1WLYA

Crystal structure of 2-haloacrylate reductase
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
332
structure length
322
Chain Sequence
VMAAVIHKKGGPDNFVWEEVKVGSPGPGQVRLRNTAIGVNFLDTYHRAPPIVVGFEAAAVVEEVGPGVTDFTVGERVCTCLPPLGAYSQERLYPAEKLIKVPKDLDLDDVHLAGLMLKGMTAQYLLHQTHKVKPGDYVLIHAAAGGMGHIMVPWARHLGATVIGTVSTEEKAETARKLGCHHTINYSTQDFAEVVREITGGKGVDVVYDSIGKDTLQKSLDCLRPRGMCAAYGHASGVADPIRVVEDLGVRGSLFITRPALWHYMSNRSEIDEGSKCLFDAVKAGVLHSSVAKTFPLREAAAAHKYMGGRQTIGSIVLLPQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 2-haloacrylate reductase
publication title Crystal Structure of 2-Haloacrylate Reductase
rcsb
source organism Burkholderia sp. ws
total genus 111
structure length 322
sequence length 332
ec nomenclature ec 1.3.1.103: 2-haloacrylate reductase.
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1wlyA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1wlyA01
3DEYX 1HE4A 4ZQHA 5A02A 1PS9A 3NRCA 1Z74A 1RM0A 1ZO8A 1H93A 4J0FA 1UDBA 5ITWA 1X14A 2BD0A 3RKUA 1DRVA 3WBFA 1P3DA 1O9BA 3H3FA 5G4KB 2GN4A 3KRTA 1HEUA 1I3MA 2R2GA 1MC5A 3ANMA 1BVUA 5IZ4A 1PS0A 4AJ2A 1N9GB 1XELA 4I5FA 5FWNA 2UUOA 1DJNA 4RF3A 3OIGA 3WGHA 1H6CA 2O3RA 1EE9A 3KYDA 4XB1A 3DAFA 2IZZA 4PRKA 4PLGA 5DP1A 1PJ4A 3ZWXA 2ZYDA 5JY1A 1C1DA 2JD1A 4KOAA 1E3WA 4Y9DA 5TJHA 3OECA 1TB4A 1UP7A 4FJ2A 4A0SA 2CZCA 3DBRA 1LRJA 2BHLA 3EMKA 2YV1A 3GVIA 1PGNA 1BDMA 3LT2A 1N7HA 1KC3A 1LDGA 4ID9A 4P4NA 4JBHA 4RV9A 4CL3A 2JCVA 3Q9NA 4TQGA 4XGKA 3F6YA 1HE3A 1VKNA 3INGA 4IJWA 4Q3NA 1GYQA 2GPTA 2XAAA 3DBVO 2C82A 2FY8A 4TRNA 3DFZA 3RWBA 1X1EA 2DTXA 3OICA 3TPCA 3UCXA 4MP3A 3RSHA 1Z73A 2NU6A 3FPLA 1KVRA 2RHRA 3Q3CA 4BNWA 3ENKA 5KKCA 2PWZA 2X8LA 2YY7A 5GZ3A 5JC8A 1W4ZA 4PN3A 5EQDA 1SBYA 1K6JA 1DFIA 1GQ2A 2P5YA 3BTOA 3BMCA 1T2AA 4MVJH 2NVUB 5A06A 4GBJA 1OC4A 2HK9A 2R00C 4R54A 4CPDA 3UW3A 3M2PA 2GASA 2FPIA 4FOOA 4Z9FA 4DMMA 2I5PO 3GN2A 1NWHA 2Q3EA 1DC6A 4L0QA 1J6UA 1YBMA 3N58A 1DFGA 1JN0A 1NVGA 1ZSNA 4KUEA 5GMOA 1E3IA 4E2YA 4LVUA 5JAZA 1V35A 4MPDA 4K1LA 4M1QA 1XQ6A 1J4AA 4IS2A 3L4BA 1T4DA 3AUTA 4J43A 4R16A 2Q50A 2D0IA 4J90A 1K6XA 1ZBQA 4Z3DA 2PD3A 1GUFA 1AXGA 1F14A 1UXJA 2VTDA 2X0IA 3JQAA 4PG6A 1YQXA 3U4HA 5C3MA 3D4PA 5EJ2A 2H9IA 4EBFA 2TMGA 3BHMA 4BKPA 4RF2A 4XYGA 5COAA 2FP4A 4DL9A 3C7AA 1ID1A 4HADA 3FWZA 1PL6A 4EUHA 2VZ9A 1GL3A 1KEUA 3GDGA 1QV6A 1UR5A 3CSDA 5IN5A 2FZEA 1JAXA 4J1SA 2Y99A 5KJ6A 4AVYA 3C7CB 1DSSG 1X1TA 4PLWA 5DCWA 3WS7A 4O6VA 4KTTE 4AJOA 3EUWA 4UUMA 4E4YA 3AM4A 1GQQA 3H5RA 4OSOA 5G4KA 1XA0A 1NWCA 4GQAA 2O2YA 1E5LA 3FCOA 1NNUA 3D4OA 2CFCA 1YB4A 4YDRA 3Q6IA 3JQGA 1N9GA 3AI1A 3Q0EA 3KSDO 4J49A 5FFFA 4JNKA 1P1RA 3UGKA 5BNTA 4GX1A 3IMFA 2DBVO 4C7KA 2UAGA 5A9RA 1JQBA 1D7OA 3IC5A 4IINA 1LQUA 2ZIZA 5F21A 4WASA 1GPDG 3KOUA 3TN7A 3T4XA 4HNHA 1KEPA 2C7VA 4E2WA 2WD7B 4BUCA 3HFGA 5DOVA 4LMPA 4MVJM 3ABIA 5U9CA 1DIAA 1R66A 1YO6A 4HY3A 1M67A 2O3TA 4A7PA 3H6KA 1ZEJA 4YBZA 1DIBA 3ANNA 1ISJA 4CQLA 1C0IA 3ZHZA 5ENVA 4M55A 4QEDA 4I5EA 1WW8A 4UUPA 5T5QA 4O5OA 1ADFA 4CM5A 3HDYA 1X0XA 1H9AA 1PS8A 3DTTA 3OQBA 5A4DA 3EC7A 1LDEA 1PJTA 2RCYA 2E6UX 3DXFA 1NR1A 4CMJA 3BXXA 2ZCUA 2NLOA 4YAKA 4YR9A 1ZSYA 3JQBA 5IZCA 3A28A 4P8RA 3AM5A 3I4FA 1X7GA 3ZWBA 4I8XA 1QYXA 3AY7A 4RQTA 4KTVE 5A03A 3DL2A 2Q1UA 3AM3A 3ZU4A 2PLAA 3WQRA 4MVJE 5K6AA 2BKAA 1SC6A 3OJOA 2LDBA 2CD9A 2J5KA 2Q1TA 3U5TA 3VDQA 5TQVA 1BXGB 4NDNE 2HAEA 2PKQP 4PLZA 5U4QA 2HK8A 5IXSA 1GY8A 4Z9XA 1O0SA 2HRBA 1NVTA 1BTOA 3BMQB 3QWBA 4OXNA 5THQA 4CV3A 4CMAA 1W0CA 3W4JA 5H82A 3UCEA 4F6CA 4ALJA 4WKGA 1I5RA 2QRKA 1P45A 3P19A 3VH1A 3R1IA 1J49A 1M6WA 1VJ1A 3ICPA 1NHGA 4IPTA 1EVIA 3PJDA 3RBXA 2X1HA 3MJCA 4YB8A 3FD8A 3GQVA 1I3KA 1LDBA 4U6SA 4WK6A 5TF4A 1I3NA 5TJ9A 5TT0A 4BS9A 5JO0A 1VL8A 1R4MB 3V2HA 2I66A 4D44A 3F1LA 2FRDA 5IDQA 3JCZA 4FD3A 3EZLA 3D3EA 2DUWA 4GX0A 3MTJA 2Y67A 4QTZA 3L6DA 4M86A 4XDZA 4XQGA 3GR6A 1B15A 3ZNOA 1PU2A 5JCJD 1BXKA 1RM5A 3OIFA 5AXCA 3PHGA 4G2NA 4E5PA 1J0XO 1AXEA 4WCFB 1CEQA 5CDSA 5EN4A 2J3JA 3LSYA 3L6EA 5L51A 4CLRB 4BV8A 4E5MA 3RVDA 4R3NA 1CQIA 4EJ0A 3P2YA 3AUSA 3BA1A 4GLLA 2VNSA 1LBEA 2X5OA 4E5KA 1FDWA 3S2IA 8LDHA 5JSFA 4Z0TA 4AJEA 2E4AA 4YQZA 1XR3A 5T67A 3LC2O 1Z7BA 4U0KA 2PH3A 2YHIB 1F17A 1R6DA 4CUZA 2WD7A 1KBZA 5IF3A 2O4UX 2P68A 3UN1A 1SOVA 4ZRMA 3D1LA 4WLFA 4MVJI 3FNGA 5I8ZA 3WJAA 4YRAA 3U09A 4CUJA 4E3ZA 3GHYA 2YV3A 1H6BA 2PZKA 3L4BC 1Q1NA 3VZQA 5KVQA 3DAPA 2C5EA 4WNCA 5CDYA 3SJ7A 3WYBA 3ZV3A 4DTIA 1F0YA 4Y6RA 4J1QA 1NQTA 1V9LA 3I9OA 4XQCA 1WWKA 5IN4A 4IQGA 4FBGA 3KLMX 4BO8A 3CXRA 4QQRA 4B3JA 4K26A 4W82A 2AQ8A 3RU7A 4OIMA 1DEHA 4CM9A 4YT8A 1WZIA 2QYTA 1ULUA 4LSWA 5KKAA 3LZ6A 4GGOA 1PL7A 1ZK2A 1M75A 2YZ7A 3DOJA 4IDCA 4EJ6A 4HXYA 2VNAA 2DAPA 4HV4A 1ADBA 3PHHA 1NPYA 3EHEA 4NPCA 2B4TO 1LU9A 2HCTA 3WQQA 3WFJA 4WLNA 1X7HA 4L4XA 4E30A 5J23A 1AHHA 4NJMB 4MDHA 1YVEI 3U0BA 1P0CA 4R1TA 2JFGA 2W2LD 4RVDA 1UXHA 1UH5A 3F47A 3PLNA 1BXGA 2G82A 2JL1A 1Y81A 2Z5LA 3KEQA 4CODB 1XU7A 4CLXA 5JDCA 1JLLA 3BMQA 1ONOA 1SEVA 5MGBA 1XHLA 2H63A 2W2KB 3ITKA 1GZ3A 1EK6A 3CIFA 3IKVA 1DRWA 5TGDA 4GWGA 3TZQA 3U49A 1T4BA 5T8KA 4CLOB 5ADHA 5G0VA 1QP8A 1E6WA 1F12A 2D8AA 5G0SA 4KMSA 4BO6A 3PGJA 2GLXA 3JD4A 4HNGA 3AU8A 1Q0HA 3VC7A 1RYDA 1EUCA 1WDMA 1M66A 4H7PA 1AGNA 3ZI0A 3OA0A 3EVNA 4J91A 4Q3BA 1K6IA 2J5QA 4WCFA 4Z3KA 5CPFA 4BL5A 4EUEA 3E5RA 2O2SA 1VI2A 3D64A 5FI3A 2OP1A 3JQBC 4J7CA 5FI5A 5IZCC 2VYND 4MIEA 1U1IA 2VQ3A 3OEYA 3T7EA 4WECA 1LSJA 4UULA 1Z6ZA 4PLTA 4D79A 2ZATA 3GUCA 5CG1A 1YXMA 4NK4A 2X5KO 2VZ0A 3WNQA 4IMPA 3UXYA 1NX6A 2DBQA 2FZWA 3GZNA 4RVGA 3VH3A 1BVRA 1XU9A 4DRYA 5B4VA 1EDZA 1U3WA 5L7YA 1R4NA 3PYMA 4UUOA 3RBZA 1F8FA 1YOVA 1NQOA 2GGSA 1PTJA 1I2BA 1O89A 5C7OO 1DAPA 4FFPA 1R0SA 3EW7A 3IS3A 5K9ZA 3TF5A 4KWIA 1E7RA 3DZIA 1LA2A 1DIHA 3TWOA 1ULSA 1HDGO 4XIYA 4ITUA 5TIIA 2X5JO 3KSUA 1LSOA 1PGOA 2GZ3A 5ER9A 3ZWOA 2JCYA 5CPBA 2EXXA 4KDEA 4PRLA 1U8FO 2Y05A 1KY5A 1EFLA 1FJHA 2J3KA 4AJIA 1OI7A 4BQRA 3WJ7A 2AE1A 2RHCA 4BO9A 2D59A 1DC5A 2C07A 5MDHA 3H3JA 3CZRA 3I9KA 2G17A 1B8VA 4ND5A 4R1UA 5LDHA 3MJVA 4AICA 4CUKA 3PP8A 2D2IA 3WSWA 1SB8A 2OL4A 4XYEA 1NBOA 5L4NA 3WB9A 1GU7A 4UEJA 3I23A 2BMAA 3VPXA 5AVOA 1W73A 2V6MA 4NBRA 3GAZA 5U1PA 4WGGA 2VZ8A 2Y1CA 3FR8A 3UUWA 5B1YA 3CUKA 2CY0A 1XCBA 4MP8A 2RH4A 5DOZA 3MOGA 4D0RA 3QA9A 3CINA 1HETA 5KJFA 4R5MA 4A03A 2B0JA 3I6IA 3IIEA 3NTQA 1ZXLA 3OIDA 1MFPA 4PFJA 2QRLA 3HN2A 3KXDA 4KQXA 5EQFA 4RVSA 3VPFA 2W2KA 4ZD6A 3ZU3A 2EG9A 3ROQA 5JYDA 4A26A 3U4CA 4QX6A 3L9XA 4HP8A 1ENPA 2WDZA 4IIUA 4FC6A 4CLOA 1HT0A 3DHNA 4NBTA 3AU9A 4OMUA 3VZRA 1HLPA 1O94A 3ZV6A 1WDKA 1VJTA 3OF2A 5EERA 4F3YA 1B26A 4C7JA 1FK8A 2HRZA 5JO9A 1XDWA 3LYLA 1E7WA 4YACA 4LSMA 4XD2A 1V0JA 4TRMA 1GEEA 1OZAA 2Y1EA 1VL6A 2WE8A 2WWRA 1XEAA 3DZBA 4D46A 3IKTA 2BFMA 3HWRA 2HMWA 1PWZA 2EJVA 3O38A 4DYDA 4NQZA 2E37A 3KUXA 4XJTA 4CJXA 4D3FA 2CMDA 2C0CA 3WGZA 5BQFA 2F1KA 1LSUA 1GFSA 4AJKA 1MUUA 1U3VA 2QYSA 2VOJA 4CM4B 1C1DB 1PJBA 3B1FA 2O7SA 5DBFA 3DBLB 1E3WB 2YFQA 2W4QA 1ADCA 3JD2A 2C54A 5LCXA 1IULA 1P33A 5L3ZA 3H5NA 1PJCA 1GYPA 1Y8RA 3BMNB 2EEZA 2AQHA 4NBVA 5C7IO 2WD8A 3HDJA 1DB3A 2PNFA 2DUUA 2JKVA 5GY7A 6ADHA 3PWSA 3DMYA 3I4CA 3QHAA 3K6JA 4RCVA 3NJ4A 2P2SA 4PVCA 3SC6A 2PZLA 4BNNA 3HFSA 2GUGA 1LJ8A 1Y7TA 1TI7A 1DIGA 5A1TA 1YGYA 1UP6A 4U7WA 1BG6A 4XRRA 2P9GA 4BNGA 4UEOA 4CL8A 3BTVA 1QYDA 2FR0A 5ICMA 1D8AA 3HNPA 4DQUA 3V8BA 1E7YA 4OYRA 3DO5A 1QYWA 2C59A 3FI9A 1E92A 5FYDA 1HDCA 1XQ1A 2Y1DA 3DBHA 4O0LA 4WCFC 1UXGA 4D7AA 3UHAA 3JQ8A 3R6DA 4CMCA 3SLGA 4A10A 2PTGA 1DPGA 4QECA 3GRKA 5KCZA 1GYRA 3JQEA 1B16A 1TA4A 5B37A 2NU8A 4RDHA 3G1TA 4DQVA 4EEZA 1DLIA 4R1NA 1C1XB 3ONFA 2P9EA 2PV7A 3E18A 1IZ0A 4MIOA 3MJEA 4QUKA 1MXHA 3GMSA 1F8GA 1ZH8A 2A94A 2I6TA 3VKUA 5KTKA 1P31A 3JD1A 3JQAB 3JYQA 1R0KA 4QFDA 3RASA 4RDIA 3BAZA 1Z45A 1ZIDA 4E21A 3UKOA 3A9WA 2FOIA 1JVBA 3NUGA 3ZWNA 3MJ4A 4E12A 4ZN6A 3ZHXA 3AOEC 3OA2A 1U9JA 3LC7O 4I9NA 4AJHA 5LC1A 5JMWA 1CIVA 4KUGA 2QG4A 3O26A 2WTBA 4ND4A 2Z1MA 1DAOA 1E3JA 1DO8A 1ZK1A 1ZJZA 3FWNA 3OP4A 3PTZA 4IM7A 4R51A 4YJDA 3WIDA 1EBUA 4IZIA 1O95A 4ALMA 4D0SA 2HDHA 1FF9A 1UAGA 2B83A 3TOXA 3QVWA 4YRBA 1VKOA 3N7UA 4TVBA 1ZNQO 1NAHA 4P38A 4TKLA 3W8FA 3AI2A 3RFTA 3BHJA 2NV6A 2EKLA 4TROA 1CQJA 4NJOA 3JQGB 4RORA 4Q3DA 2OO5A 1ZMTA 1EMDA 4JBIA 3FNEA 1IPFA 4TVOA 4OKNA 5CEEA 5JAMA 3GAFA 3K30A 3AFNA 3GDOA 3H9JA 1FDVA 3PHLA 5JFOA 4CM4A 3H2SA 2OOSA 1UXKA 4LCJA 1EZ4A 4E33A 2PH5A 4D43A 3B20A 1H0KA 3DBLA 1KC1A 1XLTA 3KM0A 4K6FA 1QSGA 4PGFA 4UVEA 4BO0A 4YJGB 1H5QA 2C2XA 4P4LA 1KEVA 3CZMA 2JJYA 4OKIA 3IJRA 2CSUA 3BMNA 5ER6A 1NQ5A 4FPXA 5DCYA 3PDUA 1VL0A 3BTUA 4CQLB 4K6CA 5A05A 1E1NA 2GZ1A 5KJCA 4J4TA 2CDBA 3JQFC 3ORFA 2ZQZA 3KVOA 3QVXA 4DA9A 3QWAA 4XR9A 2QX7A 1CDOA 3ADPA 3WG9A 1IL0A 1N5DA 2C7GA 4TMFA 4ZVVA 4BNMA 1AN9A 2XXBA 1HKUA 4BB6A 2QRJA 2X9NA 3A1NA 2QZZA 5LDGA 1TLTA 3RFVA 1MB4A 3RI3A 3DAGA 2GDZA 5JLAA 1I36A 4R9SA 3DMTA 3G3EA 3TDKA 1T25A 4DYVA 5I9MA 3DFUA 3C1TA 1GD1O 2WJPA 4IQ8A 1JA9A 4QSMA 3AFMA 1LSSA 4NI5A 2P5UA 7MDHA 2EKQA 4KQWA 2WMDA 1KVTA 1ZSVA 3WXBA 4TWRA 2O23A 2X0NA 1SPXA 3H9GA 3AJRA 4WEOA 5EPOA 4ZJUA 1C3VA 4I1IA 4GGPA 1U3UA 4W7HA 4JLWA 1C1XA 3GF4A 4J1NA 2BI7A 1QR6A 2DPGA 1LNQA 4GKBA 3RUIA 3I83A 3NV9A 1YL5A 4YXFA 2VCYA 4XB2A 1VLLA 2A4KA 4DIBA 3VZPA 4DREA 1B8PA 4WLEA 1SEPA 3OJLA 2J8ZA 2OHXA 3OQ6A 4RO0A 3RUDA 1NR7A 2WEKA 1TVEA 1UDAA 5A3VA 1QLHA 2DC1A 4WLOA 2GD1O 3M1LA 2IE0A 1YBVA 5JE8A 1GCUA 1P1JA 4FC7A 4CM3A 1HDYA 2E49A 3H8VA 2PFGA 1NQAO 3ZNQA 1DOHA 1RM3A 4BMSA 3DHYA 4XDYA 1Y9AA 1BDBA 4L4SA 4QO7A 5C7LO 4GWKA 1BHSA 1KVSA 3WFIA 2QW8A 5B4UA 3FPCA 1ISHA 2EP7A 2ZQYA 4A27A 4LMRA 2VWPA 1RYEA 1Q7CA 1SCUA 1ZKMA 3KHUA 3V2GA 1LDYA 2B5WA 4IXTA 1YDWA 3ST7A 1PJ3A 5BT9A 1V3UA 1SB9A 2NNLD 1PJQA 4IJUA 3ANLA 1PR3A 5ICSA 3M1AA 4YJGA 2JFFA 2DTDA 3VH4A 3FR7A 5KIAA 3DTYA 1S6YA 4XQ9A 2W90A 4DC0A 4JJIA 3RUAA 3LT0A 1DIRA 1GV1A 3VTFA 1PIWA 2YJZA 1E3LA 3AUAA 3S55A 3RJ9A 5IG2A 4R1SA 4JGBA 5A5FA 5HA5A 2FN7A 4IDAA 5I7VA 2B4QA 3C1OA 4ZQBA 4AJNA 1R0LA 4YWJA 3WDSA 1E1LA 2WYUA 4R5HA 4XEHA 3PZBA 4BO7A 1VJ0A 2NU9A 2X4GA 4NNJA 4QXMA 3S2EA 3ZZNA 3U3XA 1A7AA 1ARZA 2B37A 3WYCA 3DONA 3RQSA 5ENDA 2G76A 3GVHA 1SAYA 5H83A 1WLYA 4DC1A 4CM9D 2CUKA 5T6BA 5L7WA 3RROA 4J9VA 2C2YA 1X0VA 3QVOA 4OOEA 3S2GA 5KVVA 1G0OA 4GX5A 1WPQA 4RVHA 1OMOA 2NU7A 4UREA 1CYDA 4BOYA 3KB6A 4W99A 5F3RA 3UAGA 5JYEA 4JJFA 1N7GA 2NADA 5G0UA 3IL2A 1ZMOA 4RPKA 4RPJA 2X0JA 3LVFO 4H15A 4Z0PA 2ZCVA 3MJTA 3NYWA 3EDMA 3DZGA 1LTHR 3P7MA 4FOSA 3VPHA 4UVHA 1HDXA 4B4WA 4E6PA 3I9LA 2E82A 5C5IA 2CF5A 4KP7A 3C85A 4HBGA 2Q2WA 3HJAA 4DQXA 1E3EA 2WSBA 4J16A 3TZ6A 2YHUA 3ITDA 3ZV4A 1A4UA 3FNHA 1Y9EA 1O6ZA 1MC4A 3F4LA 3BTSA 4IDDA 3G79A 3W4IA 5CDUA 1FDSA 2XXJA 1ZK3A 3PJEA 3U9LA 2Q46A 4JP3A 3F4BA 1R15A 4JN6B 5ES3A 1ZVMA 4UVGA 2GN8A 3ICCA 5CDGA 3PFWO 3JYLA 4IDFA 3WLFA 4EGFA 1PZFA 3K9QO 1A5ZA 3ZWPA 2V65A 2Y68A 4R3WA 2VN8A 5TLSA 1CETA 2DVMA 2H6EA 2W8ZA 4H16A 3K31A 5I8WA 4ALNA 3MWDB 2BGLA 5AOVA 5G4LA 2XPCA 5CG2A 1UXIA 4IUYA 2TMDA 4YJFA 3HG7A 1YL7A 3ZGYA 4A2CA 1K0UA 4RF4A 1HZZA 3HQ4O 4JCOA 2Y1GA 2GRAA 2PKRA 3CMCO 3NKLA 1A72A 3ZWMA 1AE1A 4L75A 3SVTA 1U4OA 3L4SO 2Q4EA 3ZH2A 4HFRA 3UCFA 2O7QA 3NT2A 3O03A 3O9ZA 3FSRA 3PWZA 4MVJA 4WPGA 2LDXA 4EEXA 4Y8VA 5L4SA 3OMLA 2GO1A 5A5EA 3QWFA 4L74A 5CHEA 2VTEA 1ONNA 2VHWA 1I8TA 4NFHA 4O59O 4EJMA 4XYMA 1EUDA 3GZNB 2DFVA 4CQMB 4MIYA 1NM5A 1GZ6A 3RD5A 2RBEA 1QG6A 1R4NB 4J2OA 3RUEA 4PLYA 1A71A 1YOVB 3CE6A 4HFMA 4IDBA 3G0OA 3B6ZA 4JIGA 3QV1A 2VT2A 2I67A 3U4IA 3GY0A 2EGGA 3GNQA 3S1LA 5BNIA 2H1SA 3LK7A 5K1SA 1B7GO 2YW9A 3RKRA 4LGVA 1FMCA 1HRDA 3TZCA 4B8WA 2WYWA 3DOOA 2GF2A 1X15A 3K96A 6LDHA 3E82A 4DLAA 2EF1A 1HSZA 3TSCA 2BELA 1ISGA 3L0DA 1PGPA 3RUFA 3ZWYA 1N2SA 3INRA 1LEHA 1WNTA 1UZNA 3WWZA 3FRJA 4E2XA 1VPDA 1K89A 3I3OA 3MTGA 4NFYA 1IHXA 1DLJA 4AFNA 2AW5A 3H2ZA 4C4OA 3SEFA 4FW8A 1Y8QA 4DBVO 4WUVA 3H65A 1PGQA 1T1RA 4YAGA 5KJ1A 2X9GA 3K92A 4PZCA 4EITA 2O3SA 3I6QA 1A4IA 2IYOA 4R41A 1MP0A 4BQPA 1P0FA 4Y98A 5HS6A 3I9JA 3GZ4A 2FWMX 2BH9A 3M6IA 2OORA 5TC4A 4BGIA 4B7UA 4M54A 4FCCA 4I08A 4GPD1 5JCXA 3JYPA 3F1KA 4P4GA 4RPLA 2DT5A 2VRBA 2VWQA 4CR8A 2QQ5A 3O4RA 3GEMA 4M49A 4MVJG 2NSDA 5L7TA 3VTZA 3GHHA 1UP4A 5IDXA 3GVCA 1JWBB 2AQIA 3VPSA 4GLOA 2O48X 2VHVA 2J5RA 4AJ4A 4MKXA 4J0EA 3DZHA 3KZVA 3RC9A 4LRTB 1FXSA 4CV1A 5A04A 5B12A 1G1AA 1WAMA 1HDOA 1PJSA 5BNFA 3STHA 1X7DA 3PDJA 3LF1A 4HFJA 3KETA 2W98A 4KDFA 3S8MA 3ZU2A 1T2FA 3Q1LA 3WGQA 4LRSB 1UDCA 4B7CA 4E32A 4OGWA 3WGYA 2O3JA 2Q4BA 3ZNPA 3W4KA 1T26A 1U3TA 1XSEA 2VYVA 3JQ7B 1T24A 4MJLA 1T2EA 5AXDA 4DXHA 5DNAA 5CFZA 4CLEA 5BR7A 4ESOA 4PVDA 2Q45A 3V1UA 1ZCJA 3IJPA 1Y1PA 1HL3A 2B36A 2HO5A 2FR1A 1RJWA 4W7IA 3DQPA 4DPLA 5K6AC 3FN4A 1V6AA 1YB5A 3FNFA 4IQ0A 2NVBA 3DOCA 3PHJA 4MINA 4AJJA 1Y8RB 5FF9A 4CQMA 2I3AA 2BGKA 1TEHA 1YB1A 2BI8A 3E6AA 2ET6A 3A14A 1ISIA 2UYYA 3JQ6A 4TKMA 3PQFA 1MA0A 5CEJA 1WZEA 4R4JA 1Q7GA 2UV8A 3GUYA 4LW8A 3WGTA 3ZWVA 2I9PA 2IZ0A 1M76A 2Q99A 4ALKA 3OEWA 3TZKA 3V1TC 4WNIA 4WLVA 1JDJA 1EDOA 3KEOA 1EBFA 2POQX 2VHZA 2XF8A 4GX2A 1GUZA 2NQ8A 2AQKA 1WMBA 5L9AA 2DKNA 1KETA 4UUNA 1D3AA 5BSGA 5JDIA 3ZDFA 3GGOA 2JD0A 2Q2VA 3PXXA 4OL9A 2ZTMA 1GDHA 1HE2A 4YTEA 3GVXA 5B4TA 1VSUA 5DBGA 1JW9B 2PD6A 3DBHB 5AXBA 3JQ8B 4ZICA 1E6EA 4J2HA 3KSZO 3PLRA 5JY6A 1Z7EA 3JYNA 1EFKA 2IEDA 3ZHYA 4FGSA 1HDRA 1YQDA 4L4RA 3BHIA 1Z75A 3CH6A 4BIIA 4JX8A 3D5QA 3GFBA 4RPHA 3B70A 4GKVA 1P74A 4Y67A 3PZRA 4R69A 1QRRA 4J4HA 2J3IA 3HDHA 4CMIB 5I9LA 1LLQA 4IBOA 2RAFA 2EERA 3K8ZA 3E48A 4J3FA 3ASVA 1CF2O 1GV0A 1HDZA 2B69A 2BLLA 3MZ0A 4BNLA 1SOWA 1ZW1A 1JWAB 3PFFA 1W8DA 2B5VA 4XWYA 1JTVA 1LLUA 1GTMA 2RIRA 4RLSA 1EE2A 3IQDB 3ZWWA 3ZHBA 4BNJA 4MOWA 4Q39A 5DCUA 3ETGA 3LC1O 1ZEMA 4H3VA 3AY3A 4FIZA 1IE3A 3A06A 2HLPA 3TL3A 3WX0A 3LT1A 2ZYAA 4GH5A 2HSDA 3DB2A 4FFRA 5HBRA 1BW9B 3F3SA 1PQUA 3TL2A 2DTEA 4DWVA 4BHTA 2FPGA 4PG7A 3JQ7A 3PVZA 1J5PA 3WICA 3I1JA 1HE5A 4XA8A 5TRTA 1EQUA 4WJZA 2O3QA 4YEDA 4AJLA 3KYCB 1SO8A 2HQ1A 4PG8A 3TJRA 4W6ZA 1U8XX 4FS3A 2EW8A 4DIOA 2PZJA 4U8GA 4XX0A 2ILTA 3ZW9A 2FSSA 3TFOA 3RUCA 1V8BA 3GC6A 4BNYA 1GUYA 4ONEA 5ILOA 5COQA 2Z95A 5A3JA 2BGMA 4N18A 1V3VA 2DFDA 3D5TA 3RBVA 1ZZEA 4NK5A 4BMNA 4F6LA 1H9BA 4WCDA 2ZB8A 5JDCC 4B8ZA 4E5NA 3ZU5A 2P4QA 1IZ9A 1FDUA 1NYTA 4PG5A 1KYQA 4MVJP 1C0KA 2AEMA 4L73A 5KNLA 4DPKA 1E5QA 3AK4A 1YRLA 3INTA 4EW6A 4JROA 5F1KA 1LC0A 4FN4A 2DLDA 5T8KC 3ZWAA 4PLVA 2X7HA 3O8QB 4UEKA 2ZJ0A 4ZQFA 1NPTO 3HB5X 4JP2A 2EV9A 5HRUA 3WWYA 4MO2A 2X9VA 3HDQA 1MV8A 3L6OO 3L07A 5TT1A 2Q49A 4IMRA 1HWYA 3NTOA 1KEWA 3T4EA 3GRPA 1R37A 4RLHA 4NU6A 1H6DA 1U28A 4PG4A 4TZKA 1IHYA 1U2DA 1BRMA 3PJFA 3T7CA 3QVTA 1QYCA 2JCXA 5DZSA 1JKIA 4AJ1A 1PGJA 3TOZA 5HS4A 2SCUA 4L9RA 2CVOA 1P1KA 4II3A 2IZ1A 4XYBA 1A9ZA 4WOKA 3F46A 4PCVA 2ZYGA 4CMEA 1IOLA 2GYYA 4CMIA 2NTVA 2ZKLA 5HTOA 3PIDA 3G49A 1U4SA 2QIOA 4G81A 1YE3A 5A9SB 4BB5A 1E0DA 3OETA 4GSKA 1I0ZA 3JQAD 3WSVA 5DF1A 3H9UA 1CJCA 2Y93A 3QLJA 3VHRA 2B35A 3GFGA 1BXZA 3OJ0A 1VSVA 2ZB4A 2NACA 1OBFO 1WVGA 4IGFA 1I33A 1P1HA 1N1EA 3GG9A 5COBA 3RU9A 2FPPA 1NP3A 1I2ZA 3BYZA 2GNAA 2Y0DA 4FB5A 5DBIA 3AI3A 4IDEA 3OH8A 1PZEA 1BW9A 2NUAA 3PPIA 4WLUA 3ONDA 5JDIC 1BSVA 1E1MA 4XGIA 2V6GA 4YVFA 2IXBA 4ZQEA 1JVSA 1HLDA 1GADO 4NU5A 4FR5A 1K3TA 1L7DA 4D42A 3KYCA 2NQTA 4GL4A 4B79A 5CP8A 3U4DA 2E48A 5KVSA 2AG5A 4XKJA 4YAJA 3ENNA 2CNBA 5BSFA 3GPDG 3OSUA 1H94A 4AJPA 3KV3O 1UUFA 4BKOA 1EEHA 1ZK4A 2V7PA 4PLPA 4PIVA 1OFGA 2YYYA 4FDAA 2HMVA 3GVPA 1DC3A 4YT4A 2PD4A 1SMKA 1DHTA 2YFHA 3DZFA 4JJGA 4E0BA 1Y6JA 5T57A 4BO4A 4DUPA 3QY9A 4LISA 3VVBA 3D0OA 3GNSA 2VT3A 4OJNA 1PJLA 4ZQGA 2YDYA 3VOSA 4A73A 1YH3A 4ZGWA 1XWFA 1A9YA 1DJQA 2IDZA 3QRWA 4GI2A 5F1PA 4FJ1A 4URFA 3GEDA 3O8QA 3VPGA 2I99A 1QKIA 1YONA 2A92A 4U6QA 3NT5A 2Q1WA 4XIJA 5KOIA 4CM1A 4F45A 4W9NA 1PL8A 3GEGA 3GH3A 4ILKA 3KYBA 3NGLA 3HN7A 2EIHA 1GAEO 4L8VA 4XRGA 2PR2A 4MKZA 2IXAA 3MJSA 3TZHA 3WGGA 1IPEA 5DULA 4B4VA 3HSKA 1K2WA 3QVSA 5TNXA 1JU9A 4OAQA 3QW2A 1P44A 2OP0A 1PWXA 3NTRA 3X2EA 1MGOA 3Q11A 4F46A 4BVAA 3E9NA 2GERA 2C29D 4D45A 2R6JA 4J7UA 2OFPA 1MXFA 3ONEA 4M89A 2OBYA 1H2BA 3KLPX 1YWGO 3OM9A 2VRCA 4ZHSA 1B3RA 3EY4A 3EVTA 5KWEA 4OQYA 5A9SA 3IUSA 5JS6A 1Y5RA 1GCOA 2VUSA 1UZMA 3PQEA 1XIVA 3VAZA 1IY8A 1YDEA 3Q9UA 4ZU3A 1HSOA 1HF3A 4K28A 5AXAA 4OHUA 1CWUA 2HU2A 1GPJA 3HZZA 1YKFA 1I10A 1MG0A 1FDTA 3OBBA 3VKVA 1SNYA 1YJ8A 4OQZA 1JKFA 4P22A 2JFHA 3C7DB 3WOHA 1X13A 3R0IA 3OQ1A 1SZJG 4RGBA 1U7HA 2GZ2A 3QSGA 2I76A 2J3HA 3CEAA 3OHSX 1QMGA 1WDLA 4FJ0A 4BNIA 3CTMA 2GSDA 4YJFB 2FHSA 2CVQA 1HYEA 4M8SA 3KBOA 5GZ1A 3WTCA 5G2OA 3X2FA 4YT2A 2V6BA 1PQPA 3SBOA 4BNKA 3JQDA 3DDNA 1XYGA 4AL4A 2EW2A 3JQ9A 5EESA 3W1VA 1PEDA 5DP2A 4N5NA 3UICA 4CV0A 5IFLA 1HXHA 2QHXA 4R68A 3ROKA 5IAAA 3PHIA 4RZIA 1ZUD1 3CMMA 4ALLA 4NG5A 2A35A 4MVJD 2HMUA 2OZPA 3GT0A 4IDGA 4BMVA 4BNZA 3EZYA 1VC2A 2X22A 4OH1A 4QO8A 3ROPA 4D3SA 4OM8A 2WE7A 2C5AA 3GA0A 2P9CA 1PZHA 2X0RA 4O63O 5DT9A 4GMGA 4I9UA 4PLFA 4X54A 1O5IA 2EGHA 2ZJ1A 3PK0A 1R16A 1EVJA 4FQ8A 1KY4A 1QV7A 1DHRA 4GSLA 2C20A 4CMEC 2YQ5A 4DMLA 1ADGA 4CMHA 4J9UE 4Z0HO 1G6KA 2AE2A 4CR6A 4B7XA 2AMFA 4HKTA 4BGEA 1L7EA 2B4RO 2GCGA 3JD0A 2AHRA 2EKPA 4TSKA 3IP1A 4XCVA 4NHEA 4Z6KA 3PYXA 4ND1A 5BSHA 4BV9A 2EJWA 3WMXA 1LLCA 2ZTLA 4Q3EA 4YT5A 4CM7A 1B14A 3IOYA 3COSA 1Y8QB 1I24A 3VZSA 4DGSA 4XQEA 2YDXA 3FBGA 4OSPA 4ZRNA 1ISMA 2GR9A 3WIEA 4EUFA 1C14A 3QQPA 2BFAA 3I5MA 1NPDA 4TRJA 1V3TA 1XKQA 3UFXA 1KOLA 4Q3AA 1LDMA 2PGLA 3WR5A 3GK3A 5AQ1A 1ML3A 1H6AA 1F06A 3NDJA 2NVUA 3E1KA 1NFFA 2Y66A 3MEQA 4WOJA 2I3GA 1UZLA 3QIVA 1IYZA 5THKA 4XZ3A 4DPMA 4A5OA 3I9MA 3DWFA 3PIIA 1TT5B 2UDPA 3IAHA 3P5SA 1EQ2A 2OMEA 4IXWA 2HMSA 4WEQA 4XYLA 1QXSA 2BFPA 2X23A 1CERA 1P9LA 2P4HX 1ENZA 4N7RA 2DPHA 4CM6A 4IS3A 4N5LA 1M6HA 3SXPA 3NEPX 3I52A 4FFMA 3EYWA 2VUTA 4Y6PA 3U62A 1TT7A 2VWGA 3RC7A 1T1SA 3QP9A 2DQ4A 2PY6A 3LQFA 3QJ5A 4D41A 1Q0QA 2ZB3A 4FFOA 3TNLA 4BNHA 3R3SA 2YUTA 4YA6A 5L95A 3SC4A 3WBBA 1PJ2A 1E77A 1EVYA 1U5CA 2GN9A 3FBTA 2J6IA 3DMTC 2VYVD 3ETDA 2WM3A 4BKUA 3MOIA 4W9NC 3OJEA 3B1JA 3MCVA 3LDHA 4AG3A 4MKRA 3LT4A 2PKQO 1JKJA 3DZKA 2QZ9A 4NMHA 2PA3A 3RC1A 1VRWA 1NFRA 2NM0A 1EUZA 4QFCA 1PSDA 2NTNA 3JQCA 2OXIA 4KUHA 3V2UA 2OUIA 2VWHA 4BO1A 4YAIA 3LF2A 4CQMD 3GN1A 1PQWA 4PLCA 3D3WB 1IB6A 3NJ8A 1I01A 2BFOA 2X58A 4B3HA 3D4NA 3F5QA 5HWSA 4OOFA 2G1UA 3E5MA 2VHXA 1B3BA 3W8EA 1EK5A 1VM6A 3GPIA 1Z82A 2BF7A 4IGEA 1MX3A 4D3DA 4Y6SA 3ZNNA 3DC2A 1KERA 2PGJA 2Y0EA 4CLDA 4HUJA 5KJEA 4CMBA 3M2TA 3HADA 3WLEA 1BMDA 4BNFA 1HYGA 4BNUA 4R9RA 4DIFA 1TXGA 2FMUA 4RQUA 2Q2QA 5F5LA 1U2GA 4N54A 5T64A 1I32A 1E7MA 3LLVA 2HKIA 1LUAA 3H4VA 4UVIA 4NIMA 5I7SA 4TZTA 2JAPA 3UVEA 4IJKA 1B2LA 1LI4A 4NZ9A 4WE3A 5F5NA 4RVFA 5IXYA 3TRIA 3WMWA 1ZXBA 3VH2A 4GVLA 2YQ4A 1DXYA 3DHEA 3GGPA 4M87A 3AWDA 4RJTA 3C3XA 2IYPA 3FHLA 5L40A 4MP6A 3ETEA 5EIOA 4B4UA 5JAIA 3NX4A 3JQ9C 3RUHA 3ZV5A 1MG5A 2IODA 3C8MA 1HYHA 2NTJA 4S3MA 4NBUA 1G0NA 1UJMA 3NDRA 4R01A 4XJSA 5JPIA 3ROMA 4BKRA 1TT5A 3JV7A 1YBAA 5A9TA 4DBZA 1KIFA 4EYEA 2IEBA 4NR0A 2Y1OA 4ALIA 2HJRA 2HMTA 2BRUA 1YS4A 2Z1NA 3JTMA 2RH8A 2O3UA 3IP3A 3HB4X 2CDCA 4DLBA 3HUDA 1HZJA 2D1YA 4GVXA 1DRUA 1AHIA 4I9HA 1E3SA 3NGXA 4ND2A 4XR4A 3NAQA 4J7XA 1MFZA 1E7SA 1XGKA 2XOXA 1PR9A 2D4AA 2GN6A 4FFLA 4N5MA 3TQHA 2ZK7A 4BNVA 4B3IA 4B4OA 2HK7A 3G17A 3H9EO 5KVCA 1R4MA 3FTPA 5EL0A 5JCJA 4Q3CA 5JAQA 1ZJYA 2X6TA 3ZWCA 4BKQA 1AUPA 3GNTA 4LN1A 4EI2A 2HUNA 2Y0CA 3ADOA 1S7CA 3ZW8A 4DLLA 3E03A 4PZEA 1ZK0A 2I65A 5AYVA 1ISFA 1RKXA 3V1YA 3PI7A 4PZDA 5JNLA 4CLRA 3R3JA 1KVUA 2A9FA 3D3WA 4KZPA 4CM8B 3F5SA 5L53A 5IDWA 4RVUA 2G5CA 1LQTA 4TRRA 3CPSA 9LDBA 1IUKA 3ZCXA 4GAEA 1I3LA 3RFXA 3V5NA 1P1FA 2ZB7A 2EWMA 4OXKA 4LCEA 1A27A 1RM4A 4E13A 2YHIA 3GMDA 4JK3A 4EZBA 5I9NA 4U0JA 1PX0A 5EINA 1GQYA 8ADHA 3H9QA 1UAYA 2Q1SA 1C0LA 2VHYA 4LK3A 2AG8A 4CMGA 3QE3A 4BGVA 1OOEA 3AOEA 1LLDA 3ZN2A 2CF6A 2DM6A 4KWHA 4YPOA 2IRWA 1GEGA 1EVZA 1DBVO 3C24A 2CVZA 3PRJA 4LVCA 3VDRA 5EMHA 4FSHA 3RCBA 1U7TA 4J4BA 5JMPA 3PEFA 1LDNA 2FR8A 1NASA 3KO8A 3W6ZA 1QORA 2H5LA 3PGXA 2YV2A 4NBWA 3RJ5A 4G65A 4E5YA 3EAGA 5I7FA 4S1VA 1E1KA 1NVMB 4INAA 4BO3A 3WTBA 3IDSA 4RZHA 1I2CA 1NTOA 4XGNA 1LRKA 1YJQA 4YJHB 3PWKA 4BGUA 1QYVA 5TX7A 3E9MA 3C1AA 3LLSA 4ROSA 3AUUA 1I30A 1B0AA 5HM8A 5G0WA 1T2DA 3K73O 2NVWA 3ULKA 5CDTA 2NWQA 5TS3A 1ENOA 3ASUA 3AY6A 4NFSA 2W2LA 1WXDA 2F00A 3UF0A 3I9NA 4NJMA 2PZMA 3ON5A 2UUPA 4Q9NA 3SJUA 3UOGA 3QWHA 2EP5A 2PGDA 3WNVA 1M2WA 3K2BA 4I5DA 4BNXA 5IJZA 3K2EA 1KVQA 3G1UA 3BZUA 5BSEA 4UVDA 2V6FA 1K5HA 1DDOA 2EHDA 2WYVA 3D7LA 4UAGA 3JQFA 3KTDA 3MWEB 4HFNA 4EDFA 1H2HA 1D4FA 4E2ZA 5DN9A 5L4LA 1YQGA 3L9WA 1Y5MA 1RWBA 4YYZA 1YL6A 4RF5A 3NT4A 1C0PA 2PK3A 4YAEA 3BMOB 4FFNA 2JHFA 3E8XA 3PQDA 4IJVA 1LC3A 1P77A 4I5GA 4IY1A 4OO3A 1WP4A 4YQYA 2CDAA 1R12A 3GLQA 1GR0A 4FGWA 1HTBA 3WQSB 3FF4A 1JAYA 2P91A 2HJSA 2R00A 3B1KA 3JYOA 1DFHA 3FTNA 1N1GA 2OGUA 1T2CA 4YCAA 4CLHA 1QLJA 3LU1A 3QWIA 2ZTUA 4JXKA 4IZHA 3WYEA 3JSAA 4II2A 2VYNA 2G0TA 4HWKA 1MLDA 3WGOA 1BWSA 4CM8A 3W6UA 3OFSA 1BGVA 1Q2XA 2VUUA 3KYDB 4O1MA 3HE3A 1RPNA 4BO5A 3CKYA 3JD3A 3EK2A 3DZJA 3PYLA 1L1FA 3S2FA 1Q7BA 1VE9A 2X86A 3H7AA 1NXQA 1CRWG 1D1SA 4OXYA 3DBRB 1NFQA 5GZ6A 4G5HA 1LX6A 1ORRA 2UVDA 1ENYA 2ZTVA 3Q2KA 5K0ZA 3SLKA 9LDTA 4ND3A 1GZ4A 1O8CA 3A4VA 1XG5A 1E6UA 1D1TA 4YRDA 3RIHA 3E9QA 3WGIA 4J6FA 2D5CA 2AEFA 4Z9YA 1ONPA 2O4CA 1PZGA 4DVJA 4IIVA 2JHGA 3DR3A 4RPGA 3GDFA 2JD2A 2AEJA 4ZA2A 3N74A 3H5AA 3VVCA 3W8DA 4CMKA 4PLHA 3IUPA 5ITVA 4BNTA 5I7EA 3P2OA 3GOHA 5ILGA 2JAHA 1DC4A 1LXCA 3BMCB 5IDYA 5F1OA 4YJHA 4L76A 3SX2A 5CEFA 1P1IA 2D5AA 3HHPA 4K9DA 2D3TA 3RC2A 4BO2A 2OBNA 1KS9A 1ZFNA 2VRCD 2O50A 1OAAA 1W6UA 5JBIA 2DBZA 4GMFA 1N8KA 4MVJF 1Q0LA 1WMAA 4CR7A 4JBGA 2AXQA 7ADHA 1B8UA 5TSDA 4E31A 5C37A 5L45A 3K5PA 3NDIA 3EGOA 4JQCA 1N92A 1OC2A 3PJGA 5CAEA 5JXWA 2DU8A 1LRLA 2FSVA 4NH4A 2DBRA 4QT0A 3UH1A 5JC1A 3OJFA 2VOEA 5G0TA 3L77A 4U5QA 4RL6A 1A7KA 1NHWA 3BIOA 5H81A 1NAIA 3GGGA 4J1TA 3TFQA 5JW6A 1E7QA 5FEUA 2AA3A 5DDIP 4HX5A 1U5AA 3BMOA 3Q2IA 3RAJA 4W4TA 3AOGA 4CV2A 2Y1FA 3AW9A 3GG2A 3F9IA
chains in the Genus database with same CATH superfamily
3DEYX 2R4QA 1EFTA 1F8XA 1PS9A 2HQBA 5CCXA 2CKMA 1E0AA 3GP5A 5ITWA 4JD5A 2C3PA 1N0IA 2FR8C 3OZDA 4QDXA 4Y0VA 2BD0A 3RODA 1DRVA 3AT1A 1P3DA 1MC1A 2AFHE 3H3FA 5E9JA 3KRTA 4M88A 1HEUA 3SNHA 4DNXA 3G5TA 1IOWA 2R2GA 3Q0TA 3ANMA 1BVUA 3MLAA 3OBIA 5MN6A 4RFLA 3D6VA 1E94E 5JVDB 1U3DA 4I5FA 5K3CA 1KAGA 2H07A 2PIAA 5FWNA 3U3KA 4OSEA 5A2GA 1DJNA 2HMAA 1RI5A 1X7ZA 3BQMB 3JAWA 3WGHA 3AR8A 1H6CA 1Z0KA 5KWVA 2GMWA 2JASA 1EE9A 5DP1A 1BDJA 3DAFA 2V55B 3VC1A 2FN9A 2V5AA 2JHPA 2F17A 2V7GA 3ZDEA 2GHRA 4YRGA 1KGSA 4G4SO 4AZ0B 3AF0A 2IYQA 5HILA 4EARA 2HSZA 2PRYA 4M1MA 5AK4A 3OECA 1X3SA 2XX3A 4JC4A 1TB4A 5TJHA 2ROQA 4FJ2A 4XPIB 5BSVA 4GR5A 1LRJA 4G0XA 4BTLA 4P34A 3E61A 3EC1A 4WZAB 3BFKA 4E08A 1TZJA 5D00A 1G21A 2R60A 3G6WA 2R87A 1KC3A 2QMUA 3O8OB 3A6GA 2M6SA 5FUWA 4A1OA 4BLRA 1IK6A 2HNKA 4JBHA 8OHMA 2VI5A 2EYUA 3IOCA 4C9BA 1OYOA 1I5OA 2BAGA 4EDHA 1T13A 3DLAA 3HLKA 1SHJA 2C8LA 4TQGA 4XGKA 1I4EB 3DCYA 2C3MA 3QX3A 3O8RA 1OHHD 2Z57A 3MFQA 4J0KA 5KYKA 2FY8A 1G8JA 3DUFA 4MUHA 1IXKA 1S1MA 1X1EA 3HYLA 3OICA 4JDPA 1V6SA 3BSWA 2F4NA 3F7OA 3RSHA 3IDZA 3T1VA 3BE4A 1WUIS 1G20E 1PT7A 1N6KA 1Q0UA 2A84A 2I3BA 2JFUA 3MTQA 4E07A 4KIJA 5KKCA 1RPZA 2X8LA 3B3AA 3AHJA 3MCUA 1GNPA 4Y2XA 4EQ6B 4EZEA 4KQHA 4C5AA 5JC8A 4PN3A 2AC4A 5EQDA 1S2NA 2MHCA 2FKAA 4IJMA 2F2TA 3OX3A 1OT5A 3S68A 4LRWA 5EJ7A 2GZSA 4MR7B 4DLPA 2R00C 2AFHA 3OZBA 1QRUA 4IIFA 1Z4LA 2VQEB 2BTOA 4B3FX 2AS0A 5F7JA 3CS3A 1R3UA 3M2PA 3SN6A 1A8HA 2JHAA 2ZEJA 4HUQB 4Z9FA 1JFVA 2O6HA 3Q3HA 2BTEA 1NWHA 2WSYB 2GEBA 1DC6A 2N0SA 3QXJA 4WOPA 4F6RA 1DFGA 1JN0A 4MWCA 2WJHA 5HRAA 2AXPA 1EFPA 5E1DA 1KEZA 3LTEA 3V8EA 1WA5A 2BL4A 3WXMA 2QUBA 2NYRA 2YXNA 5MF6A 5LXTF 1FRNA 2B99A 4RJIA 4E2YA 2ZI5A 4NZOA 5AW6A 3L6CA 2Y2VA 5FAXA 3WWDA 1XQ6A 2IXFA 3T6KA 6NULA 1AK9A 1SG9A 1B0PA 1T4DA 1YZ3A 3AUTA 3OOJA 4EB6A 4RTMA 2Q50A 3OY2A 5DYIA 3KR1A 2R6CA 2AWNA 2GBLC 2PD3A 2VTDA 4PG6A 3VKFA 3NHBA 5K8CA 2ZSBA 4M21A 4TTVA 1P5JA 2CEAA 2FN8A 1LWNA 2XF2A 4G09A 2CCGA 2H9IA 4W8HA 2TMGA 3F7NA 3C70A 4LI0A 4XYGA 1UEJA 1WXGA 3AP2A 1XD8A 2IIQA 4TKVB 5GONB 4NE7A 3MTEA 2YC2C 2J9ZB 5IAEA 2PBLA 5JAUA 1KEUA 3CSDA 3BE8A 2FZEA 4KXXA 2Y99A 4Y2JA 2ZTSA 2WU4A 3BPSA 3OQIB 4GGMX 3QKWA 1DSSG 1E0SA 5B1EA 5DCWA 2FHPA 2ZI3A 4HVCA 4X91A 5ESXA 1GQQA 2GM3A 3EF3A 4B74A 4DSZA 4OSOA 5ADVA 1C3JA 2VHTA 2H1FA 1NIPA 1OT3A 1THMA 1XA0A 3AETB 3HCBA 2O2YA 4K46A 2ZU0C 4PX5A 4E11A 3Q6IA 3JQGA 3ESDA 3AI1A 3M5DA 4H7EA 2VDKB 1OUMA 4ZGBA 4JNKA 1P1RA 3M34A 3SKVA 4FYMA 4AULA 3RG2A 2ZVDA 2ARKA 5CX4A 4EB8A 3LHSA 1KSJA 4W8GA 1ATZA 1RJEA 4M3NA 5I7RA 3C8HA 2Y9MB 5LMCA 3WGJA 4OU5A 3U17A 2JJ1A 5CFNA 1RWVA 1NYQA 3IC5A 2KI5A 1Z4MA 2GJ4A 4GXRA 4IINA 4TTAA 3ZDAA 3KOUA 4IDHA 4DLVA 1K8RA 3T4XA 1NE2A 2WD7B 3BULA 3K70C 5HIMA 3TLYA 1GZSA 4MVJM 3JR7A 4ZAFA 4LCBA 4RMIA 2ZVQX 4W5NA 2IP2A 2Q3FA 1RACA 2VQDA 3FCUB 5LZ5A 5FFMA 3H6KA 1CUZA 1ZA1A 1ZEJA 4YBZA 3HKCA 3Q8LA 2G25A 2H54A 5K0LA 1C0IA 1WY7A 3HU2A 4QU0A 4I5EA 5HX7A 2UVQA 1S3SA 2FQQA 2FSVC 1TPYA 5T5QA 1E2JA 3GEBA 3E27A 4TVKA 1QCZA 3V7FA 2BGUA 3LCJA 3WMEA 1X74A 4ZCLA 4C3ZA 1H9AA 1Y3CE 4EGJA 1I7PA 2PV0A 1TRKA 3PXCX 4NCIA 5I7HA 3A4NA 3UG7A 4B3GA 3IR6A 4NEHB 4A8HA 1AQJA 5K99A 4XGRA 3T0FA 3W2FA 4AB1A 4HVAA 4WXEA 3GGJA 1H5UA 4CMJA 1P3Y1 2O2IA 1B2RA 2NLOA 4Q1DA 1I7SB 3U16A 3JALB 3SZMA 1BXRB 2ZWAA 5K8VA 2DEUA 1U6KA 3IA7A 1B8OA 1AHPA 1QYXA 1IG3A 4BKRA 1A8UA 1U8CB 2V45A 1YR8A 2ZLBA 2PLAA 4YRMA 4MVJE 3OCXA 2JBWA 3NAMA 1YR2A 3KWFA 3OJOA 2CD9A 4NESA 4OTZA 4BC0A 1XTPA 4LRYA 3LX6A 1A88A 2KQUA 3M5CA 3N0TA 3U5TA 4BVKA 3VDQA 3LNCA 4UAUA 4WY8A 2P27A 4QXOA 4F2WA 1IQPA 2PKQP 2YNMD 3D81A 1KEKA 3JATB 3FGOA 1O0SA 4I55B 1NVTA 1ZL2A 2YY5A 3QWBA 2MMGA 4OXNA 1AX9A 5THQA 3RWMB 3WGNA 2F59A 2K87A 3MBIA 4BLPA 1L4EA 1TX4B 4MRSA 1FFEA 2YW2A 2O19A 3R9XB 1I5RA 2QRKA 3LBFA 1NHGA 2IP4A 4BB0A 4RTPA 1EVIA 1UKVY 3UUGA 4DV5B 3F2VA 3DE2X 2WTEA 5DNCA 5J3JA 3FOAA 1ZRSA 2Q6LA 3VO2A 3BL6A 1N34B 1I3KA 1LDBA 3FM9A 4UQOA 3WA7A 3QOFA 1WF3A 3UWDA 5JO0A 3LY8A 2I66A 4L5AA 4D44A 4XWWA 2FRDA 5IDQA 4P32A 4GF5A 3T95A 3EZLA 3ZIAD 3B60A 3MA0A 4LF5B 2Q5HA 1X7XA 3IHWA 1B15A 3V7YA 1GNVA 3GJ8A 3LYUA 2R0QC 1RM5A 3OIFA 4F3TA 1SHLA 1W4RA 4ZOCA 2QI9F 3I30X 3GZJA 3BE5A 1R00A 2ACWA 1CRQA 3L6EA 3LCVB 1XYYA 2I1WA 1L7OA 3CF0A 3HN6A 3BXGA 5L51A 4CLRB 3V97A 3GJQA 4X20B 3UIEA 1C8VB 3RFUA 1HMPA 2FWAA 4PFSA 3RS7A 4BV8A 2M2IA 3HXTA 5EEHA 3WK7A 5J1TB 3L0SA 4E5KA 2Q7XA 4LXIA 4Q47A 8LDHA 1TIPA 2ZE8A 4YMTA 4AJEA 3F67A 2RHBA 1XR3A 5T67A 3I3SR 2JGEA 2QTLA 4AQDA 1J39A 4Q1FA 4Q4HB 1YNOA 2QTZA 2FF7A 2W6MA 3F97A 3S1AA 1KBZA 4BQEA 4C1BA 1AT1A 1I2MA 3UN1A 3EA4A 1QO0D 2D2VA 1S02A 3A1DA 4HGPA 3NBQA 5JATA 4ZO6A 4OUDB 3Q8WA 1E3TA 4CUJA 4E3ZA 3N5KA 4DW8A 2Y6VA 4PSKA 3CZPA 3EGCA 1JG3A 4REOA 3TNJA 3VGJA 3KKNA 1H6BA 4EX6A 1J09A 2C5LA 1Q1NA 3N0RA 4GWLA 3DAPA 4UNPA 4AC9A 1H2YA 2C4VA 2C5EA 4DDTA 5ECDA 2JI7A 3CLTC 1SBIA 3ZV3A 3C3PA 3BORA 1BROA 4J1QA 3O8BA 5A0TA 3FRIA 5IN4A 2A9OA 1B73A 2IC5A 5F2KA 1V7CA 4BO8A 2JKYA 1TLFA 1UBHS 3C3MA 1KH3A 4MW9A 3GLIE 2I4MA 3WRWA 1U9CA 1DEHA 3S70A 2BCGY 4H6WA 4P36A 2VJLA 4V2UA 1ULUA 4G0NA 4LSWA 4EFLA 3VA7A 1XRJA 1ZK2A 5LZ7A 1J22A 3AL3A 4R7TA 4XDHA 3O8LA 2V7TA 1E3DA 5HHTA 1O96B 4IDCA 4EJ6A 4HXYA 2WSLA 1I4WA 3R6TA 2DAPA 4DS3A 2XB6A 4HV4A 3PHHA 3A0RB 4NPCA 1PWYE 2B4TO 2G9RA 3OUUA 2HJGA 3Q9LA 4L6IA 4XASA 1JFTA 1QHSA 5DBHX 4DSUA 4GQIA 3WK4A 1Z22A 1CUFA 1JKMA 4WLNA 4E30A 3G9QA 4MDHA 1GL6A 4R1TA 4XSGA 2B7BA 3R0ZA 3IP6A 4CEJA 5ALZA 3GBPA 2W2LD 1QDUA 3DEHA 1OFHA 1UBUS 3MJRA 1UXHA 1R6VA 3PQCA 3OTQA 1KDRA 4M0FA 4Z99A 2HN9A 3F47A 3V4VB 1BXGA 5EMNA 1YZFA 4DDWA 1Y81A 3NEAA 3KLNA 4BWGA 2QKYA 2UZAA 1TD9A 5DGCA 1XU7A 3G5UA 4LFCB 2DPLA 3ZX4A 3BMQA 3H8WA 1QFYA 1SEVA 2C4NA 4L5IA 5JJBA 5L3QA 4L15A 2W6QA 3EXAA 1STOA 2J1LA 1YS9A 3BFJA 1W49A 2ZPUA 4KNVA 5CYFA 4PZUA 1QS0B 3TVDA 1RTKA 1QFJA 2LUOA 2H1LA 3MWKA 5TXGA 2BGWA 2GEUA 2P4SA 3DEZA 4N39A 1JSLA 4W5TA 5ALKA 4RV4A 4ZK2A 2PUBA 1FVOA 4F2GA 1V8FA 4EVQA 3GT3A 4DR1B 1MORA 4TL8A 4BO6A 2PMEA 5CGQB 2OAGA 4BZWA 5HM6A 4TZ6A 1SCDA 3PG5A 1PBTA 1SVOA 3Q5EA 3GLIA 4N3BA 1FU7A 1JA0A 3AUXA 5CLLA 4ARUA 5HSGA 2OYRA 4DE5A 1U81A 1GKUB 2I2XB 5DTEA 1M66A 4H7PA 4LK2A 1AGNA 1JGTA 1Z26A 2ZT6A 3EVNA 2AI2A 2Q5FA 3JR3A 1K6IA 4WCFA 5LNK6 5HF5A 1HTWA 2C7BA 3A6FA 3E5RA 1ULBA 2IVZA 3A3NA 1UKBA 4MV5A 2AIRA 4PZ9A 2H2GA 2VZEA 2AD1A 4TV9F 5E7IA 5AVJA 1KY3A 1OYVA 4BFTA 1QB8A 4BWYA 1XMQB 5TR9A 2OP1A 3JQBC 3GUHA 3OKPA 4JT2A 2P9YA 1U1IA 1VMAA 1K98A 2IITA 4H6VA 3L1JA 4KR9A 3QLUC 4WECA 3TM5A 2CJPA 2M1XA 3AFOA 1E8MA 4DMUB 4PLTA 3MRXA 4D79A 5T3UA 3C3DA 3GUCA 1ABBA 2ZJFA 4WNAA 4G26A 5TQ2B 3R5FA 2DE0X 2OTCA 2B8WA 1I1NA 3UJBA 3WK9A 3O74A 1N4AA 2XKBA 1U3WA 3OIYA 4UUOA 5HOEA 3LHIA 4LS3A 3EEBA 2FSHA 4OQMA 2E89A 4IEEA 4DWWA 1IQUA 1I2BA 1PTJA 5C7OO 3NH6A 1DAPA 2QTHA 3O93A 3WWEA 3H5OA 3GFVA 4KWIA 3PSAA 3QU4A 2PUHA 3U4GA 1K08A 2OG2A 3HJNA 4XIYA 5DW0A 2COKA 5KSZA 1QYRA 3G7NA 1SM4A 3AZPA 3CRVA 3PPYA 5HF8A 4NENA 4LTNA 3VTKA 3BSFA 2JCYA 2WLTA 3G88A 4KDEA 1C0EA 1PFVA 3G2IA 3WHPA 3ZWOA 4DCVA 1SQSA 2ZAYA 4DCNA 4B46A 1NXXA 4PBSA 4TLAA 2OXCA 2AE1A 4DA7A 2JLAA 5TEWA 3URMA 2YZGA 2D59A 1DBWA 1DC5A 3WLRA 2AJCA 4K6MA 3KFLA 2LWIA 5AK6A 3ZZ1A 3I9KA 1VP3A 3QI7A 2OT3B 1JPUA 4R1UA 4UFPA 4ESHA 2OV3A 5FYQA 3OHMA 4DCUA 4OJYA 4CUKA 5A6VA 2QN3A 1EP9A 5IBCA 4HDKA 1SB8A 2AN5A 1IBRA 2QRHA 2J6BA 2OL4A 4MI6A 4XYEA 2JLCA 5L4NA 3K1TA 1U0TA 2JI9A 1GU7A 2YOFA 3P9ZA 2BMAA 3ZKWA 4A8JA 4MS3A 2XA2A 1FQKA 1Q0ZA 3GAZA 4NBRA 1TQ4A 3N9IA 3LO5A 4OXRA 4E1AA 5BMVA 3ROZA 1ZJ6A 1DWUA 2VZ8A 4QOGA 2HDOA 2Y1CA 4AN0A 2QAGA 3UUWA 5LUAA 3W5AA 3U1VA 5C4IA 5B1YA 5IKPA 1BVHA 2CY0A 4LXHA 1SUCA 4JI1B 3H2GA 1SUWA 3R0VA 3WL5A 4ZVMA 3JVDA 4IF6A 1HETA 2K2WA 2YWXA 4CCYA 5AW4A 1VLHA 1HGXA 1SU7A 2AJDA 3F71A 5CAEB 3AR9A 2ODPA 1Z0DA 1T36A 1WSDA 1YCHA 3ED5A 2XBUA 2QRLA 4U7FA 4XJVA 5EQFA 3PCTA 3WWPA 5CFRA 3E4DA 5ALNA 2EG9A 3ISJA 3ROQA 4LYDA 3F6PA 3QUBA 1VA4A 4UNQA 5E9AA 3VHXA 1R0CA 4AZ3A 2D8MA 4X95A 2WDZA 3K9GA 5DNYB 5FQOA 3ROGA 2B1GA 3W9SA 1DS6A 1HLPA 1O94A 2C96A 1WDKA 4C4AA 5BN4A 1RWNA 2VAMA 3PNVA 1XDWA 1E7WA 1NLMA 3HWSA 3VZDA 1C8BA 5IF9A 1ZUNA 3LIIA 3VR6H 2W93A 1DKOA 3OPMA 4ZYXA 1W8IA 1ZICA 4HF7A 2PLFA 3VYTB 1LCIA 3MRSA 1H05A 1XEAA 4U9UA 2P8SA 5D3KA 2VJYA 2ALJA 1Y1KE 2AOTB 3E9EA 5EG5A 3HWRA 4BMZA 3AKDA 3ZHOA 2VJMB 1KAMA 2B9VA 2UVPA 4D3FA 2Z4RA 2HNBA 1XRMA 1V4BA 5BQFA 5AJTA 4Y0AA 4FYWA 4UHBA 2OO7A 5FKJA 1MUUA 1VJRA 1D9XA 4ERXA 5DCLA 1PVDA 1VI6A 1Y0BA 1C1DB 1MTZA 2ZJ4A 2O7SA 2MDTA 4F3KA 3UFBA 2W4QA 1ADCA 1VPVA 2OZLA 3B53X 1UINA 2BFDA 1WXWA 3BJRA 2P9ZA 2HLHA 1J33A 1SCBA 1PJCA 1ABEA 2AJLI 3CUSA 3H5NA 3NHMA 4JHXA 3RK0A 4A82A 1JNYA 4H2DA 1E2KA 3D6MA 4HI0E 3OKAA 3T7RA 2WD8A 3KQHA 1MJNA 2HRQA 3HDJA 1DB3A 4JYBA 4QYSA 5B7PA 5A3RA 3KJIA 3FCXA 3VFDA 4LV8B 4B2LA 2W6ID 4OB6A 4JJAA 2QRZA 3SC6A 2PZLA 2JVKA 2PMCA 3H5LA 2FJUA 5KWIA 1LJ8A 5DYTA 2I1VB 1UFOA 1DIGA 1QHGA 4OL0A 4ZVNA 1YGYA 3QVLA 1UP6A 1BJTA 2BGIA 2FPSA 2P65A 4AF7A 5K2OA 4Y6GB 3PSHA 3HCPA 3HI4A 4C21A 4UJ3A 3EH2A 1UL1X 4CF7A 3KAKA 2O2GA 4LNUB 2F3PA 2VVTA 2OD2A 1UFQA 1IN6A 2FR0A 3R77A 4PY2A 1LPSA 1GVHA 4QNMA 3TW0A 4BQFA 3HNPA 1FRFS 1QR2A 4JJ7A 3V8BA 1M1YA 1WXQA 1GDDA 4AUKA 3VKGA 2GN2A 3EIOA 1ZGGA 4I1RA 4PNZA 1Z17A 2QNRA 3EPLA 1Y63A 1O97C 2GVZC 2OCIA 2WWXA 3BXFA 3LY9A 5AVKA 4D9IA 1QH1A 3AR7A 1TM5E 1AC5A 2NUPB 3AHHA 1DZIA 1HV8A 4QECA 3WK8A 3QTTA 2OHIA 4QELA 4O3MA 1MW9X 1OAOA 2I7DA 2C00A 3GRKA 4G5QA 3W3AD 5KCZA 3VZBA 2HDNB 3OG9A 1GYRA 1B16A 5K8UA 4QLAA 3ZLVA 4W63A 2ANCA 2FWIA 2GPBA 2P78A 1C1XB 3ONFA 2WAYA 2YN4A 5KTOA 4HO1X 3LUGA 1MXHA 4KGZA 1ZH8A 2A94A 3R5TA 3U7EB 5KTKA 2ZRNA 4JSTA 2QUJA 3JQAB 1VE3A 3JYQA 3N05A 2D0OB 5KWSA 4D4JA 1JHVA 1QO9A 3BAZA 4AYTA 1IN5A 2PH7A 2XCQA 3RF7A 3VPCA 4N76A 3RVLA 1LW6E 2C77A 4QODA 3A9WA 3ESQA 3ZW7A 4MWEA 1YTLA 1USGA 5E0KB 3ZHXA 5IS2A 1N8SA 1D7AA 3OA2A 1U9JA 1O2DA 3G02A 3CZCA 3IP8A 4M0KA 3KQMA 1D4ZA 4KUGA 2WTBA 1VMIA 2XYPA 1C9KA 2Z1MA 4ND4A 3TW4A 3HP4A 3KZKA 5K05A 3FWNA 2GX6A 4IDNA 4YJDA 2WWTA 3OWOA 2K7FA 1EBUA 1DJOA 1O95A 2H1OA 3AJ8A 1G2IA 2HDHA 3C5HA 3MGBA 5TQ0A 3NBFA 3CR8A 3FPEA 4PNPA 3RABA 3TOXA 1UBOS 5C32A 5KYYA 3UXHA 1EXDA 1VKOA 3N7UA 4TVBA 4DCPA 4F3NA 4RQBA 4CW7A 3AI2A 4IWNA 4G8JA 4DLZA 2NV6A 2JIQA 3PD7A 4TROA 1ESMA 4YIKA 5AUNB 4N8SA 3TLZA 2I4OA 4Q3DA 1PJZA 1RWKA 1BEUB 2CLCX 1JALA 3IESA 3DG9A 3STXA 2CDRA 4XIGS 3OT4A 1IPFA 1M1NA 4OKNA 3GAFA 3SIWA 3H9JA 5FWDA 1E2BA 3G8AA 1EZ4A 4FT4A 3UUEA 4PZPA 3GELA 1KC1A 1PSZA 1SHZA 1XLTA 1TQ8A 1ZOPA 2C98A 4UVEA 3B82A 4WK0B 3VBEA 1N2EA 3IP9A 2R47A 1QH8B 1H5QA 4RZSA 1XN1A 2DJ5A 3LLMA 4OKIA 3IMEA 3IJRA 2WUWE 3B9PA 5ALWA 3BMNA 3RSCA 1SKYB 4X41A 2OCAA 2W43A 4HYYA 5DCYA 1PLJA 2FPKA 3ILSA 4G1BA 3QYAA 4CRWB 1VIAA 1YCGA 2JK1A 4O29A 1QTQA 1F3OA 3ZJYA 3CX8A 3T3OA 2QVCA 2PSFA 4DCSA 4EHHA 3MYRA 5KJCA 2OECA 3ANYB 3U4QA 3JQFC 5JD5A 1MB3A 2ZQZA 1E8DA 3HU5A 3IQZA 3T4PA 1SBHA 3DV2A 3DKKA 4IIHA 2WWWA 4X62B 2F8MA 3QWAA 3ZVMA 2QX7A 1CDOA 3WG9A 3KSAC 5THXA 3ZGNA 2HQOA 3F98A 3QPAA 1AG9A 1R6XA 4KYIB 1XVUA 4Q37A 4ZCPA 3VV3A 3ZLJA 4BB6A 3TLGA 3UY4A 2VAPA 4D6XA 4Z9AA 3WWOA 1QVVA 4MQBA 4A23A 1QAOA 3G2PA 1Z0UA 2Q5JA 3HUTA 1K7CA 2YRXA 4A6DA 3TZCA 1TAUA 4TTTS 5BN1A 5AUPB 4UXHA 1Q3HA 1FP2A 3ND6A 4X1YA 4JLPA 3TDKA 2HIHA 4L7QA 5FH9A 3GFQA 2YKGA 2NU7B 1W5FA 3GLSA 1QRTA 1KZ4A 3DFUA 4V0QA 1A3CA 1GD1O 3TW8B 2ECFA 2PL1A 2YIJA 2ERXA 3KD3A 1XV5A 1U2EA 5JNUA 1PT6A 1TEXA 2IYRA 3H2KA 2P5UA 3OTWA 5T4FA 3TLJA 3I6ZA 1ZSVA 5DB4A 5EJFA 3WXBA 4I1PA 4C0XA 2GPWA 1VCHA 1C4KA 2O23A 4Y1EA 2JLWA 2N9UA 1ULHA 3OCJA 4JC0A 4YECA 4FE7A 1WW3A 2GPYA 4MQ6A 2WIKA 1QIJA 4JUFA 2GILA 2PDAA 3DKVA 3HVIA 3D7RA 3WV4A 2GTHA 3ZVKA 3KKMA 2NXJA 4KQ2A 2WA1A 5BVGB 2RBKA 3VC3A 3DEJA 2QM0A 3ZY5A 2DSNA 3B3JA 2QXUA 5CT9A 4BTEA 3RUIA 1QR6A 1F51E 3ZYCA 4IZOA 3HP7A 3T15A 3U13A 2R4TA 2GBGA 1ACMA 5ESRA 1A97A 3DL4A 3HJCA 3RVNA 4DYHA 2WQ7A 2VCYA 1NC1A 4DIBA 4GNRA 3VZPA 1KOGA 1UIMA 2HIGA 2P4UA 5EKXA 4CIAA 4GZ3A 4EB3A 5JNWA 4YJ2F 1XK6A 3U6KA 4I5IA 4NZMA 3FIUA 3QTLA 4YJ3A 2DUMA 1NLZA 1CUEA 1QRDA 1NYLA 4JQYA 5P21A 1QLHA 2IPNA 2CLMB 1RXYA 2PGIA 2QTFA 5FR2A 3M1LA 2XECA 2A5YB 3WHLA 1FNCA 1NV9A 2B92A 2NN3C 5JE8A 4A5OA 1Q12A 3G2QA 3ZDFA 1QU3A 5LP6F 1A77A 3QW4B 4KPUB 4H0CA 5K0FA 4CM3A 1HDYA 4PF1A 1VE1A 4HDMA 1AHNA 2GLUA 3GYGA 4TV8B 3ZNQA 2MSDB 1RM3A 3KKZA 4PAMA 1OXVA 6Q21A 1SVIA 3DHYA 1T4MA 1T9KA 2NAPA 3RU2A 3H5VA 5H68A 1MN6A 3VUFA 2JAWA 3IEXA 4L4SA 1SUEA 4QO7A 4GWKA 1KVSA 2WZBA 1N3IA 4OQQA 4KE7A 4FP9A 2PQ6A 5BN5A 1I7DA 2QTBA 2R8ZA 4CE6A 1YMVA 1K3UB 3V42A 3KHUA 1IATA 1WZCA 5LBTA 3V2GA 1U1FA 2AN1A 1NKTA 2NNLD 3EEQA 1XQYA 3ANLA 3DL0A 3EULA 3IP5A 4B87A 3BXPA 3M1AA 5IC4A 1KMHA 2JFFA 1C9DB 2DTDA 3SSNA 2CLKB 1YTUA 4Q9KA 4DJTA 1ZM2A 2N1BA 3FR7A 4QPZA 4F5YA 5KIAA 1JTEA 4DC0A 4LOHA 3RUAA 1Y1SA 3Q8MA 1GV1A 1PLLA 4HQNA 1YIAA 2FDRA 1XTRA 1MX9A 3WRVA 4OLFA 2C83A 5EI5A 5A5FA 5HA5A 3R5KA 4EMTA 4IDAA 2EX1A 4RL4A 4AJNA 5I7VA 3FYHA 3U09A 1R0LA 4D9NA 1M33A 4KAFA 4L16A 2R7AA 1QZ3A 1Y1LA 1WXIA 1Z39A 2FQYA 3PZBA 4E46A 1VJ0A 3MOSA 5FHRA 2X4GA 5J4VA 4Q9JA 1IUNA 4H60A 4RLQA 2QMHA 3QFSA 1YCDA 3U3XA 1ARZA 4WXMA 4DR4B 1IM2A 4O1HA 3MLBA 5A5EA 1OXSC 1RSZA 3NOQA 4RIEA 3HTXA 4UD2A 2JG3A 4UNRA 3WDKA 4TMVA 4GZLA 3FYSA 3NZEA 3FPGA 4H0FA 2G76A 2VTVA 5ENDA 1SAYA 3MWFA 1O1YA 4DC1A 4V1CA 2CK3A 2OYSA 1V8PA 2WK1A 2NZXA 4CG1A 3RROA 3HHEA 2GNPA 3T0GA 5KVVA 1UMDA 2V58A 3MIIA 4KLNA 3AP1A 2ZIVB 2FZGA 3CF6R 1WPQA 3CLRC 1OMOA 4P83A 4UREA 1CYDA 4YP6A 4BOYA 3SJZA 3KB6A 3PFKA 2H4ZA 1E99A 2G7ZA 2EVWX 2PE5A 1ZMOA 4Q1EA 3TIXB 4RPJA 1RC0A 1XTZA 3A11A 4H15A 3KAJA 1PDVA 4IIJA 4Z0PA 3NYWA 2IUFA 2VF4X 2QZ4A 4JI0B 3C4VA 4CIBA 1BH2A 3CB4A 5K8TA 1YV9A 2YRWA 3H4TA 3IBGA 3OM8A 4JJZA 3QBVA 4E6PA 5HQ3A 3FDJA 1DAGA 3C85A 3OQHA 5DEIA 4RTJA 4LF7B 5FTWA 3IVRA 2WA2A 1N57A 3N8DA 1A5BB 1DTEA 1GPAA 3R20A 3EQ8A 3W1EA 2P69A 2YHUA 4BU1A 1Z3CA 5LYJF 2I54A 4QBIA 4EO7A 5BQXA 4ZT4A 5CDUA 2MSLA 2XXJA 5EMLA 4OH7A 1P1CA 1P4JA 2VDWB 3C8ZA 3U9LA 2Q46A 4JP3A 1QWOA 1GQFA 5JZSA 4LXQA 4QA9A 2PHZA 4JN6B 1ZVMA 3JXEA 3RSGA 1K8YB 4C7XA 2GN8A 4C0BA 4EECA 3LP6A 1IEQA 3IB6A 3PFWO 3TOSA 3D7KA 2ZYSA 2XQIA 1XTQA 4QOIA 2FG7C 3K0FB 3O4GA 4U2DA 5TLSA 2W8ZA 5IEBA 1MZVA 2O2EA 3K31A 5A5GA 3PKIA 5DIZA 5AOVA 5LLSA 1L5OA 2ZPAA 1JZSA 3F3KA 3I8XA 4Z86A 2G40A 4G56A 3LKVA 2QMYA 1B6TA 1K0UA 2VP9A 1NNLA 3V34A 2A0FA 2X1MA 4RF4A 3VJMA 1L5MA 4CWAA 3AONB 1PDOA 3LGSA 4JCOA 5KDDA 2GRAA 2PKRA 1NRWA 5D2CA 2Q4EA 4BJ6A 1UPTA 3A6ZA 4HFRA 2O7QA 3UCFA 3L7KA 1YFJA 4WPGA 4F56A 5L4LA 2IZ5A 2DECA 5EIBC 1OIXA 2FEWB 3FMFA 4XUGB 3QWFA 1ONNA 4EJMA 2GBFA 3DJYA 5DX8A 4TTQA 3PA8A 4CQMB 1P0QA 3D6FA 2RHOA 1AS3A 2X40A 3EXG1 1VCIA 1FUEA 1YOVB 4IDBA 4I4TA 3B6ZA 1Y33E 1YR7A 2QSJA 3SYMA 2P1RA 5C8ZA 4OBWA 2VT2A 4Q7EA 5CA0F 5DW3A 1A4RA 1XKTA 5AVWA 3KPJA 1CJSA 2EGGA 5D5QA 2WWVD 1X6VA 3S1LA 4XXHA 2H2WA 1GQRA 5F51A 1ZVJA 5BNIA 2H1SA 3LK7A 5K1SA 1S3FA 4UASA 1HRDA 1TM1E 5LNK1 2RAVA 4F2DA 4B8WA 4GDFA 1JDBB 3NIGB 5DN6A 1FDOA 4RIHA 1WDWB 4YP5A 3VO8A 3K96A 1JHQA 2VT7A 3E82A 2HBRA 3GWZA 3PRKE 1FPQA 3RGWS 2WUEA 4DLAA 1HSZA 1FYWA 1LVHA 5BW4A 3JQRA 2QLLA 3IQIX 2BELA 1WKBA 1RAGA 1PGPA 1U7XA 4R2WA 1N2SA 4B31A 1LEHA 4NL4H 4GRDA 1G6Q1 3IDFA 3AW8A 1KXJA 2OGSA 2VH2A 1K89A 1J90A 2E21A 4Q93A 1WDTA 4NFYA 2QM7A 4RZ2A 5AW7A 3LQ4A 2E0IA 4IYJA 4JP1A 3RAPR 4Q4LA 4MEAA 1OI3A 3QU5A 1H1DA 1P3JA 4DBVO 1S1CA 1TYAE 1SIUA 1LY1A 3IBCA 3SOZA 4YAGA 3F73A 5JR3A 2A0XA 2X9GA 3K92A 3HKEB 5C8XA 4KAAA 2ADFA 2O3SA 3EPHA 3N39C 1RAFA 1K7FB 5HZKA 2YOHA 1XJ0A 1JZTA 1M83A 2GWRA 4FWTA 1TYZA 2A86A 2H06A 2A1IA 5HS6A 4EPXA 1CW2B 1BQ3A 1D2NA 2FWMX 3GZ4A 4MWDA 3SJBA 4AO7A 2ZBVA 2ONZA 2PKYX 5TC4A 1UC8A 2OAEA 4BGIA 3C8UA 9MHTA 1GARA 3WMFA 3P0HA 4FCCA 4M54A 3CN7A 5FOWA 3P45A 4GPD1 3DMRA 3GFSA 3JYPA 4RPLA 2CFOA 2ZRCA 4BZPA 2DT5A 2VRBA 3UMSA 4CR8A 3BIXA 1JWLA 2JEOA 1IEXA 2FMKA 3CKKA 1PFYA 1ZGCA 4MVJG 1LPPA 2OBMA 1LPNA 4M1EA 4PGHA 1MO2A 1TE2A 1MOQA 3OFVA 1Y6RA 2PX8A 3GLVA 3L8CA 2EZTA 2O48X 3AEYA 1QM5A 2PYZA 3IV7A 1QGUB 5EUQB 4YCLA 3RYCA 4ZC8A 3K09C 2VQ6A 4LRTB 1FXSA 3ZCRA 1SRQA 1UMKA 4KE8A 1G1AA 1ZJ4A 1KPGA 2X8BA 4ASUA 5B12A 3U44A 3STHA 3ADKA 4PSVA 5LB2A 3WYGA 3PDJA 3FY4A 1LNZA 2FSFA 3A36A 1LWOA 1KOFA 1PCXA 5EE0A 3NHKA 3Q1LA 4LRSB 4TQAA 4ZWNA 4ML3A 3RBAA 1R5JA 4RPIA 1W94A 1PR4A 1VA5A 3R3UA 2XQGA 2VPZA 4E32A 4DTCA 1YA6A 2O3JA 5CYGA 1U3TA 4US0R 3R74A 3OF3A 2VYVA 1GZVA 1K1EA 1QO7A 2O0MA 1DO0A 2Q3HA 5AXDA 5JANA 1XN4A 4F1WA 4EVIA 4NYJQ 4NCKA 4F96A 4GLJA 3OE7D 1BN7A 4IQFA 5FRDA 5BR7A 5K45A 3GLKA 2RI1A 2IEZA 3DFFA 1KI4A 3TX2A 4V0OA 4BBAA 1J23A 5CFOA 3V1UA 3MUFA 2QJOA 7AT1A 3IJPA 1AKUA 2FR1A 4W7IA 4EYGA 3DQPA 2QN7A 4QPPA 4WQMA 4YRFA 5HKBA 2QF7A 4IF4A 3VR3A 2GWHA 1CF9A 4MINA 4AJJA 1WXHA 1CX9B 5E9WA 4C3VA 2I3AA 1YC2A 4ER7A 3KG2A 2CXRA 1WETA 4L95C 1ZLXA 2FFAA 2EJTA 3QA3E 4IILA 3TAHA 5I4KA 1WZ2A 4INOA 3ZI7A 2VP4A 3PQFA 1VE5A 3IURA 4GVPA 4R4JA 2V7UA 1FS4A 3EQ6A 3SNKA 4D0GA 1QVWA 4Q01A 1NW6A 3L4JA 3OPYB 4U63A 2J0UB 1CPYA 1VG0B 3EE6A 4H08A 4BDSA 4DT1A 3EX7C 1L2TA 1M76A 4ALKA 4P92A 2ID9A 2IELA 2Z2IA 4PX2A 2CNKA 1PYDA 3M3PA 2VAXA 2ZBQA 2VHZA 1WOMA 4XWAA 3S0JA 1YI0A 3IHLA 3V46A 2IPAB 1PWEA 1RBQA 1MDFA 3I72A 4HZIA 4TXHA 4DLRA 1KDTA 1GN9A 3FNIA 4MB2A 5ICEA 3PTAA 4DMRA 5BMOA 3LQQA 4CN9A 1GLGA 1L4FA 1PF7E 1TC1A 2XLBA 1SC3A 3O73A 4RHTA 1DT3A 4FYJA 4TSFA 4QJIA 4V39A 3E3MA 3TKLA 2KYRA 2WFLB 2PD6A 3FMVA 4B6RA 4D4LA 1COWA 5AXBA 3IUJA 1VI5A 1XZHA 2ZFUA 4JASB 3S1SA 1QG2A 4OG2A 3Q6NA 1F7UA 2ZUVA 3BGIA 2C9YA 3JYNA 5DNEA 4OLAA 1YDFA 5T3YA 5DSZA 5EP1A 3ZHYA 4FGSA 4W9MC 3DWGA 3FAZA 2ZREA 3HCWA 1GTG1 4LY6A 1Q6ZA 2OXTA 3TW6A 5JT1A 4L4RA 3CH6A 1Z75A 2NU8B 3D5QA 4DV4B 3CH7A 4Y2PA 1XRRA 3TEJA 1P74A 3FH0A 1W88A 3PZRA 1Z16A 1DKLA 1QRRA 1SKQA 4LZLA 1JXAA 3BQ9A 1Z6YA 4J4HA 4YROA 1DXQA 1RQNA 1F60A 2O14A 2PYDA 3I6BA 1JP7A 2XCUA 5DNVA 1LLQA 2RAFA 4JJ6A 4F5ZA 1FTYA 2PMWB 2X13A 5E2IA 1WE2A 2R25B 2B69A 2DMRA 3OT1A 4YV2A 2J3LA 2X2EA 1RD4A 3MZ0A 1NLYA 2ORWA 1JWAB 2CUZA 3PFFA 4O2BF 3V48A 4YCSA 1W8DA 1A2OA 3BGVA 3FHOA 3HDVA 3P9NA 4NNOA 4NV0A 4RD4A 3NALA 2RIRA 2GF0A 3SHWA 3KVRA 2R3SA 4IJ6A 5CRIA 1HFWA 4DLUA 1FQWA 1S8OA 2Q8PA 3G89A 4E88A 1QH0A 4H3VA 5JNVA 2YV5A 2ZI7A 1NRIA 1XZ8A 5AVZA 1LS6A 2ZDGA 2WIDA 4JI5B 3TL3A 5K0NA 4HJXA 3AF2A 5DI3B 4TKUA 3RF6A 1XDSA 2QA5A 2XOKA 3OURA 5K0SA 1XMOB 3JAMA 3H1PA 2HSDA 4JMPA 4UDOA 1TCBA 1BW9B 1FOEB 2VH5R 1CQJB 5CIQA 5B6PA 4RK6A 4V02A 4BHTA 3NVKI 4PG7A 2NXEA 3ZI4A 3C5WP 3EW9A 5A6SA 2L2QA 4D80A 4RM3A 2PUFA 1UMBB 3I1JA 5JROA 6ABPA 2PUEA 2VG8A 1CUBA 4Y30A 3T1YB 2PLNA 3HY4A 4MAAA 4LV5B 5LQKA 1ZHFA 3KYCB 2GNOA 1VE6A 2P2GA 5FA5A 2ZOSA 5AR1A 2EW8A 3CF2A 3RTGA 4EF6A 1L7MA 4F8YA 4Z4CA 1FIUA 3ZW9A 5JTTA 2B78A 2C8VA 5CJJA 3KEGA 4PX9A 3T99A 1Q1EA 4ZI7A 3BB4A 3NPMA 3TFOA 1GUYA 2MSKA 1NVKA 3JAKB 4F4DA 4YRSA 2YN0A 1CY6A 1OXUA 1XHEA 1T1JA 2PRSA 1XCPA 4NBSA 4UPDA 5COQA 5A3JA 4N18A 2B4YA 2DFDA 1EZ1A 1PBNA 1E58A 4MRVA 4KFCA 4WL0A 3RBVA 1KY2A 2UZIR 4I0WB 1RXUA 1CLEA 2P2DA 4HLDA 3RVJA 1H9BA 1GGKA 3P9RA 5JDCC 2GAIA 1L3IA 1IZ9A 1FDUA 1MMFB 1NYTA 3DE1X 4YAFA 2IIVA 2PWYA 5JSZA 1AUOA 4MVJP 4EGAA 4B32A 2IV7A 4DPKA 2GT1A 2RGYA 3AK4A 3INTA 1XWIA 1FFCA 3FDZA 4E03A 5DGTA 1SBZA 4JROA 1TAGA 5F1KA 3THYB 1R9GA 1KAEA 2QJFA 3LMKA 5E38A 4FN4A 4Y6OA 1GPLA 3CZ5A 5T8KC 2BFNA 4XD7D 4EY5A 2G6BA 2EDAA 4TQUS 3LQ2A 1NPTO 3HB5X 2FW9A 1EWQA 3HBLA 1RWXA 1UEIA 2GZRA 3LCRA 1UBLS 5KDOA 3PBKA 3AR2A 1NZFA 3HDQA 3KHSA 4TV9B 1JEOA 3M6VA 4NYIQ 1KQOA 4K9RA 1S8AA 1G8PA 3H97A 2JAXA 4WN9A 1YA4A 4LBYA 4NU6A 4KR2A 1U28A 4XCXA 2IFTA 4GFDA