A 3FNEA 4TVBA 1Y9AA 3NGXA 4MIEA 4OSOA 2OHXA 4N54A 3ZDFA 3R3JA 4LVCA 4NZ9A 1UAGA 4GVLA 5KVQA 3WQQA 1W4ZA 1B26A 4A10A 1LLDA 4TKMA 2PGLA 2IZ0A 1C0PA 3NX4A 5EIOA 5L4NA 1MUUA 3KSUA 4DA9A 2FPPA 5KTKA 5GZ1A 3RUEA 5CFZA 3PPIA 1DJNA 4IDDA 2VYVD 4J0EA 1QMGA 4XB2A 1LQUA 2AEFA 3GUYA 1Z7EA 3PWKA 4UVEA 5EERA 4J3FA 1CDOA 3TOXA 3WGHA 5BQFA 4FDAA 2VOJA 3JQ7B 5TJ9A 1ADGA 3I23A 4GX5A 4WCDA 9LDBA 1Y8RB 1WVGA 5DBGA 2VT3A 4UUPA 4WLEA 1ENOA 2PWZA 4IDAA 1TB4A 1R0SA 4Q3EA 4WKGA 5G4KA 5IZ4A 1E6WA 1P1KA 3O8QB 1QYXA 1FDWA 1BW9A 1XELA 3JD3A 1FK8A 3LLSA 4BL5A 4DXHA 3PTZA 4GGOA 3WYBA 2PY6A 1T25A 4HKTA 1R4NB 1TT5A 2CZCA 2IE0A 4D44A 1VKNA 5L95A 3VH2A 5ILOA 4S3MA 3GG2A 4J4HA 5IN4A 3G17A 2AA3A 2Q1SA 4M54A 4J1SA 3LQFA 5T8KC 1VPDA 4BNTA 1T2DA 2AW5A 4IJKA 3DTYA 3JD1A 4AJ1A 4Q3AA 4Z3KA 2BHLA 1PJ4A 4IBOA 4CUJA 4K1LA 3WSVA 3NRCA 1K0UA 1PWXA 2PV7A 1DC4A 1KETA 2Y68A 4ZRNA 4EDFA 1ZMTA 2HRZA 4D3SA 1ENPA 1WDMA 2DTXA 3H65A 2EHDA 4BNHA 5IZCA 2RBEA 2GASA 1K3TA 3PLNA 4I9HA 3WBFA 2YDXA 1ZK2A 1Q1NA 2YV3A 1JW9B 1KVSA 1UZMA 1BRMA 2DVMA 3TRIA 3RUFA 1ZW1A 2HK8A 1NFFA 2YUTA 5KOIA 1ISHA 4HNGA 1HLDA 1PQWA 4BNMA 3WJAA 4CMEC 4Q3NA 3WS7A 1VM6A 5CG2A 1C0IA 4P38A 1ENYA 1HF3A 4XRRA 2PNFA 3GR6A 3PQEA 1SC6A 1MV8A 2C7GA 5DF1A 2G17A 3ONFA 1DIAA 4QQRA 5GY7A 4JJIA 5FEUA 1CRWG 2YQ4A 3UUWA 2JD0A 1BXKA 1XDWA 3PWSA 4MOWA 4HV4A 5L3ZA 3G0OA 5B12A 2C20A 1ML3A 4II3A 3JYQA 3FBTA 3R0IA 5JDCC 2EGHA 4IPTA 1CWUA 4PRKA 3CSDA 1R12A 3NKLA 4E5KA 3JQ8A 3KYBA 1DRUA 3AM3A 4WLUA 4CR6A 1YQDA 1UXHA 1EK6A 1XSEA 3OP4A 4GQAA 4YJHA 3WGOA 1C1XB 5KVSA 4DPKA 1LLQA 3K92A 2WYUA 2BLLA 2ZB3A 3B1JA 4K28A 3UH1A 3V5NA 2BFPA 2E6UX 4KTVE 4GLLA 3K5PA 2RHCA 3SBOA 1EVZA 3R1IA 4NMHA 3VC7A 1H6BA 3AI2A 1RM4A 4BKPA 4D45A 3DOOA 2D4AA 1DLIA 1GPDG 2Y1OA 2DKNA 3PHIA 3S2FA 5L7WA 1VI2A 5BR7A 4N5LA 5B37A 2GNAA 2ZJ1A 4FJ1A 2X22A 4XYBA 1R15A 1SOVA 5F5LA 5JMPA 1DDOA 2R00C 4I5DA 3F4LA 1SEVA 3S1LA 5DCUA 4DQXA 1NP3A 4DPMA 2J3KA 4G65A 5HWSA 1WDLA 4TSKA 4YT2A 5B4TA 4XJSA 3I4FA 2RH4A 3EUWA 4J1NA 3ZU4A 5A06A 4ZQHA 3DXFA 4UVGA 3GHYA 3PI7A 4DTIA 4L76A 3L9XA 1SO8A 1PZEA 1BDBA 4J9UE 4U8GA 3UFXA 3V2HA 4ZICA 3PHJA 2EKLA 1QYCA 5L53A 3TZCA 2X4GA 3LT4A 4UUNA 3KXDA 2Z1MA 4FOOA 4URFA 8ADHA 3GY0A 3NYWA 5JYDA 3L6DA 5FI3A 2AQKA 4O5OA 3MJEA 3RVDA 2WTBA 4UEOA 3JQ7A 3TZHA 4TZTA 2Q2QA 2P5YA 4GLOA 1DB3A 1HSZA 1I2ZA 2VHVA 1P33A 4W99A 4QUKA 3ETGA 5A3JA 1N9GB 1GL3A 2YFQA 3A14A 3PDUA 4E33A 1IZ9A 3CIFA 2V65A 1MFZA 1N2SA 1D1SA 4NQZA 4BVAA 3DAPA 2VUSA 1GR0A 1GQQA 2X23A 3RJ5A 2IZ1A 2VWQA 4M1QA 3JQGA 2NM0A 4XR9A 1XG5A 5KNLA 3RWBA 1QKIA 4R54A 3EDMA 3PEFA 1LDBA 3RUIA 2WD7A 2OOSA 4NBTA 1HDCA 4I9UA 5COAA 4CLXA 2YQ5A 4L9RA 3RU7A 4JJGA 4YACA 3BTSA 4CM5A 1LEHA 1GYQA 5JAMA 4J7UA 5IF3A 3WR5A 3FN4A 4BO8A 2C2XA 3P5SA 5TX7A 5JMWA 4R3NA 2BD0A 4CM8B 4YR9A 1JQBA 1PSDA 4BKOA 3AI1A 1AGNA 4K6CA 1UXIA 3E6AA 1GD1O 3D3WA 4EYEA 2D1YA 3G1TA 5T64A 4G5HA 4E5MA 1UR5A 4E5PA 1E1NA 2G76A 2GF2A 3WX0A 3H3JA 2ET6A 3I9JA 2XPCA 4WEOA 1J0XO 1PQPA 4XEHA 2IDZA 5G0UA 4CV3A 4ALJA 2NNLD 2O2SA 4CMBA 1KYQA 2HMVA 2QX7A 4CMAA 3E1KA 4MVJP 1HETA 1XLTA 3VAZA 2Y93A 3GF4A 1UP6A 3NTRA 4GMFA 4CLEA 3I9KA 3AJRA 4E4YA 4EJ6A 5H82A 1PGOA 3ROPA 3S8MA 1E3IA 3I9LA 4D0SA 3INTA 5TRTA 2B5VA 4DMLA 3WNQA 1ULSA 3PQDA 1XWFA 3GZ4A 1EZ4A 2A94A 3H3FA 4J49A 3WIDA 2J3IA 3H6KA 1Q0QA 4GWGA 4OGWA 2BRUA 2BGLA 1GAEO 3DBHA 3RUAA 1EDOA 3BMNB 5JDIC 1FDTA 1B14A 3L0DA 3ITKA 1PZFA 3GK3A 2OZPA 2Y05A 1O9BA 1WW8A 3ONEA 3CMCO 3WGTA 3QVOA 4PLHA 3C7CB 3ZNPA 1PX0A 4OOFA 3U4IA 1UZNA 1O6ZA 2O3TA 3PFWO 3QLJA 1FXSA 4KMSA 3S2EA 2C5AA 1CJCA 4E0BA 1ARZA 3QSGA 3D3WB 3T4EA 4OAQA 3HDQA 1E92A 5ES3A 1H94A 1X1TA 4BMSA 1LDNA 1T1RA 2DU8A 4J4BA 4UAGA 4II2A 1EVJA 3INRA 1SZJG 1ZK3A 3WMXA 1LSSA 4AJEA 4Q39A 1H9BA 2JD2A 3GDOA 4G2NA 4B3JA 5I8WA 3ROKA 2W2KB 3GN1A 2AXQA 4YT5A 1GZ6A 1BGVA 3M2TA 1P9LA 4RVDA 1DO8A 4KWHA 2B83A 3UW3A 5K1SA 3WQSB 5JAZA 1HLPA 4BGEA 2VRCA 3GEGA 3RC9A 1P31A 4IIUA 4FFMA 3D1LA 4NBRA 3ZWVA 5L4SA 2BF7A 4CM4A 2J5RA 4B8WA 1LBEA 5BSHA 1TI7A 1M6HA 3TNLA 3TN7A 3E18A 4EJMA 2IEDA 5DNAA 4RVHA 1LSOA 1EE2A 1ZVMA 3FNHA 3C24A 4RVUA 2PD4A 3KB6A 1U5AA 3UCEA 2ZCVA 4N18A 4CMIA 4RF4A 4MKXA 4TZKA 3D0OA 4LVUA 3DEYX 3EZYA 3QWFA 5COBA 4BO9A 3IP3A 4P4LA 4U7WA 2B35A 2HMUA 2ZJ0A 4J9VA 4CLOA 3HJAA 5CEFA 4CLHA 3VZSA 5ADHA 1CETA 2J6IA 5JAQA 3LVFO 4CLOB 4FJ0A 3RJ9A 1LDEA 4IQ8A 4B3HA 4CM1A 4PN3A 4EUEA 3COSA 1NR7A 5A9SB 3CEAA 1HDZA 2GLXA 1R37A 4PGFA 1YOVB 4PG7A 3WOHA 2IYPA 4TWRA 4U6QA 4D43A 1VL0A 3HNPA 3OJOA 1B8VA 2Q1WA 2D5AA 2W2LA 5T6BA 1U3UA 2NVWA 5LCXA 2DLDA 1EVYA 2OGUA 5LC1A 3OQ6A 4MVJE 1IUKA 1IULA 3C7AA 1YKFA 1UP4A 2B5WA 3UKOA 3VPGA 3GAZA 1UDBA 1ZJYA 2XOXA 3KYCA 1EDZA 1GCUA 4D46A 1AXGA 5F21A 3ZWYA 3JQ6A 5TIIA 3SC4A 3WFIA 3AI3A 3RBXA 4D0RA 1Y9EA 2BFMA 1BW9B 2P2SA 1EUCA 2EWMA 4LCJA 4E2ZA 2EP7A 1N1EA 3PJEA 4W82A 4TROA 2P9EA 4OIMA 4BMNA 3V1YA 4UEJA 1L1FA 3BTUA 7MDHA 3ONDA 2WD7B 2IYOA 4RDIA 3DC2A 1VL6A 2QIOA 4MP3A 4TRRA 5CG1A 3LF2A 2IEBA 3ZNOA 5BSGA 4ZU3A 1GEEA 3FR7A 2GR9A 1CYDA 4QT0A 5AXDA 3ZWBA 1RM0A 4HUJA 4XD2A 2W2LD 1Z45A 1H9AA 2NADA 4MIYA 4WLFA 3OA2A 1QYVA 5I9MA 3I6IA 1FF9A 1OFGA 2HO5A 3E5RA 2DC1A 2VHZA 4R16A 4DC0A 4QSMA 4KUGA 4FIZA 1SEPA 3PHLA 5JCXA 4F3YA 3UICA 3AM5A 4CR8A 2UYYA 4H3VA 4TRNA 2O23A 1PR9A 3JCZA 3WYEA 4PRLA 4NBWA 4RCVA 4U5QA 3DR3A 3FNGA 4EZBA 1HDOA 2GN8A 1YONA 4PVCA 5EESA 4YXFA 2VNSA 2ZTVA 5L51A 1KIFA 4R9SA 3FBGA 4TMFA 3O38A 4KWIA 4NI5A 1Y1PA 2PK3A 4L73A 4PZEA 5KWEA 1XKQA 3SJUA 1RKXA 3K8ZA 1B8UA 3JQ8B 4PLVA 5IDXA 1GQ2A 4DLBA 5JDIA 4OYRA 3ZHYA 2VWGA 1T1SA 4INAA 3A9WA 3VPXA 1DSSG 4LCEA 1LDMA 1GYPA 1LRKA 3CPSA 3TSCA 4YBZA 4CLDA 1I33A 2AEJA 3ADOA 3Q6IA 4UVHA 2WD8A 2DPHA 1I30A 1N8KA 3AM4A 3K2BA 3P7MA 4TVOA 3GT0A 3IUPA 4BNVA 1Y5RA 5I9LA 1G1AA 2J3HA 1NFRA 4BO3A 4E6PA 4JJFA 2YV2A 1R0KA 3AFMA 3WB9A 1P3DA 1ISMA 3FRJA 1ZK1A 3PGJA 3NGLA 3FNFA 5AYVA 5J23A 3DO5A 3BHMA 2YHIA 1E77A 1W8DA 3LSYA 2HJRA 3L07A 1X7HA 3EZLA 4WE3A 3ANNA 1Q7CA 3FCOA 3GVCA 3UOGA 4Q3CA 4NJMB 5EPOA 1ZCJA 2JFHA 2R2GA 2JCVA 3IUSA 3ZU5A 1YH3A 4D42A 1MC5A 3Q9NA 4WLNA 3QVSA 2XF8A 2Q4EA 4QXMA 4AJIA 5JO0A 4E2YA 1P1IA 4E31A 2AE2A 3MJTA 3JD0A 4MVJA 3F9IA 2WE7A 1PJ2A 4GX0A 1E7YA 1E3JA 1OC2A 3K9QO 5TC4A 3WWYA 1TT7A 2FZEA 2A4KA 1S7CA 5HA5A 2ILTA 1M6WA 5KCZA 5G0SA 3VVBA 1L7EA 3ABIA 3GGOA 4ZVVA 1UXKA 3K31A 4DYVA 4RLSA 1XHLA 5EN4A 3H9JA 5HBRA 4G81A 1P77A 3TJRA 1YXMA 4DGSA 1N9GA 1UH5A 4UVIA 2AQ8A 3HB4X 4AJLA 2P68A 3NEPX 1O0SA 4BNLA 3LC1O 4WGGA 1EQ2A 1E6EA 1PGJA 1YL6A 3I5MA 1JWAB 2ZIZA 5CDYA 5MGBA 3KSDO 4NFHA 3GDGA 3AY3A 3TPCA 3IDSA 4XYLA 4J90A 1ONNA 5A9TA 3OJ0A 4XGKA 3RSHA 1HL3A 2D59A 4ND5A 4ZQGA 1JAYA 2I99A 4NJMA 2WE8A 4CM9D 3VZRA 3OIDA 4BNFA 3ZWXA 1GU7A 1PJQA 2GD1O 1T26A 1EFLA 1Q0HA 1NHGA 3GPIA 2EIHA 4XQ9A 3C85A 5DOVA 5DOZA 4IZHA 5AOVA 1BDMA 4L74A 4ZQBA 4CMGA 2WYVA 3AWDA 1LX6A 1ONPA 3F6YA 2FR8A 3GRKA 1KEPA 3KM0A 3WNVA 4FQ8A 4FS3A 2FPGA 4DBZA 5DBIA 1PS9A 1NPYA 1DOHA 1VJ0A 3TFOA 3NT4A 1G6KA 1W6UA 4W6ZA 1SCUA 3TFQA 2QRKA 5LDGA 5TF4A 2QG4A 2YY7A 4EI2A 4RORA 1E6UA 4IZIA 1KVQA 4X54A 2DTEA 4YT4A 5T5QA 4HADA 5KJEA 2V6GA 3LYLA 3DMTA 4RZHA 2BKAA 2JD1A 3H2ZA 3JD4A 4U0KA 3JSAA 5L40A 2PZLA 1KS9A 4LMPA 1MXHA 3ZV5A 3KUXA 3CTMA 4KUEA 1B15A 2I3AA 1I2BA 4RDHA 2PD6A 2HAEA 4MPDA 5KKCA 1LI4A 3DBVO 3F46A 4NK5A 4CMCA 1WZEA 1LSJA 5G0WA 2QYSA 4LK3A 5B4VA 1IOLA 2HQ1A 4RVFA 3OJEA 4ND1A 4B79A 5CEEA 2PZJA 4I8XA 3C7DB 4BHTA 2PGJA 3Q3CA 1ZK4A 3VDQA 1JWBB 4B4UA 4WOKA 1LSUA 3HHPA 4WNCA 4YDRA 4YTEA 3UHAA 2OBYA 2VTEA 4IY1A 3WGYA 4YRBA 3KTDA 3WSWA 3ULKA 3VKVA 4FFRA 3OIFA 1ADBA 3H5RA 4GVXA 4OMUA 4B8ZA 4XKJA 5GZ6A 3GGPA 1YB5A 4MVJM 1GY8A 3X2EA 1WPQA 4QO8A 3H9EO 3DL2A 4XYGA 4Y6PA 4J16A 2VYNA 3ZHBA 1P1HA 2EXXA 1U4SA 2JAHA 5EQFA 1PR3A 4LISA 1PJCA 5HS6A 1YDEA 3IJPA 1E3WA 1KVRA 5ER6A 4Z9XA 3RU9A 1UUFA 4GSLA 5JW6A 2JHFA 5COQA 1S6YA 4AFNA 4MDHA 1ZH8A 3TL3A 3WLEA 1OMOA 3D64A 3OFSA 4JBGA 5KIAA 4NHEA 2YDYA 4ZGWA 3OQBA 5IG2A 5C7OO 3UCFA 3F3SA 3SX2A 1ZSVA 2YV1A 4NG5A 3OJFA 3CZMA 3WWZA 3HDJA 4ALMA 2B36A 2Y1CA 4RV9A 3GG9A 1DFGA 4RF5A 1HT0A 2P5UA 4U0JA 5AXAA 2VN8A 2JAPA 2Z5LA 5TGDA 3WTBA 3BMOA 3BHJA 2JL1A 1HE3A 3DWFA 4LRSB 1HYHA 4EBFA 3OF2A 1QV6A 2OL4A 1NPDA 4EJ0A 4CV2A 1GZ4A 2X9VA 3IKTA 2F00A 3MTGA 3O9ZA 1HXHA 1KEVA 4DC1A 1Z82A 1OBFO 1ZXBA 4RPJA 2XXBA 3K30A 1JDJA 3N74A 1YE3A 2QRJA 4PLGA 1WNTA 1M66A 3B1KA 3T7CA 4MIOA 3TOZA 3DAFA 3QVWA 3GNTA 1HEUA 2CDCA 2O3RA 3WXBA 2Y0CA 4IGEA 4AJOA 2NWQA 3TZQA 1R4NA 1O94A 5CP8A 4AJNA 3BMCA 2OFPA 4JROA 3RASA 4OO3A 1BVRA 3AY6A 4YQZA 2XXJA 4EUHA 2C82A 3I9NA 3O4RA 3AW9A 1ZJZA 2OO5A 3LZ6A 3DZBA 3I6QA 3ZN2A 4EGFA 1I0ZA 4OXNA 1VRWA 4GX1A 1OOEA 1NVTA 4WPGA 1HSOA 3ZH2A 4OM8A 1U7HA 4RO0A 3VOSA 4A5OA 2ZK7A 1EQUA 4W9NA 1ADFA 1SOWA 1Q2XA 4BMVA 4AJPA 4WCFA
chains in the Genus database with same CATH superfamily
1E6LA 3P19A 1BD4A 2B3DA 3O5AA 1BXRA 3OUUA 4GP9A 4HAVA 4OGLA 4PTZA 4TZ0A 2Z2XA 3FWKA 4L3VA 1I2MA 1TA0A 2YXBA 1C7QA 1FNBA 4A8HA 3ETDA 3BIOA 3OOYA 2WUEA 5FOUA 4GKKB 1Y6FA 1TQDA 1SULA 4DSTA 5IJAA 2QE7D 3PQ7A 3N59A 4TRMA 1N0IA 3TD6A 1KPHA 4MV7A 1ZMOA 3VTZA 3VVMA 5HKBA 2EG5A 2RONA 3D2BA 5FUWA 2CXRA 3M9WA 5FL7A 2ISQA 2O4UX 2R1TA 1THGA 2VJNA 3SSOA 2DZDA 4F8JA 5IJ9B 2HYIC 1DV1A 1R3UA 2FX2A 2YWXA 4ID9A 4B0PA 4MJ3A 3BMCB 1WDKA 4MDFA 3W2GA 1F2VA 3NTQA 2CDBA 3LVQE 5BMVB 1NULA 1W1WA 1FFYA 3MBOA 2CKDA 4DADA 4YJDA 4WGFA 3EXHC 2QX8A 1AM4D 5DEOA 5JYEA 2CHQA 3CXRA 2RHJA 3E05A 3GV0A 4PAWA 4Y2GA 3TPFA 1N9ZA 1RJGA 1QCCA 3KLOA 4AIIA 1KEUA 2D8AA 2AEMA 1RI2A 3T9BA 4BRWA 3MHTA 1LJLA 4NU0A 5E4YA 1FP7A 1SRQA 1S8AA 2UV8A 4FEYA 4KXYA 4EHKA 4IEIA 4RPKA 1EK0A 1HDGO 1LRLA 3MS4A 4A0SA 2OVFA 4X6YA 3ISVA 2WSMA 4C4YA 2A9KA 4M1MA 1OU0A 1KNQA 3WHKA 1X92A 4V0MA 2YYYA 5C35A 4BX0A 4M1YA 5FI1B 3MUOA 5IM4A 2GJSA 5F12A 5LXTB 2ODWA 3TTVA 1DC6A 3I34X 4NJEB 2CFSA 1TC2A 3E5MA 2HJGA 1O89A 1OA0A 2NTNA 1F8GA 1RQXA 2W98A 3I2KA 4P32A 2PRKA 4R1SA 5IFKA 2HMYB 4CW7A 1S2MA 2AC7A 4IHJA 4H7KA 4EW6A 1S9DA 3A9SA 5B3KA 1JB1A 3SQMA 3IP1A 3OLQA 4JLMA 1ZKMA 3GARA 1MG0A 1N6HA 4HHEA 4XWTA 5DT9A 1CUGA 4ESVA 3HTXA 3TD2A 3D8TA 3WAKA 1K88A 2SECE 1JHDA 1LVUA 2HLPA 3G23A 3HCNA 1PJ8A 3JAWA 4LNAA 2W6OA 4FNGA 4MRVA 4E5VA 4F9TA 4H2DA 5HFJA 3M1IA 4IRXA 4G0WA 4ZVPA 2ZRBA 3FMFA 2AOTA 3QEJA 4U2EA 4L0QA 4O2BF 4BDSA 2R8PA 1ZICA 3DFZA 3IAHA 1PEYA 1VG1A 1I3NA 3CF6R 2M1XA 3Q3GE 2PL1A 1TEHA 4S2EA 3WMFA 4GM4A 4G4IA 3ADPA 5G4LA 4IQ0A 4C7KA 3PENA 4FE3A 2AS0A 1PHPA 5E3IA 1MV5A 2OGWA 1UWCA 3DTTA 2JLSA 3LG2A 4GXQA 5LZ7A 1PDVA 5U4XA 5BQPA 4D9BA 5DTRA 2FCAA 1JI0A 3WIVA 1FXUA 1O58A 3AF4A 1XTRA 3IQXA 3E81A 4BQEA 1X80B 3HSKA 3R3XA 2HA6A 2QY9A 4U6SA 1DDIA 1L8OA 1YHNA 3E0QA 3G9TA 1UQUA 1F1JA 2PJZA 3QYJA 4JEIA 1QVZA 4GU5A 4WESA 4XQGA 3N39C 2JFXA 5F1KA 2PJUA 4Q4AB 1D6SA 2DTDA 2J4DA 4LZNA 3TNJA 1DBVO 1Z4MA 3ZGYA 3U44A 4AF7A 1R4MB 2ZBQA 1ZONA 2FUG1 3VR4A 2VQ3A 2W0MA 1TT5B 2GZ1A 2CCKA 4IWNA 1C4XA 4QGBA 1QLJA 3HU2A 4G0MA 2Q99A 4QGSA 2R5NA 3KKNA 1U0FA 3PWTA 4TVKA 2C84A 1JPUA 3IQHX 4S0ZA 4OAOA 1QSGA 1E1MA 4PFSA 2GJ9A 4MQEA 1YB1A 5HM8A 4LQCA 4HZUB 4ZXFA 2WWGA 3N6XA 2XB6A 4QJIA 4MIKA 1NBEA 3MJHA 4KXUA 3A9VA 1ZUD1 5A4DA 3QPVA 4L4YA 4FGUA 4O63O 1J8FA 3TRKA 1ZFNA 2LP4Y 1GXSB 3C3WA 2CVQA 3IIKA 3IR7A 3D6UA 3HNOA 1AKMA 1DUSA 3LVRE 2BMEA 4Q12A 4A6XA 3BL6A 4WRRA 1A5ZA 2D1TA 4XB6B 3AZOA 4GOLD 1ID1A 1HM5A 5T8KA 1QZTA 2HZ7A 3CCFA 1CQJA 5LYJB 1XDSA 1K2WA 1I0IA 3BL5A 4ROSA 2H1HA 3BMQB 3IMCA 4FOSA 4OU4A 4ZAXA 4MVWA 1EM8B 2Y1WA 3WO0A 5B55A 1O08A 2Y99A 4NBLA 1KMIY 2RKBA 4XH9B 3T9CA 5K6AC 4YWJA 1GN9A 3S68A 2P4HX 1PW5A 4B2IA 4E94A 4A0QA 1SWWA 2BEVB 2JDID 2GVNA 4I9FA 1WQ4A 5AM3A 4OEHA 5GONB 2I91A 4TMTA 5DXFA 4CCYA 3D02A 4ZTZB 1HK7A 2BFCB 2NQTA 5FHRA 1VL2A 3C15C 3NANA 3D5TA 3L7MA 3LHSA 4H3KB 4HNQA 3DL4A 3S7TA 4AZ3A 4Z8XA 3TR0A 1UF9A 2MMCA 4JUFA 2CK3A 5D5PA 4CEJA 4BQPA 1VPTA 3QIVA 2QZZA 2YXDA 1OTYA 5JATA 3R3SA 3K9HA 4Y18A 1RIIA 3WBBA 4IRMA 1XRPA 3WK7A 1NKVA 4KYUA 2X7JA 1RDFA 5HUQA 2RHGB 1F2DA 4D2IA 2J46A 4OPMA 4WUVA 5ANRB 1UQRA 5JZSA 2RJ3A 4WINA 1P60A 3C3XA 4Y7DA 4JV5B 1DWOA 1JG6A 2BGUA 4JX8A 4EY6A 2GJKA 1YJXA 2AVNA 4MRPA 2O8CA 4V1CI 2NO5A 3LP6A 1P61B 3WYFA 4AZSA 3BH7A 1FFSA 3HB5X 3HZOA 4L4XA 3A1FA 4Y2SA 5C7YA 4L5YA 1SFRA 2YVUA 1NF9A 3P9CA 3LC2O 4RK4A 3I2IA 3UYKA 1M7HA 1XZ8A 4AZ3B 1N6RA 2MT9A 1DRVA 3R5SA 3ZQJA 1TVMA 3H1FA 2AWOA 5KKAA 3NEJA 2ZSHA 4YT8A 3Q9UA 2BBTA 4R2JA 3IR5A 1I3LA 4YEDA 2ZM6B 5KYXB 3UTDA 3ZHZA 4O2AB 5TEWA 2PS0A 5JCOA 3KETA 1OFUX 2RGCA 4YO8A 5TSDA 4YMWA 4RM3A 4BKMA 2FOXA 5EP2A 3L0SA 5K9ZA 2KX7A 1JAXA 1Z7GA 1AHIA 3GAAA 2CB9A 3OT5A 4IQGA 1OH7A 5D85A 1UBRS 4ZIRB 3WWDA 1ULBA 2KWIA 3G49A 1F06A 3NP7A 5D5HA 5CIYA 1KI1A 2YJTD 3KDAA 1ZNYA 3UMBA 1EK5A 3MC1A 4JBHA 1V16B 3OKPA 4C89A 5D00A 4JI3B 3FKQA 1NWCA 1JVSA 2JEZA 4XX1A 2GBFA 1KJWA 3FGNA 3UJ7A 1VC2A 1X9IA 1OLUB 1SD5A 2QVXX 3C45A 1NI3A 2HJHA 3P2OA 2VUUA 3AVTA 3Q7EA 4X84A 4XPIA 1GGFA 2EBFX 4FFVA 4HB4A 3DHEA 3NT2A 5CYPA 4PPNA 1VKHA 4UHBA 3TCNA 4BJ3A 3KAPA 3U44B 2OO5C 2C8JA 2X8BA 1Y1LA 2P41A 1DARA 3QLVA 1WP4A 1Z16A 2PV0A 3G5TA 4FHCA 1H5UA 4HB0A 4NAVA 4WASA 4LJ4A 3T35A 4DZZA 5IZCC 2RGDA 4ARBA 4NYIQ 2GN1A 3IKLA 1T15A 1TGYA 3KAQA 5G1OA 2DYKA 1LXCA 2ZRPA 5HG0A 3T7AA 3U49A 4B46A 4RLHA 4W9NC 4CM8A 3QVVA 3HI6A 3E7FA 4CM3A 3IMKA 2C2ZA 1DTEA 3F5MA 1RAFA 1YRWA 3OJLA 3ZIUA 1Y37A 2JJ8A 5D3QA 3DT8A 2ZKLA 4DN6A 3DHWC 1Z74A 4DPLA 4MR8B 4O3FA 4I1OA 3L7LA 3LBAA 5KQGA 3ISTA 4ER3A 2ZBFA 2QU7A 4JQSA 4OQZA 1V5WA 4E5UA 2H1OA 2QRHA 3LL4A 1E5TA 1WB9A 4HPXB 5AWFC 3WQBA 3WIEA 2HD4A 5IVHA 1Z0FA 4OHKA 4EEXA 4ZOBA 3L8HA 3LUHA 2G6TA 4OKIA 2DFKB 1XE3A 3MM4A 4UUMA 3HM9A 2AH5A 4EW3A 4JLBA 1YNOA 2OLJA 4YJGA 3EVNA 2H2AA 2J5QA 2C2YA 3UAXA 3ZIAA 1EFUA 1KFEB 1PWZA 4K3VA 3PD0A 3SZRA 4ER6A 4ESHA 4GI3A 1BC5A 3EVGA 3CXUA 2QYTA 2WWRA 2PR2A 1Y4AE 4D8XA 1NWHA 3GFBA 3KEOA 1EX7A 1QHNA 1UK9A 2R7MA 3GNQA 1P2SA 1MW9X 1E63A 5DCYA 1LZLA 4QTZA 5BT9A 2GYWA 2NW6A 4IS3A 1PL6A 2C8KA 2VSNA 3HACA 3AERB 3OKFA 2B4TO 2Y66A 3QUTA 1CY6A 3OC6A 4FJ2A 4IYRA 1V5GA 4J16C 4ZHQF 4M0PA 1J99A 3KEQA 1WZ2A 2EKDA 1MOSA 2CCGA 2H63A 2PLRA 3C97A 1I2AA 3ZHSA 2X8LA 4P4TA 3QBEA 1PGQA 2HBRA 2XVXA 1DTWB 2XZPA 3ER6A 5BN3B 4WNIA 5G2OA 3P94A 5BVHA 4EJFA 5AHWA 5FPQA 1IYZA 2I7DA 4NG4A 3QEKA 5JD5A 4ETWA 1OYWA 1TA4A 4YRBA 4LDQA 5GAJA 1GL7A 3OWXA 4DCMA 5A7FA 4R9NA 4N49A 1GFZA 4KFSA 4QODA 2FUEA 1QLHA 4HVLA 3ZJVA 3F1KA 3VR6A 1YACA 2I03A 1BU8A 2WP8J 5I7SA 4EMSA 2Z95A 1XRNA 4HQ6A 4WVFA 2QR2A 3T0FA 3D5EA 3DOHA 2FRXA 1GLGA 5ALKA 1BQEA 2V9CA 2WIGA 1HE1C 3DVAB 4HFMA 2VPQA 4YH1A 4EVRA 2BGNA 1DAOA 5HDQA 4F11A 3K0SA 3KJIA 4TTRA 1Z35A 4Z3DA 1N2HA 1JQ3A 1KP2A 3QVJA 4XFDA 5EY5B 5F5NA 4I14A 1CUZA 1GL9B 1Z2DA 2AEEA 4YRPA 3TLCA 3FYUC 3UFBA 3AHIA 3P4YA 3IERA 3AVXA 4Q93A 1NVVQ 1Z6PA 5FBHA 1LF5A 3W8NA 1SBHA 4RSHA 3WDSA 3GMTA 1UBTS 1OBVA 4ZRDA 1BXGA 1O8CA 3O0TA 3W06A 3R75A 4MUFA 3WV5A 3KCNA 1ADCA 1GSHA 4P83A 3VOTA 4D4IA 3D6JA 1XVAA 3ANMA 3O4FA 1KMNA 5A62A 5JVDA 4FNAA 4D9IA 2XRZA 4YAJA 1Z5NA 2LDXA 9ABPA 3OZCA 3R5KA 5TDHA 3LL7A 3SU8A 5CA0B 2IS4A 2WAOA 3GJXC 3SJ7A 3FHCB 3EB9A 4OGFA 1JLRA 3B2NA 2V0GA 2WJWA 3FSRA 4AL4A 1JR3D 1RRMA 1Y7PA 5BSVA 2JLQA 3NG1A 5H81A 4HGOA 2RKOA 3WGKA 5KWSA 4PCVA 1J7KA 2K2QB 3QPCA 2H7YA 3FFBA 5CURA 5IKEA 1B3RA 2UVQA 4RWEA 1UM9B 1DXOA 1T2UA 1WKVA 1XQ9A 3SR0A 1G55A 1VE7A 1SCDA 1IH8A 2A5LA 1FFXB 4JXJA 4BO6A 2L42A 3RD5A 2G4LA 1QQAA 3HB7A 2I66A 2JBWA 3W5CA 3A2KA 2RGEA 4KO1S 4B4OA 4LXIA 4Y6GB 5T67A 1F8YA 1FDUA 1AC5A 3RAPR 4M86A 4FW8A 2QENA 4WK2B 3BSYA 1CE8A 4LSZA 5JQWA 2XE4A 1GGJA 3DZHA 3WK8A 2BKUA 3HDHA 3ZKWA 5BV0A 1J8YF 4IINA 3I2YX 3AVYA 1TQHA 1GHTA 1WETA 1YF3A 4UBOA 5K8JB 3RHSA 4YRLA 4MK4A 2QN2A 4GRIA 5AP9A 3FVVA 2PXCA 3F71A 5DB4A 2OAP1 3T3HA 4B6PA 2VA9A 1TD9A 2C4NA 1EJBA 1KFCB 3CNHA 1CY8A 1PNVA 2QZ9A 4PR0A 3HXMA 4BB5A 1GZDA 3LA8A 4TN5A 1FJHA 3CY6A 1NQWA 4D9GA 4P0TA 4Z7JA 2E4AA 2J3MA 2WM3A 2NUAB 3SLRA 4E7OA 1CB0A 1HZZA 1KK1A 4FI3C 1R0BA 4GYWA 5K4HA 3GFRA 5LU9A 4QPDA 3SX4A 2P7IA 1YMVA 5M29A 2FPOA 2OBNA 2XUFA 3GGGA 1QFMA 4A0RA 2J9FA 4O4IA 3T7KA 1WAMA 3DONA 4P5DA 4C0SA 3PNOA 2O0JA 1CKEA 1AZWA 2TMKA 4Q9NA 3ENZA 2EW8A 3UHOA 1ZM9A 2JGKA 4ZYYA 3HUFA 4WSOA 4X8OA 1NBOA 1YUNA 5EWJA 1TCVA 1YZKA 1UDAA 2FV8A 2WWTA 3CGGA 1KI9A 4HQNA 4PO8A 5ENVA 4FZ3A 5A3VA 3IEIA 1NMQA 3JQAD 3BDVA 4TLMB 4H1VA 3O8OB 1CY2A 3E53A 4M8SA 5C8YB 3LQ4A 4AKIA 2N9UA 2B20A 3GFPA 1NQVA 1SVOA 3W8EA 3CH6A 4F4CA 4BO4A 1QIEA 1MHTA 4CI0B 3MSXA 1N3BA 2PS3A 4CHTA 2VT2A 2UXDB 3BAZA 4KLRA 2PKEA 3GROA 4P81A 1GPUA 3PT9A 5HIIA 4B5KA 1C0LA 1Y3FE 5B7QA 3OQIB 1HE2A 5IMSA 3VBCA 3THYB 2H2HA 3B12A 3PJDA 1MRNA 4NCXA 4Y1RA 5A02A 2G1JA 5B2ZA 1SM4A 2G72A 3IO5A 4RJJA 4G56A 2Q0SA 4MMYB 5IVKA 1ZQ1A 4C0HA 1K6EA 3EEIA 1F6BA 3QFHA 3RROA 4C0LA 5IU6A 4QBHA 4R68A 4AT1A 1E1QD 2XCRB 1NVWQ 4PG8A 3KPVA 5K03A 1WWKA 2B98A 3EFHA 4MWBA 1G4AE 2IJGX 3HYRA 2Q9CA 4HAIA 5FRDA 1UWVA 2QPTA 3DZFA 1LLCA 2ZSDA 3ZY3A 5A6SB 1W34A 3NUZA 1WHTB 5HCUA 2B92A 1ZO8A 2Q5EA 2QL7A 4FT4A 4MQUA 5DTQA 4CQMA 1H0HA 1XEAA 4V02A 1WD7A 1XI2A 1X8LA 1RM5A 3C98A 3KS9A 4B6GA 2X40A 5J4YA 2C7OA 2EQBA 2FETA 2Z1NA 4PS1A 4DJJA 1PLKA 3ZJYA 3CBGA 4Z6KA 2XYRA 3BWEA 3X43A 1ECGA 3V8MA 1ZZEA 1GNLA 2CUZA 4DV7B 1VE3A 5AXBA 1SKMA 1RM3A 4UCQA 1E8MA 1X42A 1MJGM 3EUFA 1QFYA 4QAJA 3PB3A 2H1RA 4I1RA 3VYSB 4C20A 1L7RA 1SCAA 1ZNQO 3LVBA 1I3MA 2OAEA 2P91A 2PX6A 1TM2A 2VBCA 3GPDG 3KD2A 5LQDA 4R2WA 1PZGA 1YB4A 4AG3A 3PFGA 3QX7A 3NBUA 1QP4A 2GF0A 3LO8A 4G4JA 5DHFA 3UAYA 3CURA 1IN7A 3FYHA 4KE6A 2W22A 1T35A 3R6WA 2D6FA 5KTNA 1YR2A 1U7TA 2P1RA 4MW6A 1PJSA 3AUAA 2XADA 4TMFA 4MVJF 3UG7A 1RQNA 4PFJA 1UFQA 4N5NA 2FLWA 4F45A 2BBSA 1UC9A 2ODNA 2QRLA 4DIBA 3DMFA 4GMGA 4RZUA 4BX9A 2I1VB 1C7RA 5IN5A 1VYVA 2H8GA 2XCLA 3BQMB 3HY4A 2FHSA 3ANXA 4PGGA 1P1JA 4PSKA 5DISB 2YZGA 4ZHQB 4V1CA 4YAUA 3R8FA 2GT1A 4W8GA 2ZOSA 5EUBA 3U81A 1NUUA 2C57A 2FW0A 4BEVA 3C5WP 4IG9A 3RVNA 3T99A 3BTOA 2JI9A 3EC7A 2BOVA 4JQCA 1XMVA 1FDIA 1VLQA 2AX3A 3FDJA 2QSUA 4WTOA 4KRXA 1A9XA 1NMEA 2D74A 4MITA 1P7CA 2ETVA 4B71A 5KWJA 5FP0A 3R3HA 1YQTA 2PUJA 1NJ1A 1W30A 3EHDA 3KYDA 4S2UA 3LWNA 3LPAA 2M6LA 3QWBA 1E7WA 5KJCA 1Y4UA 4DV3B 3ESCA 2OCPA 1Q1AA 2XIJA 2Z9BA 4M9QA 3S81A 5JARA 5IYZF 3EBLA 5C5EA 2H5LA 1V7PC 2D1FA 3DKVA 4L2IB 1J42A 4B7CA 3KJNA 2WD9A 5I3ZA 1OD6A 1T2CA 1V9LA 1XCMA 1ZN7A 3L9WA 4M6WB 5TJHA 5P21A 1QONA 3OWOA 5FR2A 3MD9A 4GX2A 521PA 2QGNA 3B5JA 3HI4A 1DPFA 1IB0A 3EIFA 3GFGA 1N4DA 5KYXA 1EWVA 3GBVA 4TXJA 1VE5A 5A1TA 3L7KA 4JLDA 1NUAA 3DO6A 3GPBA 1MEOA 1MRZA 3G2JA 2IZOA 1Z4QA 1MP0A 1JPJA 3G0GA 4YK7A 5FYDA 3S5UA 5EJ8A 2X8JA 1K6JA 2F3PA 3G9ZA 1CQIA 1OW3B 3RTEA 3S99A 4CGZA 2P35A 1HTBA 4B2YA 4RHFA 3QGMA 5EI5A 2Q7OE 3SDZA 4CCWA 1THTA 4OKNA 1M2GA 2KLBA 3FLBA 3SC6A 4DUPA 4G0VA 1UM8A 4LF4B 3PKJA 2OCBA 2SCUA 1VBNA 4ZC8A 1EAMA 4YV0A 1MX1A 3KPJA 5BVGB 4CEIB 4NU5A 5HF9A 5CA0F 4W5OA 3G8BA 4OXIA 2JIQA 1VZ2A 4ER5A 3VPAA 1I32A 4DUGA 1UOEA 4FFDA 4N47A 5CFQA 3EXHB 4NMXB 4Q00A 3EEBA 1CUAA 2H18A 3ROMA 2ZI5A 4HUQA 3ZU6A 4CM4B 4H0FA 1Z4OA 3J81A 2PKQP 2FA9A 1T36A 2BR5A 2I4MA 3HYCA 1EXMA 1F12A 4B47A 3TYXA 4WEQA 4C1NA 1GT6A 1MN6A 4G1FA 4OGKA 2VP9A 1VBMA 5BR1A 3RC2A 3WYAA 2G8LA 2FSSA 1Q20A 2WOOA 4EJSC 3ZQ4A 5ALHA 3RWOA 3PQFA 1ZN2A 3KVOA 5H68A 1JDVA 1T2NA 1W93A 1Z7BA 2EFHB 4EH1A 2V7QA 1N3YA 1QCDA 3EC1A 4FCCA 4E7PA 4M0DA 4XIJA 5CM2Z 4BC1A 1TA9A 1ODJA 2O48X 4JK3A 3IDFA 2O20A 2EZ4A 3U39A 3G13A 2FQYA 2QD3A 1E7MA 4WJZA 1GN8A 4YQEA 3V80A 5ED4A 2CSUA 2O6LA 1QFZA 2WK1A 3ZDEA 1YWGO 1QRSA 3IJEB 1V96A 1XAHA 4MRRA 1B0ZA 2A1TR 1RYDA 2F17A 2XH8A 3QKUA 4W5HA 2IGBA 4TMYA 1XVIA 4BVJA 4P54A 2PVSA 4J76A 1XB2A 3G0HA 5CDSA 1QOZA 5HILA 1MNQA 4AN1A 1QH1A 1SXJE 1ZVKA 4YDRA 3KWFA 5EXSA 1FNDA 4XIYA 1YC2A 1I7PA 1YS7A 1HC7A 2ZR7A 3C43A 3LC7O 3QMMA 5FCDA 2BF4A 4F4JA 1Y9DA 5IVPA 5IYZA 4XJTA 5E4FA 5C8XA 4RU1A 1D4FA 3RFXA 4N6NA 1NBIA 1U8UA 1Y63A 4P8RA 1RMTA 5K20A 2D1RA 2RGBA 1RKQA 2Q1YA 3HKDB 3COPA 4WA7A 5AI5A 2XYGA 5AK5A 3MWDB 2JBHA 1I2CA 3KLPX 2YOHA 3FCXA 5KOHA 3AKCA 3V34A 5JCJD 4YP5A 2A9FA 1GVNB 2VRCD 4OFBA 4HZGA 2G8NA 3BMQA 3G1UA 4KAAA 4U2FA 1AX9A 3USCS 4MVJH 5IJZA 1OVGA 1QTRA 4H6PA 4JITA 2ZSKA 4M49A 1HA3A 2JCSA 3Q0IA 3EWAA 3GRZA 3QG1A 1U4NA 4PZDA 3TUJC 3VR4D 4B82A 1E2QA 2HA3A 3IX7A 4BFCA 1U2DA 3B70A 3QOFA 3NDJA 5LWHA 3HZRA 1ZN9A 3UH0A 2UAGA 1DBRA 4PN7A 1E0DA 1Q21A 3O8BA 1YU9A 4GMHA 3THOA 3IP8A 1QS0A 1BVYF 1G17A 3M5PA 1JLLB 1MH1A 5AVSA 1P0MA 5T7BA 1QP0A 3L2OB 4G86A 4DR3B 2XUZA 1C7IA 4WERA 2HMSA 4M9UA 5BOVA 2PA0A 1X3LA 3BXPA 1AUPA 1RQLA 3OQ1A 3ZLVA 3BFKA 3GW8A 3HM2A 2IEYA 4INZA 3CVVA 4G5QA 4XEUA 2X9NA 4H3SA 4NULA 5E9AA 1DKUA 1X0VA 4MWEA 1Z6XA 4LYAA 3U3XA 4BNZA 3PUJA 4BFXA 2C9CA 2PEYA 1ZJ5A 4NE2A 4CQMD 4DT1A 1T4BA 4OOEA 7YASA 4E88A 2YBEA 1P5FA 1G8MA 4DDHA 1P8AA 2D2EA 2HDNB 1ZI6A 3A6HA 3KHUA 5T6MA 3DQZA 3VI3B 4BNNA 4IQ4A 2FPGB 1AKYA 4JY7A 1V2GA 4Q4HB 2Q2WA 3U62A 3AL0C 2HDHA 1KSJA 3RNLA 4HAWA 4S0XA 3IP5A 4BNKA 3EPHA 3A04A 4FFNA 3Q6MA 4ZP1A 2ZJ3A 2GK4A 3JX9A 3KZMA 2C98A 2IXTA 2GJAA 5AHXA 5CYFA 2CJWA 3D7LA 4Z7OB 3RRXA 3KOZA 3PYMA 3S55A 4AJ4A 4J43A 3KXKA 3QOYA 1N8NA 1QFJA 1I01A 1TMKA 3RS2A 2J59A 5CGQB 1SVKA 1B3BA 2AOUA 1CPYA 4C3VA 5BWCA 2SHKA 3DVQX 3FFTA 4CG3A 1BMFA 4LRTB 2B0JA 2I7CA 3OM9A 4FD2A 4MULA 3UA4A 1ESDA 1WXGA 4K46A 4JIMA 1YQWA 4LJ9A 4CTNA 4PINA 1HR0B 1FFBA 1N6LA 1M73E 3EDQA 3EVBA 2QIPA 1TO2E 2ZSBA 1LWOA 4MJ7A 2PYDA 4O2LA 1VSQA 1YVDA 5B6PA 3CF2A 4KGZA 1NYRA 3CX6A 1BE0A 2ZZKA 1YJ5A 2OXEA 2ZT8A 3NIGB 1Y9JA 1I4TD 1KXZA 1M6YA 1V1MB 4URHA 4Z9BA 4D9CA 3K70B 3DE0X 3HEBA 2HSEA 4X0EA 2AD5A 4W1PA 3RF6A 3DL0A 3D4IA 2AE1A 1A95A 2H06A 4MDYA 1GQOA 5HRUA 1YI0A 1T4DA 4IV0A 1GO2A 3UT6A 2VXYA 3VO8A 2VL7A 2I6TA 5K8LA 4C4AA 1I5RA 3V4VB 3DAOA 2WQ7A 2AMVA 1F6DA 3L1HA 3HV2A 3KP1A 3QI7A 5H02A 5JAPA 3S8YA 5BV2P 5JT1A 1Z9BA 2D00A 2H11A 3EWSA 2JJQA 4MI3A 3WLMA 1HDYA 2A9JA 4RQBA 2VH5R 2BR3A 2HSDA 2X6TA 4PF1A 5AK6A 4BMPB 3DLBA 5IYZB 1P7PA 1T1EA 5DN9A 2FWPA 3Q7RA 3QK7A 2O2HA 3P9XA 4XDZA 5FPKA 1TEXA 3D4NA 5A0VA 4O8ZA 1OHHD 1T36B 5EXXA 5K1ZA 1PW7A 4FYVA 2PKQO 1ZMRA 2W2PA 1B0AA 4UUAA 2IYVA 2XRMA 3B89A 4KH0A 4NTZA 1L7QA 2B34A 2MOKA 4XDGA 4ABYA 1Y9ZA 4KQ6A 4BGIA 1RWMA 5JJIA 1JJIA 1MO2A 4YLEA 3WLTA 5CITA 3AR5A 1QVVA 2HPVA 3PXEA 5KTSA 1LRJA 1OIXA 3JV7A 3SR4A 1ZISA 3ICWA 4H16A 1DIRA 5EXTA 1Y7LA 4YO7A 1CQZA 1C9KA 4JC0A 3TO5A 2IE8A 3WWOA 4DCVA 5A9RA 3K72B 4ARAA 2G09A 1FX1A 3V46A 4RELA 1XJQA 4PX3A 2COUA 3HN2A 5D3MB 1ISJA 4RPHA 1AOXA 2V0CA 2BTOA 4LQDA 3PEUA 1QV7A 1SUBA 4UNSA 2CL6X 4K9QA 4FHEA 1PR4A 3DZIA 3EWNA 4DDUA 3DM9B 2BELA 3E9NA 3MQFA 1RE0A 2NV6A 1MGOA 1Q2UA 3JRXA 2QWXA 1WUTA 4XPIB 3PQCA 1MJGA 2HBYA 4X1KA 3RFVA 3TI9A 3WGQA 3WRVA 2IX3A 5GINE 3GN2A 2CE7A 1G63A 2AB0A 3NYIA 3L7YA 3UV6A 1IFXA 1GYRA 3ID6C 5THKA 2WPDD 1NNLA 2FPWA 1HRDA 5KI6A 2TMYA 2F62A 2YOFA 5E8JA 5GONF 3V9PA 2I71A 3L79A 3R5XA 5CXSA 3ZGVA 3ZZTA 3IVMA 4DLWA 5JC1A 1IUNA 3P0IA 3PEWA 4CM6A 1Q1GA 5FIUA 1LPOA 1MW8X 4US1R 3LBFA 1DLJA 1Z08A 1S3FA 2W6ID 2XT6A 1ZCZA 2Z04A 3AINA 3INNA 3MJVA 5ALPA 5FF9A 2GJ8A 4HXFB 4YYZA 1Y8QA 1FLDA 1X13A 3VR2A 4MS1B 1AA9A 2LVBA 2EARA 1DINA 4XYMA 5D84A 3BH6A 1K9SA 1FMCA 2BKLA 3KT3A 3LUKA 4OP3A 3AYXB 2FDCA 1A2QA 1A4IA 4XZ3A 5JECA 2O2IA 1V5IA 3Q3JB 4P3KA 3A0UA 1LJUA 3LLUA 2Q0XA 4RW0A 2XZTA 3WKDA 2GDZA 2P9GA 4TL9A 1GDHA 4AJ2A 4DR5B 4NSNA 2BFEA 4Q7LA 1F7UA 3H4MA 1AXEA 3EIQA 3VZDA 1XMXA 4FIDA 1G6OA 4J0QA 4JFAA 1D07A 4MQMA 1T8PA 2NSDA 3U09A 4CDGA 4IDHA 3LBNA 3RRBA 3DPSA 5D01A 4HGYA 3B53X 2ZB7A 1OKKA 1UQTA 3PRJA 1QS0B 2X1HA 3R7SA 4BAZA 4IIXA 3TTUA 1ZWLA 4KQKA 3MLAA 4GYYA 3T9EA 1VCNA 3WICA 5B6JA 2FW7A 2LCFA 1HV8A 3C39A 1SVUA 2GPNA 3HJHA 1GQRA 1FP2A 1HE4A 1I2DA 3K70C 4QLBA 1YBHA 4KXFB 3LUAA 4D9FA 2HO4A 2VHXA 3ND9A 2JFBA 3D6AA 5CXXA 4AO6A 1QCZA 2BCJQ 3ZV7A 2JLUA 1W88A 4AVYA 2XQIA 2W6IA 1E5QA 2H4YA 1C0KA 1P29A 3GXBA 1BYIA 2FFBA 5I9TA 3C14C 3KLNA 4AKGA 1M9NA 5JE8A 4ZI3A 2FSIA 2J0VA 4PFQA 2BFWA 3RVBA 2F4NA 3M3HA 3HK2A 3GVPA 4FZVA 1PGNA 1QQTA 3LY7A 4AWAA 3SAJA 8ABPA 1J5XA 2O2JA 1T10A 4GDMA 5AVOA 3E9MA 1RRGA 3U4CA 3S2SA 4LF6B 1TIPA 1X9HA 1N5KA 1ZSNA 5K3DA 4HWKA 1F2TA 2Q28A 4G1BA 2C58A 3F8WA 3DHYA 4YRQA 2HHCA 3RSLA 5CVVA 1WOMA 3FX2A 1N6PA 1L3BA 1G66A 2DY1A 3AK4A 3AL2A 3BA1A 5LYJA 1C3OB 3ZHQA 1TEVA 3LUCA 4FFOA 2NYAA 1M1YA 3CONA 4MVJD 2VDJA 2PUCA 3N58A 3PYLA 4L9AA 1HDRA 2AYYA 3SBEA 4RCZA 3HP4A 2M2IA 2JJMA 1X8KA 1XP5A 4CL2A 1D09A 1RFLA 2P5TB 3DOCA 3EF3A 5K5EA 5ICGA 4LOLA 4CV1A 1HDXA 1XA0A 4LHSA 4OHZA 5C4MA 3K1AB 3CUKA 4HDMA 1E2JA 1MEJA 1NQAO 2VPWA 1P44A 1ZCAA 3MJ4A 1EWTA 3N05A 5TLSA 1I80A 3SKVA 1ULHA 4LMAA 4CEJB 2ZP1A 1L4MA 2V5AA 1CUHA 3HY6A 1EJ2A 4GGMX 4Q4LA 3ZV3A 3IVGA 1F2TB 2BFOA 4M8IA 2A0KA 2KYRA 4IXWA 4GP6A 4IXTA 3TTSA 4AM8A 3PR1A 5GMOA 5A5EA 1KEEA 4RD0A 1I9CA 3T6KA 3ZDRA 5DHUA 2J3QA 2X4IA 3BL8A 3DTVD 3M4JA 1JILA 2DT8A 3ZCRA 2I67A 2XQKA 3Q0TA 3GVHA 4FEAA 5EWMA 4TXMA 3KXPA 3F5QA 5HQ3A 3DTNA 5FPSA 2JBAB 1XMSA 2WG2A 2WNHA 1RQ7A 3CEPB 3DWGA 3GEEA 3GLHB 4ACAA 3GNSA 1YQEA 4A2QA 4ZYWA 4J0CA 5FUBA 4DYHA 5LP6B 3V2IA 3Q2IA 3KHKA 3TRDA 2F67A 1AURA 2PMBA 1YR9A 2UVPA 3BIXA 2Q50A 3UJ8A 2QRQA 1SBIA 1IIRA 1WULS 2HWUA 3IP7A 2FUKA 4G8JA 5EWJB 1M5UA 5C80A 4BATA 5ALWA 4QKQA 3VNUA 5DLEA 1CJKC 5TR9A 4G8BA 3NOXA 2XVZA 1N5OX 4JLAA 5AKIA 1NAIA 1M6EX 1KH2A 3ZU3A 2GESA 1P1CA 1YULA 3T5TA 5HK8A 1M2VA 4GGPA 5BNFA 3SZGA 3I52A 4J91A 5DGDA 3VPSA 1MTZA 1P0FA 3F5SA 3NC4A 4C7VA 3ZWMA 2JGAA 5DZSA 2KQUA 3RF7A 1ISSA 4TMWA 1XEXA 3DV2A 4LEIA 1OHHA 2A3RA 2IY9A 3QQPA 4KR7A 3I62A 1MIHA 1Z2AA 3GYGA 3HVUA 4PWZA 3TLGB 3JZIA 4E22A 4FHZA 4Z0TA 4XRGA 4AJHA 4QUBA 4EK9A 3CM0A 1U5BB 1YJBA 3HV0A 3IS3A 4R7GA 2WVJA 4NV0A 5KEIA 3P8ZA 2ZYUX 4E32A 2GAOA 1Y98A 5IXJA 2YV5A 2YXLA 3BXZA 3C5EA 1GTL1 1YVUA 1N1DA 1QC5B 1NTOA 2BZGA 2WSSA 2XTNA 3B6IA 3MRVA 4ND2A 4ALLA 4I50B 5HKOA 1XXHE 4CEHA 3DPUA 2WJ4A 1MX3A 3T1HB 2BI8A 5G02A 4PYOA 5LLTA 1MB2A 1LBSA 1P6XA 5LQAA 5ABPA 1KMCA 2JRLA 5CTAA 3U4GA 4A6DA 4AS1A 1W0KA 1Y8QB 1XJCA 4PFKA 2YBDA 1J9EA 2YV4A 3MN1A 4IGFA 2XWJI 1TW3A 3LNTA 4MH0R 1XLTC 4HZIA 5D2CA 3VX4A 2CZQA 4MKHA 3VHXA 4E5NA 1DADA 2FSGA 3IDOA 3WL6A 1R00A 4S24A 5HIAA 3WK6A 1WVIA 3SLKA 5AKGA 5EQDA 2OCIA 2VBFA 5KAMA 3I01A 1NVDA 1AKTA 1W85A 5A0FA 1CZKA 4WLOA 1K5PA 5IP5A 4X7PA 3IVXA 3FIUA 2MINB 3HDTA 3OMLA 2FLKA 4Q6BA 1O5TA 4BVBA 5E4TA 1T3TA 2PKWA 4NF2A 4OKSA 5FOXA 1C50A 4MO9A 4NCHA 1KVTA 1U8FO 1YDHA 2ZYTX 1U3WA 3MOGA 4NR0A 3TL2A 2Y2UA 3CE6A 3GLSA 2IUYA 4LVOA 1J49A 1U9ZA 3K09A 4I0WB 5AJXA 2XT9A 4BVLA 2XSZA 4BGVA 1KEWA 4HBZA 1DHTA 1UJCA 3NC1C 4P98A 4B3MB 5EKTA 2OD2A 3SJCA 3O91A 1Y4SA 3I3SR 4PIVA 1ZITA 1RI3A 1E1YA 1K89A 2AGVA 2JFNA 3I4CA 3KSZO 5JNSA 3PLRA 1H6DA 1XZGA 1JZSA 2CFIA 2XTZA 3FTQA 3KLMX 1CJTC 4PC6A 4NH4A 4WKCA 2WZBA 2VZEA 3UCXA 3ZBUA 1VLZA 1XNGA 3SHTA 2X5XA 1XZBA 1R5NA 2A1UB 3IC5A 3LBHA 4EI7A 2P1DA 5B6IA 1QGUB 1CEXA 2QZ4A 1MG5A 5IF9A 1AG9A 3SDBA 3Q3EA 4OSOA 3ZDFA 4EVQA 2IYNA 2XUAA 4N54A 3V4PB 2ZIAA 3IBTA 5K3EA 4FLMA 4D4GA 4LK2A 1H8HA 1E9FA 2O2CA 3HA5A 5JHHB 4H1HA 1FFEA 3BGDA 3CVUA 1F48A 1LLDA 1PLLA 4TKMA 1U8YA 2RHDA 1CRQA 1C0PA 1XKXA 1K9VF 3NX4A 5AJZA 2GZDA 3T1QA 1FMJA 3KSUA 5IANA 2FPPA 4NY1A 5GZ1A 1SHTX 3H2JA 3PDHA 3PPIA 5DN6A 3TUZC 3V9AA 2ORVA 4LJ5A 3QLVC 1QMGA 2RARA 1Y5LA 3ILVA 3GUYA 1OH8A 4UVEA 2V6JA 4N3AA 3KZXA 3OFJA 5BQFA 3SWWA 3JQ7B 1E4EA 5TJ9A 3B8EA 9LDBA 4XOIA 2R7AA 3OZUA 4KNYA 1Y8RB 2DLNA 1X70A 2IUTA 4CU2A 4IDAA 5I4KA 5KQRA 4WUTA 3MJFA 4BFSA 5G4KA 1E6WA 4ZCTA 4Q6WA 1NDHA 4HQOA 1QYXA 4Y2HA 3HY3A 3IEUA 4M0LA 4PTYA 1FK8A 3T9DA 1G3UA 3UFXB 4AUKA 4BL5A 4EY3A 5JNVA 1Z13A 3HJUA 3O4JA 3U17A 4WZBB 4DNOA 2ZIGA 1ZXXA 3O8DA 1MAVA 2PY6A 2ZR8A 1Z5ZA 2BH2A 3MOSA 4P80A 4D4LA 2IE0A 5DV9A 1VKNA 4FGKA 3NRBA 1XU4A 1EUYA 1UKZA 1JR3A 2X13A 4HF7A 3BICA 2R97A 1Y8CA 2NVOA 2XNDD 4IIJF 2B1RA 2TECE 2WG0A 4QGFA 4CZ2A 4J1SA 4D74A 4G9GA 4PAOA 3UAWA 4EHBA 1SXPA 1T2DA 4HH0A 1L5KA 3JD1A 4JNCA 4AJ1A 4L8GA 1S2OA 4Q3AA 4HXEB 3SHVA 3DNPA 4CUJA 4F8YA 4HWGA 3RR2A 4F4DA 4Q4HA 3KOOA 4LKRA 3NRCA 4Q82A 3RG8A 3T7TA 1K0UA 1PWXA 3FYSA 3I0NA 1NXTA 1Y1SA 3KIPA 3OZWA 4LBVA 3U3JA 4EDFA 3O3OB 3CLHA 1ZMTA 4EKGA 3TGPA 1LFDB 2Z98A 2BBOA 1ENPA 2BN4A 1WDMA 2C03A 2C5BA 2OSVA 2RI1A 3H65A 4MEBA 4ZQCB 5E95A 3PF8A 3WLKX 5IZCA 2ZQ5A 2R62A 1FRFS 1WTAA 2AKAB 2AMYA 2AJCA 1Z15A 4KC0A 1K3TA 2MWMA 4I9HA 5EJIA 2JGDA 1GPBA 4A15A 4WW0A 1GA4A 3F67A 3LXRA 3SP1A 3VV2A 2VSXA 5HUJA 5BY2A 1G21A 2D5LA 1JW9B 5K0SA 3RUFA 5BSTA 1QJ4A 3OE5A 3L6UA 2JH9A 5ALSA 1KK3A