1WLYA

Crystal structure of 2-haloacrylate reductase
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
332
structure length
322
Chain Sequence
b'VMAAVIHKKGGPDNFVWEEVKVGSPGPGQVRLRNTAIGVNFLDTYHRAPPIVVGFEAAAVVEEVGPGVTDFTVGERVCTCLPPLGAYSQERLYPAEKLIKVPKDLDLDDVHLAGLMLKGMTAQYLLHQTHKVKPGDYVLIHAAAGGMGHIMVPWARHLGATVIGTVSTEEKAETARKLGCHHTINYSTQDFAEVVREITGGKGVDVVYDSIGKDTLQKSLDCLRPRGMCAAYGHASGVADPIRVVEDLGVRGSLFITRPALWHYMSNRSEIDEGSKCLFDAVKAGVLHSSVAKTFPLREAAAAHKYMGGRQTIGSIVLLPQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-haloacrylate reductase
publication title Crystal Structure of 2-Haloacrylate Reductase
rcsb
source organism Burkholderia sp. ws
molecule tags Oxidoreductase
total genus 111
structure length 322
sequence length 332
ec nomenclature ec 1.3.1.103: 2-haloacrylate reductase.
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1wlyA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1wlyA01
3KOUA 1IPFA 1JKIA 2IYOA 4YT2A 4BO7A 1WXDA 2VT2A 3JD1A 5JDIC 2CUKA 3ZI0A 4DQXA 4FPXA 2O3SA 4EEXA 4I1IA 4ALIA 5IF3A 3ROPA 4CR8A 2YHIA 1OOEA 2X0RA 2OBYA 1U4OA 4P8RA 3DOCA 3JCZA 1GTMA 1EE2A 2Y1DA 2XF8A 4BO3A 1S6YA 3PJFA 1TLTA 1ZW1A 1XGKA 1ONPA 2HJRA 2VYND 3G3EA 5ER6A 1IZ0A 1ZKMA 2VRCA 3PFFA 1X15A 4BB5A 1LNQA 2XXBA 3GH3A 1M6HA 4RPJA 3TZQA 2G76A 4JN6B 6LDHA 1QP8A 4IQGA 6ADHA 4FR5A 2UDPA 3AI3A 2PZJA 3RUIA 4BNNA 1KERA 1E7MA 4W7IA 3H2SA 2OBNA 3E1KA 4MVJA 2I5PO 3PWZA 3RIHA 3FSRA 5JCJA 4N7RA 3M6IA 1G6KA 2C82A 3GFGA 4IDAA 4QUKA 1VI2A 2B5VA 2PKQP 3LK7A 3D4OA 2HUNA 1KC3A 2VUSA 3HN7A 3WJ7A 1T2AA 3ZHBA 1ONOA 4PLZA 4U7WA 4DBVO 3BTSA 4Y6RA 4WLUA 5JO0A 5B37A 1H6BA 3PYLA 4HFJA 2UAGA 2C29D 2DLDA 4RF3A 5EPOA 2X6TA 1F14A 1Z45A 4XQ9A 4RL6A 1ZO8A 3C1AA 4XZ3A 3MEQA 1LDBA 1LI4A 1PR3A 3RBXA 4ROSA 4R01A 4BUCA 4WLEA 3W8FA 1P31A 2AA3A 3IP3A 4HFNA 1K6IA 4WASA 4RVSA 1O8CA 3GZNB 3INGA 2VUTA 2X8LA 1P44A 2X9VA 4JX8A 4BNTA 4K1LA 1WMAA 1FDUA 2DBZA 2RH8A 3AM4A 4IQ0A 1T1RA 1D1SA 1QYCA 1P1JA 2V6FA 2Q2WA 1HYEA 3CKYA 3PYXA 1UH5A 4Q3NA 5TJHA 3JQ9C 1MP0A 2VRBA 1DB3A 4I08A 3LU1A 5A02A 1PJ4A 3ROKA 1EUZA 3ICCA 4J4TA 3ORFA 1VKNA 1ENOA 1E7QA 1DAOA 4P4LA 4E32A 1YQXA 2JD2A 5B4VA 1F8FA 4ILKA 3SJ7A 4N5MA 3CH6A 3FPCA 4O0LA 5FYDA 3H5RA 5JY1A 2QYTA 3W4KA 5KWEA 4RLHA 3GVPA 1ISGA 1DHTA 1X7HA 2J3JA 1U3VA 2JCXA 4LRSB 2ZYDA 4TKLA 3PRJA 3UVEA 4DGSA 2W90A 5BQFA 3D0OA 1H2BA 1E5QA 1HYHA 2EGGA 1QV6A 2ZJ1A 4YDRA 3WICA 1UDBA 1NPDA 1EUDA 2FP4A 3GVIA 4IJUA 4M1QA 2GF2A 2P91A 2PH5A 3CIFA 4M86A 4MPDA 2CF6A 4NBRA 4OHUA 4AFNA 2JHFA 2GSDA 4NFHA 1HLDA 1E1LA 4FS3A 2R2GA 3GMDA 4DPMA 4YR9A 1ADFA 2Q4BA 1DIGA 4R3WA 1KVTA 4RVUA 1XHLA 4BNVA 2O4CA 1IHYA 3D3EA 1T2FA 3Q9NA 4DWVA 2LDBA 4JROA 5A06A 2C5EA 1ZJZA 2W2LD 3NV9A 4WEOA 3L0DA 2PLAA 1P1KA 4CQLB 2RHRA 3W4IA 1NVGA 1WWKA 4Z0PA 3TRIA 3I52A 4D43A 4IDCA 1AXEA 4JJGA 4PLPA 9LDBA 3GAZA 3OF2A 4B4WA 5CDGA 4XQEA 4XX0A 1F12A 2J5RA 1R4NB 4OKNA 4CLRA 1DIHA 1GEGA 2HMTA 3HADA 3GDOA 1LUAA 1UXJA 4FJ1A 1TI7A 3EK2A 1NFRA 4F46A 5EQDA 3IJPA 2R00C 3GUYA 4M87A 1GEEA 3GHHA 2WEKA 2IDZA 1ZVMA 1W4ZA 2P4HX 1WVGA 3AW9A 3WSVA 3WOHA 4B7XA 1H6DA 3DL2A 3Q1LA 2E48A 2NVWA 5I9MA 4XQGA 4BL5A 3GNTA 2EXXA 3DO5A 4NBTA 3B70A 3RC1A 5T8KC 1Q0LA 1HSOA 1BMDA 4MVJP 5TGDA 3FNFA 5LDHA 2GZ3A 4CMEC 1PS8A 1G1AA 4IXTA 3ZV6A 1YJ8A 4BNMA 2BHLA 1DFGA 3EDMA 1VJ0A 5G0VA 3LF1A 5ILOA 3KTDA 3DBVO 4WGGA 3IUPA 2JD0A 4FB5A 1NR7A 4OAQA 4WLNA 1UXHA 5COAA 3MJTA 4RPGA 3M1AA 3WXBA 3LSYA 4AJHA 1HE5A 1SOVA 3ZV5A 1PZHA 4W6ZA 4PFJA 3UF0A 1NQAO 3DZBA 1OBFO 4CMIA 3R1IA 4R1UA 4UEKA 1QR6A 3LT2A 4YXFA 1LDGA 3O8QA 2Y66A 3Q2KA 3TZHA 4J9UE 4PLYA 3IC5A 1TVEA 5IFLA 4NJMB 3F5SA 1LLDA 3R3SA 3T7EA 1JN0A 2XPCA 3DZJA 1JAYA 3FCOA 3WB9A 2DTXA 9LDTA 4EGFA 1FXSA 2AEMA 2EF1A 1AN9A 1A71A 1PQUA 2Q2QA 3N74A 2QW8A 3EHEA 1WZIA 5JCXA 2PV7A 2FSVA 4IDGA 3O4RA 3HN2A 3RKUA 1NPYA 4CLEA 5JS6A 3JQ6A 3RI3A 4I9NA 4Q3AA 2ZYAA 4ZVVA 5JYEA 1B14A 1EVJA 3K8ZA 3OQBA 3ZCXA 3WR5A 4ALNA 1NWCA 3RC7A 1R4NA 3D5TA 2Z1MA 5IDXA 3WG9A 4CM3A 4EJ0A 1WPQA 3AUAA 3TL2A 3GK3A 4HWKA 1I32A 5THQA 5TJ9A 3EVTA 2A35A 2VYVA 3ITDA 1UUFA 3Q11A 2CDAA 3C85A 3HDQA 4XWYA 2ZYGA 4BNWA 5L4LA 1EBUA 1ENZA 3KEQA 4WEQA 2VT3A 2FR1A 2DAPA 2NNLD 4MO2A 4UEJA 5FI5A 2V7PA 3BMOB 3AK4A 3DAFA 8ADHA 4MIYA 3P2OA 5ITVA 4BGUA 3JQBA 4FD3A 3PDUA 4XGNA 4DXHA 3NDRA 1VJ1A 3VH3A 4L8VA 2FZWA 3H9GA 3F4BA 5L7YA 4I5FA 3WNVA 3MWDB 2WE7A 4ESOA 2X22A 4GX1A 2ZQZA 3OJEA 5AXCA 3W8DA 5A5EA 2HCTA 3X2EA 3HFGA 1M6WA 3RUHA 3ZNNA 3UAGA 4TZKA 3PI7A 4FSHA 3MZ0A 1RPNA 4FOOA 4IIVA 4H15A 3C1TA 2Y1OA 1PIWA 4GSLA 1LA2A 2PY6A 3GPIA 1I3KA 4K6CA 1I10A 1DC6A 3P19A 4JXKA 4OO3A 3FRJA 5DP2A 2NVUB 1LSOA 4CQMB 3X2FA 1VL0A 3BMCB 2ZTUA 1BGVA 4J7XA 5G0UA 3I9JA 1XEAA 3OM9A 1PZFA 4XD2A 1E7SA 3LC7O 4WKGA 1WLYA 4IQ8A 1ML3A 5AOVA 5A5FA 3RSHA 3WGOA 4EZBA 1ZIDA 5JAIA 2CY0A 2CD9A 1ZFNA 2I6TA 5IN5A 5IG2A 4QT0A 3W6UA 2Y99A 2AXQA 4XKJA 1GDHA 3K96A 2CMDA 3JD4A 5L4SA 1DEHA 1LLCA 1IL0A 1YRLA 1LSJA 4DVJA 4BMNA 1PU2A 4GMFA 4HX5A 3ZN2A 3KXDA 4WCFC 2WYUA 2Z1NA 4UREA 4YAJA 4PN3A 1RM0A 4ZA2A 3DBRB 1LBEA 1U28A 3HQ4O 4IM7A 4CR7A 4D45A 3BMNB 1UDCA 1ZK0A 5G2OA 2OUIA 2ILTA 4TZTA 3TDKA 3AY7A 3KSDO 1F06A 1ZSNA 3IP1A 4ZQEA 5CPBA 3E48A 3V5NA 1LJ8A 1UJMA 1DC4A 3WMXA 1IYZA 1ADGA 2JD1A 3MTJA 1RM4A 4CQMD 1XR3A 1WDMA 2NSDA 3OQ6A 5JY6A 3BYZA 3H9JA 2P9GA 3DBLB 1TEHA 2POQX 4ZD6A 1B3RA 5JDCC 3BIOA 3V2UA 4CMCA 4IBOA 5KKCA 1SB8A 4OOFA 3HUDA 4LVUA 4CM6A 1KVRA 3QW2A 2GGSA 3WNQA 3AOEA 3K92A 3PQEA 3UW3A 2C2XA 1R37A 2UUOA 2NU6A 1OC2A 1ZMOA 1D4FA 2A92A 3TOZA 4G2NA 4O63O 1DPGA 3B20A 3DB2A 4KUEA 1FK8A 4J3FA 3E5RA 4PLCA 5A1TA 3OEWA 3E6AA 3U4DA 4DQVA 3KRTA 1ZJYA 4DRYA 3PFWO 1T4BA 2ZIZA 4RVHA 4EUEA 2PFGA 4JBIA 4UUNA 2BGMA 2EERA 2IE0A 4RCVA 3K5PA 4XB2A 1IUKA 3G0OA 1CWUA 2NVUA 3CZMA 4CMKA 3UKOA 1NAHA 3BMCA 4EI2A 1MC5A 2EW2A 4MIEA 1KIFA 3LQFA 3NAQA 1Y5MA 3NT4A 1HZZA 2CFCA 4GL4A 4I5EA 3WGGA 1SEPA 3IJRA 2VHZA 3WTBA 2Y0DA 2PZMA 5C7IO 3UXYA 2PGJA 3S2FA 2BH9A 3GZ4A 3DZHA 3H8VA 4OSPA 3GDGA 3VH4A 4ZQFA 4ZGWA 4D3FA 2VTEA 1V6AA 3NTOA 5LDGA 1N92A 1IHXA 2WWRA 3GC6A 4MP6A 5BSEA 1H6AA 3GNSA 3IDSA 3AY3A 1IOLA 1D1TA 2AQ8A 5EL0A 4YTEA 2NTJA 2X9NA 5I7VA 3COSA 2C7VA 4NIMA 4XR4A 1LSUA 4DLBA 5U1PA 5L4NA 5DCWA 2ZCUA 4YJDA 3DBRA 2DC1A 3P7MA 2H9IA 4GX0A 4BO2A 1E6UA 3FBTA 3Q0EA 4Y8VA 1OAAA 1YDWA 3L4SO 2VWGA 3WTCA 3U09A 2O3JA 3RD5A 1J4AA 3QIVA 1Q1NA 2IZ0A 1Z73A 4EEZA 3RU9A 4FW8A 3NGXA 5CG2A 4IDBA 5L40A 2PD6A 3HSKA 2Y1GA 3PEFA 4O1MA 2EKPA 4LRTB 4ALJA 4CM1A 3PJGA 3KETA 2NACA 4PZCA 1V3UA 2G0TA 1P45A 3AUSA 2I65A 3WQSB 1XQ1A 1Y9EA 3KHUA 2VHWA 4J0EA 3I4CA 1G0OA 3WS7A 3PVZA 4D44A 5BSHA 2HLPA 1QSGA 2YY7A 1ID1A 4JQCA 1F0YA 2B83A 3S1LA 4C7JA 3OFSA 2D3TA 1NQTA 3RQSA 4WE3A 3RROA 1GZ4A 2Q2VA 3HZZA 4UULA 3UHAA 3GRKA 3KYBA 2X9GA 4TRMA 5JO9A 1E0DA 2CDBA 1NBOA 2X0JA 1DFHA 2BLLA 5C3MA 3ADPA 3KV3O 2DPGA 3PP8A 1KVSA 1PL7A 3PXXA 3ANNA 2G82A 4G81A 1PX0A 4II2A 2HMUA 4FFPA 4WPGA 1MC4A 1EE9A 4YRBA 1NWHA 5K1SA 1P1FA 5CHEA 4U0JA 2ET6A 4M8SA 1D3AA 1PWZA 1IULA 3NT2A 3FR8A 2VNSA 1GADO 2J6IA 2BFPA 2IODA 4XGIA 4BMSA 3L6DA 4MVJM 2O3RA 2QRLA 5AXBA 3IUSA 4WLFA 1J6UA 5KVSA 1GL3A 2HMVA 4RQTA 5J23A 3JQAA 3ZNQA 1DIRA 4BO0A 4F45A 1T26A 4FFOA 3TZCA 1C1XB 1FDSA 2R6JA 4M55A 3KYCB 2CVZA 1MG5A 2DT5A 3U3XA 4IXWA 5CDUA 3UN1A 3AU9A 5DCUA 5KTKA 2PA3A 1PJ3A 3F3SA 3LT1A 3QA9A 3PWKA 4IGFA 4CM7A 4Y98A 2I76A 2HU2A 1FF9A 3JQCA 4J1TA 5DBGA 4DPLA 4JJIA 2NQTA 4WOJA 1HSZA 3PIIA 3K73O 1J5PA 2HO5A 3DONA 3TF5A 3KSUA 3H5NA 3D1LA 4NU6A 2P9CA 4L4SA 4EITA 3VH1A 4AJIA 4E5MA 5CFZA 5CG1A 3H4VA 1GCUA 1NX6A 3A06A 1U5AA 2IXBA 4FC6A 3FWNA 1CF2O 2AEJA 1MFPA 2NVBA 1HDRA 3KBOA 2F1KA 3GA0A 3O9ZA 3GVHA 3HHPA 4B3JA 5ILGA 5TIIA 5U9CA 4GI2A 1GUFA 1SNYA 4BNIA 4E30A 4D7AA 2HAEA 4IJWA 4B3IA 1F8GA 4MKRA 3KEOA 1VM6A 5JMWA 5H81A 5K6AA 2WD7A 4CM5A 5LCXA 1PQWA 1OZAA 3RUCA 5COBA 2JJYA 1EQUA 2YZ7A 4RV9A 3G17A 2DFVA 3A1NA 3AFNA 1Q0HA 1C0PA 4DIOA 5CDSA 3JYPA 4ITUA 4AJJA 3AOEC 3EGOA 5EESA 4J9VA 4BKUA 1PSDA 4J16A 5IXSA 5F1PA 1IB6A 4IDEA 2J5KA 3OP4A 4IDDA 4J4BA 4RVGA 4WOKA 1EEHA 4J7CA 1Q7CA 5HWSA 1BVUA 2GNAA 5DN9A 3ONFA 4W99A 1UZNA 2X0IA 1E3SA 1QYXA 1L7EA 4RPLA 4XA8A 2EP5A 2YW9A 3BTOA 3TQHA 1PR9A 5F5LA 3BTUA 4NU5A 3WYBA 5C7LO 4OXYA 4QX6A 3LZ6A 1X7GA 1P0FA 2EHDA 4LISA 1FMCA 1I5RA 3HDHA 3GVXA 3NJ8A 4R68A 2P68A 1Q7BA 3ENNA 3ASVA 3F1LA 3PYMA 2PK3A 1B8UA 2PZLA 5I8WA 3ZWWA 3BHMA 3LLVA 1U5CA 1N9GB 2P4QA 3QWIA 1XCBA 2AQHA 1JVSA 4R4JA 1B8VA 3U62A 3KVOA 4KWHA 1E77A 4UUMA 3DEYX 1H0KA 1JTVA 4MP3A 3JTMA 3JYOA 1RM5A 4INAA 1C1XA 4UVEA 2OORA 1LLQA 3AU8A 3ITKA 3H9EO 5K0ZA 2JAHA 1MFZA 4NPCA 1KEPA 3ZHYA 5KVQA 3UCEA 1HLPA 1P33A 3DAPA 4I9UA 5I7EA 2P9EA 4B8WA 3ABIA 3L4BC 3GEDA 5DCYA 4WK6A 4BO4A 4E21A 3HB5X 1XLTA 4EW6A 5A9SA 3DTYA 5L51A 2YV3A 4HXYA 3PHHA 1BXGB 4GLOA 4XR9A 2VYNA 3CEAA 4IGEA 5TC4A 4BNJA 2NU9A 3C3XA 1A7KA 1AE1A 1DLIA 2GR9A 3K9QO 3PDJA 4AJKA 4D3SA 1QORA 3F6YA 5I7FA 3CE6A 4ID9A 4TSKA 3ZU3A 1LEHA 4CLOB 1K5HA 2FZEA 2VHYA 3FNEA 4LGVA 1FDTA 3FI9A 3NJ4A 4FQ8A 1K6XA 1MB4A 4JGBA 4ONEA 5F3RA 2JFFA 4JNKA 3SJUA 2V6GA 5JSFA 4QECA 1BDBA 1XSEA 4FOSA 2RH4A 3R3JA 4NBVA 1ZEJA 1AUPA 2BI8A 4IIUA 1BDMA 5ENDA 2W4QA 3S55A 1E1MA 1C0IA 3UICA 1Y6JA 5TS3A 1VPDA 1K6JA 2BFMA 3CMCO 4XDZA 2YDXA 1K3TA 4FCCA 3I4FA 1BG6A 1YXMA 1NXQA 8LDHA 3ZHZA 3A4VA 3OJLA 1DBVO 4P4NA 5EERA 1C14A 4WCDA 3SXPA 4XRRA 1RYDA 1BXKA 1WMBA 2BFOA 3JQFA 3NT5A 1ISIA 2TMGA 4DBZA 2HKIA 4QTZA 4R16A 3OJOA 4GVXA 3RCBA 2DPHA 1X7DA 1OMOA 3ROQA 3UUWA 4E5NA 3E9QA 3QWAA 2C5AA 1EMDA 2AQKA 5C5IA 2QRJA 4TRRA 1Y9AA 5L53A 4A73A 1LC3A 1ZH8A 4DUPA 1AHHA 1XDWA 2HRZA 4NK4A 1LDMA 1D7OA 3F46A 4TQGA 1NVTA 3PLRA 2E4AA 3VPGA 5F5NA 2EKQA 4Q39A 3DMTC 5IN4A 2ZB8A 4R69A 2IXAA 4R1SA 5HS4A 1N8KA 1QYDA 3DFUA 1NASA 2WMDA 3HFSA 2D2IA 2NUAA 3PGXA 1N9GA 3DAGA 4YQZA 1JAXA 1B15A 4Z6KA 2IZ1A 3TZKA 1E7WA 4F6CA 2X7HA 3QWBA 1GV0A 3G79A 3OIGA 4J6FA 5I7SA 2NV6A 4LVCA 1Z82A 3DFZA 1MV8A 1OI7A 1PJTA 1U4SA 3CSDA 3QV1A 4HNGA 1FDVA 3N58A 3QWHA 1MG0A 3JQGB 5JMPA 1DIBA 4AICA 3FWZA 4PLWA 4Z9FA 4O59O 5AVOA 4BV8A 5KKAA 2DQ4A 3AWDA 4JLWA 1YB4A 3V8BA 3E8XA 3PTZA 2PTGA 3GZNA 5KCZA 2B37A 2Q1WA 1WZEA 3RFXA 2YDYA 1VC2A 5BT9A 3DHEA 2PH3A 4OL9A 5IZCA 3Q9UA 4H7PA 3B1FA 2PKQO 4QFCA 2OOSA 1UP7A 3WGTA 5IAAA 4N54A 5TNXA 2QRKA 2W2LA 1KY4A 1Z7BA 2GLXA 4KDFA 4P22A 1JLLA 2HK9A 4BO6A 5GZ6A 5G0WA 4K6FA 4BKPA 3K30A 1J49A 3NRCA 3A14A 2G17A 3WLFA 1M66A 1MUUA 1X0XA 4W9NA 4QSMA 1VJTA 3Q6IA 3DOOA 5TF4A 2WE8A 1H93A 1Y7TA 1DXYA 1YKFA 3VPFA 4B3HA 3O03A 4IZIA 3TNLA 3G49A 4IMRA 3UFXA 1NYTA 1A9YA 3SX2A 1GQYA 2H5LA 2CZCA 1NAIA 2RAFA 3QJ5A 5G0SA 2EGHA 5KJEA 3WX0A 2O3UA 1V8BA 5L45A 4QFDA 3CMMA 2EKLA 4YJGB 4AJNA 4YJFB 1B2LA 2Z5LA 5ITWA 2AHRA 3H3FA 4YT5A 3WSWA 3GRPA 3SC4A 4BS9A 4OJNA 4J0FA 1NTOA 3KLMX 2YJZA 1RWBA 1LSSA 5FEUA 1Q2XA 3D4NA 3STHA 2QZ9A 4IS2A 2DM6A 1ORRA 1KEUA 1E3IA 4LCEA 5JC8A 3JD2A 2GPTA 2AE1A 5FF9A 1TT7A 3KSZO 4CQLA 1HE4A 2HMSA 4BO9A 4KDEA 4MVJH 4DPKA 2EJWA 2OZPA 4OMUA 4Z9XA 2HK7A 5H82A 4DREA 3BHIA 4AJOA 4BKOA 3TFOA 3RBZA 1I3LA 1KETA 2EP7A 1EDOA 3T4EA 1LRKA 2SCUA 4HV4A 5T57A 1HKUA 3A9WA 4JJFA 1HETA 2UV8A 3HDJA 4UVIA 3RFTA 4E4YA 4PLTA 4MVJG 4GPD1 1R4MB 3DR3A 3AUUA 4XYBA 4KUGA 3JQ8B 3QE3A 4KUHA 2FR0A 2ZQYA 2PGLA 3FHLA 1HWYA 2FY8A 4G5HA 1ADBA 1OFGA 1PEDA 4J49A 2AEFA 1ZEMA 4C7KA 2O7QA 3ANMA 1GCOA 1ISJA 3FTPA 3H7AA 2B5WA 4KWIA 4H3VA 2GZ1A 4WUVA 1MXHA 1XELA 2Q50A 5EMHA 2B4TO 4WLOA 1LC0A 3RUEA 1PL6A 1CQJA 4D0SA 5FFFA 3HNPA 3I6QA 3KZVA 3W4JA 2VOJA 2LDXA 3KM0A 2GRAA 4K9DA 5THKA 5B12A 3AY6A 1SB9A 2NU7A 3WGYA 3ZWMA 4R51A 4U6SA 3GT0A 5C37A 2J5QA 3V1TC 1VSVA 1U3TA 4D3DA 4GKBA 3GUCA 1GU7A 1IPEA 3F5QA 4J90A 4R54A 4L75A 5JW6A 4O6VA 1CYDA 1UXKA 4PLVA 5KNLA 2AE2A 2I66A 1LRLA 3WGZA 2GD1O 1ZMTA 3G1TA 4MINA 3JYNA 3WIDA 1O5IA 2B69A 3ETEA 3JV7A 3F47A 4I8XA 4R9RA 5A9TA 3RUFA 3IKTA 3H6KA 4XJTA 2DFDA 3LVFO 3F9IA 1E1KA 2YQ5A 2XOXA 4NJMA 5L3ZA 4LK3A 2FRDA 4Z0TA 2HDHA 1EVIA 2O23A 1QYWA 1TT5B 3BA1A 3WFJA 5U4QA 4MVJF 3OECA 4YJGA 4CMGA 1PJSA 3SVTA 1KEWA 3DXFA 4ND2A 1VKOA 4YYZA 2V65A 4TKMA 1B26A 2NM0A 2WDZA 3MJEA 1X1TA 3TFQA 3JQFC 5ADHA 1H9AA 3S2IA 4DMMA 3RVDA 4AJ2A 1PTJA 1W73A 1XG5A 2ZTMA 5ER9A 2O3TA 3C7CB 4TMFA 1YQDA 3GGGA 1R0LA 4YA6A 5A3VA 1YBVA 2BD0A 3ZU2A 4OGWA 4L0QA 2ZCVA 2VOEA 3W8EA 2OP1A 4YRAA 2VZ0A 3BTVA 4FDAA 1T25A 1VL8A 2E82A 1M75A 4JK3A 1HXHA 4TRJA 3KO8A 4JCOA 3QSGA 5JXWA 4Y67A 2Y0EA 1V9LA 1HT0A 3K2EA 3I1JA 3M2TA 1TXGA 3SEFA 4B79A 4NG5A 1O6ZA 3BMQB 1K2WA 4A10A 2Z95A 4PG8A 1DRVA 2V6BA 4EDFA 4Q3DA 4G65A 4PG7A 5FI3A 4BNGA 1PZGA 5TRTA 3VC7A 2DBQA 3JQ8A 1KBZA 3WLEA 2QG4A 3AM5A 4FFRA 4LN1A 2H1SA 2RHCA 4GH5A 4DQUA 4ZICA 1B3BA 3WBFA 4JP2A 3WGQA 4AJ4A 3LT4A 5KIAA 2PKRA 4ZN6A 4PG5A 4R1NA 2C0CA 1XU9A 1LDNA 2P2SA 2Y1FA 3FF4A 3BMOA 5KJFA 2X5OA 2AMFA 4DMLA 3K31A 1JWBB 1XU7A 2PGDA 2D4AA 1H94A 3OA2A 3RBVA 4CM8B 5A3JA 2Q1TA 1H2HA 2B0JA 3VKVA 1GD1O 2PZKA 3F4LA 1PGPA 1QV7A 1GYRA 1UP6A 1EQ2A 2EV9A 3ZHXA 2I9PA 1J0XO 4MJLA 5BR7A 4ZQBA 4ND4A 1VRWA 1GR0A 4DC0A 2ZKLA 1KS9A 4UUOA 3NDIA 5AXDA 1ISHA 5JDIA 5EJ2A 3N7UA 1PJBA 4W7HA 1A27A 1AGNA 2ZJ0A 3I3OA 1BTOA 3IIEA 3P2YA 4R9SA 5DNAA 3U9LA 5TX7A 4ZQHA 4K28A 3L9XA 3TL3A 3U49A 4CQMA 3MWEB 4CLHA 1GFSA 1VSUA 2CVQA 4DA9A 1ZK3A 2Q1SA 1E5LA 3PHIA 1ZK4A 4NHEA 4XQCA 3ZV4A 1TT5A 5CAEA 2P5UA 4PLFA 2DBRA 5TT1A 3UOGA 1X1EA 1LQUA 4A2CA 1PS0A 4BNHA 3CTMA 4TVBA 5TSDA 1XIVA 4BO8A 1JA9A 3C8MA 3MJ4A 1F17A 1BXZA 1UR5A 2H63A 1WAMA 1T2CA 2Y93A 3MJVA 4RQUA 2BFAA 3TZ6A 1LU9A 1YJQA 2O2YA 2VNAA 4J1QA 1A72A 3ZWOA 5HA5A 4RF4A 2FPIA 5T6BA 4URFA 2ZB4A 3EVNA 4RZIA 3RU7A 3LLSA 3PIDA 3VZRA 4YAIA 2Y67A 3JQ7B 3ZWCA 2WSBA 1V3VA 4E5KA 4RF2A 1GAEO 3BMNA 1PGNA 1P1RA 3QVTA 4CODB 1JKJA 3RWBA 3EMKA 1VE9A 1CJCA 3QVSA 4BOYA 3MTGA 4MKZA 4AL4A 2IEDA 2QYSA 1HTBA 2E37A 3ANLA 1E3EA 3RKRA 5B4TA 1HDYA 3CXRA 3QY9A 5JPIA 1R66A 3I83A 2O48X 4E31A 4RORA 2JCVA 4GMGA 5MGBA 2PR2A 1SC6A 2HJSA 3DBLA 4PGFA 2C2YA 4BKRA 3ZU4A 3EYWA 1GQ2A 1PS9A 1I3NA 4Y6PA 4BV9A 3JQ9A 2YV1A 1OC4A 1SAYA 1P9LA 3JYLA 3A28A 5CDYA 2HQ1A 4FJ2A 1U3WA 1PGOA 1CQIA 1A5ZA 1GYQA 1RM3A 1DJNA 3MOGA 3GY0A 3OSUA 1ZSVA 1UZLA 4NMHA 1C1DB 2DKNA 3VZQA 1GQQA 4J91A 2OGUA 2JFGA 4ND1A 2X23A 3JQBC 3DC2A 2C59A 2IZZA 2W2KB 3MJSA 1Y8RB 2IYPA 3D7LA 5G4LA 1CIVA 3RASA 4YAKA 5CDTA 1AXGA 2GN6A 1NQ5A 3AOGA 4BNZA 3D4PA 2BGLA 4HFRA 1GZ6A 5DF1A 3G1UA 4RF5A 2X0NA 4GX2A 4II3A 1I33A 1GY8A 1UDAA 4QO8A 3IOYA 1I24A 3QRWA 4L73A 3NKLA 3GQVA 2X5JO 4CMJA 2NLOA 4NJOA 4RO0A 1GPDG 3ZWNA 2YHIB 4IMPA 3C7AA 3ZGYA 2B36A 1EFLA 4ZU3A 3ONDA 3MJCA 4FFLA 4GKVA 3L77A 3TWOA 1DHRA 1XA0A 1W6UA 2QX7A 1ZXBA 2YFHA 1ARZA 4KQXA 5ES3A 3ZWBA 1GPJA 4I5DA 4FGWA 3WJAA 1RJWA 2IRWA 4E13A 1B8PA 1GZ3A 3QWFA 4NQZA 4NFYA 5MDHA 3SLKA 1QRRA 1R16A 4HBGA 1B7GO 4DIFA 3RUAA 1CETA 1V3TA 3TN7A 4YPOA 4IZHA 1XWFA 1HE2A 4L4RA 2X4GA 4ZRMA 4FN4A 1KEVA 1UP4A 1I30A 2WYVA 3ONEA 3W1VA 3WIEA 1U8XX 2R00A 3OIFA 2Q45A 4J4HA 5HTOA 3E18A 2QHXA 3TSCA 3BXXA 5A9RA 3PHJA 1NP3A 4XIYA 4XYEA 3LC2O 4CUJA 2X86A 1Y1PA 5COQA 5B1YA 1QLHA 2ZK7A 4WNCA 5T8KA 2AG8A 3KB6A 4EJ6A 3C1OA 1NHWA 3HJAA 4KOAA 5HM8A 2FPGA 1EBFA 3DBHB 4FFNA 2OMEA 2VRCD 1YGYA 4MP8A 2ZTVA 1C1DA 1L7DA 5CEFA 1U1IA 3PZRA 2A4KA 4HKTA 5F1OA 4YWJA 4PLHA 3PHLA 5G0TA 2GCGA 3DOJA 4DYDA 3DHYA 2Q46A 2W2KA 1EK5A 1Y8RA 4BGVA 4BHTA 3QP9A 3WWYA 4AJLA 3VZPA 1NM5A 4YT8A 3PPIA 3ETDA 5TQVA 1NVMB 4E2WA 5JCJD 3ST7A 1QKIA 5CEEA 1ZBQA 1YQGA 3H2ZA 4MOWA 1QMGA 1PL8A 1WP4A 1A4UA 2C7GA 2EW8A 1X0VA 1H5QA 2I3AA 5GY7A 2Y0CA 4XB1A 3HDYA 1UZMA 2J8ZA 3E5MA 1Q0QA 3D5QA 1YB5A 1ULSA 1N2SA 1YBAA 3FPLA 4PIVA 3UGKA 4E0BA 4XDYA 4Q9NA 1GV1A 2QIOA 3S8MA 1BRMA 3ZW9A 1I36A 3EZYA 1R12A 2BF7A 1E7RA 1B0AA 3QVOA 3LYLA 2CSUA 1T24A 4WCFB 2EEZA 2O50A 4J7UA 1BHSA 4NH4A 1C0KA 2VZ8A 1T1SA 3ZW8A 3KYCA 1EVZA 5BSGA 1PZEA 1QG6A 4YEDA 3R0IA 3M1LA 4D41A 4YT4A 2GUGA 3I5MA 1HZJA 5H83A 1CDOA 2HRBA 2NU8A 3I6IA 3ZWAA 5IXYA 1Z74A 1WNTA 2A9FA 4F6LA 3GPDG 2B4RO 2C20A 4A03A 4CLRB 4GQAA 3QQPA 4D42A 3ETGA 3ICPA 3GFBA 1E3LA 3V1YA 2O2SA 1ZXLA 3VDRA 1NFFA 2D0IA 3B1KA 3ZZNA 3GMSA 1I2ZA 1KOLA 2BELA 4PVCA 4EYEA 2VHXA 3AI2A 1T2EA 1XQ6A 5HS6A 4IY1A 5KJCA 2VWPA 3CINA 3FR7A 3OA0A 3DQPA 1QXSA 4PZEA 2TMDA 4PLGA 3ROMA 4UUPA 5IDQA 3DBHA 4GAEA 2WJPA 1I01A 3WFIA 4PVDA 2Y68A 3I9KA 4RVDA 5ICSA 4E2XA 4OXKA 5CP8A 3ZDFA 1Z6ZA 4IPTA 2Q4EA 1E3WB 1FDWA 1NQOA 2WYWA 4BVAA 4OOEA 2EJVA 3VPHA 2Q99A 4AVYA 4OKIA 1PQPA 3Q3CA 4XYMA 2PD3A 2VWHA 3AI1A 4XYGA 4CM9D 5DBIA 3OETA 2VUUA 4HADA 2BI7A 2VQ3A 1ENPA 3W6ZA 1HRDA 4CMIB 4LSWA 1N5DA 1ZK2A 3H9QA 5B4UA 2I3GA 4R41A 1C0LA 3O8QB 3WYCA 3GR6A 5K9ZA 4J2OA 4A5OA 4YAGA 4M49A 4I9HA 5JLAA 1DLJA 4CV2A 7MDHA 2BMAA 4XEHA 3HE3A 3FD8A 2RCYA 5I9LA 1HE3A 4DLAA 3TPCA 4PG6A 3OIDA 1YL7A 3PWSA 4WCFA 5EQFA 3ZWPA 2VZ9A 3FNHA 1DOHA 5G4KB 1DRWA 1SOWA 1E3JA 4XJSA 3RUDA 4U8GA 4ZHSA 1JU9A 5ICMA 2D5CA 4PG4A 5JC1A 4I5GA 3NDJA 3QVWA 2DUWA 3RJ5A 4X54A 3ZH2A 2Q3EA 4NR0A 5I9NA 2YV2A 1BVRA 4CM9A 2G5CA 4NFSA 5T64A 7ADHA 1EDZA 4E2YA 1YO6A 5L9AA 4M89A 3GN2A 3UCXA 1GUZA 2X1HA 4BNFA 2JL1A 1C3VA 3VTZA 1NHGA 1BXGA 1MA0A 1HDZA 4TROA 3VHRA 1ENYA 1U2GA 4DYVA 3Q2IA 4N5LA 5A04A 2WTBA 1BSVA 4L9RA 4MIOA 4J1NA 4UVDA 2DTEA 5JDCA 4OSOA 4CLOA 1Z75A 2YHUA 5DOZA 5JNLA 1YOVB 1M67A 3O38A 4JBGA 3AJRA 1DC3A 4QO7A 2GZ2A 4GBJA 5A05A 3E9MA 3ON5A 3JSAA 4ND3A 1HDXA 2ZB3A 4FIZA 4N18A 1UXGA 4HY3A 2Y1EA 1V35A 3OBBA 1LTHR 1CEQA 4CV0A 4E12A 2CVOA 3P5SA 1QYVA 4CM4B 1YE3A 2QQ5A 4LSMA 2CNBA 2FWMX 4TVOA 5TLSA 4BNUA 1E3WA 5DT9A 4MDHA 2NADA 4CJXA 1BW9B 3EC7A 1CERA 4EJMA 5K6AC 4D79A 4CUZA 5A03A 4AJEA 2JCYA 3L07A 2ZATA 3SC6A 1PGJA 1YL6A 3EZLA 3VPSA 4YVFA 5IDYA 1IZ9A 1R15A 4CL3A 1I2BA 3GDFA 5JE8A 5JAMA 1N1EA 3M2PA 4LW8A 4OIMA 2O7SA 4IUYA 2GYYA 1MGOA 2F00A 1YH3A 3ZWXA 1U2DA 2I99A 2YQ4A 3HB4X 3WWZA 1RKXA 1SZJG 2YYYA 4CR6A 3DMYA 3DZKA 1A7AA 1O94A 1UAYA 1ZSYA 3U4HA 4CV3A 4D46A 2A94A 1ZUD1 2VYVD 4YCAA 4OYRA 3QVXA 4RVFA 4Y6SA 2D5AA 1G0NA 5DBFA 2HSDA 4NBUA 1PJLA 2W98A 3PHGA 3MOIA 3NX4A 3OICA 3EW7A 4N5NA 1E6WA 5HBRA 4CV1A 3ULKA 3HG7A 5EN4A 2J3KA 3AFMA 4GX5A 4Q3EA 3SLGA 2W8ZA 5G4KA 4ALMA 2AW5A 4BQPA 1SO8A 1NNUA 1QLJA 4UEOA 4GSKA 1EUCA 1MLDA 4XRGA 3JQGA 4BMVA 1ISMA 1E7YA 3GF4A 3RC2A 3DTTA 2QZZA 4DC1A 1CRWG 3OEYA 2D1YA 2V6MA 2PNFA 2UYYA 4IS3A 4ZQGA 2BKAA 3FNGA 4PCVA 2RIRA 4HNHA 4OM8A 3WDSA 3DWFA 3INRA 5JYDA 3NTQA 4J43A 3EY4A 2DU8A 3VVBA 3PLNA 4TWRA 4HP8A 4Z9YA 4QXMA 3I9OA 2D59A 1L1FA 1LXCA 3OJFA 4ALLA 4B7UA 1BWSA 4CUKA 4Z3DA 3BHJA 4EUFA 4OQYA 4AJPA 3R6DA 1YOVA 4GGOA 1SMKA 4M54A 4CPDA 1HYGA 4AG3A 3EUWA 5JAZA 1R6DA 2FHSA 3L6EA 5LC1A 3EAGA 1EFKA 2NWQA 3B6ZA 5CPFA 1NR1A 5KOIA 2VCYA 1YONA 1WDLA 3INTA 2X58A 1M76A 1N7HA 1DIAA 1YL5A 3CPSA 4BGEA 3D3WB 4KTTE 1Y81A 4PRLA 4CM4A 4NI5A 5DZSA 2ZB7A 1U7TA 1NPTO 2GASA 4UAGA 4BO1A 3K2BA 2E49A 1VL6A 1BW9A 3V2HA 1W8DA 3DHNA 4BGIA 4BNXA 4UVGA 2UUPA 2FOIA 4PZDA 3IMFA 3H3JA 4NZ9A 2PWZA 4AJ1A 1O9BA 3WQRA 4YJFA 3ZNOA 2NTVA 2B35A 3IQDB 4YJHB 2DTDA 4R5HA 2Y05A 1DDOA 3L9WA 3H65A 4J2HA 3I9NA 4RJTA 3GOHA 1YBMA 1Z7EA 4YB8A 1XKQA 4BNLA 1X14A 1U9JA 5ENVA 5CEJA 1KVQA 4GWKA 4WLVA 3HWRA 3KYDB 1GUYA 3UCFA 1P1IA 1WW8A 1JW9B 5KVCA 4A0SA 4EUHA 1DJQA 2JHGA 1LDEA 2O3QA 3LT0A 1MXFA 1W0CA 1RYEA 1ZK1A 4B8ZA 4BQRA 3WBBA 4CLDA 1O95A 1YVEI 1NFQA 4HFMA 2OHXA 4BKQA 4XYLA 4LCJA 4CLXA 2YFQA 5F21A 3VAZA 1N7GA 3NTRA 3DZFA 2AQIA 3H5AA 3I23A 1HDGO 1EZ4A 3C7DB 4MKXA 4BB6A 2O4UX 1R4MA 1HDOA 2C07A 4GGPA 3CUKA 4L74A 4RDHA 3K6JA 2FR8A 4RPKA 5L95A 1KVUA 3C24A 4U0KA 3S2EA 2HK8A 2DVMA 5FWNA 1I2CA 5EIOA 1H9BA 3TJRA 3V2GA 3LDHA 1EK6A 3PK0A 2WM3A 2VTDA 1S7CA 3PZBA 3IL2A 4E6PA 4RLSA 5I8ZA 5BNIA 4E33A 1LQTA 4OXNA 2EWMA 4WNIA 3AUTA 5IZCC 3GEMA 2G1UA 2UVDA 3TOXA 1IE3A 4IJVA 3GVCA 4BO5A 3VOSA 3VVCA 3ZU5A 1YWGO 4B4OA 4NBWA 4W4TA 4DL9A 3U4CA 1KY5A 3AM3A 1DAPA 3D3WA 4PRKA 2GN8A 4B4UA 3GN1A 2FSSA 2XAAA 4LMRA 4W9NC 5L7WA 4CMAA 4DTIA 2BGKA 1JDJA 3PJDA 4KQWA 4A26A 3OQ1A 2Y1CA 3FN4A 3U5TA 4K26A 5JBIA 4NNJA 4S1VA 3GG2A 3PGJA 1P0CA 1P74A 2JAPA 1D8AA 3LC1O 5DOVA 4MVJE 4YJHA 5GMOA 1O0SA 5AQ1A 5JFOA 3GGOA 2D8AA 4IDFA 4GVLA 3QHAA 1Y5RA 4TRNA 2NQ8A 4EBFA 5KVVA 1VLLA 4RGBA 1K0UA 3E03A 3KYDA 4Q3BA 4JBHA 4WECA 2P5YA 1DFIA 1U3UA 1X13A 2ZTLA 3DZGA 4GLLA 1TB4A 1H6CA 1TA4A 1I0ZA 1LX6A 2HMWA 5KJ1A 3E9NA 3WYEA 2FMUA 3IKVA 4L76A 1R0SA 1AHIA 1PJQA 3JQAB 1I3MA 4E5PA 4IJKA 1Y8QB 1E1NA 3BMQA 3H9UA 3UH1A 3WQQA 5EINA 3WMWA 5L7TA 3U4IA 2GN4A 1KC1A 3OMLA 4ND5A 4CMBA 3VZSA 1E92A 1HEUA 3L4BA 2WD8A 1LLUA 4A27A 4E3ZA 2CDCA 2E6UX 1FJHA 4FFMA 3ZNPA 2OXIA 1KYQA 4KP7A 4O5OA 3I9LA 4ALKA 5BNTA 1DSSG 3RC9A 4Z3KA 3MCVA 1JVBA 4L4XA 1P1HA 1YDEA 4B4VA 1R0KA 4P38A 2GERA 1SPXA 2FPPA 1EVYA 1PWXA 4J1SA 3E82A 4RZHA 5AXAA 2BRUA 4W82A 3NGLA 4U6QA 4CM8A 4DLLA 2EG9A 5TT0A 4R5MA 4ZJUA 5KJ6A 2NTNA 4QEDA 3FBGA 1P77A 2J3IA 2XXJA 3JD3A 5IJZA 4MVJI 3VTFA 3LF2A 3JD0A 2PD4A 3RJ9A 4S3MA 3PJEA 3JQEA 4XIJA 5C7OO 1B16A 1ONNA 4JIGA 4P4GA 2OO5A 5DP1A 2OL4A 2GN9A 4ZRNA 1ISFA 5GZ3A 2EIHA 3BZUA 2C54A 2X5KO 4KZPA 1YS4A 1MX3A 3JQAD 5DULA 3JYQA 5BNFA 1SEVA 4DIBA 1U7HA 3VPXA 1ADCA 4FGSA 2WD7B 3KUXA 4YQYA 1SCUA 1ZZEA 5AYVA 3I9MA 4Y9DA 4CL8A 3V1UA 1UXIA 3GG9A 3ZWVA 4YACA 2YUTA 1JWAB 3SBOA 4KTVE 2B4QA 4JP3A 5A4DA 2VHVA 1GYPA 1JQBA 5JAQA 1DO8A 4LMPA 3KLPX 5T67A 2I67A 3L6OO 4FJ0A 3CZRA 1A9ZA 3IS3A 1DC5A 3RAJA 1HL3A 1LRJA 1PGQA 1YB1A 4YBZA 3ASUA 4C4OA 4NK5A 4D0RA 3DDNA 3DMTA 3OH8A 3GAFA 4WJZA 1ZNQO 3NEPX 2J3HA 1T4DA 1LDYA 3GNQA 3U0BA 1UAGA 2DUUA 1M2WA 3IAHA 5HRUA 4XCVA 1IY8A 4KMSA 3B1JA 1K89A 3JQ7A 4BNKA 5BSFA 1I8TA 1Y8QA 1A4IA 1T2DA 4OH1A 1Q7GA 1ZCJA 4U5QA 4XGKA 4YRDA 4QQRA 2FN7A 1V0JA 3RFVA 3PQDA 3FTNA 4UVHA 4FC7A 2JFHA 4RPHA 4CMHA 2DBVO 2JKVA 4RDIA 1P3DA 3JQDA 4BNYA 3T4XA 4R3NA 4E2ZA 2CF5A 2GO1A 2Q49A 1PJCA 3OJ0A 5A9SB 1ULUA 2VN8A 3D64A 3F1KA 4NDNE 4CMEA 5F1KA 4IINA 4F3YA 3GEGA 1DRUA 1HF3A 3GGPA 1U8FO 3ZWYA 4H16A 5GZ1A 2AG5A 3NUGA 4E5YA 5IZ4A 1N1GA 1O89A 3VDQA 4Z0HO 4GWGA 1WDKA 1SBYA 4B7CA 5IDWA 3WGIA 2GDZA 1E6EA 2OFPA 3ENKA 3QLJA 3O26A 4BIIA 3GLQA 4YAEA 2VWQA 5DDIP 3VKUA 3GHYA 2IEBA 4OQZA 3WGHA 4Q3CA 3VH2A 5T5QA 1JKFA 3T7CA 3ZV3A 1XYGA 4MVJD 4A7PA 2Q1UA 3BAZA 2OP0A 3NYWA 2H6EA 1HDCA 4FBGA 3DZIA 3PQFA 4HUJA 3S2GA 3OHSX 4R1TA 1PJ2A 3ADOA 2RBEA
chains in the Genus database with same CATH superfamily
3KPVA 3KQOA 3KOUA 4CHTA 4N03A 1IPFA 1OT3A 2V9ZA 3FM9A 3VYRB 4YT2A 5C8VA 1KZGB 4UDNA 2NV0A 2FSHA 1XVIA 2X3UA 2Z5GA 2CUKA 3ZKAA 1TF2A 5JDIC 3TNYA 1O4VA 2DZDA 1EM8B 2O3SA 4BN5A 5HKLA 4LDAA 2V7QD 4MS4B 4CR8A 4YECA 1O6FA 5FR1A 2I4NA 5FUYA 1NN5A 5IM5A 1M2FA 1R0YA 1U4OA 3SZMA 1ZN9A 4HAVA 1GTMA 4HWSA 4RMHA 2Y8EA 1G8MA 1UMBA 3B2EA 4U2FA 3SNHA 3TG2A 4ABYA 3F97A 3FWYA 4ZHQA 5DX0A 1RDFA 4Z4GA 1XGKA 2HJRA 4FTWA 1BMFD 5LQCA 3PBKA 1XA3A 3KQNA 1H2EA 1N5KA 5F76A 3U1BA 4WCVA 2EGUA 1ECGA 1KJIA 2VL7A 3GH3A 1OWPA 1MC8A 4RPJA 1WRBA 4KN8A 1G291 5YASA 2QKYA 3B1YA 2DCUA 2GEBA 1PJAA 4FR5A 2A1TS 2UDPA 3AI3A 3MPOA 3NOOA 5G1PA 1FZQA 2C4VA 1YZFA 1F8XA 3GRVA 3ONNA 4LXQA 4HUTA 3NM4A 2FW7A 1YD7A 1TTTA 3HY4A 1L5WA 3E1KA 3ESZA 4MVJA 3VU8A 3V4VB 2EDCA 3HEAA 2P3OA 2DHCA 1Q20A 3PR1A 1DQRA 4HH0A 3K0EA 2D2EA 2IZOA 4DNXA 2O2CA 2J7KA 1G6KA 2C5HA 2C82A 2QE7A 3GFGA 2YC4C 4ZOLB 2B5VA 1CY1A 1G9SA 1N1MA 4IH9A 4AQDA 3E4CA 3AYZB 4LNAA 2Y1LA 1T2AA 1UBMS 5BQPA 5ETJA 4DBVO 2CEKA 1J8YF 3PX7A 5JO0A 4DG5A 2Q6LA 3EVAA 4NBKA 1M73E 1H6BA 3HJHA 3PYLA 2UAGA 2C29D 1AKRA 2DLDA 4U2DA 4X24A 3ZWKA 1F14A 4XQ9A 3OC0A 1OYWA 1QVWA 2ZZNA 2A30A 3WVNA 3DW3X 3AJ9A 5FNVF 2Q3MA 4ROSA 5AW0A 3DKPA 4R01A 4BUCA 2XBLA 1BN6A 3W8FA 2QRGA 1P31A 2YS7A 2XXAB 1XEFA 4GDFA 3LUPA 2R97A 3P71T 5DYIA 1RI1A 1QQBA 4RVSA 3VHQA 3MWLA 2O2ZA 3O4GA 3TCKA 4X5OA 3E3NA 5FORA 1IEXA 2VUTA 3F3KA 1T35A 4CG1A 3QSYA 4BNTA 1EFPB 4JX8A 4KO4S 4CYMA 1VPWA 4P0QB 2B9EA 3WL7A 2RH8A 4GRIA 4IQ0A 2V6FA 1W4RA 3PYXA 3IAM1 3L8GA 2Q2WA 3KUKA 3EYAA 2GETA 1QH1B 3QPCA 5GM2A 2ZRJA 4Q1CA 5TJHA 3H5VA 3JQ9C 3SZOA 1BOFA 1MP0A 1CS4C 1V1RA 2P30A 3NB0A 3O82A 1W52X 4Q9KA 2RHLA 5GAJA 5BORA 1ECBA 1PJ4A 4LXUA 2AI3A 1KJ9A 4G4SO 4JH0A 1VKNA 1ENOA 1Z6TA 4P4LA 4ZO7A 4E32A 1YQXA 4GI1A 3DD5A 1OWOA 4PSDA 3CUYA 2PKYX 4D9MA 2XRZA 3FPCA 4IUDS 2ZR8A 3LX4A 5CNJA 1VPTA 4O2BF 1Z0ZA 5TMPA 5JROA 2J3JA 3LQ4A 4BQFA 3FROA 1U3VA 2XYPA 2W90A 2HV9A 2ZSIA 5BQFA 1N0HA 3UTCA 4MHOA 1E5QA 3W8NA 1L6IA 1UKZA 1NPDA 2XGJA 1EM8A 1P2SA 4IJUA 4W5RA 4M1QA 3ZH9B 2P91A 3CIFA 1W1WA 3LYAA 1ZLYA 3OLYA 1M8FA 2IBTA 4GE0A 2AJLI 4MPDA 3I73A 4NBRA 3N75A 3X1MA 1W25A 4HGRA 3CBGA 1HLDA 1XXHE 1L3CA 3GMDA 4OHYA 3WKEA 1J1UA 3UMCA 4R1OA 5EYPB 3R09A 3CH4B 4YR9A 4RVUA 3ZWDA 4G0PA 3LDGA 5REQA 5CD9A 1T2FA 2D0DA 5C8DA 5A06A 5EPUA 3N87A 3PKZA 5H5JA 1YIDA 2VI5A 1DADA 3OSZA 3OX4A 3MM4A 2GK7A 5I4IA 1HE1C 3L0DA 2JBAA 2OXRA 4F3TA 4ZO9A 3EEOA 3KUDA 3C5EA 1UBUS 3I52A 4TXNA 5CJPA 2R7MA 4I4IA 4D43A 1SIOA 1TZCA 3RFCA 4KFSA 1AXEA 4JDUA 4JJGA 5JVDB 4WFKA 3PQ7A 3VI4B 4LOJA 3H8SA 3CF0A 4XQEA 1OREA 1Z63A 2VA9A 5DMHA 4CLRA 1RQPA 3R7WB 1QHIA 1T4GA 2CUTA 4TLMB 1W36C 1XWIA 4XIIA 1UBNA 2WPNA 3NV7A 1XAHA 2NUPB 2WAOA 5K1ZA 4AMVA 4IWYA 4KNVA 3GFTA 4EMUA 4TYQA 1DUVG 5DNUA 3EULA 5A62A 2Q5FA 2B82A 2PO7A 821PA 1YBHA 5EQDA 2ABWA 3GUYA 4RTLA 3T12A 2IZ6A 5KSYA 4D0LB 4DV4B 3W3AH 2P4HX 1BXRB 3C8UA 1WVGA 3AW9A 4KLNA 3WOHA 1ZI6A 3GAMA 4HH3C 2E4WA 3PPWA 2XCIA 3PUIA 3RYCB 3PFGA 1VSQA 4NHOA 2H0AA 1IBKB 3GNTA 1EFPA 3NP7A 5T8KC 5C1DA 2PVSA 4E4RA 3MAAC 2A59A 3IAEA 1Q0LA 4B35A 1HSOA 1V8DA 2H4ZA 3CU5A 1LPNA 1QH1A 4NU0A 3SE0A 5LDHA 1G1AA 1YZKA 2GBLC 3WWEA 4UE6A 5B6JA 1Z6PA 3UWMA 1DRKA 4RD6A 2BHLA 3EDMA 4JB0A 1WP9A 3C4QA 4LJ9A 3S2SA 2NU7B 3I62A 5A3QA 1PFVA 1UJ5A 4OAQA 4WLNA 1G60A 1Q44A 3HFRA 2O07A 3EMBA 4RPGA 3WXBA 4PW0A 4ZOCA 1E5XA 4AJHA 5BSTA 3J81A 5DRTA 3ZV5A 2B1IA 4F92B 4Q1VA 2V45A 2HWYA 3N76A 3RYIB 4UEKA 5EMNA 1N3BA 3CO0S 2PXHA 1LK5A 1D04A 2ZUTA 1G5TA 5ESRA 3U4AA 2G4CA 1VE3A 1VHWA 3IC5A 4KQIA 3TH5A 3OD5A 1TVEA 2RHOA 1G7TA 1IRIA 3MHPA 3GA7A 1DBRA 3EMDA 1HTWA 3ABQB 3KELA 2P6NA 4J3NA 1K86A 2HA7A 4TQAA 1GPWB 3TFWA 1JAYA 2VNHA 2WRZA 4AP5A 2HBZA 2SICE 2Y92A 4H0FA 3QUQA 3W5CA 2QZPA 1K5DA 1K7SN 1YRAA 1Z5ZA 2QTAA 1GZVA 1Y6FA 3T9FA 3BIFA 3N74A 2FZLA 1H4QA 1TM3E 3BILA 1ZCAA 2VK1A 4IHJF 3E84A 3NYRA 2PJUA 1XD2B 2FSVA 3WZLA 4IDGA 4PTYA 4G36A 1I3OA 2PT7A 3FTCA 4YJ3A 3N8KA 1UXOA 5TF0A 1BFDA 6CHYA 3GLFA 4OVKA 3PGA1 4DSOA 1ECCA 1ZD4A 3BFJA 4I9NA 1CE8B 1RXYA 5KNCD 1V25A 2WMOB 3QTBA 1KEKA 1XRMA 5JVDA 3CLUD 2DERA 3AB8A 1J9ZA 1EZZA 1NWCA 2GAIA 2VJYA 4QHYA 1PSWA 5I7RA 5LYJA 4IWXA 3NI2A 3KU4A 4X6UA 3F7NA 4N3NA 4BGDA 1G20B 5IEBA 3NDPA 3FGZA 3L7CA 3RTBA 1Z38A 3PPVA 4EJ0A 1UMKA 2NUPA 1J8DA 4ZZ1A 1XFDA 1EFVA 2WF5A 3TL2A 3Q8LA 2XCTB 3REQA 1JQ5A 2OESA 2V8BA 2ZZMA 4NV3A 2A35A 4YRZA 1NLYA 1VFNA 3A2KA 5HIKA 1PR5A 2VYVA 2EJCA 4AD8A 5KMGA 2BZSA 3DZ8A 3Q3HA 2QVCA 2P62A 1UUFA 1VYTA 1SUFA 2D54A 3NHLA 1BXRA 3CCBA 3IMCA 1UBHS 1CRZA 2O5VA 2DHQA 3HDQA 4V39A 1S3GA 4WEQA 4MW9A 2R6HA 3VVMA 5FI5A 1G41A 3ER6A 5K8JB 1GGFA 2VK2A 4MIYA 1MD9A 3OLZA 4J0HA 4XLTA 1OX5A 3E3LA 3JQBA 4FD3A 4NCIA 1RJ9A 4OHRA 3VR4A 5M29A 4PPNA 1DO0A 1FP7A 1K9SA 3NDRA 3IQIX 3T8YA 5IEJA 4S05A 2VT6A 3D8HA 2P5SA 3NEJA 2AW3A 2FZWA 1V41E 3H9GA 4O4IB 3OFNA 3HVHA 4NEGA 4YRSA 4ZAGA 3T3IA 1SY7A 3MWDB 1GFIA 3L5OA 5FDFA 3OJEA 3M6VA 5AKXA 3QKRB 3WNBA 5A5EA 4QDZA 4ZZ0A 1DX9A 1DQZA 4QUEA 3T5AA 3RUHA 3ZNNA 3R5SA 2J30A 1YS6A 4ZQCB 3LP8A 5C52B 3MRVA 4MB6A 1NNEA 2OG2A 3PGKA 1EUQA 4MJ3A 1V71A 4H15A 3THWB 3SJAA 4GSLA 3I64A 4KAFA 5JJKA 2JARA 3WO1A 4G0UA 1LA2A 3GUZA 5TPZD 1AJEA 4KR7A 4YV2A 1Y8ZA 3EHDA 4DT1B 1I10A 4FNAA 3K35A 4HAUA 4AS1A 1DC6A 2ZSAA 1C4KA 1BE0A 4JXKA 1A7JA 4EQ6B 1XLUA 2FK7A 1LSOA 2YYAA 4DV6B 3X2FA 2BY4A 1NG1A 3FOFC 3USES 1SZPA 2HRDA 3I9JA 2GRUA 4UU1A 4XD2A 3P9XA 4IIHA 1WLYA 4IQ8A 2I4TA 5MGNA 5AOVA 4QDXA 4M8NE 4NCJA 3QE2A 1ZIDA 5KO2A 5AKJA 2DG2A 4Q03A 4C0XA 1HBJA 5JAIA 1SVUA 4O1IA 1MEEA 5IN5A 3C7KA 3TXAA 3AVQA 1LF5A 5IG2A 1L8OA 1PBNA 3N0VA 2YY5A 4BDTA 5ES4B 3DKKA 2L82A 4DLUA 4XKJA 3IV9A 2TMYA 4DSTA 3IQZA 3IVGA 2WLTA 1J20A 1LLCA 1IL0A 2OHFA 5KQLA 2I8LA 3CNNA 2ZJ8A 2Q3DA 4HX5A 1Z2NX 1VJRA 3CX4A 3ZN2A 3QG5A 4WCFC 3QBDA 4LV8B 4I19A 2JH8A 2ZAOA 1CG6A 2GPWA 1X6VA 4JJ8A 3C2QA 4UREA 3LNTA 5DNEA 1RM0A 1L4YA 1OA0A 1L4FA 2WG1A 4LI0A 4CR7A 4IM7A 1XV5A 5ALDA 3X2SA 4ECAA 5AFSA 4M38A 1AQLA 1V7CA 3FVWA 3EEYA 5TXGA 3RRFA 2QM3A 4Z9BA 3ICEA 1CJTC 1G20A 3AY7A 1G5PA 4GFDA 5L3QB 3IFSA 2Y71A 2GKOA 1D2AA 4TL6A 2IQIA 1DC4A 1KPGA 1QG0A 2H0RA 2CJXA 3CM0A 3CUWA 3VYWA 2BUCA 4ARZB 5FTKA 2WF8A 4CQMD 1NVUQ 1XR3A 3OQ6A 1LBIA 2NSDA 5DGTA 3OD1A 1U2GC 3BYZA 3KJIA 4YPVA 1JMKC 3LKBA 1L5OA 4HL6A 4JKYA 3AONB 3T3HA 1JJAA 5DJ5A 5JDCC 5L3VA 3QKTA 2WTEA 5JAPA 4TTSA 1I6MA 3A4NA 2GBFA 4IBOA 4NYMQ 5AOAA 1HDEA 2ODBA 3GPCA 5CBPB 4ZKDA 2CL0X 4CVNA 4BATA 1L7AA 2IUUA 3HUDA 3IGFA 1TVCA 3VU3A 1BQ3A 4EKDA 1AGYA 1ONSA 3HYRA 4JLVA 4C0LA 3UQZA 4LDNA 1TM4E 3TZEA 3WNQA 6PFKA 1KZ9A 3DLIA 4PC1A 4EG1A 4O4IA 5BOSB 3FI0A 1BS1A 1ZMOA 1N0WA 2Y6UA 3OAAD 1TZKA 4LE1A 3SMVA 3RC8A 3CNLA 4O63O 1WVMA 4Q3OA 5JS2A 1SM4A 3WAJA 2OWDA 1XKXA 2B7BA 2O8EB 1Z6QA 1NW8A 2EJBA 3DWGA 1SXIA 1EKXA 3I1YA 3OEWA 4E22A 4DQVA 3LHIA 4UNSA 1CJMA 3AR4A 4LJ8A 4JGIA 3TR5A 5CCXA 3L5KA 3PFWO 2WNSA 1OKKA 2ZIZA 1E2UA 4JC8A 4M0EA 2V7VA 4ISCA 3UMGA 4CTKA 1QPZA 2Q3BA 4KX3A 1NVWQ 2BGMA 3DVQX 2QLMA 4G5SA 3N6XA 2Y1WA 3DFKA 3WNCA 4DT1A 1NBME 2B94A 3LXRA 1IUKA 3EFOA 1XE3A 2BEJA 4XB2A 4EQ6A 3BWCA 3OZFA 1NAHA 1Z68A 4BJ5A 1MC5A 3UATA 4MIEA 2ADOA 2EFEB 3NAQA 2WUWE 2A0WA 3IO5A 2BJWA 4MQ4A 5DGDA 4A16A 2O0HA 2OVBA 3PT9A 2IPLA 3HWWA 3O1LA 2YZKA 1ZZGA 5AW6A 5AT1A 3TI7A 2VXBA 5FD8A 4PC7A 2W2PA 1M1YE 4C88A 2PZMA 1M2HA 4XOIA 3AVTA 5HIAA 4EYQA 2W6IA 3HBJA 1N7JA 1TK3A 3VH4A 2DQZA 3GDGA 2XODA 1OROA 1NSFA 2QU7A 4D3FA 2QTNA 5LDGA 4G0OA 3IDZA 2WWRA 4QNRA 5BSEA 3GNSA 4HYQA 3WQBA 3K71B 3AY3A 3ICVA 1HNZB 1IDN1 1GR1A 1XZDA 5EL0A 2PO5A 1T0UA 4KCGA 2NTJA 3T4PA 5CEJA 1IATA 2RBEA 5JRZA 2C7VA 4GC9A 1RLOA 4RZUA 4UOQA 4XR4A 2OK7A 3AWIA 5FOWA 1ZUHA 4D98A 5L4NA 5DCWA 4NZZA 3AT1A 5AI5A 3U7IA 2XQFA 5EKUA 1KQFA 1RXWA 5DE3A 3H18A 3V4LA 1O0BA 3OPQA 4QQNA 2YCBA 4G9EA 3ZCUA 4C7VA 3V7UA 1E6UA 4DLRA 4KWEA 3I2JA 1OILA 2WQ6A 1GPUA 3L7JA 4FILA 4ZP1A 1GGJA 4LYGA 1YACA 3KKKA 4LMAA 2Q9CA 1HFWA 3RAPR 2AF4C 3MT8A 1FYXA 1RQRA 4Q00A 4EEZA 1F6WA 4FW8A 5AVUA 1ODLA 2O2HA 1MB9A 4IO1A 4IDBA 4REMA 2I2DA 1RADA 2PD6A 1FNNA 3U7GA 2QVGA 1VMIA 3LFUA 1LY1A 4FX5A 3UO8B 4D9NA 4BE7B 1VE7A 5CNKA 2NACA 5J47A 3C5CA 3F9RA 4PZCA 5H68A 1V3UA 4GMDA 1CYEA 3AUSA 5CBPA 1HMYA 2CLSA 1P91A 2I65A 2WILA 5BWCA 3HDTA 5CB4F 1XQ1A 5EUQB 3IQXA 4G1UC 2AFRA 5BSHA 4QUIA 4GEKA 4LJLA 4B6RA 2HLPA 3D1VA 1KU6A 2YY7A 3NHMA 5EIXA 4MK4A 3D7NA 2CSXA 1EXVA 2IPMA 1YCFA 2B83A 1UKBA 1TA9A 3OFSA 4ZEVA 2EBWA 4C2BA 2VH2A 2PL3A 3IUQA 4KE6A 1NQTA 1H3EA 3RROA 3SEAA 1GZ4A 2Q2VA 3LUBA 5BNZA 1D0IA 1H85A 5J2TB 2J32A 3IUBA 5ALNA 4LFAB 2YVKA 4AAYA 3V8NA 2ZSUA 2O8EA 4NECA 4C29A 5A4JA 1E0DA 4C0SA 1O97D 3EDRA 1NBOA 1GNLA 1UDRA 2BP7B 4EBBA 3R2JA 2VPWA 4QBHA 2W2MA 3R41A 4Z0NA 2ZBPA 3AKZA 3KV3O 3GRAA 2DPGA 3CUUA 1KVSA 1QPBA 4XGQA 2VJMB 1PX0A 4II2A 5EZ6B 1F2DA 2DFTA 4FYYA 1G3MA 4M60A 3TBFA 1AQUA 5KSZA 4RFSA 2YXBA 2NYRA 1OXTA 1YZHA 4I4TB 4LECA 4LTNA 3IELA 3FKSD 1MO3A 1D3AA 4HNUA 5KYWA 3U6BA 3O74A 2BFPA 3HC7A 3K15A 4MVJM 2O3RA 2V7XA 3VC3A 1GVNB 3MAGA 4MWTA 3SDBA 1GL3A 2HMVA 4Z7OB 3JQAA 4IAOA 3ZHVA 1B0UA 1Q7TA 3RRMA 3LSTA 2F59A 3CVXA 3Q87B 2VK8A 1WD7A 1H2ZA 5FTMA 3TEFA 2WKRA 4MNTA 3TZCA 3EW9A 4M55A 1BIFA 1X1RA 3DFIA 5B7GA 2N1BA 3HXOA 1MG5A 1AURA 1B0ZA 4YUAA 5BURA 1NNLA 1TIKA 4QLAA 4NV1A 3V4ZA 3AHEA 3U3XA 5CDUA 1O5OA 3AU9A 2OB1A 1IWPB 5KTKA 4IGFA 3PWKA 4CM7A 3RO7A 4GZLA 3F67A 3CLTC 1H3FA 3NKVA 4J1TA 5DBGA 3T9AA 2MSWA 2IZ7A 2B98A 1Z35A 3GJZA 5K05A 2CL6X 4WOJA 1J5PA 3VOBA 4LF9B 3KSUA 4QDTA 1P2GA 2P9CA 1DTSA 3GT4A 1URPA 4L4SA 4TKZA 3C97A 4EITA 3CPEA 4MDEA 1QFSA 3NNSA 1X7ZB 4ZAFA 5I5EA 4AN0A 3O8BA 4OYHA 5JCOC 1SELA 2EKZA 3BEOA 1FP2A 2I0FA 3FWNA 3VJMA 1MFPA 1U3DA 4DMGA 4B9AA 3AHCA 3SSOA 721PA 4FDLA 3ZV7A 4NC9A 2XYHA 1SCQA 4A8TA 1KPHA 3AZOA 3UHFA 3H05A 1ZNWA 3O9ZA 1Z6GA 4KXNA 2BEUA 2JLBA 3GVHA 2QLLA 5ILGA 2Z6QA 2FOXA 2FP3A 1Z2AA 2VPTA 5EXSA 2HR1A 4YCMA 4E30A 3LQYA 4I1RA 2JLUA 1FTGA 2PH7A 2XMZA 4IKPA 4EHLA 2HA4A 1IY0A 1UIMA 4B3IA 1NBMD 3VJKA 2IDKA 4ZEXA 1E3QA 2WD7A 1R8JA 1W94A 5TV2A 2JVJA 4FZVA 4PONA 3WGNA 2FKAA 3CUEF 4ZMBA 2JJ1A 3AF3A 3N2GB 1AZWA 3BREA 3P2IA 2DFVA 4MVWA 3A1NA 3AFNA 3JWGA 4HAOA 4KXYA 1Q0HA 3X1KA 4DDMA 1I7SB 2CKDA 5ELLA 3DO8A 1AOXA 3K1ZA 4I6GA 5IC5A 4QAQA 4MUKA 1NXSA 2W6JA 3EGOA 5EESA 1JT9A 2QP3A 5HQTA 4EL5A 2QMEA 4J16A 5IXSA 2FLKA 3HXLA 3I45A 4JD5A 4Q19A 2XNSA 5F1PA 4IDEA 3IEUA 2V7BA 4K40A 4IDDA 5B64A 3A1DA 4KC0A 3A8TA 1EEHA 3HJBA 1E6MA 4RVGA 1V4BA 1DG3A 2GNAA 3G5LA 4G67A 5J40A 4JL8A 5IYZB 4ND7A 1TPYA 4I46A 2D2FA 4U9HS 4XIFA 1SXQA 2PX5A 3S0JA 3CONA 1KHTA 3EH1A 4ARCA 1OX4A 3QFHA 3TQHA 1M33A 2YX1A 5A1JA 1SD5A 1BYUA 2Q1XA 4K9OA 1QIMA 4QX6A 1X7GA 4TWJA 2O1WA 3FNIA 4HG2A 1FW6A 1R9MA 4X84A 5DHFA 2H4YA 3NJ8A 1E99A 1Q7BA 3ENNA 3MCUA 4PQRA 4QLBA 3TZLA 5JWRA 4Q16A 3ASVA 1WEHA 4OQDA 1H2YA 1V39A 2PZLA 5I8WA 1JB1A 3ETNA 4MV3A 4OI2A 1VLHA 1NJ6A 2NUAB 2P4QA 2RBKA 4R4JA 5KIAA 4KWHA 5DLYA 1EK1A 2CYAA 4UQOA 5E4YA 3JYOA 3ZGXA 2ZROA 5LQDA 1JGTA 1PX2A 1J97A 4UVEA 5K3FB 3IR6A 3WYNA 1JMVA 3PITA 1ESZA 3AU8A 4NS1A 3P2JA 4UBKA 5JTTA 1OR8A 4FHCA 3VPAA 1R5NA 4M0DA 1DV2A 1E89A 2CYCA 1PK7A 1P33A 2V7QA 4F0JA 2IYTA 4I9UA 2HIGA 4B8WA 1V1MB 1I7PA 2JJQA 3L4BC 3GEDA 2O5RA 4JHXA 4KDCA 4WK6A 4YWHA 1XLTA 3TOSA 4F2GA 2FU5C 5A9SA 4D6XA 1YBFA 2HYDA 2HB6A 2YV3A 4ZOAA 2YVQA 3PHHA 4Q24A 4TS9A 4YX9A 4GLOA 3EXHB 2Q5JA 4R1QA 3JAMA 1BMFA 1C4WA 4GQBA 2ORYA 3PTAA 3NIFB 1QWSA 4QT4A 4FLMA 4MQUA 3IXLA 4DR4B 1X7ZA 5AVYA 1DGQA 2AD1A 2VJQA 4JBYA 4BMZA 4AJKA 3LBAA 2BDEA 2GDJA 3AERB 3F6YA 1FU7A 1Q3TA 2PZEA 4PZPA 4TSKA 3RVSA 3ZU3A 4Q7QA 1YA6A 3WLHA 1K5HA 3IQFA 4GKKB 2VHYA 5SZHB 1FDTA 2QAIA 2G08A 2PXAA 4A2WA 2YIDA 1K3UB 4FQ8A 4LGYA 2WHXA 1FVFA 1V5FA 2G8NA 2P35A 4IDHA 4JGBA 1NY6A 1SD2A 2WUDA 4CDNA 4QECA 2BGRA 1IG0A 3H97A 3T35A 1JALA 3R3JA 5F78A 1P6UA 3GFFA 4MCHA 1ZEJA 3U3DA 4IIUA 2OO5C 3RS4A 3D8RA 3NG1A 1E1MA 4HDAA 5EVJA 1E2BA 3FHCB 4ZVUA 3PFIA 3PENA 4P36A 4ER0A 1MPTA 4I5IA 4D96A 1FRVA 3N2GA 5CFOA 2QP4A 5GOTA 1OVMA 4FCCA 3O21A 5KAPA 1YXMA 4U3JA 1D09A 1Q3KA 5LXTF 8ATCA 4L8FA 3WWPA 3DT8A 4H9GA 4RZXA 2VSQA 5CVEA 1C14A 1J42A 3SXPA 4CF6A 2Q6KA 4FI3C 3N3BC 2YWDA 1KOJA 4CNBA 2OV2A 5LYYA 5BV2P 5FX2A 1RRPA 3N05A 2NQ2C 1W5EA 2ZPUA 4AIRA 4QTZA 4RQBA 2WKQA 2ZRFA 3N0XA 1ONBA 3UUWA 3A1UA 4E5NA 1NQXA 3K20A 2OY0A 3ME5A 3E9QA 3GIWA 3OZBA 5CD1A 2C5AA 4MI3A 5C5IA 2QRJA 2G04A 1Y9AA 1THTA 4W5JA 4WKBA 1SBNE 4A73A 2QWXA 1LC3A 1H2AS 2C8JA 1NUUA 1AHHA 1RJDA 1XDWA 1XEWY 1YRHA 2XKBA 1JXQA 3E2IA 4NK4A 4ZEOA 4CKZA 4DMKA 5C81A 2GVZC 2ZZKA 1JWLA 3WK5A 3M70A 2Q5OA 3UAZA 1NDUA 1T10A 4I50B 5HUQA 4R9VA 4RULA 3QKWA 4HI0E 3DE3X 4R1SA 2C8VA 2XI4A 2IYVA 3DFUA 2EQBA 2QN3A 521PA 3E5HA 4ZAZA 2WMDA 3DE1X 3HFSA 3PGXA 1R0WA 2LD4A 2NUAA 4XJXA 4YQZA 4MR8A 1IBCA 1SZDA 2XCQA 2GZRA 1TYZA 5LQKA 3CZPA 5LQNA 1K7CA 1JHDA 2H4XA 5FPQA 3WLTA 3FPJA 2NAFA 3WLNA 4BX8A 2X7HA 1G9XA 3OOJA 4F6CA 3WGLA 3SHFA 3GJQA 1EFUA 4TMYA 2XSZD 2NV6A 2O8CA 1EINA 1P6QA 5JAHA 1OI7A 3FMOB 4K2HA 2HTFA 3N58A 2VDWB 1ZM9A 3QZUA 4J29A 4KK3A 2Z6UA 2XB2A 3FWZA 4Z9FA 2IOYA 4EB0A 4BV8A 5KKAA 3VRHA 1M5RA 5DXAA 3B1ZA 4JLWA 2HU7A 3LGSA 3VSEA 4D3YA 5T4FA 5AOCA 5KNBD 2ZEJA 2PTGA 3NM6B 2X9LA 1HGXA 2XZTA 4QPZA 2B37A 4LYHA 2Q1WA 3NASA 4MWZA 3RFXA 2YDYA 4WWHA 1OXMA 2X9QA 1T0JB 3C14C 1L4UA 1PFYA 3DHEA 3FB4A 3IBSA 4UM8B 4DA8A 1N3LA 2GNPA 3Q9UA 3WBJA 3T61A 2QRQA 3B1FA 4QFCA 4EA7A 2ZBUA 3FDZB 5BUZA 4DR1B 1CVLA 3AERA 1ZH0A 4IOMA 4NAHA 1FFBA 4F4UA 1SUEA 2QNBA 3BCSA 1JR3D 4W9RA 2EKBA 4P0PB 3CRW1 1A8SA 4K6FA 3UJPA 5JR3A 2QTCA 4MICA 1JAZA 3A14A 2O2EA 1EX1A 1MUUA 3NVMB 3ZS9A 1XBTA 2EX1A 1IIRA 1NOIA 2CCGA 2XE6A 5BV0A 1L5SA 1FDOA 1HNNA 1V8FA 1WULS 1YKFA 4LG1A 4AM8A 4B6EA 5CT6A 4UM9B 3U7HB 3KQMA 3PGMA 4B3HA 1ZMRA 2OZLA 4M1WA 3TNLA 1K98A 5BXQC 4M36A 4F21A 1W5BA 1EP1B 4UM7A 1SXJE 1QIIA 1C3LA 1A9YA 4CU5A 1K8YB 4GI7A 1S5PA 3QJ5A 1L5MA 3HKBB 3NTUA 3KCNA 3PI6A 3KT6A 1W0JA 3WX0A 2ZT7A 5AHOA 5BMOA 1CY8A 1ORVA 1T0PA 5GONB 1E63A 2H92A 3PQCA 4GYWA 1R6VA 5KQRA 1Z7WA 2AHRA 3H3FA 4YT5A 1A4XA 3GRPA 4CTOA 5HDQA 2G4LA 1M1UA 1KMNA 4JUDX 4OREX 2YBDA 1Y6ZA 4J0FA 2O8BB 4FMCF 2AWOA 1AC5A 1FMTA 1K5GA 4L85A 3GFPA 4WTOA 3CRVA 2CW5A 4KODA 2JFOA 5LNK1 2P6RA 3DE5X 1W48A 1ZH4A 3STHA 4DE5A 1TRHA 3N28A 1E3IA 1Z18A 2XQIA 4L0CA 3JD2A 4XM0A 1RVDA 3PEUA 5CM2Z 4IVPA 5E6RA 4CU2A 2FSPA 1X3SA 5D84A 4D5EA 2C7QA 1PD0A 2EJWA 2VJBA 4B8YA 2UUAB 2CJFA 5KHLB 3I9V1 2ORIA 4DREA 3ELBA 2JHCA 2WHEA 3TFOA 1M83A 1I3LA 2ZM6B 4HV4A 2SCUA 3B1WA 3L8ZA 5T57A 2PRIA 1QOQB 4D6PA 4LGCA 1JQDA 3U2QA 1NU6A 4JJFA 2BYTA 4Q7KA 3AF2A 2P67A 2DHRA 4F9EA 1KSHA 2HCRA 3LQ2A 4MVJG 4O25A 3TG8A 1R4MB 3DR3A 2UUBB 2PS9A 3L0SA 4KGXA 4QICA 5SY6A 4XYBA 3OZSA 4RW0A 1XZKA 2ZQYA 3FHLA 1S8NA 1XDZA 2GJSA 3C4VA 3PSHA 2AEFA 4OYYA 3ANMA 2OHOA 3D3JA 4MMZB 1GCOA 4UD2A 3FTPA 4OJYA 4MRMB 2ZUEA 2B5WA 4ARIA 1FDIA 2ZRMA 5JATA 1MXHA 3IDFA 1CV2A 1TVMA 5LZ7A 1PG5A 1RCTE 2XMCA 2B4TO 1CJKC 3EZ6A 1O7JA 2YC2C 1OTXA 4LX0A 1PL6A 3RUEA 5F7OA 3CR3C 1SQ5A 1J70A 3FDZA 1Y42X 3I6QA 4PRZA 4S0ZA 3KM0A 5K8CA 2ZYVX 4RKYA 4R7ZA 1J33A 3FY4A 3P9NA 5L3SA 4JYCA 5D8DA 4PSKA 4N6GA 3TO5A 3WGYA 5FNVB 4L2IB 2J5QA 3V1TC 3DOHA 3WQHA 5KNCA 4NENB 2QSYA 4I1YA 1R6BX 2YV5A 4JQZA 3V00A 1IPEA 3F5QA 3FUCA 4TYWA 5JW6A 3L1KA 4IMJB 5KNLA 2VJLA 1U1DA 4K1XA 5FWXA 2ODEA 3LAWA 4DMUB 1YNOA 4FOLA 4G5OA 1GHTA 1IN7A 4MINA 3WIDA 1O5IA 3ETEA 5IH3A 3F47A 3G2HA 1CC1S 3OEHD 4I8XA 3T06B 3IKTA 2RHMA 4MR9B 3S3TA 5KYGA 3PR2B 3LVFO 3F9IA 4D41A 1E1KA 2YQ5A 2XOXA 4NJMA 5L3ZA 3H3XA 3IT1A 3QMWA 1R6XA 4NE7A 4JB8A 4ZT4A 2X2OA 2H2FA 2X5NA 4FYVA 4K6GA 1A0OA 2LGJA 4Y2VA 3WFJA 4FHFA 1C8LA 3A9SA 4MV0A 1PJSA 3WLKX 4CMGA 4RJLA 1PG2A 1YOBA 3CCFA 3GLUA 5JMOA 4JI0B 4IF6A 1GN8A 2FB9A 2VRWA 2WOJA 4B31A 2A1UB 2FMIA 2Q2OA 1VECA 2WDZA 3MJEA 3PUJA 4O2BB 3TFQA 4D8TA 5ADHA 1SVWA 4X62B 3X44A 3BXEA 1ETHA 2JI7A 4DMMA 4Z2YA 3TUZC 1W73A 4GPZA 1KIAA 5ER9A 3C7CB 4RA6B 2PBZA 2ODQA 1YQDA 2XHEA 3NS7A 1QTNA 2F8SA 2C57A 2C31A 3ZI7A 1XXHA 5BSKA 4D2IA 5IVHA 2Q8NA 1Z83A 1DKRA 3DT6A 5EXPA 3PICA 1V9SA 4H1HA 4KPUA 2XNJA 4QHSA 1XYYA 3K2EA 3VR5H 3G9TA 2IW3A 3M2TA 2A2ZA 5L6LB 3WYFA 4ER7A 2GH1A 1NNI1 2ZE6A 1VJDA 2HPZA 1I9CA 2ZWOA 1GNPA 3RGGA 1KEZA 3I01A 3O5AA 1RRCA 4EDFA 4JVNA 1NMXA 1DIOB 1NLFA 4G65A 4Q3DA 1PZGA 1QNLA 5TRTA 1F4PA 1GQSA 1FC0A 1Z5PA 2B4YA 2I4OA 3COZA 2YN0A 4WXHA 1MJFA 1WUHS 2ZQ5A 3EIOA 3OF3A 4Q01A 4XDHA 2FTKE 4BAGA 3IEXA 1MIOB 2J0EA 2R9VA 4X3CA 3QEOA 5KTMA 5ELXA 4G1CA 5CX1B 1PL0A 1RBYA 2HC9A 4B0OA 3MUNA 3RSZA 5IANA 1JXAA 1WHTB 2X5XA 4PFSA 4WNYA 3EGDB 3R3VA 1D2CA 4MRMA 5CJJA 2PIDA 2XMRA 5GQSA 1XU9A 3SI7A 3K4PA 2UU9B 1I6LA 4N3BA 3BMOA 2FPXA 2X5OA 1DKUA 4E5SA 4G2TA 1IEWA 1SXJD 1VLVA 3M9LA 2PSEA 2D4AA 3MIZA 5T4HA 2MSDB 4BP9A 4CM8B 5A3JA 5KYXA 3P4YA 2B0JA 3VKVA 5I7UA 2PZKA 4NS4A 2AYXA 3WA6A 3CB2A 2EV9A 2PGAA 1R2QA 1S8FA 3ZHXA 2XQVA 5EHGA 3ZJTA 3LCVB 2I9PA 1NXPA 1J0DA 4YMLA 5BR7A 1AVTA 1G8SA 2I62A 1XHEA 4NENA 4OQFA 4ND4A 4ISBA 4YRFA 2R68A 2H06A 1VRWA 2C4NA 2R1VB 4U5XA 3HU3A 3VGJA 2GEVA 2X1LA 3NDIA 1ISHA 3WL8A 5CLFA 1RYYA 3OOSA 3CGWA 3V7YA 1OUMA 2G06A 3I3OA 5AK4A 1BTOA 3RAFC 3R0XA 4R9SA 4M9XA 4XW2A 3PQ6A 1NQUA 3IVCA 1BAPA 3C3PA 2IYLD 1NMYA 2E0IA 4KQKA 4L4YA 3EVFA 3IBFA 3HUFA 4CQMA 4FZ5A 3FTQA 4NARA 2REBA 4GKJB 2CVQA 3EGIA 3A6LA 1U0BB 2C2GA 2A3NA 4XQCA 3ZV4A 3OWHA 4XWTA 2P5UA 2VPIA 2DBRA 3GQBB 3UOGA 2GF9A 5BT8A 3D6VA 4ETIA 5TSDA 4URXR 1GZDA 4BO8A 3BWXA 3MJ4A 4JI5B 1F17A 2A1UA 2HZ7A 4ABTA 2BTQB 4MCJA 3ZUGA 4DSAA 3FIJA 1AZTA 3SWWA 4HNSA 2Y93A 1IQUA 1R3DA 1ZRMA 3DPUA 3MJVA 3Q4GA 1S96A 1ND5A 4GPBA 4RQUA 3REFA 1G8GA 2V3WA 3TZ6A 4F2HA 3N2LA 4DQDA 1LU9A 1XLWA 2VH1A 2IX9A 4GU5A 4XTCS 1N32B 2VNAA 3JXEA 1WCV1 1KJYA 1A72A 3QVMA 4J1QA 3L06A 4KMRA 2P6MA 4N41A 3OAAA 4R71A 1QGYA 3TSZA 4URFA 2IH2A 3MRXA 5LB2A 4ZDKA 3RU7A 1PT6A 4HSGA 1WHSB 2Q4OA 1N2GA 4JELA 3BGOS 4PCUA 1TVKB 2HPHA 1E2MA 3JQ7B 3ZWCA 4QDKA 5EZYF 2VATA 1C7EA 2O0MA 3BMNA 4JJKA 2J3DA 4DNFA 1BROA 2EBHX 2FVYA 4BCBA 5D2CA 4KRFA 4CODB 1FA9A 3RVNA 3RWBA 2PZFA 3EMKA 1LZLA 4WUTA 1VE9A 3BWEA 4FK8A 1G8AA 1F5NA 4IHJB 5EJGA 4MKZA 4AL4A 5CH5A 4D9HA 4CTMA 3ZYCA 5I3CA 4HTAA 1P3JA 3RIXA 3H5TA 1E3EA 2WJZB 1OX6A 3CXRA 3QY9A 5LQSA 4X7BA 1MIOA 1G6HA 5ALXA 3FYHA 4DZRA 4TKVA 4GMGA 2PR2A 1Y82A 3DC7A 3HV2A 1R4AA 3ZEAA 3AEQB 3M34A 1WHTA 4MUFA 2ZG6A 2XW6A 3QEMB 4G5QA 4BKRA 1YK0A 4V0ME 2OT3B 4XXHA 4H4CA 1SAYA 2JGFA 3K3PA 1P9LA 1QIEA 3A28A 4HAZA 3EFEA 4YREA 4OUKX 5E4FA 3I09A 4EUKA 1U7UA 1PGOA 2GOYA 3OF5A 6REQB 4JX9A 3CQ9A 3MOGA 1EJ6A 4NMHA 1ZSVA 3ZE9A 1MR3F 1Z34A 2JFGA 3Q9SA 2QUIA 2QZ4A 2XZPA 3P27A 4JQSA 4RE6A 5IS2A 2C59A 1KO5A 3MJSA 4IW3B 5G4LA 3D7LA 1CIVA 4D8XA 1APBA 1G5QA 4FSDA 4L3WA 1P62B 4HLUA 4ND6A 4HB0A 1NYQA 1ZS9A 1YR7A 2N9UA 4Y1EA 3ZDQA 2CVHA 1NF9A 2QSUA 4U7GA 3LP6A 5AVXA 5G1OA 1CBUA 3W06A 3DXYA 2ZW9A 5K2MA 1RJGA 1OH8A 3QFFA 3ZUPA 1JSRA 2B3DA 4WQMA 3BE4A 3IOYA 3HK2A 3M4JA 3IOMA 4RH0A 5TMEA 3AX6A 4D97A 1AA6A 3UXMA 2NLOA 4CGZA 1GPDG 2DY1A 1AUXA 1EA7A 3BGDA 3JATB 3MWYW 1G59A 2FSUA 3C7AA 2HJHA 3ZGYA 5HJ5A 4ZU3A 3GQBA 2WUVA 4BVJA 4BTLA 2WWIA 5JD3A 1PUJA 5CM9C 4UFOA 1B6SA 2HSEA 1BE6A 1WDWB 2FMFA 2BTQA 4ZXPA 3TWOA 3G8YA 3PDCA 4Q48A 1OGYA 5I9SA 5E3JA 5INTA 3FJOA 4AWAA 1U1FA 1ZXBA 2YFHA 4HAYA 4INJA 3SDZA 4EKYA 4AZTA 4O08A 5B6IA 2ZIFA 4I5DA 3RRZA 3WJAA 1RJWA 2IRWA 4KAJA 3BE5A 3KJQA 5BSUA 5IKMA 1JR6A 1R10A 4OG2A 3LY8A 3KR9A 2OBFA 1FQKA 4LOIA 5FAXA 5LN1A 1CZRA 3I4LA 1QRRA 2PMDA 1R16A 1AQYA 3DPIA 2XDWA 1CTQA 1MHPA 4DIFA 2JPDA 4LNUB 3UB2A 3HGMA 1P17A 5KX5F 1V3TA 5DSZA 1I13A 1TJYA 4IZHA 3THYB 1TZJA 1GSAA 1Z33A 4FN4A 1KEVA 1UP4A 3ONEA 2ATCA 3W1VA