1WLYA

Crystal structure of 2-haloacrylate reductase
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
332
structure length
322
Chain Sequence
VMAAVIHKKGGPDNFVWEEVKVGSPGPGQVRLRNTAIGVNFLDTYHRAPPIVVGFEAAAVVEEVGPGVTDFTVGERVCTCLPPLGAYSQERLYPAEKLIKVPKDLDLDDVHLAGLMLKGMTAQYLLHQTHKVKPGDYVLIHAAAGGMGHIMVPWARHLGATVIGTVSTEEKAETARKLGCHHTINYSTQDFAEVVREITGGKGVDVVYDSIGKDTLQKSLDCLRPRGMCAAYGHASGVADPIRVVEDLGVRGSLFITRPALWHYMSNRSEIDEGSKCLFDAVKAGVLHSSVAKTFPLREAAAAHKYMGGRQTIGSIVLLPQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-haloacrylate reductase
publication title Crystal Structure of 2-Haloacrylate Reductase
rcsb
source organism Burkholderia sp. ws
molecule tags Oxidoreductase
total genus 111
structure length 322
sequence length 332
ec nomenclature ec 1.3.1.103: 2-haloacrylate reductase.
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1wlyA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1wlyA01
2VYVA 2WEKA 4G81A 4TSKA 1DC6A 4R68A 3VH4A 2JFHA 4XYGA 1U3WA 2G5CA 1IPEA 1ONNA 2G1UA 4JP3A 4NBUA 5DZSA 4HV4A 4NFYA 1JA9A 5K0ZA 1HDRA 5JO0A 3G0OA 1D1SA 5HA5A 3VZQA 1B8UA 1U4SA 3KYCB 4WUVA 2AQKA 3QWAA 4NG5A 3ZWMA 1YE3A 5KVCA 5L4SA 5ILGA 2YW9A 3GPIA 4KMSA 3OIGA 4BNUA 1Z6ZA 1SMKA 1F8GA 4DYDA 3GUYA 1N8KA 3DMYA 3L9WA 4F6CA 5A3JA 1KEVA 1NVGA 2VTDA 4CM8B 3QWHA 2C82A 4CJXA 3AI3A 3SLGA 1JAXA 4BMSA 4ZQHA 3LSYA 3I9MA 3E82A 2X7HA 2R6JA 4NBWA 5JBIA 2X4GA 5FFFA 2ZTVA 3VZRA 1Q7GA 1YQGA 5K6AA 3H5AA 1B14A 3C7CB 3R1IA 3JYNA 5IAAA 4P38A 5C7OO 5AXBA 3BMCB 4W4TA 3DXFA 4XJSA 2BRUA 2EJVA 4FJ0A 1N7HA 5JPIA 9LDTA 2GN8A 4DQVA 4CR8A 3U49A 3AUTA 1CJCA 4A27A 3WGYA 1KVQA 1MFZA 4OL9A 2Z1NA 3L77A 2QW8A 1GV1A 2NNLD 4Q3NA 2JHFA 2A9FA 2NU8A 4IDCA 4L0QA 4DPLA 1LRLA 3C24A 1S6YA 2X23A 4U6QA 3TF5A 2CFCA 2JKVA 3PRJA 4EJ6A 4DLLA 3WLFA 2C5EA 3VH3A 1KVRA 3TJRA 1GU7A 4MP6A 4R1NA 4L8VA 1VL0A 3SJUA 2WYWA 3HZZA 2PFGA 1NX6A 2VHYA 3D7LA 2GGSA 2ZYDA 1X7DA 1NR7A 2EERA 3JQ9C 5EJ2A 1HSOA 2HQ1A 3M1AA 3ZU5A 2B5VA 3DQPA 3L07A 1VL6A 4CMJA 3TZKA 2GZ2A 3AOGA 4KOAA 4WNIA 2GN4A 3JCZA 1LI4A 2C0CA 3LDHA 1ZK2A 3GEMA 3ZWWA 1HDGO 4GAEA 3SLKA 3NDRA 4B7UA 2Q1WA 3GMDA 4MVJA 4PG7A 3INTA 4NMHA 4G5HA 4ND1A 4XYLA 3ZWYA 1Y5MA 1YS4A 3WWYA 4GKBA 1P0FA 3X2FA 4ZQBA 1WDMA 3PYXA 4QQRA 3WICA 5TLSA 4IS3A 1LDGA 4GGOA 2DTEA 2PK3A 2ZTMA 1ENZA 1A7AA 3LK7A 3W4JA 3D64A 4YVFA 2YZ7A 2Q4EA 4XCVA 5IJZA 2DKNA 1OBFO 1R15A 3RBVA 2W2LA 1U7TA 1O6ZA 4O63O 4IUYA 4K6FA 4YTEA 1JKIA 3IMFA 1NNUA 1W0CA 2A35A 3E9MA 1JLLA 3RU7A 1NPTO 4LISA 1WXDA 1QYXA 1EK5A 2H1SA 2IXBA 2OHXA 2P5YA 3TNLA 4B7CA 4OOEA 3E1KA 3GC6A 5DP1A 1X0VA 4R9SA 1TLTA 4BNLA 2ZYGA 1AE1A 1HF3A 1HZJA 2DFVA 3DAFA 5JSFA 3U4CA 3DTYA 4CQMB 1UXGA 4WLOA 3RFXA 4NQZA 3IJPA 3BTSA 1PGPA 4RDHA 5JLAA 1E1NA 3GVHA 4RQTA 2OGUA 4GMGA 4EGFA 1E7RA 3WGTA 5JS6A 5H82A 4L4SA 1XU9A 2Y99A 4BO8A 3EZLA 3NDIA 3UCEA 3PVZA 2NQ8A 3WX0A 1H2HA 6ADHA 5L4NA 5DOVA 1V9LA 4E31A 2B36A 5TJHA 1LSUA 3WWZA 3QP9A 4RZIA 1QYWA 3DB2A 4CR7A 4DLBA 4ND5A 1BVRA 4XGNA 4D3DA 3JQ9A 3N74A 1EE9A 1NQ5A 1PGJA 4M86A 1V3TA 8ADHA 2YHUA 5DOZA 1P74A 3D1LA 3RI3A 2JFGA 1GPDG 5DULA 4ZICA 1M6HA 3WQRA 1VPDA 3DBRA 3DFUA 4TRJA 4EEXA 1RM5A 4GI2A 3PZBA 4K26A 3KO8A 5I9LA 3K2EA 1I2CA 3AUUA 2Y67A 1W8DA 3R6DA 1X1TA 5DP2A 2GASA 5L9AA 3IL2A 4Y8VA 4TWRA 5CPBA 4F6LA 1TT7A 2VYND 3VKUA 1LRKA 3GA0A 4ND2A 5JYEA 4U8GA 2UAGA 3EZYA 4AG3A 1IY8A 3KSDO 3MJ4A 4WJZA 4E13A 4YQZA 4RORA 4UEKA 3VVCA 1UDCA 2RIRA 3M2TA 4UUPA 3I52A 3OA2A 3OQBA 1LLDA 2O48X 3D0OA 4E5PA 2J3JA 2VCYA 3F5SA 4W9NC 3E8XA 4Z9FA 2HK7A 3KB6A 4OQYA 4KWIA 1IYZA 2EWMA 2TMGA 2X5JO 3W8EA 1YOVB 4YAKA 1LDNA 2HUNA 2PA3A 3K5PA 4NBVA 3BMQB 2DQ4A 5TX7A 4CLRA 4BNNA 3AY3A 1Q0HA 1HETA 4OAQA 2X0NA 2D2IA 2FRDA 1N9GB 4IDGA 3PTZA 5KJEA 1O8CA 3O8QB 3WIDA 4AICA 3WS7A 1QXSA 5I8ZA 2UUPA 2W4QA 3HUDA 3FD8A 3SX2A 3RUFA 2BGKA 2VZ8A 4FBGA 4J2OA 4MP8A 1I3NA 1E1KA 1HL3A 3AFNA 5A5FA 3PHIA 5HS6A 3DL2A 1C0KA 1W73A 4Y9DA 4ND4A 4CLOA 4RVGA 2PZKA 3S2EA 3LC2O 5L7WA 3JD1A 1G6KA 2VN8A 4J7XA 1B16A 1XSEA 5CG1A 4BV9A 5G4KB 4J6FA 3OH8A 4DXHA 3B1JA 2FP4A 1HT0A 1U1IA 2GRAA 2Y0DA 2RAFA 4NHEA 1A27A 1DFIA 2PGJA 5C37A 1XKQA 1P1JA 2FPPA 5I7VA 1YGYA 3PWZA 3V5NA 3M2PA 2FY8A 5IN5A 1AXEA 1PL6A 4YAEA 3K92A 5C3MA 1VKOA 1I5RA 3TWOA 2EGHA 1DLIA 5AXCA 4D44A 3RSHA 1A4UA 3PJFA 4NZ9A 1X15A 3GR6A 4JX8A 4QXMA 4BO2A 1K0UA 2FR0A 4II2A 3UCXA 3DEYX 4K9DA 3PWKA 4Y67A 4WLFA 4LVCA 3O38A 3C1OA 4RF3A 4Z3DA 1SEPA 1EVIA 4UVHA 3JSAA 3N7UA 4BMVA 4J43A 4M89A 4LCJA 4PG5A 1E7MA 2BGMA 1XDWA 3OBBA 1ZK0A 8LDHA 5IF3A 3PDJA 3SBOA 2Z95A 1QP8A 2DFDA 1PJCA 1NWCA 4EYEA 3I5MA 2J8ZA 1PZEA 1PSDA 2BELA 1LX6A 1BG6A 3UXYA 3C7DB 1VRWA 1JAYA 1KIFA 1WMAA 1NR1A 2Q50A 1EDOA 2FR8A 4R9RA 2NQTA 3NTQA 2C7GA 3VTFA 1PJLA 4IM7A 4W82A 5I9MA 1UZMA 3UICA 3CMMA 4UAGA 1V0JA 4GLOA 5C5IA 2CY0A 1NHGA 5COAA 4WASA 3BHIA 2ZATA 3IAHA 1ISJA 4MPDA 3TFOA 3FHLA 3TZ6A 3HDJA 1SOVA 3LF1A 4W6ZA 3FWZA 3IOYA 4IXTA 5T6BA 4PZCA 3U5TA 1EEHA 1QV7A 5JC1A 2C59A 4CV2A 3MWDB 2X86A 2ZB7A 3GG2A 1KVTA 2OBNA 4O6VA 3RUCA 4KDFA 4BKUA 1E7QA 5CEFA 5IXYA 1HYGA 4FJ2A 1YBVA 3G49A 5ENDA 4WECA 1HTBA 3DWFA 2Q99A 1O9BA 1DOHA 1H93A 1Y8RB 5F5LA 1MX3A 3NT5A 3PFFA 1DHRA 3FPLA 4EDFA 4GH5A 3WNQA 4H7PA 1TT5B 1PGQA 3KSZO 5IZCA 3DHNA 5LCXA 4CQMD 3K2BA 1CYDA 4URFA 5L3ZA 1WDLA 3KTDA 4E2XA 2Y05A 2I66A 1HE5A 4OO3A 3KVOA 1LJ8A 4PVDA 1MG5A 1EVZA 3GRKA 4BNTA 5TC4A 1SCUA 3U4HA 3F4LA 5JCJD 4G2NA 1T24A 1ISHA 4E5MA 3S1LA 3P2YA 1BDMA 1BRMA 5COQA 1ORRA 4ALJA 4FFOA 1VJ1A 3DZFA 4I9UA 2NTVA 4IMRA 5U9CA 5DCYA 5KVSA 5I7SA 3QVXA 1L7DA 4WEQA 3KM0A 4JJIA 3UKOA 5T8KC 3HSKA 1DC4A 1N1GA 4FS3A 4BNZA 3AW9A 2HRBA 5KCZA 1P31A 1CDOA 4FJ1A 3ZCXA 1UXHA 2FZWA 2VYNA 3AFMA 2F00A 1KERA 3GVIA 1EVJA 3H6KA 3PQEA 3QRWA 4OSOA 4BGIA 3HG7A 4M55A 2LDXA 1WWKA 2ZK7A 4WCFC 3W8FA 2J6IA 1BHSA 4UEOA 3RWBA 1EK6A 4YDRA 1QR6A 3F6YA 4TRNA 1LTHR 2ZYAA 3F46A 4WCDA 5DBGA 4AJOA 1F17A 4TZTA 2VUTA 3FBGA 4JBHA 3WR5A 1YL5A 5ER6A 2CSUA 3ROMA 1V8BA 3QWFA 2D8AA 3MJTA 4KUGA 2NACA 3QWBA 1LXCA 4XRGA 2WSBA 1NAIA 4E4YA 3GRPA 1D4FA 2I6TA 3EVTA 4UVEA 1UXJA 2HSDA 4U0JA 4CM8A 1WPQA 4PLZA 5GZ1A 2AQ8A 2EV9A 1FDTA 1ZK4A 2EKPA 2YV3A 3STHA 1B3BA 4JNKA 3MJSA 2BFPA 4ALMA 3IKTA 4EITA 4HFNA 4BGVA 3JQCA 3T7EA 4WKGA 1LQUA 1XCBA 3G1UA 1XR3A 3SVTA 3KV3O 1GYPA 1UJMA 3MJVA 3OHSX 3ORFA 1OC4A 4RF2A 2C2XA 1K6JA 1YKFA 2PLAA 3BMCA 5IFLA 1KVUA 4QX6A 4MKZA 4UVDA 2VHZA 1OC2A 1XHLA 4J1SA 1GZ4A 3WSVA 1DLJA 1DFHA 1R4NB 4EJ0A 4AJPA 1B3RA 5TF4A 4UEJA 4Z9XA 4B3HA 1CRWG 3TRIA 4WLVA 3GF4A 4PFJA 1HZZA 1VJTA 3ABIA 4BQPA 4FR5A 5CG2A 1GYRA 3ZI0A 1Q0QA 3KEQA 1ADGA 1LSOA 3GUCA 3NUGA 4HBGA 4EW6A 5CHEA 2VWPA 4XIYA 1NYTA 3CZMA 2YQ5A 3WFJA 1CF2O 2VRBA 4PLGA 1LDMA 4MVJD 3QV1A 2BMAA 2J3HA 4PLCA 4YRDA 2O4CA 1VE9A 4RVFA 4M49A 1GUYA 4IMPA 1U3TA 3QE3A 4DRYA 2NADA 5ITVA 5BNIA 3GDFA 4L73A 3NT4A 4RPLA 1IHXA 3ASVA 1ML3A 2RHCA 3DZIA 1E3SA 2ZKLA 5BT9A 2Q46A 4L4XA 4U0KA 4B7XA 4XYBA 2XXJA 5KTKA 3R0IA 2RH4A 1E5LA 3ZHZA 1GCOA 4Q3DA 4UUNA 4KTVE 3UCFA 4H16A 4I8XA 2R00C 3L0DA 1RPNA 1Q0LA 4J7CA 3ETEA 4FB5A 1ZKMA 3K8ZA 5FWNA 3BHMA 1AN9A 5TT0A 1KEWA 5JY6A 4CM5A 3V1YA 4FC7A 3AY6A 5B4UA 4FPXA 2AHRA 4NU5A 5L40A 4EI2A 3LT2A 4KUHA 5TS3A 2PH3A 1AHHA 2GCGA 2Q49A 3QW2A 4L76A 2RBEA 4DBVO 4GWKA 2ZQYA 3QVWA 1RJWA 2OBYA 2XF8A 3BMOB 4JQCA 3RIHA 4CUJA 2OO5A 3DBLB 4FIZA 2FSSA 2A92A 2WWRA 2CF5A 2O3TA 4XWYA 1EQ2A 1GY8A 3I4CA 2BD0A 4J1QA 4A2CA 4P22A 1LRJA 3CEAA 3RUDA 5KVVA 4CQLB 1IUKA 1Y5RA 4BO6A 5DF1A 5BSHA 1BSVA 3LT4A 1F12A 2HLPA 1QYVA 4LGVA 3UOGA 3I9LA 3JQFA 1DC5A 1DSSG 3IP1A 5THKA 3Q6IA 2QZZA 1X1EA 2AG5A 3TZCA 4UVGA 3HB5X 4CQMA 3PJGA 4YB8A 5JCXA 1RM4A 2PGLA 1EFLA 2BGLA 3HE3A 3OIFA 1ZUD1 2YUTA 3PP8A 4O59O 4C7KA 1P1IA 2QRLA 4U6SA 5EMHA 2AMFA 5BSEA 3JQ8B 1WLYA 4H3VA 3NTOA 3JTMA 3OETA 5JDCA 2WYVA 1K6XA 5CDSA 3IP3A 1KOLA 1PZFA 3P7MA 1N92A 4B3IA 3PQDA 1C14A 1LDBA 4DMMA 1YVEI 1JWBB 2Q45A 4GX2A 3RFVA 4E6PA 3NRCA 5CDGA 1R16A 5I8WA 2CMDA 1GQYA 3EW7A 4AVYA 3G79A 5A9RA 1U4OA 4BB6A 4PIVA 4I9HA 4PG8A 2D59A 3JYQA 3PLRA 1P0CA 2JFFA 1N1EA 1ZEJA 2ZB4A 3OEYA 4CV3A 4BQRA 2DUUA 3NGLA 1I24A 3JD3A 4DUPA 3F4BA 3ZWNA 4E5KA 3KZVA 2HK8A 2IYPA 4OXNA 4D79A 2PD6A 3IJRA 2PWZA 5F1PA 4FW8A 4B4UA 4BNYA 3OICA 4CMKA 2HMUA 4QECA 4OYRA 3AI2A 4PZDA 4RLSA 1ENOA 3WGGA 5B4VA 1T2EA 5ILOA 4BGEA 2DU8A 4QSMA 4NJMB 2NTJA 4KTTE 3EHEA 4RPGA 1H2BA 4IJUA 5CEEA 4J1TA 3Q9UA 4LRSB 5HWSA 5KWEA 3TL2A 1IE3A 1R12A 3PYLA 1P1RA 2VZ0A 1QYCA 1HE4A 3QIVA 2GZ3A 4RL6A 1U3UA 5T57A 1PS0A 2IZ1A 1D3AA 3T4XA 1LC0A 4B4OA 5FYDA 2QYSA 4IY1A 4DBZA 4D3FA 2G17A 3EK2A 5F1KA 2CDCA 5K1SA 4AJ2A 4MO2A 3PXXA 3EC7A 1H0KA 1YOVA 2CDAA 2UDPA 3VVBA 4A73A 1Y9AA 4MVJE 3NKLA 2BI7A 4Z6KA 1ISFA 4GMFA 1KVSA 3RC7A 1R4MB 4CMAA 3BMQA 4J0EA 1B7GO 4E32A 3H5RA 1UP7A 4TKLA 2HJRA 4E12A 2AQHA 2O3JA 1N9GA 3CE6A 2PV7A 4MIEA 4ILKA 3BZUA 3O8QA 1K89A 2FOIA 3DBVO 4GKVA 1RYEA 4DVJA 1NFFA 3KETA 4WOKA 3T7CA 4NIMA 1T2CA 1UXIA 3G17A 5FF9A 2W2KB 4XR4A 3WXBA 3GZ4A 2QG4A 4BNFA 3GK3A 4MINA 4CLHA 4UREA 3F5QA 5IN4A 1MGOA 4IGFA 3JYLA 3ENNA 5G4KA 3JV7A 4N7RA 3SXPA 3M1LA 4OIMA 4XGKA 4CV1A 1DDOA 2VZ9A 2FPIA 3OP4A 3EAGA 3LQFA 3A4VA 1SOWA 2QQ5A 4P4GA 4WCFB 3CTMA 1A4IA 1XQ6A 4BKRA 1VSVA 5L95A 3I4FA 4W99A 2AXQA 4OM8A 3RKUA 1J0XO 1QMGA 1BMDA 2WE8A 3A14A 3RUEA 4YT4A 3W6ZA 3ZZNA 2VUSA 2DBRA 1BDBA 5BR7A 3L9XA 4P4NA 1BTOA 1NPDA 4BKOA 2V6GA 3WTCA 5JAZA 3ONEA 1WNTA 5B12A 3D5TA 1CQIA 3GFBA 3HN7A 3KSUA 3ETGA 2BKAA 4HXYA 4BUCA 3OMLA 4NNJA 3RU9A 3HDHA 1G0OA 5JO9A 3AWDA 3ZWOA 1HE3A 2P2SA 1M66A 1C3VA 1ISMA 1I36A 1QLHA 3EVNA 4N5LA 1J6UA 1B2LA 3UFXA 2B69A 5L7YA 4TVBA 1MA0A 3N58A 4AFNA 5A06A 3GEDA 1LEHA 4RPHA 5BSGA 2WD7B 4N5NA 2HMWA 4BNWA 4E0BA 4DPMA 4FFLA 1QSGA 4A7PA 3VHRA 1UZLA 4IGEA 4NFSA 1EQUA 1OOEA 5U1PA 1KY4A 3MOIA 3GVPA 1MLDA 1I3KA 4L9RA 4Y6RA 3E18A 1K2WA 4YAJA 4BO3A 7ADHA 2X5KO 4PLFA 1A72A 2VOJA 4WLEA 5A02A 4HP8A 4YR9A 3ICCA 4AJJA 3PIDA 2HJSA 4J49A 1EVYA 1EDZA 1UR5A 4HUJA 3E5RA 3H9QA 1DB3A 3UW3A 4DPKA 2ILTA 3WMXA 5TNXA 5DCUA 2GO1A 3DBHB 1LLQA 3VPHA 4CV0A 1ID1A 4JGBA 1J4AA 3AM5A 4EUFA 3IQDB 4PG6A 4WNCA 3ZU4A 4QT0A 1A7KA 3B1KA 4DC1A 4DQXA 2HK9A 4CM4B 1Y8RA 3DC2A 4CM6A 1T4DA 3KYDB 3VPSA 4LW8A 1PJSA 4CPDA 2J3KA 1V3UA 5KJCA 1YDWA 1TT5A 2JD2A 4E21A 2WM3A 1NBOA 1O95A 4AJLA 1B8PA 4BNVA 1GQ2A 2B83A 4PVCA 4XQCA 4RVUA 4IZIA 3RC1A 3A06A 5CDUA 3LU1A 4QFCA 2P91A 3WIEA 2JCXA 2X58A 4IJKA 4XZ3A 4P8RA 5A9TA 3ANMA 3CZRA 3B20A 3JD2A 2EKLA 5JFOA 2H63A 4DA9A 1I10A 3GGPA 3BA1A 4CMEC 4JIGA 5TQVA 1IHYA 1B15A 1NHWA 2WYUA 2AEFA 5A4DA 4WK6A 1DIHA 1P1FA 4YT5A 2C54A 1RYDA 1N5DA 3MEQA 3Q9NA 3RC2A 1R0LA 1I3LA 4YT2A 3FSRA 1GZ3A 3H9JA 3K6JA 3NJ8A 3OIDA 1H6AA 1M2WA 3BTVA 1EUZA 1E6UA 4CM1A 3L6OO 1XU7A 4II3A 4K28A 5TGDA 5C7LO 4ZVVA 1VSUA 1MC5A 1ZBQA 5TT1A 1DHTA 4M8SA 3RBXA 1I2ZA 4YPOA 1MUUA 1PJ3A 2JD0A 3H9GA 5FI5A 4GVXA 1R66A 4PRKA 2CZCA 5CAEA 3O4RA 2BFMA 3WGOA 3DZJA 1HDOA 4B3JA 4FSHA 3PK0A 2EP5A 1D8AA 1G1AA 2NU6A 1BXGB 2V65A 3PWSA 1FJHA 3DZBA 1HDYA 1JVBA 1JTVA 5L51A 2CNBA 3ROKA 4GQAA 2VHWA 4CUKA 1U3VA 4BVAA 4JLWA 1I8TA 2XXBA 1A5ZA 1C0PA 2EGGA 4YJGA 1QLJA 1Z74A 2SCUA 1B8VA 3AOEC 3WGZA 4J4BA 3V1UA 4ALIA 4PRLA 1ZJYA 4QUKA 4DLAA 4EJMA 3ST7A 1JW9B 1E92A 4CMIB 1EMDA 1SO8A 1YRLA 3KXDA 1U28A 2C7VA 2WMDA 3FNFA 1XA0A 4CLDA 4HY3A 4WOJA 2JAPA 1E77A 2DUWA 4ZRMA 2IE0A 3WQSB 4DTIA 4W7HA 4Q3CA 4Z0PA 4I08A 1Q1NA 3RC9A 1Y8QB 3GLQA 4Y6SA 5IXSA 2VUUA 5JC8A 1GCUA 4J90A 2BFAA 4ZA2A 3WYEA 2HKIA 3AUSA 2O4UX 4CL8A 1HDXA 1WDKA 1ZVMA 3U4IA 5CP8A 1SEVA 4HNGA 3W6UA 4ZQFA 1OMOA 5U4QA 4CMEA 2O3UA 3UF0A 1PS8A 2P5UA 3AM4A 3AU8A 3TL3A 1R4NA 3K96A 3RQSA 3WTBA 2Q2VA 1MXFA 3D3WB 4Y98A 1I01A 1FDUA 2RH8A 3GG9A 1ZEMA 4PLTA 3WMWA 3DDNA 3KLMX 2FHSA 1GDHA 2YJZA 2EEZA 1FXSA 1KEUA 4JBGA 2I76A 4JJGA 4OXKA 5AYVA 2JHGA 4BGUA 2O2YA 2P9GA 4D45A 4W9NA 4ITUA 2B4TO 3ZNQA 3FBTA 3I9JA 3OF2A 5EQFA 1M75A 2YQ4A 3O03A 4HFJA 3C8MA 4R5HA 4D46A 4XQ9A 1VI2A 2I67A 1MP0A 1I32A 2PZMA 3ZU2A 4I5DA 1R0KA 1Z82A 1PGNA 4YBZA 3BIOA 3JQ7B 4OXYA 4GPD1 3WBFA 3ZHXA 3Q0EA 9LDBA 2NV6A 1YBMA 3TFQA 1GFSA 3UH1A 5H81A 2B37A 2BFOA 3GY0A 2YDXA 4IQ8A 2O2SA 2GERA 3VKVA 3DAPA 1XELA 4QFDA 3AOEA 3H8VA 3GT0A 5COBA 2HMSA 4JP2A 2DM6A 4BHTA 2HO5A 3D5QA 4XX0A 1PJTA 1TEHA 3BMOA 3C3XA 3JD0A 5C7IO 3GNQA 2UUOA 4WLNA 1NVMB 4LK3A 3DBLA 5GZ3A 3ITKA 5JE8A 3PJDA 1PWXA 4XRRA 1BWSA 1N7GA 4CQLA 1DXYA 5JYDA 5THQA 3E9NA 1MG0A 3DOJA 2EHDA 2Y1DA 4NK5A 1ZMTA 3IDSA 2XPCA 4BL5A 1NM5A 2P9EA 4D7AA 5ADHA 1LUAA 3EY4A 1DFGA 4Q9NA 4WEOA 6LDHA 1LLCA 2XAAA 4QTZA 1ZXBA 1X14A 2GNAA 4GSKA 1NTOA 3CUKA 3GAFA 4RQUA 3MWEB 4ZN6A 1IOLA 4HWKA 4RZHA 2POQX 2Y66A 3JD4A 1EUCA 3U3XA 3WYBA 3I1JA 3TOZA 5J23A 5ES3A 3WYCA 3JQ8A 2RCYA 3ZV3A 4BNKA 3GGOA 2X5OA 3BMNB 2QHXA 4BIIA 2EXXA 2VNAA 2IEDA 3TSCA 2GYYA 4ID9A 4R1UA 2Q4BA 2EKQA 3OJEA 2P4HX 5DCWA 3BAZA 5T5QA 5ITWA 5JDIC 2W90A 3ZV4A 2VWGA 3OJFA 3FR7A 4HFRA 4YACA 2IRWA 1ENYA 2CUKA 1E1MA 1IPFA 5EINA 5F21A 3RJ5A 2OXIA 2WE7A 1GR0A 1GTMA 2AQIA 3H3JA 3QA9A 3PGJA 3CSDA 4I5EA 3FCOA 4RO0A 4OJNA 5CDTA 2H5LA 4O5OA 1R6DA 5EPOA 3FWNA 1YJQA 1XLTA 4XGIA 1F8FA 1BW9B 4ESOA 4YJGB 4J3FA 1ISIA 1Z7BA 3AUAA 4RV9A 1E5QA 3C85A 4E2YA 5G0SA 1I3MA 2A4KA 2FN7A 3GN2A 1LBEA 3PIIA 2NVUB 2IYOA 2E82A 4LVUA 4AJEA 3GN1A 2ZQZA 4FDAA 3EMKA 4YXFA 1I2BA 4NJMA 1JKJA 1PJBA 1Y9EA 4MVJM 1FK8A 2X9VA 5IG2A 1FDVA 4ZRNA 4MVJP 4G65A 4YYZA 5FEUA 4RDIA 4ZU3A 4L4RA 4NBTA 3PHGA 4YRBA 4PLWA 1MB4A 4RGBA 3VH2A 3ZWBA 4J16A 4DMLA 2QZ9A 5ICSA 1AHIA 1NVTA 4DL9A 4DGSA 3ASUA 2OORA 4RPJA 2GDZA 3TQHA 1N2SA 4NK4A 4GSLA 4JXKA 2HAEA 2PY6A 1KY5A 1R4MA 2X8LA 2Z5LA 1DO8A 4XDYA 3JQ6A 1HWYA 2HDHA 5DNAA 2Q2QA 3GAZA 4NU6A 2H6EA 4YEDA 3S2FA 1RM0A 1GUFA 3WBBA 3LLVA 1VKNA 4CUZA 1KEPA 4IZHA 2VT3A 3FNEA 3H7AA 2AE1A 4HKTA 3WNVA 1TB4A 1E7WA 2W2KA 2Y1OA 3PI7A 1YBAA 1F06A 4PLPA 5LDGA 4DIFA 2PR2A 4DIBA 2D4AA 5F1OA 3LZ6A 1WP4A 3ETDA 1Q7CA 1CEQA 4NH4A 5T8KA 3FF4A 1OFGA 1S7CA 3V2UA 1HDCA 1EUDA 4PG4A 4MJLA 4L74A 4S1VA 2CD9A 3ZWPA 2O3QA 4BNIA 4YJHB 1VLLA 4FFNA 4JCOA 3GHYA 1H6CA 2TMDA 3JQAB 5DBFA 4L75A 3WSWA 4J4HA 2C07A 2WTBA 1NAHA 4WCFA 3FTPA 2GZ1A 4O1MA 1PJQA 2X0JA 1PEDA 3LLSA 2DC1A 5KKCA 4IS2A 5G2OA 4IINA 2JJYA 3KBOA 4JJFA 1DAOA 4XKJA 4R51A 5I7EA 4J9UE 1H5QA 4HX5A 4LMPA 4P4LA 3AU9A 4A03A 4NDNE 1YDEA 3W1VA 1CIVA 2CF6A 5ENVA 1XEAA 3TOXA 5KOIA 1C1DA 3GHHA 4I5FA 1VC2A 4J4TA 4IDEA 2NVBA 4CL3A 2C5AA 4ZGWA 4CMGA 4GLLA 3VH1A 1W4ZA 1P3DA 1JU9A 3PGXA 2X0RA 1C1XB 3WFIA 2UV8A 4NBRA 2AA3A 2ZJ1A 2B35A 4GX0A 3F9IA 1PQPA 5KVQA 2WD7A 3NAQA 3B1FA 4OOFA 3TZQA 2YHIB 4R54A 1AGNA 1B26A 3RVDA 2DT5A 2Q1UA 4AJNA 1G0NA 4ZJUA 3ULKA 2NU7A 2OP0A 2QX7A 1MV8A 2GLXA 2BH9A 1K5HA 2D5CA 4ND3A 5K6AC 4AJHA 3ADPA 3IUPA 3RBZA 3GDGA 2JCVA 3HQ4O 1SB9A 4DC0A 2R2GA 5G0VA 3K31A 4IQGA 2C20A 2GD1O 3F1LA 3DBHA 1JDJA 1UXKA 3ZH2A 1QKIA 2D1YA 1DIGA 2E6UX 2ZB8A 3GGGA 3ZN2A 2J5RA 3HB4X 3LC1O 4Z3KA 1M6WA 3RUAA 1ZK3A 3E48A 3F3SA 2EW2A 4CM4A 1HRDA 4YWJA 4QEDA 4RCVA 3CPSA 3KYDA 4KDEA 3GVXA 3QVOA 2Q2WA 2FPGA 1J5PA 1DC3A 2GSDA 1DIAA 2CVQA 4CM7A 3GEGA 5FI3A 3B70A 2NLOA 1P45A 5AOVA 1BVUA 4BKQA 2DPGA 4FGSA 1EBFA 1WVGA 2YDYA 2E49A 1VM6A 2B0JA 1HEUA 3WGIA 3ENKA 2A94A 4UUOA 3HDYA 1SPXA 3DHYA 3U09A 1MFPA 2HCTA 5EN4A 1VJ0A 5CDYA 3ICPA 2R00A 3FNGA 1XIVA 1ARZA 2ET6A 1L7EA 3DHEA 2J3IA 2YFQA 5EERA 4C7JA 5HS4A 1EBUA 4YJFB 2X6TA 4XJTA 5CEJA 5L4LA 1GD1O 3DZGA 4ZQGA 4N5MA 1I0ZA 1E3IA 4OMUA 1NPYA 3PHJA 5ICMA 5DBIA 1LLUA 4AJIA 1O89A 1ZSVA 4FD3A 1U8XX 4DIOA 4B79A 2IZ0A 1NQOA 4D43A 3OJLA 2EJWA 2YY7A 3A9WA 3ONFA 1OI7A 4Q3AA 1LSJA 3D4PA 3NJ4A 2G76A 5HTOA 4WPGA 3GQVA 3QQPA 5GY7A 1ZZEA 5A9SB 3CKYA 1ZJZA 3ZGYA 1ENPA 3EUWA 3UVEA 4YT8A 3RUHA 1CERA 1UUFA 2CDBA 3IIEA 4IJWA 1BXGA 4J7UA 1U5AA 3GMSA 3NDJA 3PEFA 4CMCA 2Y68A 1ZMOA 4R3NA 4Z0HO 1LQTA 1PU2A 1E3WB 4WLUA 1V6AA 1PZGA 4RVSA 1DEHA 4HADA 1YB1A 2QRKA 4U7WA 4J1NA 4FFRA 3ZV5A 2FWMX 4MKXA 4PLVA 3BYZA 1X7HA 2HMVA 3MJEA 2AEMA 3AJRA 4GWGA 2F1KA 4TMFA 1R0SA 4CMIA 3MTJA 1MC4A 3SC6A 1YB4A 1B0AA 3V2GA 3I9OA 4FFMA 1P1KA 1UDAA 1IL0A 1DIRA 1ULUA 1M76A 3SJ7A 1PIWA 1RM3A 1GEGA 3TDKA 1YXMA 2C29D 4INAA 3VOSA 4FFPA 1Y8QA 4KQWA 4CM9D 2ZCVA 4XD2A 4DWVA 1FMCA 4U5QA 3WQQA 3PHLA 1XGKA 1NASA 1C1DB 4OKNA 3DAGA 3S55A 4AJ4A 3GVCA 3OFSA 3QWIA 3PLNA 5JAIA 1ZCJA 4R1TA 2VHXA 4PCVA 4E5NA 3WOHA 2B5WA 4NFHA 5BQFA 5EQDA 1H9BA 3ZDFA 3D3WA 1PQUA 3JQAD 3ZW9A 3GZNB 1IZ9A 1WZEA 4JBIA 4Z9YA 3WJAA 4EBFA 4E5YA 1E3EA 1LDEA 4TROA 1EZ4A 3U62A 3FN4A 4E30A 3EYWA 4F46A 4BNXA 5A5EA 4R5MA 2X9NA 2EIHA 2Y1FA 2BLLA 1XYGA 1ZH8A 5G4LA 3JQDA 1Y1PA 2FR1A 4IIVA 1WMBA 5G0TA 1X7GA 1HYEA 1KYQA 4Q39A 1CQJA 2PTGA 3KYBA 3VPFA 4EUEA 2DVMA 4K6CA 2FZEA 4IIUA 3GDOA 2B4RO 4PLYA 2DBQA 4YCAA 1ZW1A 4KUEA 3VTZA 4AJKA 3TPCA 4D0SA 3ANNA 4I9NA 3A28A 1BGVA 3CINA 1ZSYA 1BXKA 2W98A 4D41A 3JQ7A 5L45A 5H83A 1ZK1A 4DYVA 3QJ5A 3MZ0A 3JQGB 3VDRA 2O50A 3Q2KA 2EW8A 4JN6B 3ZWAA 4OKIA 4D0RA 5A03A 4I1IA 2O3RA 2Y93A 1H9AA 3INGA 3INRA 3LC7O 2FMUA 2W8ZA 3AY7A 5L53A 2UVDA 1IZ0A 5BNTA 2D5AA 2D0IA 1Y81A 2Y1CA 4O0LA 4M87A 2P4QA 3FTNA 3V8BA 3RKRA 3JYPA 5KJ6A 1IULA 3IC5A 5JNLA 3WB9A 3RUIA 3PDUA 4ZHSA 4I5GA 4TQGA 5JY1A 2O23A 3WGHA 1P9LA 4MDHA 3UGKA 1CWUA 4S3MA 3PHHA 2VRCD 2P9CA 1ZO8A 2I5PO 1C0LA 2O3SA 2QRJA 2Y0CA 1DJQA 4RVHA 3ZWVA 2NM0A 4XYEA 3PQFA 1NQAO 3OQ1A 4XB2A 1ONOA 1L1FA 2FSVA 4W7IA 3ZWXA 1HXHA 1GADO 2AEJA 3Q2IA 4XQEA 1AXGA 3OJ0A 4YA6A 1WZIA 1XG5A 3COSA 2YV1A 4M1QA 3S8MA 3HN2A 4HNHA 3ZV6A 1YJ8A 4GGPA 1A9YA 2YYYA 2OOSA 5L7TA 1U8FO 5JW6A 3K30A 1NFQA 3C1AA 1NWHA 2PKRA 3BMNA 3CXRA 1UZNA 3UN1A 4BMNA 2PKQP 2V6BA 2WD8A 3KRTA 4F45A 1LA2A 3GNTA 1HE2A 4MVJG 1NXQA 4ZQEA 1GV0A 3Q1LA 3VC7A 5KIAA 3KOUA 4YRAA 3IUSA 4BO1A 3V1TC 4N54A 1TA4A 3HHPA 1LNQA 1KC1A 3LF2A 3BXXA 5IZ4A 4K1LA 4HFMA 1LSSA 3RJ9A 4WGGA 5HRUA 3ADOA 3ZHBA 2V6MA 4J9VA 3Q11A 4FQ8A 2ZTLA 1E3JA 3ROPA 4IQ0A 5IDXA 5JAQA 3H2ZA 3MTGA 4D42A 1D1TA 3F47A 3OQ6A 1LU9A 1P44A 1SZJG 1BW9A 1X0XA 2NUAA 4UVIA 4TZKA 1YWGO 3GOHA 5F5NA 5KJFA 4UULA 4ALKA 1A9ZA 2I99A 3P2OA 2NVUA 5KNLA 1WW8A 4JROA 5BNFA 4R69A 4BKPA 4J2HA 2DTXA 3ZNNA 1FF9A 1KC3A 4JK3A 3I6IA 2X22A 3L4SO 3FRJA 4MIOA 3ZNPA 1MXHA 2C2YA 3NV9A 4XB1A 2X0IA 3L6DA 4OHUA 5EIOA 3GPDG 2X1HA 4NR0A 1ZXLA 3E03A 4C4OA 3C1TA 5TSDA 1H6BA 4YAIA 4PLHA 3W4KA 3U0BA 3VPGA 2NWQA 4GX5A 1UDBA 3PZRA 2ZCUA 5IZCC 1KS9A 1Z7EA 2EF1A 2CVZA 4MOWA 4KP7A 2ZJ0A 3OECA 3Q3CA 3FR8A 4LMRA 4R41A 5T64A 1JKFA 1XQ1A 1F0YA 2QIOA 4RPKA 3UUWA 3NEPX 3BTUA 2G82A 1SAYA 5F3RA 4R16A 1GAEO 1U5CA 4MIYA 3TZHA 3T4EA 1T2FA 2IZZA 3HFSA 3KEOA 1PWZA 4NI5A 3ZW8A 4CM9A 1PJ2A 1PL7A 3ONDA 3WG9A 2PZLA 4GL4A 2HU2A 2D3TA 2P68A 3DZHA 1ZFNA 1PQWA 5AQ1A 1AUPA 1UAYA 4KWHA 1O5IA 1YB5A 2QYTA 3X2EA 4BNJA 1E1LA 2IXAA 2BF7A 3WGQA 4YJHA 3HDQA 5K9ZA 3HNPA 3LT0A 4MKRA 1F14A 1PS9A 4RF4A 3F1KA 4BO5A 3JQAA 2GR9A 2OZPA 3BHJA 1SB8A 3C7AA 4TRMA 3QLJA 1T1SA 4B4VA 5A3VA 4PN3A 5DDIP 4BNHA 1Y6JA 3AK4A 1JWAB 2VOEA 3RFTA 1M67A 4BO4A 4XQGA 5TRTA 1GQQA 3LT1A 4OH1A 1PX0A 3WJ7A 1TVEA 1DBVO 2VHVA 3HJAA 4FC6A 4Q3BA 1ULSA 1DIBA 4BO0A 4D3SA 3H9EO 3RASA 5AXDA 2V6FA 4XA8A 4QO8A 3P19A 1PR3A 1TXGA 4LSMA 3EDMA 1PL8A 4B8WA 1NP3A 4NPCA 4ZD6A 1PJ4A 1H6DA 2ZIZA 4ALNA 3OSUA 5TIIA 3ZNOA 4X54A 1GEEA 4EUHA 1C1XA 5AVOA 3H5NA 3OA0A 2DTDA 4IBOA 3ROQA 4PGFA 2JAHA 1DAPA 5MDHA 1HLDA 2YHIA 3LYLA 4R3WA 1H94A 1WAMA 4XDZA 1HDZA 1E7YA 1KBZA 2DBZA 3AM3A 4IJVA 4TRRA 5JMPA 1PTJA 3RAJA 1W6UA 3E6AA 2VWHA 4E33A 1A71A 4IDBA 3PYMA 3NYWA 4FOSA 1U2DA 1GUZA 2Q1TA 5AXAA 5A04A 3DBRB 2Y1EA 3VZPA 2WJPA 5CPFA 1FDWA 3DO5A 3BTOA 1HLPA 2WDZA 3H65A 1CETA 3A1NA 2VRCA 1BXZA 3VZSA 4LCEA 4BNGA 5GMOA 2PKQO 3B6ZA 3CH6A 2O7SA 3NT2A 3NTRA 3R3SA 4OQZA 5TJ9A 4DQUA 1I33A 1Q2XA 2VT2A 4YAGA 3JQEA 2DPHA 3ZWCA 4IDAA 5JXWA 5CFZA 3PJEA 3DMTC 3NX4A 5HBRA 1E6EA 2OUIA 2PZJA 1T4BA 3GH3A 4R01A 2HMTA 2PD3A 5IDYA 4BS9A 4KZPA 5A05A 4CODB 4RJTA 4E3ZA 1Z73A 2EP7A 2GPTA 4TVOA 5DT9A 3UHAA 2VYVD 3OJOA 4FCCA 4XR9A 2H9IA 4GVLA 4BOYA 2XOXA 2PNFA 3O26A 3VPXA 2DLDA 3ZHYA 1ADFA 1Z75A 1U9JA 4EZBA 2I3AA 1OAAA 2GN6A 3I23A 1UP6A 2OP1A 3AI1A 3MCVA 3QSGA 3L6EA 3MOGA 4BNMA 2DAPA 2UYYA 3KUXA 4CLRB 5BSFA 3S2GA 1NFRA 2PH5A 3ON5A 1PR9A 1ZNQO 3OEWA 4N18A 5DN9A 3W8DA 4XEHA 3U4DA 3RD5A 1RWBA 1DJNA 1U2GA 4GBJA 4YJFA 2PD4A 1X13A 1ADCA 3EGOA 4BB5A 1Z45A 1HSZA 3I6QA 4J0FA 3OM9A 4CLOB 3KYCA 2YFHA 4A0SA 4RLHA 5I7FA 3HWRA 1LC3A 5G0UA 1O94A 3ZU3A 2JD1A 3UAGA 1T26A 3L4BC 1D7OA 2IODA 1HYHA 3FNHA 4RVDA 5IDQA 2DBVO 4MP3A 4PZEA 1E0DA 3D4NA 3GFGA 2BHLA 1Y7TA 3HADA 2GUGA 3P5SA 3QY9A 4OSPA 4BO7A 2Y0EA 1VL8A 3DTTA 1YONA 5A9SA 4A5OA 3RROA 4J91A 4KQXA 2YV2A 1EE2A 3SEFA 1SC6A 3FPCA 4RF5A 4CMHA 3CMCO 4M54A 4YQYA 4UUMA 3JQBC 4XIJA 1ADBA 4AJ1A 5HM8A 3E9QA 2OL4A 4NJOA 2VQ3A 3HFGA 3JQFC 1E7SA 4BO9A 5EL0A 1QORA 3ANLA 2G0TA 1DRUA 4TKMA 2AW5A 4R1SA 4R4JA 4DREA 1E3WA 4IDDA 2V7PA 2IEBA 1V3VA 1O0SA 7MDHA 1SNYA 1QG6A 3KHUA 3LVFO 3S2IA 4CM3A 2JL1A 1GYQA 1TI7A 2VNSA 1C0IA 1FDSA 1GZ6A 1ZSNA 1QYDA 1R37A 2X9GA 3DMTA 5JDIA 5JDCC 2NTNA 2NSDA 1UAGA 1DPGA 3V2HA 2O7QA 4LRTB 1P33A 3FI9A 1YL6A 1YL7A 3M6IA 1I30A 3JYOA 3W4IA 5JAMA 2I65A 1LDYA 1T1RA 3G3EA 4A26A 3DZKA 4B4WA 4ALLA 2JCYA 4ONEA 1UP4A 2ZB3A 1YQDA 1DRVA 4MVJH 1GL3A 5G0WA 3QVSA 4EEZA 5JMWA 1JN0A 3DOOA 2Q1SA 4FOOA 3DR3A 3DONA 3ITDA 4H15A 1KETA 2B4QA 3MJCA 3K9QO 3VDQA 1QRRA 4ROSA 1T2DA 1Q7BA 3NGXA 4CLXA 5KKAA 2E48A 3R3JA 1RKXA 2LDBA 3IS3A 2W2LD 3CIFA 5B4TA 1T25A 3H3FA 3GZNA 4YJDA 5GZ6A 4CR6A 3H9UA 2ZTUA 1IB6A 1SBYA 2EG9A 2I3GA 2AG8A 5I9NA 1K6IA 4IDFA 4IXWA 4A10A 1ISGA 3QVTA 3H4VA 4MVJI 5B37A 1E3LA 3WLEA 4CMBA 3L4BA 4XYMA 2E4AA 4Q3EA 1ONPA 2RHRA 1QV6A 5MGBA 1XWFA 2AE2A 5LC1A 2HRZA 2NU9A 1EFKA 3PFWO 1GPJA 3QHAA 1NQTA 3G1TA 1JQBA 2VTEA 2VWQA 4B8ZA 4BV8A 1T2AA 3GNSA 5ER9A 4MVJF 1YO6A 2GF2A 4CLEA 1JVSA 3I3OA 3U9LA 4F3YA 3KLPX 4E2ZA 5A1TA 1HKUA 2OMEA 1K3TA 2BI8A 2GN9A 2PGDA 3E5MA 1UH5A 3JQBA 3VAZA 3D4OA 4E2WA 2Y1GA 2IDZA 5KJ1A 1YH3A 2J5KA 1PGOA 3PPIA 4FN4A 3I9NA 3JQGA 4LN1A 3DFZA 1PZHA 2Z1MA 3O9ZA 5LDHA 3D3EA 4WE3A 4GX1A 2J5QA 3H2SA 3I83A 2E37A 4LSWA 5EESA 2NVWA 4Z0TA 2Q3EA 4FGWA 1V35A 1J49A 3K73O 5JCJA 3RCBA 3WDSA 2OFPA 3SC4A 3DOCA 4AL4A 1E6WA 3I9KA 2CVOA 5T67A 1U7HA 1ZIDA 4QO7A 1DRWA 1P1HA 4OGWA 1YQXA 3IKVA 4IPTA 3TN7A 4Y6PA 1OZAA 5IDWA 5B1YA 2I9PA 1P77A
chains in the Genus database with same CATH superfamily
2WEKA 4TSKA 2RGNA 1EX1A 1DC6A 3B2EA 4R68A 4XYGA 2BKEA 3UJDA 3VH4A 3VHXA 5CLGA 5F7XA 3VPAA 4YIHA 2VDWB 4X3PA 4IHQA 4K6HA 5DZSA 4NFYA 1HDRA 1XZIA 1T15A 3BGVA 1ZD8A 3G0OA 1P39A 4PZ0A 4JJ4A 2O57A 2PRIA 2XDWA 4YR7A 4KXMA 1P0IA 1EGQA 3F5FA 2ZZMA 1WTAA 4N82A 1RIFA 2WG1A 3CC8A 2A5JA 2G5PA 2OLKA 1BD4A 3GPIA 4HWOA 5EGNA 4KMSA 1WZUA 2P2GA 1KOFA 3FETA 1Z6ZA 2H7CA 1F8GA 3A3KA 5DB4A 3L9WA 4GC5A 4HYEA 4MQBA 4FT2A 3COPA 4Q03A 4CM8B 2OXEA 2KYRA 1MDFA 5HJ7A 5IFKA 2C82A 4DN6A 3R7AA 3SLGA 3EVGA 2JFNA 2FMKA 4X3CA 5FFMA 4OMFG 1SVMA 5IWAB 4PZPA 3I9MA 4Q3LA 3LYHA 3E82A 4WNYA 3LRXA 4YP1A 4PSKA 4LFCB 2X4GA 3C5VA 2HDWA 1YJAA 2O5EA 1Q7GA 3CM0A 4MYDA 1PT6A 2IH5A 1B14A 3IQZA 4KNYA 4ZDWA 4A8PA 3W5BA 1BJKA 1RYBA 3HJHA 1SQ6A 1SC4A 3AUXA 3DXFA 3OURA 1FP1D 5TDHA 2VZLA 1N7HA 1RVV1 5JPIA 2IK8A 3HBMA 2GN8A 3GXBA 5JVDB 4K1XA 2YNMA 1Q1AA 1Z47A 4A27A 2Q8PA 4FMPA 3KTOA 3WGYA 3BC1A 4E6EA 3RK4A 1XZLA 2AI3A 5BN5A 1GV1A 1KYXA 1DKLA 2JHFA 1E5VA 1NJ8A 2A9FA 4PV7A 2NU8A 5BMVF 2X23A 4U6QA 3TF5A 3ZJUA 1XK6A 4EJ6A 3RRJA 1PV1A 1VBMA 2F3RA 1YVDA 5G1OA 4KQKA 5EIEA 4AZ0A 3WZ2A 4YO8A 3LPNA 3LUFA 3OUZA 1GU7A 3OQIB 4TQ9A 1W1IA 4WXMA 3Q3VA 3C5EA 5ECDA 2DYKA 2PFGA 2PNJA 1R88A 2A86A 2BEUA 5IW8A 4ICIA 2ZYDA 1X7DA 1S2DA 2QPOA 2V0CA 2B8NA 3EG5A 3JQ9C 4H7KA 5KNDH 2XCSB 4AQ7A 3LQ1A 1LY1A 1L5YA 3SZ3A 3ZU5A 5LDDC 1VL6A 4LXYA 3WLOA 4I50F 4OEHA 3I5UA 3TZKA 1E6KA 4YXWA 3JXEA 5K7SA 1G1MA 2C0CA 2QTVB 3F71A 1G6OA 3ZWWA 5DU2A 1I2AA 3FYUA 4GAEA 1VKZA 2RK3A 3ABQB 2JJMA 3SLKA 3O1IC 4DIEA 4B7UA 3ER6A 4DLRA 4O4HF 3E9CA 3GMDA 4MVJA 4KREA 4ND1A 1ZLYA 2FMIA 3F78A 4XYLA 1Y5MA 4X65B 1YS4A 2QXUA 4JX9A 1IM2A 3CISA 2ORIA 3KQMA 3AR5A 1Q50A 1KKMA 3AL3A 4GKBA 1XJ0A 3X2FA 3GDWA 1E66A 5AFSA 3OPYI 3PYXA 1OV4A 4BMYA 1Q3TA 2X13A 5TLSA 1GPUA 1UOOA 2VEDA 4QNNA 3W9BA 3A7DA 3HCRA 4LJKA 1V4BA 3LT5A 4RD4A 1A7AA 2JVJA 3ISTA 3W4JA 1AURA 4LZNA 2QZJA 5JWRA 4CT5A 4QGAA 1CY1A 5KYUA 1OBFO 4U8HA 2OYRA 1KEZA 1R15A 1ZVQA 4MDYA 1TM2A 4P0PB 3O2SB 1G5IA 1ELOA 2A58A 3C7TA 1E6MA 4AMYA 2I2DA 4E5DA 3NTXA 3RS4A 4TV9F 1W0CA 3RU7A 1WXDA 2CHUA 1XRNA 1EK5A 2C98A 2A1TS 1GSAA 4NYMR 1TK3A 3EDRA 3OF3A 1MQ8B 2OHXA 4J94A 4M0UA 1NL3A 3K8YA 4UZEA 3TNLA 2XOEA 4B7CA 1CY6A 2IU6A 3E1KA 2CWWA 1JBQA 3KCNA 2JCBA 4OOEA 1UCFA 2ZAMA 4BNLA 3B1WA 1HF3A 2DFVA 2NYUA 1H2XA 2QN6A 2H4YA 3GA7A 2ZXFA 1K7EB 2DUNA 2JH3A 4K6OA 3U4CA 3CVUA 4M9ZA 4WLOA 4NEHB 5L3SA 3D6TB 3V8QA 1K1EA 3IJPA 4NQZA 4C76A 2ACVA 1DOAA 5JLAA 4RV5A 3EFBA 3KR9A 4GMGA 1PWEA 1GNSA 3LLMA 4HC4A 1QIFA 2GZRA 4PYOA 1JYEA 5I47A 4H35A 1SWVA 4M98A 3DOEA 4AZVA 3VNRA 1XU9A 3IH5A 3HO6A 3HV0A 3OC0A 5GWXA 1DAMA 3IAXA 1RAHA 4BO8A 3FTQA 3RVNA 2B3DA 2JHCA 4LBZA 3WX0A 2NQ8A 2VK2A 1Z3IX 3A2LA 3ESBA 3GQBB 3SFZA 3DOIA 1GZ5A 5KNBD 2J1LA 3KKPA 1W5BA 3I2KA 4FGJA 4EKYA 1Z2NX 2Q3FA 4D92A 5FTNA 2DRIA 3QP9A 2Z1DA 2ZI9A 2BMWA 4FKZA 4OHPA 3ZVNA 1ORWA 2R68A 3O5AA 4D3DA 1YIOA 4LJ5A 3TMYA 5EJ7A 4RENA 2QG6A 3IVCA 4LXIA 3CGWA 1V3TA 2O8DB 4RNCA 2BY4A 1DBWA 5B4TA 1RJFA 2JFGA 3LUBA 4IL5A 1GPDG 2CSXA 4QJ3A 2X0DA 4WZZA 4EYGA 1VPDA 3ADKA 3DFUA 5KDLA 4ARVA 3TRJA 3GFRA 1Q3HA 1SU4A 4HPJB 5J1SB 3HNRA 3UT0A 3PZBA 5JR3A 1WD5A 1W8DA 3R6DA 1X8JA 3TJMA 3PQ5A 3UHJA 4R2JA 3PWTA 1FSSA 3H3XA 2P35A 2EKDA 5BQOA 3VKUA 1L5LA 1YDFA 3GMIA 4ND2A 4V39A 5JYEA 3EZYA 2ZRQA 3H1EA 3HHEA 2F4NA 3DQZA 3KSDO 3ZLTA 2JFVA 3A1CA 1Z4NA 4E13A 4EK9A 3I6MA 5ICFA 1J42A 3CR3C 2ATIA 1Y34E 5B1HA 5B3AA 1PR1A 2J3JA 3DM5A 2FEAA 2QTHA 2PBLA 4QTXA 4MS3A 3PXAA 1XQWA 4W5RA 4KWIA 1IYZA 3CWQA 2TMGA 3E27A 5IUNC 3ICWA 3BGOS 4F4UA 1GM5A 4LYAA 1ADYA 2PA3A 1KK3A 3LP5A 3MIZA 4RSRA 1G8KA 2OLJA 1PNTA 4LWQA 2DQ4A 3B9BA 4KMOA 4RKYA 3ZR4B 4D6YA 1NQVA 4Y18A 4P34A 3AERB 2OAQ1 4Z2AA 3GV0A 3IQFA 2YVQA 2L17A 1W36C 1AKQA 2EZ4A 5DYGA 4J7AA 3KL2A 3WS7A 4BATA 2V97A 1EGMB 1N3YA 2ZPAA 1K6EA 1N6HA 2C88A 2PXCA 2RGDA 1NVVR 1TO2E 2W4QA 4FBGA 4LDPA 1BWQA 4QPNA 4UBIA 3A6KA 1H0SA 4EPRA 5HF6A 1E1KA 2YVLA 1NXXA 4XM1A 3DDWA 2D1FA 1ZR2A 2M98A 2Z6QA 3DL2A 5BORA 4HLUC 1CB7A 2VPIA 5KTRA 4TLAA 3KLNA 4RVGA 2PZKA 4CLOA 4G5SA 1RC8A 3LC2O 3QVKA 1I5OA 5HGXA 3BB1A 4GE3A 5G4KB 1JEOA 4J6FA 5HILA 1RLOA 3WL5A 3TNFA 4D3XA 1HT0A 2FPIB 2H06A 3RG8A 1JMYA 1XDZA 4QDZA 3EXHA 3RIXA 1QU3A 5EXEA 1DFIA 5LYJB 1CUCA 3L5KA 3PX2A 3QFSA 4JBWA 4ZAVA 5ALZA 3AJDA 3FCXA 3BH7A 1RRGA 1U8CB 1UKYA 4TYWA 4R2IA 4MI6A 4EF5A 3TRHA 4RTLA 5I7VA 1YGYA 3CEPB 3M4XA 3PWZA 1Q91A 3F4KA 4GS5A 4Z7OB 4U9UA 4H7HA 3EUEA 1W75A 3I12A 3B3AA 5JSQA 2HCFA 4NAUA 2GMWA 1YTUA 5C3MA 2NG1A 1I5RA 3RHSA 3A7EA 2MR6A 4CF5A 1CKEA 4NZ9A 1X15A 3UY4A 4BEJA 4QXMA 4BO2A 2FR0A 4II2A 1FQKA 1PW7A 2OV2A 4K9DA 1CQIB 3WRYC 2PJZA 2QIPA 3BGWA 1XZAA 5HRCA 3GRRA 5C8ZA 1TPZA 1M1NB 3BFVA 3JSAA 4BJHB 1LPBB 4INPA 1RWWA 2NYAA 3BUSA 4M89A 2VG8A 1AJEA 2PE5A 1YZNA 2XYQA 2C00A 2BGMA 4L2IB 3ZVMA 5IX8A 2A1TR 3RIMA 2QZSA 1IN6A 3PDJA 5CCEA 3K71B 3THRA 2DFDA 1IBCA 1NWCA 5CVVA 3I5MA 4UKDA 2WJJA 5CNIA 3RF6A 1LX6A 1QONA 5IASA 3IRVA 3IDFA 3UXYA 4JMLA 4PGAA 3AF3A 1FTSA 2PLNA 4IV5A 1U6IA 2QD5A 4F7WA 1VP9A 2I55A 4R9RA 3NHUA 2NQTA 4LFAB 1PRYA 2CEKA 3OSZA 3GX1A 4WHMA 2A9VA 5JVDF 2JI4A 2C7GA 3GEPA 1PJLA 5I9MA 1F4LA 5FP0A 4MARA 1YS1X 2PZGA 3T3IA 3PQCA 3ZHCA 4GLOA 5C5IA 4H18A 3BHIA 2ZATA 3WNZA 1ISJA 1KEKA 2XCRB 4OH7A 1JHXA 1FEZA 1T0IA 3N1UA 1N8NA 2ZSUA 4IR7A 3IOYA 3I72A 4KV7A 1W4CA 1IK4A 1QV7A 5AVWA 3NS7A 2C59A 1DKNA 3MWDB 3OESA 5E7MA 1ZESA 1I7NA 1NW5A 4OHKA 3WO0A 3HCOA 2VTBB 1QRTA 1QZZA 3GCXA 3SS9X 1HYGA 4K8OA 4GIBA 4R40A 3WAKA 1PEKE 1YBVA 4KDCA 5JPCA 1AKTA 1X1AA 1Q92A 5BWNA 1L4LA 2VAMA 4RVNA 3U80A 2SKDA 3N7AA 5KPDA 1H93A 2Q6TA 3SDZA 3Q10A 3SZRA 5ALRA 3ZQUA 1RCFA 4GW3A 4DVGA 5DHFA 2ZSIA 4PR3A 3PFFA 2JLCA 3FPLA 4C4XA 1EHCA 1IY2A 3PS9A 2WZBA 3WNQA 1E2MA 1TT5B 1PGQA 2AD1A 1K5GA 2PCJA 2ZUCA 3RVBA 4KR3A 2OGSA 3BJRA 1T6ZA 4MYRA 1I1HA 2PJDA 2AWNA 2PMCA 2DFPA 1XZKA 1UC4B 3K2BA 3OVMA 1CYDA 4Q4LA 1WDLA 5AH0A 3VDNB 3WB0A 4E2XA 3HJFA 2PL9A 4I1RA 4UE3S 1HE5A 1VSTA 1K68A 1WCXA 1JTFA 5KNBA 1GO2A 1KFKB 2W42A 2Y1LA 1J9GA 1ZXXA 4N12A 3EMVA 4MV1A 2EL7A 4PVDA 3RR2A 3VSEA 5EQJB 2EC5A 2YYAA 1U0EA 3R0VA 4KMMA 4I6JA 2GCNA 3ZLBA 3U4HA 2Y9MB 4BQFA 5JCJD 4G2NA 4A6PA 1T24A 3R74A 4DCTA 2J0UA 1YZTA 5KI6A 1YTLA 3IUEA 1BDMA 1L5VA 2BE7A 1ORRA 2EDCA 2H4WA 2HQSA 4JP1A 4RMIA 1GLVA 1VJ1A 3V3KA 4DCSA 3K70D 1RDFA 2Y0BA 4DJ5X 2PGNA 4WZBE 4I9UA 4PYJA 3DTNA 3EPJA 4I1VA 4WEQA 2HZ7A 4Z7QB 5T3UA 3IR5A 1LPAB 2V1UA 3UW1A 2GBLA 1YQWA 4NS4A 2IUYA 2CLMB 2VJMB 4KITB 1DC4A 1N1GA 2ZULA 2OV4A 3SFVA 4ZKDA 1J2YA 1RFGE 4C22A 2HRBA 3DT6A 5DISB 2N9UA 4YCBA 5KOJA 4G1EB 2YVUA 3ZZUA 4QBTA 4ETMA 3OZ7A 1NC3A 1B0PA 1V25A 2AFHA 2VIIA 3AFMA 1VLJA 1EVJA 3ZQJA 1F2TB 4NOKA 3TBKA 3ICEA 4YLGA 4BFTA 2ZJ8A 2ESRA 5F4BA 4WCFC 2OSBA 1JG3A 1OE0A 2P3LA 1QQ5A 5IKOA 5CAEB 3W8FA 5F9FA 3L1JA 4UEOA 4CG1A 4ZGBA 1QF9A 1SXIA 1N8TA 4TMVA 1RLTA 1V11A 4LQLA 3L6RA 1LTHR 2PKYX 4IFTA 1XTJA 4LHZA 5TF0A 5WRFA 2B61A 4PZZA 4N5HX 2O8CB 3ISJA 4EW1A 5JXHA 5FUMA 1QUEA 4S1NA 1F5SA 5ER6A 3B1ZA 4UQOA 1CZUA 4LRQA 4LF6B 3W90A 3CJTA 3U31A 2SCUB 2YHBA 3HEMA 2R44A 4BJ5A 4DARA 4XRGA 5KZMB 4ZCPA 1MKYA 4DMRA 2IWHA 2W6PA 3EVTA 4UVEA 1R6UA 4ZO4A 4B5KA 1MMFB 3OCWA 1VIVA 2IW3A 1EAYA 4FR2A 4WN9A 5GJWC 4U0JA 4OXQA 4PLZA 4XUGB 1C3EA 3VMMA 2HHJA 2WVJA 4MPRA 2WWXA 3T8YA 4ECEA 5DM0A 3GD5A 2BFPA 3U0VA 1E8NA 4ALMA 2VHTA 1J9ZA 3HMQA 1HM5A 2E1PA 1UJNA 2OKCA 4GKAA 1MJ5A 2D5IA 2FUKA 3V7YA 1ZGHA 2EJBA 3T7EA 3WA6A 4WKGA 4BX2A 5AM1A 1XCBA 2JIOA 2ZVDA 4KXNA 2PX5A 3TLXA 3NCTA 4MWBA 3TSWA 2H4JA 1OROA 1UOPA 4MGKR 1Y1QA 5KINB 2C2XA 2QVLA 1K6JA 1EK0A 3HB1A 2A6PA 4Q16A 4O4IA 1GR1A 4WA7A 3TDNA 2F43B 1U90A 1Y4UA 2A14A 2A1UA 2JVKA 4V0NA 5ESDA 1DQSA 4J1SA 1GZ4A 1AK2A 5AJYA 3WSVA 5C34B 2JI7A 1B3RA 3VX3A 1Z35A 3O3NB 4EHNA 3H9CA 5C7YA 4Z9XA 1FUKA 3TTUA 3GYBA 3TKLA 3FDZB 3B82A 1RCTE 1HZZA 1VJTA 1Z0FA 3MJDA 2LIPA 3AVQA 2GB4A 3D6AA 5EUBA 5CG2A 2HI0A 3C4VA 4Z4FA 4XLZA 1DTSA 2TECE 2VHQA 1Q0QA 4BJ6A 4PTZA 1RQGA 3HVKA 2XQIA 3HS3A 3PC4A 4J3JA 3HC7A 2GN2A 2OCIA 4LOLA 2VQFB 3O4IA 2QUJA 3QV1A 3ENVA 3TXYA 3TDMA 2O4CA 3HEBA 4QT4A 4HDAA 4UBLA 1VE5A 4C6RA 2BFEB 4IMPA 1PFYA 4LF7B 1XO1A 2WV7A 2XRYA 3QE3A 1WOMA 2OYCA 4AQDA 4AURA 3GDFA 1C9NA 1XMSA 4H9GA 4L73A 4RPLA 3ASVA 4LEIA 5BNIA 4G0QA 3VPDA 2RHCA 4AF7A 1L5FA 3DFMA 1E0SA 4LHSA 3T15A 5KTOA 4MUXA 4R8VA 2QRGA 2CFTA 3MRXA 1N2JA 3PDHA 2XDQB 4M88A 1KPGA 2PVCA 3SOPA 2XXJA 5BN4B 4A6DA 1XXHB 3R0IA 4HRAA 1E5LA 3V7UA 4WXHA 4OI2A 1PX2A 2G08A 1PDWA 1GCOA 1CXZA 3D1JA 3O21A 4H16A 5BXQC 1ZRMA 4LJ9A 1WU8A 2LWIA 3ETEA 1ZKMA 1KY2A 3Q3HA 2DCUA 1KEWA 4LYDA 4YRTA 3V1YA 4CM5A 3TGLA 3H5WA 4NU5A 5L40A 3UGJA 3LT2A 3TAUA 4C5CA 2IV2X 2PH3A 1AHHA 2GCGA 2F9LA 3QW2A 4KXVA 5A7FA 5LYJF 2PSEA 3AEYA 3QPUA 4DCPA 2EP8A 4BVFA 5M2QA 1O0BA 2OBYA 2XF8A 2HQRA 4JQCA 1XRQA 4MAAA 3VJMA 4DLVA 2HL6A 1GNQA 1K2VN 2FSSA 2WWRA 3OTGA 1OZHA 3PNQA 1P7YA 3I4CA 4B75A 1QWOA 3QJYA 2WSLA 1VJCA 4LRUA 2QR5A 1XVIA 5CX1A 2HLDA 3U7HB 3U6KA 3GCDA 4O25A 2NOAA 2WWTA 1Y5RA 2HT1A 1BNCA 3KQNA 1HGXA 4Y9TA 4BV3A 1A9OA 4TWAA 4IGIA 3AF1A 2I80A 4UHJA 5L3QB 1FOEB 4RCZA 4F12A 3BE5A 5FB3A 1MVOA 3CWZA 4UJ3A 2HLPA 3LYAA 3I9LA 3JQFA 2HJ9A 4GD3Q 1DC5A 4LXXA 4NV1A 4RIEA 5IPFA 3OM0A 4Y2XA 1TD1A 2V45A 2IS2A 2HWYA 4CKCB 1XLVA 4UVGA 5K8VA 2ZUVA 4WESB 3PJGA 1WXIA 2PPLA 3QV2A 2FRVA 1ZIXA 3W5JA 4B4KA 3EA5A 3HABA 1QTRA 1TKRA 3LUGA 3S2UA 2YUTA 1ODSA 3M6WA 3PGKA 3B53X 1GFZA 1G7SA 4CE6A 5BSEA 4HSGA 2XVZA 3BAFA 3BKWA 3PD1A 1FMLA 3JTMA 3UHOA 3OETA 3R9WA 4HB3A 4Y1RB 2VH5R 4BWYA 5CDSA 2VDJA 3IP3A 4YNBA 2X8JA 4N7JA 3P7MA 1NDUA 2P4SA 3L8MA 1U0SY 3PQDA 4F85A 4UU8A 5KKNB 1M7HA 1G64A 4E6PA 1G16A 3CE9A 1R16A 5JD4A 1CZKA 3BVPA 1WE2A 2OM6A 2WJYA 3EW7A 4AVYA 2CN1A 4BB6A 2GI4A 4X91A 1UFRA 1JLKA 4B7AA 5AHWA 2VYQA 2VDQB 1YHNA 4GP6A 4C4YA 3MT9A 3PLRA 1P0CA 4N3GA 3UQYS 1AKMA 2EATA 3AQIA 4MW7A 5EJFA 1CHDA 3OEYA 4JNCA 1NVFA 2DUUA 5E6RB 2VVTA 1N6OA 3ZWNA 3DE5X 3E5HA 5E1MA 5EIHA 1YHYA 1IHOA 1OI3A 2X5XA 1RXCA 2GKOA 5LQDA 3M81A 1NF8A 3ICOA 3IJRA 4OQNA 1TVMA 4DV6B 4Q21A 4EKIA 2ZE6A 4CMKA 2HMUA 1THZA 5I3ZA 2G28A 5CLQA 2O0MA 4PZDA 3TXXA 1ENOA 4I1PA 2XNSA 3SZGA 3I05A 2XVAA 4OJKA 2DU8A 2GHIA 1VHLA 3SE7A 5BV8A 2A1IA 2PH7A 2NTJA 4M76B 3EHEA 3DH0A 2VRNA 1UT5A 4NJMB 4IJUA 4RPGA 2KLBA 4BU1A 5BUQA 5C8YB 3Q9UA 3QLUC 4ESEA 4W5WA 1HC7A 1NJSA 4RHCA 4R05A 4YI5A 2CXRA 2GBIA 4YV2A 3U3DA 2C5HA 2G9UA 1MO6A 2VZ0A 4OUDB 3RTEA 4RL6A 3UMJA 2GZ3A 2ADMA 3NG1A 2PBFA 4H08A 4JUCA 3T4XA 3DE3X 4G5XA 3FYSA 2C2WA 4DBZA 1Y6RA 1UXOA 3GARA 4D9IA 2QP9X 4D3FA 2G17A 2HGZA 2WKSA 2W83A 1VKRA 9ABPA 2UYQA 1TF7A 5EAIA 2H9AA 2H92A 2PS0A 3THXB 5JATA 2XVYA 3PXXA 4O4JB 4QFBA 2IZ6A 2I1LA 1N32B 2BI7A 2HU8A 4G26A 5GOZA 3K1AB 4J0DA 2ACKA 4B3CA 1OWMA 1B7GO 2NX2A 3TMAA 3H5RA 2H54A 1UJ2A 2BOVA 3WWOA 2PL1A 1SXJE 3GFVA 3O95A 1KZGB 4RVOA 3B85A 1JR3D 2R60A 1XV5A 4OAOA 4PO8A 4E12A 3RIEA 1R00A 3EA4A 1NV8A 2O3JA 2TYSB 3CE6A 4MIEA 3GNLA 4ILKA 2Q5EA 1CVRA 2J7KA 2XF2A 1G4UR 2HA0A 2JK0A 2BM1A 4HRYA 4O1HA 4DVJA 3OX2A 2OK7A 3T7CA 3LY9A 4QHTA 1MB2A 4IDOA 1N6KA 1A76A 1UXIA 2W2KB 4QDTA 5FF9A 1JHZA 1FA9A 1ZI9A 3GZ4A 3WKDA 4UDXX 3WXBA 3RKSA 3ZGZA 1H69A 4MINA 3TBFA 3F5QA 4RA6A 1BHO1 1R6VA 4KXWA 3FGNA 1DC8A 1MGOA 2OGZA 4GOMD 5KNDD 2IVZA 2DZDA 4XPIB 3ZC3A 2IUEA 3ENNA 4FZ3A 4GYJA 2RK6A 4UU1A 1E9SA 2CLKB 3HUFA 4LA4A 3NIWA 3LECA 4CV1A 4OIMA 3EDQA 3OP4A 4TLMB 5GIOE 2I2XB 4C0BA 3CNEA 5FLYA 2FZ4A 3WL8A 3C6YA 4KN9S 3CG0A 2QQ5A 3MWKA 4FS8A 4GECA 1FCJA 2PGXA 1W4BA 3CTMA 3I01M 1JQEA 4LZPA 4P4GA 4RFLA 3WRXA 3QU7A 5ABPA 3LPCA 5BNWA 1VSVA 2Q3LA 2XYHA 1KDVA 1VCNA 1VMKA 2AH5A 1QDLB 4GEGA 2RHBA 4HMOA 3B6KA 1J0XO 1DG3A 1QMGA 3A14A 3RUEA 4A0GA 1XNRB 4UXHA 2OE2A 3W6ZA 1O6BA 3IMKA 2FX3A 3FKSD 3UJ7A 5KQPA 2O07A 2DBRA 5F64A 5BR7A 1BTOA 2V9ZA 4O6VA 4M9RA 3CNOA 4BKOA 2V6GA 1JFVA 1TRKA 3T4UA 5JAZA 4NF2A 1YE8A 4RHYA 4EWLA 3EXIA 4CXMA 1RLMA 4G01B 5B12A 3GFBA 3KSUA 1XAJA 3ETGA 1YBHA 1T29A 3S1AA 1KAHA 2NSJA 1AIPA 1I5EA 1K08A 3OMLA 4BUCA 2CXXA 3RU9A 4CN8A 4NCAA 1WSDA 3HDHA 1P0PA 1ST2A 1ZD5A 3ETLA 4QYIA 4Y9SA 3AWDA 5DK6A 3GRUA 2YR0A 3ZWOA 1AZTA 4AMGA 5LZ5A 1POWA 1QLHA 2BEVA 2JGNA 3EVNA 4N5LA 5CFNA 1D2CA 3DVSX 3G2OA 1AKUA 4QOJA 5I7WA 1Y7IA 1TCBA 2EZUA 1VIDA 2GEFA 4FLMA 4AFNA 1LS1A 1TQDA 1LEHA 1QBGA 3EGWA 4N40A 4QPJC 5CT4A 1E63A 3DYVA 1W34A 2P9JA 4IZ6A 4MV5A 4E0BA 4L8YA 2IKQA 3SNKA 4EFMA 2RI1A 2MDTA 4X20B 3C3CA 4A7PA 3VHRA 3VR5H 1UZLA 3H83A 3RVMA 3ZUGA 2BH2A 1EQUA 1P3Y1 4AYTA 4X1KB 2BR5A 3GFTA 4JDUA 3RS8A 3UT5A 2P6OA 1MLDA 5DTIA 3QTLA 3PDCA 4YAJA 5JJIA 2YN4A 3AJ8A 3KQYA 4K03A 4PLFA 7ADHA 2VOJA 3ICCA 2HJSA 3L79A 4FHZA 1EVYA 4J49A 3O8RA 1EDZA 1Y9JA 1OFIA 3OE5A 2BFFB 5AI0A 4RWEA 721PA 3MOSA 4LOIA 3WMXA 5JS8A 5LLSA 4DRXB 4PHCA 1I2DA 4I19A 4CV0A 1ID1A 3LY7A 2BFCA 2CFIA 4V1CA 1YDGA 1YF3A 2GKGA 3D4BA 4A0QA 4EUFA 4PG6A 4HHEA 4M1ZA 5EUQB 1IPHA 4UAJA 1Y8RA 1QCZA 1ZX1A 4G8JA 4DG8A 4MA5A 1YUBA 3LY5A 2IH2A 2WJAA 2QRNA 3VPSA 1NJ6A 3IJEB 4CPDA 4PAQA 4W63A 5KJCA 1PR4A 2IS4A 2FPGB 3ECSA 3ES9A 4HXGA 3S5JA 4E21A 1NBOA 4L15A 4Y9UA 3JWJA 3A3OA 4AJLA 2YW2A 3KAJA 1C1HA 4PVCA 2PUEA 1JGTA 1T1JA 1WXHA 2RARA 4QA9A 4R9UC 2XVMA 4BP8A 3AO0B 5SV2A 1NUQA 2I2BA 4MB0A 3RC1A 2VBFA 4JGGA 1E64A 1A8UA 1PK9A 3RSGA 3KQWA 1NLMA 1Q19A 3ANMA 1NMEA 3LC0A 4BPRA 4ZCTA 1ES9A 2DHRA 2OGTA 3AUYA 3B20A 2EKLA 4D0GA 3HKEA 1K7XB 1BU8A 3VYRB 5LNK6 3LRTA 3PL1A 4MLPA 5B7NA 2LKCA 4HN9A 5JASA 5AKYA 4XWWA 3REOA 5AI4A 3AGQA 1P9WA 2CJFA 4CYMA 1A3CA 2IUUA 3LLUA 1C7EA 4YT5A 1V1MB 1GPLA 3Q9NA 3RC2A 1BX0A 3HK2A 1J22A 2YH2A 1JPJA 5C52B 2JHAA 4C6TA 5JT1A 3UJ3X 1IQPA 2V0GA 1H23A 2IXGA 5J40A 3UHPA 4AJOA 3PXDA 5KOHB 13PKA 3VKGA 4R2MA 1GXSA 1V1RB 4KJXA 1M2WA 2ZBGA 3BTVA 1A9XA 1H8HD 1GU0A 2CXPA 1SOAA 3TKAA 1Q0RA 4II3A 1JALA 1GITA 4K28A 5IBQA 5TGDA 3I8XA 3QVGA 2XLCA 3DYBA 4M8SA 5E3IA 3RBXA 3GPCA 3LVBA 5JEDA 1JEQB 2YXBA 4FW9A 1TGVA 3KKZA 3W04A 5JZMA 2GEUA 2JD0A 5FI5A 4C14A 3Q87B 3UXEA 3GLHB 2PLRA 2J6BA 3HU1A 1WQ1R 5EWMB 4DIKA 3O4RA 5EP1A 3WGOA 2GH1A 4UBJA 1GA4A 1TEZA 3DMRA 2HLHA 1Z6TA 1G1AA 5TQ0B 3V34A 4FHFA 4QQFA 5CCBA 3DHVA 4OD0A 1BXGB 3UMGA 4D8VA 1CUAA 3BSYA 3G8CA 4ZVRA 1YFLA 1JSLA 4DGQA 2PHZA 1AF4A 1NTRA 3ROKA 2QAJA 3H2IA 2VHWA 3ZDRA 1O96A 2DSNA 2PU5A 2V7TA 4BVAA 4RQAA 2XXBA 2Z5GA 2EGGA 1GTRA 1KWKA 4G0OA 1B6RA 4KE8A 4D0LB 1QLJA 4L3WA 3RS7A 3AOEC 6REQA 2ABWA 1JR3A 3FOAA 5LXTA 1JNXX 5I7UA 1L1QA 4ALIA 4OFBA 2G9VA 5K8IA 3B60A 1P3JA 1SA0B 5L6MB 4TWBA 2ZANA 1NJ2A 1PK8A 1JW9B 3E70C 2OM2A 1E92A 3KAQA 2PL5A 4KQFA 4RJJA 5DMXA 3V3TA 1SCAA 2WJ4A 1IEXA 2W00A 4K46A 3OZAA 4P31A 4FE4A 3TW8B 5I9BA 3AHFA 1IJFA 2O2JA 2C7VA 3FNFA 4GM1A 1XA0A 4I1YA 3U7QB 4CLDA 1O6CA 3M4YA 1KQFA 3UWKA 4UNRA 5BPHA 2Y2VA 1RLUA 1YUMA 1GA6A 3WQSB 2F64A 3COZA 4TUYA 5KNDA 4Q3CA 5CYPA 5BVGB 3UWSA 3Q6MA 5K6RA 1NM5C 5LP6B 3HLKA 5AKJA 4MCIA 3L7IA 3LO5A 5JC8A 2PBRA 3P9ZA 4ZA2A 4CG3A 4FKMA 5JZ9A 1AB6A 4CL8A 1L8QA 2OR3A 3MLAA 2I0FA 4NP6A 5DJ5A 5C8YF 2H51A 4ZQFA 4KNWA 2IV3A 1B93A 1DXOA 1PS8A 3DZDA 3AM4A 1KYZA 3UF0A 1TFRA 2P40A 1AA6A 3VAAA 3D3WB 4MV0A 1A97A 1P17A 2RH8A 2ZAIA 3CX8A 3FMGA 3FKSA 5HYVA 4PHGA 3DDNA 4AKTA 5A1JA 1S3GA 2IZOA 1PT5A 2WTXA 3I2HA 3L0IB 1DCMA 1GDHA 2Y77A 2YJZA 2A9RA 3BA6A 1YRQA 1KI8A 1TJ3A 2I76A 2MYNA 2R6ZA 4JJGA 2ZKIA 4O4JF 4L4ZA 3IT0A 4OXKA 2AYXA 1R0YA 3RG2A 4DMCA 2P9GA 2OY0A 5CA1B 1JBKA 1ZAYA 4P92A 1PFUA 4TWZA 4W9NA 4X84A 1V8OA 3I9JA 2FWBA 2MSLA 1QX3A 4ZMRA 1M75A 2YQ4A 3VO8A 2XUPA 3C8MA 3ZXYA 1FJXA 1E1DA 4UNPA 2QRQA 1QYRA 1VI2A 2I67A 4POAA 3ROZA 5CFOA 5JALA 4G4SP 1KY3A 2O54A 1TEVA 1XCOA 3EMDA 4QVGA 4FYXA 2GM3A 2V4MA 1Z28A 3ZU2A 1EWKA 4QTTB 1J24A 4I5DA 1G9SA 2I7XA 1R0KA 1C7ZA 2AOTA 2ZWMA 5AK5A 3UK2A 5CIYA 2OFOA 3JQ7B 2OEPA 4MGHA 1I9CA 4C88A 2IW1A 3CVWA 1BQ3A 1M2FA 2X4IA 1J33A 4KYIB 1M1YB 3IKMB 5I7OA 1TMOA 4JR0A 4TZ6A 1QO9A 2G67A 4DG5A 4IQ8A 1INLA 2O2SA 5CURA 4GMKA 3VKVA 2R7LA 4UMDA 4E88A 3EPLA 1XELA 2C4WA 1W85A 3H8VA 1DXQA 2BGWA 4I1OA 3NDBB 1I14A 2FSIA 2GJKA 2DBYA 1PNQA 2DM6A 4D98A 4ESVA 1FBNA 2AC2A 4H1HA 4BHTA 4DWJA 2DQKA 4TS1A 3ZWQA 1PJTA 3BMOA 3C3XA 4EBBA 5C7IO 2XMDA 4WLNA 2D2FA 1RZRD 4P6VF 1V9SA 2WQZA 5JE8A 4DJDC 1NUSA 1PWXA 5EGSA 4ZT4A 1N2CA 1VSBA 5H3HA 1U2RA 4MYHA 8ABPA 1FP4B 1I2MA 1EE1A 4ITRC 4ZT3A 1T2VA 5FOSA 3QUAA 4Z3DA 2IX3A 8AT1A 2BI4A 3GUVA 3IDSA 2GPSA 4BL5A 1QB8A 1E3TA 5ADHA 3EGVA 2IYFA 4PYLA 1K5DA 3EY4A 3H0EA 4PYKA 5DNEA 3PC8C 2BUAA 4C07A 5JSUA 2WWWA 3LFTA 3WLSA 3DLBA 1U81A 1SH7A 1X14A 3A9SA 1NTOA 1HLFA 1O9GA 5JZOA 4XFDA 1Y4SA 2C99A 1YR2A 3D2BA 3HB9A 3GAFA 3OT4A 4Z4EA 1IOLA 3KKNA 4PXYA 1EUCA 3U3XA 1AGXA 4TKVA 2VH1A 3JVUA 4L8WB 3TOZA 1VECA 1DUIA 3U3OA 3N6RA 3WYCA 1JIXA 1OXXK 3R7WB 2C4VA 3TLYA 3ZV3A 2OHGA 1GVHA 2Z2JA 3AP1A 4Y7DA 4DIUA 1V5EA 1I4EB 1OH5A 2PXHA 4D4LA 2BL4A 1JR4A 4DHWA 2EXXA 4DV2B 3RYHB 2WYIA 5EEGA 2GYYA 1QZXA 2VP5A 5FYQA 2G9NA 5T5QA 2W5UA 3BAZA 2J9ZB 3G9ZA 5ITWA 1WB5A 3BEOA 1BH6A 3FMIA 1XZNA 2VH2A 2FHPA 4JJ6A 2HMAA 4PHFA 1XTBA 2JH8A 2VEOA 2CLSA 4JOBA 4DCUA 3CVVA 2WYHA 1E1MA 1IPFA 1X39A 1X70A 1X42A 3EF3A 1JPVA 1LVHA 1TF5A 3FLMA 3GT7A 1FTNA 4L95C 5REQB 1GTMA 4TVKA 4UQLA 1MJFA 1U0LA 2Q41A 4PYQA 1H0HA 1H8HA 2F8LA 4RO0A 5F76A 5CDTA 1O6GA 3L0BA 4MPJA 3FCAA 1J0CA 1GQFA 1I7PA 1PFGA 3FWNA 5ALIA 1XLTA 1BW9B 2CBZA 4C01A 1CP3A 4P86A 1C4XA 2X9QA 4YJGB 4GOOD 4RV9A 4HR7A 2I7TA 1SCDA 1J99A 3L4JA 4BN0A 3IDQA 4PPGA 3GN2A 2PSDA 5DTQA 4LVUA 2RGRA 4OQEA 1KKUA 2WBLC 3EMKA 5GQSA 1KP3A 1JKJA 2XBUA 1QH8A 3KSBC 1PJBA 1Y9EA 1R8QA 1JXMA 2HD4A 1FK8A 2X9VA 1QH9A 1ULTA 1W88A 1WXQA 1FDVA 2QYHA 2IPOA 4DR5B 1AUVA 4G65A 4LYYA 4WK2B 4XX1A 3T7RA 4AULA 4EZIA 3GFSA 1JJIA 3FMPB 3PHGA 4YRBA 3B48A 1MB4A 2C2HA 3EEQA 4Q02A 4J16A 1SHUX 4RGBA 3VH2A 5CB6A 5ECYA 1AHIA 3AB3A 4D9BA 2UYGA 3M6UA 1GNPA 3ASUA 4PONA 3VO2A 3VU0A 3U7GA 4RPJA 4QRDA 2X2OA 3TQHA 4FDLA 2R5WA 2CJWB 2YWDA 3G0CA 4IXDA 5ADVA 1I13A 1W35A 2WM8A 1R4MA 2GYVA 2Z5LA 1DO8A 1WQ3A 3JQ6A 1HWYA 3IALA 3CF4G 3G2IA 3UK7A 4DQ0A 5LU8A 2W2OA 4ER7A 2Q2QA 2L42A 1PD1A 4NU6A 1TU3A 2ZGVA 5ALLA 4MJ3A 1QC5B 4YEDA 5KYWA 1UKCA 2WSSD 1N2ZA 3QEKA 3H9BA 4QEKA 4Q12A 1RM0A 2JZOA 4B2PA 3K72B 3Q88A 5GAJA 3KTAB 3DB1A 3GLFE 1M2OB 2VT3A 1SVWA 5CVDA 1U4NA 3ZGXA 3DE6X 2I6XA 1J0AA 2JPDA 3WWPA 5HE9A 3TQQA 3WNVA 3HXPA 1QS0B 2CD7A 3H0KA 4WBXC 1EH5A 4BC0A 5JH7A 4QBGB 3NV7A 3PBKA 1WP4A 3ETDA 3BD9A 3FF4A 1SKMA 1JFRA 4UBKA 1WHTA 2D1QA 2UZ1B 1RS0A 3FNRA 3WDLA 1HDCA 1VCOA 2C31A 1ETHA 3DPUA 4Q3KA 4X8MA 3RBAA 3ZX4A 4BWVA 5HR5A 2J09A 3FPHA 1XMJA 3IMEA 3DDHA 1YS2X 4FFNA 4GDMA 3MTIA 1X92A 1K3FA 1H6CA 3GHYA 3RYCB 1X7XB 1FFSA 2TMDA 4OHFA 2JLXA 4EUNA 2WAYA 5AW4A 3OM8A 1ZAKA 3WSWA 4GOLD 1V7CA 3A4NA 3LXUX 3TLEA 4O1MA 1PJQA 4DIMA 3ODGA 4AMZA 2H4ZA 4KIFA 1JE1A 2DC1A 4GP7A 4IS2A 1O03A 1VBKA 3KWMA 3QOWA 4IYRA 4US1R 2VBCA 1YS6A 2I6SA 4B47A 1E2QA 2JAOA 1IJBA 1H5QA 2H18A 3AU9A 5CT6A 1FW6A 2XCOA 4CDRA 1UKBA 1YDEA 1CQZA 3W1VA 4B2IA 1DKUA 2CF6A 3RAFC 2LKDA 1RKUA 5HUQA 1CNMA 5J2TF 2F7SA 3NIFB 2PXXA 1QU2A 3CX7A 1VC2A 4J4TA 4E09A 2YXDA 4YALA 2H1IA 2H5IA 3DZ8A 2C5AA 1F7VA 3L8YA 4CMGA 4GLLA 1Z2CA 4ZYLA 3SYNA 3B8EA 3PKZA 5AJUA 1US8B 2VF8A 4YMWA 5HIJA 2HRQA 1DT3A 1FLVA 3K35A 5DHAA 3CT6A 2IUFA 5JQGB 4N1AA 4F86A 5LIPA 3MINA 3GJ6A 3PXCX 2AA3A 2ZJ1A 2B35A 2IYLD 3IHWA 4GX0A 4K9SA 4NBRA 5LP6F 3FVWA 1VDMA 1WXXA 3NAQA 4MR8B 3B1FA 3G9TA 2YHIB 3QEAZ 3R0XA 4MX8A 4PSUA 1B26A 1DRKA 2PT6A 2Q1UA 2Z04A 5FNVA 4AJNA 2C4KA 2NU7A 2PMFA 2D8MA 2H07A 1UWVA 1JXQA 2QX7A 2ZZKA 4FTWA 3LPAA 2QROA 4HZUA 3UG7A 4QQNA 1EVQA 1Z17A 5B53A 1RZRA 3WVNA 3ELBA 2YX1A 2HW8A 1MOQA 1ABFA 3NTLA 3UJPA 5EJ6A 4QUIA 4EARA 2JFYA 1PJ8A 3GP3A 1ZN7A 4ZVUA 3DULA 1QG0A 3KV1A 1DE0A 1K97A