2CD9A

Sulfolobus solfataricus glucose dehydrogenase 1 - apo form
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
366
structure length
363
Chain Sequence
MKAIIVKPPNAGVQVKDVDEKKLDSYGKIKIRTIYNGICGTDREIVNGKLTLSKGKDFLVLGHEAIGVVEESYHGFSQGDLVMPVNRRGCGICRNCLVGRPDFCETGEFGEAGIHKMDGFMREWWYDDPKYLVKIPKSIEDIGILAQPLADIEKSIEEILEVQKRVPVWTCDDGTLNCRKVLVVGTGPIGVLFTLLFRTYGLEVWMANRREPTEVEQTVIEETKTNYYNSSNGYDKLKDSVGKFDVIIDATGADVNILGNVIPLLGRNGVLGLFGFSTSGSVPLDYKTLQEIVHTNKTIIGLVNGQKPHFQQAVVHLASWKTLYPKAAKMLITKTVSINDEKELLKVLREKEHGEIKIRILWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structural Basis of Substrate Promiscuity in Glucose Dehydrogenase from the Hyperthermophilic Archaeon Sulfolobus Solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Oxidoreductase
molecule keywords GLUCOSE DEHYDROGENASE
total genus 112
structure length 363
sequence length 366
chains with identical sequence B
ec nomenclature ec 1.1.1.120: Galactose 1-dehydrogenase (NADP(+)).
pdb deposition date 2006-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
A PF16912 Glu_dehyd_C Glucose dehydrogenase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2cd9A02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2cd9A01
2ZTLA 3WG9A 5IDWA 3E82A 4RQTA 2PGDA 3GGPA 4JNKA 3B70A 3ZNQA 3PYXA 5KNLA 3TZCA 5BSFA 1CYDA 1IYZA 2FN7A 3U3XA 4WLUA 4HFJA 2CSUA 4JIGA 2VT3A 3ZW8A 4CV0A 2XXBA 3TJRA 2GD1O 3H9JA 2VWGA 2VRBA 4UVGA 3LDHA 1MB4A 1LNQA 3AW9A 4ZN6A 4WNIA 2BELA 3WIDA 4MINA 5IF3A 3H3FA 3HJAA 2GO1A 1PWXA 2Y1FA 3KEQA 4LSWA 4BMNA 4DVJA 9LDTA 5L53A 3FTPA 1T2AA 1K3TA 4ZD6A 1OBFO 1PL6A 1X0XA 2QHXA 2D5CA 4BMVA 3T7EA 4J4BA 1UZNA 3DMTA 3PJEA 4KQWA 3VH2A 2OORA 5G0SA 2HRBA 2Q1UA 1UR5A 3DHEA 3HHPA 2PLAA 4PLZA 3KUXA 2BD0A 4FIZA 3ZWNA 4A7PA 4K28A 4OJNA 4WPGA 5ILOA 1DHTA 1NNUA 4DBZA 4NH4A 2Q50A 4RF3A 4ROSA 6LDHA 3E5RA 4KTVE 5JDIC 5COQA 1TB4A 2NV6A 1PQWA 2YV2A 3ST7A 5A05A 4Z3KA 1W73A 3GFBA 4E12A 5J23A 1CWUA 4XRRA 5JYDA 1LDYA 3KSDO 3QJ5A 3BHJA 1FF9A 1HL3A 3FNGA 3PGJA 2DPHA 3HDYA 2LDXA 3Q1LA 3WS7A 3X2EA 4NBVA 2IE0A 4NIMA 2VOEA 1E6EA 4C7KA 4ZQFA 1OZAA 3K9QO 4ZQEA 3CH6A 3U4DA 3JQFC 3RQSA 3O26A 1V35A 3VZQA 4CMGA 3L9XA 5GZ1A 2PTGA 2B83A 4XB2A 3GMSA 1H0KA 4XDYA 3BTSA 2V7PA 3WQQA 3PHHA 4CQLA 4IY1A 3H65A 4JQCA 4IDGA 3VDRA 3U4HA 4NBWA 1D4FA 2FPPA 3VPGA 1VL6A 3E18A 4YBZA 3OHSX 3NX4A 1A4UA 4E2ZA 5HS6A 4YQYA 1N2SA 2O2SA 3RAJA 3RUHA 2ZCUA 4MKZA 1WW8A 3KVOA 2EF1A 1Q7GA 1YBMA 1N9GA 4H15A 4B4VA 4BNXA 2ZJ0A 4QT0A 3H9UA 4PLFA 3OJLA 5L4LA 3D5TA 4HXYA 1KVQA 5BR7A 1CEQA 4XIYA 4AJJA 3VZSA 4BNGA 3WQSB 5ILGA 2HK7A 1Q7CA 5L4NA 3KYCA 3PIDA 1T4BA 2NACA 5KCZA 3H9GA 3T4XA 5JCJD 1QLHA 2RCYA 3BMNB 4YJGA 1CQJA 5BNFA 5KJFA 2PD6A 2Y1GA 4IJUA 1LLCA 1YWGO 2DQ4A 2HJRA 3A28A 3GR6A 4BV9A 4J2OA 1FDUA 5A3JA 3RU7A 4TRMA 3LT2A 2EKPA 3IP3A 4JGBA 1ZVMA 1I3LA 2DU8A 2VRCA 1WNTA 3RROA 3JQGA 3DOCA 3WGIA 4XYEA 1PJ3A 4ZHSA 4U8GA 3ZV6A 2A9FA 4XEHA 1BMDA 2QRKA 1DFGA 4A2CA 3DMTC 5BSHA 5JY6A 1GZ6A 3LVFO 3OBBA 2FY8A 3GY0A 3STHA 4EDFA 3QSGA 5L7WA 3HFSA 1IPFA 2J5KA 3K2BA 3OIGA 1NVGA 1V3UA 3GRPA 3OMLA 4YJFA 1ZKMA 2X0JA 3VOSA 2QRLA 3DAGA 2VZ9A 1W6UA 3GGOA 1HLPA 4ALIA 1E1KA 2DC1A 4AJPA 3MOIA 3DXFA 4FFNA 2AW5A 1BRMA 4CQMB 2PGLA 1RM5A 3JQ9A 2CUKA 3ONEA 3V2GA 3FNHA 4GH5A 4NU6A 4PVDA 5ICSA 4QO7A 3DHNA 3WR5A 1VLLA 4M55A 4BB5A 5L3ZA 2HAEA 1LX6A 1I33A 3GG2A 1UUFA 3M6IA 1HYHA 1I5RA 2ET6A 4FB5A 2AEFA 3HN7A 2IRWA 4URFA 4BNZA 4TWRA 1TA4A 3LLVA 1YH3A 3V8BA 5TF4A 3DFZA 1WLYA 3DWFA 4R16A 1P1RA 2I65A 7MDHA 4LGVA 1Z73A 3ROQA 1PJCA 4A0SA 5KJCA 3OSUA 3DMYA 5F5NA 3CKYA 1QXSA 1UP4A 4Q3EA 3F3SA 3L77A 4U5QA 1T2EA 1U3VA 4DBVO 3HB4X 3ZV3A 4UVHA 1I36A 4W82A 3IJRA 2G1UA 2W2KA 4NDNE 1LI4A 5TRTA 4OSOA 4EITA 3IAHA 3E8XA 4QO8A 4TROA 4J2HA 1M6HA 4N54A 4UUPA 4GKVA 4XYGA 4FOSA 5CG2A 4YJDA 4D3SA 4G5HA 2NVWA 4PLPA 3DQPA 4ND1A 2E82A 1PZFA 4BNMA 4RO0A 3ZV4A 3HADA 1QR6A 4MIYA 2VWQA 1B8VA 2Y93A 1P77A 4NBTA 1LU9A 3AUSA 1DIGA 1B8UA 4BO7A 2RHCA 3S8MA 3VPXA 2JFGA 1VKOA 4YAKA 1AN9A 3JD1A 1R0LA 4J7UA 2X22A 3CMCO 2WMDA 3ZCXA 2JAPA 4FJ1A 1NAHA 2VUSA 1ENPA 4GSKA 8LDHA 2GUGA 1OAAA 3P5SA 1X1TA 3MTGA 1C0IA 1VPDA 4H16A 1ZK2A 1NFRA 4NJMB 5I9NA 1YL6A 4HFMA 1NAIA 5CDGA 3DDNA 3FD8A 3WJ7A 1PL7A 4O1MA 4DMMA 2BGLA 4EJ6A 4GVXA 4B8WA 4OGWA 3ETGA 4CUZA 3H5AA 1DLJA 1YXMA 3HDQA 4M8SA 4OKIA 4DA9A 1U7TA 3E9QA 4EJ0A 5IZCC 1DIHA 1X14A 2ZB8A 4XZ3A 1Q0HA 3D0OA 1YJQA 2QZ9A 3GMDA 3WSVA 4DPMA 5DZSA 1HYEA 5ITVA 1ZEJA 1GADO 3DOJA 3DBVO 2O3QA 4CLOB 2EERA 2Y66A 2RH4A 3VVCA 4ID9A 2PNFA 1R4MA 2DVMA 2X8LA 4E2WA 1P33A 3INTA 4KP7A 3UGKA 1JU9A 2V65A 1UDAA 2AQKA 3EYWA 2WYUA 3KYDA 1A7AA 2Y0DA 4YWJA 3ZU2A 3WGHA 2VYVD 1IZ0A 1J4AA 4F6CA 1QYVA 3SJUA 1GD1O 5U1PA 3RKUA 2Z5LA 1Y6JA 1MA0A 1DDOA 3D5QA 3V2HA 4N5LA 1ZMOA 4NJOA 4OHUA 5TT1A 4Z0HO 4PG5A 2D4AA 3VZPA 2GZ1A 4XQGA 4LMRA 4EUEA 3GVIA 4BKOA 1VL8A 3GG9A 1DC4A 4FJ2A 2VUTA 1N7GA 1O5IA 3TZHA 1A9YA 3JYQA 1Q7BA 1F14A 4J91A 4RVGA 2PD3A 3CZMA 3CPSA 3PP8A 1FDSA 3F4BA 3T7CA 3PWSA 3UKOA 4CUJA 3IKTA 4XJTA 4Z9XA 4BNFA 3C1OA 3OECA 3FNFA 2NTNA 4QQRA 4IDCA 3DAFA 1I30A 1BW9A 2D3TA 2NU6A 2WD7A 5TS3A 5EQDA 1WDMA 3HUDA 4A10A 2B5VA 2QW8A 3AM5A 1PTJA 3GAZA 1YE3A 1PS0A 1IPEA 5AOVA 3DR3A 3IKVA 3JYLA 3UVEA 4R41A 2E6UX 1T4DA 3ROMA 2NNLD 1DC5A 2OZPA 4BNKA 4DIBA 3GPDG 3DONA 3ZHBA 1R4NA 3P7MA 2X9NA 1ADGA 1AHHA 1GYPA 4L75A 1JDJA 1V0JA 4U0KA 3I9MA 1DRUA 4P4LA 1ZNQO 1L1FA 1O8CA 2WYWA 5JMPA 2NM0A 2C7GA 1VJ0A 1Q2XA 4E33A 3ASUA 2UYYA 2ZYGA 5L51A 3M2TA 4B3JA 4YPOA 3PEFA 3RD5A 3X2FA 3INRA 3WSWA 4AJNA 3SVTA 3JQFA 3RUDA 4UEKA 5L95A 3JYPA 5DT9A 3NV9A 2EW2A 5EINA 1PZEA 1P3DA 1Y7TA 2EKLA 3BHMA 3H2ZA 4TVOA 4CLRB 2OP0A 1IB6A 3WFJA 1XQ1A 2O7QA 1KY4A 1Z6ZA 2O3TA 1IUKA 2O3UA 3NT4A 1D3AA 1T2CA 3QVSA 3W6ZA 1O89A 1BDBA 2EXXA 3DB2A 4R5MA 4D45A 4GWGA 5JAMA 4INAA 4RLHA 2HK8A 3QLJA 3PLNA 3F6YA 1EFKA 5T8KC 1M67A 1VC2A 2VHYA 2JL1A 4Q39A 4Y6RA 2DPGA 1LUAA 3RC9A 1ENZA 3GVXA 1E7RA 4W7IA 1Y8RB 4EJMA 2NQ8A 1TVEA 4D0RA 4IDFA 1UAYA 1GPJA 1RWBA 1EUCA 2EJVA 1CJCA 3C7CB 3I1JA 4BGEA 4E2YA 3K30A 3WGOA 1LDMA 1B14A 3C1AA 1YONA 5JAQA 2FMUA 3OJFA 2VT2A 5T64A 3OEYA 1OI7A 1SOWA 1UJMA 4YJGB 3I5MA 3PDUA 3JQ8A 4PLWA 4U0JA 1LRKA 1U8XX 2PZKA 3FPCA 1ISMA 1R37A 1F0YA 1T2FA 2Z1MA 3C7DB 3L6DA 3KYBA 4WASA 4R69A 2VOJA 4CR7A 4CM1A 1WAMA 4F45A 5K6AC 1ZMTA 3WYBA 4XJSA 1EZ4A 3IC5A 4GQAA 2Q45A 3MJ4A 3CEAA 4DREA 4CMHA 8ADHA 3ZWVA 5HM8A 3F1KA 4BL5A 1ZSVA 4MP6A 3U5TA 4CQMA 3GOHA 1JW9B 2H1SA 1QG6A 5B4TA 5CPBA 1NR1A 2NSDA 3KB6A 3Q11A 4LVCA 4PG7A 3ZWAA 1RJWA 1P1IA 2WWRA 4LSMA 1KYQA 5HTOA 1TT5B 3AOGA 4MKRA 4TRNA 1UP7A 1ZK4A 1H93A 4IIVA 4YJFB 1JKFA 5THKA 5KJ1A 1DSSG 4OMUA 2W2LA 1EVIA 3JSAA 3UAGA 2AHRA 5ER9A 1UAGA 3TPCA 3ZI0A 5KIAA 4XGKA 1ONNA 5ADHA 1UP6A 4MVJD 5A9SA 2VN8A 1UXGA 1UXHA 4P8RA 4HP8A 1SEPA 4OH1A 5TNXA 3VKVA 2YV1A 3K8ZA 3L0DA 4GX2A 4CMJA 3JQ6A 1DO8A 3JD3A 5DNAA 3FCOA 2IEBA 1Y1PA 4MVJA 4N5NA 2QYTA 2JCVA 4XGNA 2NU9A 2VUUA 4MVJF 4PFJA 3VPSA 4DQVA 2A4KA 4RL6A 4I9UA 3LLSA 4BO5A 4EBFA 1G1AA 4RZHA 3RUFA 4GLOA 4J1SA 3RFXA 2YFHA 3JYNA 1GL3A 4DUPA 4ZVVA 3ZNOA 4YEDA 2CVOA 2R6JA 1DFIA 4R1TA 1QYXA 1RM3A 4FD3A 3H8VA 2XAAA 2YW9A 3EY4A 1E1LA 4WE3A 2E48A 2O2YA 3NAQA 3W8FA 2ZQYA 3KSZO 4JXKA 4E5YA 3BZUA 4OL9A 3ZWPA 4CM5A 3VC7A 3H6KA 4JROA 3I4CA 2WE7A 4UVDA 5BSGA 3GVHA 1GU7A 1HDGO 4BVAA 1DJQA 4XB1A 4MOWA 1GUZA 3DBRB 3K96A 4LCJA 4YAEA 3HZZA 1ZJZA 4CR8A 3PQFA 1J49A 3EC7A 3ETDA 2P9GA 2B4QA 3OFSA 3RVDA 3AUTA 3IOYA 1T1SA 1HDYA 1T26A 3K31A 2X1HA 3AM4A 5DOVA 3D3WB 3FSRA 4F3YA 4TVBA 5L45A 4CQLB 3QVOA 1KEUA 3JTMA 1ORRA 4XX0A 2NWQA 3O9ZA 5COBA 5JO0A 4Q3BA 3I52A 1KVSA 1I8TA 1T1RA 3WNVA 3A14A 2BRUA 3DBLB 4W9NA 5B37A 2DUWA 4FN4A 2EGHA 2WDZA 4LN1A 4Q3AA 5TC4A 3NGXA 2VZ0A 3PJFA 1VRWA 4PLHA 4RGBA 1MXFA 1CERA 3ZW9A 1HEUA 4DC1A 4GGPA 1HWYA 1GQ2A 2OP1A 3HDJA 3LC2O 4GL4A 4WGGA 3VHRA 4QEDA 5FI3A 1K2WA 4J6FA 1DJNA 4BNNA 4X54A 2JFFA 4K6FA 2V6FA 4U7WA 2GYYA 1HDXA 3GVPA 5IFLA 3QY9A 2EV9A 3KRTA 1QV6A 4NPCA 3I6QA 2AG5A 3V5NA 4BKUA 4UUMA 1GUFA 3OJOA 3PJGA 2Q1SA 2Y99A 3E03A 2P2SA 3BAZA 4Z0PA 2CDAA 3INGA 1EK6A 1ULUA 4AJOA 1ARZA 1C0KA 1UZMA 3M1AA 3PVZA 2YHIB 1R6DA 1SB8A 1DOHA 1WPQA 2C54A 4EUHA 3M1LA 4UEJA 1CQIA 2AQ8A 1TT7A 1SO8A 2VTDA 4CPDA 2GZ2A 2OOSA 4AICA 3A1NA 4NR0A 4RPGA 1QYWA 3O8QB 1GCUA 3DBRA 2GPTA 2UUOA 3MJTA 4YXFA 1HE4A 2CVZA 1T25A 2P9EA 1XU7A 2VHVA 5DP1A 3ENNA 4BQRA 1KVTA 1U8FO 3KTDA 4XIJA 1Y9EA 4BO4A 4Z9FA 4BB6A 5IG2A 4AJLA 2CF5A 2ZCVA 2ZTMA 3HE3A 4XQEA 3PK0A 2G76A 5DF1A 3PYLA 3OEWA 2Q1TA 1BWSA 2C82A 1UXKA 2HU2A 4WJZA 2Q2QA 3FNEA 4JJGA 5KVVA 1NVTA 1H6CA 1NQOA 4UEOA 3K73O 3ZNPA 5IDQA 2DM6A 4ESOA 3PI7A 4N7RA 1ADBA 2I5PO 3Q6IA 2B35A 1CDOA 3AFNA 1T2DA 1C1XB 2YZ7A 4O0LA 1H2BA 3AM3A 2IDZA 1PJ2A 3CZRA 2YV3A 5JDCA 2FOIA 3G79A 1BXKA 1QKIA 1SOVA 1LBEA 1QP8A 1IHXA 3BYZA 1HSZA 5T57A 3W4KA 5L9AA 4XWYA 4BGIA 4WECA 2NADA 2GN4A 3QIVA 1LXCA 2O4UX 1HDZA 3R3JA 2I67A 2GZ3A 4DQXA 4I08A 4AJ2A 3AY3A 1ZFNA 1AXEA 3TZKA 2V6GA 4PLYA 3MEQA 3FWNA 3QRWA 1HLDA 5KKAA 2EP5A 4YRDA 5KTKA 3MJEA 1ZO8A 3W1VA 3TWOA 4UVIA 1N1EA 5H81A 2I6TA 4RZIA 2HUNA 4RPHA 2X5KO 4JBGA 5JYEA 3I4FA 1KVRA 3PWKA 1V6AA 2W98A 3LT1A 1OC4A 5A9TA 3QQPA 1DXYA 3AOEA 3QE3A 5HBRA 2ZATA 2PKRA 2YFQA 1E7QA 1BVUA 3QVTA 5I7VA 1GZ4A 3PHLA 1LEHA 2GLXA 2PA3A 3OIDA 4U6QA 1B15A 3DTTA 3RFVA 4ZU3A 1QYCA 2HRZA 1E3EA 4DGSA 1B3BA 4J49A 4MPDA 4PN3A 1HT0A 3HNPA 1C14A 3JQ7A 4XGIA 1SCUA 4XR4A 5BSEA 2LDBA 2X5JO 3CMMA 3SJ7A 1PGOA 4RV9A 1E7YA 2HCTA 3A9WA 1H2HA 1A72A 1MGOA 4K1LA 4BO2A 3ZHXA 4O5OA 2P5YA 5EESA 2WM3A 3ORFA 2W90A 5C7IO 3AUAA 3AFMA 4ND2A 2IZ1A 3ZDFA 1TEHA 2CDCA 1IL0A 1BVRA 2WD8A 1GFSA 1ISJA 3EZLA 2HSDA 1AE1A 3FR8A 1E6WA 5I9LA 2EGGA 3AY6A 1XKQA 5ICMA 5JXWA 2V6BA 5H82A 3WOHA 4CLRA 4DWVA 1Z45A 1YOVA 2X5OA 3OJEA 4J0FA 4J90A 2YQ4A 4QX6A 1MP0A 3ZHYA 2XPCA 1E6UA 3OJ0A 1KEPA 3B1JA 3GUCA 2C7VA 3WBBA 4O63O 3LF2A 3VH4A 2HO5A 1JLLA 2GNAA 1GY8A 2X0IA 1B7GO 3LC7O 5C7OO 3CSDA 4GVLA 4CR6A 5JFOA 4HX5A 4FOOA 3L07A 3PFFA 4L74A 3ITKA 3A4VA 3BIOA 1P44A 3HB5X 3ZWWA 4GPD1 2P68A 4CM9A 2ZYAA 3DHYA 4CM8B 2DBRA 2JCXA 3GDGA 1K6JA 1JAYA 4XYMA 1EDZA 2HQ1A 1FXSA 1FDTA 3KLPX 3HN2A 4WCFA 1HSOA 2NQTA 2CDBA 4OIMA 4KDEA 4A5OA 1GR0A 3I9OA 1K5HA 1R4NB 5L7YA 4BNIA 1NQ5A 4BUCA 2GASA 4LISA 2X0NA 3ABIA 3GZNB 4H3VA 2VCYA 2D0IA 2NVUB 3ZWCA 4CJXA 1DIRA 1X7HA 1B16A 1H6DA 1BW9B 1NVMB 1WDLA 4JX8A 1P0FA 3H5RA 1YDEA 2PR2A 1ID1A 2YUTA 4RPJA 4WLOA 4HUJA 3DBLA 4A73A 5U9CA 2C0CA 3OM9A 1P1JA 4TSKA 2Q1WA 2Q3EA 1XEAA 3KO8A 3W4JA 5KVQA 5CP8A 3ULKA 4IZHA 3LC1O 4F6LA 1GUYA 3C7AA 2WJPA 3S1LA 3AOEC 1E3LA 3FI9A 4ND5A 3AK4A 3DZIA 4KTTE 4E4YA 1ISIA 5BNIA 4GX1A 2GDZA 3RKRA 4ZQBA 4WUVA 4R5HA 2HMTA 4PZCA 4KUEA 3ZU3A 1D7OA 3SX2A 4F46A 2BI8A 2VNSA 3IDSA 1DIBA 4ITUA 3D7LA 3EW7A 5DBFA 1LSUA 2OXIA 3QVWA 3R6DA 3U4CA 5B12A 3JYOA 3RI3A 4FBGA 3AU8A 3B1FA 1NPDA 4J4HA 2ZTUA 4QFCA 3KETA 3UCEA 4R1SA 3ROKA 2UUPA 3QW2A 4JJFA 1BGVA 1OOEA 3GZ4A 1XG5A 1PWZA 1KVUA 1E5QA 4IDEA 3DZGA 3PQEA 4J7XA 4J9UE 4I5GA 4L4XA 1T24A 3JQCA 1QORA 2A35A 2DBQA 3WICA 3S2EA 3BHIA 4MJLA 4CMEC 1PL8A 1U1IA 1I3KA 2GGSA 3L9WA 2YDYA 4AJ1A 4CODB 4DIOA 5U4QA 3S2GA 3PHIA 4D44A 3AI1A 5T5QA 1UH5A 3TF5A 2E37A 5A9SB 3SC4A 2EEZA 1XDWA 4C4OA 2DTDA 3MOGA 1F12A 1C0LA 4DLAA 2RAFA 4BNYA 5I7EA 1NX6A 4J43A 4CLDA 1IOLA 1VJTA 2D8AA 3GF4A 3JQBC 4B4UA 3DO5A 3ZV5A 3U62A 1PZHA 4GX5A 2Q2WA 2JAHA 3AY7A 1U7HA 3LU1A 4BNTA 4CL8A 4N18A 4LMPA 5K1SA 3JQEA 5K0ZA 3K92A 2BFPA 4IS3A 5JW6A 3E48A 1LSOA 1NFQA 1EE2A 2HJSA 3UICA 3WB9A 5JMWA 1PJTA 2JHGA 1GQYA 2HMSA 2J3HA 3WYEA 3E1KA 3BMQB 4XYLA 1O95A 5CFZA 1K0UA 4YR9A 4HY3A 5DN9A 2J3IA 3ADOA 4W7HA 5ENVA 5JY1A 4R1UA 1YBVA 1GDHA 3QV1A 3MJSA 5EL0A 1YL7A 2X6TA 4E5MA 1LTHR 3JQ8B 1R12A 1KBZA 1HXHA 1K6IA 3WLFA 5EN4A 1IE3A 4DIFA 5HRUA 1ZH8A 1P1FA 4CMBA 1EVZA 5A3VA 2CZCA 1E3IA 4Q3DA 1A71A 3FRJA 3WQRA 3VH1A 5G0VA 4IGEA 5DP2A 1F17A 2BFOA 3UXYA 5G0UA 4E0BA 4IXTA 5AQ1A 3ROPA 1Z75A 1RYDA 2CFCA 1B0AA 4XD2A 2VHXA 4G81A 3PZBA 4TRRA 5B4VA 4FC6A 2FRDA 2OHXA 3TDKA 4GMFA 3LT4A 1E7WA 1MG0A 2VTEA 1LC0A 4IQ0A 3ITDA 4ZQHA 4YAJA 4E2XA 1PGNA 4UUNA 4PCVA 1PR3A 2QIOA 3S55A 3F4LA 1KEWA 2IEDA 5JC8A 1YB5A 4GKBA 3ZWXA 2BGMA 1U5CA 4ND4A 3GNQA 3OQ6A 5JAIA 1HYGA 1IHYA 4YT2A 4RLSA 1YRLA 3ANLA 3GNSA 3N58A 4BNJA 1NFFA 1LDNA 4RVSA 4EW6A 4KUHA 3QWHA 4NFSA 5DCYA 1KS9A 4HADA 1GYQA 5IZ4A 4IS2A 3H9QA 3NGLA 3HSKA 3IIEA 1BHSA 2R00A 2O3RA 3UFXA 1PZGA 3VDQA 5BQFA 3GN1A 1W8DA 1EQUA 3R3SA 3VZRA 3B6ZA 3SLKA 4CMEA 4WLVA 3NYWA 4NQZA 3UUWA 5MGBA 2O4CA 3PZRA 3GPIA 1EFLA 4NK4A 4GLLA 3U0BA 1Z82A 5G4KA 3W8DA 4EGFA 2FR0A 3WIEA 4D43A 4MVJP 2A92A 4RDHA 3WFIA 1A4IA 4CQMD 5DBGA 5A9RA 3DZJA 1JKIA 5JC1A 2NLOA 1A5ZA 1XSEA 4NG5A 1RPNA 5F1KA 2GN6A 3GK3A 1ISGA 3D4OA 2FR1A 1PGJA 4YJHA 2UVDA 3OA0A 3I9NA 3KBOA 3BA1A 3WGQA 2H63A 4QUKA 3V1YA 1U2GA 4NBUA 4IQGA 1D1SA 1DFHA 2DBZA 2HK9A 3PPIA 5CHEA 2QRJA 2DFVA 4YB8A 1Y8QA 4E5PA 1QLJA 2Y1DA 2JD2A 4HWKA 2JKVA 4Y6SA 1VI2A 4E3ZA 4W4TA 4XKJA 3LQFA 4IPTA 1EK5A 4DPKA 2B69A 2OGUA 4NNJA 4II3A 1M66A 2O23A 5A04A 5L4SA 3WGGA 1WP4A 4EEZA 2PZJA 4PG6A 4RF4A 3GNTA 4FFPA 2BI7A 4RVFA 3ZU4A 4YTEA 2X7HA 4BGUA 5AXAA 2VYND 4RCVA 5TJHA 2BH9A 2PK3A 1HTBA 1LSSA 3RIHA 3AJRA 3NTOA 1XCBA 4IDAA 1CIVA 2Y05A 2I76A 3HG7A 3KYDB 5FFFA 2Y0EA 1BXZA 1SZJG 5DOZA 4OXNA 3IS3A 4RF5A 3UOGA 4D41A 5TT0A 2ZTVA 1ONPA 1YQXA 5AXCA 4DLLA 2P4HX 4YRBA 1FJHA 2FSSA 1S7CA 4PRLA 5C37A 3F5QA 3DZKA 3UHAA 3EAGA 3GZNA 4PVCA 5JDIA 1PGQA 2AE2A 4NBRA 3WGYA 3R0IA 4IZIA 1LRJA 3LF1A 4FFRA 4NI5A 3QWAA 1E1NA 5EMHA 1DAOA 5T67A 5TIIA 3GEMA 4ZA2A 1SMKA 3ICCA 4EUFA 2J5RA 4CLXA 1JTVA 1GZ3A 1P1KA 2C29D 4CLEA 1X7DA 1YB4A 2V6MA 4TQGA 1YS4A 3LT0A 1HKUA 1P1HA 3EMKA 4J9VA 2G0TA 1LA2A 4JBHA 4P38A 1E7MA 2H6EA 4ZGWA 5FF9A 1ENYA 4HFNA 5ITWA 4W99A 2ZYDA 2IZ0A 3ONDA 4BO0A 5I7FA 1H9AA 1V3VA 1YQGA 3BTUA 2DAPA 1YKFA 4UAGA 3FHLA 4WCDA 2OL4A 3GHYA 4NFYA 4AJHA 3DC2A 1Y81A 3OICA 4C7JA 2PGJA 4XCVA 4WEQA 5CDSA 2NUAA 3UF0A 1LC3A 1PSDA 3UH1A 5A06A 4J7CA 1VM6A 5IZCA 3DZBA 1U28A 3UN1A 1LLUA 3GRKA 4M1QA 5G0TA 2DKNA 3WTBA 4Y67A 3V1UA 4RVHA 4WKGA 3P19A 5GY7A 5LDGA 1JVSA 4W6ZA 4DMLA 2Z1NA 1KETA 3KLMX 4WLEA 3I83A 1KERA 5THQA 3WYCA 2D1YA 4EI2A 3FBTA 1NWHA 4K9DA 4PZDA 4BNLA 3BTOA 4XYBA 2OBYA 4CV1A 3C3XA 4FDAA 1WVGA 3QHAA 4GMGA 3NJ4A 4XQCA 4FW8A 4UULA 3WNQA 3JQAD 3IMFA 4JCOA 4RORA 4FQ8A 3HQ4O 2YQ5A 1V9LA 2RIRA 3QWIA 3Q9NA 3P2OA 4TMFA 1PIWA 5KWEA 3G1TA 3ZWYA 3KEOA 1VKNA 2OUIA 1LQUA 2BF7A 4IDBA 3U09A 1DPGA 4WCFB 3BMCB 4TRJA 4M89A 2Y67A 4R01A 3DBHA 2CNBA 2B4TO 3QP9A 3CINA 1N8KA 4IUYA 2C2XA 3F1LA 1DB3A 4PRKA 2E4AA 4WOKA 1DRVA 2HDHA 4IDDA 2GCGA 4M87A 4CM4B 3EZYA 1TLTA 4UREA 3KOUA 4Z0TA 3WLEA 3K5PA 3KM0A 5DBIA 4G65A 3ASVA 1U5AA 1YOVB 1DC3A 1ZZEA 1GEEA 1Z7EA 4UUOA 3RFTA 5B1YA 1EDOA 1H94A 1J5PA 4Y98A 3T4EA 1LDGA 3WJAA 3BXXA 2SCUA 3RC2A 2P4QA 4YA6A 3DEYX 1DIAA 5AXBA 4LRSB 3RC7A 3OIFA 1R0KA 4R54A 1ONOA 2ZIZA 1PS8A 3JD2A 4JP2A 5EQFA 3D64A 5TJ9A 2FP4A 4JLWA 2O50A 1P9LA 1ZCJA 4Q9NA 3SEFA 1OFGA 3WWYA 3GFGA 1UXIA 5JCJA 1E3JA 1E92A 1GTMA 1EMDA 2GN8A 4KWHA 5I8WA 1DRWA 3JQAA 1XR3A 3GLQA 2PH5A 3JQGB 3W8EA 2UAGA 3JQ7B 1MLDA 2POQX 3QA9A 1R15A 3ANMA 1ZIDA 5KVSA 1NXQA 3U9LA 5TX7A 2C5EA 3NT5A 4NU5A 1M2WA 2PY6A 2WYVA 3WXBA 4TZTA 3OA2A 5JPIA 4YYZA 1EBFA 4PG8A 5A03A 1I3NA 3IP1A 1NP3A 4UVEA 1VE9A 3C1TA 1E5LA 5AYVA 4BO9A 4ALKA 2Q2VA 5HS4A 1Y5RA 1X13A 2H5LA 4I5FA 1ISFA 2EKQA 4LW8A 3EK2A 4CM3A 5BT9A 1SBYA 3LYLA 4TKMA 4BKRA 1N9GB 2AEJA 4ONEA 4O59O 1IULA 3NT2A 2PWZA 3FPLA 4JBIA 3EDMA 5DCWA 3GH3A 2OMEA 4MP8A 4QTZA 4CMAA 1LQTA 2PH3A 1O6ZA 3I3OA 3GAFA 2FSVA 3SLGA 2DT5A 2Y68A 3ZWBA 2VQ3A 4BQPA 4R1NA 2HMVA 1OC2A 2D2IA 3R1IA 4DYDA 4LCEA 2G5CA 5CEJA 3PHJA 4TZKA 3VPFA 3EVTA 5IJZA 5TGDA 3TZ6A 2F1KA 2F00A 4IMPA 3EUWA 2PKQP 3C24A 3EHEA 4PIVA 2X86A 3TFQA 3TNLA 2EP7A 4I5EA 4PLTA 4RJTA 1I2BA 3TFOA 1FMCA 4OAQA 3JD4A 2Q99A 3WGZA 3WMXA 1DBVO 2R00C 3Q9UA 5JLAA 2EJWA 4CM6A 1JA9A 3PXXA 4ALNA 2O7SA 5IN4A 1Y8RA 3M2PA 4CMIA 2X9VA 1LRLA 1UDCA 3WMWA 4XQ9A 2ZB4A 3FBGA 3RUEA 3VVBA 1ADFA 2NU8A 1U3WA 3COSA 3ZZNA 5EERA 2YDXA 4P4GA 1AGNA 3JQBA 4M54A 4CMCA 3RUCA 1YVEI 1PJBA 3CIFA 4IJVA 2JD1A 4RPLA 2J3JA 5JBIA 1MG5A 3ENKA 1PS9A 4FS3A 2Q4BA 2I3AA 4HNGA 3W4IA 5HWSA 1P0CA 1PU2A 4RVUA 3SXPA 2GR9A 1ZJYA 1HDOA 3VH3A 4I8XA 2BHLA 2Q4EA 4JJIA 4RPKA 1ISHA 4KWIA 4ND3A 1L7DA 1E3WA 3RASA 1ULSA 4XA8A 4OOEA 4CM4A 2AA3A 2I66A 2CMDA 1M76A 1WXDA 3MJVA 1U4SA 3HWRA 1KC3A 2YHIA 4FGWA 4QECA 4YQZA 4B7CA 2DLDA 2NU7A 1PJ4A 5I8ZA 2QZZA 4Y6PA 3ANNA 5GZ6A 1E1MA 5DULA 1CETA 4EYEA 4DL9A 1AUPA 5A1TA 1A7KA 4OSPA 4IBOA 3AUUA 4YT4A 1RKXA 3BMCA 3GT0A 1FDWA 4ZQGA 1SAYA 1ZSYA 2GSDA 4D7AA 4KZPA 1NYTA 1N92A 5C7LO 4IIUA 4Y9DA 2R2GA 2C07A 3V1TC 3IJPA 4MVJH 3RBXA 3IQDB 3F9IA 4FC7A 2FR8A 3VAZA 2NTVA 3C8MA 3B1KA 3GEGA 4B4OA 1NQAO 1I01A 4LRTB 1EQ2A 3LSYA 3L4BC 1N7HA 2AXQA 1DHRA 1RYEA 1ZK1A 3ADPA 1CF2O 5EJ2A 1LDBA 3C85A 4U6SA 4D3DA 3HFGA 1HZJA 1I0ZA 1X7GA 4M49A 4A26A 4E5NA 2BLLA 3B20A 4OXKA 4NFHA 1Q0QA 1Q1NA 3OETA 4L0QA 3ZU5A 4FGSA 3NTQA 1N1GA 3D3WA 7ADHA 3Q2KA 6ADHA 2C20A 2DBVO 3BMOB 5G0WA 1C3VA 1A27A 4A27A 2B37A 1TT5A 1PQPA 1YL5A 4S1VA 2A94A 4DXHA 2EW8A 4E6PA 1MFPA 1NQTA 3PLRA 2CD9A 4GWKA 1XGKA 2X58A 2Y1CA 1JVBA 3TQHA 4BNHA 4N5MA 4OO3A 3NEPX 1H6BA 2PZMA 1W4ZA 2ZJ1A 2H9IA 4B79A 2Q46A 2AE1A 5LCXA 3GEDA 2FZWA 3DTYA 5KJ6A 1MV8A 1Y8QB 1NPTO 1EUZA 1FDVA 5ER6A 3OQ1A 4DTIA 1ZSNA 1R4MB 1O94A 4BO6A 2TMGA 5CPFA 4I9HA 4LK3A 2WSBA 4HFRA 3E9MA 4AVYA 3CTMA 2X9GA 1QYDA 1PQUA 4Z9YA 3MTJA 1HE5A 1XHLA 5C5IA 4IMRA 4E21A 3TSCA 4FCCA 4ZICA 5JS6A 4YVFA 4J0EA 3PRJA 3H2SA 1TXGA 3F47A 5CDYA 1PJLA 3DZFA 1DEHA 1VSUA 1IY8A 1AXGA 5MDHA 2ZK7A 1X1EA 4BGVA 1C1DA 1LSJA 4NJMA 3RSHA 1XU9A 1KOLA 2YYYA 1GV1A 3ICPA 2TMDA 3OQBA 2BFAA 4WOJA 5GMOA 3Q0EA 4CV3A 2HLPA 3AU9A 4BKPA 2IZZA 1BSVA 3H7AA 4FFMA 4AL4A 3MCVA 5BNTA 1X0VA 2JFHA 1SC6A 3NJ8A 5KJEA 2G82A 4R4JA 2G17A 2JJYA 2Z95A 5F5LA 2IYOA 3H9EO 1SEVA 4OXYA 1HETA 2GERA 4IJKA 4XR9A 1QRRA 2EHDA 3K6JA 1XELA 2VRCD 5K6AA 1YDWA 1RM0A 4FFLA 4B7XA 3GDOA 2NTJA 1O9BA 1PJSA 1SNYA 4KQXA 3NDJA 1WMAA 3GDFA 1F06A 1ZBQA 3H4VA 2C5AA 1NHWA 1B8PA 3IUSA 4RF2A 5JSFA 3U49A 1GEGA 3CE6A 4BIIA 1M6WA 4J1TA 4CM9D 1WZEA 5F3RA 1ZEMA 1SPXA 1B3RA 3JCZA 1TI7A 1OMOA 4NMHA 4QSMA 4CL3A 3OH8A 3ZWOA 5L40A 5G2OA 4IM7A 1EUDA 4OKNA 4I5DA 1BXGA 1NASA 2VYNA 4GI2A 5EIOA 2W2LD 5FYDA 2B0JA 3G49A 1P74A 2W4QA 5G4KB 4J3FA 5FEUA 3TN7A 1GCOA 4II2A 4RDIA 2D59A 3H5NA 4QXMA 3PFWO 2I99A 2YY7A 4OQZA 3SC6A 5CEEA 4E31A 5CDUA 4K26A 4FR5A 1B2LA 2FZEA 1ENOA 1V3TA 4WEOA 4BOYA 1NPYA 4GX0A 4ZRMA 4Z6KA 3I23A 1JKJA 4DRYA 3GQVA 4MKXA 2ZB3A 3I6IA 2J5QA 3JD0A 5G4LA 4MVJG 1I32A 1R0SA 1ZK3A 2OO5A 4MVJM 5A5FA 3I9LA 1JN0A 4GBJA 3ZGYA 3FF4A 3E6AA 4OYRA 4CUKA 5TLSA 2EWMA 3O03A 4JP3A 4WLFA 5I9MA 3VTZA 1N5DA 5F1OA 1I24A 3IUPA 5DDIP 2B5WA 4D79A 4B3IA 5KVCA 3NRCA 2O48X 3PYMA 5H83A 1XLTA 3PHGA 4ALMA 3DOOA 4S3MA 3RBZA 4BNVA 2OFPA 2GRAA 3G3EA 2DTEA 4YAGA 2VHWA 4DC0A 4YACA 2FPGA 3WDSA 4BS9A 1QV7A 4BNWA 4IINA 3NDIA 4KMSA 3W6UA 4R9SA 2PD4A 1P31A 3D4NA 4WNCA 5JAZA 2GF2A 2OBNA 4Z3DA 5IDXA 1MXHA 3PIIA 1UXJA 1F8GA 3UW3A 3JQDA 2XF8A 5AXDA 4DQUA 3WX0A 1D8AA 3MWDB 3DL2A 4O6VA 4W9NC 4L73A 3F46A 4CV2A 3DZHA 4GGOA 2VHZA 4J16A 3ZH2A 5A02A 1MX3A 4NHEA 2WD7B 1EEHA 1Z7BA 2BGKA 1UDBA 2WTBA 4HKTA 1I10A 1DAPA 3FN4A 1HDRA 4EZBA 3ZWMA 2X0RA 1UZLA 2B4RO 1KY5A 4MIEA 4LVUA 4D0SA 4PZEA 3BMQA 1M75A 2I3GA 5JO9A 1G0NA 1QMGA 2IXBA 4PG4A 5EPOA 5IXSA 1MC4A 2J6IA 4BV8A 2EIHA 2ZQZA 3RCBA 3I9JA 3O4RA 4IXWA 2QG4A 4FSHA 2IXAA 3EGOA 1I3MA 4B7UA 4Q3CA 1EVJA 5IXYA 1H9BA 2PV7A 3WBFA 2IYPA 3PQDA 5F1PA 1A9ZA 3PWZA 2DFDA 5LC1A 4KUGA 3NUGA 4WLNA 4MVJI 4WCFC 2ILTA 1VL0A 3FR7A 3F5SA 4BNUA 4FPXA 3FTNA 1V8BA 3G17A 5B4UA 3ZHZA 4BKQA 2AQHA 3MZ0A 4MO2A 2JHFA 3N74A 2UDPA 3ONFA 3RJ9A 3JQ9C 2IODA 3L6OO 3GN2A 2VWPA 4BHTA 5IAAA 1RM4A 4PLCA 2VWHA 4AJKA 4D46A 5GZ3A 1U2DA 3WGTA 2VNAA 1WDKA 2O3JA 1VSVA 1CRWG 2JCYA 3DFUA 3MJCA 2W2KB 3KSUA 1E3SA 5COAA 3QWBA 4YJHB 1R16A 4YDRA 4GSLA 4AJ4A 2P9CA 3CUKA 4CLOA 4FJ0A 4L76A 1G6KA 1MC5A 3L6EA 4AJIA 1HE3A 3FWZA 5FWNA 4MDHA 1O0SA 3CXRA 1E0DA 5F21A 4E30A 1L7EA 1PGPA 3RC1A 1NHGA 1EE9A 1YJ8A 2JD0A 2Y0CA 3GVCA 5T6BA 3LK7A 1HE2A 4I1IA 5IN5A 3GUYA 1AHIA 4G2NA 2WEKA 5JE8A 2RBEA 1EVYA 1FK8A 3WTCA 4FFOA 1SB9A 3I9KA 3KZVA 3L4BA 5AVOA 2PKQO 1WWKA 1XA0A 1R66A 2YHUA 2NVBA 3TL2A 4ALLA 3UCXA 5I7SA 2YJZA 1PR9A 2PZLA 2RH8A 4MVJE 5JDCC 5TQVA 1Q0LA 1HF3A 1E3WB 2QQ5A 4HV4A 1KIFA 1NR7A 2VYVA 4NK5A 1PEDA 3G1UA 1J0XO 4WK6A 5CEFA 4PLVA 1MFZA 1U4OA 5A5EA 3Q3CA 3L4SO 2CF6A 1S6YA 2AQIA 4Q3NA 3KHUA 2PFGA 1H5QA 1MUUA 3H3JA 2AEMA 4RVDA 2HMWA 4MIOA 3D1LA 4E13A 4L9RA 2C59A 5L7TA 1ML3A 3TL3A 4BO8A 1NWCA 3KV3O 2O3SA 3RWBA 1YGYA 1PX0A 3Q2IA 4IJWA 4CMIB 1YQDA 3P2YA 5ES3A 2Q49A 3WWZA 1ZK0A 4BO1A 4XRGA 5CG1A 4L4SA 3GC6A 4OQYA 4MP3A 4YAIA 1BXGB 5TSDA 2QX7A 4NZ9A 3VKUA 2FWMX 3EVNA 1YBAA 1E77A 4PLGA 3OP4A 4CLHA 1XYGA 2VZ8A 5K9ZA 2Y1EA 3ON5A 1GYRA 1GQQA 2I9PA 3U4IA 4AFNA 1IZ9A 4CM8A 2X23A 1ZXBA 3SBOA 2BFMA 3DAPA 4J4TA 2J3KA 1BG6A 1GAEO 4Y8VA 2RHRA 1JQBA 4YT5A 4ALJA 4HNHA 3S2IA 3QVXA 1VJ1A 3KYCB 3MWEB 4AJEA 4E5KA 1Y5MA 1ADCA 4HBGA 4JN6B 4L8VA 1C0PA 2X4GA 3GHHA 4YRAA 3AI3A 2DTXA 4ZJUA 2FPIA 4BMSA 3K2EA 2BMAA 1P45A 2QYSA 1WMBA 4R3NA 4R3WA 1BTOA 1YO6A 4XDZA 1Z74A 4ILKA 1X15A 1ZUD1 2W8ZA 4DYVA 2E49A 1G0OA 1GPDG 3GA0A 3OF2A 3RBVA 3RUAA 5LDHA 4L4RA 4R9RA 2DUUA 4JK3A 2P91A 4AG3A 2HKIA 3A06A 5HA5A 4DPLA 3TRIA 3ZNNA 2Y1OA 3NKLA 3TOZA 4ZRNA 5KKCA 4CM7A 1E7SA 4B3HA 2P5UA 4H7PA 1C1DB 4KDFA 4BO3A 2B36A 1BDMA 3O38A 2C2YA 4QFDA 1HZZA 1KEVA 3AI2A 4TKLA 2D5AA 3E9NA 2EG9A 4PGFA 1EBUA 4YCAA 1NBOA 5CAEA 1HDCA 4IQ8A 2WE8A 3D3EA 3RJ5A 3V2UA 4DLBA 5KOIA 2XXJA 1XWFA 3VTFA 2CY0A 4R68A 5JNLA 5C3MA 5CDTA 4J1QA 2UV8A 2ZB7A 3JQAB 1LLQA 1ZW1A 3PTZA 3D4PA 3VPHA 1I2ZA 3BMNA 5ENDA 4YT8A 4A03A 3PDJA 4M86A 1GV0A 3BTVA 1U9JA 3TZQA 1DLIA 4I9NA 1NM5A 2ZKLA 1XQ6A 3NDRA 4D3FA 1Y9AA 3ETEA 1B26A 1ZXLA 1J6UA 3LZ6A 3O8QA 1KC1A 4P4NA 3ZN2A 1QSGA 2CVQA 3HDHA 5DCUA 4RQUA 5A4DA 2BKAA 2GN9A 4J1NA 2J8ZA 5JCXA 1U3UA 4EEXA 1D1TA 2AG8A 3BMOA 5IDYA 1JAXA 3G0OA 1DC6A 1HRDA 9LDBA 1XIVA 1LLDA 1YB1A 4CMKA 3E5MA 1PJQA 2HMUA 4OOFA 4K6CA 1K89A 3KXDA 3RU9A 2FHSA 3S2FA 1JWAB 3GGGA 1JWBB 4B8ZA 3IL2A 1F8FA 3DBHB 4IGFA 5FI5A 3PGXA 1H6AA 1C1XA 4B4WA 4E32A 3TOXA 2XOXA 3JV7A 4R51A 1W0CA 1LDEA 4KOAA 2AMFA 1LJ8A 3N7UA 4D42A 4P22A 3UCFA 3RUIA 1U3TA 3NTRA 5T8KA 3PJDA 1K6XA 3QWFA 2NVUA 4GAEA 1NTOA 4OM8A 3AWDA 1WZIA 1I2CA
chains in the Genus database with same CATH superfamily
3WG9A 3HCNA 4FYHA 4UU0A 3LY7A 4RVCA 3H1TA 1RRGA 3KFVA 4BX2A 5IDWA 4KRGA 2PGDA 1FFAA 2QW0X 4TKVA 4ZJPA 2F3PA 1CYDA 4DZTA 3U3XA 5E8RA 5C34B 4JQYA 4GWLA 4MTLA 1DBSA 1VE3A 2ODQA 3IDAA 3ODPA 5KWIA 5FR1A 1KZ9A 2LXNA 2XXBA 2X0DA 3WNCA 2XUQA 4AW9A 1CT9A 1FQKA 1KXJA 1E18A 2VWGA 4UVGA 3TQIA 1WBDA 4CEHB 3AJAA 4WZAA 1MB4A 1KI3A 1OZGA 3IB6A 4A0QA 4DCJA 2GF0A 3UWSA 4MS4B 2CLDX 2VBCA 3NASA 3AEXA 3D6HA 3EQ9A 5L53A 3KEQA 4Q4AA 1WE2A 4G5GA 3U6BA 1T2AA 1R5OA 2CXHA 1OBFO 3KZMA 4J76A 4JJEA 5FQNA 3TINA 3W34A 4Z7QB 3TUZC 1I4DD 1X94A 3LOUA 3LI2A 1FU7A 3KU1A 4KMOA 1SU8A 3VH2A 1FUEA 4WBNA 1W4CA 4IRUB 2W6ZA 5I9BA 1V47A 1M73E 1UJNA 1M7GA 2Q1UA 4LQCA 3DCYA 2PLAA 3NBAA 2KBEA 2G7ZA 2VATA 3KEGA 4DG8A 5ILOA 3LUBA 4OJNA 1M2HA 2D8MA 1RAAA 3B9BA 1ZLYA 2C92A 2GX6A 2HHAA 4DBZA 5LKRA 2B20A 3UMYA 1IDOA 2CHGA 2WMYA 3O3CA 5COQA 4B6RA 3SYTA 2NV6A 3NEYA 1AZSC 1AY0A 4DABA 2VTKA 4E12A 1C9NA 1FEZA 5JYDA 4IHAA 5LBIA 3O4GA 3MCAA 3CUTA 1KKUA 3QJ5A 4LPSA 3AESA 4JKYA 3ZY2A 4BCBA 5ARBA 1VECA 3S8EA 5DGHA 3A6HA 3PQ8A 4EJSC 5L3SB 4QRDA 2YNMD 1KO4A 4W5WA 3ELUA 2WTMA 5IM5A 3RSGA 3PGJA 5FI0B 4BN0A 2DPHA 3QVMA 1OPRA 2HUPA 2BHNA 2I4RA 5KYXB 2EFDB 3WS7A 5KKNB 3EFOA 5LQNA 3P0EA 2HSJA 2PZAA 3AUFA 3NP7A 1VYUA 3MT0A 1FZTA 2MHCA 1OZAA 2N0SA 2BTOA 1AIPA 2BZSA 4L4UA 2E4WA 3UG7A 4CMGA 5EKXA 3EH1A 2ID4A 2D13A 4JQSA 3ADCA 1P0IA 2PTGA 5CDHA 3EXEB 2VHTA 1TYAE 2CHUA 3LIPA 4QYTA 1MHPA 1YUNA 3EAQA 4XB2A 1H0KA 1XQXA 4XDYA 3BTSA 3WQQA 1SHKA 1UT5A 2W6IA 2X76A 4CQLA 1CUVA 3MCUA 1BQEA 3AEZA 3H65A 3MTQA 4PE5B 3VDRA 4ANFA 4MCIA 3TYXA 4BQOA 2HC9A 2I2XB 2OTCA 3U4HA 1RD4A 3A2NA 3JAKB 1XAGA 2BC9A 3FXAA 4QNRA 1BD4A 2WHQA 4DNOA 4XVCA 4CGZA 4ZEWA 3BH7A 4YQYA 4RFSA 4HK4A 2XY4A 4URXR 8ABPA 4EGAA 1C41A 1P9RA 5E9AA 3RAJA 4C7XA 4DAOA 3RUHA 2ZCUA 3IERA 2QZJA 4LQDA 1MO3A 1WW8A 3WWOA 4QQ8A 3ZGLA 1N9GA 4H15A 2XBMA 4QT0A 3DDUA 1R4ZA 3OJLA 4US0R 8MHTA 2VF7A 5GOZA 4GF5A 3RG2A 3VZSA 1SBIA 4BNGA 2YXLA 2GS9A 1JFSA 3BXEA 3HTXA 3KNZA 4HYTA 4ZC8A 2I1LA 4P5DA 2XDQB 1DO0A 1OI3A 1U2EA 2NACA 4RMIA 2O8EB 3AF0A 1R0RE 2X19A 2YZMA 3TIGA 5ERYA 1D6MA 3RW9A 3SBXA 1NN3A 1P2VA 1N2XA 1CX9B 1FBNA 1IXSB 5KJFA 1I4TD 4EVQA 1S89A 2P8JA 1EM6A 3FTDA 4EB0A 4YJ2B 5CITA 3KSAC 2JLAA 4Z5XA 4J2OA 4QTXA 4YAFA 1G3QA 3EVDA 5HM6A 4EGCB 3GFTA 1WHTB 5EY5B 2WKSA 2I8AA 2I03A 4IW3B 2ZUDA 4JGBA 2DU8A 4Y9RA 4U2DA 2QM3A 1WNTA 4D57A 4LXIA 3BBPA 3RROA 2XVXA 5IKOA 1B23P 5DGXA 1PJ3A 2Q1XA 3HJHA 5D3MA 4EFKA 4D8XA 2GBLC 1ZPDA 2W22A 1E5TA 3B6EA 5FTNA 3WBKA 4XEHA 3GJ6A 1L5KA 3DDWA 1BMDA 2IPLA 3OPNA 2P77A 1T5DX 5CLLA 5E0OA 5HFNA 4A2CA 2R8ZA 4M6WA 3DMTC 1GZ6A 2PH7A 1WXHA 2OWDA 3BJEA 2BP7B 2P4UA 2XTZA 3EJ6A 5IJ0A 2IXFA 2FE1A 3NBFA 3K2BA 3KZCA 4QEZA 3OIGA 1DCKA 4CG0A 3EXHB 2AOTA 4JEIA 3JRWA 1NVGA 3OU2A 2PS3A 4AZ3A 3L0YA 4DY4A 4HAWA 4DR4B 4G0ZA 3QKSB 2X0JA 2VTVA 4HLUC 1LX7A 1O6GA 5T3UA 2J7KA 1Z8NA 2QRLA 3FKSA 3M6WA 4K46A 1JL3A 3CF0A 3IV6A 3K71B 3EGVA 3ADDA 2XX3A 3I2YX 4MGKR 4OPMA 1E1KA 2DC1A 3PRYA 3MOIA 4QTUB 2FJ0A 5ALEA 4ALIA 2AW5A 4BB9A 3LFTA 1O6FA 4G09A 1RM5A 4CQMB 3GJ8A 2CUKA 1FDIA 1R0CA 3PD7A 4TV9A 2EBFX 3FNHA 1PT9A 2ODBA 1DIOB 3UNXA 4M55A 3WOVA 5TMEA 5EZYA 1M1YE 1WDWB 1GTL1 1NJ1A 1SKUA 1Z7GA 1TLLA 3PRHA 3A6JA 5T6MA 4F4IA 4ZCMA 2DX7A 4FB5A 3T12A 1Q3TA 2D0DA 4EW3A 2Y1XA 1MO6A 4RE5A 1TA4A 1TECE 1HEYA 1U9ZA 1XTSA 1N9ZA 1YH3A 5TF4A 1D5CA 1SFRA 1WLYA 3BA6A 1VRVA 4JCCA 4QHSA 4C0KA 5FTMA 2NZ8A 1MGPA 2BBWA 1P1RA 1AB6A 3NPMA 2GUWA 5JSZB 1L5YA 1WLSA 1Y3AA 2EEPA 1Z73A 1RLTA 3DVLA 3ROQA 4A0SA 2X41A 4GOXA 5D3QA 3DMYA 3SJBA 3HL4A 3CKYA 3O3MB 3T5DA 3GWGA 5I45A 4Q3EA 3LWDA 1T2EA 4Z8YA 3BD9A 3PC3A 1AT1A 1KMMA 3SIXA 1WUTA 4UVHA 4TXJA 1ZM7A 3V42A 2Q7DA 5A4JA 4M8NE 5B30A 5FTWA 2W2KA 4PEVA 2HIMA 4BMYA 3M6XA 3COWA 3OI7A 1KJYA 4NICA 5LZ8A 3TTUA 5IXJA 2PUCA 1WF6A 1M6HA 2OQRA 3P0JA 2VSXA 4UHFA 4UUPA 5CG2A 4D3SA 3TD2A 2A4MA 1TYEB 1ORVA 3ISVA 4G5HA 4QPJC 3UAOA 5F78A 1G5IA 3PE3A 4RO0A 3WWPA 3TRHA 4DIUA 3HADA 2OK7A 2VEDA 4IEEA 2Y93A 3ZJUA 1TJ4A 4NBTA 1H3EA 1LU9A 3AUSA 5F98A 1DIGA 1B8UA 1NNLA 3STTA 2RHCA 2YJ4A 4K9OA 4LDJA 1CNMA 3W5VA 1PT6A 3NP9A 3JASA 3QTTA 3S8MA 1VKOA 4OA5A 3TRJA 3S28A 4ER7A 4YAKA 3JD1A 1R0LA 1JZQA 1RYZA 1WMEA 4RK0A 2WMDA 1KMNA 1SBZA 2JAPA 3TR5A 1JHVA 4W5QA 1E69A 2YXNA 1ENPA 4QARA 1PWEA 3U56A 4V1CB 5P8WA 1CJKC 1G18A 2ZYHA 3HUFA 1KFCB 1OAAA 1MIOB 5CDFE 3D1JA 3MTGA 5BT8A 3D54D 4EDHA 1ZK2A 4F5DA 4MWSA 3SI7A 1DWQA 3EC1A 4MV3A 1TF5A 2BGLA 3G5TA 4MB6A 3RARA 4A8JB 4GVXA 2ORYA 2R7AA 3DLIA 1VBFA 1LPSA 3UA3A 4B8WA 4OKIA 3BDVA 3OU6A 4CHTA 3LQRA 5EXSA 3T3IA 4DA9A 4EJ0A 3IFSA 4UBKA 1V4NA 4AYTA 2NO5A 1MC8A 5KOHA 1Q0HA 1TVKA 1TVCA 3GMDA 1GPMA 1QYRA 2XD9A 1JQLB 2XLCA 3E84A 4X85A 2DBYA 5DZSA 1HYEA 1VLZA 2QZPA 2DLCX 5ITVA 1XU4A 4HAVA 1JHAA 4HGZA 2CXTA 1D6NA 3U81A 4PZLA 1T6BY 1IXKA 1DINA 3U3RA 4ID9A 4RCYA 1OZ0A 4G1BA 4D9HA 1U9IA 4X6UA 4O02B 1P29A 2NG1A 2OT3B 5FV7A 4KIFA 4KP7A 3UGKA 1M74A 1UDAA 2O8CA 2QTMA 2WYUA 4JOBA 1C50A 2C57A 2BGTA 3KD2A 2RE8A 4MUBA 1W44A 5FH9A 5J2TB 1UANA 2AFVA 2VYVD 4Y2RA 1P80A 1UMKA 3A0UA 4LOIA 4MJ3A 3SJUA 5U1PA 1FRVA 2I1VB 2YWGA 5KX5F 3V33A 4U3JA 1W9MA 4CFZA 2CN1A 2PPVA 2JLRA 2PVPA 3EBPA 3IOCA 4JWTA 2YS6A 3IYLW 4FOTA 4TM7A 3QA3E 3D2AA 4W5HA 3SF0A 3A2MA 2QZ4A 3FGPA 4DDVA 3HKEB 4PXSA 2WT9A 3FCSB 1X2EA 3I3SR 2YZKA 4NJOA 1COZA 1GPLA 1Z16A 4OHUA 1XX6A 2FOXA 3A04A 4ECEA 2C2WA 3GJ0A 3VUEA 4O4HB 1SKYB 2REBA 1J0DA 1MJGA 4XQGA 3G2OA 4LMRA 3Q87B 4EUEA 5GJCA 4BKOA 1EFDN 1DAKA 1VL8A 1A9RA 2B8NA 3TSAA 2GAIA 1TKBA 3GG9A 4FJ2A 4UDXX 3COJA 4R8VA 1XTQA 1A9YA 1EXMA 1JIQA 3NIGB 1F14A 4IDQA 4D02A 2PWYA 3T1NA 1NVVR 1BXRB 5GQSA 3V8QA 2P3OA 1D2CA 1S3SA 3PWSA 3PE4A 3T9FA 3T7KA 2F1RA 2FX5A 1T2UA 4BXOA 4OFXA 3KSBC 2OD2A 3LZCA 1I30A 3F9CA 3HEBA 1V7PC 4YO8A 4IYRA 4JZKA 3ROZA 5T41A 4A10A 1OB5A 3AM5A 4OYLA 3GAZA 4BQEA 3DWGA 3DMDA 1UBLS 5IWCA 3TAUA 3JYLA 2PUAA 4R41A 2E6UX 5JSYA 2ZYRA 4JASB 1DC5A 3TQRA 4DIBA 4G89A 5LD2C 5ECGC 1XCPA 3H9BA 3D8TA 1ADGA 1D2HA 3NNSA 1CJSA 4MKHA 1TDJA 2CZGA 3B3JA 1JDJA 3HKCA 1KGSA 4PQYA 3QXJA 1QH1A 3GLHB 4FR2A 4XIIA 5DYTA 3JSXA 5B1SA 4WA7A 2Q9AA 4L3WA 4X61A 2NM0A 4P5EA 1V9SA 1DWUA 3AV0B 4XSVA 4IIJB 1G20E 4D9FA 1J20A 2GXUA 4Q4JA 1T9HA 4E33A 3ASUA 2ZYGA 3NV7A 1ZR2A 2UUCB 1U8CB 4B7ZA 3FAKA 4ZI5A 4P3NA 4B3JA 2GSWA 5CXUA 1QV9A 2XLBA 3PFKA 4K1XA 2VDWB 2H8KA 3R5FA 2Z2KA 5DHSA 4B3XA 5F2KA 1FFDA 2XKAA 2XTNA 4P9NA 2VDOB 3FPBA 3JQFA 4TTTS 4OI0A 1OFUA 3QYJA 1H85A 1GNQA 4D9BA 3ZCRA 3FTCA 4HH1A 2XE6A 5FTLA 5DT9A 4NMMA 1WB9A 2X3UA 3DLAA 3N7AA 2XDWA 2XOEA 2WWIA 4OHFA 2EW2A 2O2EA 3ZJ4A 4EPVA 1OSNA 5EINA 4ON9A 2EKLA 1J97A 1ZD4A 1XI2A 3H2ZA 4TVOA 2P9HA 4RC9A 5CFPA 1ILEA 1JGTA 4E5SA 4ENUA 2B9EA 4F1KA 1JDNA 1Z6ZA 2O3TA 2QVXX 3QBEA 4GPTA 1BEZA 1JIXA 4R3UC 3VXKA 2C3UA 2JAUA 2ZRHA 1M8GA 3H17A 1PQ4A 2HBQA 4LOHA 4RLHA 3ROFA 4B6GA 3STVA 1XXHB 4HGYA 4YCSA 5JAMA 4HDMA 3GCZA 2HK8A 3T0FA 4Q4JB 1EFKA 4LXQA 4CKBB 1M67A 1VC2A 2JL1A 3C3CA 1ODKA 4Y6RA 4ESVA 1QO0A 2RKOA 1LUAA 3RC9A 4TXMA 4C2AA 1KZYC 4CKZA 2QQFA 1U1GA 2IQ5A 1T4CA 1TVEA 2NQ8A 4I0WB 4TLMB 2BZ0A 5HK9A 4MV6A 5HMMA 4HNUA 1QH1B 4YHHB 4R2IA 4F2PA 1GPJA 4W5OA 5LFAA 2IF2A 1EUCA 3FMIA 4NAHA 3I1JA 5DRYA 2VDJA 1P2FA 4JB0A 1A98A 2IKSA 3IVCA 3WGOA 1OH6A 3RYIA 1M54A 1JSLA 3C1AA 5CXQA 5JAQA 1ZOPA 3DYVA 4OQDA 3E8MA 3KCNA 5JJLA 1CY2A 1OI7A 1M6NA 4BP1A 4YJGB 3JQ8A 4PLWA 3NQ41 4GXRA 4U0JA 2PZKA 2ATCA 1KORA 4JYMA 4DB2A 3FCYA 1S1CA 1TAGA 4P08A 1WB4A 1ZOIA 1QOZA 1OKKD 1T2FA 3FPSA 1JT9A 2PX2A 3L6DA 3N2KB 4G0OA 4HQKA 5K6AC 4Q01A 2Y1KA 4XJSA 4GQAA 1N75A 2ZWMA 3D2LA 4PAQA 3HJBA 5HM8A 3I42A 4DEYA 3KV1A 3WGNA 3GOHA 3PPXA 2GHQA 3EVAA 1FYWA 1BU5A 1QNLA 1TCVA 4RK7A 2NSDA 3KB6A 3BK1A 3O8LA 5K3FB 5BV8A 5MN5A 1U7DA 3ZD9A 5JJBA 2QVLA 5M2QA 3LTNC 1J7JA 1FTNA 2ZJ3A 2FQQA 3AOGA 3D8NA 1D2MA 5BVGA 1AHPA 3KPVA 2O7RA 2EZ4A 5KJ1A 5KBYA 1DSSG 2W2LA 2VDLB 1EVIA 2R25B 4OSEA 4RKWA 2WZDA 5D01A 5EI5A 3HXOA 2V0CA 4ZMBA 2DWCA 2ZUVA 3L7KA 4S0ZA 4TM8A 4XGKA 5C31A 2PLFA 3ZWQA 5ELMA 4I55F 4DSNA 3K1AB 1EUQA 1ZMBA 2PX3A 1MZPA 1UXGA 1UXHA 4XDHA 4P8RA 4HP8A 1EXDA 3VKVA 2X9QA 4QU8A 4UU7A 5BYAA 4PC2A 1DO8A 1KY2A 5CTAA 5DNAA 3FCOA 1RWNA 1NUHA 2KQUA 3C2QA 2IEBA 3DE0X 1Y1PA 4ZHQF 1XDSA 4FI3C 4N5NA 4COOA 2CB0A 2JCVA 1Q0PA 2QYTA 2VUUA 4MVJF 4XGNA 2H1CA 4DQVA 3AM1A 1THGA 4JL6A 1E1DA 4ZFNA 4US2R 3BIXA 5J40A 2VPZA 4ZEOA 4EY7A 4PINA 3VRHA 3ZBUA 2QAJA 1RWKA 4KQGA 4ZVVA 1R8YA 2ODTX 2KE5A 2R6JA 3KTOA 3BDIA 2IDKA 1P5ZB 1QYXA 4FD3A 1VPEA 5AUOB 1WMDA 3H8VA 2H9AA 2VLBA 1E1LA 2BMWA 1MABB 2VJOA 2BM0A 2O2YA 3B8HA 3NAQA 3QVLA 3BCUA 3F97A 3VNBA 1K8ZB 3W8FA 2ZQYA 4MJ7A 4YLEA 4B35A 2PUFA 3NIFB 4E5YA 4OL9A 1SD5A 2EFYA 2FF7A 1Y5LA 3U7QB 2MR5A 2WG2A 2GEUA 5TARA 2X6RA 4CZ2A 2XECA 1PSWA 3GRUA 4HD8A 1AS0A 2WE7A 3GVHA 1VLVA 1ZS9A 4DA0A 3GCDA 3GROA 3GJ5A 4DLNA 2J5XA 3PCXA 3DBRB 4LCJA 3WAJA 5CCBA 3UJHA 4YAEA 4JLAA 5BVHB 1C5KA 2A9RA 5JG7A 1V8PA 4AURA 1L7RA 1ZNXA 3RJMA 1LPOA 4RJLA 2PS1A 1P18A 2QD4A 1G7RA 3OFSA 3ND7A 1AXRA 1NU8A 1ODLA 4KO2S 1T1SA 2NO9A 3ZK7A 1HDYA 3AUKA 3ENZA 2RGRA 2VS1A 2X1HA 2NV0A 3AM4A 4EFNA 4ZOQI 5DOVA 2ETVA 3D3WB 5I5EA 3SZMA 1QQ7A 5GGYA 1K4KA 4G36A 4JODA 3QX7A 3NONA 3N8KA 4MV1A 4JOSA 3JTMA 4XQ0A 4XX0A 3PU6A 8OHMA 3E1SA 3MQFA 3ICWA 4DCMA 5JO0A 3B6IA 4M46A 2J3QA 3A25A 5ALSA 3ILSA 4HQNA 4CCYA 2QX8A 3A14A 2C3PA 4P33A 4X65B 5B37A 1W2HA 4LN1A 4OQFA 3PXCX 4JFAA 3PJFA 2ZQ5A 1RADA 3K2QA 1H42A 4DNXA 3SZ3A 1W4AA 3P8ZA 2J3EA 5KAPA 3WMFA 1BFDA 5JRJA 5JYCA 3ZW9A 4DC1A 1GQ2A 3TDNA 1U0NA 4GL4A 1KSGA 5D2CA 1GPKA 1DT3A 1RXCA 1MO2A 3GW8A 3HCWA 1DJNA 2PMFA 3N07A 1QPGA 1XNGA 4J6FA 1ZUNA 4N03A 2J0SA 2ZITA 5JADA 1KJZA 4L22A 4D82A 1JEDA 2V6FA 2ZSFA 2ZWIA 4TVKA 3WBJA 4FMCF 1M6EX 2R97A 4ZYYA 1XZGA 3KRTA 3ZUPA 2AN5A 2G5PA 2VYFA 1PK8A 3V5NA 4PSDA 3EDQA 4NDZA 1L1EA 1C3JA 4E2FA 2YXDA 4RTLA 2OB2A 2Y99A 1J8YF 4JHLA 3W2EA 3DR5A 3A9RA 2GJ4A 3Q7PA 2VK1A 4N8DA 3OX2A 3ABZA 2UYOA 3AVWA 2CDAA 2ZBUA 5HPYB 1ULUA 2A9QA 2ZWOA 5E9JA 4AJOA 5LL6P 1UZMA 1E8MA 3SR3A 4CTKA 1V37A 4G5XA 4B3TB 1SB8A 1MD9A 1DOHA 2C54A 4A6XA 2TMYA 3M1LA 4EUHA 5LWHA 2FQ1A 1Q44A 1V5WA 5KREA 1QCYA 2AQ8A 4W63A 1T5LA 2GZ2A 2OOSA 5TMDA 3QU7A 1HX7A 2IW1A 4JYBA 4QGAA 4ZI3A 1W48A 2DFNA 4MKGA 1RWVA 4MQ6A 4C3VA 5FNVF 4L8WB 1NJSA 1X77A 2HOQA 4LZNA 3SP1A 2WHRA 3O8QB 3ZEAA 1G59A 2Z04A 4KVGA 4KXWA 3MJTA 3LY8A 2BOVA 1EWRA 4IF6A 4U2KA 4PX9A 3SR0A 1B2RA 1R7RA 2VHVA 5DP1A 5C8YA 1KVTA 1MJFA 1U8FO 3D7SA 4XIJA 4LI0A 4J07A 1Y9EA 3KBBA 4EB3A 3IQXA 3TLYA 3PNBA 3CLRD 3RVKA 4GZ6A 3BSWA 3CX4A 3VR0A 2FK7A 2CF5A 2IITA 4PFSA 2ZTMA 3DO6A 1YZTA 5JARA 3T61A 1PFVA 2JGAA 3SX0A 4ABYA 3PYLA 5IAKA 1SVLA 2CNKA 5AK4A 3OEWA 4LOLA 3I0MA 4UBLA 3L4JA 3W77A 4UEWA 1AK2A 2PJDA 4MW0A 2ID9A 4NOLA 4CFYA 4MRSA 4UEOA 3N3AC 4DUGD 2A59A 4IHJF 2A88A 2EOAA 2RK3A 4DRXA 4GOMD 1CDOA 3RVLA 4C7BA 3MRVA 2B1JA 1TRHA 4WNAA 3FMPB 1PG5A 1W93A 3R3WA 1VG1A 1CHDA 1CQJB 1G6Q1 4JLMA 1GT6A 1J8QA 2Y6UA 5IW8A 1EFRA 3TQOA 2G80A 2POCA 3HB9A 4EIWA 1QKIA 5MDHA 1LBEA 1QP8A 1IHXA 2L17A 1AV7A 2WA2A 5E38A 2O8EA 1KDZA 1MPXA 4LC1A 1V26A 2LPMA 4LWQA 2Q4TA 4WECA 3L0ZA 5FO1A 4JI3B 4DSTA 3QIVA 1ZD1A 2VXOA 4XTRA 1JI3A 1HDZA 1RJFA 3WQBA 4LA4A 1QFMA 2H00A 4DQXA 2BJHA 2CMKA 4YV1A 2AJDA 2JG3A 2GPNA 2DG2A 2CV2A 1EGMB 3KOZA 3IAM6 1D1PA 4I08A 1R27A 1KJNA 4P98A 4FDLA 4U9HS 3SVLA 2OHHA 2W2PA 5KKAA 2EP5A 5KTKA 3MJEA 4A2WA 4E1AA 4NCJA 1AO3A 3TWOA 2OSVA 5FOXA 5UKDA 2DPXA 1UBNA 4LKOA 4RZIA 2WP8J 2X5KO 4RPHA 1B73A 3QE0A 4H17A 4YIKA 2PUHA 2W98A 2VYCA 3ZX4A 2VQEB 4Y7DA 4G3XA 3RB8A 2BUAA 1OC4A 1UBKS 1V6CA 1LBSA 3AOEA 2QNRA 4H7JA 4PGHA 4R83A 3C1UA 4OHPA 2BFWA 4RSHA 3OZFA 4EG8A 3G2MA 2Q3JA 3IPXA 3SR4A 4V3BA 1BVUA 5I7VA 2EZUA 1LEHA 4QVKA 3GYBA 2E9SA 3P0IA 1FFWA 4LWPA 3LCMA 1D2RA 2I0FA 4KPFC 1XPJA 1R10A 4ZU3A 3VZDA 3BB3A 3S3TA 1MBZA 1B3BA 4DKXA 2YWBA 1TJ5A 4RZ3A 1SXPA 4C4AA 2BE7A 4XGIA 3K8YA 4QUEA 1P73A 3T3GA 3FW1A 3A11A 3ONNA 4OEHA 1XHFA 1VKHA 3A6FA 5GGXA 5KSZA 1ULHA 5A0VA 3I2HA 1WETA 3EGXB 2HCTA 5HE8A 1KY3A 1MGOA 2FDXA 1ORIA 4BO2A 1AA6A 2PMWB 1DX9A 1WXEA 2I4NA 2P5YA 2QQ0A 4O5OA 5H0IA 3AFMA 4CF6A 3TUJC 2HSGA 3HLTA 4PGGA 2A3NA 3ZDFA 1TEHA 4V0RA 1F4PA 2XVYA 2R86A 1CULC 3EZLA 2HSDA 2XEXA 4JXZA 1OH8A 2Y9MB 2VK4A 5JEEA 3N2GB 1AF4A 2X0FA 1V1MA 2DCUA 4Y6GB 2CUZA 3R7SA 2V6BA 4CLRA 1XTRA 4DWVA 4TGLA 3FUXA 3NVAA 1DOZA 1H0HA 4J0FA 4J90A 1CZLA 3JVEA 4ZCTA 3ZKAA 1H1TA 1SBNE 3OJ0A 4JB8A 3A31A 1DQYA 2QT1A 3G85A 5EP4A 3WMEA 1R9JA 1KP2A 2C7VA 3JZMA 1L4UA 1P8AA 2C2GA 1U0BB 1MVLA 3L7IA 4HVCA 3F8SA 1YBFA 2Q27A 3F6BX 3I01M 3LF2A 4MGZR 5FOTA 3U60B 1SCDA 3JXEA 1NMEA 1RC0A 1WULS 2JASA 3FSJX 4KQ1A 3E0XA 4MR8B 4E51A 3R3XA 4EHJA 1BYIA 3OPYI 4GVLA 1Y3BE 3O8CA 2RJOA 2HF9A 4DOMA 3RADC 4LNHA 3IAEA 4Q48A 3HB5X 3ZWWA 4AWXA 1I7LA 2P9BA 4H31A 4CM9A 4F6RB 1D2EA 4CM8B 2JCXA 3ED1A 5JS1A 1JAYA 1Z13A 4B3BA 3FPGA 4XYMA 3L46A 2HQ1A 3N0XA 1FXSA 4JXXA 5C35A 1FDTA 3NVMB 1U04A 3HKDA 1F7UA 3LC0A 4OIMA 5E3JA 5ESDA 1C3LA 4WXHA 3USES 1R4NB 1YQQA 1NQ5A 2C4KA 2ZVQX 2A0UA 2NIPA 4B85A 1C2YA 2NVUB 3RFUA 4RULA 2CL6X 2L42A 1AKRA 4M9RA 3FVWA 4C30A 2I7CA 4QOSA 4P4SB 3FCXA 3TM5A 4ZZIA 1WXQA 3HRHA 3UPUA 1BW9B 2Q3LA 4AZVA 1F8XA 2E5WA 3H5RA 3PFCA 2F48A 3OY7A 1KJQA 5LP6A 3H83A 3BRWA 5C1OA 5CVEA 1XZIA 4RPJA 1J5XA 4CDNA 3CWCA 1TTTA 2P3QA 5ECDA 1RRPA 1UPBA 2D06A 3DEIA 4E1BA 3CPHA 1Z4NA 1BXRA 1M2KA 4AMVA 1O97C 4TSKA 4ASUA 4H4CA 5HZKA 3S8YA 3IHTA 2R3SA 5F7JA 5KVQA 2JKZA 4IZHA 1E2LA 4C3OB 2VJPA 1JFFA 3LC1O 1GUYA 1WSDA 5DTJA 3VU3A 2WJPA 3N3BC 4O4LB 4NCKA 4L78A 1LPNA 2IELA 1DKLA 1Q16A 3AFOA 2JCGA 4TYNA 4ND5A 1JE0A 3AK4A 5CVTA 4XWWA 4N0QA 1PKXA 1EHCA 2BDUA 3FBWA 3E3OA 3RVJA 1U2ZA 1ISIA 3F90A 3HKEA 5LLSA 3NRBA 5CX4A 5M29A 2R8PA 3OQVA 3RKRA 2QSZA 4WUVA 5C5EA 2FEXA 3G13A 1QFSA 5IS2A 3DCJA 3I1FA 3C43A 5LMNB 1D7OA 3SX2A 3PT9A 4X3OA 4G5RA 5AP9A 4PZUA 3I32A 1FP1D 1GQSA 2BI8A 3HPQA 3IDSA 3WAKA 4WCVA 4DJFC 5DBFA 1L5RA 5AI4A 1N2IA 5KINB 1V11A 1TKCA 3W90A 1YVUA 3DC7A 4J6EA 4O4JF 1Y80A 4YP1A 3UK6A 3QU9A 2PSEA 3U4CA 4B3SB 5B12A 4GZLA 2PL1A 3JYOA 3GLGA 4I6GA 2CLCX 4FBGA 2W2XA 4Q1DA 1SQ6A 1X9IA 4QFCA 3PD1A 2A6PA 2OHGA 4U63A 2VDUE 1QQTA 5ALXA 1YFKA 1XL0A 2UUPA 2PZGA 2V8BA 5EJMA 1ZD3A 1E6KA 1JHRA 1P2DA 4FSXA 4I4CA 5A4FS 5KOHB 1A4RA 5CT4A 4MQBA 3R9WA 1TM7E 3PQEA 2ZRAA 4J9UE 1XZ8A 3MMXA 3SXUA 4F96A 4LFAB 2X14A 1QH8B 4L4XA 5K0GA 2RGBA 4U00A 2WV7A 2A35A 3EGCA 1G5TA 1WSWA 2DLNA 5DN6A 1U1IA 2GGSA 4MUKA 3W5HA 3L4EA 3R0QA 3S2GA 2BIFA 4RSGA 4L2IB 4UKDA 3AXTA 4URWR 4D44A 5BV1A 2JK0A 5JXIA 4EH1A 4GKAA 4EJSB 5KTTA 4DKJA 3AHIA 1UH5A 2R7MA 4NU8X 3VC3A 2JI8A 3T1YB 2E37A 3A4MA 3MPOA 4O2AF 5G1PA 3GLKA 3K0FA 4IWXA 2DTDA 3MOGA 5LNK6 2BSAA 5ECWA 4L4ZA 4BNYA 3A2KA 1FUUA 2B7LA 1TQHA 5HKOA 5SICE 1SOMA 4HRVA 4O4IB 5F5XA 3GF4A 4GOLD 3NBKA 5HCNA 1M2GA 3EZ7A 3PFNA 4BE4A 4REMA 2JAHA 3AY7A 4FU0A 3B2EA 4RSMA 4S1TA 4BNTA 3OE4A 4P0TA 4BVBA 1J8VA 3OESA 1TU0A 2V7GA 5HF8A 3HXQA 2GK7A 3G5AA 4NECA 2ORIA 3ZJYA 3U3JA 4CIXA 1NFQA 1AB5A 3ISJA 3UICA 2XE4A 3WB9A 5JWOA 1PJTA 1SVKA 1Z2NX 2BMJA 2BT4A 4C29A 4RTMA 3EVCA 3OOYA 3WYEA 1O87A 1AK1A 1YDMA 4Q37A 5LNK1 4Q15A 3VNRA 1J39A 4HY3A 3EWAA 5HJEA 2J3IA 1G21B 5ENVA 2PJUA 4R1UA 5BW6B 3G0GA 3MJSA 5JCZA 5FLXA 1ID8A 4F8JA 4EKYA 3OLCX 1ECCA 4U39A 2P2CA 4CKXA 2W6PA 3KQUA 3VKHA 1UDRA 3R0JA 4OD0A 5EN4A 1XAIA 5CNMA 4DIFA 2QI9F 1XF1A 3LQYA 4PBRA 4RD1A 2QEQA 4B3CA 5HRUA 5HYVA 4AN0A 1P1FA 3AJ8A 3LWZA 1VIMA 1II8A 5A3VA 5KWVA 1A71A 1Z28A 3FRJA 3WQRA 3VH1A 5DP2A 4E0BA 3IUYA 3K0HA 1AA9A 2X1VA 5G0UA 4AXBA 1E79D 1YRAA 5HJ2A 2QRNA 3WE7A 3WK6A 1J2UA 1EHYA 1NBHA 3TTXA 1LD3A 1H2WA 1MB9A 1PX2A 1LB1B 2BV3A 2H3HA 1DVRA 4TRRA 5B4VA 5JMOA 3Q12A 3GRFA 2BL4A 3AR8A 2HIGA 4GMFA 4KN5A 1MW8X 3QEMB 1PYDA 4OL0A 1MG0A 2VTEA 2ZUCA 3D1VA 3IULA 4EZIA 2OM6A 3ESZA 1HO3A 4CWAA 2RGNA 2JVIA 3S55A 2Q6IA 1X42A 2IHJA 2VAWA 2BTEA 2J32A 3NAZA 3QXHA 1KEWA 2JNWA 1KBOA 1EFPB 4JJ7A 5JC8A 1QG4A 4GKBA 3ZOZA 2QLJA 4LZJA 1OFUX 4JENA 4CYMA 4KGDA 1Q7RA 3MQ4A 3MELA 2WWYA 1F0PA 1QHHA 4ZTBA 3RIGA 4D4GA 3FGNA 4RFVA 4RLSA 1ABEA 1MVOA 4KI0A 5EWJA 3GNSA 5JS8A 3OTIA 4WBNF 5IBCA 1PR2A 2CK3D 1LDNA 4RVSA 4CKBA 2FSUA 2WVGA 4KUHA 4QOJA 3W0LB 4M1YA 4NFSA 4DJTA 5TDHA 1KS9A 2PMEA 2XZLA 3F7OA 1GYQA 3V8RA 5IZ4A 5H3CA 5HIKA 1GL7A 1BHSA 3PGA1 3ZKWA 3QFCA 3UFXA 3VDQA 3DPUA 3E7XA 3K0FB 4GVPA 4JV5B 1W8DA 2NXCA 3VR6A 1TADA 1TUEA 3BWCA 3FLMA 4NX2A 5CJJA 1LI5A 3VZRA 4H2DA 3UK7A 5EP1A 3SLKA 4WLVA 1W4BA 1Q6ZA 3IEVA 2AG0A 2IZ7A 3FOBA 1NIJA 4KYIB 3HCAA 3ID6C 1QS0B 3WL6A 4XSGA 1FNNA 1LH0A 4J0HA 4PZYA 1ZVJA 2FR0A 3FAZA 4K9RA 3WIEA 3ZDEA 2A92A 1RWPA 4EG1A 5IK2D 2XNCA 2CJWA 2ECQA 4PCAA 5A9RA 3DZJA 1JDBC 2GA9A 1XSEA 1JIKA 1RPNA 3CQ9A 1VE5A 1OFVA 5EGNA 1ABBA 4QOHA 1EFVB 1K8RA 4HS4A 1OCEA 1TQ2A 5C80A 5DWDA 1YR7A 1E1CA 5B1IA 5EIBC 2F1JA 2MYTA 4DC9A 1Q84A 2D7DA 1OXVA 2JJ8A 2RHGB 4HF7A 1BS1A 2C5GA 4G0VA 4YJHA 3EMDA 3KBOA 2ZRQA 2PWAA 3TR6A 1G8HA 1DDIA 4B6QA 3LPAA 2DFVA 4YB8A 4X20B 4C4ZA 3SZUA 1OBCA 1FVFA 1D4AA 1YULA 4OLHA 4EO7A 1NW6A 4FEYA 3R5JA 5IUNC 3DO8A 2YN0A 4TS4A 4WWHA 3AT1A 3H4MA 1KTVA 2JFZA 1EK5A 3G89A 5JQWA 4DPKA 3QU2A 2AG6A 4Q03A 3RS2A 3JRNA 1SVNA 2NUBA 5SV2A 3DA8A 1GWNA 1Z3CA 2RGDA 4NNJA 1M66A 1JQJC 2J0UB 3E9YA 3H4IA 4KXLA 4FLEA 3G2PA 1F6BA 3L7MA 4DSZA 1RKUA 1WP4A 2PZJA 1KE1A 4QYMA 1E2HA 4MW7A 3V8PA 2DPMA 1CRLA 4BX8A 4BE7B 3D5EA 5C8VA 2BI7A 2QUJA 4IFIA 2ZM5A 4I8IA 2FWJA 4EAAA 2X7HA 3C8HA 4JLJA 3MYYA 1M2OA 2ZUTA 2RHBA 1WKBA 5C1PA 1XCBA 2JAXA 4JT8A 5BYKA 5IWAB 1KKMA 2XGOA 2I76A 4JD5A 4MS3A 3L1HA 1L4LA 5JNTA 1FP4A 1NXPA 2FR8C 3O3OB 4G5OA 4YLGA 5IC5A 3VGJA 5JS7A 1DG9A 1THTA 2I6FA 1BXZA 3AX6A 3PF9A 4PZAA 1M5TA 3OPMA 3UOGA 5JASA 2HV9A 1YQXA 1A9TA 2VNJA 2QROA 1JV2B 1UFVA 3JQQA 5C37A 4GGMX 3HU1A 3DZKA 5FOVA 2CNOA 3QUBA 3C3DA 5AIBA 2JLZA 1FTSA 5ITSA 3CEPB 3U4QA 2IS1A 1G3MA 1L8OA 2FZ5A 3WRXA 4GL2A 3G7UA 2XUPA 2G9ZA 4PC7A 3M4NA 3I72A 3KVVA 3LF1A 4OQ4A 2QN9A 2WIDA 3TIVA 2HQBA 4CT5A 3QWAA 1E1NA 2Q5FA 3B2QA 4R9NA 4QBFA 5HILA 5AW2A 4A8PA 4ZA2A 1SMKA 3ICCA 1X8KA 3HWWA 2EDAA 1GZ3A 5DRTA 1U0HC 1M6VA 5D7NA 4KWCA 1HNXB 4ZXFA 4TQGA 2J45A 1BQ3A 1HKUA 3LT0A 1S5PA 5LYJA 2C3YA 4RA6B 2G77B 2MDTA 4RJ2A 5EJFA 3OCYA 2WBLC 2AKAB 4HFNA 5ITWA 3EXIA 4PICA 2GZSA 2WHXA 1H9AA 3DVRX 2FAXA 2JLBA 2JFQA 4XIGS 4P4UA 5EFZA 3AP2A 1TE2A 1UT6A 2I91A 3ESXA 1S3FA 3MMSA 2ADOA 4NFYA 5C4MA 3UOAB 3WI7A 1QNFA 3R7WB 4FZ5A 2Z83A 5AJZA 1SUSA 3UF0A 3KSMA 2M2IA 1XTVA 4MI1A 4N7JA 4TLLB 4XD7A 4J7CA 4MS4A 13PKA 4BE9A 1M33A 2B1QA 2FETA 4I46A 1X7ZB 1U28A 1NP7A 3DZBA 3NM4A 2XAUA 3RIYA 3TMAA 3UN1A 3SVZA 2IP4A 3BK7A 4ZCLA 3N2GA 2Q5HA 4ACAA 2WF6A 3S70A 1NJ6A 2BI4A 4ZT6A 2FA9A 5CVUA 1B4DA 3EE6A 3LUAA 5B58C 1KERA 1XVVA 3CONA 1YK0A 3WYCA 4OHRA 3FBTA 3U3OA 1NWHA 4K9DA 4BNLA 5JSQA 4E88A 3W5SA 2XYVA 4GMGA 2YIDA 3NJ4A 2XHEA 1V1RB 3M1YA 4M4SA 4INZA 4YMTA 2HPVA 1YJ5A 2HF7A 3JQAD 3SX4A 1D09A 3TXYA 2QWXA 1A8QA 2WFMA 3M5WA 4JCOA 3HQ4O 4JC8A 1JPNA 1JMKC 1V9LA 2ARKA 5DXFA 5KWEA 3G1TA 3AL0C 1NOJA 5FPYA 5DB4A 3HXMA 2OUIA 1LQUA 2XCIA 1DPGA 2B78A 4S1WA 4Y2UA 2C9MA 2FZLA 4UHJA 3UAYA 2W11A 2C4NA 2YVAA 3ND9A 4TRJA 4Z7NB 3FMVA 2FN9A 1A96A 4XFDA 1IBSA 2GN1A 3FSEA 4GBGA 1E9FA 3B3FA 2NYRA 4F6RA 2CNBA 1WZ2A 4ZVUA 2P6RA 3RAEC 1DQZA 1GG5A 3U7GA 3TLGB 3DJFA 3RHSA 1YAHA 4QM7A 1VPTA 3FCUB 3F1LA 1DB3A 3B9QA 4DM7A 4N9QA 4AM8A 1W8IA 3FYDA 4MR8A 3UV3A 1UKEA 3OU7A 1U7XA 3EIOA 3HRKA 3BPSA 1J07A 1DRVA 3K0CC 4FMCB 1LNZA 1O5OA 2I87A 4M87A 2B3TA 1V41E 2PUJA 4S05A 4OXXA 5K09A 4P58A 1SXJD 1FW6A 1HFEL 2F1HA 3QFTA 3M70A 3PPVA 5ESXA 4Z0TA 4ESHA 2HHJA 2GVNA 3KR0A 2QRZA 2IKQA 3U19A 2C0QA 3OQNA 5FPPA