1WLYA

Crystal structure of 2-haloacrylate reductase
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
332
structure length
322
Chain Sequence
VMAAVIHKKGGPDNFVWEEVKVGSPGPGQVRLRNTAIGVNFLDTYHRAPPIVVGFEAAAVVEEVGPGVTDFTVGERVCTCLPPLGAYSQERLYPAEKLIKVPKDLDLDDVHLAGLMLKGMTAQYLLHQTHKVKPGDYVLIHAAAGGMGHIMVPWARHLGATVIGTVSTEEKAETARKLGCHHTINYSTQDFAEVVREITGGKGVDVVYDSIGKDTLQKSLDCLRPRGMCAAYGHASGVADPIRVVEDLGVRGSLFITRPALWHYMSNRSEIDEGSKCLFDAVKAGVLHSSVAKTFPLREAAAAHKYMGGRQTIGSIVLLPQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 2-Haloacrylate Reductase
rcsb
source organism Burkholderia sp. ws
molecule tags Oxidoreductase
molecule keywords 2-haloacrylate reductase
total genus 111
structure length 322
sequence length 332
ec nomenclature ec 1.3.1.103: 2-haloacrylate reductase.
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1wlyA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1wlyA01
5A3JA 3STHA 3DZGA 4IS2A 4L4SA 3KO8A 3BHJA 2QW8A 4PLHA 4IQGA 1SZJG 3FNEA 4Z0TA 4J9UE 2G76A 4J1TA 4ND2A 3KSZO 1JTVA 3JQFC 4MO2A 4EEZA 5I8ZA 1HRDA 1ULSA 2P68A 1RJWA 2PKQP 1UZNA 2OO5A 3PQDA 1H2BA 2VQ3A 4IJVA 3TZ6A 3QVXA 1CQIA 1E77A 1CYDA 3DZBA 5LCXA 4UULA 4WCDA 3F9IA 1XU7A 1WMBA 2NLOA 2PFGA 1FF9A 1DO8A 4JN6B 4D79A 2VRCA 3ADOA 1C0KA 1CDOA 2ZB4A 4L4RA 3O9ZA 3AUSA 1WW8A 4LISA 1SAYA 5KJ1A 4CM8A 5DOVA 4ROSA 4PG4A 3HZZA 3UHAA 2PH5A 4IPTA 4CLHA 2P2SA 3ASUA 3I83A 4MVJF 3VVBA 4BL5A 3K92A 1T4DA 4TROA 3E9QA 3D7LA 1ML3A 3DHYA 2VWPA 1F8GA 4QO8A 2O3TA 2YFHA 5A5FA 2AW5A 1DJQA 3QWHA 3C24A 4D41A 3EGOA 3GOHA 2UUOA 3ST7A 2JD2A 4BB6A 5F21A 4ZU3A 2X0NA 5AVOA 1AN9A 3LK7A 1J49A 4DIBA 4XYLA 5ER9A 3PRJA 2SCUA 3L6OO 4IJUA 2AQIA 5HM8A 3OIGA 1BGVA 4NQZA 4QXMA 4CMAA 1UJMA 4GAEA 2BH9A 3DTYA 1V9LA 3INRA 1UXIA 4DTIA 3OFSA 3BHIA 3RUAA 2Y93A 3DOCA 4D3SA 1WMAA 3JQ7B 4PZCA 3RVDA 4I5EA 4L74A 4FB5A 3WDSA 1QSGA 4Q3EA 2IRWA 1NHGA 1DPGA 3DZJA 4GGOA 2CMDA 4Z9XA 2NQTA 2W2LA 4ZGWA 3GN1A 3FD8A 1ENPA 3HDJA 1O89A 4E2ZA 2PH3A 1D7OA 3RJ5A 4PRLA 5L53A 4BO8A 1KBZA 4R41A 3A1NA 4II3A 3KYDA 4PLYA 5TSDA 4DPKA 5GMOA 4E5KA 3EDMA 1PJCA 4WKGA 4A03A 5T64A 3ZWXA 3ZNPA 5IXSA 1PJ3A 3ENKA 5FEUA 3OIDA 3I9JA 3BTSA 2HJRA 5CDYA 1P44A 3IL2A 1DXYA 4A7PA 4CQMA 2NV6A 4CM8B 2P4QA 4YT5A 5I7SA 1RM4A 4PG8A 3QWFA 2ZQYA 1SB9A 2P91A 3GEGA 4OXNA 4BNWA 1SMKA 1LDBA 4YQZA 3DWFA 3RBZA 3H9QA 4J1QA 5G0VA 4DGSA 3WGOA 2Y1OA 1PQPA 2AEFA 2J6IA 5ES3A 5FI5A 4Q3BA 2Z5LA 4DXHA 2GPTA 2RIRA 4N5NA 1PS8A 4UREA 5IZCA 5ITWA 4K26A 1NM5A 3B1FA 3HFGA 1WDLA 1LUAA 5A05A 3OJFA 4RPLA 2C5AA 5BSHA 4II2A 2IXAA 3AY7A 3RI3A 1HTBA 3RFVA 4G81A 2YV3A 3I52A 1V35A 4RZIA 1EVYA 3DFUA 3Q9UA 3C7CB 2Y66A 3IQDB 3O26A 1BW9B 1I32A 5U4QA 1K0UA 4R51A 1KVSA 3JYNA 4KDFA 5HTOA 3KYCA 1T24A 4CMKA 3DZFA 3PJDA 3T4XA 5A4DA 3RBVA 5JO9A 4QEDA 2B37A 4U5QA 8LDHA 5C5IA 4D0RA 1DIGA 1JA9A 2A94A 4I9UA 3GZNB 4I5DA 1GY8A 1GU7A 1X15A 4IY1A 3BHMA 3C8MA 3GVPA 3TPCA 4E31A 1UXKA 5A5EA 5JAMA 2RBEA 3S2EA 3GC6A 4EJMA 4BQPA 1B2LA 4O6VA 3TOZA 2XXBA 2XXJA 3COSA 4GH5A 2J8ZA 3R1IA 1EMDA 3SBOA 4KTTE 4MVJI 1IB6A 4LRSB 2OHXA 4AJOA 3WIEA 1UP4A 1DFHA 3P19A 2NTVA 3TL3A 2Z95A 1E7SA 1UDAA 2IDZA 3LF2A 4E2WA 4E5MA 2O2SA 2QRKA 1Q0LA 3ZV5A 5GZ6A 4PGFA 4IM7A 3VOSA 3VTZA 5JDIA 1ZVMA 4C7KA 3ZNNA 1PJTA 3FN4A 3SLGA 4IDDA 4QTZA 2VUUA 4I5FA 4YJFB 1BHSA 1NWCA 1E3JA 1HSOA 1ARZA 1P1FA 4IQ8A 1GV1A 4L9RA 1SPXA 5CEJA 4O59O 5F5NA 3DEYX 3U4IA 4BNZA 3PQEA 3JQFA 1QRRA 3E82A 3WWYA 1BSVA 3QWIA 1ZEJA 3JQ9C 1LDNA 1ZKMA 4MOWA 1ZK1A 3U09A 4ALLA 1VM6A 2BKAA 3UW3A 1PS9A 4DMMA 4NNJA 2QYSA 4IIUA 4FGSA 3WGGA 4FJ1A 4OSOA 4E32A 1P9LA 1BVUA 2GO1A 4J2HA 2ZTMA 3HDYA 3QRWA 3CINA 3GMDA 3L4SO 5EQFA 4ALMA 2CSUA 4R1UA 4ZJUA 3I1JA 1G1AA 2UVDA 4YAKA 4CLRB 2Y0EA 3GGPA 2G1UA 4P4GA 4KTVE 5DT9A 4H15A 2V6GA 1FDUA 3GN2A 2DTDA 2OBNA 4TMFA 4PZDA 4BKOA 3U5TA 2JHGA 4EJ0A 3DXFA 3GNSA 4XEHA 2VT3A 4ZHSA 3F1LA 3EAGA 5CG2A 1E1LA 1T2DA 3G49A 5BQFA 2D2IA 2HRZA 5CDUA 2B5WA 1KIFA 3AY6A 2NQ8A 1ZO8A 2WEKA 2JHFA 2W8ZA 3EW7A 3MTJA 4XGIA 3TFQA 4HKTA 1L1FA 1NPDA 1WP4A 2Y68A 2AA3A 5L4NA 3JV7A 2W2KB 1U7HA 2YHIA 3KBOA 5IDXA 3DOJA 1E0DA 3AI1A 1Z74A 4D3FA 1ZXBA 3JYPA 3PYXA 3ZWYA 4EBFA 3U4CA 4ZQBA 1XU9A 9LDBA 4LGVA 4Z0PA 4DC1A 2GRAA 1Z75A 1NAHA 4M8SA 4GX1A 3WYEA 3EC7A 5HS6A 1DIRA 1LSOA 3NGLA 1SOVA 3AJRA 5L7YA 3JD4A 3SXPA 3GAZA 3V5NA 3F1KA 4J49A 4HXYA 2I5PO 4YJHA 3G79A 1PGQA 1B14A 1OC4A 4G5HA 2X23A 2Q1WA 3BMOA 3OSUA 3S2FA 3QJ5A 1U4OA 1HYHA 2CF5A 4HUJA 1PZFA 4IDBA 4MKRA 1Q0QA 3U4DA 1YL7A 1YONA 5FI3A 5ICSA 4B3JA 3ROKA 1XYGA 4J7CA 2GF2A 4N5LA 4RF5A 4YYZA 3W8EA 1YDWA 2AG5A 4Q9NA 4BGEA 1T1RA 1KVRA 2XF8A 5T8KA 3CTMA 3WGIA 2HMVA 2J5RA 4FJ2A 4BO2A 5BT9A 3SC4A 4UVGA 3JQGB 4LCJA 4MVJD 3GR6A 3GEMA 2DBZA 3VDQA 2YQ5A 4RJTA 1P1RA 3FHLA 4I9HA 1XHLA 3CKYA 4TRJA 1PL7A 2GR9A 4NBWA 1T2AA 1LDMA 4OKIA 4RF4A 3LC1O 2FRDA 4MP3A 3LQFA 5TJ9A 4NIMA 1GZ6A 1JWBB 4RVDA 4OL9A 3U62A 1BMDA 3PWSA 1BXGA 1GL3A 4EDFA 4NZ9A 3GZNA 3MJCA 5I9NA 3MJ4A 1QLHA 1SCUA 4NPCA 3B20A 4W7IA 4RVFA 3NT4A 4CV0A 2PD4A 4DYDA 2B83A 3KXDA 5ADHA 1LEHA 1VJTA 4B8ZA 1UUFA 2Q99A 4WLEA 5JSFA 1NBOA 2E4AA 3E8XA 4NI5A 1GZ4A 1V3TA 4RO0A 4RVSA 1BXZA 1DLJA 5KKCA 1HE5A 2B35A 3ICPA 4AJIA 1A5ZA 2BFOA 2PGDA 4J7UA 3BAZA 4BMSA 3QQPA 3MWDB 1M6WA 3BYZA 2AEMA 5T8KC 3IKTA 1GYPA 1ZSNA 2ZKLA 4WNIA 2YUTA 1DC5A 1YBMA 2RH4A 4WGGA 3HB5X 4CL3A 1UAGA 4KWHA 1YH3A 2A4KA 2HSDA 3ON5A 3SX2A 3ZCXA 2EXXA 4EUHA 5GY7A 2VYVD 4CMEC 3JQEA 4E4YA 5JY1A 3M1LA 1YQDA 2I3GA 4ALJA 2VUSA 3NUGA 5L3ZA 1PQUA 1ZMOA 1Q7GA 1XELA 4XB2A 4YT4A 4W6ZA 4KUEA 4LVCA 1OAAA 3VKUA 3DOOA 4RDIA 3DAPA 1KVTA 5TQVA 3K5PA 1JKFA 5EN4A 5FFFA 1NP3A 1YL5A 4YBZA 3JSAA 3M2TA 4CMCA 1OMOA 3F4LA 1C1DA 3NJ4A 3ZZNA 2F1KA 1I33A 4TKLA 5K6AA 1ADFA 3B1JA 4WPGA 1EBUA 5CPFA 4OAQA 1E1KA 1EVZA 1PZEA 5AQ1A 4N54A 2YY7A 1M2WA 4ND4A 5CG1A 1X7DA 3JQBA 4ZQGA 1KOLA 4BNVA 3GGOA 1K3TA 2VNAA 4NDNE 4Z0HO 3ZWOA 3ETGA 3K31A 1FDWA 5A9TA 2JD0A 2V6FA 3F46A 4FS3A 5G4KB 2OP0A 2GNAA 3B70A 4QT0A 1LSUA 3DTTA 3HDHA 1B7GO 3GAFA 2X9GA 3D4NA 2X86A 2B69A 3H65A 5F1OA 3W6ZA 3FF4A 4S3MA 4BNTA 3MCVA 5KWEA 3EZLA 3BZUA 1ADBA 2DM6A 1NPTO 5TNXA 3ZHYA 4GSKA 3WBFA 1Q7CA 2FSVA 1WWKA 3BMCB 4YRBA 3ZU5A 1I8TA 3QVOA 3UF0A 2Q1TA 5KVQA 4J2OA 3UH1A 2NU9A 3GUCA 4IIVA 1OC2A 5IXYA 1YWGO 2RHRA 1N9GB 1LRKA 3V2HA 4OJNA 2I99A 1MLDA 1J4AA 4BKPA 1V8BA 1MC5A 2Q50A 2R2GA 2RCYA 1LLUA 2DUUA 4Z9FA 2ZTLA 5CDSA 3MZ0A 1Y9EA 5DZSA 3FI9A 1DOHA 4B8WA 1NYTA 1E1MA 2H1SA 1V6AA 3DZIA 1QMGA 5DDIP 4EITA 3WGZA 2I9PA 1KEPA 2JL1A 3ZNQA 3L6DA 3HG7A 1DC6A 3NTRA 4WLVA 4M1QA 3ZV6A 1C1XA 2PR2A 2GD1O 3OJ0A 3MJSA 1FXSA 1PIWA 3KLPX 5KOIA 4PLGA 4UUOA 2V6BA 2DBVO 2Z1MA 2X9NA 1U8FO 1XKQA 3VDRA 1TT7A 1TI7A 1BW9A 2XPCA 5KNLA 4TVBA 2FHSA 1YBAA 4NBTA 2ILTA 1VSUA 1I3KA 3BIOA 3GFGA 3RAJA 3VH2A 3QE3A 1P31A 5JCXA 5JNLA 1XA0A 1R15A 1ZZEA 4HV4A 1PTJA 3RCBA 1GQ2A 2DPHA 1BRMA 3OIFA 2B4QA 5C7LO 1I01A 2GUGA 3DR3A 3GK3A 2P9CA 3Q9NA 1BDMA 2NU8A 1TVEA 2FOIA 1LBEA 3K30A 4NMHA 1ADGA 3TQHA 1XQ6A 4EYEA 4J3FA 2YV1A 1U7TA 5KJ6A 1GUYA 3ETEA 4KUHA 4PLCA 5KTKA 1YQGA 1HE3A 2DFVA 3PJEA 5IZ4A 1F06A 3EY4A 1GEEA 2G0TA 5JMWA 3FRJA 3HE3A 4Y8VA 1NTOA 3V1UA 3AI3A 3U4HA 5TS3A 3JQ9A 3ZW9A 2RHCA 5A06A 1U1IA 1F0YA 5U9CA 4E5PA 1EE9A 1X7GA 2YDYA 4LCEA 2X7HA 4OH1A 2Q2QA 3F3SA 3VZPA 4AJPA 1I3MA 3ICCA 4B3HA 2OUIA 1T1SA 1O94A 5LDHA 2C07A 1GPDG 4ID9A 3H5RA 3TDKA 5I9LA 4WOJA 1MG0A 1Z6ZA 2HJSA 4OOFA 4RVHA 5ENVA 5A9SB 3NX4A 3P7MA 3I3OA 4IQ0A 4P8RA 1E3LA 4Y67A 1VC2A 4OO3A 3MJVA 1ZXLA 2VHWA 4E2XA 2Y67A 3H2SA 1JAXA 3HADA 1E7RA 3QA9A 3PGXA 4ND1A 2DVMA 4YEDA 4GVLA 4PLFA 2WD7A 5IN5A 4DIFA 5AXBA 4XQEA 4CMHA 2C5EA 5L45A 3M2PA 2X9VA 5HWSA 1M66A 3CSDA 3N74A 3NAQA 3H3JA 4I9NA 4OIMA 2OBYA 3WG9A 4UVHA 4HFNA 1YOVA 1EE2A 4UEKA 4YQYA 3TRIA 2AE2A 4M89A 1OZAA 4CLRA 5TX7A 1PJBA 4MJLA 5L51A 3KUXA 3PYMA 4IGFA 4KP7A 4D0SA 1MXFA 3WJAA 3ANNA 2FR1A 3FR8A 2VZ9A 3QLJA 2ZATA 2H63A 1TLTA 4MVJM 3DQPA 3WYBA 3OM9A 3GT0A 4CQLA 1LXCA 1TT5B 4YA6A 1KY4A 5IAAA 1PEDA 4MP6A 4DIOA 2NVUA 3DHEA 3DMYA 3SEFA 2Y05A 2VNSA 3JD0A 1P33A 1U5CA 2V65A 1PS0A 2NU6A 5I7EA 3I23A 3BA1A 3NDJA 3PIDA 4CM4A 2CDCA 4TRNA 2IEDA 3GNQA 2ZYAA 1I2ZA 4Z3DA 4ALKA 3RSHA 5THKA 1UZMA 5L40A 3RUCA 5A3VA 4AFNA 4GMFA 4GL4A 3WGTA 3HUDA 2YQ4A 4YTEA 2AG8A 2Y1DA 4BGIA 2D3TA 4EEXA 1KY5A 3ULKA 4TRMA 1EVIA 2PWZA 2J3HA 3PHIA 4DVJA 4LK3A 3RQSA 2EV9A 3IUPA 3LU1A 5KVSA 1F12A 3C1AA 3GMSA 4OMUA 1XDWA 4CLDA 4WCFC 3VZRA 2PD3A 3AW9A 4RQTA 1UAYA 2JCVA 5TT0A 2TMGA 4NBUA 4AJ1A 4DQUA 2QG4A 4A0SA 3HB4X 3AM5A 4NU6A 4RF2A 2J3IA 1R0KA 2BGLA 3H9JA 5EIOA 2GZ3A 3QIVA 2EEZA 2VT2A 3OF2A 1HEUA 3RASA 2QRJA 3D3WA 2FWMX 1QXSA 4UVEA 3KLMX 5JXWA 1HZZA 3ANLA 3ZU2A 3Q6IA 1H0KA 1EQUA 4RGBA 6LDHA 4OXKA 3PWKA 5B37A 2HK7A 2O3RA 3DBVO 5ILOA 5HRUA 2R00A 5H82A 2Q3EA 4YRDA 2O48X 4BO1A 2GYYA 3DZKA 4RVGA 1P0FA 2NUAA 1H6CA 4U6SA 4N18A 4R5HA 5U1PA 2VRBA 3VPHA 3Q2KA 3TZCA 3UN1A 1ZBQA 4PG7A 4CM4B 1EUZA 1K6XA 4TWRA 4BKRA 1JU9A 1GCOA 3KOUA 4CR8A 4Q3CA 1UZLA 2Y0CA 3L4BA 3PJGA 2WM3A 4JXKA 3E5MA 2Q4EA 3IDSA 4TZTA 4DA9A 1QYXA 2WDZA 3WFJA 2NTNA 4TVOA 3UICA 2VYND 4R4JA 1SB8A 2CFCA 4DLLA 5G0TA 3UKOA 1W4ZA 2X8LA 4J7XA 2PZMA 1R4MB 2IYOA 4IJWA 3ZWCA 1JN0A 4UUPA 2NWQA 3P5SA 1KEWA 1GYRA 3PPIA 1UP7A 1PR9A 5I8WA 2EGGA 3AOGA 4H16A 4JLWA 4L73A 3NGXA 5MGBA 5TLSA 2PV7A 3IC5A 3WIDA 1PR3A 1LDEA 1Y8QA 3FBTA 4IZIA 3GLQA 5HA5A 1KS9A 1A72A 1ZK0A 4JJFA 2VTEA 3L0DA 4XYBA 2ZTVA 3JTMA 3NDRA 4JK3A 3QVSA 1W6UA 4ZVVA 1JVSA 4LMRA 1DIAA 1N8KA 2I67A 1ZEMA 4IMPA 5C7IO 4FJ0A 3INGA 1LI4A 4FOOA 4B4WA 3PDJA 4J91A 3H9EO 3OJLA 4PCVA 4CM3A 3ZHBA 1NQ5A 5JS6A 4CV1A 4GSLA 4YACA 3V1YA 3WMXA 3I9MA 4ITUA 5IF3A 5KVCA 2BGKA 1UR5A 2Q45A 1BXKA 4JJGA 4L8VA 3EUWA 2PGLA 3W1VA 5IG2A 2LDBA 1DRUA 3LT0A 3WS7A 1H6DA 1ID1A 3VZQA 1ISGA 2D8AA 4YJDA 3C3XA 4J16A 2CVQA 2R6JA 3ORFA 1DB3A 3GVIA 3H4VA 3D5TA 3SLKA 1C0IA 2OOSA 4BVAA 1B8VA 3JCZA 3PYLA 5C7OO 3INTA 3CMCO 4TKMA 1EFKA 4XB1A 5KKAA 3RC2A 1DEHA 2WE7A 2HK9A 4JX8A 3ZWMA 3D3EA 1QKIA 5COBA 4OQZA 3CE6A 5H83A 3F47A 3WICA 4A26A 1QLJA 3IOYA 2NACA 3NKLA 3D64A 1CERA 1JDJA 3G1UA 1CEQA 3H6KA 2JFHA 4BGUA 3LVFO 4E2YA 5G2OA 3O4RA 4YPOA 3V8BA 3LF1A 3D4PA 1DRVA 1VJ1A 4NHEA 5JAIA 4YJGB 1ULUA 4UAGA 3ZWWA 1ENOA 1CETA 3KSDO 3JQDA 5EJ2A 1ONNA 2JJYA 1WAMA 3AWDA 3BMCA 4CM7A 4AJNA 3LT1A 5F1PA 5B4UA 3TOXA 3AM3A 4FC7A 4K28A 4R69A 4RVUA 4E30A 3N58A 5DULA 1XWFA 2RAFA 4GBJA 3AK4A 3KTDA 4YJFA 1T25A 1IY8A 4YAGA 4UUNA 2PNFA 2ZB3A 4F6LA 4QSMA 2BHLA 4PZEA 1GQYA 5HBRA 3WBBA 1NPYA 1GR0A 2JCXA 4J0EA 3TL2A 2CDAA 1VLLA 1Z7BA 4ZRNA 4BNNA 7MDHA 1MX3A 1NHWA 1GAEO 4BO9A 2NSDA 1U3WA 4XQCA 1XCBA 3H7AA 4HADA 3PEFA 2OGUA 3K6JA 3PXXA 1B0AA 3GFBA 2G82A 5CPBA 5AYVA 1XIVA 1LC3A 3KV3O 2VN8A 2UYYA 3QP9A 5A9RA 4FC6A 2G5CA 4YDRA 1HZJA 4XQGA 1C0LA 3S2IA 4CMGA 4QFCA 3UCFA 2BI8A 2DAPA 4NJOA 2DT5A 2J3JA 3U49A 3W6UA 4OXYA 5JFOA 4BO7A 3MJEA 1LLQA 3PDUA 1GUFA 3EVNA 4L75A 1N92A 4LVUA 4RLHA 3AUAA 4CODB 1HT0A 1HE4A 3D4OA 1P1HA 3P2OA 4E5NA 1DAPA 2R00C 3IMFA 4WK6A 2GN4A 5JW6A 4D3DA 1SNYA 3NTOA 4DPLA 1LA2A 3T7EA 3DO5A 5TT1A 4XWYA 1I3LA 2BRUA 4BO0A 1SBYA 4U8GA 3RC9A 1CRWG 2UV8A 2PK3A 1DSSG 2NM0A 5DBIA 3WSVA 1RPNA 1PWXA 1CQJA 3FNHA 2VZ0A 2HMWA 1XSEA 4DBVO 5IJZA 2D59A 1BVRA 3LC7O 2DLDA 2FMUA 4Q3DA 1AXGA 3U0BA 1Y5RA 3LSYA 5JPIA 1IE3A 3VPGA 4BNLA 2D5AA 1FDVA 3K73O 1IUKA 1PQWA 4CJXA 5A1TA 4RPHA 3SJUA 3MJTA 1N9GA 4NBVA 4WLOA 1UXHA 1Y81A 4BIIA 4ND3A 4WLUA 4MKXA 2I3AA 1WDKA 3WMWA 1N1GA 4AJHA 1JKIA 2Y1EA 5CDGA 1SEPA 2AQHA 3OQ1A 3WYCA 1RYDA 2Y1CA 3LDHA 1WVGA 3RC1A 2GDZA 1Y1PA 2OP1A 4W4TA 4YT8A 3E9NA 2H9IA 1ZCJA 2EGHA 5TC4A 4WCFB 4YXFA 2YFQA 3DFZA 3RUHA 2C2XA 3NRCA 1MB4A 4FD3A 1RKXA 1O9BA 1DIHA 1EUDA 3AM4A 3GF4A 3UUWA 3I6IA 2O50A 2EERA 1ONOA 1IHXA 1U28A 1B8UA 1R16A 4IXTA 2ET6A 3U3XA 1ISJA 1GDHA 3X2EA 4B7XA 1HL3A 4Y98A 1XGKA 1ZMTA 4TRRA 4R9SA 2DKNA 2PZKA 1NFFA 3E5RA 4E6PA 3BMQB 3ANMA 3RFXA 3L77A 2FR8A 1I3NA 1BG6A 8ADHA 3ZV3A 4D44A 1ISHA 4QFDA 3H8VA 5IDQA 1OBFO 4J4BA 4HNGA 1YB5A 2NVUB 2AE1A 3QWAA 3WGHA 4BB5A 4D7AA 3ZW8A 4LSMA 1EBFA 4BGVA 5DN9A 4B7CA 4K9DA 3WWZA 3QY9A 3R0IA 4PVDA 1IOLA 3VVCA 5ICMA 1GADO 4R1SA 4FQ8A 1O0SA 1I10A 2E6UX 4NG5A 4BO3A 1LJ8A 4NFHA 4CLXA 3VC7A 1WZEA 2EHDA 1D1TA 3KYBA 1A7AA 2J3KA 1Y5MA 2QQ5A 2NADA 5JAQA 2OXIA 2G17A 1H2HA 3JYQA 1LDYA 4FW8A 4P22A 4K6CA 2FR0A 1GQQA 3DC2A 5TGDA 3H9GA 2O4UX 1DAOA 1PWZA 2ZB8A 2VCYA 2TMDA 3PJFA 1C3VA 4RZHA 2GLXA 5EINA 5MDHA 1KYQA 5KJCA 4FBGA 1E3WA 5JE8A 1OFGA 1EDZA 1NWHA 4MKZA 1PJ4A 3GZ4A 2FZWA 1C0PA 4MPDA 2HLPA 4WOKA 2AMFA 4CM5A 4H3VA 2NVWA 4IDAA 1MA0A 1W0CA 4FR5A 1ORRA 5JYEA 2YW9A 4E0BA 4OYRA 2A9FA 2NNLD 3O03A 4IZHA 1GD1O 4GLOA 3GG2A 4NFSA 4OOEA 4PIVA 4BNHA 1ZK2A 1PJQA 2XOXA 1KVUA 2BFMA 1YOVB 3GHYA 4PG6A 3FWZA 3QV1A 4FPXA 4BKUA 1CWUA 4CM1A 2DQ4A 1HDOA 4CLOA 1O5IA 3JQ8B 5IDWA 4GKBA 5CFZA 1NASA 1S7CA 4WJZA 2WWRA 2AEJA 1I0ZA 3CZRA 4FGWA 1DIBA 3Q11A 1H9BA 3OJEA 4E13A 2A92A 4FFMA 5CHEA 1PGPA 4WLNA 1JLLA 4YT2A 1GCUA 2X58A 1J6UA 2NTJA 3VAZA 1P3DA 2QZ9A 2BD0A 3JQBC 3TZQA 3JQAB 2CNBA 4OGWA 4XA8A 1Y7TA 2AHRA 3K9QO 1WPQA 2EG9A 1SEVA 5K6AC 4PVCA 4XR9A 1NQTA 3B1KA 3RBXA 5C3MA 4AJKA 3RWBA 2CD9A 3I5MA 4U0JA 4IDEA 2FY8A 1YKFA 2DUWA 5THQA 4GWKA 3ZWNA 4HFMA 4PLVA 1U3UA 2GERA 5L9AA 3JQ7A 3KB6A 2A35A 2UAGA 1JAYA 3IKVA 4CM9D 2EJWA 1Y8QB 2D5CA 4UEOA 3KEQA 4J43A 4KZPA 4PLPA 3WR5A 3ONFA 1M67A 3DONA 4IINA 5L4SA 3MOGA 3CMMA 1AUPA 4D42A 2JFFA 4CUJA 2B4TO 3VTFA 5IN4A 1IZ0A 5AXCA 1QYDA 1FJHA 3DHNA 3GQVA 4FFLA 4PFJA 3SC6A 3WB9A 2O7QA 4HFJA 3PTZA 1HKUA 1MUUA 4DWVA 5JO0A 1HF3A 1X1TA 2Q1UA 3JQ6A 4RLSA 2EIHA 4YR9A 1U3TA 1NQAO 2QX7A 4P4NA 3JQ8A 2JKVA 4R01A 3EYWA 4J0FA 5ILGA 3NDIA 1ISIA 4RQUA 2GN9A 4ESOA 3WJ7A 4RCVA 5EQDA 3TNLA 4CR6A 1YL6A 3R6DA 5BNIA 2E49A 4E5YA 2CVOA 3EHEA 5FWNA 3DAFA 4EUEA 1T2FA 4AG3A 1GZ3A 3TJRA 3HFSA 2C2YA 3NT2A 1AGNA 5KJEA 4CR7A 3WNVA 3E48A 4WEQA 1Y8RB 4B79A 1MC4A 3C7AA 3E03A 3OJOA 5G0UA 1A9ZA 1NR7A 5DF1A 5KCZA 3ZHXA 4J6FA 3DBHA 1VPDA 1V3UA 5ITVA 3KETA 4KQWA 4XRRA 1I2CA 2EKLA 2IZZA 2YHIB 3PWZA 3PZRA 1VL6A 4GX5A 1I36A 3CUKA 3LT2A 5L4LA 3GDGA 4ZQFA 1NFQA 3I9NA 5FYDA 1E7MA 2YYYA 4YVFA 3N7UA 3W8FA 2HMUA 2BI7A 5A9SA 3FPCA 1YS4A 2HQ1A 2X5OA 4JP3A 3VH1A 2Q2WA 4BNYA 1FDSA 1HDRA 2P5YA 1VE9A 5F5LA 1PL8A 1E3WB 4GX2A 1ISFA 1Q0HA 4I08A 3AU8A 1E3EA 1HLPA 3OA0A 3RUIA 3UXYA 1ADCA 4UVDA 2FSSA 1O6ZA 1E7WA 4W9NA 2O4CA 1NVTA 3H5AA 3FWNA 5I7VA 1WNTA 4A5OA 1X0XA 2PKQO 1C1XB 4N7RA 3ITDA 3AOEC 3O8QA 4R1TA 3S1LA 3W4IA 3SVTA 2VYVA 1NR1A 2EP7A 3ZNOA 1X1EA 4P38A 4O63O 3ZV4A 1B15A 4AVYA 4GPD1 2I65A 1H6AA 3OHSX 1D3AA 2HMTA 2UDPA 2WMDA 1LDGA 2BMAA 3GVXA 4HBGA 1N5DA 1ZUD1 3PLNA 4A73A 4KMSA 1V3VA 2PKRA 2ZYGA 3GVHA 5CP8A 2Y1FA 4YCAA 2Y99A 2X0IA 2W98A 4GKVA 1WZIA 3C1OA 3K8ZA 4INAA 3QSGA 1P1JA 3IUSA 1QYWA 5BNTA 1T2CA 3NT5A 4WE3A 1IL0A 1ZW1A 3O38A 4Q39A 1P77A 3C7DB 1OI7A 1XQ1A 3H2ZA 4M55A 3H3FA 1QYVA 2I6TA 2I66A 4R9RA 3DBLB 3G3EA 2PTGA 4XR4A 2P9EA 1MG5A 2VOEA 1YB4A 4RPGA 2CDBA 5L95A 3OQ6A 2PZLA 5K1SA 2ZCUA 3DB2A 2DBRA 1PSDA 3GRKA 1Y9AA 2C29D 3G1TA 5GZ3A 4DL9A 1RM5A 5AXDA 3TF5A 3AI2A 2P5UA 2VZ8A 3ZHZA 3FCOA 4EI2A 1YRLA 2DTEA 4EUFA 2P9GA 4CLEA 1KC3A 5KIAA 2GZ2A 1G0OA 3EZYA 3NTQA 4JQCA 4PLZA 2EWMA 2QZZA 1LQTA 1UH5A 2EJVA 3RU7A 2ZB7A 4ZRMA 3UAGA 2Q46A 2VOJA 2H6EA 3PFFA 4FSHA 2IZ1A 1B26A 2RH8A 3B6ZA 4FDAA 4I5GA 4QUKA 5JDCA 1Q2XA 4WUVA 3L4BC 2EKPA 4XIJA 1EUCA 2C54A 4PN3A 4NBRA 2FN7A 5TIIA 1XLTA 4M87A 4ZICA 4BUCA 4MIYA 2GCGA 1I5RA 1PZGA 3P2YA 4EGFA 1U3VA 3R3JA 4ZD6A 4EZBA 2ZYDA 1I24A 2CUKA 4R16A 3GUYA 4X54A 3RD5A 1YO6A 3ONDA 5IZCC 5T57A 3RU9A 5A02A 4XDYA 3E18A 3FTNA 2HUNA 2VTDA 3OP4A 3BMNA 4KOAA 4WCFA 2VHXA 3UCXA 2V6MA 3L9WA 2X5JO 3F5QA 2Y1GA 4WASA 3ZH2A 1DJNA 2BFAA 3RUDA 2GZ1A 3I9KA 4NR0A 4CMBA 2WE8A 5EPOA 2Q1SA 3NJ8A 4G2NA 4YAEA 3VPSA 4UEJA 3RKRA 4ALNA 4R5MA 3PHJA 4B4UA 1I30A 4IMRA 3IJRA 9LDTA 3RKUA 1PJ2A 1MFZA 1Z7EA 3IP3A 3JD1A 3DBLA 3QVWA 4XKJA 3BMQA 1A4IA 1JQBA 3R3SA 1L7EA 1R6DA 4AL4A 3KYCB 4BKQA 4O0LA 2FP4A 3KEOA 3LZ6A 4LN1A 4UVIA 4MVJH 2X4GA 5HS4A 2O3UA 1R4MA 4CMEA 4CV3A 4D45A 4BNJA 4GVXA 1EFLA 1KERA 1K5HA 2YDXA 3IAHA 1E3IA 3ROQA 1EEHA 3ITKA 4HP8A 1UP6A 2C0CA 3E6AA 3L9XA 5TF4A 2V7PA 4O5OA 4TSKA 1BXGB 3OETA 1WDMA 5L7TA 2PZJA 1RM0A 4MINA 4L76A 4BMNA 2X6TA 4BO6A 1N7GA 4NH4A 1QORA 2IEBA 1B3BA 1XR3A 5DCUA 1A71A 1ZFNA 4J1SA 4F3YA 3GPDG 4DLBA 1ENYA 3FR7A 2VWGA 5L7WA 2E48A 4XJTA 5T67A 5JDIC 4BNIA 1EK6A 3CXRA 2BGMA 4OHUA 4FIZA 3GG9A 1GV0A 3OMLA 4PLWA 7ADHA 4WEOA 3FBGA 3K2BA 4F45A 4DBZA 2DTXA 2JFGA 4YB8A 1HXHA 2IODA 4O1MA 5AXAA 4DUPA 1I2BA 4W82A 3TSCA 1GPJA 5DCYA 4CLOB 3PLRA 1NAIA 2GN8A 5A03A 3HQ4O 4A10A 4XYEA 4CMIA 5CEFA 4L4XA 3GPIA 2HCTA 1R66A 2YHUA 4HNHA 2PD6A 4DMLA 3ETDA 1D1SA 1R0SA 1UXGA 4JIGA 2FPGA 1DC3A 2D0IA 3GY0A 1AE1A 1MV8A 3ONEA 3OECA 5CEEA 2OZPA 3IJPA 1YQXA 1MP0A 2YJZA 1ONPA 4JBIA 3LLVA 4L0QA 3ZU3A 1DRWA 3MTGA 3OA2A 4NJMB 1EZ4A 2CY0A 3OICA 4PLTA 4CM9A 4N5MA 3W8DA 4LMPA 3A28A 4PRKA 1EVJA 3I6QA 4JNKA 2WD8A 2EF1A 1PZHA 3ROPA 2QRLA 1MGOA 4IDCA 3AUTA 5DCWA 5ENDA 5C37A 4XRGA 4MVJP 5BR7A 1PU2A 4MDHA 4CMJA 2CF6A 4XYMA 4GQAA 2IYPA 1HDCA 2O23A 4JROA 3GDOA 3WTBA 4YWJA 1WLYA 3JYLA 1ZH8A 4DQXA 2C82A 4NK5A 5EESA 4E33A 5DOZA 4R1NA 3MWEB 4CPDA 4DQVA 1IPFA 2OFPA 3ZI0A 3WQSB 4CUZA 1CF2O 5TRTA 4A2CA 1M6HA 4Q3NA 4ZQHA 4R3NA 3UVEA 1CIVA 1D8AA 1NVMB 3RUFA 4CQMD 2EKQA 3GEDA 1IYZA 1D4FA 5JAZA 3LC2O 2HDHA 1KETA 4XGKA 1G0NA 1LU9A 1YB1A 3A4VA 4PG5A 5K0ZA 5JC8A 5F3RA 1GYQA 3W4JA 4JGBA 3S2GA 1DFGA 4QQRA 3FTPA 4JJIA 5DP1A 2WSBA 4BV8A 3DBRA 4OQYA 4ND5A 1IPEA 4W7HA 5FF9A 5COAA 1T2EA 5LC1A 3VH4A 4CMIB 1PJSA 4Z6KA 3I4CA 4F6CA 4BNKA 1LQUA 3WFIA 2OL4A 4YJHB 5T5QA 3HNPA 4WECA 1DBVO 4MIEA 4URFA 3SJ7A 2HK8A 2X0JA 3FPLA 4CQLB 2VUTA 3ZWPA 3D0OA 4AJ4A 2GGSA 2C20A 3X2FA 4R54A 1QG6A 4BS9A 2J5KA 4TQGA 2VHVA 4KDEA 1J5PA 5B12A 5IDYA 3A06A 3S8MA 3PHLA 1LRJA 1HDYA 4MVJE 5DBFA 3T7CA 1KEUA 3TFOA 4GI2A 1GFSA 3KM0A 4LRTB 3WSWA 2DFDA 3E1KA 1K2WA 2NU7A 1GEGA 4EW6A 2EW2A 2QHXA 1TB4A 4F46A 1PX0A 1HE2A 3GGGA 4JBHA 3ROMA 3ADPA 2ZTUA 3V2UA 4EJ6A 1TA4A 4B3IA 5G0SA 3WTCA 4XQ9A 2WYUA 1DDOA 2GN6A 1NX6A 1X13A 4XCVA 4BHTA 5B4VA 5A04A 1B16A 5IFLA 1LLDA 3QWBA 4J9VA 4OSPA 2ZJ1A 4XZ3A 2B0JA 1IULA 2B4RO 1E1NA 2IXBA 2UUPA 1AXEA 4HX5A 4M54A 3PVZA 2X1HA 5COQA 5TJHA 2PA3A 3F5SA 3JQAA 1TXGA 1YBVA 2POQX 3EMKA 4IDGA 3PP8A 4MVJA 1K6JA 3VHRA 1E5LA 1EDOA 1UDCA 4LW8A 3CPSA 1H94A 1P1KA 3PQFA 1C14A 3OEYA 4J1NA 4RDHA 1N2SA 2X0RA 1ZK4A 3TN7A 2ZJ0A 3T4EA 1E7YA 4Y9DA 3ZDFA 4YAJA 1EQ2A 1JVBA 3GH3A 3WLFA 3H5NA 4XDZA 4P4LA 3A9WA 1E6EA 1M76A 1YJ8A 4IBOA 4JBGA 3V2GA 1HLDA 3HN2A 1QV7A 3HN7A 4WNCA 1VKNA 5DNAA 1GTMA 5F1KA 4HFRA 4FFNA 4NU5A 4ZQEA 3JD3A 2PLAA 4S1VA 3S55A 2WD7B 1QP8A 1BWSA 1K89A 3PFWO 4RORA 4AICA 2AQKA 1UXJA 3O8QB 3VPFA 2J5QA 3MOIA 1WXDA 5CDTA 1MXHA 3JD2A 4AJEA 3Q1LA 4R3WA 2FPIA 1C1DB 1LSJA 3IIEA 2VWHA 1X0VA 3OBBA 3ZN2A 3OQBA 1QYCA 4BV9A 1YXMA 4DC0A 4E3ZA 1BTOA 2B5VA 1R37A 5BSGA 4H7PA 4RV9A 1NXQA 1QR6A 4J90A 3OH8A 5G0WA 5JYDA 4XD2A 2OMEA 1HDGO 1HDXA 3HHPA 3G17A 2WJPA 4FCCA 2X5KO 2FPPA 1W8DA 3E9MA 4Z3KA 1VI2A 4DLAA 2WYVA 3WQQA 4U0KA 3PZBA 2HU2A 4M86A 4A27A 1R4NA 5BNFA 4XJSA 1LLCA 4XIYA 3I4FA 6ADHA 3FSRA 1PL6A 5BSFA 3DMTC 4B4OA 1FDTA 3VPXA 4D43A 4G65A 3NEPX 1FK8A 3D1LA 5DP2A 3JQAD 5JMPA 3G0OA 3PI7A 3UCEA 2F00A 1LNQA 1HSZA 2IE0A 5KJFA 2O3SA 4BNMA 1DFIA 1E7QA 4DREA 3HWRA 1ZSYA 3AOEA 3AU9A 3A14A 3AFNA 1FMCA 1NNUA 4XX0A 3L07A 3LLSA 1H9AA 2DC1A 1ZJZA 5JLAA 3DZHA 3JQCA 3UGKA 2HRBA 3LT4A 2CZCA 2VWQA 3RC7A 3W4KA 1VRWA 4JP2A 3M1AA 1J0XO 4IGEA 1VKOA 1W73A 4UUMA 3AFMA 2GASA 1O8CA 4RPJA 1E6WA 1NVGA 1XG5A 4MVJG 1ZIDA 1N7HA 3EVTA 3KRTA 4RF3A 5JCJA 3K2EA 2PGJA 2FZEA 1NQOA 4E21A 1A7KA 5H81A 4CM6A 3WX0A 1IHYA 4ILKA 1A9YA 4C7JA 4CL8A 5JC1A 1HETA 3M6IA 4HY3A 3Q0EA 3WGYA 3MEQA 4Q3AA 1U8XX 3GA0A 1T26A 1E3SA 3DDNA 3EK2A 2D1YA 2EW8A 2BFPA 2DPGA 2Q4BA 3BTVA 3C85A 3WLEA 3OEWA 1PGOA 3RFTA 2DBQA 4NFYA 4AJLA 1U4SA 1BDBA 2IZ0A 2XAAA 5KVVA 1P1IA 3ZWAA 2EP5A 2JAHA 3Q2IA 1P45A 1TEHA 3KZVA 4J4HA 4YJGA 2Q2VA 4IUYA 5EMHA 3CEAA 1F17A 2QIOA 1U2DA 3KHUA 2JAPA 5B4TA 2NVBA 3VH3A 1G6KA 4IS3A 4W9NC 1E92A 3KVOA 5JDCC 1ENZA 4DPMA 4MIOA 4ALIA 4BO4A 2WTBA 1LX6A 3V1TC 1GUZA 1U9JA 1E5QA 2BF7A 1YVEI 4Y6SA 1PGJA 3CH6A 4YRAA 2ZK7A 1EK5A 2Q49A 1NFRA 5JY6A 1T4BA 1H6BA 3GDFA 1P0CA 1L7DA 2HKIA 1AHIA 1H5QA 4XYGA 3QVTA 2O2YA 1Y6JA 4XGNA 3BMOB 2Y0DA 2JCYA 3BXXA 4FOSA 4CUKA 2W90A 5CAEA 4Z9YA 2GSDA 2W2LD 2P4HX 1Z73A 3ENNA 1DHTA 2E82A 2C7VA 4I1IA 3UFXA 1R0LA 4J4TA 1A4UA 4QX6A 4NJMA 4I8XA 1MFPA 4KWIA 1CJCA 5JBIA 4DRYA 4E12A 1ISMA 1Q1NA 3JQGA 1B3RA 2H5LA 1DC4A 1HYEA 4ZN6A 5I7FA 4GGPA 4IJKA 2YV2A 2B36A 2AXQA 3DAGA 3LYLA 3D5QA 4Y6RA 2LDXA 4BNUA 5BSEA 1KC1A 2Z1NA 1N1EA 3ZGYA 4IXWA 3HJAA 4QO7A 4BOYA 1AHHA 1M75A 4R68A 5G4LA 5ER6A 1TT5A 1HWYA 2CVZA 5K9ZA 3BMNB 1PJLA 1Y8RA 4KQXA 1SC6A 3PIIA 1B8PA 1XEAA 2O3QA 1QV6A 4K1LA 3HDQA 4OKNA 2ZCVA 3JYOA 3WGQA 3PK0A 1DHRA 4ONEA 4RPKA 3IS3A 1F14A 1R4NB 1LRLA 3CIFA 3F6YA 4NK4A 2O7SA 3WOHA 1YJQA 2QYTA 3WNQA 3BTOA 3WQRA 3IP1A 5JCJD 1X7HA 2D4AA 5DBGA 4CV2A 1JWAB 3VZSA 3ASVA 2W2KA 4M49A 1RWBA 4DYVA 4FFOA 2BLLA 3PHHA 3ABIA 4LSWA 1HYGA 3VKVA 4TZKA 4BMVA 1LTHR 4HWKA 5J23A 3RROA 4BQRA 2VHYA 2X22A 1KVQA 2VHZA 2C59A 3H9UA 1Z82A 1A27A 3ZU4A 4C4OA 3F4BA 4KUGA 3GNTA 1RM3A 3KYDB 4BO5A 2JD1A 1SO8A 4GX0A 3BTUA 1DLIA 3TZKA 1YGYA 1VJ0A 5AOVA 2E37A 3DMTA 3NV9A 4BNXA 4GMGA 3PGJA 5B1YA 3RUEA 4K6FA 3CZMA 3D3WB 1K6IA 4W99A 3TWOA 3U9LA 3C1TA 4CQMB 3DBRB 4Y6PA 5I9MA 2YZ7A 3K96A 3KSUA 3NYWA 3WXBA 4B4VA 1OOEA 1LSSA 4ZA2A 1IZ9A 4OM8A 2I76A 3I9LA 4U7WA 3QHAA 1SOWA 5T6BA 4YAIA 1Z45A 4IDFA 4QECA 3RJ9A 5LDGA 4JCOA 4BNGA 4FFPA 4FN4A 1YDEA 2C7GA 1H93A 3GVCA 3GRPA 1JW9B 2VYNA 4AJJA 1ZJYA 4FFRA 2VRCD 2HAEA 3TZHA 1KEVA 1ZNQO 5EERA 1O95A 3Q3CA 3ZWBA 2BELA 3FNFA 1VL8A 2OORA 4RL6A 2HO5A 5GZ1A 3L6EA 4GWGA 1E6UA 5G4KA 1YE3A 3ZWVA 2PY6A 3AUUA 3RIHA 2WYWA 2W4QA 1HDZA 1V0JA 1JKJA 1Q7BA 1VL0A 2DU8A 2ZIZA 2HMSA 3GHHA 4BNFA 4D46A 1F8FA 3PHGA 4MP8A 3DBHB 1LC0A 1RYEA 3FNGA 3UOGA 3HSKA 4U6QA 1P74A 1VSVA 1U5AA 3AY3A 3DL2A 4WLFA 3I9OA 2AQ8A 5EL0A 1X14A 4B7UA 1U2GA 3QW2A 1ZSVA 1PGNA 1S6YA 2ZQZA 4AJ2A 1ZK3A 2O3JA 4GLLA 1UDBA 1R12A
chains in the Genus database with same CATH superfamily
2WDPA 1NUPA 3PNOA 1TMYA 4GNRA 4M8IA 3DZGA 3VPCA 3BHJA 2QW8A 4PLHA 1OX6A 4IQGA 2CJXA 1LNZA 1SZJG 2BCJQ 3FNEA 3OTWA 4J9UE 5A5GA 5K45A 2Q5CA 5HFNA 4ND2A 3G1WA 5HX7A 1SKMA 3HJHA 5A5DA 5FNVF 3JQFC 3RT7A 4J0JA 5I8ZA 4ZT3A 3WL8A 1HRDA 3D8SA 2AIRA 3RM3A 4OYRA 1CUGA 2PKQP 2BDTA 1H2BA 4LZZA 2FMTA 1JA0A 4JH0A 3M6WA 2XGOA 3K9NA 1CYDA 3B48A 2WB4A 1IY0A 4YJ3F 3U56A 2PFGA 1FF9A 1Q1BA 1DO8A 1XL1A 1YVDA 4PY2A 4X97A 1KMNA 4X45A 2Q5FA 3R7WB 5HHTA 1KZYC 2Z2YA 1Q0RA 4IQFA 5EHGA 3HN6A 5B1IA 1XTUA 5AM1A 4FOTA 1GG8A 3AUSA 3IP8A 4RM3A 1CE8B 2RJ3A 5C1IA 1KJJA 1M0EA 2VCHA 2RGYA 2FG6C 3KX2A 4CM8A 5DOVA 1NOIA 1TYEB 1W46A 1XALA 4DLYA 1XFAA 1TZMA 4IOMA 4PG4A 2CLFB 2PH5A 5BWCA 1E2GA 3I83A 4MVJF 1R6UA 3FJ1A 4M9CA 1YT5A 5DBOA 2Q4OA 3E9QA 4MMYB 2J6HA 4NCJA 3O0TA 1YS1X 4NWIA 2J7KA 4XD7A 2GETA 2O3TA 4Z7NB 2AW5A 1ZN7A 2FW8A 4NE7A 4NZMA 4M7OA 3T3GA 3KEMA 3DC7A 3GOHA 3L5KA 3KLNA 1UAAA 1G20A 1VGQA 3DVAA 2XUQA 2X0NA 4ZU3A 4KIFA 1LK5A 2VPIA 4AWBA 1J49A 2IOYA 3OLZA 1DBQA 4RFSA 4ZVSA 1XPUA 4XYLA 5ER9A 1APBA 3ICVA 3O84A 3VV3A 1XCLA 3KJIA 3L6OO 4IJUA 2NZ2A 2UVPA 4NONA 4ER5A 3TUZC 2XI4A 1ST2A 1Y42X 4GOXA 2CL6X 4TV9F 3FGPA 4GAEA 4AXBA 4G4SP 2BFEA 4G97A 2G1JA 5FPTA 4ZHQB 4HS9A 1V9LA 3INRA 4QTYA 3NIDB 4DTIA 1R5NA 3BHIA 4OQFA 1RAFA 2YBDA 1A5AB 1E1QD 1N0HA 2OK7A 4KNWA 4LXUA 1UPAA 2XUJA 1SCDA 1GDDA 2YXNA 4L74A 3IEIA 1YIOA 2FK8A 4FB5A 4KIJA 1NHGA 1DPGA 3TTUA 1KJZA 5EIWA 4D9NA 1F7VA 5I45A 1ZHOA 3I9FA 1XVTA 2B2XA 3GLGA 5EE5B 4ZGWA 1BRTA 4DMKA 4X0EA 5I48A 2GD6A 3OHPA 5LM3A 3ZHUA 1VG1A 3HDJA 1W5SA 3HB0A 4E2ZA 4BUZA 5KHOC 3RJ5A 4J3JA 3DOHA 2OYSA 2OBBA 1XYYA 1KBZA 5TSDA 4P3OA 2BEUA 2JBAA 3LUAA 2PJRA 3LQKA 4HL6A 2VDNB 2VVTA 3I04M 1TM5E 3ZI7A 3OD5A 4A03A 2Y0BA 4OA8A 4BX9A 3IPCA 3LLMA 3OPXA 4FTWA 4N0DA 4Y2QA 2CXXA 3AL3A 3E58A 3SFVA 3TLEA 3TMAA 4F11A 5FEUA 1RQGA 3I9JA 5J2TB 1P0IA 2YWJA 4YCCA 3KE9A 1KI1A 4P82A 3RS8A 3BWYA 3TXXA 5C53B 4IDQA 1GUBA 1GQRA 4J0IA 1UFRA 3KU1A 2QDXA 3FWYA 4EHDA 2D1FA 5BMOA 2DPYA 4L72A 1RM4A 4OCZA 3HCWA 3HKBB 5J1TB 3QWFA 1SB9A 2VQFB 1ECPA 2HSEA 2NYUA 4BNWA 3S1SA 1SMKA 1LDBA 3DWEX 2XUGA 1IFXA 3DWFA 3H9QA 4G63A 4HSGA 4IGKA 3FDZB 4J1QA 5G0VA 5B53A 5KDLA 1PQPA 1J5EB 2I29A 3T35A 3STTA 4F9FA 2H2DA 2WNSA 5E6SA 1L7XA 2YZKA 4YDHB 1PS8A 3QLEA 1JJFA 4MH0R 3G0BA 2J48A 3QVLA 4O4LA 4F5ZA 4IWXA 1M34A 4ZYLA 2IX3A 4BMYA 1RPZA 3S27A 3UGTA 1NXPA 4QUGA 3E7DA 2C5AA 4L02A 3SS8A 2KS6A 4BEVA 5SZHB 1RQPA 3CZ5A 3OCJA 4Q02A 1PG5A 5JROA 4B3TB 1ITZA 1HTBA 2ASEA 1JV2B 2O0HA 4OHCA 3BXPA 3CU5A 3T1YB 3SMVA 4B8YA 2V1UA 2CEKA 4G81A 4HNAA 3G0IA 2GZSA 4UXHA 1GLGA 1EM8A 2ZJ4A 5C1DA 2XWPA 3EH1A 1K0UA 1P5JA 2Q0XA 2VTKA 1J2RA 4R51A 4RFLA 3QYFA 1EFRA 4US0R 2GD2A 4WKBA 3QUBA 3UWKA 4ZFNA 1K4MA 3DZFA 5FJJA 3PJDA 3QQ5A 2GESA 3RBVA 1A9RA 1JEYB 3PI6A 4Y9UA 1U0BB 3C41J 4FHEA 3EXG2 4RPCA 3F6BX 4W63A 4JA0A 2LPMA 3SR0A 1GY8A 2G6TA 1TJPB 3KR0A 5M29A 5IMSA 2A0FA 2AN3A 5AHOA 2FEPA 2JLRA 3BD9A 1UPBA 5JAMA 1LI5A 1NW3A 1O9HA 4GW3A 4MQLA 3U3JA 4C5CA 4K3VA 1FNBA 1B2LA 2W6JD 4EJMA 3DLBA 1EGMB 2IIQA 3C3DA 5NLLA 4F3NA 2XXBA 3COSA 5HR5A 1LVHA 3I72A 1DO2A 1XRJA 3ILYA 4IJ6A 4WY5A 3LCRA 4TYNA 3SDBA 1Z2CA 2GX6A 1W581 4A15A 1L5LA 3TIFA 2VBFA 2I4TA 2IDZA 3ENWA 1L7NA 4MS4A 1FUEA 1OBOA 3QM1A 1A8UA 4KE9A 3H2BA 2B20A 4IM7A 1ISSA 4KAAA 3VTZA 5JDIA 3HP7A 3ZNNA 2ZXUA 1PJTA 1N1MA 1T5OA 3FN4A 4NPAA 2POCA 3SLGA 5K0FA 1UL1X 2J1LA 2ZBDA 4U2BA 1COWA 2AYXA 1OZHA 2FSHA 3X1XA 1E3JA 3SZ3A 1P2TA 2ZRDA 2NXWA 1ARZA 5K3FB 2NXEA 2X19A 4C4AA 3EMDA 1KZ7B 4I55F 4L9RA 4UARA 1YR1A 1QGOA 4KYVA 2VIIA 1ULZA 3L4EA 2YYAA 3LZCA 4O59O 3WYAA 3ZX5A 4A0FA 4UDYX 4NNPA 1ZHHA 1CB7A 3PQEA 1Y4ZA 1ABBA 3BJEA 2IEZA 1BSVA 2PWYA 3KE8A 1V11B 4IIJB 4Q4AB 3TQTA 3ZH9B 1X1RA 5KKNB 3AEYA 1FW6A 3PD1A 4OTZA 1ZKMA 3G2HA 2AUMA 1ZZGA 2FNAA 2D7CA 1JKXA 2N75A 3ILXA 1Y0BA 3R8FA 4HS4A 3E70C 1LF5A 3ISVA 5DYGA 5KTRA 3MF4A 1PD0A 3KQLA 3OFVA 1KQPA 3N2NA 5E8RA 5DTJA 2FUCA 2FDCA 5DW3A 2R5NA 2LRHA 2C2MA 1P9LA 3K05A 1FX0B 1NRJB 2GO1A 4J2HA 2MSLA 3ZBTA 2ZR8A 1QU3A 3RU3A 3L4SO 1DNPA 2Q6OA 3EXHA 2CSUA 4R1UA 1Y82A 2UVDA 3I1JA 1V1MA 2ZJAA 5JQGF 2Y0EA 3VRHA 3C7TA 2V58A 3LCJA 4GZ5A 4B3GA 2G9ZA 4P4TA 1M2JA 1KL7A 2GHTA 1AU9A 1JECA 4KWTA 1NJSA 3D7MA 1CF9A 4MWCA 3EA5A 5DT9A 3B1YA 2HX1A 2RK6A 3H4MA 1FDUA 2DTDA 3MWGA 1KI9A 1E3QA 3U5TA 2RD2A 3EIFA 2YINC 1RD4A 3DXFA 3DE3X 1AZSC 1QH8A 3GNSA 4XEHA 2XWJI 2WKWA 3KPVA 1E1LA 3CEJA 1T2DA 3SF8A 2RE8A 2IE8A 2XJ9A 4P33A 1TPZA 2PIAA 2QKYA 5HF5A 4F72A 4ZCSA 4ZI3A 4HVLA 1CHNA 1OX4B 1ZO8A 4DCMA 1QFYA 3GLGB 4WFKA 4EFNA 3Q1KA 4ZV9A 3W2IA 4CHGA 1J1UA 1E69A 2HF7A 2XE6A 3SXJA 3LRPA 1ATZA 2PV0A 3C74A 1LS1A 1DUIA 1KOFA 1SJ9A 1ZL2A 4S35A 4WZ6A 3C8UA 3OU7A 3BK1A 2JFNA 1JSLA 3D8NA 3PGKA 3KBOA 4P3XA 4PSVA 4ZZ0A 3OIYA 3PQ7A 3JVVA 5DVZA 4IF4A 2QY9A 1OXKB 2P27A 3QW4B 2FEWB 3ZWYA 2PUDA 3PUWA 1JEQB 4URHA 3T5BA 3U4CA 5AI8A 2OO5C 4KH1A 2DZDA 3HKCA 2IYYA 1K4KA 4MQ6A 3GX1A 2VG8A 4GYWA 3FZNA 3KPUA 2J4FA 4G56A 4ZC8A 1YR7A 1DIRA 1LSOA 2QQGA 4NBSA 3G9ZA 3O2QB 1CUUA 1AN0A 1LVUA 2IF0A 5FHQA 3IHWA 1XAIA 1C3JA 3G79A 1PGQA 3MW8A 3NHJA 2LTAA 4YJHA 4ARZA 3QA3E 1RRKA 3GIWA 4IKEA 5JARA 3BMOA 3A1WA 3OSUA 3GDHA 2Q5EA 4Z3OA 2CF5A 3NATA 4HUJA 4IDBA 1YZNA 3M1IA 4QRDA 1DQZA 4E6EA 4FEAA 2VJCA 5F9MA 1RTKA 1I1NA 2R6R1 3TI7A 3LVQE 1IXKA 3AHDA 2QW0X 1DKOA 2XUIA 3DT9A 2WY2D 5E3IA 4JJZA 3CX4A 4LOLA 1EG7A 1UMKA 1XYGA 2H2AA 4W1QA 5AIBA 3DE2X 3W5HA 1G41A 3BAFA 2R6AA 1U7XA 2AOTB 3KQNA 1UK9A 1KVRA 2PX6A 2EZ8A 5DLEA 3CTMA 4R8RA 5ECDA 3RIEA 3V1KA 2HMVA 3HRHA 2YWCA 5KPDA 4PIPA 3N87A 3T3OA 5IT0A 3HI6A 3C45A 4P5DA 4FE4A 1Z33A 2DBZA 1T6BY 3ROZA 2I2AA 1IY1A 1UBSB 1JP7A 2CLHB 2IYTA 3VDQA 4I9HA 4G8CA 5K3SA 1AM4D 4J0CA 4DW8A 1SR8A 4TRJA 3N6VA 1DT5A 4RF4A 2WAMA 1ZUWA 4QSHA 2DT8A 2BBOA 5IEBA 5FTMA 1E4EA 1DWQA 1RYMA 1U99A 4OP3A 3F8SA 2PKWA 4QJ4A 1M2EA 2R47A 4I19A 1IXZA 4NOJA 2WTAA 1GL3A 5AQEA 2A84A 5AVXA 3HUFA 5GV8A 4W5QA 1Q0UA 2H00A 3BZWA 3J80A 2DHQA 3MJCA 4EA7A 1KIMA 4NPCA 4PSUA 1O9GA 3B1XA 5DMXA 3B20A 4GG1A 4HTFA 1L5VA 3FOZA 2ALJA 2EWWA 4H6VA 1QIMA 2Y6VA 2B83A 3KXDA 5ADHA 3H5VA 2CYCA 1FFXA 4B84A 4A8PA 4KCGA 4MPRA 3PKJA 3ZXSA 2Y3IA 1V16B 1V3TA 2X7XA 3RSGA 3HEMA 2XOKD 1YS9A 4Z4GA 3DYVA 2B35A 1CE8A 1T3TA 2QAGC 4ZV7A 2NU9B 2WZCA 2WBLC 5FA5A 1M6WA 1NY5A 3H97A 1A9OA 1GPNA 2JRLA 4Q1FA 4UC0A 1ZSNA 2ZKLA 1J20A 3BB3A 4TTJA 4LAFA 5DWVA 1QP7A 3LD9A 2LUOA 3E22B 4Y3UA 3TTTA 3K71B 3LV8A 1PK9A 4HVAA 1V25A 2RI0A 1WS6A 4WGGA 1UAGA 3LUFA 2A4KA 3ZCXA 2Q3JA 4IOKA 5HIAA 3K8QA 3LFHA 2QR2A 4L0MA 3V42A 4LGMA 3RQIA 4Z7QB 1PX2A 2JLQA 2JLVA 1YQDA 1TRHA 2WABA 2W4MA 1QGYA 5K03A 4ALJA 1G20B 3SHQA 4KDCA 1NN3A 1ZMOA 3LHDA 1RBQA 1TK2A 1UK7A 1G55A 2FK7A 2P9TA 3NH9A 4KUEA 4W6ZA 2XY4A 4YXWA 3ROGA 1OF1A 3WKBA 2QBYA 5ITZB 1Q91A 2QTHA 3GJQA 1VLVA 3KXPA 1JHPA 1JKFA 2ZUWA 2DCMA 3QXGA 4LV5B 1ESEA 1NP3A 2JATA 2R4QA 2XCUA 3R09A 4YBZA 3WIOA 4DMUB 4CIAA 1HH4A 2DWQA 5FD8A 1HTWA 1C1DA 2CVFA 3IHKA 3ZZNA 2WMYA 1I33A 1TU4A 4TKLA 4C87A 5KWSA 3I42A 5AKJA 3N2GA 5I5GA 3RHFA 1UPTA 1ZL0A 2PSDA 4ZTZB 4RHFA 2BFBA 2XA1A 3ORYA 3CZPA 4ZVQA 3U6KA 1KZ9A 2ABWA 3KB2A 4WCVA 3GEBA 4GQIA 1RABA 4EHLA 4EY4A 4KRGA 5IBRA 3VOBA 2J67A 1UJCA 3JQBA 1KOLA 2YWRA 4NDNE 2VNAA 3DVAB 1FUIA 2JLZA 4LDNA 1DDGA 1FDWA 2Q3CA 4UQOA 2JD0A 5KAPA 2EJCA 2G72A 4C6HA 3B70A 2ZP1A 4JVSB 1WXGA 2Q5JA 4ZVUA 5F1OA 2HIGA 4RX1A 3W6ZA 1Z8HA 1K7SN 2KHZA 4S3MA 3MCVA 2XT9A 1RPAA 4BNTA 4LGCA 4C7BA 2SKEA 1ADBA 2XYGA 4TUYB 3WBFA 5LZ4A 2FSVA 2OQIA 2L0XA 3FUUA 3W06A 3WV5A 3QVOA 4YRBA 4F4CA 2JHPA 5K0GA 2Q1TA 5DV9A 1QZZA 1NYRA 2FPKA 4M0FA 3FSGA 4AYTA 5IXYA 2RHRA 2ESRA 2W6PA 3EXIA 3KL2A 1FYVA 2BMEA 2OSVA 4OJNA 4KOEC 2I1WA 2ZDHA 2NUPB 1MLDA 5F7ZA 2PRIA 3ZGZA 1KDOA 4K9KA 1RC1A 4LY0A 1J09A 4R05A 2WG0A 3GLIB 2ZTLA 1E1YA 1II0A 3GI1A 3LNCA 4LOKA 4P7KA 1Y9EA 5CJPA 4JIMA 1VB5A 5JZVA 2WPNA 2AFHB 2RDMA 1W2HA 4QTUB 1RWOA 3UV6A 4BRUA 5IYZB 4P0PB 3AEUA 2WSSA 1V6AA 3DZIA 1QMGA 4OL0A 4EITA 2JL1A 3D2CA 1Q3KA 3VKGA 3GFSA 3HG7A 5EYPA 4G1FA 3SKYA 1YRHA 2D2XA 3BKWA 3NTRA 2HZBA 2DE0X 2JFQA 1OPXA 4GMKA 3I04A 5AJTA 1YHZA 5HVNA 2YXEA 2HFJA 1O94D 3MJSA 4R2LA 1PIWA 3KLPX 2H7YA 4UUOA 1R6XA 3QU9A 4KAXA 1U8FO 2B98A 2OHIA 1XKXA 4P7FA 2OCAA 2KJQA 4E3WA 2UVQA 3ND7A 2PGNA 1JTEA 4J16C 2FHSA 1VSUA 2O1XA 1VMKA 2R7KA 3VH2A 4DLSA 3ORQA 4F3TA 3QE3A 2GZHA 2I55A 1P31A 2QM0A 4GLJA 2INGX 1GHTA 1VI5A 1XA0A 3RABA 1PTJA 2NUBA 2ZSUA 4HDCA 3H3XA 3A11A 2B4QA 3R7DA 5C7LO 5EZSA 1CJUC 2BJWA 3DR3A 2ZE8A 1GR1A 1TVEA 2FOIA 5BNWA 2W83A 5FAKA 3K30A 4EYEA 1ILEA 3JZDA 5DYWA 3LQYA 4V1CB 5KJ6A 5CK4A 5K8UA 4KUHA 1Y8AA 4C5AA 5DFAA 2HPZA 3BFXA 1EIWA 4EMTA 1KEEA 1TM1E 5F1YA 4QBHA 4AY3A 3X0DA 3TBKA 4DCCA 1J39A 3HVUA 4YRGA 2P65A 5JMWA 3FRJA 3HE3A 5GAJA 1SELA 2WVAA 1U0SY 4PAGA 3EQ2A 1CUDA 1MX5A 1RQXA 3ZXUB 2PMDA 1U0GA 4ZAWA 3CO5A 3RE1A 3DDHA 1KY3A 2RHCA 1QH1B 4HRVA 3R8CA 1F0YA 5A06A 1F2DA 3DV9A 4IDHA 1AQJA 1X7GA 4LCEA 5HKBA 2LKCA 1Z4NA 2X7HA 2Q2QA 1JIKA 1TYBE 2G5GX 2OY0A 1YMQA 3OWOA 4HDKA 4RZ2A 1BGXT 3ICCA 3DCNA 5IJAA 4DIUA 2CBZA 3UJ6A 2FDXA 4KE8A 2Y2UA 1E9SA 2CJFA 1GKLA 1ND6A 5EP2A 4KITB 3KTFA 2C07A 1GPDG 3UPTA 3TDKA 3IDFA 1MG0A 4WOJA 5JD4A 1Z6ZA 1YZTA 1NLUA 5EJ8A 3BCHA 3NX4A 3PEWA 2WWHA 2ZJ5A 3QKWA 2JNWA 3TSAA 4HDNA 2DERA 1SUCA 4CU5A 5HRAA 4GUDA 1ECLA 2Y67A 1NW9B 3DMRA 5DI9A 1MT0A 4CCYB 3U7HB 1E7RA 1GFZA 1NC1A 1S96A 3G5TA 3PGXA 2RGUA 1W59A 2O2EA 3QITA 2DVMA 4KQEA 4MI6A 4PZUA 4KNVA 4YEDA 4RLQA 3ISJA 5JYBA 5IN5A 4YRKA 3AINA 4BFYA 4P84A 1PK7A 4OYHA 4XQEA 4DMHA 5L45A 3NB0A 1DKNA 4J2TA 3M2PA 3U44A 2HK6A 1KIAA 3QBJA 3N74A 3DKVA 2OBYA 2J3EA 2QQEA 3BUSA 1UPUA 3UWSA 4BU0A 4DLWA 5CVJA 2J0UB 4HPXB 4LY9A 3UFBA 1S1MA 1UMDB 5E6UA 3U16A 2XCLA 3AVQA 1OZAA 3ZWKA 3QMPA 1V1MB 1ZN9A 4M88A 4ZREA 2MSDB 4MJLA 2QYOA 3GLFA 4IGFA 4KP7A 3QLVC 2MU1A 5CH3A 2XMSA 2TMKA 2A0YA 4AI6A 3NM5A 4R9VA 3QLJA 4UAUA 5J2UB 5LA6A 3KXKA 4F85A 1P5ZB 2V6IA 5LL6P 2B2CA 5DGTA 1GTRA 1TLTA 6Q21A 2QK4A 2IOHA 5IBQA 3WYBA 1N75A 3OM9A 3ZJUA 3THOA 2NQ2C 2VKTA 4NS1A 4U2EA 1LXCA 3QNUA 1M6VB 4QGAA 4EK9A 5TVKA 3DT8A 1PEDA 1NULA 1MTOA 1E9EA 1ZRMA 3KIPA 4BMOB 4DQ0A 1S4MA 3FGNA 2NVUA 3DHEA 3DMYA 4EVIA 2GZAA 1RYYA 1U04A 2V74B 2C2WA 2Y05A 2D1TA 3TVYA 2A67A 3AONB 1RW4A 2O6LA 3FOCA 2IPXA 3UYKA 5FBZA 3ZLUA 5B64A 1FX0A 5IVHA 2V65A 5I7EA 1UDXA 3ZZTA 1I3OA 3BA1A 1JYSA 3NDJA 5AW5A 3P4YA 4MW9A 1G7CA 1J06A 1W76A 3GNQA 4HAVA 4K6MA 1K2VN 3QXSA 3TIXB 4Z3DA 5HUJA 1KO7A 2C8LA 4NV3A 1UZMA 5JR3A 3BWCA 4TPKA 1S2LA 3BD7A 5CYPA 1A8QA 4IMIB 4AMZA 3PUJA 4D8TA 5HZKA 3ACDA 1NVWQ 4Q7JB 1CR6A 2VP6A 4ZO7A 1TA9A 1YZFA 2EG5A 3ME5A 4HGZA 5EA2A 3ZE8A 4EEXA 2K5UA 2P41A 4MYTA 2AR7A 5F73A 2FQWA 3OBIA 3DL7A 4O2BA 2O0MA 2EF0A 4KPUA 2WF9A 2VK4A 4YO8A 1LTQA 4UMFA 4DUGA 5KVSA 1ZNXA 1NDQA 1OTXA 3FCXA 4O3FA 2YMMA 3GW8A 4OMUA 4S1TA 4WCFC 5ESRA 5IMBA 3T41A 3VZRA 1YDFA 5F12A 3T5AA 2FJPA 3CB4A 1VKZA 3FSJX 2OXRA 2REBA 1Q50A 3OZ7A 2BVNA 1SBIA 2R48A 4PXAA 3WXMA 3SSOA 1Q92A 3TIGA 4HT3B 1WULS 3F7NA 1YSCA 4DQUA 1ES9A 2QG4A 4HDQB 3HB4X 4NMLA 4P98A 2DCUA 3RKSA 4RF2A 2XGJA 1O6BA 2J3IA 4A3SA 3ZD6A 1R0KA 4ZGBA 1P73A 5EIOA 4DC9A 2DSTA 1DKMA 2EEZA 2NUTB 3OF2A 4GWLA 1CPYA 5BT8A 5LD2C 4RADA 1HEUA 1IBCA 2JGIA 2QRNA 5EIHA 3I8OA 4WA8A 3D3WA 1EUCB 1AS3A 1E0KA 4FEGA 5EZ6B 4C0XA 1US8A 2AC4A 4UVEA 4BQNA 1O08A 1VRVA 3JASB 3WK9A 1HZZA 3EPPA 2VYCA 4YRCA 4AP6A 1OXSC 1P80A 4Z4IA 2IS4A 4RGBA 3KQTA 5JRJA 3RRXA 3HLKA 2CBXA 4FWBA 2AFIB 4C78A 2ZVQX 4P31A 1ZJ5A 2QMYA 3SC2A 4MRVA 5B37A 3SHOA 1TU3A 3CVUA 4JSTA 4D9CA 4ZT4A 4EJSC 1I5EA 4KFTA 4BWYA 4D97A 2QTVB 3GV0A 4NAHA 2FZLA 3JWGA 3U80A 2WWVD 4BXOA 1IB0A 4YRIA 1UFKA 1Z8FA 2X8WA 5DSZA 3U5ZB 1A69A 2OXCA 2QMHA 1E18A 1KA9H 3VBEA 1CB0A 5JTUA 3GJ6A 2FLVA 3I6BA 3CCCA 3UN1A 3V34A 4A1OA 4O1IA 4CM4B 5LJIA 1AKNA 3CJRA 2PSFA 3R6WA 1ZU4A 1SUIA 2XB8A 1BWPA 1RWXA 2A9VA 1JU9A 2BBTA 3D1JA 3KZKA 3KOUA 3IUNA 4OQMA 5CU7A 5UKDA 3LYAA 3TLXA 2HPVA 5KSZA 1XRLA 1LW7A 2J3MA 3PJGA 5AT1A 1CKEA 4YJ3B 1MQ8B 3E5MA 2Q4EA 1M9NA 2W71A 3H0EA 2BGNA 3S0JA 3WFJA 4U00A 5IABA 3B13B 3BGIA 3M4XA 1UBMS 4K81B 1ABFA 1LD3A 2C61A 2CFCA 4WD3A 5G0TA 3UKOA 1OILA 1GZSA 1W4ZA 4XUCA 3RTEA 3GFTA 3C98A 5AI9A 4IJWA 3SQOA 3WHIA 1JLHA 2P9QA 3VJKA 4Y2YA 3MXOA 4OHYA 2E89A 3AZQA 5AVRA 3P2IA 1TEZA 4HQKA 1DRKA 4UTNA 2A59A 3U4QB 1N6RA 3ZS8A 2Z8YM 4JLWA 4AMGA 3IJ5A 1H1DA 2DWOA 5B7GA 2P11A 3JAKB 3WK4A 3WLMA 2CXHA 2UYOA 4RZQA 3OOSA 1N3BA 1QIKA 2AYYA 2JEYA 1KS9A 4ZEOA 2YTZA 4JJFA 3L0DA 1ZH4A 2B7LA 4M0EA 3NDRA 3OVMA 5C37A 3CN7A 1JR3A 4ZVVA 3VR3D 4NCNA 1O0CA 1RI3A 4K0KB 3CRMA 4DMGA 5EMKA 2HXGA 2WF7A 2O2IA 3N0TA 5IAGA 2AEEA 2R6FA 2GAIA 3O1LA 3T5CA 4CEHB 4QFBA 4FFVA 3O1HB 4B4WA 3PDJA 1UMDA 1XZCA 3K4QA 1D0IA 4AX8A 5CITA 4ODIA 3ASYA 4G9BA 4EIWA 1TUBA 1NQ5A 2C2KA 3NR2A 4KHZA 4CV1A 1X7YB 2W70A 1MC1A 2AJTA 3LPDA 2IOFA 4IX1A 5B3JA 5KC8A 4HQRA 3W5SA 3ZY4A 1FFYA 3S7ZA 2D0PB 3AL2A 3FFTA 4DARA 3B5EA 5CFRA 3WGJA 3W3AA 1XJQA 2JAUA 3MMPA 4QVKA 4B71A 1XZDA 4BC1A 1D2AA 5HSGA 4TLBA 4RLFA 1EG2A 2PGLA 5K0SA 3HY6A 2LXNA 3WRWA 3GA5A 1PDOA 1GZ7A 1ID1A 1P7ZA 2P1DA 3H17A 2GOYA 3D6JA 1TZJA 2XHZA 4OGLA 5KYVA 1M5RA 4N7MA 1ISGA 4E5UA 3IAXA 2REQA 2LE0A 2OPBA 4NY1A 3VR4H 1XLUA 3D5TA 3SLKA 2P30A 1K97A 1B8VA 3JCZA 2O19A 1C7ZA 2PANA 3MWLA 5C7OO 1NXTA 1JFLA 3CMCO 3INTA 3D7RA 1WHTB 2WR8A 3EGXA 3MA0A 3MRSA 1P3Y1 4LTDA 4MWEA 2CYBA 3NV7A 2GNOA 4OJYA 1QUFA 5EUBA 1SXJD 3ZWMA 1TW2A 3D3EA 3CVXA 3I5YA 1GGNA 5H83A 2C96A 3F47A 4A26A 3IOYA 1IBMB 3N3AC 1Z07A 3D64A 1UIRA 3QU2A 3H6KA 2H07A 2XE4A 3KU4A 2IPNA 1JIJA 2JFHA 2YWEA 4GE3A 3T5GA 4DDVA 4UE6A 4AULA 1UKCA 3QELA 3AG5A 4YBRA 4ZVPA 1ICEA 2OCXA 3KR2A 1Q19A 4E15A 5HJEA 2H2GA 5JAIA 1VG8A 4IUCS 3QEBZ 5MF6A 1CETA 1D2HA 4QOSA 4DANA 4FZVA 1A1SA 2PYDA 2JGFA 1OX5A 3KKQA 4DGQA 4TWBA 2OBLA 3DYIA 2XT0A 3DXXA 2JJYA 4URUR 1WAMA 3ZCSA 4YP6A 3MT8A 1NOKA 3CSUA 1G4UR 1IN4A 1SVWA 3D8TA 5F7JA 3H0CA 1XVIA 2ZS8A 3PFKA 3SPXA 3ITEA 1G3UA 3AIKA 4FC7A 4RVUA 4K9MA 3N58A 3WZLA 4TXNA 4A91A 3DCIA 2Y6UA 3A26A 1D7AA 3GBVA 4FX2A 5H70A 3CLRD 2OXTA 3RVMA 4PAOA 3WLTA 2WHPA 3QEKA 3AK4A 3KTDA 4YJFA 1OGJA 4DS3A 2GEUA 2BRUC 4U2CA 4F71A 3HKBA 3FCSB 4YX9A 1MJNA 4JP1A 2IYZA 5ES4B 2Y1LA 2JCXA 4M1KA 3AERB 2HXYA 3TL2A 3UANA 5CDHA 2ZW9A 2VA9A 3IMGA 2JLYA 2OV6A 1GAEO 4BO9A 4BFLA 4LJLA 1U3WA 1Z8DA 4UFNA 1G9TA 1B0AA 1RBYA 3GFBA 4HNRA 5AYVA 2A5JA 4LFBB 3TQSA 2VQ6A 3BCSA 3KV3O 4KACA 2VN8A 4KGVA 4MARA 4PCUA 4Q1CA 5AHWA 4AUMA 3LDUA 1G3IA 3QP9A 5A9RA 4FC6A 2UXCB 4GPTA 5AW2A 4Y1RA 5C8ZA 5KNDH 3FDIA 3S2IA 1FDRA 4B6EA 4CMGA 5F2NA 2FSGA 3RS5A 1CRZA 1YMUA 2HU7A 1TTHA 2F67A 3E8MA 3QK7A 1C81A 4QFCA 1SXJE 2PA0A 2BI8A 5JHGB 3C6KA 2J3JA 3U49A 4OHVA 3WKEA 3RYHB 3KVVA 3KT3A 5H16A 3CSSA 1DTWB 4HDKB 4KIGA 4PRYA 3SU8A 3NNDA 1MX9A 2XH8A 1MVOA 1N92A 2IGTA 4L75A 3GCXA 4PX3A 4RLHA 4CODB 3OQVA 3K8OE 4JUIA 1E58A 1UINA 2GYVA 4HXFB 4DCOA 1ZIPA 1XMJA 1P1HA 1IVNA 1ZQ9A 2CLLB 2EBHX 2O57A 3L84A 3LO5A 3R5TA 4GPAA 4C4TA 4EGSA 3UT5A 4Z5XA 1M1NB 3UJNA 3OEEA 1SXIA 3W5CA 1Z38A 3OTGA 2GJ8A 2YIDA 4JLNA 3Q4GA 1SNYA 2QL5A 1S3SA 1V8FA 4CCYA 3OCXA 4UBJA 2BRUA 3FUXA 4LECA 4I36A 4U8GA 4Q3LA 1YS2X 1SUWA 2WWXA 4B83A 1QZ3A 2CJWB 1DSSG 3ZE2B 4N03A 1P72A 4D9KA 3DW3X 4ZU1X 2ADOA 2J3LA 1ETUA 2CZGA 5DYNA 2G07A 4DBVO 1R6AA 5IJZA 1GCGA 1LLFA 1ZMBA 3A7DA 1BVRA 1UJ5A 4GP6A 5J5AA 4YUZA 3L6UA 2GXAA 1AKMA 1SIOA 1AXGA 2N46A 5BQPA 1XMXA 5LQSA 2Z5VA 2EL9A 4AP5A 4Z1OA 4Y2SA 1TU0A 4X3PA 2VPYA 5FO1A 1S9HA 3IUMA 4BNLA 2L19A 4JVNA 4EKGA 2R97A 3MJTA 2W2TA 2Z30A 1DKUA 3PFHA 2NYAA 4B35A 3IAEA 4UQLA 1GRQA 3OEHA 3DE0X 5LA6B 3U13A 5AW8A 5EKTA 5CCBA 3KEFA 2ISSD 4HJRA 1EA5A 3U1VA 1G8YA 3VYWA 2X8AA 2XRYA 3C5HA 4ZOBA 3WMWA 4GFDA 3KPYA 3B78A 3WYCA 1RYDA 5LIPA 4LNUB 2GDZA 1Y1PA 1UDBA 1G9SA 4YT8A 2GAJA 3E9NA 3H4IA 1CUHA 4KE6A 5A1JA 5D3ZA 5E6RA 5TC4A 1U11A 3PXAA 4WCFB 3TX2A 4YXFA 2DH5A 1T0UA 4H3KB 1J5XA 2C2XA 3C16C 4OBBA 5EJ5A 1MB4A 2AK3A 2Y76A 1YK0A 3M7IA 3WIVA 4QRIA 1BS9A 5KTPA 4WNAA 3LUKA 1TTPB 3K70C 1U28A 5KOHB 2WPDD 3FTEA 1XVLA 3GFPA 1J00A 5IYZF 1HL3A 5FPPA 4Y98A 3X2EA 1DPFA 4AY6A 1IAVA 1L6IA 4I0WB 4ZYZA 2TYSB 2V9CA 1A5BB 4URXR 3PV0A 4W5JA 3QMWA 1W5EA 4R9SA 3L6CA 4JBLA 3RFXA 1IM5A 4JDPA 3PUVA 4ZIRA 2R8RA 2FR8A 2ZI7A 3N7AA 1XN4A 1I3NA 1BG6A 1E2QA 2Y2VA 1LPMA 3E8SA 2PMKA 3IRVA 3ZV3A 1L4HA 2NU8B 4DIMA 1AC5A 4K0RA 1R5JA 2APJA 4R0VA 4NOKA 1M2GA 1M0SA 1J90A 4LXIA 4YUWA 1XPRA 3O21A 1T9GR 4CETA 2P2DA 3QWAA 3WGHA 1CFJA 2QAJA 1TUGA 5DBHX 2QF7A 4B7CA 1H8HA 1JNXX 3P1JA 5FLXA 1UT5A 2H16A 2BKEA 4PVDA 3U39A 3A25A 1Q11A 1BN6A 3LECA 4R1SA 4WVLA 1CQWA 1N6IA 4YP9A 2E6UX 3HYTA 1LV8A 1LJ8A 3MB8A 4NG5A 4WXRA 5AK3A 1WZEA 2FG7C 3ZZ1A 2EHDA 2QVZX 4KIUA 1EK0A 5E0OA 5GIOE 1A7AA 1L4BA 3HB9A 2J3KA 2MTBA 4CKCA 2JLUA 1QYRA 3D3JA 3ZE9A 4E94A 5BN3A 2QQ5A 1OI2A 2PRYA 3DVQX 2ZSJA 4DYHA 1WXXA 2GXSA 2OGWA 4UCFA 5ALYA 1QDUA 4K6CA 5ABPA 3BGOS 3MERA 1JEQA 2AI3A 4B09A 1DAOA 1Z4IA 2ZB8A 1NKVA 5EINA 3MGGA 5JT1A 3VHLB 1T9DA 4DAOA 4OHPA 3GAAA 5I7RA 4S12A 4L08A 4B40A 2CVHA 3CVWA 2ZR7A 1P19A 3L8HA 1O97D 3F6SA 3RYCA 3D8RA 3D6MA 3VJRA 1KI7A 1QKJA 3KAQA 1UODA 3R0ZA 2H5JA 4ESHA 3O8DA 4IHQA 4MPDA 4PO1A 4WOKA 3SZOA 5IAOA 2GM4A 2C2OA 1O54A 1AKEA 3HA3A 2GJSA 3EB9A 4PQRA 3DEAA 3L8DA 4QKQA 5JPDA 4H3VA 1FXWA 2IXFA 1M1YA 2NVWA 2C9CA 2P35A 4C08A 1O0BA 1EFDN 5FPHA 2YCBA 2YW9A 3HR4A 2F17A 2FH5B 4KN9S 4AC9A 4BAUA 4EF6A 3O03A 1MAAA 2GLUA 1KSGA 4CFZA 2R7AA 3D6VA 4AG5A 4WXMA 2XOXA 3T3HA 1UF9A 2IHBA 2VQDA 3U4MA 3QV1A 5HW0A 1CNEA 3TNFA 3LM8A 2XKAA 1WOMA 1FTYA 3J7TA 3PITA 4OLHA 1O5IA 3JQ8B 1VL2A 2Z6VA 3QXXA 5H9VA 1J21A 5CFZA 4WJZA 4CL0A 3JWPA 2WJJA 3WC4A 3GUHA 1B42A 2FWRA 1LBTA 3MT7A 1QIFA 5DGHA 4NYJQ 2DWUA 3WGNA 3DLPX 3EG5A 3ROFA 1TQ4A 3P2JA 4BXOB 3H9BA 4Y7CA 3SIRA 3EDOA 4R2XA 4DT1B 4ARSA 2ZSDA 5CHEA 3Q5DA 1SXJA 4GO1A 5C4GB 1J6UA 4IG9A 1HM5A 5FLEX 4A2WA 2HO4A 3TZQA 1T8SA 2CCKA 2YUIA 3A4TA 3ELYA 3JQAB 3JVEA 3MWEA 1WUJS 1O57A 1J8VA 1FCJA 3DDWA 3KD2A 3OY2A 5HCIA 4QREA 2G83A 4XA8A 3B9BA 3TB6A 1RMYA 2NU6B 3TS1A 3UG7A 4DNOA 3WSTA 4X1IA 1D8TA 1QQAA 1BYIA 2SCUB 1F6WA 2JJ8A 3HGMA 3OQMA 1WUYA 1IK6A 4KGZA 1J7KA 2W6JA 4PVCA 3W0LB 3J7AC 5B58T 4XR9A 2QVCA 4BKMA 2RBKA 3B1KA 4C0KA 1WTAA 3QMVA 2AR9A 2I7DA 4U0JA 1CR0A 3VNBA 1YKFA 5DI3A 3JQQA 1TYAE 4H4DA 4IDNA 5IT5A 1SC1A 1U6JA 4L2IB 4ZRDA 4KQKA 4YCMA 1U3UA 2GERA 3DKPA 1C9EA 3G13A 2CDRA 4GM0A 4FOLA 5BQOA 3S8EA 4F1KA 4TV9B 2A0KA 4PTZA 3BDIA 2VDWB 2GK4A 3IKVA 5FOSA 3UY4A 5HQ3B 1Y8QB 3VAAA 4YH1A 2K2QB 4UEOA 5ESWA 1RBMA 5BN4B 4KPYA 1EWVA 3KEQA 1TM4E 3ICQB 3NHWA 3RF6A 3WR5A 1P9OA 3O1JC 1M67A 4NZNA 5DWDA 4F7WA 1HUQA 4G8BA 5FWYA 2O5CA 5HMLA 3MOGA 3CMMA 1AUPA 1NJ8A 2QN3A 5MGNA 3VTFA 1IZ0A 1JR3D 4CI9A 3UNXA 1G66A 2O7QA 3PC4A 1E63A 4YREA 1HKUA 5E4YA 1IBRA 4DWVA 5HXAA 1X1TA 3JQ6A 2EIHA 4D0NA 2DBYA 1AKUA 1E2LA 2QX7A 2TRSB 4P4NA 5DI3B 4TS4A 4J0FA 2IS2A 5BSMA 1UFQA 3NDIA 4ZV4A 4W9RA 1MQAA 3HCCA 2ECFA 1XHEA 3WJ7A 4RCVA 1E6LA 3IQFA 2VDVE 4Y6QA 3SFTA 2BCGY 3EHEA 3RTGA 3ZBUA 5FWNA 3DAFA 4HI0E 1KO8A 5GVRA 2BGRA 5CK5A 5E9QA 1RAGA 1HA3A 1I9GA 2F55A 3H1FA 3NXKA 4PWYA 3RS0A 1GZ3A 3KKNA 3HFSA 3NWJA 4MWZA 4QXRA 3TJRA 3NIFB 1L5WA 3WNVA 3E0QA 4NBLA 4DBLE 5KC9A 1V6SA 3BEDA 1Y6RA 3BFKA 2BM9A 3E03A 3RVOA 1RJ9A 1A9ZA 1NR7A 3IR6A 5DM1A 4Q4JA 1H4QA 1E6CA 5KCZA 5FKJA 3ZHXA 4J6FA 1BGWA 2JIMA 3DBHA 1KQGA 5IRCD 3SQNA 1JHAA 3NBQA 1JHXA 1MB3A 1QHGA 1NVEA 4JZYA 2VP5A 4KQWA 1I2CA 4ETNA 5JAOA 5KHLB 2YHIB 3OIVA 3T7SA 5BR4A 1O87A 4GX5A 3NBFA 2JJMA 5H4GA 1WABA 3EODA 2FP4B 1OT3A 2OC4A 2ZUVA 4Q15A 1M5TA 5L4LA 1GQSA 2V7VA 2QMEA 4RGVA 3I9NA 5EZYF 3KKLA 3RNLA 5ALFA 1JDSA 1W4RA 2Z6UA 4J76A 3ZHVA 4C4RA 1I6MA 4ZEVA 3HBAA 4KDRA