2CD9A

Sulfolobus solfataricus glucose dehydrogenase 1 - apo form
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
366
structure length
363
Chain Sequence
MKAIIVKPPNAGVQVKDVDEKKLDSYGKIKIRTIYNGICGTDREIVNGKLTLSKGKDFLVLGHEAIGVVEESYHGFSQGDLVMPVNRRGCGICRNCLVGRPDFCETGEFGEAGIHKMDGFMREWWYDDPKYLVKIPKSIEDIGILAQPLADIEKSIEEILEVQKRVPVWTCDDGTLNCRKVLVVGTGPIGVLFTLLFRTYGLEVWMANRREPTEVEQTVIEETKTNYYNSSNGYDKLKDSVGKFDVIIDATGADVNILGNVIPLLGRNGVLGLFGFSTSGSVPLDYKTLQEIVHTNKTIIGLVNGQKPHFQQAVVHLASWKTLYPKAAKMLITKTVSINDEKELLKVLREKEHGEIKIRILWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords GLUCOSE DEHYDROGENASE
publication title The Structural Basis of Substrate Promiscuity in Glucose Dehydrogenase from the Hyperthermophilic Archaeon Sulfolobus Solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 112
structure length 363
sequence length 366
chains with identical sequence B
ec nomenclature ec 1.1.1.120: Galactose 1-dehydrogenase (NADP(+)).
pdb deposition date 2006-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
A PF16912 Glu_dehyd_C Glucose dehydrogenase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2cd9A02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2cd9A01
4RCVA 3QY9A 1PZGA 4E3ZA 2HMUA 1XSEA 4UVHA 1IHXA 1QR6A 2RIRA 4N54A 1RM4A 2X9NA 4R69A 1K89A 3P7MA 4QXMA 3BAZA 3PRJA 2CF6A 4PLVA 5CDGA 3GAZA 1UAGA 1WDKA 3JYPA 1DIGA 1JKFA 4LK3A 4WK6A 1HDOA 4D79A 1U5CA 1T1SA 2EWMA 3L9WA 1PJ3A 1UP7A 1UXHA 3GAFA 1X14A 3QSGA 4G5HA 3RUIA 3DBHA 3H5NA 1H9BA 3BIOA 4R1UA 1M76A 5TS3A 4Z0PA 1DRVA 1H2HA 3DBVO 1ZK0A 3PQEA 4P4LA 3WGZA 2W2KA 3UVEA 5C3MA 4X54A 4GKVA 2EG9A 2Q45A 2PK3A 1D7OA 1SOWA 4J90A 4CR7A 1QP8A 5BSGA 3PTZA 2ZK7A 3CMCO 1ULSA 3JQCA 4AJPA 1YO6A 3K73O 4UVDA 3NTOA 3RC2A 3GR6A 3JYOA 2O4UX 4UUPA 4XJTA 4WCFC 4YA6A 3ZU4A 5C7IO 3WNVA 4YAGA 2DFVA 2IZ0A 4BNGA 4B8ZA 5F5NA 4BO8A 5A02A 3DXFA 3W4KA 3OM9A 3OIFA 4UVIA 1IULA 1MFZA 4XGIA 3GQVA 4Q3CA 3G49A 2V6MA 1HDYA 4R1NA 3ENNA 5CPBA 1EZ4A 4CLHA 2VQ3A 4Z0TA 4E30A 5THQA 2B83A 2EP5A 1YL6A 3B1JA 4A10A 1HKUA 3SC4A 3LF1A 2QRKA 4IDAA 2VHXA 3RSHA 4JBGA 1FXSA 1GQYA 1NYTA 1DSSG 1CF2O 3GGPA 1GUZA 1F8GA 1YONA 1E6UA 4IUYA 3ZWMA 4CM9D 1J6UA 4R3NA 4FJ1A 5G4KA 3TNLA 3C7CB 1EE9A 1KC3A 1R0KA 3JD2A 4PVCA 4KMSA 3DOCA 3ADOA 5BQFA 9LDBA 3C1OA 3D7LA 4ZRNA 4Z9YA 4LMPA 5HM8A 3AFNA 3C7AA 3TZ6A 1LUAA 2X5JO 3KV3O 4WNIA 4D3DA 2P5YA 1NFFA 1XA0A 3PQDA 3CZRA 3I9MA 4BNMA 4FFLA 3E6AA 3K2BA 4AVYA 4GX0A 4K6CA 3IKVA 1HDCA 3CH6A 4XIYA 5L53A 2NTJA 3DAPA 5JDCC 2BFMA 1LC3A 1DLJA 3K31A 1EVYA 3B1KA 1IB6A 4W82A 1TT5A 1HETA 5I7VA 1Z82A 4DGSA 2NU9A 1YGYA 3V2UA 1OI7A 4PFJA 1Z45A 3I4FA 2YJZA 3VPHA 4RVDA 4IINA 1UAYA 3ZU3A 3MZ0A 1WMAA 2VWHA 1LLUA 3F5QA 1D3AA 4GLOA 4ND2A 1H6CA 4DQXA 4FFNA 3Q2IA 4WOJA 4IS2A 2UV8A 4E5YA 1L1FA 2ZB8A 1JKIA 1IUKA 2XOXA 1PEDA 3MJ4A 3H5RA 1BHSA 2O3JA 4RO0A 5TC4A 1WW8A 4DXHA 3CSDA 4CMBA 3QLJA 1B14A 2NVUB 3BTSA 1IYZA 1Q0QA 5TF4A 4IZIA 4MVJP 4BUCA 5C37A 2Z1NA 1RM3A 1MB4A 1J4AA 4OSPA 4BNXA 2POQX 4RF2A 5KOIA 4JBIA 1CEQA 3D1LA 3I1JA 2D3TA 5I8ZA 1RJWA 2Y1DA 4IQ8A 4FFOA 4PG4A 3WQSB 1DRWA 1HLDA 2A35A 4TZTA 1KC1A 3WDSA 4KZPA 5B12A 3GZ4A 5TIIA 5JYDA 4IPTA 2O50A 3DBRA 4MDHA 1ZEJA 3U4HA 5JSFA 1HF3A 5BNFA 1GZ4A 1E5QA 2HSDA 2QQ5A 2EIHA 4L4RA 3AM5A 3ASUA 1R4MA 1EUCA 3NAQA 2C5AA 2PNFA 4NJMB 5COBA 3EYWA 5KJ6A 4IXTA 5AXDA 1MGOA 2BGMA 1YBAA 3E18A 1KY5A 1GU7A 2PGJA 4QX6A 3R1IA 4TVBA 3QVXA 1DFGA 2GNAA 4WCFB 4CLOA 1X7DA 2QW8A 4OOFA 5JMPA 5ILOA 5K9ZA 3A28A 1SO8A 2AXQA 1YH3A 4ZD6A 3DFZA 4RDHA 1GADO 4B3JA 1E0DA 3LU1A 1I2CA 3RC9A 4MO2A 4FFPA 3E82A 2F00A 5CDSA 3T4XA 3S2IA 2DBZA 2O3SA 4U6QA 2GN9A 2IZ1A 4FR5A 5JYEA 3NT5A 1VLLA 1E5LA 4EEXA 1V9LA 3LT4A 4O5OA 5CDYA 4L75A 3OIGA 1H9AA 1HTBA 1P0FA 4YB8A 3W4JA 1LI4A 4GLLA 4PG5A 3C8MA 3NGLA 3FTNA 2WE7A 3JQ9A 4CR6A 4W6ZA 1VSUA 2XXJA 5EIOA 4E4YA 2AMFA 5IDYA 4OHUA 5KCZA 5KWEA 1VL8A 3RBVA 4B7XA 1TVEA 3CZMA 4YQZA 2NTVA 1EVIA 3K96A 2E6UX 2EKPA 4GPD1 4J1NA 5DN9A 2IEBA 2J5QA 4FJ0A 4DPKA 3WGGA 2UUPA 4I9HA 4E2XA 3W4IA 1WVGA 1D4FA 4OMUA 4FOOA 1WPQA 2Y66A 2A92A 4LCEA 3PHGA 1NAIA 3KB6A 4XZ3A 4CLRA 1O94A 3GFBA 3JQFC 5COAA 1KVSA 3JQBC 1Y8RB 4E32A 1VKNA 3EZYA 4R5MA 1LSUA 1XKQA 4BGUA 3GZNA 2VHWA 3G3EA 1PJTA 4P4NA 2JCXA 4H3VA 1DB3A 3DHEA 2WYVA 4ONEA 4PLGA 3AY3A 1DXYA 1E3WB 2G76A 3V2HA 3ITKA 4BO3A 4IJVA 4LVUA 4YBZA 1LDGA 3DC2A 1G0NA 4MIEA 3X2FA 3KM0A 1K6IA 5ITWA 3OBBA 4AJ2A 2O3UA 3AOGA 4KQWA 5I9LA 1P44A 3ZWPA 2OMEA 3IAHA 1P1KA 4INAA 2V6GA 4RZIA 5TJHA 2GR9A 4ZN6A 1K5HA 3L6EA 1O95A 1CWUA 2ZTVA 2YFQA 2ZATA 4WNCA 1WZEA 1F12A 1OC2A 3M1AA 1MXHA 5CG1A 2YQ4A 2BFAA 2YYYA 1ZXLA 1WMBA 1ENOA 2HK9A 3PWSA 3D5TA 1A4IA 4J9VA 1T2CA 4W99A 4IS3A 1JWBB 1GTMA 4YJHB 4B3IA 3PQFA 1L7EA 1KOLA 2C59A 1PWXA 4YRBA 2D5AA 4FGWA 3K6JA 1ADCA 1T2EA 1E6WA 1LQUA 4L8VA 1X1TA 4LVCA 4Y6RA 1GV1A 4TRJA 2HMSA 1BWSA 1N1GA 1R6DA 2ZIZA 4FBGA 1CQJA 4WE3A 1PS9A 1KIFA 3RBXA 3ZHYA 5F21A 4PG7A 1Y8QB 4ITUA 2DAPA 3LLSA 1F14A 1YB1A 5L95A 3KHUA 5KNLA 3DMTA 4R9RA 1JQBA 5IN4A 4HBGA 2X1HA 4HWKA 1EDZA 3SEFA 3TPCA 4FS3A 2Z95A 2GSDA 3L07A 4YRAA 1UR5A 1C1DB 2JAPA 3UICA 3EUWA 1EQ2A 4BO2A 1SC6A 4XQCA 3OFSA 2WYUA 2FPPA 5A4DA 3GPIA 3F9IA 3LC2O 3S2EA 3ONFA 3WB9A 2B4QA 3SJUA 1F17A 2JAHA 2Y05A 1YOVB 4LGVA 3IC5A 2AEFA 3KOUA 4MVJI 3ZH2A 3VZPA 3W6ZA 2O3RA 1DOHA 2X4GA 5KTKA 2X9VA 4O1MA 1MFPA 1PQWA 1TT7A 4YEDA 3ZV4A 3CINA 3K2EA 5EPOA 3FNEA 1SCUA 4BGEA 2BF7A 4BQPA 4CLXA 4YJFB 5KJCA 5KJFA 1ISFA 4Z0HO 1NHGA 2NSDA 1KVQA 3FN4A 4WEOA 5DZSA 1ID1A 4ALIA 1BDBA 3CXRA 3WGQA 1JW9B 2VZ0A 4JJFA 4QT0A 2J3IA 5JY1A 3FBTA 4R51A 1I3MA 5F3RA 3VPFA 1VJ0A 5KVSA 2FWMX 4OXYA 1NASA 4BIIA 4BL5A 1Z7EA 2Y0EA 3HN2A 5K6AC 1H0KA 2G5CA 1LX6A 1BW9B 3IUSA 1W73A 2EKLA 5ICMA 3PJFA 1BVUA 1C0LA 3MJTA 2YHIA 1SEPA 3NX4A 4FSHA 4L4XA 1GFSA 4YAEA 4GH5A 2HRBA 3T7CA 3LK7A 4AL4A 1N8KA 5IZCC 5JAIA 2WDZA 3KYCA 1Q7BA 1RYEA 3PIIA 3RKRA 1OOEA 4OOEA 5CG2A 3GNSA 4A03A 1U3VA 3JQEA 4RF5A 5CHEA 5JDIC 1BSVA 1XU7A 4P38A 1GY8A 1SNYA 3LT1A 4IXWA 4KDFA 3DDNA 1M66A 3S8MA 1TXGA 3NKLA 2CVZA 4NFHA 3RROA 3DWFA 4MVJH 4YT2A 1QV6A 2R6JA 3QWIA 2AG8A 4IGEA 4TZKA 4A27A 4DBZA 3MTGA 2J3JA 5T5QA 4XYLA 1D1TA 3F4BA 3ZWVA 3OECA 3L6DA 4HFNA 1KYQA 3KO8A 5KVQA 2UVDA 2OFPA 1LC0A 3WSWA 2D2IA 5FI5A 3WQQA 1BG6A 4IDCA 3DZIA 3R0IA 4CM8B 1PX0A 2C2XA 1E7MA 3GDFA 1X1EA 3KTDA 5FYDA 1C1XB 2Q4BA 5KKAA 3ZNPA 1OBFO 3WIDA 1VI2A 5G0WA 3H9QA 5U4QA 2EF1A 4MIYA 2C29D 4R9SA 1ZNQO 4FW8A 3WG9A 4CPDA 4EDFA 5IDXA 3GG9A 2ZJ1A 4R1SA 1GZ3A 3WYEA 2VHVA 2AE2A 2C7GA 2I3GA 2E48A 2IYOA 1QYCA 2AQHA 4IZHA 3ZZNA 5IF3A 3NJ8A 2CMDA 3UKOA 4BNVA 3STHA 3BMOB 3GGOA 1ZZEA 2UAGA 1PJSA 1LSJA 3B20A 1E92A 5IXYA 4BV9A 3Q11A 4CMEA 2IRWA 2JHGA 4XCVA 1Z74A 4LW8A 1GCUA 3ROMA 4DTIA 3P2OA 3ETDA 3JQ8B 5GZ3A 1VJTA 5JXWA 3EVNA 1PJ2A 1T4DA 4GMGA 2IE0A 4XRGA 4AJ4A 2CSUA 4JNKA 5IN5A 1I2ZA 2VRBA 4IDFA 2PD6A 3ROQA 1CYDA 1AN9A 4RVUA 4CQLB 1T2FA 4UULA 3FWNA 4AFNA 2NU8A 2X23A 3PJGA 6ADHA 1U3WA 2Y67A 1E7SA 4ALLA 2HJSA 2ILTA 1UH5A 1WDMA 2Y1EA 5F1KA 5HS6A 3NYWA 3WXBA 3DZFA 3NGXA 4RVHA 4E5PA 4JX8A 2JFHA 1P45A 2CNBA 2Q46A 2PKRA 2DC1A 3MJEA 4K26A 3H9UA 4NK4A 1XHLA 5G0SA 4ZQBA 1P77A 3D4PA 3FSRA 3WYBA 4BKOA 1U4SA 4MVJA 2RH4A 3I6QA 4DIOA 3KEQA 4I5GA 1AHIA 3D3WA 4OM8A 1ONOA 3D4NA 4YR9A 4TRMA 1H94A 3WLEA 5I9MA 4BNUA 2I99A 4J91A 2H1SA 2FP4A 1EFLA 2QRJA 1NWCA 1U7TA 1DAPA 1UZLA 1PU2A 1KETA 5IZ4A 3F4LA 1GPDG 2H63A 2AEJA 2W90A 1V3TA 1P1IA 3U3XA 3BMQA 5B37A 2TMDA 3WMXA 4IJWA 4YT8A 4RVFA 4B79A 4EJMA 4EUHA 3ORFA 1YS4A 4EJ0A 2JKVA 2DU8A 3AM3A 1HDZA 2WD7A 7ADHA 2VWQA 1HDRA 5KVCA 1LQTA 4BO9A 2O7SA 1DEHA 3RWBA 4CM4A 4QO7A 2H5LA 1O0SA 2HUNA 1EVZA 3DZBA 4BGVA 1O89A 1ISHA 2OUIA 1PJLA 1U28A 5IJZA 2AG5A 3ROPA 2I66A 5L3ZA 3BMNA 3QIVA 3I9JA 3WGTA 2BRUA 4XQEA 1MP0A 3DBLB 5A04A 4PCVA 3F1LA 2I76A 2Y0DA 1R12A 3RD5A 2W98A 2GD1O 3WX0A 2C5EA 4Z9XA 3RFXA 2J5KA 1E3EA 1AXGA 1RYDA 3A14A 1NAHA 4CM1A 1S6YA 5G2OA 3K92A 2XAAA 2JL1A 3WMWA 3S2FA 3I52A 4CJXA 4J0FA 1UDBA 2VT2A 3H6KA 4GWGA 1Q0LA 3E9QA 3PK0A 4PG8A 3VPXA 4IMPA 4CUZA 4YXFA 2W8ZA 3ETEA 3L6OO 5IDQA 3RJ9A 5BSFA 3GVCA 2OZPA 4A73A 1EFKA 1XIVA 2HMWA 3O8QB 4Z6KA 3FNHA 1NWHA 5JMWA 3VPGA 1DRUA 4QUKA 4CMCA 1YVEI 3ETGA 1ADFA 1KEUA 2GRAA 5DCYA 1M75A 3E8XA 3U5TA 2FRDA 4W9NC 2FSSA 5JNLA 4DIFA 5T6BA 2VUTA 1LRKA 2DBRA 1N7GA 1A27A 1BTOA 1PGQA 2OBNA 4J0EA 3HJAA 3PWZA 4GGOA 4AJ1A 3R3JA 4BMNA 1P31A 2WSBA 1BDMA 1T26A 1ENPA 3GFGA 1P33A 5DBGA 3RUCA 3NJ4A 1GR0A 2ZB7A 1Y5RA 3AU8A 1LLDA 4CMAA 4DREA 3INRA 4ND3A 3DONA 3EMKA 1W4ZA 4MINA 3HSKA 3IIEA 3V1UA 5L7YA 4BNIA 1N7HA 5JO0A 2TMGA 1U2DA 4P22A 4CL3A 4D42A 2R2GA 3A06A 3PLRA 3ZU2A 5EINA 3TZQA 3V5NA 1LDMA 2Q99A 2AQKA 4OYRA 4YRDA 1GQQA 1WLYA 3DB2A 1I24A 2P68A 1V6AA 3PFFA 4N5MA 5BNIA 2PTGA 4GSLA 1I5RA 3TOXA 2VHZA 5CEEA 4OAQA 1QLJA 3NDJA 4ZA2A 2VOEA 2YDXA 3GUCA 3ZWOA 4IDGA 3VZRA 1PGJA 1I10A 3GDGA 3RVDA 1HDXA 3BHMA 3G17A 4BVAA 2C54A 2Y99A 4BNWA 1NNUA 3H7AA 1LDYA 2NADA 3DL2A 2HU2A 3OJOA 1ZBQA 2BMAA 2CDCA 1I2BA 1DIAA 1QYWA 2HRZA 3D64A 4I9NA 4OKIA 1VKOA 2GYYA 2G82A 2ZKLA 4KTTE 5L9AA 5DCUA 2GZ1A 2I5PO 2YQ5A 3I5MA 4R41A 4BMSA 1YXMA 1K2WA 2ZB4A 4FC7A 1FMCA 1N9GB 4BNKA 4UUOA 1BXGB 1WZIA 3L4SO 2HDHA 4CL8A 1WAMA 1LNQA 1UXKA 3GDOA 4RDIA 3ZHBA 2JCVA 1I3KA 3PZRA 1XR3A 4TROA 4J1SA 3DZHA 4N7RA 1JAYA 3DAFA 2PWZA 3OQ1A 5KIAA 1QYXA 3JV7A 1R4NB 4MVJF 1GYRA 1C0KA 3MJSA 5F5LA 3UOGA 2QG4A 2HCTA 1HE2A 4PZDA 4S1VA 5JCJA 3RUDA 1DIHA 2XXBA 5ENVA 1FDUA 4LSMA 1B8UA 1SB8A 2D0IA 1ZMOA 3QWFA 4ROSA 1LTHR 5C7OO 5BR7A 1I3LA 1V3UA 2HK7A 5ER9A 2J3HA 5T67A 5A3VA 2ZYGA 1DLIA 3GVPA 5DP2A 3DBHB 1VRWA 1I8TA 3MOGA 3U0BA 1A5ZA 4YAIA 2GUGA 1E1KA 2ZTLA 3AWDA 2FZWA 2HKIA 1MC4A 3WGIA 1UP6A 3IP3A 3LYLA 3EZLA 4N18A 3E9NA 1Z7BA 2NU7A 1QORA 3VH4A 3ZW9A 3QVTA 3SC6A 4U0KA 4XR4A 2OOSA 4MKXA 4NH4A 3V2GA 4D45A 1E3LA 1VJ1A 3WSVA 5MDHA 2GCGA 3HDJA 3OQBA 1GYQA 4FQ8A 4GVXA 3FTPA 1U3TA 4BOYA 1ZXBA 4ID9A 4ZHSA 1NVGA 5HTOA 4NJMA 2OP0A 3VVCA 4YTEA 2WMDA 3KYBA 3QVOA 1LU9A 5L7WA 3AU9A 3F47A 2PLAA 3D3EA 1J5PA 3DQPA 4WOKA 2A4KA 4ZQHA 3RKUA 2JJYA 4O59O 1ZSNA 3JYNA 5DBFA 3WOHA 3NTQA 1P9LA 4LMRA 4C7KA 1I30A 1WXDA 2R00C 4BKPA 3VKUA 4M54A 1XEAA 5EQDA 4R68A 4I8XA 2F1KA 1GCOA 1LSSA 2EW8A 2WYWA 1ZUD1 3KSZO 3SVTA 4XJSA 5ITVA 2YV3A 1A4UA 2VCYA 2EJWA 5DF1A 1KVUA 4RV9A 3WGOA 2WWRA 2B36A 3N58A 3VAZA 5G4KB 3L9XA 4PG6A 2ZYAA 4GL4A 4J16A 4M87A 4XGKA 3WQRA 1K6JA 3K9QO 4PLWA 3KBOA 5GZ1A 4CUKA 5IDWA 3CEAA 4MVJD 3VOSA 4DYDA 2IYPA 4J1TA 1MG0A 4GBJA 2PA3A 4RVSA 2GASA 3ON5A 2DLDA 3DZKA 1DAOA 4BKQA 1DBVO 4BMVA 3FNGA 2DBVO 1QMGA 5JC1A 2X6TA 1P1JA 1U5AA 3U4CA 1ZK3A 3E1KA 3LVFO 3OJLA 1IZ9A 4CUJA 4DLBA 1HZZA 1N1EA 2OBYA 4OKNA 4I5EA 2AHRA 1B16A 3GVXA 5A9SA 3UCEA 3QWBA 2GF2A 3QJ5A 4XX0A 1PJ4A 1Z6ZA 4URFA 1MA0A 3AY7A 1MG5A 1QG6A 1U9JA 3DTYA 5JDCA 3DZGA 1LRJA 3VZSA 3H5AA 4HFRA 3AOEC 3AUAA 5G4LA 4W4TA 4A2CA 3AK4A 3UH1A 4CV1A 4BNLA 5ICSA 4BO1A 2ZTUA 3VTZA 2JD0A 4L74A 3A1NA 2I9PA 2Y1GA 4FPXA 1F8FA 1Q1NA 3I83A 3E48A 1QXSA 1YQXA 1EVJA 1U4OA 4IQGA 1HWYA 3CKYA 4BB6A 3VZQA 2YV2A 4LISA 1UXGA 2BI7A 4E5MA 4YPOA 1HDGO 4H15A 3RASA 4DBVO 4AJKA 5L4LA 2WE8A 3H8VA 5JAMA 1LDNA 3ONEA 1E3JA 5KJEA 3OP4A 4CV2A 4YAKA 4BO7A 1PWZA 3PP8A 3VPSA 5JY6A 2EXXA 4IMRA 2IZZA 4J43A 4ZQFA 1QYVA 1ZJYA 1EUDA 5A05A 1CJCA 3JQGA 1R4MB 3GC6A 4IBOA 1HE5A 5DP1A 2QHXA 4MP6A 4DMLA 5JC8A 1U1IA 4YJHA 4IY1A 3COSA 3JD3A 4MP3A 2NWQA 1M2WA 3PJEA 2QYTA 3G1TA 3RFVA 1IL0A 4U6SA 1XCBA 4CMIA 4WPGA 4CLOB 2AW5A 2P9CA 3HDHA 3F46A 3QVWA 2ZQYA 3ZWBA 4CMKA 3ZWCA 3MJVA 3RAJA 1EQUA 4OO3A 1XYGA 4I5FA 4E5NA 5JAQA 3EC7A 4DIBA 1TI7A 1CRWG 3AI1A 4NFYA 2QZZA 4QO8A 1ISGA 5KJ1A 1DIBA 4ALNA 2RHRA 4JIGA 3PHIA 1YBMA 3TDKA 7MDHA 1NHWA 2CDAA 4QECA 1BVRA 4FFMA 4XDYA 3W8DA 2OORA 2PKQP 3GVIA 4E21A 1YBVA 1UXJA 5CDUA 4PRKA 3A9WA 1C1DA 2VNAA 2V7PA 2O2SA 3SLGA 3PDUA 4PIVA 2WD8A 5B4VA 1ZMTA 2WM3A 1ADBA 4WGGA 4Y6PA 2YUTA 3I9NA 3TZCA 1LRLA 5IAAA 2DTDA 3TZHA 4XYBA 5COQA 1IE3A 1YOVA 1PIWA 3UHAA 1PS8A 3FHLA 3M2PA 1XG5A 1NQAO 4Z3KA 4A0SA 4IJKA 3E5RA 1P0CA 4TSKA 4AJLA 2JHFA 1DFHA 4B4UA 4II3A 1GPJA 3PPIA 3FCOA 3HN7A 4FC6A 3M6IA 2QZ9A 4YJFA 5JCXA 1MC5A 1YQGA 4GMFA 1DHRA 3ZU5A 5ADHA 1HRDA 2GN4A 4B4OA 4CLRB 2ZB3A 1NVTA 3K5PA 3OA2A 4KDEA 4XR9A 1N5DA 4B7UA 1YRLA 3W1VA 4HXYA 3I9OA 3V8BA 4XWYA 4MKRA 3CMMA 3GZNB 4JN6B 3DZJA 2NV6A 4HNHA 1B8VA 1SZJG 3WWYA 1A71A 1BW9A 2SCUA 1F06A 5TQVA 2RH8A 3AI3A 3E5MA 3JQFA 1ML3A 4IQ0A 3Q1LA 2QX7A 2B5WA 2BFOA 1DC3A 2VOJA 3TL2A 3VDRA 4BHTA 1YDEA 3I6IA 1W6UA 3LQFA 1ZK4A 3GA0A 4J2HA 4Q3DA 3G0OA 2P4HX 1QYDA 4RPLA 4AJNA 4AJJA 2AEMA 1DC5A 3MJCA 3U62A 1PZEA 4ND4A 4PLFA 3WTCA 1A72A 3Q9NA 3VTFA 4YVFA 1PSDA 1UXIA 3FF4A 4TKLA 2Z5LA 4D46A 3KLMX 5JCJD 1CERA 1FDSA 2B69A 3Q6IA 4I1IA 3PHLA 4RPGA 4W7HA 2JCYA 4Q3EA 4E5KA 2Q2QA 2IXBA 3DTTA 3JCZA 3RFTA 2G0TA 3WYCA 1HE3A 3JD0A 1QKIA 4HADA 4NQZA 4FIZA 1M6WA 1S7CA 1V8BA 2DBQA 5H81A 1YE3A 3HQ4O 2DUWA 5JW6A 2DVMA 3JQ7B 4BNFA 2FPIA 2HAEA 2CZCA 3UCXA 4MJLA 3HE3A 4MP8A 2NUAA 3OJEA 4FB5A 2V6BA 1YL7A 3OHSX 4J4BA 4EUEA 5B4TA 1NFQA 2QYSA 4H7PA 2PD3A 1PGOA 5L40A 2B4TO 3L4BC 4QTZA 1Y7TA 2C7VA 3PXXA 2BLLA 3AM4A 3N7UA 1TLTA 4Q9NA 4ZU3A 1NQ5A 2O4CA 5ER6A 4AJEA 4EJ6A 3QA9A 1GUFA 3BMOA 3KRTA 1NX6A 4U8GA 4CM3A 5LDGA 3GT0A 3WBBA 1ZSVA 2FHSA 3MWDB 1F0YA 1FDTA 4L4SA 3RU7A 3DMYA 1U3UA 4JJGA 2FR0A 1Q2XA 1ISIA 4ALMA 3GN1A 2HO5A 4G81A 3OSUA 1HXHA 1UDAA 1UZNA 1I32A 3DEYX 3LT0A 4XQGA 3OA0A 4PZCA 2C0CA 3RU9A 3UUWA 2Q1TA 1YWGO 2BHLA 1H2BA 3OMLA 1AE1A 2JFFA 1MLDA 1V35A 1KY4A 3ZNOA 4NIMA 1B7GO 3G79A 4JK3A 3WFIA 1B2LA 3H2ZA 1V0JA 2EJVA 3WIEA 4CQMA 1RM0A 1ZKMA 3TQHA 4B3HA 3IMFA 1E7RA 1NM5A 1N92A 3KYDB 2GGSA 4NBUA 2UUOA 3I9KA 2YFHA 3TZKA 4KQXA 5JBIA 1ENYA 2FY8A 4XD2A 2B4RO 4F46A 1WP4A 1H93A 2EV9A 2X22A 3FBGA 4D41A 3JQAA 3QHAA 4CODB 5H83A 3H65A 2GLXA 3KVOA 2FPGA 4DQUA 1A9ZA 4O63O 4NU5A 5G0VA 5A5FA 3FRJA 1XGKA 4FOSA 1PR3A 1O8CA 4WLFA 1FDWA 2EHDA 4HFMA 4EZBA 4AJIA 1VC2A 1BGVA 3KYCB 1UZMA 3Q0EA 4DPMA 5K6AA 3I4CA 1ZEMA 4OQYA 3RJ5A 3RUAA 3HWRA 2GZ2A 4NG5A 1SPXA 2D59A 1CIVA 1MV8A 4L9RA 5CPFA 3BMCA 1NFRA 3UFXA 4E6PA 1JAXA 5JFOA 2NVBA 5AXAA 1IZ0A 2X0JA 4TKMA 2AQ8A 5IZCA 2BH9A 3AFMA 3HZZA 2FR1A 3GNTA 4M8SA 5EESA 3JYLA 2WJPA 3INGA 2X7HA 4XQ9A 4NU6A 2C2YA 3DAGA 5JDIA 2EGGA 2VNSA 1ORRA 1LLCA 2Z1MA 3PDJA 4W7IA 4UVEA 3HFGA 5CFZA 1T2AA 1E7QA 1G6KA 3QV1A 1YB5A 4J7UA 3DBLA 2O3TA 4BNJA 3KSUA 2O7QA 4GKBA 4XIJA 4C4OA 4CM7A 2QIOA 1IHYA 1E7YA 2ZCVA 3HG7A 4J7XA 3RC7A 5T8KC 2GO1A 1J49A 4Y67A 5THKA 4BGIA 3GVHA 3PVZA 2IXAA 2V65A 1EBFA 2RCYA 3TRIA 2GDZA 3V1TC 3UGKA 1OMOA 2CDBA 1AXEA 1NBOA 1ZW1A 4YJGA 2PGLA 2Q49A 4JROA 2EW2A 4DUPA 5GZ6A 1EK5A 2OP1A 3O8QA 3AW9A 3NV9A 3Q2KA 3BYZA 4AICA 1XDWA 3TF5A 1PJBA 3PGXA 4MVJM 1YL5A 1QRRA 4J4HA 4DLAA 4K9DA 4JP2A 2X9GA 1ONNA 1JVBA 3NUGA 5JS6A 1ZIDA 4PRLA 2I67A 4TWRA 4CMJA 1OFGA 4J2OA 1HZJA 2PZKA 3EVTA 3OICA 4FDAA 2CUKA 1T24A 4NMHA 3RI3A 1X0VA 3O4RA 1I33A 5AVOA 4B4VA 4DYVA 3ULKA 4TRRA 1JU9A 1XWFA 4CR8A 5B1YA 1R37A 4PN3A 1ULUA 3ANNA 3LLVA 4XKJA 4N5LA 1GYPA 3ASVA 5EQFA 5T57A 3OF2A 1BXKA 3EY4A 3ZWAA 3PLNA 4L0QA 1Y6JA 1Q7GA 2Q3EA 4E13A 1R66A 1HSOA 3WBFA 3VC7A 3WFJA 4YACA 5DNAA 1KBZA 5TGDA 3QW2A 3GMSA 1U8XX 2IODA 2X0RA 4J7CA 4D7AA 2VRCA 4QEDA 3TSCA 4BNHA 2P91A 4RPJA 1PL6A 2UYYA 1P1HA 3BMQB 3KUXA 1AUPA 4HNGA 1B3BA 1DFIA 1JWAB 3AY6A 4DA9A 3HB4X 3D0OA 2I65A 3LC1O 4BNZA 1N2SA 2FMUA 1ZO8A 1Y81A 1PS0A 4TRNA 4E33A 4PVDA 4GX1A 1W0CA 4TQGA 4WLVA 2HJRA 4YCAA 5DOVA 1HYGA 1A7KA 1NPTO 1PL7A 4CM4B 4K1LA 5B4UA 3PGJA 2YZ7A 2OL4A 3IOYA 3TOZA 3JSAA 4I9UA 2NTNA 2V6FA 4IJUA 3SX2A 1R0LA 2DTEA 3GPDG 1NTOA 4A26A 3DFUA 3NT2A 4XEHA 2X8LA 5BSHA 1O9BA 4LSWA 3ZN2A 3PJDA 5F1OA 3GY0A 2BGLA 3GEMA 4IIUA 3AI2A 1K0UA 1B26A 2A94A 4RF3A 5AQ1A 2J5RA 2YV1A 1B8PA 4E0BA 3S1LA 4BO4A 3TFOA 4WEQA 3IL2A 2J8ZA 1R4NA 1UDCA 1C0PA 3SLKA 2JFGA 3IP1A 4JQCA 1Y9EA 2PGDA 5JPIA 3GUYA 2EP7A 4RLSA 3GOHA 4P8RA 5FEUA 4NFSA 2Q50A 3GRKA 3F6YA 1ZSYA 3GF4A 3FNFA 5L4SA 2NACA 1RWBA 3GHYA 4YJDA 2VUSA 1CETA 3D5QA 3H9GA 2C07A 2B5VA 1VM6A 4NDNE 3TWOA 4Q3AA 3P2YA 3GG2A 4RJTA 1I0ZA 1P3DA 4E2WA 2FN7A 4M49A 2VT3A 1CQIA 3RCBA 3X2EA 3N74A 3VVBA 2O48X 3LSYA 3I23A 4AJHA 4KTVE 3SXPA 2E82A 2J6IA 3NDIA 2NQTA 4R01A 1ZH8A 2VYNA 2C82A 2D8AA 5ES3A 4GX5A 2YDYA 5L7TA 3SJ7A 4W9NA 5IFLA 1PQPA 2D1YA 1GZ6A 2VZ9A 5LCXA 3QQPA 5A06A 1E77A 3GGGA 1KVRA 3BTVA 4YQYA 5HWSA 1ZK1A 4L73A 5CEFA 1KS9A 4HP8A 1A7AA 2RBEA 1PGPA 2O3QA 2DPHA 4ZGWA 4Z3DA 3GNQA 1W8DA 4ILKA 2PKQO 2NVUA 1GEEA 1NQTA 1X15A 2YY7A 3BZUA 2ZCUA 3F1KA 1DHTA 3ENKA 3FR8A 2VTEA 2O2YA 4WCDA 4XRRA 4YYZA 1Q7CA 4CLDA 1E6EA 1IPFA 4ZVVA 3S55A 2W2KB 3E9MA 4BKUA 1IPEA 1MX3A 5U1PA 4WUVA 4KUEA 4CQMD 3VDQA 3W8EA 5BSEA 3HDYA 5DCWA 3T4EA 4NZ9A 4JGBA 2QRLA 4XDZA 3B1FA 1G1AA 2EERA 3WS7A 3ZWWA 4P4GA 5TNXA 4E31A 5A5EA 5EMHA 4RZHA 4OL9A 4B4WA 4XYMA 1I01A 1X7HA 2EEZA 2HLPA 2PV7A 2WTBA 1H6AA 1LJ8A 1WDLA 4DQVA 3JQAD 1XU9A 1EEHA 3ITDA 4Y8VA 4LRTB 3IS3A 3IQDB 3ZWXA 2Y1FA 3QWAA 4UAGA 4BQRA 3H3JA 5BT9A 3GH3A 2CF5A 3H3FA 5HBRA 4WCFA 3INTA 4NBVA 1T25A 3PFWO 1PTJA 2Y1OA 3M1LA 1M6HA 1DC4A 5A1TA 2LDBA 1Q0HA 5AOVA 1HE4A 1UJMA 4DLLA 5I7EA 3JTMA 5CAEA 8ADHA 3QWHA 5A03A 5AYVA 4JP3A 5I9NA 2OXIA 4CM5A 4FJ2A 5JE8A 4BO0A 3DHNA 3JQ9C 2W2LA 4NK5A 2FZEA 1V3VA 3VKVA 1X7GA 4CM6A 4JCOA 3JD4A 4EI2A 3VH1A 3ZV6A 3MWEB 1JTVA 1SB9A 4NR0A 4F3YA 2PZJA 3C7DB 2GERA 4WJZA 3M2TA 4XYGA 3DO5A 4TVOA 3FPLA 4CMGA 4FCCA 3WWZA 3AUUA 2Q4EA 4O6VA 1BMDA 3GRPA 3KETA 4HV4A 3B6ZA 4C7JA 1PZHA 4KWHA 4BNTA 3R6DA 1UP4A 2EGHA 1GDHA 1TT5B 4ZICA 1KEPA 3GN2A 4RQUA 1QSGA 1PZFA 4UVGA 5H82A 2GPTA 4KUGA 1RM5A 3O38A 5IG2A 2DFDA 4E2YA 4A5OA 3FR7A 1BXZA 4XB1A 5DDIP 3GHHA 2E4AA 1Y8RA 1PL8A 5FF9A 4UUNA 3ZHXA 3UF0A 2Q1WA 4NBRA 2FR8A 3ANLA 1ARZA 5K0ZA 1Z73A 3ANMA 1SBYA 3HDQA 3VH3A 4ALJA 4OGWA 3HHPA 4J6FA 3ZNNA 2Y68A 4PLCA 3IDSA 1NQOA 3KLPX 3RC1A 1E3WA 1P74A 4F6CA 2P9GA 4RVGA 1C0IA 1X0XA 4ZRMA 3RUEA 3O26A 5CEJA 3RQSA 4PLPA 4F6LA 3PYLA 3K30A 4D3FA 4GQAA 3KXDA 4S3MA 4RL6A 1JA9A 2ZQZA 3BXXA 4M86A 3EGOA 2DM6A 1I36A 1TA4A 3Q9UA 2R00A 2OHXA 4B8WA 5EJ2A 1ZK2A 3CE6A 3FI9A 2BD0A 1AGNA 2FSVA 2NLOA 1PR9A 1O6ZA 4U0JA 2B0JA 2C20A 5I7SA 2X5KO 3U49A 3DBRB 3ZWYA 2JD2A 3JYQA 2X0IA 4EW6A 4U7WA 4ZQEA 2GN8A 1LXCA 6LDHA 3IKTA 1WNTA 4ESOA 5L4NA 3NEPX 4GX2A 4JJIA 3PHJA 4IDDA 4RQTA 1RPNA 1P1RA 4WLOA 5TT1A 1AHHA 2VRCD 4JLWA 3DMTC 1ENZA 4JBHA 4L76A 5A9SB 2VWGA 1PQUA 3EK2A 4FD3A 4NBWA 2VN8A 4ALKA 3CUKA 1NXQA 1GEGA 2XF8A 4GGPA 3FPCA 5CP8A 9LDTA 1Y8QA 4RF4A 2DUUA 3BHIA 3LT2A 4R16A 3ABIA 4E2ZA 1HYEA 4EGFA 2NNLD 4IM7A 5I7FA 3EDMA 4WLNA 4NNJA 3C24A 2HQ1A 5G0TA 2H9IA 1A9YA 4DC1A 4FN4A 4UEJA 3IJRA 3WJ7A 4R5HA 2P4QA 2EKQA 2FOIA 1YJQA 3QVSA 3AOEA 3RUFA 3ZDFA 5A9RA 1DIRA 2ET6A 2VYVA 3JQDA 3E03A 2PD4A 4CV0A 1EK6A 1LA2A 3TL3A 2CFCA 1D8AA 4J1QA 4MIOA 2O23A 5EERA 1TEHA 4OXNA 3WICA 4GAEA 1E1MA 1YB4A 3PZBA 5K1SA 3CTMA 3P19A 1DDOA 1EMDA 1O5IA 1T2DA 2Q1UA 3DOOA 3GMDA 1C14A 4AG3A 5JAZA 3A4VA 1E1NA 3P5SA 2NU6A 3HADA 1LBEA 3H4VA 3JQGB 3WGHA 5C7LO 4O0LA 4QQRA 3ICCA 2IDZA 3AUSA 4RORA 4UEKA 4GVLA 3BHJA 3PWKA 4RPKA 1KEWA 2J3KA 3JQ7A 1H5QA 4ND1A 3C3XA 2B35A 2DT5A 5ILGA 3UXYA 4CMIB 3PHHA 4DPLA 5L45A 3PIDA 4YAJA 2PZLA 1ONPA 2DTXA 4FGSA 3U4IA 4NPCA 3JQBA 4KP7A 3L0DA 4IDEA 1LDEA 3AJRA 4EUFA 3C1TA 5GY7A 1U2GA 3C85A 4D0SA 1SEVA 2RHCA 4QFDA 5U9CA 2D5CA 4R4JA 2VYND 1ISMA 4WLUA 4PZEA 3ST7A 3KEOA 1YJ8A 1X13A 2VWPA 2UDPA 4OH1A 2YHUA 4HKTA 1YKFA 1P1FA 3RBZA 4M1QA 4II2A 4KWIA 2CY0A 4D44A 2WEKA 1GAEO 1SAYA 3ROKA 1XELA 3JQ6A 1FJHA 3OQ6A 1KVTA 1IY8A 4OXKA 1VL6A 1ADGA 4TMFA 4PLYA 4IGFA 4NJOA 5FI3A 4MVJG 1E1LA 5DOZA 4CM8A 3OIDA 2RAFA 4H16A 4K28A 4BB5A 4CV3A 1C1XA 1GUYA 2PFGA 5KVVA 5DBIA 4J9UE 2OGUA 5AXCA 3WR5A 1MUUA 4UREA 5EL0A 5JLAA 1NR7A 3U4DA 4MOWA 1U8FO 4I08A 1U7HA 1XQ1A 1ZJZA 3OJFA 3W8FA 4ZJUA 4CMEC 3ZHZA 5A3JA 2DPGA 3KYDA 2I6TA 4MVJE 3EW7A 4D43A 2NQ8A 1HT0A 5BNTA 4OQZA 2YW9A 4AJOA 3DR3A 3D4OA 3H2SA 4G2NA 2BFPA 2CVQA 1RKXA 4OJNA 1IOLA 4FFRA 3GEGA 5GMOA 3JQ8A 4E12A 4YT4A 3NTRA 1OZAA 3MOIA 3F5SA 5C5IA 3BTOA 4OSOA 3UAGA 1BRMA 4WECA 4WKGA 2DQ4A 3U9LA 1I3NA 4WASA 1DO8A 4J3FA 4CQLA 1NPDA 3TJRA 1EBUA 4XA8A 3GLQA 4CLEA 3ADPA 1FK8A 4DVJA 5TX7A 5TSDA 1YQDA 3EAGA 3QE3A 4HX5A 2H6EA 4Q3BA 3MEQA 4CM9A 4EYEA 1H6DA 2W2LD 4YWJA 1PGNA 4RGBA 1JN0A 3VHRA 5I8WA 3OETA 4Y98A 1GL3A 3ICPA 3KSDO 1Y9AA 4M55A 1H6BA 5EN4A 5FWNA 3OH8A 4OIMA 8LDHA 3BTUA 1B0AA 4PGFA 2XPCA 1E7WA 1ZVMA 4XYEA 4LRSB 3RIHA 4BS9A 1MXFA 3F3SA 3QP9A 4PLTA 5TRTA 2G1UA 1DJNA 2CVOA 1J0XO 4PLZA 2GN6A 2YHIB 2ZJ0A 3OJ0A 1PJCA 4XB2A 3U09A 3O9ZA 5JO9A 3EHEA 2IEDA 3ZI0A 2CD9A 4IDBA 1R0SA 2ZYDA 3PI7A 2AE1A 2BELA 4GWKA 5LDHA 1VL0A 4J4TA 2P5UA 1HSZA 5L51A 1OAAA 1WWKA 3MTJA 1NR1A 4HY3A 4MKZA 3RUHA 4F45A 4EBFA 3L4BA 2JD1A 5DULA 1T1RA 5IXSA 1OC4A 1ISJA 3LC7O 2GZ3A 1HYHA 2A9FA 2B37A 2E49A 3NDRA 2DKNA 3H9JA 5G0UA 4BV8A 4QSMA 2PY6A 4BKRA 5TLSA 5KKCA 1Y5MA 3S2GA 1QV7A 3L77A 2PH5A 3WNQA 5HS4A 3MCVA 2BI8A 3R3SA 1B15A 1E3IA 1KEVA 2Y1CA 2ZTMA 1G0OA 4Y6SA 1HEUA 1M67A 1C3VA 1XQ6A 4GSKA 5F1PA 3FWZA 2AA3A 3AUTA 3O03A 4BO6A 2VHYA 1EE2A 4CQMB 3K8ZA 1GV0A 3NT4A 4XGNA 4RPHA 1SOVA 1ZFNA 3VH2A 4YDRA 3GK3A 4PLHA 3PEFA 3BA1A 4DL9A 3C1AA 4I5DA 3ZCXA 3HB5X 4LN1A 2Y0CA 2PZMA 4K6FA 4RLHA 1UUFA 3JQAB 1FF9A 1R15A 3LDHA 4IIVA 1B3RA 3G1UA 1ZCJA 2LDXA 2Y93A 3CPSA 2AQIA 4ZQGA 2PH3A 3B70A 3HNPA 4ND5A 2P2SA 4YT5A 2BGKA 3LF2A 3V1YA 4A7PA 2HMVA 4KOAA 1JKJA 1E3SA 4KUHA 5J23A 3DOJA 2W4QA 4DWVA 3HFSA 1R16A 4EITA 5ENDA 5FFFA 3BMCB 2Q2VA 4LCJA 1VSVA 1YDWA 3FD8A 5A9TA 3QRWA 3ZW8A 1PJQA 5DT9A 3JD1A 2HK8A 1QLHA 4D0RA 4Y9DA 1EDOA 4R54A 3UN1A 3ZV5A 3CIFA 3ZV3A 4B7CA 3WJAA 2VTDA 4DMMA 1Y1PA 3D3WB 4Z9FA 3ZWNA 4M89A 4CMHA 3WLFA 4GI2A 4UEOA 1T4BA 3GEDA 2VYVD 4HUJA 4D3SA 1D1SA 1JVSA 3ZGYA 4J49A 2D4AA 4U5QA 1NVMB 4BO5A 3IJPA 4HFJA 1TB4A 2OO5A 2P9EA 2G17A 2NM0A 2X58A 4UUMA 5CDTA 5AXBA 4WLEA 3ZNQA 2Q2WA 1JDJA 4R3WA 1SMKA 1LEHA 3ONDA 3OEWA 3WGYA 2VUUA 1DJQA 1L7DA 2BKAA 2X86A 1GD1O 4MPDA 4DC0A 5HRUA 4YJGB 1HL3A 1EUZA 1LLQA 5TT0A 2HMTA 5LC1A 3UW3A 1VE9A 3I3OA 1FDVA 2NVWA 2WD7B 4R1TA 2VZ8A 5T8KA 3OEYA 3TFQA 3H9EO 4QFCA 3Q3CA 1HLPA 4EEZA 1JLLA 1K6XA 1Z75A 4G65A 5T64A 3PYXA 1LSOA 4JXKA 3DHYA 5TJ9A 5HA5A 4NI5A 2E37A 5MGBA 1LDBA 2X5OA 4Q39A 3WTBA 1NP3A 1GQ2A 4NHEA 1VPDA 3UCFA 4BNYA 3TN7A 1N9GA 3BMNB 1XLTA 2PR2A 1BXGA 1K3TA 3SBOA 2I3AA 3LZ6A 4N5NA 3PYMA 1DPGA 3I9LA 4BNNA 1DC6A 4NBTA 3NRCA 3T7EA 3W6UA 1KERA 2Q1SA 3HUDA 4Q3NA 2X0NA 3IUPA 1CDOA 3KZVA 4DRYA 1NPYA
chains in the Genus database with same CATH superfamily
1ZN9A 4B3BA 3PGLA 1GFWA 2RG7A 2HMUA 4M60A 3SJCA 4ZKDA 3KB1A 3KJHA 4N49A 3WRVA 3LMKA 3P7MA 5FTKA 1AMNA 1OFIA 4I1OA 4RL4A 2GSWA 1JQ5A 5CDGA 3VR2A 1SCDA 2AJ8A 1V1MA 4I9GA 2ZJ4A 5FYQA 1UAGA 1CUHA 2GM5A 1DIGA 2HPHA 3B2QA 3O2SB 5CM2Z 1G7SA 1MOZA 1X42A 1IIBA 2PX6A 2HLHA 4G0OA 3ZQKA 2B1JA 4LF6B 2QB5A 2ZG6A 5IK2A 3OM1A 1Z9BA 3L1JA 3HEAA 2PYIA 1PJ3A 4X93A 3CH5A 3GAFA 3IERA 1N4DA 3VPDA 2ZYWX 1HQYE 2QWXA 5FXMA 5G53C 3AB8A 1H9BA 4R1UA 5H3LA 4ABYA 4IP0A 4M98A 5BYAA 4H7FA 1Y7PA 1ZK0A 4P4LA 5C3MA 3FFWA 3SYRA 1F7UA 1XXHA 1E2IA 2WYOA 3DAHA 2XXAB 1D7OA 2GI4A 3D8NA 3UZUA 1QP8A 3BULA 3KKZA 3TCXB 3PTZA 1G64A 4ARIA 4FSDA 1EVEA 2PXCA 3T7JA 1ULSA 4AJPA 2PQMA 4RSHA 3K73O 2QTCA 3T3IA 1BN7A 4UUPA 3O8OA 2ICAA 1TIBA 1OAOA 4KFUA 4G0VA 2IOFK 5F9FA 3MRVA 2IZ7A 2RKWA 1PTJC 3CNOA 4ZAXA 3B3AA 3UKDA 1M8KA 3VYVA 4YAGA 2BDEA 2IZ0A 4HB2A 4MYRA 2QD2A 1F0PA 1F8UA 1WB6A 3BDVA 3FPGA 3GGSA 3W4KA 3OM9A 2JHAA 4JUDX 1VPEA 1BA2A 4G6ZA 2J07A 3KZMA 1MFZA 5EMNA 4OQLA 4XGIA 4UNIA 4CL0A 4Q9KA 1JI3A 1G55A 1JMYA 1HDYA 2ZSHA 4R1NA 1RQPA 1I6KA 1N3IA 3AFGA 1JB9A 1EZ4A 1KWKA 4PZYA 2OHJA 2Q5JA 5THQA 4B6JA 1CR6A 3Q5EA 1VE6A 2EP5A 4HOYA 3TTUA 4AMGA 3RW9A 3NHRA 2GOYA 3ROZA 1JAHA 4WZBA 5MGNA 3UJDA 1BWPA 2QRKA 1FNSA 2VHXA 4IDAA 1TCUA 4KAJA 4ESVA 2I4RA 3G82C 2WKWA 1JILA 5J2UA 4BVBA 4UU7A 4ZK6A 4B74A 3ZWMA 5LUAA 3DE4X 1J6UA 4FJ1A 1EFHA 3FGNA 2CNWA 5ALFA 2NO4A 3AVTA 1UKBA 4MI6A 1DI0A 1KC3A 1NN5A 2W42A 4OBBA 5BQFA 1WXFA 1I3CA 4EF6A 1T0IA 1UWCA 2WTUA 5HM8A 3RYTC 3VJMA 3EHDA 1MN6A 1OYYA 1Y7IA 2X5JO 3C7AA 3I5AA 1XUOA 4D3DA 3VVLA 3PQDA 3I9MA 4FFVA 4QPJC 3RT1A 1ZJ5A 3K2BA 4DLVA 4GX0A 2UYGA 3FSJX 1VJDA 4PS1A 3FA2A 1GGHA 1E2HA 3TVYA 3UMYA 5L53A 1N75A 2NTJA 3DAPA 3K1TA 1T4CA 2Z6AA 4P0PB 4LFCB 2BN4A 2HA7A 2YXNA 1EVYA 3DDCA 4N3AA 4MUXA 5DSZA 5BWNA 3OE7D 1TT5A 5D3MA 1BDIA 8OHMA 3KLBA 2BKEA 2YRWA 5GOTA 3PC7A 3VI3B 3V8NA 2NU9A 1UBNA 3UMCA 1C1HA 2GAOA 2XQIA 5DYGA 3IDFA 3I4FA 2RG1A 4PFJA 2YJZA 2QVXX 5E8RA 4CBVA 1OWNA 5DI9A 1K68A 4KQMA 3GROA 3FY4A 1USGA 1WMAA 3MZ0A 5D51S 5EYPB 3ZU3A 3HU3A 3ZE9A 4AUMA 1D3AA 3BH0A 4RKRA 2DFLA 4UU0A 4PONA 1RABA 1L6RA 2HX1A 4D4KA 2IOFA 2C58A 3KUDA 2JJ2D 2QXYA 3AUKA 2UV8A 4Q4LA 3AEXA 3KQHA 3CE9A 1EAYA 1JKIA 1YGPA 4LCBA 1PEDA 3E2IA 1G8JA 2O3JA 2I2CA 4FMDB 5LQNA 4DXHA 3DOHA 2GILA 2X1VA 5TQ0A 1B14A 1CR4A 1Q0QA 4GBGA 3BGDA 4IZIA 1OE0A 3UJNA 2Z1NA 4N7BA 5HYVA 4OSPA 2MOKA 4PNPA 4MRMA 2OLEA 5KOIA 4JBIA 3DLTA 4B1FA 3D1LA 3AP3A 4RLFA 5I4CA 5F7ZA 5KWIA 4J2TA 2CE7A 2Y1DA 3MWJA 1U0JA 4Z2YA 4UHDA 5DNUA 1DRWA 3G88A 4LPSA 2J0QA 5FTJA 1Q57A 5AD1A 3OP1A 1KU6A 2QL9A 1DTEA 5JYDA 5A5VA 4KBGA 1XVVA 5JSFA 3ECSA 4IQFA 1HF3A 3NCHA 1TM7E 1GZ4A 1E5QA 1W0JD 1U80A 2QQ5A 5BNFA 3T8YA 5HKKA 1WCIA 1Y8CA 3E3OA 4MLZA 2I3ZA 1W4BA 2E4VA 2IXDA 2ORWA 4TTIA 5CH8A 1AIPA 5HF6A 5BSMA 2VC2B 3QFCA 5MN6A 3EYWA 5KJ6A 1EFAA 4QJIA 3R3UA 1JXQA 2PUTA 2IXTA 3RSZA 4DLWA 1IZ8A 2JJ8A 5EZQA 4EB8A 4IIGA 3AEQA 4QX6A 4AURA 4YMTA 2MJLA 4QD3A 4F91B 3DWIA 2D2XA 1XK7A 3UT0A 2WU8A 3LUHA 2QW8A 1TGYA 2JBWA 5BYJA 5K9ZA 2Y1LA 3A28A 3UO8B 4HGNA 5K01A 1YRAA 4K9LA 1CJKC 3L1VA 2BTQB 2HC9A 5EKTA 4ZD6A 2XADA 2FW6A 2OVBA 4KJXA 2RGWA 2V96A 5KYUA 4DF3A 1XCMA 3E82A 2F00A 4ZEVA 3JZMA 4OUDB 4R3UC 3S2IA 4KR6A 4JDPA 4U6QA 2B94A 2NXWA 3RTCA 4WZZA 4DNQA 5JYEA 3NT5A 1VLLA 2UYQA 2W6QA 3EVFA 1V9LA 3LT4A 3D3KA 3QNWA 3W5UA 2GVNA 3RU3A 4EEXA 5A5GA 2FZ4A 4L75A 4GPTA 4MGKR 2DECA 5D7NA 4YB8A 2ZSJA 4K2AA 3W4JA 4L5BA 1HMYA 3GH1A 3OQPA 3OT5A 3Q0TA 1X1RA 4PG5A 1I14A 3C8MA 3JXEA 1TUIA 3QELB 2V7UA 3W5IA 1KOJA 4M0CA 2UVPA 3VJKA 3PNLA 4M0LA 2GLTA 2QKYA 3KVYA 3DE3X 4CR6A 1VSUA 2JKYA 4GYWA 5EIOA 1NN3A 1U5BA 2GD6A 4B46A 2VS1A 1P9OA 5IDYA 3V9AA 1Z0IA 2IP4A 5KCZA 2G4VA 2XRZA 5DNYB 2C7PA 1P8AA 3E15A 2ETVA 2NTVA 1EVIA 4PC3A 3C4QA 3LXXA 5ESDA 2W2OA 3MAGA 4L08A 2EKPA 5IC6A 1W6RA 3BCRA 4AF6A 1C9MA 2B98A 4UOZA 5AK6A 4HWOA 1ODSA 3SJBA 2VNHA 1JR2A 4I9HA 4S1TA 3U9TA 4E2XA 2GARA 1VBMA 3DTVA 4TS4A 3E9YA 1JPVA 5DHUA 4XX0B 5TVGA 3RSOA 5CCXA 2ZSEA 3FUVA 3MJHA 4FOOA 1WPQA 5FNVB 1GZHB 3IR5A 4CLRA 4XZ3A 2OVFA 1I7PA 1O94A 1ZITA 3GFBA 3NNSA 4MX8A 4UBIA 1XD2B 5DHPA 3VU0A 4HXGA 1Y8RB 3OESA 1S1CA 5FUYA 3ZDZB 2ZVDA 4V3CA 5ALGA 3EZYA 3H42B 4KQHA 3QTBA 1FJXA 5DMXA 3TG2A 2VHWA 3ANSA 2IPNA 3G3EA 2OOKA 4LRXA 1PJTA 1WCXA 3V97A 4H3VA 4IMIB 3F78A 1JHVA 1IEVA 2GXAA 3DHEA 4GIBA 4H7JA 4FEYA 4L0MA 3DQQA 4TVKA 5HVNA 3V2HA 3ITKA 4BO3A 4EA9A 4IJVA 4F9GA 4I3FA 3HV0A 1RC0A 2VG8A 5EZ5A 3KZCA 1T8TA 3L7OA 2J0EA 3KM0A 5J1SB 4JAVC 2G28A 1H2XA 2BMWA 1IU9A 1CJVC 2O3UA 3AOGA 2RSLA 3EEQA 2WSSA 4I55B 4A8HA 1P44A 2HF7A 1P1KA 4INAA 5TJHA 2HB6A 3N8KA 3T7SA 3JWGA 5AHOA 1WUJS 4G1FA 4DSOA 5FUQA 3LHFA 2YFQA 1C9EA 3M1AA 1OC2A 2Y1KA 1TMGE 1QIMA 2OCLA 5CG1A 3U3DA 4ESEA 4LA4A 1L7BA 2NXEA 3BWXA 2YYYA 1Z2CA 4AUNA 5IF9A 1HQDA 2HK9A 1MT0A 2XHZA 1C0EA 5D8DA 4HS4A 1HY3A 2PGAA 1A4IA 4EKIA 2ZRLA 3EGVA 1E94E 3ZXIA 4BIMA 1T2CA 3FYDA 4IS3A 1AK9A 4W99A 1IBKB 1L7EA 1LQ2A 4PX3A 4S1WA 3PGKA 3K6JA 5GAJA 2CL7X 1CP3A 3R3XA 2QJOA 4IOJA 4K3VA 5KAPA 5LBUA 3SNHA 3OFND 3U0VA 1DWPA 1Z38A 1LQUA 4JGGA 3ZDDA 1PLLA 5DYYA 1Z36A 3F2IA 2O1WA 1BWSA 1N1GA 1R6DA 2ZIZA 1N0UA 4FBGA 2V9PA 3BGIA 4MYHA 4F4JA 3UMSA 3PICA 1MB2A 4BQIA 2O8CB 5F21A 4AMZA 4K9QA 4LX8A 2B8TA 2C4KA 1ZHHA 1A5TA 4PG7A 5FTNA 1QZXA 1Y8QB 4ITUA 3RNOA 1BX3A 5AW6A 1YB1A 4ZDIA 1EBBA 2OGTA 3CLVA 3DMTA 1FPMA 2XLBA 3FFBA 1NVWQ 4CEJB 16PKA 1AN0A 3KX2A 2VQFB 3IPYA 4L5JA 3RSQA 3EEBA 1YULA 3HJBA 1C8BA 3WNZA 3L07A 2AJDA 5FPPA 5M29A 3G0HA 1UR5A 1ZI6A 3GJ0A 4Z51A 4MTCA 3B3JA 4PTYA 1U1EA 3CKKA 3ORHA 2QE6A 4PANA 4MUHA 1XX6A 2FPPA 3LAWA 3S2EA 5G02A 3WB9A 2GCOA 2B4QA 3G2MA 3SJUA 3VC1A 4CT5A 2XUZA 3A11A 3IC5A 4W8OA 4WY8A 1KAMA 3AL2A 4ZV9A 2DWQA 1NM5C 3VZPA 3W6ZA 1AZTA 2JFZA 3PKZA 3DHVA 3IAS6 1FFCA 1KFEB 1IMOA 4YEDA 4KQCA 1U3GA 3VMFA 3H84A 2QVBA 3FNEA 4OP2A 2XW6A 4Q7MB 4WERA 4BN0A 3V4OA 4CLOA 4GRIA 3KAJA 4CLXA 3MBOA 4YJFB 4YV7A 5KJCA 3TGLA 2NU6B 1W93A 1C30B 3IGFA 3WKDA 3WLLA 3S1AA 2CHQA 3E3AA 5DZSA 4M22A 3WGQA 4JJ6A 1JW9B 3IMKA 1UC5B 3S40A 4XIFA 5JY1A 1I3MA 5F3RA 1KI6A 3LGAA 3ZWQA 1ZD8A 3HGQA 4BRSA 4FOTA 1G20A 4OXYA 2VUIB 1Q0ZA 3HN2A 4XWOA 2XUPA 3QX3A 2V3VA 1XZBA 1YI8A 4TLBA 5FJIA 4A9AA 1BW9B 1QS0B 4BVFA 5IJ9B 2EKLA 3QF4A 2JLXA 2NUTB 3NX4A 3MJTA 1K1EA 2YHIA 4L4XA 4YAEA 1EGVB 4I2VA 4K8OA 3SDZA 4EJSC 3U48A 3T7CA 1WLSA 4DBLC 1A9XA 1YRHA 5TS2A 1RR6A 1JJVA 4CF3A 1HX7A 3TEJA 2ZI3A 4EPVA 1RWKA 1Q7BA 1CJSA 4TLLB 3S8EA 2OR3A 1RZ3A 3AXTA 3GNSA 5IWAB 1U3VA 3TECE 4K88A 4MUFA 1BSVA 1T9KA 1XU7A 2NSJA 3RHFA 2P9ZA 5I4KA 4LXHA 2NSYA 2B9EA 2CYAA 4Z1MA 3S8MA 3RIEA 5D01A 3TUZC 4LDAA 5EEHA 1A7UA 2I8CA 4CN9A 3RROA 3HU2A 2QX9A 1RYBA 1WPGA 2JFYA 2AG8A 2R6JA 4TZKA 4WA8A 5AUQA 4DBZA 1NY6A 2BZ0A 5TQJA 3NRBA 1TZKA 3NEJA 3ECAA 4I1UA 4COKA 4XYLA 2A9VA 2UXDB 1E9DA 4GC9A 1PI3A 3KOXA 1DAHA 1WE2A 2QN7A 2W6JA 2FWIA 4FOLA 1NRWA 5KVQA 1MOSA 4HDNA 4Y6LA 2JGKA 5KTSA 1KSHA 4AY6A 4R8KA 1VKZA 4WFIA 2BGWA 4IDCA 1VFNA 4Q4HB 2FZCA 3GDFA 3QX9A 1XZMA 5FYDA 5TB5A 1EGAA 2JGRA 3WIDA 4KB5A 2W9XA 3T7KA 5JFGA 3AKDA 2WJ6A 2PCLA 3AKYA 1X3LA 3THWA 4FW8A 1U7ZA 3HL4A 2O8EA 2NUAB 4B71A 4EDFA 5IDXA 1S2DA 2Z04A 2NSLA 1G60A 3GG9A 4J0JA 4RD1A 4KC0A 3UJHA 5K0GA 4AB1A 2I3BA 4OHXA 5EZYB 2C7GA 3N6XA 2IYOA 3AJDA 3HUFA 2R65A 3RDPA 4C7BA 2WFAA 1RYFA 3SR4A 2NXNA 3H11B 3NJ8A 1KEZA 1ZUIA 3I5UA 1CD5A 3STHA 1BEZA 1O4WA 2R8YA 3GGOA 2WKQA 5HM6A 3CX7A 1PUXA 3TINA 1PJSA 1AQYA 5HF5A 3A2KA 2B8WA 2QY6A 1E92A 3OZ7A 2IUUA 1UBOS 2Y9MB 3R09A 2JHGA 2Q7XA 1Z74A 1TLFA 3E8SA 3AETB 4LOAA 4X6LA 4ER3A 3ETDA 3O92A 5DEIA 3LL7A 1G8FA 2HMAA 4P7FA 1T4DA 3FTCA 4GMGA 3KBBA 4AJ4A 4RA9A 2CSUA 1VPTA 5IN5A 3Q4GA 4FUQA 3BF7A 5HOEA 2VRBA 1I9GA 5A1JA 1CNFA 1CYDA 1MBZA 1S3FA 4CQLB 4XLLA 4Q47A 2GZDA 2ZDQA 3HWWA 1ZDMA 2Z8XA 4UULA 3GRCA 3SE0A 1RQ7A 2BOVA 1XDDA 6ADHA 2K2QB 3QTTA 3GAAA 3KP1A 3PVCA 1UH5A 1WDMA 2LE0A 5F1KA 5HS6A 1RRFA 3YASA 3DZFA 2PE5A 1RDFA 2F1RA 3VSDA 5JWHA 4KOEC 5B7QA 1P45A 3BXGA 7REQB 4DCUA 2PKRA 4JBNA 3EPKA 4Y1EA 3PITA 1XHLA 3F7NA 5G0SA 4OHYA 3B7PA 3D4PA 2R5WA 1OF1A 1Z5VA 4MVJA 3EUEA 4BZQA 3P0HA 4NNOA 4ZOQI 5I4BA 3KCQA 1QH0A 2B9VA 3NFYA 3JPYA 4A2QA 1YJ5A 4OM8A 3B52X 3ZXYA 4DRXA 2E3JA 2Q3FA 3EIWA 3E3NA 3MWYW 2VFAA 3EARA 5F4BA 4ZC1A 2I99A 4IH1A 2W2PA 2CMHA 3MJFA 2NO6A 1YZ3A 2AC2A 4G5XA 1BS9A 3U19A 1NUUA 5LLDA 4HR7A 3B1VA 3D7SA 4NV3A 4X1OA 5DI3B 3TLMA 2H63A 2AEJA 3O4FA 2W90A 3S5JA 3WBJA 2JGJA 1V3TA 2PDAA 3U7EB 3U3XA 4D9IA 2GWRA 5JNSA 4OYLA 1Y6FA 1Z7YA 1KYYA 2JGNA 5CJJA 4GRDA 1NULA 5B37A 3WMXA 3MW8A 1KZ9A 2WZBA 3RRYA 4E70A 5HUJA 1YQTA 2G1PA 4B79A 2PL1A 4TKVB 5AVKA 3U16A 5IBPA 3IO5A 4MARA 1T1JA 2I2DA 4RH3A 2JIDA 1NUTA 5ITZB 5K8UA 4LJ6A 3UWMA 1HDZA 2JLYA 4GICA 1ORDA 2ZOSA 3VBCA 4QELA 4R2IA 3CFYA 2O06A 4BO9A 2ZS7A 4FHZA 4GD3Q 4QO7A 4Q82A 1ITZA 2K6GA 3TNDA 1V8ZA 2HUNA 3O1HB 3GIWA 3JQPA 2XSZD 1U1GA 2XCSB 1RPTA 1N7IA 2OUIA 5AW4A 4HVAA 2Z6QA 2ZU6A 3H7IA 4IG4A 2FEXA 2O6HA 4D4HA 4DUGA 4V24A 2JLVA 1X7ZB 1FB5A 2O2ZA 2XTAA 3FUCA 3PNVA 4JYBA 2ZR0A 3HYRA 3IV7A 3EXHC 3F7OA 2C2MA 4UMVA 1MP0A 1MW9X 1QMPA 1I5EA 1R12A 2WNHA 2WG2A 2GD1O 3TMYA 4WBNA 3FOEC 2F3RA 2QVLA 1IEWA 4QYXA 2C5EA 4V0LA 2IBMA 2J5KA 3L8HA 2RHWA 4Z9XA 1E3EA 2VO1A 5SY6A 3SDSA 3LKDA 2AX3A 5DGTA 1NAHA 3I2JA 1VG1A 3S4YA 1Z22A 1XD8A 4KNWA 4EA6A 1L5WA 1N2IA 2B1QA 2C88A 3S2FA 4EFNA 4ER6A 2J9XB 5A6VA 4RTMA 4J0FA 2VP6A 4HXEB 2G1AA 4QODA 1UDBA 2I6UA 2VT2A 4GWGA 1IPHA 3OKCA 5FV7A 4D3YA 1Q0LA 1AQ6A 1UPCA 2HV9A 5T4HA 5F2OA 3VPXA 1H8HD 5IDQA 1QQBA 1WDTA 1E62A 2D00A 2BM9A 2OZPA 3KQVA 1R6TA 5BSFA 1C9DB 1RBYA 1WBJB 3CF4G 1EFKA 4MSUA 1RFLA 3AILA 2F1JA 4YPFA 1TM5E 5H8WA 1E9EA 4MR9A 3IEMA 4ES6A 4QUKA 3FVVA 4CMCA 2IEAA 5FUXA 3KUUA 1KKMA 3PUKA 1ZRNA 4X6YA 1K0FA 1ADFA 1RJDA 2YIJA 4YAFA 4Q15A 1QPBA 3BJZA 4Q19A 2V59A 4ZVNA 4ZCRA 3E8XA 4JUCA 4NEQA 3CVWA 4PSKA 1XFAA 1RACA 2Z9DA 4OJQA 2PPLA 2X6RA 4J8PA 3SFVA 2P2YA 2FGKA 5LD2C 3RWOA 2JBAB 1KO7A 2A59A 4UNQA 3R3JA 4RGYA 4X6UA 2FJUA 4JOSA 2QVCA 4Y9SA 1FTSA 2NAPA 5E3IA 5KNDA 3STVA 1BDMA 2VAVA 1T26A 2JVKA 1F2TB 4QQ8A 1TA9A 2PYZA 4E88A 3F73A 4CW7A 1Y5RA 4N5DA 2JCGA 1P61B 1AGXA 9MHTA 3KPYA 4YO8A 4ND3A 2PJZA 1V7CA 3Q8MA 3H8WA 4MINA 4DQDA 3IIEA 4BNIA 4C7VA 1PWHA 1U7PA 4MDYA 3HGMA 2C7OA 4PE5B 4D42A 1C7FA 1E9BA 3P4UA 5EINA 5CVJA 1BAPA 5K7SA 3GOQA 4ZREA 1LDMA 3OX2A 4HDMA 2Q5HA 4OYRA 2ZWVA 4YRDA 5FA5A 2J46A 4D9JA 3BILA 3EPLA 1C4XA 3DB2A 4NOMA 1WW2A 1U9CA 3ASYA 3F98A 4IHAA 1ZM4A 2JNWA 1CY4A 1T1IA 2V4UA 3AYXB 2QN8A 3HY4A 4KMOA 4LYFA 4NEHB 4C4RA 5AM4A 2REQA 3TOXA 4EZIA 2VHZA 3CUEF 3I1YA 2VHJA 3IB3A 5FKJA 2IQIA 2ABWA 2VOEA 3MUEA 5ALDA 3GUCA 4CVNA 5C4IA 2C8LA 4RJJA 3EZ2A 3H9BA 4AZ3A 1FFDA 2QLTA 1KEEB 3GDGA 2ECQA 5AKLA 1TJNA 3RVDA 2O8FA 5LZ9A 5JR3A 2OGWA 5EUMA 4KV9A 2C54A 4TZ6A 2Y99A 4MEBA 1NU6A 1OBVA 1WZUA 2PS9A 2AN9A 5TGZA 2HU2A 2OBLA 3AINA 1ZLXA 2BMAA 2UZ0A 3D64A 4BX8A 1QYWA 2HRZA 3FH0A 4BP8A 5FTMA 1HYBA 1U6IA 2GYYA 2WJJA 4ARUA 4C0JA 4PQGA 1LBSA 2WFLB 3USCS 4YRSA 3EXEA 5D6NA 4YBRA 5TVKA 2YQ5A 3W2TA 3DCYA 2ZB4A 3KLOA 2ORYA 1XDGA 4FC7A 4ICIA 4BNKA 4DLTA 3WJ2A 1PN3A 1J2UA 4Y2HA 2QG6A 2WICA 5B53A 4CIAA 1UXKA 4NCXA 2BDUA 2D5IA 4RDIA 4QPZA 4HDRB 1I3KA 5IJWA 3KPUA 5ALHA 1DQZA 1CRQA 1MTZA 3D5EA 3ES9A 1P2SA 3G9TA 2HNAA 1N6NA 2MT9A 4N7RA 1L4MA 4MW7A 1W34A 3DAFA 2PWZA 2CNNA 1QYXA 3FNIA 3JV7A 4MVJF 1GT6A 1C0KA 3MJSA 1GRRA 4LZAA 4XGRA 5LZ4A 1RAAA 3BK7A 3K1AB 2VT7A 4MS3A 4RZUA 3GLFA 3L0CA 4XVCA 2C1XA 2OGSA 4OQQA 5I7HA 3HCRA 2PJUA 5KYVA 1FDUA 4H7EA 1LF5A 4LV5B 4EYSA 5JARA 5CVDA 3T54A 4YRMA 1EUYA 4ROSA 1LTHR 4AF7A 4R81A 3L6BA 1TZ2A 1I3LA 4L1KA 5ER9A 2HJ9A 1W19A 2XB4A 5C8DA 4NONA 4NZOA 4C0SA 4S05A 1KQ3A 4BFLA 4CHGA 5EE5B 5FO1A 1R3DA 4QDKA 4IL5A 1I8TA 4Q00A 3MOGA 1Y42X 1A5ZA 2D62A 3QUAA 3UIEA 4EEKA 2VQDA 4FZVA 4C4ZA 1AGPA 1CQIB 4B6RA 4X24A 1OSNA 4GDMA 3L92A 1RRVA 3GJYA 4KCGA 3WGIA 1UP6A 3H17A 1MDFA 1KXJA 4N18A 1Q74A 1QTQA 2NU7A 4Y18A 3ABOB 2Z9BA 3SVZA 4RH1A 3ZW9A 1Y80A 3COWA 4FWBA 4XR4A 5HFNA 2NZJA 2OOSA 4NH4A 4TYQA 4K9SA 3SC6A 4D45A 1VJ1A 4IF6A 5HDBB 3ZVRA 4DMFA 4F6RB 4AKGA 2BKUA 2GCGA 3S29A 4BP3A 3RVRA 3SIXA 4GVXA 1OTYA 2P6NA 4R8MA 4ID9A 3A6EA 4JC8A 1N1DA 3V8VA 3GLSA 3H2IA 1XMVA 5LMZA 2VNKA 1XTRA 3SU8A 3AU9A 4JLMA 2UZ4A 1MKYA 1VLQA 3D3EA 5F73A 4WOKA 2A4KA 4D9FA 2JJYA 1PEKE 3AMVA 1SVUA 2KYRA 3QFSA 4R2KA 2WA2A 5DBFA 3UANA 1U0FA 1F0KA 3X1ZA 4PQEA 1JSCA 1I30A 1WXDA 1M2VA 4L07A 4MW5A 2J59A 4ATNA 5JSZA 2FN8A 3KOMA 4MQLA 3O8LA 3JRWA 4ILEA 3CW9A 2FSVC 3DE1X 2BTQA 3IESA 4OQNA 4WK0B 3ZJ5A 1OH6A 4KVAA 1MOPA 5ITVA 2C3MA 2YV3A 1KSGA 4EI7A 3C3JA 4D9HA 4BVLA 2QT9A 2XQFA 4RV9A 2WWRA 3RYIB 1P75A 5DHFA 2PR7A 2WT4A 2YIMA 1NA5A 5G4KB 3L9XA 1K27A 2CYCA 2LKDA 4PG6A 2YHSA 4J16A 3SYKA 3TE6A 1WUTA 3M6AA 1P7VA 2W43A 4PLWA 3EF1A 3FOFC 2EKZA 2FPKA 4AZVA 1XTPA 4J1TA 2HUPA 3G9QA 2C83A 4Y0NA 3QELA 1WV0A 1A77A 3PUIA 1RXVA 2GASA 3ON5A 2DLDA 3K0CC 2C2BA 2WTEA 5IKMA 3N2GB 1G2QA 1VJRA 1WO8A 3X2SA 3L6UA 3WKBA 4C6SA 2IS4A 4KYVA 4JQYA 2CFSA 3RAGA 2X6TA 1E59A 1MQSA 4KXWA 4DCSA 3SBEA 3PFNA 1OLUB 3U4CA 3OJLA 1DQSA 2A78A 1OZHA 2ZPAA 1CRZA 1HZZA 1W2GA 1GNQA 3ADBA 1XRRA 4K0KB 2YC4C 3E9CA 1M5UA 2REXB 1GOTA 1EJ0A 2GVZC 2AHRA 4C4SA 3CZPA 1OWLA 5A9SA 4YRLA 1ZQ9A 1F51E 3AHEA 4KBYA 4R1PA 3ZGNA 1G19A 1U9IC 4XX0A 1I2DA 3Q8LA 1VZ3A 1Z6ZA 1QHGA 3O93A 5FNVA 1YDFA 3O31A 5JDCA 3CLRC 3T1QA 3DZGA 1OY1A 5AI8A 2IF2A 3KC2A 5EIBC 3H5AA 4K9RA 3N8HA 1NRIA 3Q8WA 5KOHB 3KL2A 1XRSB 3N5KA 4E7PA 3QU2A 4MPTA 2JGDB 1X92A 3NV7A 1AS2A 2WTAA 5J5AA 4CV1A 1W8IA 2ZIUB 1K9VF 1ZD2P 3LTNC 5IEBA 2OFFA 2J4CA 3VTZA 4QPCA 3WGUA 1XPUA 3ROXA 1F8FA 1QU3A 1F1JA 4RTLA 3T1HB 3ZYZA 1AQLA 2ODBA 3FAZA 1YQXA 2OV1A 1N3YA 1VKRA 4R9UC 4YCCA 2WQ6A 2QJRA 1HWYA 2GEBA 1R0XA 1T9DA 2BFFB 2W2VA 3VR1A 2CK3A 4A8TA 2YV2A 1UXGA 4N6NA 4E5MA 3DYVA 4I55A 5C5EA 1LPSA 1YZLA 4H15A 3RASA 5BPFA 2ZYRA 3FYUC 1JI0A 1WUIS 1Z29A 3PTAA 3TK1A 3C87A 4HL6A 4AJKA 3LPNA 5E0OA 4B34A 5JAMA 3ZCTA 4BDSA 2O8BA 3OP4A 4DA4A 1G5PA 3PEVA 1EFTA 3PP8A 3KTFA 4KZKA 4HUTA 4NOJA 1TIKA 1QYVA 1W1UA 4ZQFA 4ZVQA 3NBFA 1ZJYA 3W5DA 3V4ZA 5L3QA 2D1QA 4G0UA 3Q10A 4BBJA 4JWTA 1AKEA 2XVXA 1M8JA 1R4MB 2FOXA 3M6LA 4RTOA 3F49S 2QHXA 2INGX 5F7JA 4HLCA 4W9MC 1U1IA 3SEZA 4IY1A 4J0HA 5LQSA 3HI4A 4MP3A 2NWQA 3PJEA 1U2GC 2AR7A 3N87A 5LOVF 1IL0A 5JNTA 2MR5A 3WV4A 1KAQA 3QVWA 2B8JA 5ESWA 3OOWA 3OWOA 4Q7KA 3A9UA 2YMMA 1Z56C 3B7GA 2GMWA 1ADYA 1B1AA 4UQLA 1JIXA 3FZQA 4OO3A 1TQ4A 2ZYTX 4QHTA 5LZ8A 4GMXA 3EC7A 4DIBA 1BKYA 2XKAA 1QB8A 2OKCA 2R97A 3LRPA 2FMIA 4MKIA 4WKCA 1PD1A 5F12A 4ALNA 2H57A 3PHIA 1QDUA 1RKQA 7MDHA 3KT8A 4DDVA 4XLZA 1VI6A 2IZ5A 2PH7A 2YRXA 2I62A 2BBOA 3LE8A 5CDUA 3MUNA 5TPWB 4AN1A 5FBZA 5G1PA 1AKUA 4AXBA 3LLUA 5IKPA 2O2SA 4FHDA 4IIXA 4Y6PA 2Q3LA 3NZEA 2ZVPX 5BW8A 2IKSA 3C74A 3CYFA 3I9NA 1NVUQ 1RWOA 3TZHA 1PIWA 1V3QE 3QENA 5D3KA 1ZIPA 3LO8A 5IYZB 3CRRA 1Z4OA 2CWWA 4RS3A 2EYUA 3TMAA 3O1JC 4P80A 4RD4A 4TSKA 4AJLA 1VDMA 3PWTA 4MZXA 3STYA 2CCKA 1KIAA 3FUXA 3H6GA 2BCJQ 3UOAB 2PCJA 1B42A 1KMQA 2V0GA 2JF0A 4TT3A 3PPIA 4NOKA 3PDIB 4PNHA 4QUGA 4RGQA 3TSYA 1G5QA 5FADA 1KAEA 4QYIB 3M6IA 2QZ9A 4YJFA 4BQQA 5C35A 1DVRA 1YV9A 5ADHA 2IP2A 2VK2A 3BB3A 2GN4A 4B4OA 3GEHA 3WLSA 4I5IA 3R9IA 1SQGA 1CZNA 3HRHA 1RWNA 4KDEA 3RUPA 4EKEA 3G7SA 4DLKA 1IDN1 4XWYA 4IHQA 3SC3A 4K2HA 4JN6B 2IS2A 4EY8A 3W90A 3CUWA 4XWWA 3MOSA 1SZJG 1LPAB 4OY3A 4WNAA 2Z5GA 3V1KA 3G9XA 1BW9A 1QS0A 2CLOB 3IR7A 3RG8A 1ZVJA 2RH8A 1YDMA 3OVMA 3T12A 2GS9A 3IVAA 1Z4MA 1QUFA 1ML3A 4QWWA 5CK4A 4C01A 5K8CA 1KO1A 5D86A 3C98A 4ZXFA 2BFOA 1UIRA 4BMCA 4EG6A 4CKCB 1NG1A 2VOJA 2GBLC 3VDRA 4DBLE 1JXMA 4HI0E 5BSKA 4AU1A 3LQFA 2PEYA 3CB4A 1J8YF 2CKDA 3LPCA 2ERXA 2HFJA 2HU7A 5ARBA 4KNVA 4C5CA 1BMTA 3GA0A 1LZKA 4FR2A 1YRBA 1YFKA 3N6VA 4MR8B 3A27A 4EPXA 4AJJA 3T1TA 3UT5B 3RRNA 2P41A 3NXKA 5TEVA 3K2QA 3K9HA 4PF1A 4PLFA 5GM1A 3TLEA 2FG6C 1F2DA 2O6LA 3X44A 4BE9A 3VTFA 4JHLA 4Y2JA 4GLBA 2QRUA 1ZOLA 1YHYA 1DC7A 1WPRA 4MWTA 1H1LA 4JV5B 1OYOA 2NNWB 1SIWA 2YTZA 3HVJA 3I6ZA 1CERA 2ATIA 4I1IA 3KELA 4CFZA 1ISRA 3TSWA 2GQ0A 3FPBA 1XVUA 2QRHA 1TM2A 3JCZA 3DTTA 2X8AA 3KSRA 4Q48A 2GXQA 3GJ7A 1IN7A 4HH3C 2JG3A 1M6WA 2V03A 1V8BA 4Q4HA 3VYWA 2AFIB 4B83A 2DBQA 2CB0A 2H2WA 1NVXQ 5JRDS 2DUWA 4OEHA 4PO1A 4TUYB 1F48A 2E4WA 3UCXA 1F38A 1HEIA 1RCFA 1Y7LA 4Z9AA 2EJBA 1QF6A 2NUAA 4YLYA 4H17A 4EENA 3OHSX 2GF0A 3UAWA 4EUEA 3A1EA 4KI0A 2WUVA 2MYNA 4FT4A 4UPVA 1Z2AA 5EZYA 2KBFA 3LSTA 5BWMA 3I5XA 1OI2A 4LOJA 5K0LA 1FS4A 4IW3B 3IAM6 4JI7B 5IKEA 1CBUA 4A23A 1I4WA 3KQMA 2J9ZB 2IOHA 3N7UA 4Q9NA 4QEKA 4ZU3A 1KZ6A 3M0EA 5GGYA 3KRTA 1FNDA 4U8GA 3K05A 1O7JA 3X43A 5HNKA 2P6OA 5TGTA 5KKNB 1F9AA 3NVKI 4HO1X 1X94A 1EIZA 3A58B 1F0YA 3OU7A 4ER5A 5KSOA 1XHFA 5SYMA 4F4IA 4WXEA 1U3UA 2ZJ2A 2YOHA 4WXRA 1GG8A 1CZKA 4KN5A 3SFTA 1WRBA 2FG7C 1VSBA 3GN1A 2ZETA 2Z83A 3RFCA 1K7YA 1HXHA 3NW9A 1P60A 1ESZA 3N0RA 3DEYX 2JARA 2BFWA 3NBKA 1R6XA 4PW0A 1E32A 2X3FA 3NHBA 1O9HA 2XWBF 4N5IX 4XQGA 5J5VA 5ULLA 4EDHA 5DWVA 2VPYA 3UUWA 1YWGO 3NATA 4HLUC 2P0YA 4NMLA 2GZAA 1U0TA 2P3LA 4LJ8A 4EHIA 2HWUA 1AE1A 2JFFA 4NAVA 1V35A 2DHRA 4M0KA 5IRCD 2ZRBA 4UE2A 3AR8A 4HDCA 2R96A 3VNQA 3A32A 1GZSA 4V0ME 5HGXA 2C3YA 3PR1A 2PMEA 3IQFA 3L8EA 4CQMA 1SUIA 1ZKMA 1RM0A 1VA5A 1UWLA 1YZNA 4G0QA 3TQHA 4B3HA 2QROA 1FS5A 3IMFA 4C06A 2JIOA 2J0VA 1HNWB 3I9KA 5JBIA 2YFHA 3S27A 2BFDB 4KQXA 4Q1BA 5K8JB 1T6ZA 4Z8XA 1RJFA 2AV6A 1RU3A 3IA7A 3L0IB 4GXQA 4B9AA 2QY9A 4F46A 3NMUF 1J5XA 1H93A 4DWJA 2N42A 1RQRA 3NETA 3TTSA 5LIPA 2KM1A 3GLFE 1GKUB 4OPMA 5MN4A 2OG2A 2J9GA 3AQ4A 3FPEA 1W581 4M4SA 3Q6MA 1P6QA 3JQAA 1ZOIA 3QHAA 4HAYA 4KN6A 1YNSA 2GLXA 1NONA 2P4SA 3ZUGA 3NYIA 4DQUA 1MDBA 4F2PA 3WE7A 3J81A 1JDSA 1JBKA 3B3GA 4ZJYA 3UJ6A 1Y4UA 5DI3A 2ATCA 1ULBA 3BRWA 3OZTA 4FOSA 5JXHA 1Z8NA 1A82A 1C3EA 4NG4A 1CRLA 5HJ5A 5FI0B 1WEHA 3UC5A 5AW7A 4WLFA 4BP9A 1FDWA 3LHKA 4HFMA 3TTXA 5A4AA 3T3PB 1BGVA 1ISPA 1Z0UA 6Q21A 4OKSA 4TKVA 5CK5A 4LJ9A 4NAHA 1SU4A 2MSEB 2BAGA 1SPXA 2VSYA 1DCFA 4JY7A 1RYHA 5ITZA 1DG3A 4N48A 1NFRA 3ESAA 3MMSA 1I80A 4PX9A 2A58A 2NVBA 5H4HA 3WIUA 4BNDA 1IZ0A 1WMDA 4TKMA 1R5OA 1C9NA 5IULC 3AFMA 4L50A 3DFMA 3PPXA 4FEAA 4Q93A 2HHHB 5CYFA 2C03A 2R66A 4NYJR 2C2YA 2PWPA 2VNSA 4EUNA 1A7JA 1ORRA 4I4TB 4ZT7A 3JWEA 5CR9A 1QDLB 1YFZA 3QV1A 4C20A 1FU4A 2Q0QA 5DLQC 4UZEA 1BCRA 3GLVA 4J7UA 1RNLA 4BLTA 2Y3IA 2R6HA 4C4OA 4I66A 2UUCB 4KPFC 4CM7A 3F0TA 1D4ZA 2QIOA 5F3DA 1A9QA 2A57A 2ZCVA 3VAYA 2I1LA 2HA3A 3KR9A 4YCMA 1T5OA 2GO1A 4PBRA 3O75A 4BGIA 2XVMA 3PVZA 2IXAA 2HGSA 5G1OA 6ABPA 1EBFA 4GM0A 1AT1A 3VYUB 4XDGA 1H23A 3GJ6A 3UGKA 5B6JA 2CDBA 1ZW1A 2DWOA 4JROA 3JRNA 2O8NA 3G2IA 3JY6A 2A67A 2EDCA 1IG0A 3OM8A 3P4YA 4RSMA 3PC6A 1EK5A 4UDXX 2PRJA 2PRZA 1Z6GA 1JNXX 1E2MA 4Q4DA 5ECDA 4I50A 2O5RA 4DC9A 4DR2B 4OX9Y 5ABPA 2DHEA 1Y7HA 4HMOA 5EMKA 2XUQA 4KHZA 3B3QA 1MMFB 1NVFA 4KI7A 1RI3A 3IRUA 1NVVQ 5M3BA 2VDWB 1MX9A 3NUGA 4ASUA 3U61B 1NW9B 1ZIDA 3BB1A 4DNPA 2I67A 4TWRA 3M3DA 1OFGA 2Q5CA 5TEWA 3R7LA 3EVTA 4JL8A 4JOBA 1YIDA 3U60B 1BS1A 2JBAA 3O4RA 3PX3A 4UUQA 3B89A 5I8PA 5JI2E 1XKXA 1AGYA 2OZLA 4DV0B 5BWLA 1J2JA 2JGMA 5BN4B 1VBKA 4JJ4A 4EWLA 2XUHA 4RVNA 4MS4B 3U6BA 3L5OA 3BRQA 4V0MA 1OB5A 1YRWA 2W6MA 2H5IA 1DCMA 5HBGA 2WUDA 2ZUDA 3ANNA 3LLVA 4YUXA 3NOXA 1DKUA 4AULA 1GYPA 4OB8A 1OXBB 1VCMA 5KOJB 1BXKA 3AG6A 4ERNA 3EY4A 2A7XA 2GK6A 5EY5B 2V5UA 5H3HA 4L0QA 3HKBB 3Q1KA 1CPYA 3GL9A 3PNYA 4LEIA 1KBZA 1YR7A 3MSCA 2PWAA 2ZI7A 3LCUA 4LJKA 1RS0A 3AW8A 3GMSA 4UBNA 3WWEA 3EZ9A 3H8SA 3EFEA 2NP7A 1K8RA 2K87A 2IODA 3RVLA 3IUYA 5KNCA 2VRCA 1UZUA 3KIPA 2CJWB