4UEOA

Open state of galactitol-1-phosphate 5-dehydrogenase from e. coli, with zinc in the catalytic site.
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
346
structure length
346
Chain Sequence
MKSVVNDTDGIVRVAESVIPEIKHQDEVRVKIASSGLCGSDLPRIFKNGAHYYPITLGHEFSGYIDAVGSGVDDLHPGDAVACVPLLPCFTCPECLKGFYSQCAKYDFIGSRRDGGFAEYIVVKRKNVFALPTDMPIEDGAFIEPITVGLHAFHLAQGCENKNVIIIGAGTIGLLAIQCAVALGAKSVTAIDISSEKLALAKSFGAMQTFNSSEMSAPQMQSVLRELRFNQLILETAGVPQTVELAVEIAGPHAQLALVGTLHQDLHLTSATFGKILRKELTVIGSWMNYSSPWPGQEWETASRLLTERKLSLEPLIAHRGSFESFAQAVRDIARNAMPGKVLLIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords GALACTITOL-1-PHOSPHATE 5-DEHYDROGENASE
publication title Enantioselective Oxidation of Galactitol 1-Phosphate by Galactitol-1-Phosphate 5-Dehydrogenase from Escherichia Coli
pubmed doi rcsb
source organism Escherichia coli
total genus 106
structure length 346
sequence length 346
chains with identical sequence B
ec nomenclature ec 1.1.1.251: Galactitol-1-phosphate 5-dehydrogenase.
pdb deposition date 2014-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ueoA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4ueoA01
5THQA 4BO2A 3LT1A 1JU9A 2GERA 2O7SA 3G79A 4FS3A 2PNFA 2FPIA 5C7OO 1N7GA 3L0DA 2BI7A 3I23A 4BNVA 4JBIA 1E77A 1YJQA 3GNQA 1LUAA 2Y0EA 4IDDA 4WNIA 2EJVA 2GRAA 3U0BA 2NVUA 1K5HA 4I5FA 4ALKA 2JCXA 3MOIA 2LDXA 3OP4A 1PQWA 3KYDA 3LC7O 3BYZA 3HNPA 4A5OA 4FFNA 4IJKA 4E30A 2IRWA 1O0SA 5U1PA 1NHGA 3JQEA 4YJFB 3SLKA 3G3EA 3EZLA 3INGA 5L53A 1YL5A 3DBVO 4CM1A 1I3MA 1PGJA 4L0QA 1LJ8A 4N5MA 4MVJD 2G17A 1ML3A 5HWSA 2BELA 1M75A 1GZ6A 1T2EA 2WE8A 3H65A 4WLFA 5DN9A 3WIEA 2BGMA 2NM0A 1LLDA 2EP5A 5A1TA 4PLWA 4YQYA 3DOJA 2AE1A 1ZXLA 5U9CA 1KVQA 1DC3A 3WGYA 1PX0A 5DP2A 4BNNA 1P1HA 5T8KA 4R16A 1T25A 1YB1A 3PZRA 4KQWA 1A4UA 3MCVA 6ADHA 1CDOA 1Y8QA 4BNLA 3H2ZA 1MP0A 1F0YA 5A02A 3IMFA 4E3ZA 3MTGA 5DZSA 4NG5A 2ZB4A 4L74A 3JYNA 3BZUA 2FSSA 3UH1A 1W4ZA 3ZI0A 4ALJA 3RROA 2DUWA 4NBTA 3MJTA 9LDBA 5G0WA 1GL3A 1HDRA 4OKNA 3TFOA 3GGOA 2EP7A 2DBQA 3DZIA 4C4OA 5JNLA 3RASA 1EDOA 4NBRA 4Z0PA 3AOEC 5JDIC 5DOVA 2Z1MA 4IJVA 1U8FO 1WMAA 1P1RA 2ZKLA 4YJGA 1DIHA 1ZMOA 3WMXA 5T57A 1LX6A 3W6UA 4BVAA 1E1LA 1Q0HA 1B8VA 3JQGB 3WTCA 4E0BA 6LDHA 2EKQA 4WCDA 3RVDA 2Q49A 3BHMA 1OBFO 5ICSA 1XCBA 1P3DA 4EYEA 3WBBA 4Y67A 3LU1A 4WASA 1DO8A 1RJWA 3ZN2A 1GY8A 3WOHA 1R4MA 4NHEA 4E2ZA 3IUSA 3H9QA 3KYCA 4NDNE 3RUHA 1GUZA 1KEWA 3DFZA 4WK6A 3TN7A 1CETA 3DHNA 4H3VA 4B7XA 3OJOA 4KZPA 5CPFA 5L95A 2X6TA 5JAMA 2DKNA 1JWBB 1UZLA 1C0KA 1GADO 2DBRA 3RFVA 2IYPA 3F5QA 4PN3A 3HWRA 1A72A 1N9GA 4R1SA 5G2OA 4YEDA 3TL3A 2AG8A 1RYDA 5JYDA 3VC7A 3IQDB 3GNSA 2GN9A 3NGXA 1J6UA 1A27A 3QSGA 4R9SA 4ROSA 3R1IA 3WG9A 1PZGA 1O95A 4CQMB 1UXIA 4J0FA 4M49A 3PJEA 3QVXA 4FBGA 4B7UA 1Y9AA 3Q2IA 3TFQA 3ZU3A 5ILOA 5TRTA 4J1SA 4TVOA 3GT0A 2VRBA 1T4DA 3T7CA 1WDMA 5C5IA 4Q3EA 4YAKA 4BNIA 3WFJA 4XB1A 4O59O 3U9LA 1NYTA 1MGOA 4MVJP 3QE3A 3SEFA 3LVFO 1LQUA 4J9UE 3F1LA 3FNEA 3OA2A 1E3IA 1V0JA 3EYWA 1DPGA 1I36A 4RJTA 1MUUA 4RV9A 5L40A 1EVZA 3PJGA 1LQTA 2NSDA 3PQDA 8LDHA 5KKAA 4B7CA 4RF4A 3GVXA 1M66A 2Y66A 2EXXA 4GLOA 4GSKA 4CLHA 1EE9A 1TT7A 3IIEA 3ANNA 1EK6A 5JMPA 4GGPA 4YT8A 1WPQA 3V5NA 1EUDA 2HRZA 3D3WB 4YTEA 5EIOA 5JY6A 2X0NA 1NVMB 3WYBA 1KY5A 3FTPA 4NQZA 3ROMA 3K31A 4N54A 4RVGA 3AFNA 3ZZNA 3VDQA 5GZ1A 3W1VA 1HE2A 1SBYA 3JQ8A 1NHWA 3E18A 4U0JA 5IXSA 4EDFA 2YFHA 3WGOA 5MDHA 3IC5A 3JQFC 2Y0CA 1NQAO 3S2GA 3L4SO 2YQ4A 4P4NA 3AY3A 4HXYA 1V9LA 4B3HA 3AOEA 1GUFA 1PEDA 1T2FA 4DQXA 3KVOA 5ENVA 3FWNA 3NT2A 1XQ1A 1WW8A 3DBRB 1U2DA 5JCJD 4AJEA 3H2SA 4AJNA 1GQ2A 2NQ8A 3K9QO 2WTBA 4JN6B 2O50A 1X0VA 3RJ9A 2C5AA 5BT9A 4DMLA 1XKQA 2DU8A 3D0OA 5JPIA 3L07A 3PWZA 3PJDA 1X0XA 2BFAA 3GVHA 5JC1A 3I83A 2UVDA 1ADCA 4LISA 4WLNA 5A3JA 3GRPA 4NNJA 1WWKA 3QW2A 4MKZA 4CM6A 3LT2A 1NNUA 4PCVA 1L1FA 1NPDA 3L9XA 1F14A 3FD8A 4U6QA 3CTMA 4OQZA 1QP8A 1L7DA 2JFGA 1E7RA 4OXKA 1YE3A 2ZYAA 4XJSA 1E7MA 2FRDA 4BUCA 4CM9D 4YACA 4J4HA 3ZWNA 3GLQA 1DC6A 3FRJA 3FR8A 3PGXA 4AJJA 5AQ1A 2G0TA 4BMNA 1E7QA 4TROA 3AU8A 4BV8A 3EMKA 5LCXA 1Q7BA 5EJ2A 5I7VA 3L4BC 3PHIA 3OIGA 4DMMA 5HM8A 2QQ5A 3H5RA 3H3JA 2AEFA 4H7PA 1BXZA 4C7JA 2IEBA 3DTYA 1JKJA 4W6ZA 3GAFA 1LBEA 4FN4A 4OH1A 2CNBA 3BMNB 4MP8A 1BMDA 3JQCA 4GPD1 3WFIA 4XDZA 1JW9B 4R9RA 2V6BA 1WZEA 2B83A 3NRCA 4LSMA 4D0RA 3DZJA 2B4TO 2EERA 4N18A 1RM4A 3WNVA 2HLPA 3PJFA 3VZRA 4BGEA 1BRMA 4CLEA 1V35A 2O2SA 1YDWA 1YO6A 2BH9A 1NFQA 2HJRA 3VTFA 3ROQA 1P44A 4FOSA 2IZZA 3C85A 1LDBA 3HE3A 3LT4A 3AJRA 3DZKA 4RZIA 1V3UA 4YA6A 1TT5A 1JAXA 1HETA 3W4IA 3UCEA 4RPJA 3C1OA 2ZK7A 3ZV3A 1HYEA 3BTVA 4QEDA 3VH3A 1KERA 3ZHZA 4BKRA 1HF3A 3HDJA 5BSEA 4G5HA 1KEPA 1ISIA 4E5NA 2CVQA 3ENNA 2YV1A 4YAIA 4BO5A 1XELA 1OMOA 1EDZA 4CODB 3QVWA 5DBFA 3JQFA 5BSHA 2C82A 2ZB8A 2C59A 4YXFA 1N5DA 2GF2A 3E9MA 4JP3A 4JXKA 2J3HA 3R0IA 1Y7TA 4E5MA 4O0LA 4XJTA 2I99A 5JAIA 4OJNA 1VL8A 1B3BA 2D59A 3H3FA 4D7AA 3B1FA 4CMCA 4CV0A 1LDYA 4I5GA 4J2HA 3NJ4A 1AUPA 3MJEA 3OETA 1P1KA 3PGJA 2GNAA 4CQLB 3PIDA 2ZB3A 4ALNA 1GU7A 3WGTA 1P0CA 1QYWA 4LMPA 3JQAD 3ZW9A 1NVGA 3HUDA 4DLAA 2AE2A 3H9UA 1LRJA 1G1AA 3TZCA 3CKYA 1UP6A 4R01A 1YQXA 2JD0A 1PZFA 1O94A 3JYOA 1IZ9A 1V8BA 1FK8A 3GRKA 1ZBQA 4NJMB 1QV6A 2H5LA 3GN1A 2YJZA 1VKOA 4BNXA 2VUUA 1KEVA 2C20A 2PKRA 4BIIA 3AWDA 4RORA 1P45A 4WCFC 1NR1A 1R0LA 3QHAA 3PPIA 4BO1A 2GN4A 4QSMA 4DWVA 1KC1A 3DZBA 2HSDA 1KOLA 1UP7A 2D1YA 2OMEA 3JQGA 3ZWVA 3FN4A 2NTVA 4YAEA 2OGUA 2Y99A 3E5MA 1O5IA 1T2CA 1EE2A 2FR0A 2WD7A 4ZICA 2X1HA 3DDNA 4FD3A 4I5EA 4OQYA 5CHEA 4IIUA 4J3FA 2QYTA 2Y1EA 2ZATA 1ZEJA 1J4AA 2JFHA 1LDNA 4Z0HO 3SX2A 1E7SA 3CMMA 3GHHA 1SC6A 1X7GA 3BTOA 3HFSA 1T24A 3M2TA 2EIHA 2Y05A 1VLLA 2O3RA 2Q2VA 1Z6ZA 3TF5A 2ZCVA 2JHFA 2YFQA 3CPSA 2J3IA 3JD1A 4CLOA 1Y8QB 1W6UA 4LVUA 4XZ3A 4NI5A 1GR0A 3N74A 4FFRA 2PFGA 3PLRA 3OECA 2D5CA 1T1RA 2XPCA 1PSDA 4ND5A 4CPDA 4E5YA 4YT4A 2IDZA 1YBAA 4I9NA 4E2YA 1EQ2A 1K6IA 5L51A 1X14A 4ND3A 3KSZO 3QY9A 4L75A 5FI5A 5I9NA 1D1TA 1C0PA 4YJGB 3INRA 2TMDA 1H6AA 3KLPX 5ITWA 3JD3A 4MOWA 4TZTA 2NV6A 3E5RA 4JBGA 1I3KA 1DJQA 5KCZA 1EUZA 4RQUA 3M6IA 2AXQA 1E3SA 5CDGA 3QV1A 2UDPA 2HDHA 1PIWA 3OJEA 5I7EA 1Z82A 4EJ0A 4RZHA 4RPLA 1UDAA 3VH2A 3WWYA 3DQPA 1LTHR 3S55A 2IEDA 1QV7A 4BNTA 4P38A 5JCXA 1E5LA 1VSUA 1DFGA 3Q1LA 3QVTA 4ALMA 3MJ4A 2WDZA 1E7WA 4Q9NA 3D3WA 5EN4A 3UW3A 3U62A 1OI7A 3I9OA 2P91A 4II3A 3BHIA 1IHYA 3TQHA 2OBYA 5F21A 3RD5A 1H5QA 4AJPA 3VH4A 3V1TC 3ADPA 1UZNA 3C7DB 4D0SA 1XGKA 2X4GA 1K6XA 5F1PA 3OQ6A 3GGPA 3ONDA 5TF4A 1M2WA 1SMKA 5DOZA 3CINA 5AOVA 3RUIA 3VPHA 3AI2A 1JWAB 3D5TA 4I9HA 2VT2A 4HFMA 4RQTA 3RBZA 1ZVMA 4BO9A 3TRIA 4IM7A 3D3EA 1KETA 2CSUA 5BNTA 4R1UA 2V7PA 4MP3A 2E37A 3ZWXA 2I5PO 1PWXA 2FR8A 3GAZA 3GMSA 2AEMA 2F1KA 2Q45A 3K2EA 4IBOA 3LK7A 5AYVA 4J4BA 2O7QA 3WQRA 4J7XA 2Q1TA 3ZWOA 3DR3A 4L4XA 1GTMA 3JQBA 5A5EA 1DLJA 4CM5A 3KLMX 1YGYA 1Q0QA 3VHRA 2EF1A 3PDJA 3L6DA 4KOAA 4TKLA 5JW6A 1HE5A 2QZZA 1C0IA 1M67A 3OICA 1DIGA 4EITA 5L4SA 3JQ7B 3UXYA 4S1VA 1Z45A 1ZMTA 4ITUA 1EVJA 1YL6A 4XDYA 3LC2O 5A04A 1RYEA 3D5QA 1PR3A 4JX8A 1UJMA 4B3JA 1Z73A 1GYPA 1YBVA 4FOOA 4BNYA 4EUHA 5G0VA 2F00A 1YL7A 2CVOA 2FMUA 3NKLA 3PFWO 1J0XO 1CF2O 5DF1A 1CEQA 5HA5A 3NGLA 5TC4A 1OC2A 1PJ4A 3TZHA 4Z3KA 5TS3A 3P2OA 5IN5A 4R51A 4RF5A 4CMHA 4FQ8A 1OAAA 4JK3A 1PS0A 3JQ8B 3RUFA 1QKIA 1YRLA 2VHZA 1VM6A 3BMNA 3ROPA 5KVSA 4K6CA 4F46A 2Q2QA 4DRYA 1G0NA 4WGGA 4RO0A 4YRBA 4U6SA 4R54A 1N92A 4GBJA 5CG2A 3U5TA 4K6FA 4Y98A 1X15A 4E13A 2C2XA 1NBOA 3GVIA 5JC8A 2Y1DA 4D45A 3JD4A 3LSYA 1GEGA 1IB6A 2C07A 4MVJM 4IQ0A 3UHAA 4MVJA 1HYGA 5C7LO 2W2LD 3DZFA 4WEOA 2UYYA 3NDJA 3ZNQA 1BW9A 7MDHA 2Y68A 2A92A 3FWZA 2BFOA 3ZDFA 4B8ZA 2E48A 3I6QA 5BNFA 1E92A 3RKRA 4CMIA 4G65A 4Y6PA 3KRTA 2AQ8A 1SNYA 5T64A 1PJQA 1FDWA 2B5WA 5AXBA 5JYEA 2WYWA 4DQVA 2VHWA 3DEYX 1G0OA 3H5AA 2NVWA 4QT0A 4RGBA 3HQ4O 1N1EA 2D4AA 4R3NA 4AJ1A 5L7WA 3FNHA 2R00A 1LRLA 3WWZA 1TXGA 4PG7A 4NFSA 3VPGA 2ZTLA 3ASUA 1KIFA 1X13A 3SLGA 1YKFA 1I32A 5AXDA 2DQ4A 4CR8A 5GZ6A 2VRCA 1B15A 2EHDA 3JSAA 2GYYA 2NU6A 3JV7A 3KTDA 1UXGA 4M8SA 4ZQBA 2X9NA 4JGBA 3GR6A 4ZA2A 3VZPA 4CQLA 2PY6A 5IJZA 2RCYA 5ADHA 5ES3A 4QECA 4BO8A 1E0DA 3S2IA 4UAGA 1MXHA 3TOXA 1SO8A 2ZIZA 1QR6A 1HXHA 3E03A 3GFGA 3O26A 1EBUA 4E6PA 1QLJA 2VOEA 2AEJA 4GVLA 1ZFNA 3VPSA 1IYZA 1E1KA 5JAQA 1C3VA 4ZN6A 4NJMA 3QWHA 2Y1GA 4WE3A 4IZHA 1TT5B 2PK3A 4OXNA 4B4WA 1KY4A 3GDOA 2TMGA 1ISJA 2UAGA 1T2AA 2NUAA 4BNWA 2CDCA 1E5QA 4LW8A 1ISFA 2B69A 3IJRA 1AHIA 2X0JA 1K2WA 1WZIA 4CLXA 4EGFA 2JJYA 4PLTA 3LDHA 3ZGYA 4CR6A 1JLLA 3COSA 4NU5A 1B16A 5GY7A 1ZK1A 1JN0A 3EGOA 4ZGWA 1B8PA 4ND1A 2O4CA 5COQA 1GEEA 2Y1FA 1LA2A 1T1SA 5CAEA 1GYRA 4Q3DA 1WVGA 3GK3A 3L6OO 3VZSA 4BQRA 1ENPA 4BS9A 5A06A 2HMTA 3AI3A 3OIFA 1ORRA 1YQGA 2Z95A 3CXRA 4U8GA 4K1LA 3WQSB 3OEYA 5KJ1A 5KTKA 1U9JA 1ZH8A 4GKVA 3K5PA 4ZQGA 3LF1A 1H0KA 2EG9A 4R3WA 2OXIA 3RJ5A 4G81A 3C7CB 1SAYA 3GZ4A 4R68A 4L8VA 1M76A 3I9NA 3PHLA 1EMDA 2P2SA 4URFA 3PVZA 4BNUA 2CY0A 3F3SA 3JD0A 4Y9DA 1VRWA 5CDSA 4O63O 4PIVA 2NACA 3L6EA 5IZ4A 2VWHA 5F5LA 3IJPA 5GZ3A 3IL2A 2B36A 4HWKA 1ADFA 1K6JA 4ALLA 1IY8A 1FJHA 2NWQA 4TRRA 3DWFA 4DL9A 2X5JO 2HQ1A 4DBZA 3S2EA 3GGGA 1XYGA 1LLCA 2WD7B 2X8LA 2NADA 3ENKA 2G82A 2B4RO 2C7GA 2YYYA 3CE6A 5JSFA 4XQCA 1ULSA 3EDMA 4FCCA 4J9VA 1CIVA 1K3TA 5F5NA 3WSWA 1F12A 4EZBA 4MVJG 1ONNA 1LSJA 4XYGA 5CG1A 3PDUA 5IF3A 2VTEA 4NIMA 3GPDG 3CZRA 4RL6A 1MC5A 1Y6JA 1BGVA 3SC6A 3ZV4A 1DC4A 2D2IA 1ENYA 3N58A 4XB2A 3HDYA 1Y8RA 4CLOB 3DAFA 1P33A 2JHGA 1V3VA 2VWGA 3WR5A 2DVMA 2ILTA 2VHVA 4N5NA 1SEPA 4DTIA 3PWSA 5DCWA 1Q2XA 1NFFA 3S8MA 5TIIA 3PHJA 4CM8A 5LDHA 4EUEA 1A9YA 4FC7A 2P4QA 4PRKA 2VYNA 5U4QA 3CEAA 2I67A 5CPBA 4ZQHA 5KNLA 1IPFA 2Q3EA 4B3IA 4KUHA 2GGSA 1A4IA 4WECA 1VI2A 2Z1NA 4CM9A 2DUUA 1YB5A 2PZLA 1NWHA 2QRJA 4TRNA 2YZ7A 4LK3A 4CM4A 2A35A 3B70A 5JS6A 2I9PA 4Q3NA 3JQ7A 1HDOA 2BGLA 2SCUA 1O8CA 3I9JA 4XKJA 4C7KA 4GWKA 3FPLA 1I24A 1I3NA 3DHEA 4IUYA 3DB2A 1BWSA 1UAYA 3ZW8A 2VQ3A 5B12A 5C37A 1Y9EA 3G0OA 3W8EA 3WNQA 1ISHA 4EBFA 4GSLA 3HN7A 4TRMA 5CEEA 5I7FA 4QUKA 4QXMA 1PJLA 3RUAA 1DB3A 2P4HX 1B26A 4KQXA 4HP8A 4YPOA 3A28A 1ONPA 4KTVE 4CL8A 1PGNA 3AY6A 2E82A 5KVVA 2OHXA 1NTOA 1CYDA 3GC6A 3Q9UA 1ZK4A 3NTRA 1SEVA 2UUPA 3X2EA 3Q3CA 4UUOA 2POQX 5JDIA 1DLIA 4E5KA 1ZJZA 2D0IA 3ZWPA 1U7HA 1XEAA 3E9NA 1TB4A 2Q50A 1YS4A 2JCVA 4M86A 2EWMA 4XYEA 3BHJA 1ZIDA 2JAPA 3GOHA 4FB5A 4IXTA 4PLFA 4IQ8A 1HDYA 4MP6A 1LC3A 1S7CA 1UAGA 3AM4A 3GY0A 1P1IA 1PJBA 4J0EA 3ZU2A 4R69A 1XR3A 4UVDA 3JQDA 2PZJA 1UXHA 1WXDA 3GH3A 1QXSA 1HDZA 2IODA 2Q4EA 3HZZA 3AUAA 3PI7A 2BFPA 1FDVA 1XA0A 4XR9A 1YXMA 2V6MA 4YB8A 4DA9A 5K9ZA 3A9WA 4BMVA 2HMWA 3ZWCA 4AL4A 4Z0TA 3PK0A 1K89A 4M87A 1MXFA 1LU9A 3I6IA 1NX6A 4PRLA 4BKPA 5DT9A 4YDRA 4NFHA 3L77A 3DXFA 3PIIA 1Y5RA 4UEOA 5BNIA 3OBBA 2QHXA 3AOGA 5ER6A 1W73A 5L4NA 2H6EA 1LSSA 1JKFA 1GQQA 4EEZA 1LC0A 1Q7GA 3WGQA 3ZV5A 4E2XA 3WSVA 4DQUA 1X1EA 3CZMA 4DPMA 3QRWA 4RLSA 4CMJA 2HKIA 3WXBA 3A14A 2Q1SA 1CQJA 3CSDA 3BTSA 4LMRA 4M89A 1ZK3A 2V6GA 1NP3A 5B37A 3U4IA 1E7YA 3RQSA 2IYOA 3UICA 5JDCC 1R12A 3KB6A 4UVEA 1NQTA 1UXKA 1NAHA 3UN1A 5H81A 1LDMA 1LSUA 2HUNA 4Z9YA 1ULUA 5KJ6A 2VZ0A 3N7UA 4GGOA 4WLVA 4DXHA 1HRDA 4ONEA 2HMSA 4AJKA 3EUWA 2V6FA 3O4RA 3ONEA 1H94A 3WTBA 2I65A 3RBXA 2CDBA 5IAAA 2B37A 4G2NA 3BTUA 1UDCA 4MVJH 1GFSA 3D7LA 4CMEC 4RVHA 4O6VA 5JFOA 3HDHA 4EJMA 5JE8A 2E6UX 1VE9A 2J3KA 1UR5A 2Q1UA 5AVOA 2D5AA 2BMAA 2FHSA 1GDHA 5F3RA 3UGKA 1BW9B 4M1QA 3LQFA 4FSHA 3HFGA 4WLEA 4H16A 3KZVA 4CMIB 2QRLA 3HDQA 4D46A 4GKBA 1AXEA 3P7MA 1N7HA 2JFFA 4BO0A 1M6WA 2GCGA 2FWMX 2X9GA 2O3QA 1IZ0A 3HJAA 3PP8A 4OHUA 4JCOA 2BHLA 5CP8A 3WGHA 1GCOA 3NDIA 3QWFA 4NK5A 3VAZA 4PLGA 1IOLA 4DGSA 4NR0A 2PGDA 3D4PA 3V1UA 1D3AA 1QRRA 3JQ6A 5KJFA 3WGGA 4FFPA 3C24A 4XX0A 2NNLD 1JA9A 2R6JA 2RH4A 1HKUA 3KEOA 4MIYA 4P4GA 3TWOA 4MVJE 3GG9A 3H4VA 2PGJA 4BKQA 1ENZA 1FDTA 1HZJA 2ZCUA 4Y8VA 3FCOA 5EESA 4IZIA 3FTNA 5F1OA 5JY1A 1H9AA 3AM5A 5CEJA 3OFSA 2AG5A 3VKVA 1TVEA 3QWBA 4BNFA 1PL7A 3OQBA 3U4DA 3HG7A 1BG6A 4NBWA 1YWGO 3IP3A 2X0RA 5JAZA 1HEUA 4A73A 2W4QA 3RBVA 5EPOA 3UVEA 3Q2KA 1U3UA 3P2YA 1PGQA 3BA1A 2VHYA 3DAGA 4OIMA 3DONA 1NR7A 2WD8A 4B79A 2I76A 4QX6A 3MTJA 1QG6A 2IZ1A 4RF2A 4W7IA 3ZWBA 2QW8A 4BNMA 4K9DA 3VVBA 4YT5A 3F9IA 1ZXBA 5CFZA 4MPDA 1U4OA 2WMDA 4PLPA 3L4BA 5HTOA 1E3EA 1KEUA 3TSCA 1OZAA 2ZB7A 1P9LA 1H2BA 5JDCA 3IP1A 1FDUA 1PS8A 2Q46A 3OJ0A 3VPXA 4D3SA 3WGIA 3I52A 2GO1A 4ZJUA 1PWZA 3UOGA 3W8FA 3M2PA 3PHHA 4Z6KA 5BSFA 4JJGA 4PLVA 4UUMA 4JROA 4WNCA 3GVCA 3LF2A 2PWZA 4PG4A 4F6LA 2WWRA 4YR9A 4BO7A 3F4LA 3WGZA 1P74A 5BQFA 2GLXA 1BHSA 3AI1A 5TJ9A 4NH4A 3WX0A 5B4VA 1DFHA 1PZHA 3WMWA 4AG3A 1Z7BA 3AW9A 3KYBA 2EV9A 2DTXA 3ORFA 5EERA 5EQFA 4DUPA 4DLLA 3D4OA 3TDKA 3GMDA 1EK5A 2AW5A 4XIYA 5B1YA 3KHUA 4I08A 1DRVA 4UEKA 3DTTA 4ND4A 4JJFA 3GG2A 1BVUA 1C0LA 2AA3A 3JQ9C 2BKAA 3U4CA 1ZO8A 2AMFA 4CMGA 4BO3A 1VSVA 4O5OA 5AXCA 1BXGB 2O3SA 2HMUA 4MVJF 4PVDA 1I01A 2VNAA 1BVRA 2JL1A 1E3LA 2QIOA 1F17A 3JCZA 4OMUA 1I8TA 3SXPA 2PZKA 5T6BA 2BLLA 3E9QA 3SVTA 4NBVA 1XWFA 2QYSA 4O1MA 1B0AA 3F1KA 3EY4A 3O8QB 5L45A 2WJPA 4BNHA 1I2CA 1NPTO 3ZWWA 1EVIA 5TSDA 1LDEA 5K6AC 3ZU5A 5EQDA 1D1SA 3B6ZA 3OSUA 4M54A 3NV9A 2NVBA 3FPCA 3SC4A 4BNJA 9LDTA 3BMQB 3K6JA 1UXJA 1NVTA 2JCYA 3K2BA 1Y8RB 3P5SA 1HSZA 3PZBA 3FSRA 5IDWA 1PTJA 3TZ6A 2VOJA 3RU7A 4WCFA 3O38A 1HTBA 4TWRA 2NU7A 2ZTVA 3LZ6A 2B0JA 3MWDB 2VHXA 1N1GA 4J2OA 1FXSA 1LRKA 4CM8B 5K1SA 3C1TA 4U5QA 4XGIA 3ZU4A 5B4UA 1U7TA 1G6KA 4HKTA 1R16A 3I5MA 1SPXA 1QLHA 4JQCA 1C1DA 1ZK2A 2HK9A 3DO5A 3ROKA 2HRBA 5A9RA 2OORA 4CM4B 3QP9A 5KVQA 4IDCA 3DZGA 4XRGA 4RLHA 4IJWA 3KETA 5TQVA 1HSOA 4INAA 3H9JA 4J1QA 1A7KA 3BXXA 2O23A 4D41A 4R5MA 5TX7A 2HK8A 1E3WA 4YRDA 4A7PA 4YT2A 2PR2A 5BR7A 3OJFA 2OFPA 4WEQA 3WICA 1B2LA 3ONFA 2Y67A 3NX4A 1BDBA 1ZZEA 3RFTA 4JP2A 4J7UA 4J43A 5I8ZA 5DULA 2H9IA 3I1JA 1DDOA 1NXQA 3RCBA 2ZJ0A 2NTNA 1D8AA 4CUJA 3KOUA 4J91A 5IN4A 4IGEA 4XRRA 1BDMA 2GD1O 3I9LA 2C0CA 4KP7A 5KJEA 4P4LA 1VL6A 2PD4A 4CQMD 4ZU3A 4D44A 4NBUA 4HV4A 1KC3A 2HU2A 2PKQO 5TNXA 4DYVA 1FMCA 3U3XA 4WLOA 3INTA 3IKTA 2DBZA 1NQOA 1QMGA 4AJLA 1T4BA 2BRUA 2J5QA 1RM5A 2J5KA 3HB5X 4Z3DA 1MB4A 2P5YA 4E4YA 3T4EA 4UREA 2PZMA 3GA0A 1DJNA 1KVUA 3LLSA 3VTZA 2DFVA 2DPHA 3F5SA 2P9EA 1N2SA 1AHHA 2PD6A 3GFBA 1GYQA 2NLOA 3CH6A 4IDAA 1U3WA 3KUXA 1JAYA 2HAEA 4GWGA 4ID9A 2CDAA 5CDTA 4ZHSA 2J8ZA 4FFOA 4E32A 4RPHA 4GI2A 4AJIA 4QTZA 3QVSA 1ADBA 5FWNA 5KOIA 2VCYA 1DAPA 4ZD6A 4PGFA 2YQ5A 4U0KA 3HN2A 3OF2A 4ZQFA 1Z75A 3EHEA 2Q2WA 4YRAA 3BIOA 4ESOA 1BXKA 8ADHA 2P9CA 4FJ2A 5I9LA 1I33A 1R6DA 1PGPA 2FPGA 1GD1O 4DIOA 4CLRA 3JQAB 1KS9A 2GN8A 2FSVA 3ON5A 1X1TA 1A5ZA 4X54A 3RC2A 1V6AA 2E4AA 3ZHBA 1VPDA 1YJ8A 5ER9A 1RKXA 1W8DA 4YJHB 2OL4A 1NASA 1XU9A 4CMKA 2VT3A 3RFXA 1XHLA 3ETDA 4FFLA 5T67A 2VUSA 1P77A 4QFCA 2BD0A 5EINA 2CZCA 5DCUA 1MA0A 3A06A 1O6ZA 2VYVD 3G1UA 1PQUA 1XG5A 1SB8A 3NAQA 3PFFA 4FDAA 4RCVA 2VTDA 1U5CA 4FC6A 3GEGA 3FNGA 1CWUA 2FZWA 2O4UX 3AFMA 2EEZA 3PLNA 2XXBA 1W0CA 4PG5A 4QO7A 1NAIA 5KVCA 4RDHA 4HFNA 3A4VA 4W9NC 4KDFA 3NT4A 4EI2A 5JXWA 2NQTA 4CV2A 4CV1A 1FDSA 4TKMA 4J1NA 3JYPA 1UUFA 4UUPA 2IE0A 4R41A 1HE3A 1YDEA 2QX7A 4A26A 2I66A 3DC2A 3H7AA 2DBVO 2CVZA 1J5PA 1SZJG 4OM8A 4XYBA 4B8WA 1GZ3A 1LXCA 1DOHA 1YBMA 4ZVVA 4XQEA 4XCVA 4E5PA 1U4SA 3PQFA 5GMOA 5A9SB 1ZSVA 2A4KA 4LGVA 4S3MA 5JBIA 3VH1A 1PL6A 3R3JA 4EUFA 2EW8A 4II2A 4E33A 3I9MA 3ITDA 4YYZA 2X9VA 3AK4A 3A1NA 4I5DA 4PFJA 3MJSA 2C2YA 4XEHA 2UV8A 3HB4X 1KVTA 3ADOA 3MEQA 4OSPA 3JD2A 3QA9A 3ZNNA 2CF5A 4HUJA 3JYQA 2YV2A 2RAFA 4W82A 2WYUA 2HCTA 3QWIA 5HRUA 3DZHA 1HT0A 4TQGA 3B20A 3T7EA 4BGVA 3I4CA 1Y81A 3I4FA 2ZTMA 1EQUA 3OA0A 4A0SA 3EAGA 1LI4A 3ZWAA 1ZSYA 1F06A 1R4NA 4ZRMA 2VZ9A 3TL2A 1F8GA 1PU2A 1B8UA 3DL2A 3NT5A 1ZUD1 4K26A 4MVJI 2HJSA 1YOVA 3DFUA 2V65A 4GH5A 1ZK0A 2QZ9A 4PVCA 2H1SA 4UUNA 3PHGA 3RWBA 4AJ2A 4WPGA 4CJXA 1AGNA 4GLLA 2OO5A 1DXYA 4IINA 4GMFA 4IPTA 4N5LA 3GEMA 1FF9A 3DBHA 3GVPA 4N7RA 1UDBA 1BXGA 4EW6A 3KM0A 1TA4A 3W8DA 2YV3A 4QFDA 5G0UA 3TZQA 2PV7A 1A71A 1RPNA 1KYQA 4E2WA 4XYMA 1CJCA 2ZYDA 2VRCD 3BMOB 4IDFA 4GL4A 1ENOA 4CLDA 1PZEA 3KSUA 5DCYA 1KVSA 4GX0A 5FFFA 3TZKA 3U09A 1GUYA 1B3RA 4DREA 3O8QA 1B7GO 1MLDA 4BB5A 2GR9A 2XXJA 4M55A 1HDGO 1VJTA 1ZSNA 3V8BA 4GX5A 4MIOA 4MO2A 5JCJA 1LDGA 3TPCA 3UF0A 1DFIA 2FR1A 4FFMA 3C3XA 1LLQA 3DOCA 3K8ZA 3GPIA 1YB4A 4OL9A 4OAQA 4TSKA 1Z74A 3BMQA 3EW7A 3D1LA 1PS9A 5JMWA 4W9NA 3SBOA 2VWPA 4QQRA 1SCUA 2G76A 2E49A 1H2HA 1XLTA 2H63A 4XGNA 5A05A 4PG6A 3R3SA 3W6ZA 2YW9A 5THKA 3H8VA 1UP4A 2RIRA 3ITKA 3MOGA 1DIRA 2Q4BA 4L76A 4E31A 2B35A 4YBZA 2WSBA 4KDEA 2A9FA 4FGWA 3JYLA 3QIVA 1YVEI 3I9KA 1DC5A 3VKUA 1DAOA 4DLBA 4A2CA 2JKVA 4HADA 3RAJA 3I3OA 3W4KA 3D4NA 4FW8A 5A03A 1YH3A 1GPJA 5L4LA 1QYCA 2YUTA 1NM5A 4RVSA 2EKLA 3WYCA 2YY7A 5HBRA 1EFKA 1QORA 4TMFA 4B4OA 3CIFA 4HFJA 4NPCA 3LYLA 3TOZA 1LEHA 3E8XA 2DPGA 5T5QA 4MINA 2Q1WA 2I3AA 2I6TA 3RKUA 3CUKA 1GPDG 3X2FA 3WIDA 2X22A 1GZ4A 5DBGA 3HHPA 3VPFA 5FF9A 3ETGA 3VDRA 4AJ4A 3RI3A 2OBNA 3V1YA 3BMCA 3ASVA 1U2GA 4J6FA 3O9ZA 1H6BA 5L7TA 2BF7A 3IDSA 1SOVA 1MC4A 3S1LA 1I2BA 1K0UA 4BB6A 4DPKA 5G0SA 1LLUA 2Y1CA 1CERA 4RVUA 4UVIA 2AQIA 4XWYA 4DC0A 4A10A 2WEKA 2DTDA 2GDZA 4WCFB 3EVTA 3OMLA 1MFZA 3ICPA 3E82A 1U3TA 1R37A 2XF8A 4J1TA 3NEPX 2PD3A 1EEHA 3RC7A 3AUSA 3OEWA 1XDWA 3GUYA 5COBA 1ONOA 4IS3A 2X23A 2EGHA 4IIVA 1C1DB 4DIFA 3RC1A 5JO0A 3H5NA 2D3TA 3MJVA 1Q0LA 4RVDA 4CM7A 5A5FA 1NPYA 1PJ3A 1YQDA 3KBOA 3ST7A 3F4BA 4JBHA 4BGIA 3KEQA 2O48X 3QWAA 4OXYA 3GZNA 5TT0A 1IL0A 1C1XA 2O3UA 1E3WB 5MGBA 2Y1OA 5G4KB 3RC9A 2C29D 4W99A 4IQGA 4FJ1A 1DIAA 3DAPA 3L9WA 2CF6A 5FI3A 3VZQA 4PLYA 4BGUA 1CRWG 4Y6RA 1E6UA 4NJOA 2R2GA 3B1JA 4LCEA 5F1KA 1YONA 4P8RA 3JQAA 1ZW1A 1JVSA 4AFNA 3AY7A 3OIDA 1CQIA 4MIEA 1HZZA 3DOOA 4D3DA 1A9ZA 1IPEA 2X5KO 2CUKA 2ZJ1A 4L4SA 5IZCC 1Y5MA 3K96A 3WDSA 4YJHA 4OGWA 1VC2A 2VYND 2X0IA 1B14A 2Y93A 5A4DA 3OJLA 3QVOA 4BOYA 3EK2A 4JIGA 5FYDA 4J4TA 3LC1O 1H9BA 2OP1A 3DBLA 1SB9A 5KWEA 4DBVO 3JTMA 4RPGA 7ADHA 2EKPA 1UZMA 5H82A 5L7YA 4ND2A 1MX3A 4Y6SA 2VNSA 1I2ZA 2EW2A 3G49A 5DP1A 3ZNOA 4WOKA 4OOEA 4HY3A 2GASA 2ET6A 4J16A 4DIBA 2DC1A 2Q99A 2B5VA 3WYEA 1EBFA 2AHRA 3GUCA 3GF4A 4Q39A 4RVFA 2W2KB 2PTGA 1DRUA 2IXAA 2C5EA 3ULKA 3QQPA 4PZCA 2EGGA 5JLAA 3GDFA 4OKIA 3IUPA 3WLFA 3H9EO 3RIHA 2XAAA 2FP4A 1LNQA 1HDCA 5KJCA 1Q1NA 3WQQA 1ISMA 4OO3A 4XGKA 4XYLA 5A9SA 4I1IA 1I10A 3TJRA 4HFRA 3EZYA 1M6HA 1VKNA 2OOSA 1IE3A 3PWKA 4FGSA 4CMBA 4CLRB 4YJDA 3U49A 4J49A 4GVXA 5TT1A 2HO5A 1NWCA 1PJCA 5DBIA 1JQBA 3Q6IA 3H6KA 3LT0A 3GHYA 4YQZA 4WLUA 2W90A 1Q7CA 1I30A 1OC4A 5L3ZA 2D8AA 4R5HA 1XSEA 3NYWA 3PRJA 3OQ1A 4L9RA 4BO6A 4YJFA 4CR7A 3RUCA 3STHA 1WNTA 4KTTE 3DMTC 2FN7A 4KMSA 4GX1A 2X86A 5I9MA 5L9AA 5J23A 3OH8A 4TVBA 2Y0DA 2O3JA 1ZCJA 3UCXA 2ZQZA 4BHTA 4MKRA 1XQ6A 2WYVA 2YHIB 1O89A 3LLVA 1DHTA 1AXGA 2FZEA 1EUCA 1HYHA 4IDBA 5H83A 3ABIA 4K28A 4BKOA 4HNGA 2NU9A 3FBTA 3TNLA 1MV8A 3GDGA 3K73O 2W98A 2EJWA 4IGFA 5KKCA 3KXDA 1ZNQO 1VJ1A 1ZKMA 2FY8A 1S6YA 2P9GA 1U28A 1RWBA 3MZ0A 2GUGA 3WJ7A 3ANLA 2LDBA 4BNKA 3P19A 4I8XA 5A9TA 5AXAA 1VL0A 3NDRA 4FJ0A 5IZCA 4XD2A 4RPKA 3SJUA 3BMOA 4LVCA 1DSSG 4XIJA 4I9UA 3ZWYA 2HMVA 3DMYA 5HS6A 4GQAA 3GEDA 1GQYA 4A03A 1R0SA 1MG0A 1EZ4A 2VUTA 1QSGA 1H93A 1HWYA 3FR7A 1EFLA 1ZJYA 2G1UA 3C7AA 3NUGA 3PEFA 4OYRA 5G4LA 1NFRA 3RU9A 3Q9NA 2NVUB 1AN9A 4ZQEA 1DBVO 2DT5A 2PH5A 3KYDB 1PJSA 3NJ8A 4Q3CA 1O9BA 5I7SA 5IDXA 2ZQYA 5ICMA 4BNGA 2QRKA 4J90A 4FPXA 3FI9A 3RUDA 1V3TA 4CUKA 1QYVA 4Z9FA 4CMEA 4EJ6A 2DTEA 3JQBC 1PL8A 3MJCA 4IMRA 4GAEA 4LN1A 4TRJA 1KVRA 4ALIA 3FBGA 5TJHA 3WS7A 3IKVA 2PA3A 4XA8A 2AQHA 3UFXA 1ZEMA 2GZ1A 3PYLA 3RUEA 1N8KA 2CFCA 1R4NB 1WDLA 2BI8A 2OZPA 4OOFA 4XR4A 3O03A 4H15A 3VOSA 3V2HA 2J6IA 4CMAA 2VZ8A 3AM3A 4FR5A 1E6EA 1PQPA 1YOVB 2WE7A 1J49A 3QLJA 2I3GA 2G5CA 4LCJA 4R4JA 3ANMA 4ILKA 3ZCXA 1JKIA 1P31A 4AJHA 3DBHB 4MJLA 4J7CA 5CEFA 3G1TA 5DDIP 4HBGA 3NTOA 3SJ7A 4PLZA 4EEXA 1I5RA 2RH8A 5IFLA 1ID1A 5BSGA 3PYXA 4CQMA 4D42A 4A27A 3FF4A 2X58A 3KO8A 3D64A 4YCAA 1ADGA 2P68A 3IOYA 1XU7A 3EVNA 4DVJA 1I0ZA 3DMTA 1Z7EA 3V2UA 3QJ5A 4KWHA 3ZNPA 2DAPA 3WJAA 1T26A 4IXWA 2PGLA 1E1MA 1PJTA 1R15A 2OP0A 2IZ0A 1JTVA 4IS2A 2YDYA 2BFMA 1WDKA 4FIZA 5LDGA 5TLSA 4MDHA 1D7OA 3G17A 3Q0EA 3ICCA 3T4XA 4LRSB 1R66A 4DPLA 3MWEB 2PLAA 3PYMA 1PGOA 2W8ZA 4L4RA 1JVBA 4JLWA 4UEJA 5A3VA 1LSOA 1E3JA 2W2LA 4PLHA 3OHSX 4WKGA 3S2FA 2NU8A 1R4MB 4AJOA 3CMCO 3KYCB 5ILGA 2RBEA 3HADA 2CD9A 1GAEO 1Y1PA 4RDIA 4UVHA 4WUVA 1I3LA 1QYXA 2X5OA 4W7HA 1H6DA 4MKXA 3ETEA 3OM9A 4HX5A 3R6DA 2VN8A 2DM6A 4GMGA 4RF3A 5DNAA 4Q3AA 4R1NA 1N9GB 5EL0A 3IAHA 4UULA 1ISGA 3FNFA 1IULA 5JO9A 4PLCA 2R00C 2J5RA 1RM3A 3PXXA 3KV3O 5I8WA 4NK4A 1MG5A 3DBRA 1HL3A 3UCFA 3ZWMA 3Q11A 2GSDA 2O3TA 4L73A 1TEHA 4P22A 3C1AA 4R1TA 4CM3A 4DC1A 3EC7A 5G4KA 5EMHA 4YWJA 3F46A 1NQ5A 2GZ3A 2ZTUA 2IXBA 4IDGA 4CV3A 3W4JA 2QG4A 4XQ9A 2VYVA 2OUIA 1DIBA 4KWIA 4QO8A 4YAJA 3IS3A 2YDXA 5LC1A 1HDXA 4PZDA 5C7IO 2VWQA 4IJUA 3BMCB 3E1KA 5C3MA 3K30A 1P0FA 5FEUA 2A94A 3VVCA 4BKUA 1XIVA 1HE4A 3E6AA 2JAHA 4BNZA 1DRWA 3K92A 4HNHA 3H9GA 1HLPA 3DHYA 1R0KA 4NZ9A 1U5AA 1X7DA 4NMHA 1ARZA 2BGKA 3FHLA 5CDUA 1DEHA 3PQEA 3JQ9A 1TI7A 2PH3A 4D43A 1OOEA 1UH5A 2DLDA 4Q3BA 2GPTA 3ZV6A 1P1FA 4KUGA 4IDEA 4WJZA 1IUKA 4Z9XA 5IXYA 2C54A 5IDQA 2CMDA 4U7WA 4F6CA 3GN2A 3UKOA 1SOWA 4W4TA 1T2DA 3HSKA 1GV1A 4YVFA 3U4HA 4UVGA 2W2KA 2HK7A 5IDYA 1TLTA 2GZ2A 4BQPA 5KIAA 2FOIA 4IMPA 3ZHYA 1BSVA 3GZNB 2GN6A 5K6AA 4BL5A 4E21A 1C1XB 3GNTA 4LRTB 4OSOA 4F45A 1WMBA 3AUTA 3KSDO 4GX2A 1H6CA 5HS4A 4NFYA 1OFGA 5T8KC 3WLEA 4TZKA 2DFDA 2RHCA 5B4TA 4E12A 1VJ0A 4B4VA 2C7VA 5COAA 4JJIA 4AVYA 1U8XX 1D4FA 4CUZA 5IG2A 4D3FA 4D79A 3WBFA 1PJ2A 1F8FA 1AE1A 2YHUA 1WAMA 4CL3A 1JDJA 3NTQA 4LSWA 5TGDA 2XOXA 3M1LA 4DYDA 1E6WA 2RHRA 1MFPA 1WP4A 1E1NA 1KBZA 3WB9A 3BAZA 1HLDA 2AQKA 1GCUA 3E48A 1X7HA 2Z5LA 1DHRA 2WM3A 3AUUA 4BO4A 4PZEA 4KUEA 3DBLB 3ZH2A 1WLYA 5ITVA 3GQVA 3B1KA 1L7EA 2X7HA 5CDYA 1RM0A 1U3VA 2JD1A 2ZYGA 2PKQP 1IHXA 2JD2A 2J3JA 2YHIA 1QYDA 1A7AA 1U1IA 3PTZA 4BV9A 4NU6A 3F47A 2FPPA 3UAGA 3ZHXA 1C14A 2NTJA 1EVYA 4IY1A 4WOJA 2O2YA 2UUOA 4BMSA 4F3YA 3UUWA 3M1AA 3V2GA 5K0ZA 1BTOA 2B4QA 3F6YA 4AICA 5ENDA 3AU9A 4XQGA 4B4UA 2P5UA 3RSHA 1GV0A 4ZRNA 4YAGA 4PG8A 3C8MA 1P1JA 5G0TA 1PR9A 4JNKA
chains in the Genus database with same CATH superfamily
3P9KA 2X6QA 1O2DA 3G79A 2PIAA 1GN8A 4NSNA 4ZQIA 2BI7A 3DDHA 3HY3A 3I23A 4JBIA 3DR5A 1SHUX 2Y0EA 3RKSA 4L8YA 2QPLA 2GRAA 3U0BA 4XFKA 3P0IA 1V41E 4EB3A 4HLDA 3OP4A 2QTAA 4IIJA 1YVPA 1CV2A 3LC7O 3NVMB 2FUNB 3VDMA 4QJ4A 4A5OA 3OWXA 1PLKA 4FFNA 4OK6A 1GTL1 4US2R 1EZ1A 5E3HA 1UADA 4EGQA 5U1PA 3SLKA 3CUUA 2GEBA 3EZLA 3D54D 3INGA 4WBNA 5L53A 1YL5A 2ZUFA 2Q9CA 1I3MA 4Y1EA 3MIIA 1QB8A 4L0QA 4N5MA 1KMNA 4L07A 4B71A 1M75A 1GZ6A 1T2EA 1V47A 3JY6A 1Q1BA 2G70A 3KHKA 2NM0A 4IHQA 1ZAYA 3KZOA 5A1TA 4YQYA 3DOJA 1P17A 2AE1A 4H4EA 4MS1A 1IVNA 2DY1A 2FQXA 1KVQA 5E4YA 5ECGC 4C0JA 3DEAA 3MUEA 4HGRA 1OT5A 1PX0A 5CMLA 5TY0A 3WMRA 1P1HA 1UMCB 1BZYA 4DSTA 3PE3A 3IT3A 1T25A 1DC7A 4TT3A 2AJDA 1A4UA 5FADA 5K4AA 4DIDA 4ED9A 1HM5A 3COZA 3WK7A 1Y8QA 2BF4A 3L6BA 3LQ4A 2ZI4A 3V1KA 3A3PA 3IPYA 1RJFA 1CU1A 2BFEA 4M37A 1WS6A 1Y3CE 2BEWB 4NEQA 4YXWA 2EZ8A 1RLMA 2R1ZA 2ZB4A 3OQIB 3ROTA 3BZUA 3PX7A 4IQFA 2V6IA 4EVRA 4AXBA 4OM7A 4OUKX 4A2QA 2DUWA 3H42B 1DU4A 1VHJA 5G0WA 1GL3A 1SQSA 2GPNA 3LX4A 4B40A 1NVKA 1GRQA 2DBQA 1YR2A 3DZIA 3HO6A 3HU5A 4FQ5A 5EHIA 3RTDA 1XNGA 5AM0A 1U7OA 3RASA 1I5EA 1K6EA 3TB4A 3VISA 4B3CA 1NOJA 4FHDA 3A6JA 3NO4A 4MVCA 5DOVA 5DSZA 4NY1A 2BUBA 3RQIA 1U8FO 3CLHA 4CKYA 4C7VA 4KPGA 2ZULA 2ZKLA 1DIHA 4JD5A 1Z88A 2PRYA 2GS9A 5T4FA 1LX6A 3A4NA 3Q8MA 3T34A 1E1LA 1RQNA 1B8VA 3IOBA 3JQGB 1GTVA 4E0BA 6LDHA 2QRHA 1HH4A 4WCDA 1SIWA 3RVDA 1NX9A 2GN2A 1UK6A 3L7YA 1VJRA 4EYKA 2BMDA 2F3UA 4RA6B 2ZWVA 4H18A 4UDNA 5FHQA 3W2FA 5DK4A 1GTRA 3DWIA 4YJ2B 1DO8A 1BRTA 4HWGA 1T43A 1RJWA 2FUCA 4ARZA 2X2FA 3LX6A 1VLVA 3H9QA 4UMVA 4BB0A 3LHSA 4WK6A 5KO2A 1V5FA 1FOEB 1CETA 4H3VA 4K2HA 5CPFA 4UAJA 2W6CX 3UAOA 5EJGA 2EATA 2QA5A 4BFWA 1JVNA 1UZLA 3NHBA 4JU8A 2YWXA 2DBRA 4KIJA 1OIVA 3ZTYA 4UTRA 1N9GA 1JHPA 5JISA 4ON9A 1Q1AA 4ZRDA 4EL5A 1XVVA 1Z0FA 3I2KA 3IQDB 1Z6PA 3M6VA 4HS4A 5DTJA 5AVSA 3QKRA 1L1QA 3LY8A 3AL3A 1GLGA 3B3GA 2ZEJA 3TQFA 1TYDE 1H9CA 4M76B 3GLIB 4ROSA 3R1IA 3OKAA 1FXUA 2E21A 2PAAA 3IHKA 4GOND 3KSBC 1MC1A 5TPZA 2JLBA 2UZ3A 5LZ7A 3TRDA 3N6RA 5HTKA 4B7UA 3WWPA 3NIBA 1Y9AA 5FWYB 3RVJA 1CZLA 3Q2IA 3RS3A 3TFQA 5A5VA 4QPCA 3B9PA 1YHNA 3GDHA 2Z3WA 2IZ7A 2VRBA 3MXOA 4BQIA 1WDMA 1X8JA 3M6LA 3S29A 4DLXA 4YAKA 5C5IA 3AHGA 4XB1A 2J3LA 3SXJA 2Q5FA 1DX9A 3ILYA 3U9LA 3SEFA 1ZITA 1LK0A 2JS7A 1Y8AA 1Z0KA 1E3IA 3Q41A 1G2QA 1TE2A 2IYAA 3IA7A 4BC1A 1HC7A 1EVZA 3ER9A 4EG3A 4URXR 1WP9A 3GW8A 2XSZD 8LDHA 4UE3S 5C5EA 1E9BA 4TKVB 2H8GA 3GVXA 1Q7RA 2Y66A 5HX7A 1EE9A 1TT7A 2X41A 2JA1A 4LXYA 1GM5A 3IQZA 1POWA 2NU8B 5DSXA 4GZLA 5JMPA 1Z12A 1KGSA 4EZEA 3AEQA 3B1ZA 4OHXA 2ZSAA 1EUDA 3D3WB 1B1CA 1X39A 5BSWA 4Z4QA 1LBHA 2H08A 3A4TA 3LCJA 3L8GA 5DXJA 4A8JB 1KAHA 1NVMB 3KIPA 1U3CA 4DJJA 4F1KA 5EXPA 1NXXA 1AVTA 3K31A 4IDPA 4N54A 5EJ5A 1YTLA 2ZRNA 3VDQA 5IKPA 2WHQA 4R2KA 3W1VA 1WEHA 1HE2A 1SBYA 5AW5A 1NHWA 4U0JA 3ZHRA 4EDFA 2JRCA 2D00A 2YFHA 4WN9A 1Z34A 2V3CC 4RMIA 3JQFC 3VA7A 3M6XA 2QTBA 2C96A 5FTLA 5J4YA 3AY3A 1QGED 3Q0IA 1H05A 2R66A 4LYFA 3AOEA 2ST1A 1Z29A 3K8QA 2ONJA 3P2JA 1GKYA 4R1PA 3RS8A 1XQ1A 1WW8A 3DBRB 3VR1A 5HJ5A 3H2SA 2NQ8A 5FX2A 2WTBA 5GIOE 3EFEA 1AQJA 4PGHA 2O50A 1X0VA 3L41A 4N65A 1R8QA 2C5AA 4R8LA 1TIBA 4IWNA 3F67A 1XKQA 2C57A 4DLRA 3NW9A 5JIBA 2VHQA 4MV3A 5CD1A 4RDXA 9ATCA 1VHWA 4BAUA 3TPFA 4MCIA 3CRVA 2UVDA 2ENWA 1YD7A 3ZGVA 2WFLB 4NNJA 1XXHA 1XTBA 1TOAA 4G5SA 1WWKA 1ZD2P 4MKZA 2D1QA 4E22A 2L69A 1J39A 3K0EA 4PCUA 1KI6B 3ES9A 2OFOA 4JP1A 2CNDA 3WHIA 3AEUB 1KQPA 4PCVA 3DV0B 3IDOA 1L1FA 1UFOA 1ST2A 3FD8A 3CTMA 3UC9A 1XCOA 3UBTA 3RNOA 3U48A 4F9GA 1QP8A 1L7DA 2J9RA 1YE3A 1W96A 1E7MA 4UC0A 5JTTA 4BUCA 5JASA 4CM9D 4WAUA 3N5KA 2QMZA 3DB1A 2BR4A 2DHEA 4KJZA 3V8PA 3I9V1 3ZWNA 3FRJA 3HL0A 4BMYA 4GPBA 4F4IA 5AQ1A 2QRMA 2JLUA 1NI5A 2WWFA 4E7PA 2ZFUA 4TROA 3AU8A 4U3JB 4YJ2F 3M6AA 5I7VA 3QXCA 3QX9A 5LBIA 5I01A 4DMMA 5C53B 3Q0TA 3H3JA 2AEFA 1J2EA 1CHNA 1CUSA 3P9SA 3QKIA 1QIEA 4H7PA 3W04A 2HHCA 4RTPA 1A2OA 1JKJA 1JGTA 3GAFA 1DOZA 3CLRC 2QUZA 2VJCA 3W2IA 1BMDA 1YZUA 3JQCA 1AY0A 1OT3A 5ALWA 3WFIA 3RBAA 3JZDA 3SHVA 3HK2A 1JW9B 3SKVA 2V6BA 3TNYA 2B34A 3HVJA 4LSMA 1ODSA 4D0RA 1JFFA 2B4TO 4N18A 1E1QA 1EA7A 3AFIA 1D2CA 3HR4A 3SF8B 4RD1A 5AJVB 1J2UA 3D4LA 4LRXA 3TTVA 4QASA 2OQIA 1WLSA 2UUAB 4BVJA 5DI9A 3KSMA 4G0XA 1IJEA 1ZLYA 4XIJA 4MQ5A 1C7QA 1NBEA 1XTRA 2WNHA 3ROQA 3WK5A 2IZZA 4L2IB 3OOYA 4G5RA 3HE3A 3LT4A 1MNQA 2JIMA 3EFBA 4YPVA 1JH8A 3GIDA 2GX6A 3DZKA 4HAWA 2XQIA 3IT2A 3IVGA 4O4JB 1TT5A 2PS3A 1ZM2A 2CL5A 3C8DA 1HFKA 4YRQA 3SM9A 1F6WA 5EQTA 3ZBQA 3W7VA 1FQKA 3TM5A 2Q7XA 3F8TA 4Q05A 1VL1A 4UE2A 1NJFA 2WYHA 3EIXA 1P4AA 4QEDA 2PKYX 4BKRA 2O2IA 2YXLA 3SP1A 4AC9A 5AKJA 4XSGA 1D4ZA 4L9SA 1JQDA 2JGIA 1MIOB 3AIKA 4QU8A 1IXKA 1AS0A 4G36A 3R8FA 3FNRA 3R74A 1KIMA 1XELA 3GOQA 4PYRA 2PLNA 1EJ0A 3OUTA 5DXAA 4RH0A 3V97A 3VYTB 3ADCA 2ZJ4A 1NYQA 1EHYA 2A5DA 2H7YA 2OVBA 2PXAA 2ZB8A 3AESB 4L0CA 4MJ3A 4GKAA 1N5DA 5J40A 3ZDZB 3ZGNA 2XCUA 2KS6A 3OPNA 2JFYA 3VMFA 1WUIS 4F04A 3FPHA 5BNWA 5F73A 3C3JA 4QQFA 2IW3A 3HP7A 5JQWA 4E5MA 5BN4B 1MB0A 4LOAA 2JFQA 2P5TB 1SC9A 1B3BA 2D59A 7ABPA 3IIMA 1PQ4A 4G5QA 5B6JA 3ZLTA 1F60A 4I5GA 4HDNA 2YIVX 2NU6B 3IO5A 3FUTA 3VJKA 2FLWA 4UEWA 1QF6A 4M4SA 2PX8A 3DEFA 3MJEA 3OETA 3HZOA 3AR9A 2XUGA 1E4VA 2IYXA 2ZB3A 4ALNA 4CKBA 2ZWPA 1I2MA 2QT1A 1ZD4A 3WGTA 1FRNA 1QYWA 1UWLA 2ZAYA 4F1JA 2Z3VA 4FFSA 3Q5EA 3DLAA 3HUDA 4F38A 2QGNA 2AE2A 3CX7A 2ZKIA 2R7KA 3H9UA 3T1YB 1G1AA 2H18A 2JFZA 1Y0BA 3CNNA 1GNLA 1UBFA 1UP6A 1YQXA 3WC4A 3SN6A 1D0IA 2OO3A 1XFDA 2AFIA 2G88A 2WVGA 4GP7A 4PX2A 3UV7A 1UC9A 5IUKC 3GRKA 1FK8A 1YQUA 5DIZA 5FO0A 3CPEA 4H31A 5E0OA 3DKKA 2OXFA 3IR7A 4EHHA 2OBBA 2YJZA 5AM5A 4BX3A 4B33A 1WV0A 2C20A 3G0CA 4BIIA 1MN6A 3AWDA 1R9NA 2NUAB 1YHYA 2BKVA 4WKCA 4HYTA 1GFZA 3E9CA 5ALSA 1QZUA 3PPIA 3SFTA 2DR3A 3WLRA 5KNDH 3V00A 2GBLC 3NALA 1UP7A 3QH4A 1HOXA 4QRDA 2WJAA 5DM60 3ZZMA 1CZRA 5DYWA 2Y99A 4YBRA 1DBRA 1P2BA 1T2CA 4P3YA 4REQA 2OHGA 2Q07A 1Y4UA 4OGLA 2VIIA 4Y7DA 4ZOLB 1JZQA 4FD3A 3FOBA 1G7TA 4I5EA 3REQB 2ZS9A 2Y1EA 3I2GA 2RAVA 4M99A 3TMAA 4Q93A 1YBHA 3G6KA 5CAEB 4Z0HO 1A8IA 2VTBB 1E7SA 1RZRD 4IH9A 4MKIA 3VAAA 3GHHA 1U0JA 4HSGA 1RS0A 1SC6A 1X7GA 2P1DA 3BTOA 1T24A 1WX1A 3HFSA 4IIHA 1JDZA 5H4HA 1UFRA 5JNVA 4A23A 1JJ7A 2ZIAA 3TF5A 1MJNA 1DAEA 4LE0A 3K9BA 4EZIA 3KWMA 3EEBA 4LY0A 2WAXA 1W1UA 3CPSA 4G1UC 4UAUA 2O05A 2OHIA 3DUWA 2GK7A 3QLVC 1BVHA 2FCRA 2PX3A 3IIJA 1TNDA 4X62B 1EFPB 3U3KA 1HE8B 4G09A 2GN1A 2F7SA 4NI5A 2FWPA 2AMJA 3ZXYA 3KKZA 2XGJA 3N74A 8GPBA 2PFGA 2IHUA 3MCAA 2E85A 2WJYA 1JKMA 1T1RA 2XPCA 3N39C 1Z5GA 3C4QA 2ZZNA 4V3CA 1ZMRA 1SK9A 2FZ4A 2VRNA 3SLRA 4AF6A 1IY2A 1K6IA 1KRHA 1YR9A 1MEEA 3IODA 1X14A 1CEYA 3EVAA 4ML3A 2EIXA 1J20A 2DPLA 2EFEB 2W6ID 5FI5A 3AKYA 2FK7A 3EGDA 1UINA 4BASA 1D1TA 3LX5A 5D3QA 4C0LA 1FP4A 4YJGB 5FOVA 4PC1A 2FPKA 2WP8J 3D7KA 4O4JF 5BN3A 5A4IS 5IH7A 3JD3A 2H1LA 4R81A 4R83A 4Z3OA 1DJQA 1MORA 4M0EA 4KYTA 4ZAYA 4RQUA 1N6KA 2AXQA 5CDGA 4WESB 4DR4B 3MAAC 3L7OA 3MT8A 1MVNA 1PIWA 3A1FA 3OFVA 3PPXA 3UXMA 4F4JA 5HJ7A 2O59A 3HKEB 1KQOA 2WHXA 2GEVA 3WWYA 1FQWA 2FHPA 3S55A 3T6KA 2KPOA 3RT7A 4GKKB 2YYZA 4CQJA 2HLHA 1Y7IA 4L78A 5C31A 4ALMA 3D8TA 1TMOA 3ONWA 4EUKA 1N0HA 1Y1KE 5EN4A 3UW3A 4AN0A 2VKQA 1QP0A 2ZBEA 2XRZA 3KOWA 4II3A 5UKDA 4AB1A 4C7OB 1KXJA 1OXMA 1IBSA 3UJPA 4LEIA 4G85A 1YZKA 1H5QA 4AJPA 2XUAA 4TXNA 2V97A 4KAAA 1SU4A 2RSLA 2X4GA 4G97A 10MHA 3IMCA 2MJLA 2G9NA 3C8ZA 4M1YA 1EIWA 4GUDA 3LECA 3TLAA 1SMKA 4TTVA 4YY3B 4Z1MA 1XCJA 3VJLA 1YS7A 2PX4A 2IYWA 2A0YA 1XVIA 1C7EA 3RU3A 3GT3A 1WB5A 4DCGA 4RQTA 1RBYA 1FUEA 3ZE6A 3RBZA 1T4MA 1AKQA 4JUDX 5B3AA 1IBRA 1KETA 2CSUA 3A1VA 2CL7X 3AYZB 3NXSA 3AVWA 2I6XA 2I4OA 3G5AA 4NE9A 4F3KA 1TVCA 1BJKA 2FF5A 1Z2OX 5ES4B 3CLTD 2FR8A 3TSYA 4EA7A 2AEMA 1AXRA 2F1KA 2RB5A 3OZXA 4HLUC 4QYIA 5AYVA 1OBCA 2O7QA 5AW0A 2Q1TA 1AMOA 3GBPA 4ZO7A 3JQBA 1GZSA 2X1VA 3GBVA 5A5EA 2GI4A 3KLMX 3TE6A 4HT3B 3TXYA 4YCCA 1YGYA 4YHHB 1ZQ1A 1OHHD 3AILA 1HE5A 2XTZA 3J81A 3WL6A 1KP2A 1BQ3A 1M67A 2HMYB 4WA7A 4HRXA 3F74A 2XCOA 4TS3A 3DD5A 2SCUB 2PJRA 2OCDA 3UXYA 1Z45A 2CFIA 2B1IA 1XDZA 2I87A 5D84A 5ADWA 3VC2A 2C9OA 4ITUA 1EVJA 1P4RA 4QICA 4TUYA 1GA1A 2JIZD 3CM0A 3WL8A 2QGFA 5A04A 1K1EA 1ZBDA 2IPLA 2B99A 5EWLB 1UJMA 4B3JA 1Z5UA 1A9QA 1IG0A 5G3YA 5KOJB 1SULA 5FOUA 1KMQA 1PNVA 3WV4A 1PNOA 1YL7A 2FMUA 4GQBA 821PA 5K4HA 1XMVA 2AF3C 1MNAA 1Y9ZA 4ZOLF 4JC5A 5DF1A 5IEBA 3RV3A 3C4JA 3ZV7A 5HA5A 3A4MA 3G2IA 3NGLA 1OC2A 5TC4A 1PJ4A 5JAHA 4DR2B 5TS3A 3P2OA 4R51A 5CDHA 4UNIA 2BEKA 4RF5A 4CMHA 4KBYA 2VJQA 4RY2A 2PUDA 1PS0A 5DNDA 1QKIA 3OKPA 1EX7A 1AQLA 3TR0A 2HR1A 2GYWA 3BMNA 1OREA 2HGZA 2POCA 3NPMA 5KVSA 1EIZA 4XJVA 2IX9A 4F46A 3VUEA 4BJ5A 1G0NA 3F7NA 5EMNA 5I6DA 3MAGA 4YIHA 5EXSA 4D25A 4FWTA 3QMPA 4U6SA 4WZ6A 4GBJA 5CG2A 4MW1A 3UBMA 4R40A 2H3EA 4Y98A 4P4SA 1S7GA 4H1UA 3DVAA 4ERNA 2ZYWX 3FPFA 2AR9A 4Q6WA 2W2VA 1LF0A 4PC3A 4PZYA 2SKEA 5CCBA 1II9A 3M3HA 1XZIA 4FS8A 4X1IB 5EE5B 3SGLA 4IQ0A 1AF4A 3UHAA 4QA9A 5ERGB 1ODLA 3TI7A 4E1BA 5C7LO 1QRSA 4H9GA 3DZFA 4MR8B 3T38A 3NDJA 4KQKA 5DHRA 3TW4A 3ZNQA 3O4HA 1FS6A 4DARA 3IEVA 2A92A 2BFOA 1AM4D 2V6JA 3GRAA 1IZYA 3I6QA 1EFRA 1N36B 3BWEA 4Y6PA 3I6ZA 4R1MA 4FE7A 4L8GA 5BQ5A 3P9XA 1PJQA 3ZH9B 2AUMA 2B5WA 1Q14A 1KPGA 2RK6A 4HLNA 1O5OA 1XV5A 2COUA 4DQVA 3B52X 3MGBA 5JXIA 3GD7A 4Y1FA 1PFVA 3H5AA 3KEGA 1J7JA 3VPDA 5D3ZA 4JKIA 2QN2A 3DFMA 1C3JA 3WWZA 1K7XB 2RGUA 2V5VA 4HUQA 3HO8A 2EQBA 4EHAA 1A7UA 5C32A 2XQVA 1T6NA 4U7TB 4Y1RA 1LF5A 1UEIA 1VHDA 2P4EA 2X8JB 4I55B 1LBIA 1CNFA 1KIFA 3V9AA 3ZGYA 1YKFA 1A2BA 5AXDA 2WV7A 4H4DA 4I4TB 1U9YA 3CBGA 4D26A 2HBRA 2WZQA 3GI1A 1CR2A 3JV7A 1HOTA 2GYYA 5FKJA 1I4EB 2HTEA 4F2PA 1NKTA 1UXGA 4HDAA 4LIPD 3WGVA 3OT1B 5KCMA 2X9NA 4JGBA 1UDRA 2VT6A 2QP4A 3THWB 3GROA 1TMYA 1F4PA 1RRKA 2PY6A 3OZUA 3RLFA 5ADHA 1OZGA 5IJZA 1D2AA 5ES3A 4ZPXA 3ACDA 1H8ED 3OIYA 3S2IA 1FP2A 4ARCA 5AUQA 3UV3A 1GGVA 3E03A 5EYPA 4GPZA 1JLRA 1J7KA 3Q15C 4YUXA 2VK8A 1NMSA 2XRYA 4FILA 3K9CA 5F3DA 4W5OA 5DXFA 1KYVA 3G5MA 4GVLA 1Y9DA 1FX1A 1MBZA 1ZFNA 1EGHA 1TO6A 2OV4A 1GQFA 4LNUB 4TV8A 3LO8A 3TQCA 4C4AA 1SVUA 3QWHA 1XA4A 3F90A 3OX2A 1H0SA 4DDMA 4A0HA 5AHRA 3GFQA 3LA8A 2PJZA 3KYJB 3EG5A 3HUEA 3DFFA 4OXNA 1E9SA 4U7HA 5EXXA 1SUFA 4V0MA 3UEOA 4DMFA 4IG4A 2UAGA 1HR0B 3H87A 3IVCA 4B7ZA 1A7JA 1FU7A 2B69A 4R6XA 2AWOA 1R74A 2BDEA 1RBQA 5ERYA 1G19A 3RODA 4EK9A 5C1PA 1FU4A 3FHTA 1WZIA 1OXVA 3RS5A 4EGFA 3TGWA 4EATA 1Q0PA 2G28A 1UJNA 3OY7A 4UTOA 4B81A 1KK0A 3AC0A 2R7LA 1OCEA 2NV2B 3COSA 3U37A 5K0FA 3KQHA 3U9SA 4UNSA 3I64A 4O1IA 4RPCA 5AM4A 4BLUA 3AEKB 5COQA 1NJ8A 2GZAA 2XX3A 1LA2A 2AMVA 2Y1FA 3PSAA 4OP1A 5DX1A 2IV7A 4C07A 4Q3DA 4LJRA 5EFOA 2X2PA 4RELA 2QUJA 2FE4A 3DSRA 4DDVA 2GAAA 1D4AA 1SZDA 1CY0A 2OB2A 3FMVA 3IKLA 3PFNA 4XTRA 5H7XA 3U13A 5M2QA 3SX4A 1ORRA 1YQGA 2R47A 1K7EB 3UIEA 3LUHA 5AK6A 2R4UA 1EVLA 3RS7A 2D54A 3LHKA 3OEYA 2H92A 2EHJA 3F5FA 3G7UA 5ESWA 1Z0DA 4FWIB 1GGKA 3N8GA 4OK5A 4MDFA 2GVNA 3E2IA 3I6MA 5CB6A 4DT1B 4JI6B 5CYGA 4GKVA 3L0ZA 4ZQGA 1PE0A 1VPEA 3RJ5A 4EYSA 4RKRA 4G81A 3MUOA 4QLOA 2CUNA 2R1TA 3JZIA 4KO1S 3L8HA 4QOEA 3I9NA 3PHLA 3EARA 3QU7A 4ESHA 3K0KA 5E6SB 2A9KA 1C1YA 2IHJA 3C98A 4YALA 2NXCA 4W7SA 5E0KB 1VRWA 1EP2B 3O94A 2PV0A 4PWYA 1FPMA 5CDSA 3W5AA 4P7BA 4PIVA 3PEYA 1RPAA 3DTVA 2IELA 3EQ8A 4YRKA 2VF2A 3L6EA 1FIUA 4OFZA 3E1GA 5F5LA 2HWUA 2AK2A 1NBMD 2ZJAA 1M6VB 3AVOA 3OBIA 2WJWA 3OPYB 4YCBA 1TM7E 3V4RA 1FMJA 3W3AA 3QG5A 2ORYA 2BEVA 1SVKA 1RABA 3EGIA 2V9CA 4KLRA 2YW2A 4J0KA 3BEOA 1RWNA 5TVGA 1T9KA 4TRRA 3FVRA 2I1QA 2WF6A 3HVKA 5FOSA 1QNLA 2MYNA 3JWIA 2P9QA 1EFUA 3S2EA 1T8YA 1XYGA 3JS5A 1LLCA 2CHEA 4TS4A 2NADA 1OXXK 1R0XA 3FOCA 4ER0A 2B4RO 1IXZA 2C7GA 3DQQA 3CE6A 3ELWA 4QHTA 4E1AA 1NZDA 3HVHA 4YAWA 3NBQA 4HDCA 3UA3A 4M9XA 5J3JA 3A9UA 5F5NA 1F8YA 1U0HC 4EZBA 4LWPA 1ONNA 4D02A 2R25B 4PY2A 4YMTA 2AFIE 5JZVA 4DJAA 3LPMA 4QKQA 3BB4A 4RK1A 4XYGA 1ZISA 4CF4A 3LP6A 4KPEC 4NIMA 5TMEA 4ACBA 1RQRA 2A2ZA 1T9ZA 5EHGA 1OI4A 5DBEX 2IYSA 2BTQB 4KLCA 3MELA 5EPUA 3SC6A 1E0AA 1KK2A 1JQKA 1DJMA 3GJ3A 4XB2A 4I55F 5BWMA 2JG3A 1SM4A 3HDYA 2D0PB 2CXSA 1Y8RA 4CLOB 2YJ5A 1H4QA 4GR4A 1DOAA 1S9DA 5E3JA 3N53A 1H4TA 4I4TF 2DLNA 2ZR8A 2DVMA 2I80A 2VHVA 2WOJA 1WD7A 1YI1A 2DUMA 2VJBA 3A9CA 2I2DA 3I0NA 3IYLW 4N5NA 4QVIA 3OM1A 3R09A 3PQ4A 4PBRA 1N2CA 1NFFA 3WGMA 1GR1A 5F7JA 4MW0A 3S8MA 5TIIA 4KKXB 4YI3A 4YGXB 1RYYA 2QPTA 1JDNA 3DM5A 4RXTA 4C3OB 2RGEA 2MR6A 1V95A 2Z1NA 4CM9A 3BN3A 3UPDA 4TRNA 5EJ8A 3DAHA 2VDUE 1TUBA 2YZ7A 3B38A 4X92A 4CM4A 3B70A 2MINB 2J6BA 3THOA 3ECCA 1OPRA 3TLCA 3JQ7A 3DOUA 1HDOA 1NLFA 3BRSA 2CJFA 5IUJC 3GLHA 4RTKA 4XKJA 3FGZA 4RJKA 3EVCA 5JI2E 5JAPA 1V26A 1G20B 3DHEA 4YRJA 2GXAA 3D8RA 3GLFB 1R0YA 2WJJA 4GP6A 2Q4TA 1IONA 2VQ3A 5C37A 1ICIA 2BGIA 3G0OA 3W8EA 3WNZA 3F3MA 2QUHA 4DM4A 1BDHA 1ISHA 3NMUF 2GTIA 3DFIA 3SICE 3HN7A 1T5HX 3S2ZA 1Z2EA 5EZ5A 1N2IA 4MS4B 4V2UA 3NBZC 5ALJA 1GIAA 1QAMA 1U3FA 2FWBA 3HU1A 3KKMA 4R05A 4Q03A 6GPBA 5JS8A 5KOHB 2XCQA 3JZFA 4YPOA 1UK9A 3LPNA 4G5GA 1XA3A 3O1IC 3P9YA 4KTVE 2YZKA 2V0NA 4B8YA 5KVVA 3IX7A 4HNAA 4BMZA 1RWQA 1Y3FE 1CYDA 2B8EA 2G5TA 4YONB 3E8SA 3T7DA 2XJ4A 3DO8A 3NTRA 4HAUA 1KJWA 1SEVA 2GHQA 1LY1A 5CLQA 1YZGA 4MNTA 4ESEA 1AS3A 3I32A 4GXRA 2AXEA 2EX0A 2ZETA 3B6MA 4QWWA 1DLIA 4QL3A 4OLFA 2YC2C 3QFHA 3ZWPA 1QVZA 3QJGA 1CVLA 2QJOA 1YS4A 2JCVA 4XYEA 2IGTA 1ZIDA 4PINA 2WY2D 3EJ6A 1M2NA 4AKTA 2FLVA 1VZ2A 3B82A 4G0NA 1RHJA 2VDJA 4MP6A 5FI1B 3KAQA 1DAFA 5AIAA 1XZFA 4J0EA 1R00A 3L6CA 4LZJA 1PJBA 2XTJA 4AG5A 4F0JA 4U9IS 2J30A 4DSNA 3DF7A 2HU5A 3C14C 2Y4OA 2CE7A 3HLYA 5FTWA 1SD1A 3A05A 3WO0A 1UXHA 5EHNA 1B0ZA 4HH4A 4MV5A 4X94A 1T5SA 2OFXA 3ONNA 2IODA 4NE2A 4ZYLA 2Q28A 1OTXA 1FDVA 3D6TB 3WYAA 3ZLJA 4BPRA 2V6MA 3C2QA 1WY7A 4A6DA 5K9ZA 2YWJA 2DKFA 1V37A 2XUOA 2HMWA 4KIFA 4Z0TA 5DNCA 4M87A 1F7UA 3D81A 3CUWA 4BDTA 3K5WA 1CLEA 1NX6A 4HO1X 3C7TA 3M5WA 1T4CA 2Q21A 4YRNA 4WXYB 4DV5B 1PVVA 1NSYA 3PRYA 4TN1A 3OBBA 1OU0A 1TLFA 1U28C 3LDAA 1W73A 5IW8A 1LPOA 2EJTA 1JIQA 4M98A 2H6EA 2CNOA 3EX7C 4AYTA 1JXOA 1KKMA 3NWBA 3ZV5A 3WSVA 5ED4A 2N47A 1GOTA 2NO5A 3QRWA 4HAIA 1E0JA 4F93B 2HKIA 5FOQA 3HA2A 5I7UA 4JBNA 1O95D 5FWXA 4LMRA 4R0VA 1S3IA 2HBYA 4QXAA 1E7YA 5E1OA 1ECPA 1GP2A 4AUKA 5B7GA 5BWCA 1LTKA 4PHFA 1NQTA 3ZVKA 4Q9LA 1UXKA 3ISVA 2B61A 3TW8A 3P9CA 1Y3AA 2ZU6A 2I6FA 4BFCA 3PWTA 4RD2A 2EKDA 5KJ6A 4DXHA 5CA0B 5JSKA 4IIFA 4AJKA 3U16A 2V6FA 3ONEA 4BTVA 2ENUA 4NAHA 4XD7A 2AOWA 2I65A 4IRXA 5LN1A 1XLWA 5JSHA 2NZUG 5IAAA 1NXOA 5LB4A 1GA6A 5DISB 3UMCA 3RJZA 1PFGA 2O0JA 1IZ8A 2CVFA 3MOSA 2WVAA 2F8TA 1UL1X 1W48A 4MDYA 1WKBA 7REQB 4RVHA 2RGBA 1VIVA 4EJMA 1WMSA 1ZMXA 3E9EA 3IBFA 1VE9A 3O82A 1AKTA 1ILWA 1FLDA 1NJ1A 2P8JA 2GJKA 2PSDA 4UPDA 4FOPA 5FUVA 1C30B 4OHRA 4NNOA 2C9BA 4WXEA 2M9MA 1KMCA 3D7MA 4P36A 1QAQA 3LQFA 3HFGA 5JZMA 2A5LA 3PNBA 3PPYA 2CL6X 2EZ9A 4G4SO 5EIWA 4LY9A 2VP9A 4ETWA 3P7MA 1N7HA 2XI4A 4BO0A 1M6WA 2FWMX 4HK4A 4WZAA 3DUFA 3HJAA 4X1YB 4Q9KA 3K32A 2GWRA 4JCOA 2Z6QA 1X1DA 4AT1A 2IWHA 3T9AA 1R64A 3LC0A 4JODA 4AW9A 1YZHA 3NDIA 3GQBB 3QWFA 3VAZA 1CIPA 3S6JA 4DGSA 1IOLA 1Z6XA 1ZY2A 3D4PA 1AKUA 1J0AA 2EX4A 4YLYA 3R9IA 3SQMA 5KJFA 1N75A 4PFQA 3C24A 1J8MF 1EH5A 2B8WA 3QVGA 1CUEA 2A84A 1EP3B 3M3DA 2KJQA 2NNLD 1JA9A 5KTOA 1HQYE 1KNXA 4LOLA 1CDDA 1UBMS 4BBJA 4URUR 2FMFA 4BKQA 2V7QD 4ZI7A 4ZHQF 5IXJA 4GKJB 4HZIA 3G5UA 4IZIA 1H9AA 1MENA 5CEJA 5DYIA 3FWYA 4GP9A 2AG5A 1TUIA 1TVEA 5CNMA 3NHYA 3GGJA 4EJSB 2EFYA 3K4HA 2YHAA 2QJFA 2ZSHA 3JTEA 3TE7A 3B9QA 1NQUA 5JAZA 1S1MA 1S8NA 2R8EA 2Q6TA 3MWLA 5AKKA 3SEZA 2DR2A 1UAAA 1RVDA 2FUG1 3GCGA 5CM8B 2XCTB 1JIXA 2RGNC 1PGQA 4ZV9A 3NHKA 4ZXPA 1QGUA 3S27A 4F97A 2BV3A 2VR1A 2A7QA 1DKUA 3BA1A 3JAKA 3WZLA 2YWGA 5CUQA 4B79A 4PRYA 4UXIA 4UZEA 3X1KA 1XRQA 2HA6A 3TINA 4DXAA 4DMRA 1QG6A 1DQSA 4TTSA 6PFKA 3HP1A 1H2ZA 5A3SA 4TWBA 4BNMA 4DRZA 4YO7A 1T36A 3P2KA 4YECA 5HCNA 3B78A 3VVBA 2CLHB 4YT5A 1NOKA 2EWVA 2RK3A 4W1SA 1NSTA 5K6TA 1Z38A 1IBCA 1ZXBA 1SKAA 3A58B 3G0GA 4MPDA 4PLPA 2M1XA 3L4BA 4DCUA 5HTOA 3SY8A 2ONCA 4JJEA 4QDOA 1OZAA 1J70A 1YDFA 3AW8A 5L3QB 1ECFA 1GPKA 2JIQA 4HJRA 4OGGA 2IEYA 3EWIA 4URYR 1QG4A 2QMHA 1Q95A 2QG6A 4HGQA 1A5AB 4EX6A 3NHFA 2Q46A 2OORC 3WGIA 1DJLA 1UBCA 2GO1A 2ON6A 3NTXA 4CE6A 2QBYA 3PNQA 4QBFA 3UOGA 4YWHA 1J8DA 3WHLA 1US8B 1C9YA 3W8FA 3M2PA 4MR9A 4JJGA 4UUMA 4RNDB 4KVAA 4WNCA 1DDIA 3TLMA 5LP6B 1YBFA 3HYLA 9MHTA 2X8BA 2YV5A 3QM1A 4DUYB 2W4IA 3COPA 2EL7A 3KJEA 1TQ2A 1QRTA 2EZTA 4RAQA 3UJ9A 1LK7A 3UWPA 5CXSA 4OHMA 3A6FA 3FFAA 4HX9A 1FSGA 4DG8A 5BVHB 1T0HB 1RRMA 2OZLB 3K2QA 1NY5A 3L49A 1IXRC 1KO4A 2WU4A 1KSGA 4R1OA 3LBHA 3L7NA 4YASA 5BW6B 3WX0A 2XA9A 3CZ5A 4YMIA 1PZHA 4IKPA 2BGRA 2XWBF 4KAFA 1Z7BA 3T7TA 3AW9A 3WMWA 4BMOB 2EV9A 3ORFA 1SXJB 1WZNA 3W6OA 2BTEA 1KRXA 1OV6A 2IHTA 3TDKA 5CA0F 2AW5A 1XDDA 5B1YA 5LQUA 2H1FA 3B6KA 1W85A 2I4LA 2JIZA 2ZRBA 1MW9X 5CLGA 3RR2A 5BUQA 1IEWA 1SVIA 3V1LA 4JJFA 3ODGA 4RZ3A 4W8HA 1VLMA 2BRUC 2XA1A 4RK6A 4OFXA 5CVDA 1BVUA 5K0GA 1VB3A 4W1QA 2OE2A 3NONA 3HB7A 1L4FA 1XJQA 1VSVA 2C0PA 1ZI6A 1X7ZA 3QJYA 4L5IA 4O5OA 5IKMA 4R71A 3WGKA 4OUDB 4MVJF 3ZWDA 4YK7A 5JJBA 1I01A 1QDEA 2YKGA 1BVRA 4IF6A 1CX9B 1E3LA 1F17A 2QIOA 4KRGA 1Q3KA 3K6KA 2Z8YA 3SXPA 2HW8A 9ABPA 3HXOA 1NURA 2QT9A 4WHMA 3VDXA 4N5HX 3KTAA 3T1HB 1K63A 2BLLA 3KQPA 3N0VA 4NEGA 2J3MA 3CUEF 5B55A 4Q66C 5BYAA 4BMCA 4WACA 1B0AA 3F1KA 1K68A 1P4GA 2OXTA 3G82C 4J0GA 3G8AA 3L8MA 3THSA 1I2CA 1A0OA 1PN3A 3NFRA 4ZT4A 5AI9A 2AMLA 2F1OA 1GZVA 4LRWA 1ZUNA 5TSDA 1LDEA 3CVJA 2R0QC 3HPRA 1PF7E 2KLHA 5EQDA 5H8WA 3KOMA 3NV9A 1OAKA 4A2PA 3L1UA 4CYMA 2G83A 5F9HA 3K6JA 1DUIA 1O94D 2JCYA 3SG0A 4DWJA 3ZHOA 4H7KA 3P5SA 4B3BA 2CUZA 1M34A 2BHNA 2I8AA 4P4TA 4LF5B 2QN1A 3FTCA 4IO0A 3X1XA 2OG1A 1A69A 2VOJA 1I14A 1ABBA 3CX4A 5AW6A 5DO9A 1LI5A 5HPYB 3QK7A 2NXEA 2PXHA 4G4IA 3LZ6A 3HZRA 3STXA 1TK3A 4J2OA 4XUGB 4OYYA 3G2HA 4FXOA 2VHCA 2QX6A 1XZGA 4XTCS 1U7TA 1QVWA 4Y9RA 1WVMA 3G2JA 4BFSA 1QLHA 4DB2A 4JQCA 5AD1A 1O0BA 4EYQA 1U1CA 1W25A 3AFGA 1AQNA 2GKSA 1XO1A 3DO5A 1VE7A 1Q0UA 3QP9A 4LYHA 1I1NA 3PBKA 4F3NA 4IJWA 3KETA 2GD2A 4HZUB 4KAXA 2JFXA 3H9JA 4INAA 4J1QA 4LC0A 4O08A 1A7KA 3TL6A 4YP5A 1CUXA 4D41A 1F4LA 1FTQA 2O8DA 2YVKA 1FVXA 1E9AA 4A7PA 5JYCA 2PR2A 3QNMA 3KPVA 4PO1A 1U6IA 1NT4A 2XWPA 2G4LA 5FUQA 3WICA 4OLHA 1N2CE 2Y67A 3BSYA 5J2UA 2PS9A 1ZZEA 3LQYA 5ARCA 4JP2A 1OWNA 2WIFA 2QY6A 1Y1RA 3H05A 2CXHA 5I8ZA 2H9IA 3M6MD 4PCLA 1ZCBA 1NXQA 3EQ6A 1M3SA 2OZVA 2PJDA 3BH0A 1UOPA 5D00A 2O2GA 4Q00A 2A1TS 4YREA 5EJMA 4ZZ3A 5IN4A 4IGEA 4KH0A 1U3GA 5IBQA 1CJBA 4PZZA 4FWBA 3WGLA 5K8VA 3BRCA 1RC8A 4A8HA 4BTLA 2W6PA 1VL6A 4P4LA 4K86A 1CUFA 1CY6A 4QOGA 4ZU3A 1M83A 2IU3A 1HV8A 2PZ8A 1KC3A 4RD3A 4ZQCB 5TNXA 2LW7A 1IWBB 4QXQA 5FR2A 3IKTA 2X7JA 3CA8A 3SHTA 5LP6F 1QMGA 1VBKA 4WFJA 1L5MA 2EJCA 3RE1A 3GLHE 3PQ8A 3PTAA 2WQZA 1T5BA 1ESEA 3U3DA 2ZRPA 1I13A 3C43A 4DAOA 3KE8A 2Y77A 3T4EA 4E4YA 3VNUA 3GA0A 1W76A 4O29A 3I76A 5D01A 1KVUA 1Z5PA 3LLSA 3K6RA 1PBTA 2WD9A 1EG2A 1M2OA 2DPHA 2XIJA 3F5SA 3Q88A 4MIKA 5CJPA 2C7RA 3M82A 4WDRA 3T5TA 3KAJA 4GIBA 4Q4CA 4L15A 3H0CA 4OGFA 1RI1A 2HAEA 3COJA 1N2XA 4D4KA 4CN8A 5CDTA 4E32A 5KYYB 2WHPB 3WO1A 1E2BA 3WADA 5TQ2A 1NKVA 3VNRA 5KOIA 2A5YB 3KDSE 4QPZA 4PGFA 4RTNA 2JBWA 4PFKA 3G2PA 4U0KA 1J97A 2BDTA 2HA2A 1NJ6A 1WTCA 2P5SA 3HN2A 4FZRA 5I9BA 5IT4A 4G41A 4AKEA 3OJXA 1OLUA 2QF7A 1Z75A 2MR5A 2PFKA 4KH1A 1U7ZA 2YMPA 4RJIA 1CLUA 1XE3A 1Z5VA 1ZH2A 3BXHA 3P94A 2C7QA 2AUNA 1W88A 8MHTA 2TYSB 3QXXA 4PPQA