4UEOA

Open state of galactitol-1-phosphate 5-dehydrogenase from e. coli, with zinc in the catalytic site.
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
346
structure length
346
Chain Sequence
MKSVVNDTDGIVRVAESVIPEIKHQDEVRVKIASSGLCGSDLPRIFKNGAHYYPITLGHEFSGYIDAVGSGVDDLHPGDAVACVPLLPCFTCPECLKGFYSQCAKYDFIGSRRDGGFAEYIVVKRKNVFALPTDMPIEDGAFIEPITVGLHAFHLAQGCENKNVIIIGAGTIGLLAIQCAVALGAKSVTAIDISSEKLALAKSFGAMQTFNSSEMSAPQMQSVLRELRFNQLILETAGVPQTVELAVEIAGPHAQLALVGTLHQDLHLTSATFGKILRKELTVIGSWMNYSSPWPGQEWETASRLLTERKLSLEPLIAHRGSFESFAQAVRDIARNAMPGKVLLIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Enantioselective Oxidation of Galactitol 1-Phosphate by Galactitol-1-Phosphate 5-Dehydrogenase from Escherichia Coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords GALACTITOL-1-PHOSPHATE 5-DEHYDROGENASE
total genus 106
structure length 346
sequence length 346
chains with identical sequence B
ec nomenclature ec 1.1.1.251: Galactitol-1-phosphate 5-dehydrogenase.
pdb deposition date 2014-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ueoA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4ueoA01
4QO7A 1R4MA 4ZD6A 5B4UA 2GO1A 4DWVA 1XLTA 4BO4A 1P1IA 3ZU5A 5LDHA 2D8AA 4DPMA 4X54A 3ZV3A 1F12A 4P4GA 4AJJA 2OGUA 5JYEA 2E82A 2PV7A 3BMOA 3PWKA 3BTUA 3NKLA 1KBZA 1LX6A 4XCVA 1NQ5A 3ROPA 2D3TA 4HY3A 2V6BA 1JW9B 3QWHA 3ST7A 2OORA 2R00C 3PJGA 3AOEC 5CDSA 3V1TC 1PWZA 1ZK0A 1VSVA 1YH3A 4YA6A 1RJWA 2HJSA 4DQUA 5BQFA 5BSEA 4Z9XA 3GQVA 1B15A 4MP3A 1YL6A 5DN9A 5IAAA 1D4FA 2VWGA 2CDAA 1UJMA 2VRCD 3D5QA 3I9NA 2FPIA 2BI8A 1YB4A 2VUUA 5TC4A 5KKAA 3UCXA 4AJKA 1ADGA 2DQ4A 3HZZA 5G0TA 2WSBA 4QQRA 1XG5A 2GCGA 3L6OO 1PQWA 3AK4A 3E9QA 4OSOA 3ENKA 4RVHA 3AU9A 3S55A 3MZ0A 1HTBA 5C7LO 3VVCA 1I0ZA 2E37A 3WJ7A 4EZBA 4WLOA 4A0SA 3INGA 4EJ6A 1NQOA 2C0CA 1A7AA 1KEVA 4N5NA 4JJGA 4N54A 1WDKA 2OXIA 2Z1MA 3L0DA 1PZEA 3D3WB 2HO5A 3IUPA 3TRIA 2YUTA 1V3TA 5IF3A 4Y6RA 2G17A 3C85A 5TLSA 3ZV5A 2I3AA 1A4IA 4GL4A 4UAGA 3RKUA 3ASUA 4WLNA 2EIHA 4JIGA 1HZZA 1P74A 2JL1A 3GGOA 1P0CA 4NU6A 1KVTA 2W2LD 4OMUA 1GQQA 4LMRA 7ADHA 4D46A 4PFJA 1HDXA 4RVFA 3ZNOA 3I9JA 4J2HA 2PZKA 1X7GA 3AI1A 4ROSA 4D0RA 3JD1A 4Y67A 3ZV6A 2PH3A 3GEDA 4XYLA 3VH4A 1HEUA 3Q0EA 5EIOA 4R1TA 6LDHA 5L53A 3PDUA 5AQ1A 1ORRA 5JO0A 3HE3A 1GZ6A 2DBQA 2DLDA 4CLOB 2HUNA 4YPOA 3TFOA 2CDBA 4RPJA 3HG7A 4FN4A 1EDZA 4MDHA 5LC1A 3V5NA 4PLZA 1PGOA 2JFHA 1ISIA 4GKVA 4WE3A 3GRPA 2YDXA 5L9AA 5JBIA 3JQAD 3QA9A 2HAEA 1IZ0A 3F46A 3GNTA 3RUIA 2W2LA 2O3UA 3OQBA 3JQ7B 1H6BA 1T1RA 2A35A 4WCFB 1QYWA 3BZUA 2WD8A 1DRUA 2RHRA 3KYBA 4BNIA 2NNLD 5IJZA 5KJ1A 2I3GA 3C3XA 4EITA 3W6ZA 3ZWXA 1AUPA 4R9RA 2IZZA 2GN9A 4OXKA 4OXYA 1LLUA 2YJZA 5HS4A 5K6AA 1QYCA 2B4RO 4R1UA 2W2KB 3OM9A 1YL5A 3U4CA 4D3FA 1EE2A 1QV7A 5GMOA 3ZI0A 3NDIA 4RF2A 4BGEA 1T2EA 4NBWA 3VPXA 4BB6A 3DAGA 4L74A 3CINA 1RKXA 4FQ8A 4JNKA 2GUGA 3F1KA 3ZU3A 4CLOA 4NJMA 4J49A 4I9UA 1YONA 2FWMX 1SO8A 3H5RA 1UZNA 2WYVA 1U3TA 3E9NA 3VTZA 1MUUA 4UREA 4CLEA 5JDIA 1R0SA 3GLQA 5T8KC 4RVSA 4J9VA 4A27A 4DPLA 5BSGA 2Q3EA 4DL9A 5F5NA 3F4BA 1VJTA 1R6DA 4WUVA 1MB4A 2NVUB 1Y5MA 3MCVA 1J49A 5DCYA 1VI2A 2ZB3A 1Z74A 4DYDA 1X7DA 1I3MA 2O48X 4GX0A 3JSAA 4ND5A 4EEZA 2BH9A 1EFLA 4A7PA 5JO9A 3IJRA 4TROA 2EEZA 3M6IA 4FC6A 3D1LA 4O59O 2WE7A 3VKVA 4WLFA 3RASA 3KOUA 1XCBA 3GUCA 4B7UA 1H2HA 1ML3A 4BV8A 1GUYA 4E2YA 1GUFA 3DZHA 2QZZA 4K26A 4P4NA 3B20A 3Q2KA 2A92A 4XEHA 4UUOA 5FF9A 3KYDB 1ONNA 3RI3A 5I8WA 1B8VA 1KEPA 1E7YA 1P33A 1Y7TA 5DOVA 3RD5A 1P1FA 2X5KO 2ZTMA 1NPYA 1LDGA 2ZCUA 3FI9A 2C2XA 4L9RA 4OH1A 1IE3A 1T4BA 1AHHA 4XIYA 4YAKA 3NT5A 3IQDB 3WTBA 3K5PA 2B5WA 1E7MA 1EBUA 2XXJA 2GN6A 1XEAA 4AJPA 5EESA 2P5UA 5A9SA 3DZKA 3W6UA 5K1SA 1KVUA 4IDCA 2WD7A 4QUKA 5KKCA 3JQFC 1VKOA 4O5OA 3OECA 3H4VA 3LZ6A 4IQ0A 4NR0A 4OSPA 4XQGA 2VTDA 5TS3A 2XPCA 4HXYA 4AL4A 3OIDA 4DPKA 1ENOA 3O26A 3I4FA 2BLLA 1NFQA 2D5CA 2VHVA 2FMUA 1LLDA 1NVGA 3ETEA 4UUPA 2C5EA 2Y99A 1ZK3A 2P9CA 3L77A 4J1SA 1TA4A 4L4SA 3UKOA 2WJPA 1Q0QA 1BGVA 4HX5A 1KYQA 3GFBA 4RLSA 1YB5A 1FJHA 3H2ZA 2CDCA 2TMGA 2DTEA 3GPDG 3PI7A 3WR5A 4L76A 3UICA 4DREA 2QHXA 3PK0A 5ES3A 3VPSA 3RJ5A 3ZN2A 1C1XA 4FJ2A 4ALNA 4BMNA 4OQZA 1NHGA 4DYVA 2NLOA 4EI2A 4MJLA 4JXKA 3ONDA 4L4RA 3ITKA 4RPKA 2VHXA 4QT0A 4CV3A 1YBAA 3S2IA 4D43A 4P4LA 4YRDA 1WW8A 1YJQA 1H9AA 1YO6A 3LLVA 3HFSA 4D45A 4M1QA 2FPPA 3R3SA 3I6QA 3GOHA 4JROA 3NEPX 2X22A 2VRCA 1GR0A 3KM0A 4B8WA 1XWFA 5KJ6A 3TL3A 2DBZA 1HWYA 1UDAA 1CDOA 1V9LA 2VRBA 2NWQA 4R69A 1SC6A 5ENVA 1SZJG 4E2ZA 5IDQA 4P22A 2YFHA 5FI3A 3UHAA 2Q1WA 4WECA 2V6GA 4ZJUA 4MVJG 1A27A 3T4XA 3TZKA 4UEJA 4F3YA 1K6IA 3WIEA 4YBZA 5DP2A 1IL0A 1LQUA 4YDRA 1MXFA 5EJ2A 4CLDA 2BFPA 1HDGO 1HT0A 3RU9A 4CM6A 3B6ZA 3R0IA 3LVFO 4E5KA 3BMNA 1AXEA 4LMPA 2HDHA 1R66A 4YRBA 4RZHA 4L8VA 2VTEA 1GTMA 4BVAA 4W9NC 3HJAA 4XX0A 3GG2A 1M6HA 1Y6JA 1NYTA 2ZQZA 3PHLA 2QX7A 3PHGA 3NGLA 4GAEA 4I5GA 5FI5A 4BNFA 3E82A 3ZHXA 1C0IA 3PLRA 1XGKA 3EAGA 1ISMA 1CRWG 4WLUA 4EGFA 5KVSA 2FP4A 4GX5A 1FDWA 3COSA 4J0FA 4CUKA 4BUCA 3DL2A 1E3WA 3WNQA 4Q3AA 2EG9A 4HNHA 1QR6A 5ADHA 3VKUA 3ZNNA 4XB2A 4AJLA 4KUEA 2VYNA 4KQWA 1EUDA 3JQFA 3D4PA 4XYMA 2Q2WA 3DTTA 3GHHA 1NQTA 2V6FA 5HM8A 4FGWA 1A5ZA 3VC7A 4BHTA 3RUFA 3CZMA 1PJQA 4MVJH 2HKIA 4II2A 3L07A 5ITVA 4I5DA 2JCVA 1T4DA 5JW6A 1Y5RA 4Y6SA 2XF8A 1M6WA 1U7TA 3IC5A 1TT5A 5A06A 3AOGA 4BO2A 3ANMA 1NBOA 3EK2A 3LT1A 2BFOA 2SCUA 4IIVA 3RSHA 4ZA2A 1PL6A 2C07A 3BMOB 4NU5A 2YW9A 3GUYA 1PZFA 2D2IA 4DMMA 2EKLA 4MIYA 3V8BA 2RH8A 2HMUA 4LRTB 2X86A 5AOVA 5G2OA 1GY8A 4LCEA 2J3HA 2J5KA 2X58A 1S7CA 4J7XA 1E0DA 3WGQA 3L4BA 4D0SA 3MJSA 4CV1A 1D1SA 1CETA 3I9KA 5CPBA 3DBLA 3KLPX 3RAJA 3JQAB 2R2GA 3DZJA 1PWXA 4R54A 4J1TA 4YAJA 4IUYA 4XB1A 5CDUA 1G6KA 3BXXA 3JD3A 2CVQA 5L7WA 2D0IA 2AW5A 4HFMA 4IDFA 3TN7A 3DZBA 3PHJA 3X2EA 4JGBA 5I7FA 3ZWNA 3KSDO 2V65A 3GH3A 2VZ9A 3WNVA 4Q3BA 2PLAA 1QMGA 4EJ0A 2GN4A 2UUPA 4FJ1A 1F8GA 1G1AA 4R1SA 1OC2A 4BNYA 2WYWA 5FFFA 3ICPA 1XELA 4RF3A 4IQ8A 2EWMA 3RROA 5DULA 5JNLA 4ZRMA 3PHHA 4ILKA 1NWHA 3JQ9A 2ZJ0A 4GLLA 4B4UA 5DZSA 3AI3A 3ZNPA 3QSGA 1SOVA 4KOAA 4WCFA 2BMAA 4UVIA 3KTDA 1L1FA 4A5OA 3W4KA 3ZWVA 3HDJA 4XJSA 1R16A 2O7QA 3DFZA 1GQYA 3C7DB 4OGWA 1WZEA 3EW7A 2O2YA 5T6BA 2BFMA 4G5HA 2Y1OA 4WEOA 4DA9A 2X7HA 4OOEA 4ZQFA 1N7GA 4FFOA 5A04A 4ZRNA 2H6EA 2JFGA 1SEVA 1LJ8A 1BW9B 2EGHA 2X5OA 4PIVA 2YV2A 4CM9A 1O8CA 2BGMA 5B4VA 4OO3A 1TEHA 4EUFA 3SEFA 2ZYAA 1LUAA 3F1LA 3Q2IA 4XYEA 1WAMA 3JQ7A 4IXTA 4R1NA 2PTGA 1PIWA 2ILTA 4IGFA 4CMEA 3ZV4A 4LGVA 3DOJA 1KC3A 4JLWA 4FFPA 1YWGO 4PRLA 2IE0A 3AI2A 2X23A 2B36A 2Q46A 2IYPA 4G81A 1A4UA 3AM5A 1AE1A 4CMHA 2C7VA 4BO8A 5U4QA 2GRAA 4A26A 3G17A 2RCYA 2Y1FA 3EUWA 2HRBA 3WQQA 1E7SA 2HJRA 4PZEA 2PFGA 4IJVA 3WTCA 2IZ1A 1VC2A 4K1LA 4PG5A 4YT5A 2Q1SA 1ISFA 2GN8A 4XWYA 3ZWYA 4FJ0A 3HDYA 5JC8A 4UVGA 1Q2XA 4GLOA 1YJ8A 2G76A 5G4KB 2O23A 1HRDA 2VNSA 1HE3A 4Z9FA 2X9GA 1DIRA 1ZMOA 3AY3A 4Z3DA 2Y93A 4FSHA 4CM7A 4PG4A 3SC4A 1JWBB 3FNHA 5TQVA 4PLPA 1E77A 3FR8A 2JHFA 1PJTA 3I23A 2UVDA 4E0BA 5EPOA 2DT5A 1KY5A 3KVOA 4N5MA 3KYDA 1KVSA 2NVUA 4GVLA 4ITUA 3ADOA 3BTVA 1UDCA 2EJWA 4ZHSA 1HSZA 2H1SA 2OBNA 1TLTA 4ZQEA 2P4HX 1YL7A 3AFMA 4ZGWA 1QLHA 1TB4A 2X0IA 5THKA 3GPIA 4H16A 1LSSA 4OKIA 4YB8A 4IS2A 3TQHA 3WICA 3OH8A 1E1NA 2NTJA 3RUCA 3IJPA 4IDAA 5IN5A 4RF5A 4UEOA 5BNFA 5HWSA 4ND3A 5IZ4A 1O0SA 1NAHA 1DLIA 3EY4A 1IUKA 1GD1O 3FNGA 3PHIA 3ONFA 3U0BA 5KWEA 5JY1A 4U6QA 2Q45A 3QQPA 3TJRA 3WGIA 1B14A 1PR9A 2RAFA 3FCOA 3H2SA 5TX7A 3DXFA 1C1DA 2GYYA 2VN8A 5GY7A 1VRWA 3OP4A 2JJYA 3PEFA 2RH4A 4TKMA 1O94A 1PU2A 2VOEA 5G0VA 2G5CA 3FNEA 1NVTA 3DHEA 1N1EA 2AQKA 1DC3A 1NHWA 4GI2A 4BNNA 1PL7A 4WEQA 1I36A 3WGHA 4XRGA 4BO1A 4Y9DA 1EFKA 1GAEO 4BNZA 1XDWA 3RC2A 4D3SA 1V8BA 2F1KA 1OFGA 4ZQBA 4Z0TA 1D1TA 1DAOA 4QX6A 5EERA 3RC9A 5BR7A 3WXBA 1M67A 1OC4A 3GDOA 3PWZA 4JN6B 1R0LA 4YJHA 4ALKA 5JAMA 4E2XA 4BKRA 2OBYA 1XA0A 1NASA 1DC6A 1PZGA 3BMQB 3GF4A 3WG9A 5G0SA 3I9OA 3LLSA 5B1YA 2O3QA 1WXDA 1E3SA 2DKNA 4GGOA 3G49A 2QW8A 3NGXA 3CXRA 3OFSA 1TT7A 2ZB4A 3CIFA 5IG2A 1NXQA 2WD7B 4N5LA 4M55A 1PL8A 4WOJA 4E5PA 5I7EA 3JQAA 4UVDA 2B83A 2A9FA 2ZK7A 4GWKA 3V2HA 1Y1PA 1BVRA 5CFZA 3RFXA 3RIHA 3D7LA 1WP4A 5A4DA 4IZIA 4N18A 4KWIA 4W82A 3DHYA 2DAPA 4HFJA 4PRKA 3ONEA 1N8KA 2HQ1A 5DF1A 1N92A 1VSUA 3GN2A 3ZCXA 4EYEA 4CJXA 4FB5A 3GZNA 3O4RA 3U4DA 4E30A 4YYZA 5DCWA 3E18A 3T7CA 4BO6A 4BV9A 4CR6A 9LDBA 2V7PA 8LDHA 4PVDA 4ALIA 4YAGA 5KJCA 1LDMA 1P77A 2BD0A 2EXXA 3ZU4A 1GADO 4GPD1 5U9CA 2FR8A 4XGIA 3GFGA 3UCEA 4ALLA 4CLRB 1I10A 2Q50A 4CODB 1ISHA 3VPGA 4JBIA 5DT9A 3E5RA 1AHIA 3OBBA 4DUPA 2OP0A 4IIUA 2X4GA 5ER9A 3E6AA 3KYCA 1ULSA 1W8DA 2CF6A 2GNAA 2W8ZA 1DFIA 2IRWA 2CFCA 4Y6PA 3S2GA 4II3A 2BRUA 3UF0A 2D5AA 2Q49A 2YV1A 3EC7A 5F1KA 1SNYA 4FS3A 3UOGA 5KVVA 1Z7EA 3GAFA 1BDMA 1B8UA 3WLFA 4ESOA 3NT4A 4F6CA 3ZWWA 5CEJA 4DVJA 4L4XA 1HDCA 3OHSX 4ZVVA 3PJFA 4J16A 3WGYA 4GGPA 1M75A 2DUUA 3HB4X 5COAA 5JLAA 2P4QA 5F1OA 3NTRA 4J91A 2XAAA 5TNXA 5G4KA 2D1YA 4E3ZA 1HLDA 4CMEC 5KOIA 2OL4A 2HMWA 1H5QA 5L40A 5DBFA 2UAGA 3HQ4O 3A06A 2I99A 3F6YA 3ZWAA 5T64A 3GVXA 4IXWA 1U8XX 3AY7A 4WOKA 3WYEA 3F5SA 3BTSA 4YAIA 4A10A 3SLGA 1NPTO 3KV3O 1P1HA 3BAZA 4D7AA 4NHEA 2HRZA 3PGJA 1NM5A 4NZ9A 2YDYA 2F00A 3INTA 3CMMA 5COBA 4A2CA 3BA1A 2QRKA 3LF2A 3PYLA 5L51A 3RC1A 2PGLA 1E7QA 3TOZA 3VPHA 2HK9A 4B7CA 5ICSA 4Q3EA 1U3WA 3PZRA 3LC1O 1L7EA 4KP7A 1VJ1A 2RIRA 3ON5A 1FDVA 4GMFA 1U4SA 3GAZA 1V35A 2ZYGA 4IS3A 4MPDA 5H81A 3RC7A 5L7TA 4XJTA 5G0UA 4W4TA 3DTYA 2QRLA 4E5YA 3L9WA 1JQBA 4Z9YA 4CQMB 2NU8A 2B5VA 2JCYA 5KCZA 5T5QA 1O6ZA 5EQDA 2C59A 3UUWA 1MG5A 4IDGA 5T57A 1O9BA 1DC4A 3PIDA 1U3VA 2IXBA 4NBTA 3PFFA 3C24A 1BTOA 1UXJA 3DO5A 4CMGA 5BNIA 2WEKA 1E6UA 1YQDA 2HU2A 3K9QO 3NDJA 3X2FA 2NU6A 3DZIA 4G2NA 2W98A 4FOOA 5KVCA 3CZRA 3H5NA 3L6EA 3LYLA 3C7CB 4LRSB 4MP6A 5TSDA 1V3UA 2OP1A 1C0KA 2J5RA 3LT2A 4ZU3A 2O50A 3W8FA 1H6AA 1GPDG 1ZKMA 2DPHA 4BO0A 1HE4A 2H5LA 1CEQA 4RPHA 2Y0DA 1DJQA 4JX8A 2I76A 3MTGA 3NRCA 2FN7A 1OMOA 1E3JA 2EGGA 3OICA 1QYDA 2AQ8A 1YRLA 1NPDA 1YOVA 4MKRA 5EL0A 1I3LA 1ENZA 3SXPA 1CYDA 1A72A 1YBMA 3GHYA 4AJIA 5H83A 2BKAA 3MJTA 4QEDA 1YBVA 5KVQA 1BW9A 5I7VA 1LSJA 4WKGA 1B16A 5IZCC 2C82A 3JQ8A 3K96A 1UR5A 4Z0PA 5CDGA 5IFLA 5IN4A 4MVJD 4XRRA 3G1UA 3A28A 3GDFA 1PJLA 2VZ0A 4I5FA 1J5PA 3OJEA 2CMDA 1AN9A 3JQGA 3C1OA 2P68A 2GERA 1P1RA 4CUZA 3WBFA 3SJ7A 4IINA 4H3VA 1DPGA 4OQYA 3FN4A 2QQ5A 3M1LA 2PH5A 1XU7A 1PEDA 3LQFA 4DMLA 4E12A 1NR7A 5FWNA 4AJ1A 3KSUA 1DIBA 4FGSA 4PG8A 3RBZA 1IHXA 1MP0A 4LISA 2C54A 4CM8B 4CMKA 5G0WA 4RO0A 2BFAA 4Z6KA 2LDXA 3QVOA 4ZICA 4DTIA 4Q39A 4OJNA 1HE5A 4ALMA 3DZFA 4BGUA 4IZHA 5A5EA 3VZSA 4RV9A 1O95A 3R1IA 4BQPA 1B0AA 3D4NA 3ZWMA 2WWRA 2ZTLA 3DC2A 3DEYX 3KSZO 1EK5A 4CMBA 8ADHA 1JVBA 1P1JA 1T2DA 1YKFA 2FRDA 3JQGB 4LSMA 4ID9A 4D44A 1UXIA 3FBTA 5JFOA 3GVPA 1HYGA 4M87A 1ZBQA 1Z45A 4RZIA 3ZNQA 2EW8A 3I1JA 1NAIA 3KETA 1H0KA 4OXNA 1W6UA 1QORA 1I32A 4J9UE 1ZSVA 5TT1A 4DBVO 1UAYA 3DBRB 4M89A 3VZQA 3OEWA 1K5HA 2ZB7A 3FWZA 1GCOA 3FBGA 1K6XA 5L3ZA 1T2FA 2NADA 3IDSA 4RVDA 3RKRA 4G65A 1IZ9A 1Q0HA 1IPFA 4GH5A 5TIIA 3WS7A 2ZB8A 5C3MA 1UXKA 5IDXA 5IDYA 3WDSA 4DIOA 3TZCA 3WFJA 4P8RA 3DOOA 1ADBA 5THQA 4J4HA 1P44A 1LTHR 4YTEA 1E3IA 1F8FA 5JMPA 2GD1O 1X0VA 3DMTC 4E21A 4RQTA 3DBHA 3U4IA 2G0TA 1Q7CA 3U9LA 3ZHZA 4YQZA 5AXDA 3O8QB 4E33A 4QSMA 4GWGA 3UW3A 1N9GB 2LDBA 4J4TA 1JDJA 1MFZA 1ZK4A 4OAQA 4YWJA 4XQCA 5JYDA 1GYPA 3FR7A 2QRJA 1OOEA 1KVRA 5CAEA 4YXFA 3DZGA 4I5EA 2VHWA 3K2EA 2VT2A 1QYVA 3I3OA 2CSUA 1H9BA 2X9NA 4U0JA 2D59A 4MP8A 1UDBA 1GEGA 3PFWO 4FFRA 4EW6A 2PK3A 3WMXA 2IODA 2AG8A 3D4OA 3IOYA 4ND2A 4BMSA 4BO9A 1DC5A 2RHCA 4AVYA 1RM3A 3QY9A 3MJEA 1XKQA 1DFHA 1NVMB 1QYXA 2Y0EA 1E6EA 1ADFA 1HDYA 3KEOA 2NQ8A 3TFQA 3F4LA 2VUTA 1I2BA 1C1XB 1R15A 3K6JA 2QIOA 5F21A 2YQ4A 2CNBA 4UVHA 1GYRA 3OA2A 3JD2A 3W4IA 4TRMA 1ZK2A 1ZH8A 3ITDA 4ALJA 4NBRA 3ZWBA 2HCTA 2PD6A 4FBGA 2J3KA 4AG3A 1JA9A 3VDQA 5A5FA 4RL6A 4S1VA 1I3NA 3QVWA 3KBOA 3FWNA 1SMKA 3Q1LA 3A1NA 2GZ1A 1QSGA 3G1TA 4RDHA 5I9NA 4JP2A 2GZ3A 2YHIA 1NP3A 4PCVA 5I7SA 2ZCVA 1U28A 3RQSA 1LSUA 2QZ9A 3FRJA 1C14A 4J1QA 2IZ0A 2IEBA 1I8TA 1GZ3A 4CLXA 5TT0A 5A02A 4RGBA 5J23A 1HLPA 3QHAA 3ROQA 1FK8A 2PKQO 3NX4A 1HZJA 1TVEA 3DBVO 4BNJA 4MKXA 3KXDA 4BNHA 4IDEA 4CQMA 2NTNA 5EINA 3M2TA 4JJFA 3GVIA 3MEQA 1ZIDA 4QFDA 1U7HA 4B7XA 3K2BA 1KEUA 4BMVA 2YQ5A 3T7EA 3E8XA 1U5AA 4KDEA 4LK3A 1ZSYA 3U09A 2YHIB 3RUAA 4DQXA 1JKFA 2YFQA 4DLBA 3I9LA 5LCXA 4MVJA 5CPFA 2X6TA 1DRVA 1I33A 3BIOA 4RJTA 5ITWA 2CVZA 1R4NB 2VCYA 1ZSNA 3PXXA 4AJEA 4CV0A 3AUTA 4BO3A 4CM3A 2BGKA 2P9EA 4YJHB 2I5PO 3WWYA 3QWBA 4J43A 2EJVA 3MWDB 4R16A 2C20A 4TZKA 2QYSA 3ZHYA 4AJNA 1QG6A 3RBVA 1ZK1A 5C7OO 2J3JA 3C1TA 3JYLA 3OEYA 3SX2A 4A73A 1YQGA 1NFRA 1ONOA 4CLRA 4MVJP 3VH3A 2C2YA 4K6FA 4FFMA 1ISGA 2FR0A 5A9TA 4CR7A 3B70A 3RWBA 2ZTVA 3I6IA 1JKJA 4F46A 3ANLA 1TI7A 4B3JA 1PJCA 2B37A 3H7AA 4B79A 4NI5A 1KETA 3JYNA 1B2LA 1LI4A 3IKTA 3EGOA 2P5YA 1WVGA 5DDIP 5HTOA 3FPLA 3QV1A 3FPCA 3EMKA 2X0RA 3N74A 5ICMA 3ZW8A 3ETDA 2W90A 1F06A 2VUSA 4Y8VA 4BO7A 1HDRA 1HL3A 4EDFA 3DB2A 2NSDA 4KWHA 3LSYA 4R51A 3GEMA 4J90A 4P38A 4TVOA 2NACA 4UULA 1B3RA 1BDBA 1H93A 1SCUA 2A94A 1VLLA 1ZZEA 3AFNA 4HKTA 4IJWA 4RLHA 5U1PA 2W2KA 4BNMA 3OJOA 5KIAA 1PGJA 1E7RA 4TVBA 2AE2A 5L45A 1ISJA 3WFIA 3JQBA 4DGSA 3HB5X 3LK7A 2GZ2A 1ZNQO 4K28A 1ZUD1 1MC4A 1A7KA 2AEFA 3HN7A 5K9ZA 3I5MA 4YVFA 4W7HA 4GX1A 2HMVA 4RF4A 1VL0A 1HETA 3IL2A 1C0PA 2NVBA 3WMWA 5BNTA 1WDLA 2AEJA 3CMCO 1P3DA 1FF9A 3GVCA 1IULA 1DHRA 3WJAA 3ZDFA 4YT8A 4W6ZA 3U4HA 3OJFA 4WCDA 1PJ2A 1E7WA 5JCJA 2PGJA 3MOGA 1PTJA 5GZ6A 1GL3A 2HMTA 3H9GA 1F17A 1U3UA 3TZHA 3ZHBA 5HA5A 1M66A 4M8SA 4I9NA 3LC2O 1M76A 1PS8A 1GEEA 2PZMA 2AHRA 5KJEA 4B3IA 2DVMA 1DIGA 2VZ8A 5COQA 1MV8A 1ZCJA 3OIGA 4OKNA 1BVUA 5EMHA 2C7GA 4KTVE 3INRA 4NFSA 2DPGA 3K30A 1GU7A 3WSWA 3RUHA 4UUNA 4OIMA 1I3KA 1E1KA 1LEHA 2VYND 4C7JA 1XSEA 1ZJZA 1DO8A 3TOXA 1ARZA 4GQAA 1XQ6A 2CUKA 3F5QA 3OMLA 4H7PA 3PQEA 1EVYA 2CY0A 4TSKA 1EMDA 2FR1A 4BNVA 5ILGA 1E6WA 3WGGA 2W4QA 4BNLA 1ZEMA 5AXBA 3D64A 3JD4A 3E9MA 3PYXA 4TKLA 1XYGA 1LDNA 1UZMA 2DC1A 3HHPA 1GQ2A 1LRJA 4FOSA 3BMCA 1WMAA 1N1GA 1PJ4A 1WNTA 2AEMA 5JDCA 4TRRA 1ZVMA 5A3VA 1I24A 4TRNA 1UP4A 1DB3A 4K6CA 5BSFA 1PQUA 2DU8A 3E1KA 1RYEA 4NFHA 3HN2A 2OFPA 1VJ0A 2AG5A 4BNTA 3NDRA 2NUAA 1Y9EA 1DAPA 4Y98A 1AGNA 5L4SA 4IM7A 1PX0A 5KJFA 4KMSA 3TZ6A 3IAHA 4GBJA 1FMCA 4NFYA 3QRWA 3U62A 1ZFNA 2Y0CA 4RQUA 1MGOA 1JAYA 2ZTUA 4L0QA 3Q11A 3WWZA 4E6PA 3DQPA 2B35A 2PWZA 1U2GA 2DTXA 2WTBA 3UFXA 3D0OA 2OMEA 2YHUA 1EUCA 1LQTA 2POQX 3F3SA 4GX2A 2DBVO 3W8DA 5C37A 1E3LA 5A3JA 4BOYA 4PLVA 4M86A 2UV8A 4DBZA 3H3JA 1X1EA 2IDZA 2ZKLA 3O03A 2BGLA 2VHYA 5BSHA 1BSVA 1K6JA 1ENPA 2DM6A 4NH4A 1V0JA 3K73O 1U9JA 2GSDA 2WM3A 4XGNA 3CEAA 2I6TA 2Y66A 1F14A 4FCCA 4IJKA 3OQ1A 4XZ3A 2X9VA 1ZJYA 1PR3A 3I4CA 5T8KA 1Y81A 1ULUA 1Z73A 2EV9A 5G4LA 1N2SA 2NV6A 1RM0A 2Z5LA 5CG2A 3G79A 1BXZA 2AMFA 5EN4A 2I65A 4E2WA 1Z75A 1OAAA 4BL5A 2DFVA 2O3TA 4LW8A 4NBUA 1MX3A 1W4ZA 1H6CA 3DHNA 1JWAB 3MJ4A 4NNJA 3ZZNA 5K6AC 3DBRA 3S2FA 4XD2A 4R5MA 2E48A 2HLPA 1R12A 4AJ4A 5CDTA 3TZQA 1A9YA 1J4AA 2FZWA 1HSOA 2J5QA 4CQMD 1M2WA 4E4YA 4R68A 1HDOA 2JD1A 3CTMA 4U5QA 3TL2A 4KTTE 4PLWA 2QG4A 4MO2A 4JK3A 4XA8A 1T1SA 2O4UX 4F6LA 3KUXA 1IYZA 1PGNA 1V6AA 2AXQA 3FD8A 3RJ9A 3WGZA 3IKVA 3SVTA 2PR2A 5JCJD 2NU9A 3GMDA 3NAQA 4ONEA 2WE8A 4Q3NA 2Y68A 3AJRA 3O9ZA 4M49A 1PSDA 4NDNE 1Q7GA 3OSUA 4PZCA 1LDYA 3HADA 2AQIA 3EVTA 1D7OA 2GR9A 1T26A 4IDDA 1NX6A 4O63O 1FDTA 2OHXA 4FFLA 1MG0A 3CKYA 2TMDA 2X5JO 3GMSA 1X14A 4CMJA 4GVXA 1Y8RA 4CQLB 1GV1A 4R3NA 4C4OA 3WQSB 1IY8A 4KUGA 3PGXA 2PD4A 1U4OA 1X7HA 2Y1DA 3A4VA 2PZJA 3HSKA 3UN1A 3GGGA 5HRUA 4YJGB 3GZ4A 3NTQA 1R0KA 5JXWA 4OOFA 4MVJF 5B37A 4AFNA 1H2BA 2VHZA 3DBLB 3DWFA 4MVJI 1KY4A 1U1IA 3GT0A 4XDZA 2AE1A 4RPGA 4EEXA 1CERA 2XXBA 5C7IO 4MOWA 3DONA 1YDWA 3WGTA 3P19A 3PQFA 3HWRA 1YB1A 1O89A 1VPDA 3C1AA 3ABIA 4O1MA 2ZQYA 1W0CA 1BXKA 4JCOA 6ADHA 2FZEA 4QFCA 4I8XA 3A14A 4R4JA 2O2SA 3AUAA 3ENNA 4N7RA 2VNAA 4YJDA 2Q4BA 4J6FA 2EHDA 2Q2VA 5BT9A 1NR1A 2D4AA 4XQEA 1WZIA 3K92A 4JJIA 1P1KA 3GY0A 3JYOA 1DOHA 3OJ0A 4E13A 4FR5A 4BGVA 4CQLA 1GPJA 5TF4A 1LA2A 2CZCA 2NM0A 2Q4EA 4EJMA 3QLJA 4IY1A 3PJDA 1P31A 3RFVA 4PG6A 5L7YA 2H9IA 5B12A 4INAA 1P45A 1Y8QA 2X8LA 5AYVA 1LDEA 5I8ZA 1GCUA 5TGDA 4NK4A 4GMGA 3U3XA 3H6KA 2B4TO 4MKZA 4QO8A 1VM6A 3M1AA 2P9GA 3C8MA 2CF5A 4E5MA 3VH2A 1QLJA 3VVBA 2C29D 1EDOA 3AOEA 3I9MA 3DR3A 2BI7A 1EBFA 1LXCA 4RCVA 3V1YA 1T25A 3ULKA 3I83A 3AUSA 5FYDA 3QJ5A 3GK3A 5JPIA 1MLDA 4WGGA 1JN0A 1CQIA 3FSRA 4R01A 4HNGA 1ZXBA 4XR9A 4BNWA 1FDUA 4XYGA 1GZ4A 1TT5B 3H9QA 4YR9A 2GF2A 2ZYDA 1CF2O 1BMDA 3GEGA 4LSWA 2YY7A 3PVZA 1C1DB 3IP3A 4OYRA 3WX0A 3N58A 2GASA 3NJ8A 3HNPA 1KVQA 5I9MA 3QWFA 2PKQP 4KQXA 3P7MA 4BNGA 1MFPA 1QV6A 2ET6A 2DTDA 2UDPA 2WDZA 4QTZA 2Z95A 3E5MA 3FF4A 2E6UX 4O6VA 4BKOA 3ZWOA 1A9ZA 3PQDA 1A71A 4Q3DA 2JAHA 3JQBC 1J6UA 5EQFA 3TSCA 2FY8A 4J1NA 1PS0A 4R9SA 1HF3A 1VKNA 1WDMA 1K89A 2Q1UA 1KEWA 1EK6A 1UZLA 3ZWPA 1OZAA 4HFRA 5CP8A 1D3AA 1NNUA 4DC1A 4RDIA 3C7AA 1JVSA 1T2CA 4CL3A 2JHGA 5JDCC 1XHLA 2E49A 4ND4A 3GGPA 1J0XO 1XU9A 1C0LA 4XR4A 1GDHA 1GUZA 2Q2QA 4BB5A 4CM5A 3ICCA 1NTOA 4PG7A 5JS6A 3ZU2A 3SLKA 3RUEA 4RORA 3RVDA 4HBGA 2OZPA 3GNSA 4UVEA 5MDHA 3B1JA 1U2DA 4H15A 3Q3CA 1HDZA 3D3WA 5A9RA 1E5QA 1YE3A 3GN1A 4EUEA 1B3BA 4BKQA 2JFFA 1T2AA 4CMIB 4WCFC 4JBHA 5F1PA 1DHTA 1HE2A 1LRLA 3EVNA 3JQ9C 3SC6A 3GG9A 2EP5A 3Q9UA 4DLLA 1G0OA 3D5TA 1PS9A 4FW8A 4MIEA 3QW2A 3ZGYA 1XIVA 3PRJA 3DMYA 5I9LA 2JD0A 2A4KA 3TDKA 1JAXA 4KUHA 4J4BA 4WJZA 3UXYA 3CH6A 4PLCA 3JCZA 2PNFA 1JTVA 3D3EA 1X13A 5IDWA 3PDJA 4BNUA 1BXGA 2GPTA 5JSFA 4LVUA 1N5DA 1DIAA 2OO5A 2O3JA 4HFNA 3HDHA 2YV3A 1Q0LA 4AJHA 1FXSA 1NQAO 2IYOA 3WBBA 2FSSA 4NG5A 4XIJA 1IHYA 3B1KA 2PGDA 5K0ZA 3WYCA 4J7UA 3VPFA 4YCAA 3BMCB 3VZRA 5L4LA 1UP7A 1MA0A 4W99A 3S1LA 2B4QA 3MJCA 3EDMA 4IPTA 3ROMA 1NWCA 1QKIA 1JLLA 4IDBA 4LN1A 2HK7A 3KO8A 4R41A 4EUHA 5JMWA 3P2YA 4IGEA 3F9IA 2B0JA 4QECA 1ZXLA 3IMFA 1PJBA 2NQTA 2VWQA 3F47A 1GYQA 5JE8A 3NUGA 4R3WA 2OOSA 3K31A 4NJOA 1CJCA 4B4WA 1GFSA 2AA3A 2GLXA 2AQHA 1PZHA 3AW9A 5CG1A 1BWSA 5DNAA 1UXGA 1LC3A 3HUDA 4J2OA 3T4EA 4CV2A 1PGQA 3KRTA 4HWKA 5JC1A 3WQRA 3B1FA 1B26A 1LU9A 1KS9A 2I67A 3P5SA 3VAZA 3E48A 2P2SA 5L95A 3EZLA 3BHMA 4CM4B 1WLYA 3VDRA 3JQ6A 2H63A 3WIDA 5CEEA 2BELA 3BHJA 1CWUA 3OIFA 3RFTA 4BNXA 2VWPA 3ZWCA 2Y67A 2IXAA 2C5AA 5TJ9A 4BNKA 3EHEA 1CIVA 2PA3A 3UVEA 3QVXA 5ER6A 5KNLA 1DDOA 1DXYA 1RWBA 1P9LA 3QWAA 2Q1TA 1Q1NA 4HADA 4BQRA 1BRMA 1ZW1A 1MXHA 3LU1A 4Z0HO 3RUDA 5TRTA 5H82A 3CUKA 4CMCA 2EKPA 4W9NA 1SAYA 1NFFA 5TJHA 2JD2A 2NU7A 4GKBA 4PVCA 1Q7BA 2FOIA 1SB8A 4U0KA 3GC6A 4U8GA 1YXMA 4L75A 3MOIA 4UUMA 1O5IA 1JU9A 2PKRA 3PWSA 4W7IA 4TWRA 1SBYA 3L4BC 4DC0A 1QP8A 1H6DA 2J6IA 3MJVA 2FSVA 5A05A 3WSVA 1BG6A 2O7SA 1JKIA 3S8MA 4FIZA 2VWHA 5DBGA 5JY6A 4NK5A 4YEDA 3S2EA 4NIMA 1W73A 3VOSA 1UAGA 2Q99A 4BIIA 1X15A 1E92A 1K3TA 4DIFA 3VH1A 4FC7A 4WPGA 5L4NA 4E5NA 1WPQA 4L73A 2HK8A 2HMSA 5DBIA 3NT2A 1LC0A 2VQ3A 4YJFA 1WWKA 4S3MA 3Q6IA 5AXCA 1T24A 2RBEA 1LRKA 4IQGA 2X0JA 4WLEA 4IBOA 4PLFA 4CL8A 4JQCA 9LDTA 3H9EO 4B4OA 1L7DA 3G3EA 1Y8RB 2GGSA 3GZNB 5GZ3A 3JV7A 4GSLA 3GVHA 4XGKA 3H9UA 3PPIA 4WNCA 4CM9D 1CQJA 1IB6A 2VYVD 3STHA 4CPDA 1EEHA 4XKJA 5DP1A 2PY6A 3IIEA 3QIVA 3FTPA 3M2PA 3OJLA 1GV0A 3ROKA 1KC1A 3BTOA 3JQCA 4LVCA 4OL9A 4Q3CA 4TZTA 4WK6A 4NBVA 2OUIA 4KZPA 4DIBA 1DJNA 1I2ZA 1BHSA 3L4SO 4D41A 3HDQA 2EERA 5B4TA 1C3VA 4F45A 4R5HA 4Z3KA 2ZATA 3RU7A 5C5IA 4YJFB 5FEUA 3L6DA 2JAPA 4PLHA 4LCJA 1KERA 2X1HA 3CSDA 4U7WA 3ASVA 4XDYA 5ENDA 2YYYA 2ZIZA 3PJEA 2JKVA 4HP8A 4YAEA 4D79A 2Y05A 5AVOA 4I1IA 4DQVA 2JCXA 3NJ4A 3BMQA 4JBGA 1PGPA 3H8VA 5DOZA 2B69A 5F5LA 1H94A 1Z6ZA 1R37A 2X0NA 3OA0A 3EZYA 2UYYA 3LT4A 4JP3A 1HYHA 1QXSA 3ZH2A 4BO5A 5CHEA 3OETA 3DOCA 4RPLA 5CEFA 1S6YA 3KHUA 1LLQA 1DEHA 1R4MB 2FPGA 4WLVA 3FHLA 1B7GO 2P91A 2PZLA 4FFNA 4I9HA 3G0OA 1YGYA 3H9JA 4NJMB 2NTVA 3Q9NA 4RVGA 3JTMA 3PLNA 2XOXA 3LC7O 3QVTA 3KLMX 3OF2A 1HXHA 3LT0A 3LDHA 1I30A 3E03A 1SPXA 3K8ZA 3TF5A 1EVJA 3OQ6A 2IEDA 4OHUA 1ONPA 4FPXA 1N9GA 2WYUA 4MVJE 1UH5A 3RCBA 1KIFA 3AM4A 5F3RA 3AM3A 4DRYA 1EQ2A 1ID1A 3PP8A 3DBHB 1Y8QB 4O0LA 4PLGA 1EVIA 1RYDA 3WB9A 3DDNA 1ZO8A 1VL8A 1E3EA 4NQZA 4M54A 1HYEA 3AY6A 4A03A 4ZQHA 2PD3A 4CM4A 1LDBA 5JCXA 1UXHA 4EBFA 5A9SB 1DLJA 3U49A 3DAFA 3JQEA 7MDHA 4K9DA 4HV4A 3H65A 4NMHA 3WYBA 1I01A 4YRAA 2CVOA 1PJ3A 3KEQA 4HUJA 2J8ZA 3R6DA 1ZEJA 4PN3A 3RBXA 1B8PA 4CM1A 4MIOA 3TPCA 4MINA 1P0FA 4TQGA 1F0YA 3WOHA 4URFA 4ZQGA 5LDGA 1DRWA 3U5TA 3EYWA 3DFUA 2WMDA 1X0XA 2UUOA 5IXYA 5IXSA 2G82A 3P2OA 4IMPA 3W4JA 1RPNA 5JAQA 1XQ1A 1Z82A 1DIHA 3NTOA 1MC5A 5IZCA 5JAIA 1QRRA 3GRKA 5HBRA 1TXGA 1SEPA 3TWOA 2ZJ1A 4D3DA 2QYTA 3IS3A 2Z1NA 4YT2A 3SJUA 1VE9A 1ADCA 3VHRA 4J7CA 1K0UA 3CPSA 4UEKA 3BHIA 3KZVA 5ILOA 1RM5A 3V1UA 1LBEA 4YQYA 1KOLA 4WNIA 1EQUA 4BGIA 5JAZA 3ETGA 3PYMA 1SB9A 1YOVB 3O8QA 1PQPA 1PJSA 2YZ7A 3GR6A 4PLYA 4PZDA 4CMIA 1E5LA 2R6JA 3NYWA 1Z7BA 1HKUA 3R3JA 4CR8A 1U5CA 3ORFA 3GDGA 4CMAA 2Y1GA 2J3IA 1UUFA 3PTZA 3DMTA 4IJUA 5DCUA 3V2UA 4DLAA 2EW2A 1BXGB 2VT3A 1EZ4A 4QXMA 3HFGA 4AJOA 3MWEB 2O3RA 4U6SA 4B3HA 4TMFA 1E1LA 1N7HA 2I9PA 3DAPA 3UH1A 3KB6A 4CM8A 1YDEA 3JYPA 1U8FO 1EVZA 3QP9A 1DSSG 1WMBA 4IMRA 4B8ZA 5JDIC 1LNQA 2BHLA 3PZBA 3NV9A 3VTFA 1LLCA 3W1VA 3PIIA 4AJ2A 1D8AA 5GZ1A 1X1TA 3IUSA 1R4NA 3AU8A 1OBFO 3QVSA 4C7KA 1LSOA 5HS6A 1DFGA 1YS4A 3GA0A 3WLEA 4BKUA 1AXGA 4YJGA 5AXAA 2V6MA 1DBVO 4NPCA 3CE6A 4E32A 3UGKA 4FDAA 5T67A 3IP1A 4PLTA 4MVJM 4XQ9A 3SBOA 3LF1A 3AUUA 4CLHA 3A9WA 3QWIA 3JD0A 4CUJA 4D42A 3QE3A 2DFDA 4XYBA 1XR3A 2EKQA 3UCFA 1ENYA 2FHSA 3BMNB 4ZN6A 1VL6A 3ADPA 3GNQA 3VZPA 4J3FA 1EE9A 3UAGA 2O4CA 3H5AA 2NVWA 4ND1A 3AWDA 1K2WA 4Q9NA 2G1UA 4AICA 3JQDA 1ZMTA 2EF1A 3V2GA 4TRJA 3MTJA 5A03A 3W8EA 4I08A 1V3VA 3I52A 2GDZA 2R00A 3ANNA 3WGOA 4YACA 2I66A 1E3WB 1G0NA 4PGFA 1I2CA 2DUWA 2VOJA 5MGBA 5KTKA 3L9XA 1E1MA 2Y1CA 4KDFA 4J0EA 1I5RA 3H3FA 2BF7A 4RVUA 1FDSA 3JQ8B 1OI7A 3O38A 1UP6A 3JYQA 1SOWA 3N7UA 2E4AA 4WASA 1Y9AA 4OM8A 4BKPA 5A1TA 3FNFA 4DXHA 3TNLA 2CD9A 3BYZA 4BS9A 4GSKA 1YVEI 2DBRA 3FTNA 1RM4A 3ZW9A 4E31A 1IPEA 1YQXA 2EP7A 4B4VA 2VYVA 2HSDA 4FD3A 3KYCB 1EUZA 1IOLA 2O3SA 5CDYA 2Y1EA 4YT4A
chains in the Genus database with same CATH superfamily
2QMUA 5EUMA 4EW1A 5B4UA 3P2JA 4IR7A 2QV7A 3IUJA 4LJ7A 4MYDA 4BO4A 3VBEA 2D8AA 3OUTA 4X54A 2OGUA 4J2TA 2GYUA 3NPAA 1PBNA 2P4EA 5DSTA 3F2IA 3ZWQA 4EW6A 3EGXB 2FSGA 1NQ5A 3ROPA 5F23A 2KI5A 2D3TA 1NJ1A 3SR0A 3BDIA 2QM0A 2YXLA 2R00C 3GRYA 2J33A 3ABZA 3VTAA 4OQXA 1V5EA 3V1TC 2GXSA 4EATA 3AB3A 3DDUA 1OAOA 3ODGA 1MIHA 3GLHA 2PS9A 4YA6A 3T6KA 1X7WA 3UJNA 1MDBA 4IZ6A 1CU1A 1M34B 2FPUA 2QN1A 2VHJA 3K1ZA 1NZFA 2HA7A 5DN9A 5K3BA 4BFXA 1D4FA 2VWGA 1C4XA 2CDAA 3VJRA 1DBIA 1XN1A 3QMMA 4EECA 5AVVA 2YVQA 2OILA 2V0CA 1UMDA 1K8XB 1T8PA 1V5IA 4MV8A 2VUUA 4RDXA 1UOPA 5TC4A 3O4IA 4KQ2A 1A3CA 3OWHA 3UK6A 1I4TD 2BFCB 1P17A 4HXGA 4Y1EA 3HZZA 3P9IA 1E60A 4QQRA 4IICA 2XGGA 3AK4A 3OOYA 3UUFA 3KIPA 1USIA 5F7JA 2CUZA 3AU9A 4G9EA 2B4AA 1HQKA 4KVZA 3KZCA 1HTBA 1EWQA 5C7LO 5JYBA 3NVDA 1TM3E 3R7FA 5M7EA 4GMXA 5C5DA 2NMVA 2VZEA 5MN5A 2H00A 2O8BB 5F64A 3INGA 3IDOA 3P27A 4EJ6A 1A7AA 1KEVA 1ULBA 1P4GA 9ATCA 3O82A 2OXIA 3GLIB 4AWBA 2ZGVA 1XZCA 2Z1MA 4WOBA 3SR4A 3W1EA 4DMHA 1DKLA 5A2QA 1Z6GA 2B4YA 1TVMA 3C85A 4IFIA 4KR0A 5KYKA 1TA9A 2PPVA 3DYIA 4O3MA 2I3AA 3EXEA 3HKDB 5D3ZA 3WLLA 1QFSA 3IAS6 1CS0A 4G2TA 1UM9A 3P45A 1OU4A 3NZEA 1WBDA 1W75A 2ID7A 3NTUA 1VKJA 4NU6A 1KVTA 4K9OA 3HB7A 4LMRA 2IEYA 3PNYA 4POOA 1N5IA 2ZIUB 4PFJA 3THYB 1YHNA 2G1PA 4CKWA 5LZ9A 4LQLA 1RKVA 4ROSA 3AI1A 1MQ9A 1OLOA 4KRXA 1I6WA 2P8JA 4MS4A 3HYTA 5CLGA 3UJAA 1VPEA 2PLRA 4D0RA 2NXJA 3Q3EA 4EY6A 5JEEA 5KOJA 4CU2A 3K35A 3CXUA 4L4YA 3WHPA 1TCVA 4DIKA 4JT8A 3AGPA 1IY1A 1IZ7A 4WY2A 3O84A 3DQZA 1JUDA 3WWDA 3PDUA 3U7HB 2XXAA 1DKRA 1NVAA 2DLDA 2LIVA 1FP7A 3EZXA 4PC6A 4B32A 4LHXA 2QVLA 4CLOB 2QPAA 4DCGA 3HXOA 5KNBH 3EIHA 3WB0A 4OHRA 4RPJA 3THOA 4FN4A 4CIXA 4P0TA 4Q6BA 2GLUA 4MUFA 3UA3A 1E4EA 3VR5H 3EX7C 2JH9A 2HX1A 2B7CA 2RARA 1PHPA 1ISIA 1SUDA 2X2FA 3ABRB 1XWIA 4J0KA 1TRKA 3SOZA 4B85A 4YUWA 5A7FA 1KP3A 3CV3A 2F8LA 2BDEA 4TUYA 1XKLA 3QA9A 2HAEA 3K0BA 3KHKA 1UBHS 1L4GA 3TRDA 4U2KA 3JARB 1EFRD 3SFZA 2O3UA 3NTLA 3K0CC 2VHCA 3N53A 4CIYA 1KOJA 1T1RA 3GRZA 5FJIA 1FDOA 5JUWA 4ZAYA 4WCFB 3WLRA 4GKKB 1G60A 3BZUA 4OXXA 3W5JA 3SD7A 3VNUA 4LWZA 5CW2A 5AR1A 3JASA 4H6VA 1ZH0A 1PAUA 4LYDA 1F2TA 1I1OA 1YD7A 2NNLD 4PR0A 1XLUA 1CF9A 3LG2A 3EGWA 1XZEA 5IJZA 1DCTA 4Z1MD 2EG5A 1R88A 721PA 1KI2A 2AVNA 2IA5A 3W6ZA 3ZWXA 4PHGA 4R9RA 2IZZA 2DHEA 4MCAA 4OXYA 4ENSA 5HS4A 2P75A 2VSQA 5K6AA 3GJTA 1JFRA 3OM9A 1YL5A 5TPZD 5C7YA 1ZR4A 1E66A 1MAAA 1L8OA 1AKTA 3C3BA 1EE2A 2O7RA 3NDIA 1C9KA 1RBYA 1Z17A 3QBVA 4G85A 4P4SA 2FSUA 2V7QD 4BB6A 4IHAA 3DAGA 1J5XA 2MINA 2XHZA 4FQ8A 2GETA 4X9XA 4FWTA 3V7NA 4P3PA 2YHSA 1I5EA 1YONA 2FWMX 3NC0C 1UZNA 4EY7A 4JWTA 3E7XA 3NS7A 3K1TA 3ZDQA 1QRUA 4G0QA 4QPJC 1SUIA 3N39C 3DDOA 3GLQA 2DFNA 4K6KA 1P7WA 1EM6A 4LDPA 3MD0A 4RVNA 4RSGA 4I6GA 3OC0A 2ZRBA 3DL4A 1IN1A 5JIBA 2Q3EA 1KKMA 1V96A 3H7IA 1N6RA 4NBSA 4DL9A 1X1RA 2BEWA 4OLHA 4EG5A 2VAVA 2Q5JA 3L92A 2XNDA 4WUVA 1Y4SA 1Y5MA 3H6HA 3M9XA 5IKMA 5ALIA 4I5IA 1I1QB 2I0FA 4FXPA 1VI2A 1Z74A 4GUAA 3H5TA 3PICA 3CM0A 2O48X 3KR2A 1XQVA 2C5HA 3OZWA 4GX0A 4KIGA 4ND5A 1EFLA 2QDKA 1N2JA 3OFNA 1ZESA 1U7ZA 2A0YA 1V16B 4PXSA 4WSOA 4F4FA 5DEIA 3TFWA 5IC6A 1PW7A 4LNUB 4PC2A 1WP9A 5JS2A 1G7CA 1TOAA 3HVUA 2QT0A 3VKVA 4WLFA 5K8CA 3FXAA 4O2RA 2XI4A 2Q27A 4FDUA 3RASA 1KJ8A 3SEZA 1DKOA 1XCBA 3IIJA 4HDKA 4A1OA 4BQIA 2RGEA 4XSVA 1HT2E 3IO5A 4F7WA 3B1ZA 1GUFA 1CZKA 3GFQA 3I2YX 1Z0DA 3DS8A 2H2HA 2M6RA 3RIYA 5HFNA 2CNLA 2VTVA 1AGYA 2Q3LA 1ONNA 2WHPA 2P3QA 4B3MB 1CZUA 1KEPA 1J8FA 3UWMA 2YYZA 1NT4A 2HIGA 2G5GX 4L9RA 4OH1A 3ILYA 4N4AA 4RD1A 4DJ5X 5G1NA 1AHHA 2ADOA 3O4FA 4XIYA 1Y4DE 1IJKA 1QBGA 1YVRA 2AUMA 1KDVA 2WW8A 3R3UA 2IF0A 3UJ7A 3W5BA 1P9OA 2ZBFA 4V0OA 5LN1A 3ZPXA 4BAUA 1MIOB 3WMEA 4LXYA 5C8VA 2GN6A 3CR7A 2FDCA 4CKZA 3H05A 4AJPA 3QTTA 3IUYA 3O8LA 5EESA 2W83A 4AT1A 4LE0A 2I4IA 4QUKA 2FCRA 1Z7GA 3ZBQA 3AQ4A 4YV2A 4QQ8A 1GGEA 3LZ6A 4IQ0A 4L6AA 4XQGA 4YDSA 5TS3A 3HRHA 2FZCA 4DPKA 1ENOA 5JTUA 3ZXXA 2JJ1A 1X1QA 2XTJA 3EWNA 3MBKA 3RTCA 4EKEA 5GIOE 2J59A 3ETEA 1UFVA 2C5EA 1YE5A 3MBOA 4D81A 2II6A 3G13A 3C4VA 1KZGB 3FE2A 4J1SA 4L4SA 1IIBA 1E59A 3ISJA 1NT2A 4QA9A 3QOXA 3MRTA 1SKQA 1YI0A 1U8YA 1GTJ1 1D0SA 2ERCA 3FB4A 3ORYA 5DNEA 3RTAA 3GFBA 4AMUA 4WZBA 4BZQA 1QG0A 1FJHA 2CDCA 2GNPA 3GPDG 3PI7A 2CBXA 2HPVA 3AR8A 1QVZA 3CJRA 1PN3A 2QHXA 1VHWA 3C0KA 3R3XA 2FN8A 3R0ZA 3G1WA 3VPSA 4FE3A 4MI6A 3ONWA 1C1XA 3N0XA 4KGDA 2QZ4A 4ALNA 4BMNA 5L3SA 4M6WB 4OQZA 2I4LA 2CHUA 2QPOA 4JXKA 3ONDA 3ITEA 3TX6A 3HNRA 3KOOA 2REQB 4L4RA 1JR3D 3RVBA 3KYIB 1VG0B 3VKWA 2OFWA 2CWWA 4F2WA 3NAMA 4BB9A 5E0KB 4RZSA 1YBAA 1MAVA 3S2IA 1Y9DA 4B84A 1RE1A 3VAAA 4D9GA 4PX9A 1JQKA 4YRDA 1N4DA 3UQZA 3U5ZB 5KWJA 2HDWA 2Q3JA 3LLVA 4MR8B 3VYSB 1U2EA 3ZY3A 4M1QA 4O3FA 4D45A 3QKWA 3GOHA 1KTVA 4QUJA 5EMMA 4MV5A 1UKBA 5T4BA 1ELOA 2PBLA 3BM5A 4UNSA 2VRCA 3KM0A 3A6PC 1XWFA 1N0VC 3L0IB 3MG9A 5D6OA 4I1RA 3STYA 1N0HA 4HPWA 1UDAA 1V9LA 3L7DA 1W36C 2NWQA 1Y7PA 1SC6A 3AC0A 3SC2A 4E2ZA 5FPKA 4P22A 1MOSA 5L3SB 1EUYA 1AZWA 1HE1C 5JZMA 1SZCA 1QC5B 2HA6A 1WF3A 1A27A 3HLTA 3IEIA 4JB3A 2VBFA 4QC2A 3T4XA 3HXPA 5ICGA 2Y92A 3PUVA 4B6PA 4H59A 1D2AA 3UWOA 4F2PA 3OWXA 3D7RA 2CXQA 4RC9A 3DE0X 1PFQA 2V9CA 5DP2A 5CU7A 3R76A 2G9UA 5EJ2A 5E8JA 4HHEA 1LW7A 4DMCA 4CM6A 1HDGO 1KPIA 2QUHA 3F78A 4LY3A 3T0IA 4BDTA 821PA 2IXFA 1WXEA 3TB6A 3D43A 1M74A 4ON9A 1CUUA 2NXNA 2XKAA 4LMPA 1LV7A 1H5NA 3A27A 2GFIA 1R66A 2NO1A 4QUDA 5IAGA 3RYCB 4L8VA 2W48A 3A4YA 3HJBA 4QQNA 2VTEA 1NF3A 3V2IA 3HK2A 5E1DA 1EB8A 4BVAA 1IAQA 3HJAA 1I51A 1O96B 2PUTA 4M0FA 3GG2A 3DVLA 2P78A 3PRKE 4KHZA 5ALSA 4I5GA 3T9CA 3VNAA 3PHGA 5B2FA 4L5CA 3OX4A 5KSOA 3E82A 3EQ9A 3ZHTA 2WICA 4GGMX 3RTGA 1XGKA 5AKEA 3M6UA 2A9JA 2Z4SA 4ENRA 4MDEA 3ER9A 3FGPA 2P6MA 3COSA 3MJHA 4BUCA 4CUKA 5JZVA 4YCLA 1UK7A 2BDTA 3EWIA 4H1HA 4Q05A 5DJ5A 5ADHA 4TZ6A 3TTTA 1ZWKA 3HFJA 1NP6A 3D2BA 1XAJA 1NRXA 4ZVOA 4HAZA 3DTTA 4GM4A 3IURA 2WSSA 2IBTA 1OH5A 3ENQA 3EPPA 2CXXA 4I1PA 3LGXA 4M38A 3VSBA 3GFPA 1EZZA 1UMDB 1KI6A 1YRAA 2LCFA 2NUTB 4N6NA 2GBIA 5GM2A 1FYEA 1UEJA 3CZMA 3RUFA 5CYGA 5FUQA 3J81k 2ZREA 5JW6A 3UB4A 3REFA 4YMHA 1DEXA 3EBPA 2R8RA 3K8OE 5E1MA 1XMVA 3K4QA 2XF8A 1U7TA 3COZA 3C14C 4HX9A 1Q1EA 1JHAA 1IRXA 1R6XA 1R4ZA 3AOGA 1FW8A 3M7IA 4KQMA 5EIHA 1NBOA 3LJKA 1V16A 4MB0A 5FULA 4ZYTA 1B23P 4ZYXA 3LT1A 1GNSA 2BFOA 4POAA 4CQJA 4ZCMA 2FPIB 2W6OA 2ARKA 2OYSA 4ZA2A 2OGZA 1RZ3A 4NU5A 3VPAA 3GUYA 2Z2KA 5ALGA 1PZFA 2D2IA 3B7WA 4EJSB 4P54A 4F7DA 1FL9A 1U0JA 2JVJA 2XF2A 3HUUA 4B83A 4DMMA 2HRCA 1I4LD 3LVRE 3OUZA 3V8BA 4COOA 2KLHA 1YSCA 1ZGAA 2FP4B 3D3NA 1GY8A 4HRYA 4QEKA 4G5GA 3VJLA 2RGGA 2X58A 1S7CA 3OX2A 3AF3A 3IELA 4L6CA 5DHFA 5DV9A 5AT1A 3WGQA 4AMBA 1ZMXA 1FNDA 4RAOA 4MWTA 5CTJA 4XWOA 1D1SA 1CETA 4XVCA 1QHHB 1VJCA 3DBLA 3KLPX 3SKXA 3PITA 3RIGA 4P7JA 4PGHA 4Q21A 4IUYA 3SM9A 3N5KA 1AUXA 4A4DA 4TTQA 1JIUA 4JXJA 4OBXA 1NGSA 3H9CA 3GDWA 2Q2OA 2C2ZA 4MKFA 5L7WA 1YTUA 1YOBA 2D0IA 1PLJA 2AW5A 3DT9A 1QMPA 4ZVUA 4AWAA 3THXA 1KIAA 1WHTA 2Q9AA 4AIIA 2Y1WA 3I61A 4YI3A 2RD2A 3ERCA 1AMOA 3K05A 3IT1A 4H0FA 3KSDO 4X45A 3WY9A 3U56A 2NZXA 1K3FA 2R7NA 2B9VA 3WNVA 4C07A 5A4IS 3MT9A 4GXRA 1QMGA 4PANA 2GN4A 1AS3A 2OTCA 3T3EA 4MZXA 3ZJ4A 4GHWA 4EJ0A 4TXJA 4DBLC 1AF4A 1W2GA 2WYWA 3ICPA 4CTNA 5FOXA 3DEFA 4MYSA 1M0TA 2EWMA 2H1RA 2YXDA 4G8DA 4A8PA 4YRGA 3PHHA 5LOVB 3RK4A 4HUQA 4QPNA 5A2GA 2JRLA 3KQYA 4FDVA 2ZJ0A 4OB6A 1HFEL 1ZMRA 2XBMA 3QLVC 2G8NA 3O92A 3QG5A 3ZNPA 2ZSHA 4KVGA 4WCFA 2BMAA 4GPBA 2PSHA 5KEIA 2EWWA 4A5OA 4Z9AA 2IZ5A 3TNJA 3HDJA 4N1AA 3A3YA 4WHMA 1PEKE 2O7QA 2GNOA 3NEJA 3THSA 4DIUA 1N3IA 1S2NA 4OGWA 4PIPA 2J3LA 2ZRJA 2C2WA 2O2YA 5ADWA 4ZAFA 1YVUA 1KJZA 4G5HA 1DMSA 4ZC8A 4C0KA 3OE5A 4ZQFA 2FGKA 2VAXA 4OQFA 2BUBA 2HREA 5JV5A 1Y8CA 2CMHA 5H3LA 2Z83A 1XQYA 4MUBA 3V1LA 4E4RA 4F84A 1BW9B 2X5OA 2RK4A 4PIVA 3QY0A 1JSRA 3GUHA 4JUDX 1J0BA 4GE0A 2ORIA 2IYEA 1QDEA 4OO3A 1EDEA 3R5HA 5ANRB 5KAPA 3GA5A 5B4VA 5CDHA 2A5LA 5CIWA 1V45E 4ZVNA 5LIPA 2ZVJA 4KBYA 4XYEA 3BK1A 5ENZA 1G98A 2QJWA 1Z2OX 2ILTA 2E7ZA 4ARZA 4BLRA 4ENQA 4LJ5A 3H17A 1R9NA 3E4CA 4FFPA 2XCOA 3RYIA 2B36A 1K8RA 4DA7A 2GQ0A 5DM4A 1N6OA 4KRFA 3CYFA 2JFUA 1XAHA 1VFPA 4Q03A 2P1DA 5C80A 4LJLA 2ZBEA 2EKBA 5SY6A 4E1VA 2GJSA 4B43A 3H1TA 1TJ4A 3G17A 4RHEA 4U5XA 5E4FA 2Y1FA 3NHPA 4LOLA 4CFSA 2O54A 2MMCA 4ABYA 2XZPA 1OY1A 5HRCA 1X3LA 3HLYA 4G41A 1Q6ZA 1DJLA 4D0LB 3H75A 4WBNA 3UUEA 4A0HA 5KVAA 3KLOA 3WTCA 3WP1B 1YJCA 3R7BA 1VLMA 3IHKA 4LI3X 1GL6A 1XMIA 4XWYA 3ZWYA 2JGNA 4FJ0A 2XDWA 1KMMA 3HDYA 3GJ7A 3OFJA 5JC8A 1H1DA 1QS0B 1YQ9A 2FG7C 5C1OA 2ID4A 2G76A 1YRHA 2VNSA 3KKLA 4HAOA 4HGPA 4DCPA 1A9RA 3P4UA 1C4WA 1ZMOA 2Y77A 3AY3A 1XDDA 3SQXA 3TQCA 2ZRMA 4QYIB 2YN2A 5IJ9A 3FOCA 1MEJA 1X7ZB 1YZUA 3STUA 2QUZA 1R00A 2IYTA 5CIQA 2NT3A 3UQYS 3HKCB 3QPUA 2R5NA 3N2EA 2EP8A 2A4MA 1T3LA 1PJTA 2JHFA 3FR8A 3K0KA 3LAWA 1A77A 4XM0A 4XX0B 1DAGA 5FOSA 3EXHA 3DTVB 3IQEA 2DT5A 1KY5A 3NVAA 3D6MA 4BWVA 4LOJA 5JCZA 4N5MA 4F72A 4LF9B 3T3PB 3KYDA 4KQFA 2GAIA 2OPBA 5LQCA 2A5JA 5KYTA 4GVLA 1P75A 3ADOA 1CEXA 2EJWA 3BTVA 4IOJA 4OEHA 5TMPA 3Q8WA 5BWNA 1TLTA 2RAVA 4ZQEA 4HUTA 3UXEA 2XNJA 1XXHE 1ZRNA 1UBGA 1DP4A 4HQ6A 4K2AA 5ALKA 1R8SA 5FL3A 1QH1B 1QLHA 1TB4A 1U0FA 1YDMA 3RRFA 4WZBE 1GG9A 1RW4A 1SPBS 2FVXA 3DPUA 3OH8A 2BY4A 5BYKA 1QHEA 3ZY4A 1TVCA 1W94A 3KCNA 1L5LA 1R18A 1O0SA 4UU1A 4OG2A 4UAVA 1NAHA 1DLIA 5KQLA 2CUNA 4RTPA 1GD1O 4YV7A 1VG8A 3FNGA 3PHIA 3TSWA 4EW2A 4E1AA 5KWEA 3KB1A 3V1NA 1T1EA 4QUEA 1D4ZA 4NECA 1UBNA 1RFGE 3HCCA 1O97C 2ZBRA 1NQUA 4LPSA 4Y2HA 2Z98A 3QQPA 5ED0A 3RC3A 4QG3A 5JECA 3LCUA 3OHMA 3GROA 3PA6A 1QOZA 3JRNA 2NW6A 3H2GA 2YRWA 3O8BA 5G1PA 3N0TA 3C6ZA 3MGBA 4YUVA 2JFQA 2ZJ5A 2G5CA 2J5XA 4LOIA 2OE2A 1RMYA 2ZSAA 3B1WA 3EHDA 3LBFA 2AQKA 1DC3A 2VJNA 4UCQA 3AG6A 1ZOIA 3N8NA 3SLRA 3UAVA 3QEOA 2XCLA 1O08A 1MBZA 3DCNA 4ZCTA 1PL7A 3LIIA 2FVYA 2N3ZA 4G56A 3DW3X 4JSRA 1P9RA 1KFCB 1X80B 4HB3A 5EIFA 4X8LA 1EFKA 4N6OA 4BNZA 2ZOSA 1XDWA 2VT6A 3TIVA 2HBRA 5ECYA 1XTVA 4NH0A 5C8YA 4D3SA 2F1KA 1OFGA 5BMVA 4CT0A 1G4HA 5BORA 1XC7A 1GITA 4HNRA 4X7BA 4BLVA 1R0WA 2BN4A 2H1VA 2WIBA 3CUUA 2IHJA 4LSZA 3RC9A 2MIIA 4LV5B 1EAYA 2XT9A 2APJA 1QF9A 5B36A 5FR2A 4UKDA 3DOHA 1JTEA 1XA0A 3BMQB 1PZGA 5EMNA 1RQ7A 1Q92A 3DP7A 3I9OA 5B1YA 5IF3A 2O3QA 4FVTA 1WXDA 1Q77A 2YQZA 1O95D 3IVXA 4I99A 4B3FX 1FYFA 2QW8A 1F0NA 3TQIA 3HY6A 3OFSA 3ED1A 3S27A 2ZB4A 2D74A 5KMGA 3F90A 1BJKA 1YIDA 4BX2A 1QIEA 1K7CA 1PX2A 3KEFA 1PL8A 2QL7A 5CNKA 1FIUA 3DM9B 4UVDA 4ZANA 2Q2NA 1UBJS 2ZK7A 16PKA 2QAGC 1IMJA 2C1EA 5C0OE 4WI1A 1QIHA 2P9BA 4OA5A 1QTNA 2ZJ3A 1KS2A 5GV7A 5CFZA 4INPA 4PAMA 3RIHA 4ACAA 1WP4A 2EGUA 1GWNA 1PR1A 4GOLD 3SE7A 4ETIA 1A2BA 4Q18A 3W2FA 3FPGA 5FPQA 1J24A 3WV5A 2AC7A 1N8KA 1XO1A 4O4HA 3SVZA 1N92A 4EYEA 4EO7A 1P81A 3O4RA 4EHJA 3OO1A 4BO6A 1TMYA 1U02A 1L5WA 3ZE0B 4RYDA 5DASA 3W5DA 4Y30A 1KAOA 2P4SA 4DV4B 2XNSA 4MQ4A 4ALIA 3WWEA 4YAGA 1LDMA 1PEAA 1Z4NA 4Y6LA 2BD0A 2EXXA 3G88A 2ZI6A 1UJ2A 2G70A 5CT5A 4ZOLF 1JYSA 5DNVA 5GM1A 4RVOA 3ZE2B 4TQ9A 1C50A 1GA1A 2OSVA 4IKPA 4TUYB 1I6MA 3BCHA 3GFGA 5FYQA 4ALLA 3U19A 1JGTA 3F4KA 2XKJE 5DT9A 5FA8A 1B0UA 5LLSA 3EOBI 4DUPA 2RGNC 3BWXA 3OBBA 1EHYA 2D0DA 3FMIA 1IUNA 3E6AA 3KYCA 2CF6A 4NJEB 5BSTA 4B81A 4L2IA 3AYXB 2W8ZA 2IRWA 3CISA 2CFCA 3G59A 2H16A 4RSMA 4Y6PA 2VP3A 3SG0A 4OU4A 3VNBA 2H4HA 2YV1A 1JDNA 1XV5A 2J30A 1UAAA 3EC7A 3SFVA 4YMUA 2PIAA 3GAFA 1BDMA 2GK3A 1L8XA 2VK2A 4YMSA 1LY1A 4F6CA 4MQEB 3CO0S 2DJ5A 1GAXA 4OJKA 3AUJB 5HVNA 1CR1A 2I1QA 3THRA 2WFMA 3PJFA 1WJGA 2WUVA 4RMJA 1WCYA 3BQNB 5T3UA 2UYOA 3AEQA 4NMXB 1S7GA 2HCFA 4LXQA 5FT9A 5JLAA 3ZZTA 3TGPA 4KLRA 3E9ZA 1GO2A 1EIWA 5FKJA 2X1LA 3OEED 4YJKA 4A0RA 5AK6A 4CMEC 3GLUA 4G89A 1H5QA 1T36B 1FFWA 2HMYB 1N3LA 2J9XB 4TXNA 1ATIA 1SU4A 4UXJA 3ZWAA 3LM8A 2QLFA 4ZXFA 2WWTA 2AMYA 4PFSA 4EMTA 4IO0A 3WE7A 2JI8A 1U8XX 1XVVA 3SHOA 3PVSA 3HM9A 4JLAA 4B80A 1DX9A 3F5SA 1PWYE 3EXFB 4U39A 3RS5A 3P9KA 4ASUA 3GLGE 3AONB 1E8DA 1ZOSA 2Y0PA 2FSHA 3BXOA 4D7AA 3KUUA 4Y2VA 1VI5A 1HC7A 1NM5A 1SKBA 1WD7A 2GHTA 2WC1A 2WK1A 2YDYA 3INTA 3CMMA 3GEIA 2G04A 4CDMA 5JFTA 5COBA 4KAFA 2DE0X 3KDAA 2PRJA 4UMEA 5CB0A 1VHQA 3WRXA 3V4FA 2A3NA 1MB9A 2R97A 2CKMA 3PUKA 4EWLA 1CUAA 3DXYA 4K05A 4Q3EA 3RSOA 1GPYA 4LK2A 1U2SA 4IV5A 3PZRA 3SQWA 3LC1O 4KP7A 2QPLA 5K8LA 1ANKA 3NV7A 1U7PA 1VL2A 3HR7A 4F4HA 2ZM5A 2FTKE 3EC2A 3IYLW 4LRWA 5H81A 1F4PA 2Q4TA 5L7TA 4DLSA 3ZLJA 1JHQA 4URYR 2O0LA 1P2BA 2I7VA 3IMGA 1TIBA 5G0UA 4MKGA 2JAXA 5DX1A 1XTUA 3NIGB 3HVKA 4FYVA 3VSDA 1NOJA 1JQBA 3KQUA 3HCDA 2NU8A 2B5VA 5KCZA 4L27A 3BSFA 5T5QA 5EQDA 2EFEB 2C59A 1IXZA 1MG5A 1TF2A 4IDGA 1UQUA 4DC9A 1O9BA 4XCXA 4DJJA 1BDIA 3HB9A 2FI1A 1U3VA 5KDDA 2VJKA 3PFFA 3UWDA 2WJJA 1BTOA 1G9TA 2IVFA 4JELA 1QCDA 3PTAA 1NBIA 2WEKA 1Q22A 3HS3A 2YBDA 5BWLA 2W98A 3GBVA 1JA1A 1OLUA 3H5NA 3RS2A 4C4AA 5F77A 5D1NA 3LLUA 1NURA 2GM3A 2OP1A 2WTXA 1THGA 1JIQA 2P0EA 3LT2A 4GI3A 3K3PA 3DKKA 2CCJA 1D6NA 2JIPA 4R7GA 5NLLA 3HDGA 3W8FA 3SNHA 1DPFA 1H6AA 1UMCB 3EZ2A 4HX2A 4MAMA 3I42A 4NEGA 1DXQA 1J9ZA 4KK3A 2EKDA 2B3DA 4RPHA 2B3TA 1DJQA 5IJXA 3WK8A 1OXVA 4H6XA 1XEWY 2WJWA 1QYDA 3HJCA 1V11B 4RELA 4ZO6A 3FUWA 4Q34A 1I3LA 3KT6A 3LX6A 3QKSA 4QYSA 1U0SY 5ALOA 1CYDA 5JG7A 5BVGA 5AVTA 1JWLA 1NX9A 4OP2A 1A72A 3KWMA 1KAQA 1G20B 2OO7A 1E9AA 4H7FA 4BFTA 2BKAA 1TFRA 5GWXA 1R0CA 2PT7A 2FMIA 2ZE5A 4GI7A 3F3YA 5EMLA 2VP2A 4UU8A 2HL6A 1Q7EA 1Z0AA 5DXJA 1B6GA 3HVIA 2J0UB 1JDUA 2WOOA 1L5SA 3FTDA 4PXYA 1MHPA 3PL1A 2C9MA 4CN9A 1SOUA 3HL0A 1TQ6A 3IKLA 1ZNXA 3L84A 3ZQ6A 2ZT7A 2RH9B 2DR3A 3G1UA 1EUCB 3UAWA 1DEKA 3PI6A 3L8FA 2GLTA 1DT3A 4WCVA 3QPAA 2WIDA 3U7QA 2EVWX 5EJ9A 3A28A 1MAWA 2IOFA 3WRYA 4ZC1A 4C0LA 2IE8A 3ET4A 3EDOA 4U9UA 1G17A 3D1JA 3TLGA 1UJNA 3K20A 5J43A 3K8QA 3NLLA 3QPBA 1AN9A 4N03A 1BEEA 4BE4A 2XB8A 2ONYA 3KFVA 1CUBA 3CS3A 3IMCA 2JFNA 2JGMA 4OJMX 1CZOA 3SJ7A 1HNZB 2D62A 4AS3A 5E9QA 5DTRA 3FN4A 2P9ZA 2O05A 1XZ8A 2CNDA 2P40A 3LQFA 5CLIA 1OBCA 4BZXA 4S0XA 3BH6A 4LWPA 3SHQA 5FWNA 3RVNA 1GTZA 1PYOA 1APBA 3PVCA 3RBZA 3UAXA 4BJHB 3RVRA 1IHXA 4O4HB 5CYFA 3LZCA 4CM8B 1ETUA 1DJMA 1EFVB 1Z83A 4FE4A 5IBPA 1CQJB 1VRCA 2EQ5A 3TKLA 4Z6KA 2YCBA 3QVOA 4QYIA 1O77A 4ALMA 2RMKA 1HE5A 3JZAA 2OFXA 4OJNA 4EG4A 3Q72A 4BGUA 5JD5A 2HLDA 1FFCA 3L02A 1UOQA 3QYAA 3GD7A 1Q15A 4LF4B 4BQPA 1MH9A 2FXVA 1B0AA 3OQIB 4G5FA 4D0GA 3DEYX 4JEUA 3OZBA 1HT3A 1EK5A 1X3SA 1OI4A 2W6PA 4PBTA 1BGXT 4DILA 2FFAA 2ZWAA 2OV1A 1L7OA 4M7WA 1XNGA 5DPMA 5LXTB 5A62A 2FRDA 4ID9A 3FJ1A 4U4AA 3JR7A 1MT3A 3HP7A 5FWYB 1CEYA 4CI0B 1H85A 1OXUA 4TGLA 1JIKA 1TUBA 1U6KA 2GF9A 2EW8A 1Z3IX 3TSZA 2VDWB 3NBXX 3V55A 4ZHQB 1RPAA 1U1EA 4Z7OB 4KACA 4PIMA 1M8KA 4BAZA 4D25A 4RS3A 1JU3A 1VMEA 2BEVB 4OGFA 5TT1A 3N6VA 3QX7A 4LWOA 3VHQA 4UNQA 3DTNA 5LQRA 1NJ2A 4OUKX 4DBVO 2YFKA 1UAYA 3A26A 1SRQA 3DBRB 3OEWA 4LBZA 4M89A 4OH7A 4GBED 1EXMA 1K5HA 2ZB7A 3FWZA 2V45A 1G41A 2AGVA 4C0HA 3FBGA 1NC1A 1PT8A 2FW1A 1K6XA 4HLUA 3TJMA 1KMQA 1QGZA 1TO1E 3QU9A 4AY5A 5AO9A 1IZ9A 1Q0HA 3A2KA 1AHNA 2AG0A 3U26A 5FQNA 3B3GA 3DJYA 2DSNA 1UXKA 4N40A 4RK4A 4F93B 1N6IA 3TD6A 1J2RA 4GNKA 3CWQA 3O9MA 4KR3A 5JLJA 4DIOA 2QBYB 1PR4A 3TZCA 2JGJA 4IRMA 3M6VA 2DHCA 1QHXA 4BVLA 4YTEA 1LTHR 3WL3A 3SEQA 4ZVPA 3VAYA 3BJEA 3DBHA 5D51S 3ZHZA 4YQZA 5AXDA 3O8QB 4DR5B 5JH7A 4E33A 3G7SA 2ZULA 3JY6A 1KR5A 1LGYA 2QQFA 2XA2A 4XGQA 2LDBA 1KJWA 3PNLA 4LC0A 4PTZA 5EHZA 2VF8A 3EDCA 2Q7OE 3M6XA 2HJ9A 3FR7A 1ZINA 1A1SA 4QUIA 4JU9A 1KVRA 3AP3A 3CW9A 1P39A 5D6NA 1HK7A 4UDXX 3D0QA 4I5EA 2VHWA 3S6JA 3WLQA 5CBPA 2CSUA 4AZ0B 2X9NA 1SVIA 4AF8A 1NW7A 2BBTA 3TTYA 1S96A 2K4MA 4IX1A 2ZSIA 1QIFA 4FOPA 2V97A 2PK3A 2GVDC 1L5HA 4Q4CA 2IODA 3L79A 4C7MA 3U4MA 2A57A 1GOTA 1X19A 1XKXA 2VHTA 3D4OA 3DE3X 3IOYA 1OPXA 4MYRA 5E3IA 5AM4A 3W05A 4BMSA 1TM2A 1GA6A 1PCXA 2ZRNA 3QY9A 4Q7JB 2QRUA 5H1YA 3AVQA 3MIIA 1SCNE 2QVZX 2WUDA 3PXBA 2G1JA 1ODFA 1WHTB 5JSYA 4ZMRA 4FZRA 2IYZA 3AYZB 4PQYA 3L7CA 3ZVMA 1E6EA 3TLBA 4D4IA 2NQ8A 3ED5A 2VUTA 1I2BA 3HYLA 4HDNB 3VU1A 2JFYA 5I7AA 5F21A 4UVHA 1EJ0A 3KKZA 1QO9A 1GYRA 2B8EA 2Z3VA 3TE7A 3I5XA 1RQPA 5KCMA 4G1UC 5HX7A 4X7MA 1DAEA 3OAAD 2CB9A 4NBRA 4DSNA 3R8CA 3TEJA 4RWZA 2D00A 4I4TB 3IVMA 4CBVA 1YMVA 4LS3A 2WUEA 3U2QA 3IT2A 3JYHA 2I8AA 4DKXA 4KBFA 1GLVA 4NV0A 5REQA 4HH4A 3N8IA 3RRXA 3FWNA 3OIVA 1TO6A 3BICA 5DYYA 5LYYA 2BGGA 1ZVVA 2GZ1A 1EGMB 5I9NA 1DRJA 1G2IA 5KYXA 2YHIA 1XD2A 1AVTA 1UJ6A 1NP3A 2H06A 1R6UA 2Y76A 2QMEA 2ZCVA 3JWEA 4C0XA 5I7SA 4O4JA 1W19A 5LLDA 1ZUWA 1LSUA 3CZAA 1CQIB 1U6JA 4RSHA 4Z9BA 5FHQA 1IBSA 4QJ4A 5TGZA 4NS4A 2IZ0A 1U0RA 2QU7A 3PC6A 1L4KA 4DIMA 1TD1A 4H3HB 5A02A 4RGBA 1KNQA 4N6GA 5B7GA 4JA0A 2HXYA 4UTPA 1RZRA 1J56A 1HLPA 3QHAA 5TQJA 3SQNA 1HNXB 1RSZA 2A0KA 1HFKA 5FTKA 1F2UA 4EIWA 1Z0ZA 2H4YA 3U44A 3ICWA 4LHEA 4DR3B 2DY1A 3IVCA 4IDEA 3KPJA 4B2PA 4KL8S 3M2TA 3KOYA 4MMYB 4KDRA 3OJCA 4JJFA 3GVIA 5A4JA 4AI6A 3X44A 4NULA 1U7HA 4IHJF 1UFOA 1YS9A 1KEUA 2H85A 2A88A 3T7EA 4EGAA 3E8XA 2DWUA 1ZJJA 2R96A 4LK3A 5EZQA 3RU2A 4E94A 1EXDA 2C4MA 2YHIB 2JLSA 1JKFA 1DOZA 4IIBA 1HO3A 5FEMA 1T91A 4BQNA 4RK0A 3T8YA 2HTFA 4KIWA 2W22A 1Q5PA 3IPRA 1G2PA 5DIFA 2X9LA 1OE0A 4J29A 4X1KA 3RFCA 3TSOA 3GLHB 4E03A 4W63A 5JCPA 3K6SA 1H2EA 2YVAA 3PXXA 1M8JA 3CLRC 4FUTA 3AUTA 3OTQA 2A59A 4BO3A 1T8UA 2BGKA 4Z4GA 4K0RA 3USCS 3UMMA 1B8NA 1FX0A 3WWYA 1ODCA 5ARBA 3MWDB 3NBZC 2Z2XA 2Z5GA 3ZHYA 3KJZA 5ESWA 2P2ZA 1FUUA 2XW6A 1GP2A 3DKIA 4OP1A 1ZK1A 1RBQA 4S1OA 4NSNA 5ALEA 3CCBA 5H3HA 5A71A 2JEZA 4P7BA 4RXTA 3QUCA 3IVAA 4A73A 4GKAA 4MVJP 2C2YA 3A1DA 3AIMA 4LXXA 4OUDA 4MEJA 4AN0A 3FLBA 1YZTA 4WVLA 1N2CB 2JA2A 1V25A 4G5QA 3B70A 1RPJA 4J0JA 4P3YA 3RWBA 1JKJA 4OX9B 4B3JA 1NIPA 5DM2A 2B37A 4P83A 3FPAA 4IQ4A 1RPZA 3RS3A 2W11A 2HCRA 3VPDA 3Q7EA 1JE1A 2HTEA 1N75A 3JYNA 2NAPA 1F8UA 4PE5B 3KPWA 3N2ZB 2WWVD 3EGOA 4WT7A 3G2NA 2JC3A 1NJ5A 1E1CA 1ZIOA 3KOXA 1JKXA 4WNAA 4NNOA 1GA4A 2PLWA 3L0OA 3RIMA 3ZW8A 4B44A 4F2GA 2GD0A 3H1EA 4UM5A 1F6WA 4Y8VA 4EPWA 2OYCA 3DB2A 4QOGA 3E8MA 3UJBA 3FHOA 4DUZB 1U94A 1VDMA 3GEMA 4J90A 3L2OB 2XE7A 5LQMA 3ICQB 3BAFA 2C97A 2GD6A 3EYAA 4DIEA 2DLCX 1G64A 1B3RA 2IGTA 2SBTA 1SCUA 1YBFA 1VLLA 1DE0A 3AFNA 1OX6A 4IJWA 1EZ1A 2IPOA 2E1RA 1FE8A 2B6NA 4CKWB 4GRIA 2PSDA 3V4SA 4BXOB 3FYCA 3G5UA 1W9MA 1GTVA 4D9HA 1HQCA 1YCGA 2PJZA 1ISJA 3ECCA 5L45A 3UPTA 5EE5B 3FMFA 3LK7A 2ODBA 1MAUA 1FRQA 1YZKA 2Q5HA 2F1JA 1XTRA 2JJ8A 4UJ3A 5ERXA 3NVKI 1ODIA 3FRHA 3ZLTA 4YVFA 4W7HA 1GGVA 2HMVA 2QQEA 1NOIA 3DMDA 3VV2A 2HH9A 1F2TB 4L08A 3WMWA 4LNHA 3KG2A 3MB8A 3FFWA 4TYMA 3CMCO 1NZJA 3FYSA 1M5UA 1K9VF 3GFTA 4DLRA 3CZPA 3IV7A 2A8YA 4QOEA 1XMXA 4GXNA 4B6OA 1MOZA 3O94A 4B48A 2DBYA 3S2SA 1SXGA 4EG7A 4ZHQA 1RLMA 3I1FA 3ZZ1A 5AQEA 2XOEA 1PTJA 4M37A 2HMTA 1QH1A 5KTRA 3DEKA 4OFWA 5HA5A 1M66A 1ZH6A 4G4SP 5A4MS 2QD3A 4P4SB 5IW8A 5GQSA 2O06A 3EGEA 3LKZA 4NFLA 3KWLA 2QP9X 5PNTA 2P9QA 1J0AA 3C4JA 4DNOA 1DIGA 1M2JA 1ZCJA 3P2KA 1RMQA 3DOFA 4KNWA 4MUAA 2VJBA 4OKNA 4GR4A 5EMHA 4YRJA 1UKVY 2ZJOA 4KTVE 3L8DA 1DKPA 4NFSA 3C3MA 4Q3OA 4EPYA 2P65A 3LUGA 2V7GA 3RUHA 2HWYA 5I7WA 2HF2A 3F5MA 4CYMA 5JQWA 3T5BA 1IJEA 5DE3A 1DO8A 3TOXA 1F38A 1JA0A 1Z0KA 4GQAA 5CCDA 4MDFA 1XQ6A 4R0NA 3E7DA 4H7PA 2BTQB 1JMYA 2ZS8A 2BEJA 2CY0A 2ZJAA 3MHPA 3PQEA 4NMWA 4TSKA 4QJBA 1AH2A 3FDIA 1GNQA 4V0MA 1NR5A 2HN9A 3HYSA 1VMAA 1NW6A 4BNLA 4CG0A 2Z4TA 2ZVDA 5AKIA 2PUHA 1KO5A 2GTPA 3QH4A 4I55F 2V5AA 4JP5A 3VSAA 5BUZA 1SR8A 1LDNA 4URXR 4M4SA 4FOSA 2PRYA 4DWWA 4DBLE 2K2WA 3MLAA 1QIJA 2JJ2A 2QU8A 4TRRA 5A3VA 2VR1A 1NVVQ 4XFDA 4BX9A 3H84A 5BSFA 1KMNA