2CD9A

Sulfolobus solfataricus glucose dehydrogenase 1 - apo form
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
366
structure length
363
Chain Sequence
b'MKAIIVKPPNAGVQVKDVDEKKLDSYGKIKIRTIYNGICGTDREIVNGKLTLSKGKDFLVLGHEAIGVVEESYHGFSQGDLVMPVNRRGCGICRNCLVGRPDFCETGEFGEAGIHKMDGFMREWWYDDPKYLVKIPKSIEDIGILAQPLADIEKSIEEILEVQKRVPVWTCDDGTLNCRKVLVVGTGPIGVLFTLLFRTYGLEVWMANRREPTEVEQTVIEETKTNYYNSSNGYDKLKDSVGKFDVIIDATGADVNILGNVIPLLGRNGVLGLFGFSTSGSVPLDYKTLQEIVHTNKTIIGLVNGQKPHFQQAVVHLASWKTLYPKAAKMLITKTVSINDEKELLKVLREKEHGEIKIRILWE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUCOSE DEHYDROGENASE
publication title The Structural Basis of Substrate Promiscuity in Glucose Dehydrogenase from the Hyperthermophilic Archaeon Sulfolobus Solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Oxidoreductase
total genus 112
structure length 363
sequence length 366
chains with identical sequence B
ec nomenclature ec 1.1.1.120: Galactose 1-dehydrogenase (NADP(+)).
pdb deposition date 2006-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
A PF16912 Glu_dehyd_C Glucose dehydrogenase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2cd9A02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2cd9A01
3E48A 3G3EA 3GDFA 2ZB4A 3KVOA 1EFLA 2IYPA 3TN7A 1GEEA 2PGLA 2PGJA 3MJTA 2Z1MA 3RFVA 3DB2A 3QVOA 3OMLA 4TROA 2I99A 2IRWA 5DULA 5CEFA 3C3XA 2D3TA 5C3MA 1B3BA 1E3LA 4QUKA 1KC3A 4RVSA 4D79A 1R16A 4J4BA 3ONDA 2EV9A 3TJRA 1HDRA 1Y9EA 4JP3A 1AN9A 3KYDA 4D7AA 4XRGA 1K0UA 1JWAB 2CMDA 2WJPA 1CWUA 2HKIA 3P2YA 3QVSA 4RQTA 4Z9FA 1ISJA 3I9NA 2DC1A 4E6PA 4CR6A 1Z7BA 4B4VA 1FF9A 4OM8A 4BNIA 1QYWA 4DIOA 1VL0A 2C59A 2E37A 2B83A 2EKPA 3QVWA 5CPBA 3K2BA 2SCUA 2PTGA 1WDMA 3PHHA 3JQAD 4ALJA 2YHIA 5HRUA 3M2TA 1M76A 3GK3A 4IJKA 1ML3A 3WSVA 3DHEA 1V9LA 4GWKA 1A7KA 5F1PA 5ENDA 1BXZA 3BMCB 4MP6A 3OQ1A 2ZKLA 4N54A 1UDBA 3RVDA 4MJLA 1H5QA 3GLQA 4R1UA 1RWBA 1AHHA 2C2XA 3OJEA 5KNLA 3WX0A 4FBGA 4UEKA 1JAXA 4Y8VA 1C14A 3NV9A 1XLTA 1K2WA 4Q39A 3JTMA 4J2OA 1UZNA 2GN9A 3FRJA 3K2EA 4ZRMA 3AWDA 1KIFA 1WZIA 2I65A 4XIYA 4GSLA 2UAGA 5FI5A 1OC4A 1WAMA 2G76A 1X0VA 3H5NA 1XU9A 1NHWA 4E2WA 1K6JA 4XA8A 2EERA 2PD6A 2X9NA 4TRRA 1ISMA 3FPCA 1I32A 2Q1TA 1U8XX 5I7EA 3GGOA 4IS3A 5TC4A 5IDQA 4UUMA 1Z7EA 1DBVO 3PI7A 3PLRA 4L4RA 4D0SA 2XXJA 2JFFA 5TQVA 1KC1A 1I5RA 4GL4A 4D3FA 3LC7O 2BGLA 1E1MA 3W4JA 3WGGA 1HE3A 1D4FA 1ZFNA 3WTBA 5JCJA 5KJEA 5ICMA 3FD8A 3O8QA 3UCXA 3HB4X 4IUYA 3RUDA 4AJ1A 1LC0A 2HSDA 4NI5A 1ZMTA 4CM9D 4J9UE 2WEKA 3V1YA 1EQUA 5MGBA 1RM4A 5ITVA 2IEBA 3A14A 4RLSA 1PJCA 3OH8A 2X5JO 4RDIA 3WSWA 3UF0A 2F1KA 3UOGA 4CMEA 2HLPA 2I76A 5F3RA 3QVXA 5JO9A 2P4HX 4R69A 4CUJA 1H6DA 2HMTA 1XCBA 2JAHA 3DBLB 1WW8A 2Y67A 4PN3A 1NR7A 4GMFA 1J6UA 4FSHA 1U4SA 1ENZA 1LTHR 3KSZO 1BVRA 2UUPA 2YQ4A 2XXBA 4HXYA 2X5OA 3H9EO 3LC1O 4M89A 2DKNA 4JNKA 4ND3A 2GF2A 1DRWA 3ABIA 1YDEA 4UVHA 1X14A 4YAJA 1DIGA 1FDTA 1NPTO 4E33A 5JAMA 3D4PA 5F21A 4IS2A 2BRUA 1L1FA 2GR9A 3IAHA 3DTYA 3FSRA 1UZMA 3HJAA 2G5CA 4FOOA 5H83A 5B1YA 3EZYA 4WLFA 5A03A 1LU9A 3V2GA 3HDJA 2O4CA 2WMDA 4E0BA 3PHJA 1LA2A 2BD0A 4WLUA 3TFOA 1HLPA 3X2FA 3LF1A 3WDSA 1WWKA 3RASA 4JJGA 2IXAA 1U28A 4BIIA 1C1DB 1ONNA 4UAGA 4BMNA 1E3WA 4Y6RA 5G0SA 3AJRA 4N7RA 3UUWA 3ETGA 1SOVA 5EJ2A 4BO3A 1TLTA 5G0TA 4J1QA 3LYLA 4EJ6A 2TMGA 4XYGA 4CQMA 3ANMA 7MDHA 2OL4A 2VHZA 3VH4A 4UREA 5ILOA 4RV9A 4R9RA 2VYNA 2PZMA 4MOWA 3ZWMA 3DMTC 3QWFA 4IDBA 5EN4A 4E2ZA 1E7YA 5A9SA 1X7DA 1ZCJA 4BO4A 3GZNB 2R00A 4ND2A 1I01A 5FF9A 3U09A 1E1LA 4BKPA 3DBHB 1WZEA 1IPEA 2OZPA 1K5HA 3VPHA 4BS9A 3NYWA 4U5QA 3FF4A 4YJFA 4RVUA 1B2LA 4D43A 1QSGA 5U9CA 3C1OA 4IXWA 2BF7A 2VT3A 2ZK7A 3OICA 3Q6IA 4PLPA 1CERA 1UH5A 1YB5A 2C7GA 5TX7A 1NQ5A 4DVJA 1JVBA 1MC5A 3EYWA 1N1EA 1GYRA 4ALKA 4O0LA 5A1TA 1LSOA 2EG9A 5AVOA 4FGSA 3F1KA 2YZ7A 4OQZA 1HE4A 2XOXA 3DEYX 3UGKA 2ZCUA 1AXEA 1GUZA 4D0RA 2DUUA 1NVMB 2NNLD 3KO8A 1K89A 1X0XA 5CPFA 3G1UA 3HE3A 1NVTA 8ADHA 2I66A 3ADOA 2YFHA 4YAKA 4YB8A 3LDHA 1VRWA 4HFNA 4JGBA 5ICSA 3MWDB 1B26A 3W6ZA 4FPXA 1P3DA 2GLXA 1MGOA 2O23A 3IIEA 3NEPX 4B4OA 2OHXA 4J16A 1P1FA 5K6AC 1N7GA 1GUFA 2BFPA 2Y0DA 4D42A 1KETA 3WIDA 5JDCC 1KVSA 5JC1A 3H4VA 5GZ3A 4KTTE 2VNSA 3CINA 3MTJA 4MVJG 1BDBA 2I67A 1GZ6A 4KTVE 4MIOA 4W99A 1U7HA 3I6IA 3TZKA 4YRBA 2Y66A 3OA0A 3AU9A 3DMYA 2VOEA 4I8XA 1AGNA 2O3QA 3UICA 4B3JA 4CLOA 4BNUA 3H2SA 4CLRA 3HDHA 1EDZA 5TF4A 3E9NA 3IUPA 4FGWA 2D4AA 1UDCA 4HY3A 4DA9A 4J7XA 2PH3A 4FC6A 3A06A 3WGHA 2O3UA 4BNZA 4DLBA 2CZCA 3ON5A 4NFHA 4N5LA 5CG1A 3HADA 4I5EA 1MXFA 2AHRA 3TNLA 4ZU3A 5IZCA 1SBYA 2QX7A 2VUSA 1XU7A 1YOVA 1IUKA 1JN0A 1A27A 1PQPA 1Y5RA 3LZ6A 5I8WA 3GNQA 1BXGB 2HU2A 1BMDA 1GDHA 3MJEA 1BW9A 1E3JA 1EE9A 1S7CA 4PG4A 4PIVA 4ROSA 1SC6A 3O26A 4L76A 2VZ9A 1LLQA 4RVFA 1H6AA 3LSYA 3NT4A 4YRDA 3VDRA 3AUTA 1NASA 4CPDA 1IULA 1QV7A 1NQTA 2NQTA 4XGIA 3E5RA 1K6XA 2OP1A 2X86A 4NBWA 3UH1A 3F46A 2EF1A 3S1LA 2YFQA 2ZCVA 1XQ1A 4H15A 3W4IA 4WEQA 3EMKA 1J4AA 3DDNA 5A05A 1PJQA 1VE9A 1PL6A 3MJCA 3ZV3A 2VTDA 4OSPA 2NVBA 3HN7A 2P91A 2QRLA 1U3UA 5KWEA 2G82A 3E82A 1E6WA 5I9MA 3HQ4O 3MEQA 4B4WA 2AQKA 5CG2A 3KYCA 4E4YA 1U4OA 4R3WA 3QQPA 3QWAA 4OJNA 4YT5A 3IP1A 3QW2A 4U0KA 3PYLA 1NHGA 5I7SA 3ORFA 1R4NB 4CM6A 2BH9A 2CVZA 3GR6A 1HF3A 4W9NC 5BSFA 4BUCA 2H9IA 1CIVA 4KWIA 4PLWA 5TT1A 4DC1A 1MFZA 3O9ZA 4IZHA 4OOFA 2Y0EA 2P5YA 1DO8A 4CODB 3OEWA 3D4NA 4M54A 1ENPA 1HDYA 1ID1A 3IP3A 4RVGA 4F6LA 4MVJM 2PZKA 1LSUA 4MVJI 4CV3A 3LC2O 5HM8A 1GADO 4I5DA 3JQ7A 1UP7A 1M6HA 5EESA 3I83A 3F47A 4TKMA 3ROPA 4TRNA 3W8EA 4DBZA 2NVUB 1JVSA 1NQOA 2YHUA 4EJMA 4F45A 5L95A 1HETA 1NWCA 3BMOB 2RBEA 4BO1A 3BHMA 1EVIA 3ZCXA 4E2XA 1GZ3A 4I5FA 4GI2A 3GEMA 1PJTA 1LNQA 3ZU2A 2BMAA 3DZJA 2OP0A 4BHTA 3NGXA 3EGOA 4YJHA 4GX5A 3S8MA 1RM3A 4BO2A 4Z0TA 4N5NA 4PLHA 4EDFA 1LDMA 2EIHA 2CY0A 5DP1A 2HO5A 4NJMB 4OAQA 3NTOA 4Q3BA 3I9LA 3UCEA 3PJGA 5JCJD 4RF5A 1U3VA 1ZXBA 3L9XA 5KCZA 2TMDA 2C0CA 3FN4A 1U3WA 1ADFA 3X2EA 5JAIA 3WJ7A 4CQLA 2BFMA 3FWZA 3TSCA 2DT5A 2GCGA 5B4TA 2H1SA 1NR1A 1C0KA 3Q0EA 3CE6A 5BR7A 1C0IA 1VI2A 1H9AA 3DZGA 4H7PA 2DFDA 5IDYA 1XR3A 5BSEA 3INTA 2X9GA 3E03A 1F17A 3A4VA 3GUYA 3A1NA 4HX5A 4A5OA 3RIHA 1KEWA 1LC3A 4O63O 2AE2A 3DOCA 4BO0A 3LLVA 1TT7A 3WGIA 3G79A 1E6EA 4Q9NA 3STHA 3OIGA 5FI3A 4BNWA 3GGGA 2FPGA 3PZBA 1L7EA 1EQ2A 4EI2A 3N7UA 4W82A 4I1IA 4ZQFA 4B3IA 5L51A 3I1JA 4FJ2A 4ZVVA 2QRKA 1B8PA 5EINA 1EVYA 4BNFA 2NQ8A 1YO6A 5K1SA 1CQJA 2JD2A 4L8VA 2ZIZA 5FYDA 1QMGA 2D8AA 4RO0A 5BNTA 3OSUA 2HK8A 2OBYA 1LSSA 4KP7A 2AQIA 3VOSA 5A02A 4DPMA 3UKOA 2RCYA 1AXGA 2Q4EA 3JSAA 3I9KA 1PS9A 4D44A 1NNUA 3JCZA 4CM4A 2YDYA 1SNYA 2HK7A 4CQMD 1WPQA 3GMSA 2H5LA 4MVJA 2ZB3A 3BMNB 3TOZA 1TEHA 3LF2A 1DFGA 4XYEA 3WWYA 4ND5A 2VYND 1Y6JA 1R0KA 3QWBA 2NADA 2WM3A 3OQBA 4R16A 5HBRA 3PJDA 4FFRA 5JW6A 2PKQP 1YL5A 3KETA 4IXTA 4LMRA 4G81A 2X6TA 4RZIA 2DVMA 4E21A 3AM3A 2GPTA 2EJWA 4FQ8A 3GN1A 4LCJA 4F6CA 1ULUA 3JYOA 4PFJA 1OFGA 1E7QA 4GX1A 4BNMA 5EQFA 5AXBA 2Z95A 1NYTA 2PLAA 4JBHA 2NVWA 4B3HA 5KVVA 3S2GA 4DPLA 5BT9A 3BMQB 1QLJA 4EJ0A 1IYZA 3MOIA 1A9ZA 4P22A 5C7OO 3ZHZA 4CV1A 1MUUA 1MFPA 1QP8A 3C1TA 5IDWA 2GZ2A 1DAPA 1H9BA 2GN4A 1M2WA 4U6SA 3UCFA 4IDFA 1G0NA 3JQGB 4M86A 1Y8RB 3GNSA 1ZMOA 4GKVA 4LVCA 4IQ8A 4YAIA 2O2SA 3EHEA 2EGGA 3GMDA 2OMEA 2DPGA 3AI1A 4BNKA 1LRLA 4NHEA 5KIAA 2O3RA 3BTUA 2PNFA 3DMTA 1O95A 1P33A 2JD1A 3JD0A 2AQHA 4PG8A 4HFJA 1LRJA 3OECA 4J43A 4OIMA 4QO7A 4HNGA 3DC2A 2HCTA 3ZV4A 1WLYA 3SLGA 3DBRB 2WYUA 3FBTA 5GMOA 1XQ6A 4XX0A 3JD4A 2QYTA 3D5TA 2FSVA 3PHIA 1B7GO 3SC4A 4CLEA 4NG5A 4KZPA 3ZWBA 1YE3A 4IQ0A 4AG3A 4JXKA 1Z74A 3W6UA 2GN8A 5L7WA 5JY1A 1EDOA 2O48X 4IINA 3D7LA 1U2DA 3I9JA 2Q45A 4BNXA 4JK3A 3CH6A 3WGQA 1NPYA 4R1SA 4X54A 1RM5A 1T1SA 5CEJA 1Y1PA 3KOUA 3WICA 1DJNA 1YJ8A 3VKVA 4CMIA 1A71A 3L6EA 4BNVA 1YXMA 2ZJ1A 3QVTA 5KKCA 2PFGA 3ZNQA 3OA2A 3RUFA 3WB9A 3B1FA 2VUUA 3PPIA 3ZWYA 5B12A 4IGFA 2ZTUA 3GGPA 4UEOA 5CDSA 1EBUA 4RF4A 5I7VA 3D4OA 5JMWA 5KJCA 4K6FA 5K6AA 3FWNA 1U5AA 1LLDA 4U8GA 5JDCA 2C20A 3K92A 1IOLA 1GV0A 3RKUA 4XGKA 2AE1A 2JHFA 5JYEA 1RKXA 4XWYA 3T4XA 4A0SA 4AJHA 3CMCO 2GZ3A 4BO9A 1T4DA 4DRYA 2X22A 4Y6PA 4ZA2A 3AUAA 1ISIA 1A4UA 3CKYA 3OF2A 3BAZA 2P9GA 5THKA 2H6EA 2E48A 2DQ4A 3IJRA 1ZO8A 1A4IA 2P68A 2Y1FA 4OKIA 3GQVA 5I8ZA 3RBVA 1EFKA 2O50A 1DC6A 4C7JA 1RYDA 1P1RA 3NAQA 2OUIA 4FB5A 1NM5A 4IDGA 5COBA 3DOOA 1YQGA 4OOEA 4TWRA 1QLHA 2ZATA 1LQUA 4FJ1A 5DCWA 1QYXA 2ZTLA 4OXKA 2IEDA 1Y8QA 1LLCA 1LDNA 1PSDA 2C54A 4MVJP 4AJOA 1HKUA 3BA1A 4CMKA 1B16A 3H7AA 4O5OA 5T5QA 5BNFA 4XR9A 5KJFA 4ITUA 3NUGA 1PJLA 3ZHBA 4E5NA 3AY7A 2Y68A 4PVDA 2VHXA 4ZQBA 1DOHA 4W6ZA 1Q0QA 1N2SA 5TNXA 4JCOA 1NVGA 2DTDA 3RFTA 4E2YA 2NU9A 1Z75A 1ZXLA 2VNAA 3EW7A 1JU9A 4BB6A 5DBGA 1KY4A 2AA3A 2OO5A 3O8QB 3GN2A 5HA5A 1D1SA 4B8ZA 2WD7A 2Z5LA 2FPIA 3JD3A 2JD0A 1F8FA 5T57A 3HFSA 4UULA 4J0FA 3NDJA 1VJ1A 1LDBA 3TL2A 4I08A 2HDHA 4WEOA 3ZU3A 1UXKA 2CUKA 3W4KA 4FFPA 3AK4A 3K96A 4NFSA 3WGYA 1JKFA 3S2FA 2J5KA 3D64A 3NDIA 1A7AA 3QLJA 1MXHA 4NIMA 1FDWA 4ID9A 5TSDA 3HWRA 1PS0A 4NQZA 1MG5A 5JC8A 5A5FA 1AHIA 1QKIA 3R6DA 4NNJA 4AJKA 4BMSA 1OC2A 4EBFA 5BSHA 2CF5A 4FN4A 4QX6A 3HG7A 1IHYA 3PIDA 4J0EA 3VPFA 3ONEA 4CL8A 6LDHA 4YJDA 4YWJA 1DC5A 4EYEA 5THQA 4W9NA 1NXQA 2WDZA 1LRKA 4NH4A 3R1IA 3BTVA 3L4BC 1P1JA 2VWPA 5DDIP 1I3LA 4CM8A 4JQCA 1CJCA 2JFHA 4R41A 1I10A 1UR5A 5JSFA 2V6BA 3QA9A 5KTKA 4DMLA 4IMPA 3MJSA 3IJPA 4DUPA 4ZQHA 2CSUA 4RCVA 1PTJA 4RPHA 3EVTA 4IZIA 3GHYA 3NJ8A 3IDSA 1VL8A 4XJTA 4ZQGA 3TQHA 3R3JA 5KKAA 5TT0A 1QV6A 3R0IA 4LSWA 3RJ9A 1C1XB 2IYOA 2JHGA 1EVZA 3F4BA 2A35A 4L0QA 2VWQA 4L4XA 3KTDA 2D5AA 2WYVA 5JDIC 5KVQA 3ANLA 3G17A 1WNTA 3OEYA 4J90A 1PL7A 1NAHA 2G0TA 1OI7A 1Q7GA 2QZ9A 3QRWA 4UVGA 3ZWCA 4WLVA 1D3AA 3UW3A 2DBVO 1XKQA 1HDCA 1ZEJA 2ZJ0A 1EVJA 5DZSA 4FFOA 4MIEA 2UYYA 3OJFA 5U4QA 1XG5A 3VH3A 4ZGWA 1I30A 3RBZA 2VOJA 3JD2A 1OBFO 1BTOA 3AY3A 4HUJA 4J7CA 4FR5A 3QSGA 4W4TA 4YDRA 1HE5A 4RF2A 5TIIA 1UXIA 1YL7A 3BMCA 3C7AA 3C7CB 1YB4A 3GRKA 3D3EA 1PL8A 5JXWA 5EERA 2AQ8A 2WWRA 3AFNA 3KB6A 3PWKA 1ZNQO 2G1UA 2O4UX 4MVJD 5DBFA 1UUFA 1I2BA 4QQRA 3RQSA 1ISHA 4AJ4A 2GUGA 2VQ3A 3GPDG 5FWNA 2J3KA 3I5MA 2QW8A 4WUVA 1QR6A 3GNTA 4DQXA 3FTNA 4JIGA 1VJTA 4CM7A 5L40A 2CDBA 3I52A 2Q49A 1V3UA 2C29D 4HFMA 2EKQA 1E3SA 3JQEA 3LT0A 4Q3CA 1N9GB 5COAA 1VKOA 2HQ1A 2W98A 1QYVA 2GYYA 3RJ5A 3CUKA 2NTNA 4XCVA 1U3TA 1NX6A 3OJLA 1AUPA 1DLIA 4CLOB 1R4MB 4HWKA 1XA0A 3H5RA 4PLTA 1PS8A 2V7PA 4BNTA 1PGQA 2FP4A 4FIZA 5F1KA 5G4LA 2J3HA 1XHLA 1MA0A 3PHLA 1Y81A 3WFJA 1XIVA 1DHTA 4CMHA 1NPDA 2CDAA 1DHRA 2ET6A 4PZEA 3NX4A 1TXGA 4KUGA 1E92A 3NTQA 1MP0A 3EC7A 1I0ZA 3B70A 3GVIA 2V65A 4D3SA 4II2A 3DBLA 3FNGA 1TT5A 3SLKA 1YS4A 1TVEA 2A92A 2X1HA 1E5LA 1BDMA 4FC7A 4RDHA 4BGIA 3CIFA 2Q2QA 3UAGA 4FD3A 2EW8A 1D8AA 1UP6A 1UP4A 3P7MA 1KBZA 3A28A 2PD3A 3QY9A 4Z9YA 5A9RA 1JW9B 1HDXA 3AI3A 4RL6A 1V6AA 2HK9A 5A3JA 5G4KB 5IFLA 1UAGA 1LUAA 3GHHA 3ZDFA 2IDZA 2VT2A 4WK6A 1LDGA 1XDWA 3ZZNA 1EBFA 4MPDA 3KXDA 1RYEA 4WLOA 3T4EA 1U1IA 2ZB8A 4BB5A 2AXQA 3WYBA 5HS6A 2PKRA 4N18A 3DONA 1C1DA 3T7EA 4C4OA 4HP8A 3SEFA 4RPKA 5CDUA 1YJQA 1I24A 4IM7A 4CUKA 4F3YA 3PRJA 2E82A 1YBAA 2P4QA 4GGPA 4EW6A 3TPCA 4C7KA 5B4UA 3GY0A 4BGEA 3B1JA 6ADHA 2FN7A 3TZHA 2JCXA 2B5WA 2C2YA 4O59O 1ZZEA 4PG6A 3E9QA 2EEZA 3U4CA 3H8VA 4JN6B 4BOYA 3RBXA 4EITA 2DAPA 2NSDA 2PA3A 2QZZA 3HUDA 1YH3A 3N74A 3DBHA 1JDJA 1KEPA 1ZK2A 1EEHA 5ENVA 3RAJA 2WD8A 3PFFA 3PQEA 4WCFB 1LLUA 1EK5A 4IQGA 3ZW9A 3VH2A 5FFFA 4FCCA 3H9QA 1HYGA 1PZGA 1WXDA 4R54A 4WJZA 3JQAB 1W8DA 4AJLA 3WWZA 4LSMA 1ADCA 1U8FO 3BXXA 3PP8A 1HL3A 5F5NA 3IOYA 1P31A 3RC2A 4CLXA 5C7LO 1FXSA 4MP8A 4U0JA 4YEDA 3ETDA 3BYZA 3ZWPA 2NWQA 2VHYA 4EEZA 5HWSA 2WE8A 4BO5A 5MDHA 3JYPA 3UHAA 1GYPA 5EIOA 1ISGA 3QIVA 4DLAA 4PLZA 1YONA 3MZ0A 3WGTA 2PWZA 1KY5A 1DC4A 2UDPA 3EUWA 4AJEA 3OJOA 2UUOA 4G2NA 3Q9NA 3BTSA 3H9JA 1IZ0A 4J7UA 1MX3A 2RH8A 2GN6A 3IQDB 4CMAA 2J6IA 4Z0PA 1E1KA 5AXCA 3OJ0A 2CDCA 1T2AA 2QYSA 4TVOA 1G1AA 3AOEC 4RGBA 1YB1A 4B7XA 1KVQA 3RFXA 4LRTB 4WLEA 3RWBA 2EP7A 4XB2A 1FDSA 3JD1A 1ZSVA 1ZK4A 5JE8A 3SVTA 2VWGA 2Y1CA 1M67A 2Y1EA 3ONFA 4RZHA 2B69A 2DBRA 3AW9A 3PQFA 4HKTA 1VKNA 4DPKA 5C7IO 2C7VA 3EDMA 1H93A 3DOJA 2NU8A 1PGNA 1X15A 5L7YA 4GH5A 1Q7CA 4CL3A 2EP5A 2HRZA 1GU7A 4RPJA 2I5PO 4NPCA 1GCOA 1H6BA 4XQEA 4GBJA 4I9HA 2CFCA 3U62A 1I3MA 4BNLA 1H6CA 3RUEA 1ZEMA 1T24A 1PX0A 3KYBA 4MO2A 4J49A 4YACA 4KOAA 1ORRA 5GZ6A 4P38A 4PG7A 2O7QA 5EQDA 1Q0HA 3QWHA 4GQAA 5JS6A 1KEVA 3HNPA 1C0LA 1VSVA 1U2GA 4R5MA 2PK3A 3LVFO 4YJGB 3JQCA 3JYNA 4Z3DA 1VSUA 2W8ZA 4K1LA 4WNCA 4E3ZA 4RORA 4EGFA 3EAGA 3ADPA 4FDAA 3RU9A 3ZGYA 1NAIA 2YDXA 2W90A 1X1EA 3ROMA 4BNJA 2I3AA 1OZAA 3Q3CA 2Y1OA 1BXGA 9LDTA 1P9LA 1FDVA 1T2EA 2JAPA 4L9RA 5G2OA 1LJ8A 3MTGA 4BNYA 1H2HA 4GAEA 1EE2A 5G0WA 1E5QA 1R6DA 2O3JA 3BZUA 3DZBA 3F5SA 3RUIA 4CM4B 1BVUA 1N92A 1XELA 3ITKA 3WYCA 4Y6SA 3JQ9C 4OYRA 3H9GA 4BKRA 2HMUA 5L4LA 1ZH8A 1KS9A 4DBVO 5LC1A 1SMKA 1VC2A 3GC6A 4AJPA 3TZQA 3GG2A 5JAZA 3LQFA 1NQAO 5EL0A 3VTFA 3FR8A 5COQA 3KV3O 1SB8A 4A03A 4AVYA 5LCXA 5IF3A 4DLLA 4YTEA 4XYBA 3JQBC 1K3TA 3D5QA 5CFZA 1PR3A 5TJHA 3OETA 3KBOA 1GZ4A 4IDCA 3WYEA 4BO8A 3TZCA 3L4BA 4A7PA 1PU2A 3GDOA 4BMVA 3CZRA 2B37A 3Q2KA 2J8ZA 4BNGA 4IIVA 3DAGA 1ZW1A 4ZHSA 5CDGA 3EK2A 4YQYA 2NU7A 1CETA 1VPDA 3DBVO 4BGUA 3SJ7A 1NFFA 3KLMX 4Z6KA 3VVBA 3V2HA 1I36A 2DLDA 4J1NA 5AXDA 5IAAA 3RD5A 4CUZA 2DPHA 1M66A 3I3OA 3KLPX 1EK6A 4Q3EA 5A04A 1P77A 5A06A 3PYMA 2I3GA 3GAFA 1N7HA 4HBGA 1WP4A 3FBGA 4GSKA 1NP3A 2HJRA 4E5YA 5K9ZA 1J5PA 1U9JA 4P4NA 4J6FA 3OIDA 3VPXA 1DFHA 1W0CA 5JDIA 5EMHA 4PVCA 5TS3A 3Q11A 5DCUA 2PH5A 2W2KA 5L53A 1DIAA 2NVUA 3K8ZA 1F06A 4E32A 3D3WB 2B4RO 1B3RA 1H2BA 1KVRA 4RVDA 4MVJH 3BMOA 4MVJF 4ONEA 1O89A 2X9VA 4RVHA 1HLDA 3PIIA 4D45A 2J5RA 4TMFA 2P2SA 5C37A 4NFYA 3GRPA 2GSDA 5IN5A 3ANNA 3B20A 1T26A 1A5ZA 3QP9A 4XQ9A 2EXXA 4NU5A 1VLLA 1PQUA 1FMCA 1SO8A 4OL9A 2HAEA 1BGVA 3WQSB 3GAZA 1TB4A 3TL3A 2JCYA 4GLLA 4NJMA 4XRRA 2BHLA 4TKLA 5ILGA 3T7CA 4Z0HO 4OKNA 3JYQA 3P2OA 5KJ6A 4CMGA 1S6YA 1UXGA 4KUEA 1KEUA 1CRWG 4R9SA 4K6CA 3PK0A 4RLHA 1UXJA 4R5HA 5T67A 4CMIB 4ZN6A 3AM5A 1N8KA 3JV7A 4H16A 1MG0A 3GPIA 2HMSA 2Y1DA 2JJYA 2NUAA 3I9MA 2PKQO 3U0BA 1YWGO 1ZVMA 3GZ4A 4KQWA 4OH1A 3G1TA 3K31A 2BI8A 4A27A 2E49A 3GVCA 1JTVA 2BGKA 4A2CA 2FPPA 2YQ5A 3DR3A 3GA0A 4JX8A 4E5MA 1VJ0A 1YQDA 1GPJA 3M2PA 1B15A 3B6ZA 4DREA 4E31A 3SX2A 2HUNA 3RUCA 2C5AA 4YBZA 4ZD6A 2D1YA 3WLFA 4BKUA 4PRLA 5C5IA 3K73O 4WNIA 2F00A 1K6IA 4LVUA 4JLWA 2DBQA 4FJ0A 4J91A 2CVOA 1W73A 3DHNA 1SCUA 4NMHA 5IZ4A 4YAEA 1PR9A 4CR8A 3PFWO 2Y1GA 3WQRA 1RJWA 1HDZA 4MKXA 4L75A 5K0ZA 4WKGA 1DRVA 2ZQYA 1JKIA 2HJSA 4RPGA 1KYQA 3WJAA 4BV9A 3RC1A 5G0VA 4EUEA 3QWIA 4XJSA 4ALLA 4BO7A 1BWSA 3Q1LA 2C5EA 3EY4A 1HSOA 1EUCA 3BMNA 1DJQA 4ND4A 2P9EA 3DFUA 2H63A 3DHYA 3VZRA 1I8TA 1NWHA 1HSZA 1DIRA 1P44A 3KYDB 4LW8A 4QECA 5DP2A 3C1AA 4BKQA 5LDHA 4OO3A 5TLSA 3RUAA 1O9BA 1GUYA 4IMRA 4XGNA 5T64A 4ALNA 4J2HA 3ZNOA 1OAAA 3RC7A 1PEDA 2LDXA 2YV2A 1A9YA 3UN1A 1E7WA 1WMBA 1N5DA 3FNEA 4J4HA 2YHIB 2PD4A 3HFGA 3NT5A 2FZWA 1IE3A 3RI3A 4U6QA 2J3JA 3ZWAA 4DL9A 4INAA 4BL5A 1EUZA 1PIWA 2O7SA 4YR9A 5IJZA 4AJJA 1TI7A 4NJOA 3MOGA 1A72A 2C07A 3BMQA 5ES3A 3WTCA 5L4SA 1GL3A 2OGUA 5KJ1A 4DIFA 4I9UA 1JWBB 3WBFA 3PTZA 2FOIA 3FTPA 5H82A 1YRLA 2E4AA 4DXHA 9LDBA 2NV6A 4NBTA 3H65A 5AYVA 3JQGA 4KMSA 1Y8RA 1DRUA 1QG6A 3DZHA 3L0DA 3S2IA 2BI7A 1QYCA 4UVDA 1EZ4A 1QYDA 3GDGA 1T25A 2UVDA 1ULSA 4E12A 1ZK0A 3SBOA 4ZICA 1KVUA 1ARZA 3INRA 4GLOA 2EW2A 3GFGA 4K26A 4B79A 3VVCA 2Q99A 3I6QA 4IJWA 4JJIA 1FK8A 1EUDA 2YUTA 3AI2A 3VKUA 5B4VA 4J9VA 3L9WA 1LX6A 3JQFC 2X23A 3DBRA 4P4LA 2BGMA 4GGOA 2J5QA 4GWGA 4UVEA 5ITWA 2VRCA 3H3FA 4YT2A 5BNIA 4LCEA 4WECA 3WG9A 3ICPA 4WCFC 3R3SA 3N58A 1OOEA 2VCYA 3JQ8A 1PZHA 3CXRA 5CAEA 2Y99A 3F9IA 1LEHA 3UVEA 3PQDA 5DBIA 3WBBA 4FFNA 1R0LA 5L3ZA 2XAAA 2EHDA 4II3A 1F12A 3O4RA 2I6TA 2AEMA 4TZTA 3TF5A 3LU1A 1DDOA 1YVEI 4YXFA 3SXPA 3ENKA 1VM6A 4Y67A 4FFLA 1HZJA 3HB5X 1T4BA 4NBVA 4E5KA 1BHSA 4XEHA 4AICA 3AOEA 3V8BA 2YJZA 1DFIA 2X0JA 1E3EA 1ENOA 3PXXA 3RROA 4ALMA 5B37A 5IN4A 4JP2A 1I33A 2E6UX 2GRAA 4MINA 3VC7A 4CV2A 2Q46A 1V3VA 3O38A 2IE0A 3IL2A 1JA9A 1CQIA 5IG2A 1XWFA 5JCXA 4MDHA 1T2DA 2HRBA 3TZ6A 1R0SA 1ENYA 2Q3EA 4CMBA 3F4LA 2JL1A 4AJIA 4PLGA 1GR0A 1ZK1A 2GZ1A 2W2LA 3NRCA 4IBOA 3S55A 1J49A 3PYXA 1E3WB 3E5MA 4D46A 3FR7A 2PV7A 3HSKA 5A5EA 4B4UA 4FOSA 2CVQA 3HZZA 1DPGA 4WPGA 5T8KA 4CQMB 1HZZA 4LISA 1UJMA 2G17A 1KERA 2X5KO 3VZSA 4NK5A 4XKJA 4BVAA 3LK7A 5A9SB 4LGVA 5DOVA 1RM0A 4BKOA 2OORA 3PGXA 1O6ZA 2IODA 3HN2A 4ILKA 1YQXA 3VPGA 5GZ1A 1SEPA 5DT9A 3KZVA 4H3VA 4YJFB 3U4HA 4ALIA 3OIFA 1HWYA 4IY1A 1P74A 1V0JA 1BRMA 5DOZA 4MIYA 4R4JA 1DEHA 3JQ9A 1G0OA 4WOKA 2A94A 3PHGA 3Q9UA 2D5CA 2DU8A 3IKVA 2FY8A 1X13A 2A4KA 3IC5A 4Z3KA 1D1TA 4TZKA 3QJ5A 1R37A 4PZCA 2FZEA 4XZ3A 3INGA 1UDAA 1TT5B 1E77A 1PJBA 3ZWVA 1T2FA 4QFCA 4QEDA 2RIRA 3LLSA 3GVPA 4E30A 4R3NA 5AQ1A 3JQBA 4UVIA 4P8RA 1E6UA 1SB9A 4HFRA 4RQUA 2ZB7A 1PGPA 3ZW8A 4RPLA 2UV8A 1H0KA 4D3DA 3VTZA 4EUFA 4B7UA 2C82A 4G5HA 5IXYA 2J3IA 5FEUA 1GV1A 4UEJA 4IJVA 1QXSA 4UUNA 4OSOA 4FS3A 3CSDA 3U49A 4AJNA 4MP3A 1LBEA 4FFMA 3ZWWA 3DO5A 2AW5A 2FHSA 4EEXA 2Y93A 1KOLA 5A9TA 4DIBA 1SZJG 2FRDA 4CLRB 1CEQA 3RC9A 4R1NA 4YT8A 1J0XO 5DNAA 1PJ4A 3IS3A 3OM9A 2B0JA 3BIOA 4LK3A 3DFZA 4PCVA 5EPOA 3ZH2A 1GPDG 3ICCA 1C1XA 3VDQA 4NR0A 4PLCA 5G0UA 2RAFA 2NACA 2WE7A 3W8DA 4E5PA 3NDRA 4TVBA 1ZBQA 3ZNPA 1Z6ZA 1YGYA 1ZJZA 2GERA 4I9NA 4IGEA 5IDXA 1R66A 1NFQA 1O5IA 3JQ6A 3GEGA 1MLDA 1I3NA 4IPTA 4J4TA 1YOVB 2ZTMA 3DZIA 2IZZA 3C8MA 1HYHA 1FJHA 1CDOA 4GPD1 1WVGA 5JLAA 5JO0A 2JCVA 4BNNA 1BW9B 5JFOA 3W1VA 4NBUA 1CF2O 2YV1A 1HDGO 4JBGA 3KSUA 2Q2WA 3DWFA 4QFDA 1IB6A 5TGDA 2LDBA 4W7HA 1E7MA 3H3JA 1I2ZA 3F3SA 3E1KA 4M1QA 2GO1A 4O6VA 4XD2A 1H94A 3WQQA 4PZDA 5GY7A 3L07A 3G49A 5JBIA 5KVCA 3ROQA 3ENNA 1AE1A 1BXKA 1GAEO 1LDEA 1CYDA 4IDEA 2D2IA 3WMWA 4J1TA 4GMGA 4NDNE 4M8SA 2BELA 4XYLA 2AG8A 3ZHXA 2WYWA 2NM0A 1F14A 2QIOA 3DL2A 1C0PA 3M6IA 3A9WA 1YBMA 3WIEA 2RHRA 1BSVA 2VYVA 3KYCB 4O1MA 2Q1SA 5DF1A 3GUCA 5CHEA 4XR4A 3F1LA 4WOJA 1N9GA 4M87A 2QHXA 4ZQEA 2YYYA 2XPCA 3OHSX 3DAPA 3NTRA 4M55A 3ZWNA 5DCYA 1ADGA 4PRKA 1DIBA 1IHXA 3DZKA 4HV4A 2JKVA 1Y9AA 3GZNA 3F6YA 1UXHA 2PY6A 4Y9DA 1R4MA 2YV3A 5T6BA 3GVHA 2AMFA 2ZYDA 3S2EA 4DWVA 3MJVA 1Q1NA 3VAZA 3WNQA 4GVXA 4KDFA 4W7IA 1OMOA 4R68A 3JQ7B 5IXSA 4JROA 1V3TA 4TQGA 3RUHA 2NU6A 1RPNA 2X58A 3I23A 2EWMA 4XIJA 2B5VA 2RH4A 2FSSA 4EZBA 1N1GA 4A73A 3RCBA 4NZ9A 3ZI0A 1NBOA 4CM5A 1E0DA 3B1KA 3ASUA 1DXYA 2A9FA 4PLYA 3GF4A 3QHAA 3TOXA 3OBBA 3PGJA 4KWHA 3ROKA 1U5CA 4A10A 5AXAA 1B0AA 4YJHB 1E3IA 4GX2A 5JMPA 1UAYA 1Q0LA 2VRCD 2B4QA 2Y0CA 3PEFA 4I5GA 4PG5A 3JQDA 1ADBA 2DTXA 5G4KA 1SAYA 4B7CA 1B14A 3ZV5A 3KHUA 4XDYA 1ZSYA 2B35A 1Q2XA 2Q1UA 1JAYA 3E9MA 3D1LA 1YBVA 1ZKMA 3GVXA 3LT1A 3U4IA 4CM3A 3CPSA 4CQLB 1GY8A 1ZIDA 4YQZA 3C24A 1JKJA 3VZQA 3L6OO 2X0NA 2Q50A 3VH1A 5I9LA 1DLJA 1W6UA 2OOSA 3H9UA 4Q3DA 4YT4A 5KOIA 1NTOA 2BFAA 2BLLA 3KM0A 1YDWA 4QXMA 3HDYA 4KUHA 3CMMA 3ZU5A 4E13A 3I9OA 1B8UA 3E8XA 2VRBA 5HS4A 3MWEB 1DC3A 2EKLA 5CDTA 3FCOA 4QSMA 3K5PA 2FWMX 2WTBA 3JQFA 1Z73A 2NLOA 5ADHA 5T8KC 5CEEA 3PZRA 3AY6A 4ZRNA 3GEDA 4YVFA 1GD1O 4R1TA 4JJFA 5TJ9A 1EMDA 2JFGA 1HYEA 3EVNA 4WE3A 1LSJA 2GDZA 1XYGA 1I2CA 4WCFA 3WFIA 1XSEA 3BHIA 1P0CA 4HNHA 3WOHA 3MCVA 3DQPA 2I9PA 5F5LA 1C3VA 3JQAA 2VN8A 2B36A 3ASVA 1ISFA 3DTTA 2W2LD 2RHCA 4BGVA 2PR2A 3LT2A 1MC4A 5F1OA 1HTBA 3PWZA 3U5TA 3CTMA 2NTJA 3ZWXA 3FPLA 1DAOA 2W2KB 1ONPA 1GFSA 5ER9A 4JBIA 3COSA 1XEAA 2FR0A 4RJTA 4NU6A 3C7DB 4B8WA 1XGKA 3OFSA 4IJUA 3WGZA 3UXYA 1SEVA 4NK4A 4Y98A 2DFVA 1T2CA 1P0FA 3PLNA 4CMEC 4G65A 4CM1A 1ZK3A 1R12A 1E1NA 4HADA 2R2GA 4K9DA 4R51A 3ITDA 1F8GA 4QTZA 4ND1A 3VZPA 1LI4A 4CJXA 2AG5A 4LMPA 1GCUA 2AEJA 1HT0A 4AJ2A 1B8VA 1MV8A 4BQPA 1PGJA 4YAGA 4CLDA 8LDHA 4GVLA 4IDAA 3VPSA 4NBRA 4OQYA 4WCDA 1Y7TA 1IY8A 3IKTA 2Q4BA 5A4DA 2DTEA 2HMWA 2ZYGA 3DAFA 4IDDA 1R4NA 1YL6A 1Q7BA 2GGSA 1PJ3A 1P1HA 1W4ZA 2W4QA 2X8LA 3GT0A 1KVTA 4GX0A 3RU7A 3W8FA 4DYVA 2HMVA 3BTOA 1GYQA 2Z1NA 4OXNA 1F0YA 1PWXA 1LQTA 4OGWA 4XB1A 4CM9A 5JYDA 3P5SA 1G6KA 4YRAA 1T1RA 2V6GA 3UFXA 4DC0A 1DSSG 4YA6A 1X1TA 2DM6A 3PDJA 4D41A 3OQ6A 3ZHYA 4ZJUA 2AEFA 3KUXA 3FNFA 3HHPA 3MJ4A 3OP4A 3KSDO 1U7TA 4AL4A 3AFMA 3AM4A 3V5NA 3V2UA 3I4FA 4TSKA 1WDLA 2EJVA 3NKLA 1ZUD1 3WLEA 2IZ0A 2NTVA 2VZ0A 4DQVA 4YJGA 3CEAA 3KRTA 4DMMA 3M1AA 4ESOA 4DQUA 3E18A 2VHVA 3ZWOA 5L45A 1ZJYA 1M75A 3GG9A 2R00C 4CV0A 3ZU4A 2FR8A 2V6MA 1L7DA 2B4TO 5I9NA 3V1TC 3AUUA 3NGLA 1WDKA 4IIUA 1M6WA 4RF3A 2PGDA 1PJSA 3TRIA 3U3XA 3WS7A 3L77A 4TRMA 5AOVA 3F5QA 3HDQA 2BKAA 3NT2A 5ER6A 3TFQA 2GD1O 2CF6A 5JPIA 2Q1WA 5H81A 3NJ4A 3AU8A 2ILTA 5BQFA 3ST7A 3PVZA 3K9QO 4QO8A 3GOHA 4FW8A 1O94A 1UZLA 1NFRA 2YW9A 3E6AA 1O8CA 1LXCA 3GH3A 3KEQA 1MB4A 1R15A 4QT0A 1GQQA 5TRTA 1X7HA 4L74A 1WMAA 4S3MA 4DYDA 1HEUA 1PQWA 1E7RA 1P1IA 4OHUA 3P19A 5CDYA 4OXYA 2Y05A 1V35A 4PGFA 2O2YA 4BO6A 4XQCA 1GTMA 3M1LA 3WR5A 3H6KA 3IUSA 2V6FA 1E7SA 3ULKA 1P1KA 3PDUA 4YYZA 3SC6A 3K6JA 1GQYA 4KQXA 4TRJA 3U4DA 3CZMA 4A26A 2OFPA 4OMUA 4DTIA 1PJ2A 2P5UA 4M49A 3VHRA 1YKFA 4YPOA 2OBNA 1JQBA 1I3KA 1JLLA 3H5AA 3O03A 5JY6A 2ZQZA 5L4NA 2YY7A 4J3FA 3FI9A 3D0OA 2GNAA 3WXBA 3EZLA 3ZN2A 4CMJA 1Y5MA 1QRRA 1IL0A 1BG6A 1Y8QB 2X7HA 2O3SA 4Q3AA 1HE2A 4MVJE 3FNHA 2D59A 5JAQA 4KDEA 5L7TA 3D3WA 2VYVD 4MKZA 3AUSA 3H2ZA 2VZ8A 3L4SO 3GFBA 2PZLA 4WGGA 1IZ9A 2VUTA 1VL6A 2ZTVA 4J1SA 4K28A 5BSGA 4BV8A 3SJUA 2GASA 2QG4A 3LT4A 4N5MA 4S1VA 3ETEA 4DGSA 2FR1A 3DZFA 4URFA 4LN1A 5IZCC 3IMFA 3JYLA 5CP8A 3C85A 2P9CA 3JQ8B 1ONOA 2WD7B 3G0OA 3WNVA 4BQRA 2R6JA 1HXHA 2X0RA 4CLHA 2D0IA 2VHWA 5LDGA 4Q3NA 1PZEA 2PZJA 2X0IA 3QE3A 3Q2IA 4CR7A 1FDUA 1X7GA 1DB3A 4GKBA 5L9AA 1LDYA 4U7WA 3RSHA 4MKRA 5HTOA 1D7OA 2QQ5A 4P4GA 3WMXA 1TA4A 1IPFA 2Q2VA 3QV1A 5JNLA 4WLNA 5KVSA 2DUWA 1SOWA 2FMUA 4UUPA 2BFOA 3DXFA 3TWOA 4L73A 4XDZA 3PJEA 2VTEA 5I7FA 1PZFA 1PGOA 1Z45A 4CMCA 3ZNNA 4LRSB 1SPXA 3U9LA 1PWZA 7ADHA 4XYMA 2POQX 1GEGA 4BNHA 3RKRA 3AOGA 1ZSNA 3BHJA 1O0SA 1P45A 5U1PA 3L6DA 3PWSA 2XF8A 3ZV6A 3PJFA 4PLFA 1HRDA 1HDOA 2EGHA 1DIHA 2QRJA 3FHLA 1GQ2A 5DN9A 5A3VA 3V1UA 2CNBA 2VWHA 4WASA 2X4GA 4AFNA 2O3TA 4CM8B 4YCAA 2WSBA 2IXBA 4R01A 3WGOA 4UUOA 5J23A 3TDKA 1Z82A 4PLVA 3I4CA 2CD9A 4F46A 3K30A 2DBZA 1QORA 2ZYAA 4XQGA 4EUHA 1V8BA 4L4SA 4Z9XA 2OXIA 2IZ1A 3KEOA
chains in the Genus database with same CATH superfamily
3E48A 4ZPJA 4DMFA 3CEPB 1SUBA 1GAJA 3QEAZ 3SQWA 4MR9A 2QVZX 1GG9A 4XM0A 3CRVA 3O0TA 3DB2A 3RFVA 3OMLA 4TX1A 2HPHA 4JKYA 2O7VA 5CEFA 1ZH4A 4HWSA 3KBBA 4HO1X 2CLMB 2O8FB 3CQ9A 1B3BA 1E3LA 4QUKA 4ZXFA 3VUEA 4ZFNA 2NW6A 2NMVA 4J4BA 3EBPA 1E2IA 2JVIA 3TJRA 1FX0A 1Y9EA 1IQUA 1J00A 1S2DA 2QVCA 1IONA 1KMMA 2MU1A 1JHVA 4L95C 5H59A 3KYDA 5EJ7A 5KEIA 1PN3A 2WJPA 1TK9A 5FRDA 4D9HA 3I9NA 2AOXA 2FI1A 3IUYA 3UBTA 4UMVA 4MUKA 3NBYC 1FF9A 2R85A 1ICEA 1T1GA 1KDPA 4MI9A 1VL0A 3ZDQA 2C59A 5JD6A 2B83A 3C6QA 3QVWA 3OCVA 4M1EA 1JDZA 4YCBA 4AURA 4B3GA 4URHA 1WDMA 2I3DA 2BFFA 2YHIA 1KFCB 5HRUA 3B3FA 3M2TA 1FU7A 1XRNA 4YP6A 5FPYA 3GK3A 3RBAA 3RYIA 5I5GA 5F1PA 1V9LA 4MA5A 1A7KA 4GM0A 4FW9A 3M6AA 5EGNA 1ZWLA 2VYQA 1WZUA 3WISA 3OQ1A 5C8YF 7REQA 2O8NA 2H8GA 2AZMA 2QXYA 3IT3A 4MJLA 4EHBA 2OLEA 4Q15A 2C4NA 4XTRA 4YP0A 2FPUA 3M9XA 3LY5A 3FDZB 2DGDA 4HQOA 3UXHA 4HGZA 3C3PA 4TKUB 3WX0A 2A6PA 4Y8VA 1UMKA 1P0MA 1X7WA 3L7KA 4RTMA 1Q92A 1Z0KA 1L4FA 3NV9A 5EYPA 3TPZA 4Q39A 4BYMA 1Q7RA 3JTMA 4DWJA 2HQSA 3K2EA 3AWDA 3I64A 1WZIA 2I65A 2IY9A 1W1IA 4MO9A 4TLCA 4AG6A 1RLOA 1WB9A 1AK2A 5LVAA 3ZGOA 3L6RA 1N5IA 4QPCA 4UTRA 4LWPA 3B6MA 3H5NA 4LY0A 3IEMA 2V0CA 3A6JA 4FHZA 4G5OA 2X9NA 3RK0A 4BATA 2C3OA 4HGPA 1T9GS 1FSZA 1VYHA 2DULA 1L5HB 2I22A 2Q1TA 3IA2A 1YA6A 4ZZIA 1HE8B 5I7EA 3N75A 4FEYA 4DRXB 2KBFA 2BV3A 2C31A 2FJ0A 4L02A 4FZ3A 2PXAA 3PPYA 5TQVA 1DE0A 2JFFA 2REOA 1KC1A 2CMFA 3ZX4A 3GBSA 1I5RA 4DUGD 2QSJA 3LE8A 3K9CA 1G63A 1E1MA 5EE5B 3OD1A 3P8ZA 4ZKDA 4R8LA 1NJ2A 4HQ6A 2NGRA 1XZIA 3FNQA 4F9TA 1HE3A 1KI1A 3WTBA 4HWGA 5ICMA 4PYRA 4Z4FA 1OI3A 3B7WA 2VNKA 2AOVA 2V3VA 1QVVA 1N6NA 3OQPA 4IUYA 4TL6A 4XFDA 4JASB 1CJTC 4H60A 4IDOA 3B9BA 3AEKB 1V5EA 2E0IA 3TEJA 5BV0A 5MGBA 4M83A 2P1DA 4JOCA 2P62A 4P58A 4X97A 1IK6A 2JRLA 3OH8A 1QYIA 1W5AA 2X5JO 3GJ4A 1Y4SA 2X7XA 5SICE 2OQRA 5IHPA 4WA7A 2F1KA 4BFSA 2HLPA 2I76A 3RNOA 3W79A 3RRMA 4CMEA 1FSPA 5ICEA 4CUJA 3MGCA 5I7WA 2WP8J 1YZLA 2O6LA 2P79A 3L8EA 3TYXA 1WW8A 3UJPA 1NR7A 2OQVA 1U6KA 3WLPA 4WJLA 1TRHA 2GWHA 1J2TA 2Q5JA 2W8BA 3KSZO 3ME5A 2UUPA 4Y0AA 1ORVA 2QVBA 5IBRA 3OQNA 4F3RA 5J59A 3H9EO 4MPJA 4M89A 1NNI1 4BJHB 4C9BA 5JVDB 4LHSA 4TMWA 5DV9A 2GF2A 1DRWA 4EENA 3ABIA 3ZYCA 4TSFD 4OYHA 1DIGA 3KTAB 4NEHB 4YAJA 3TQOA 4R83A 3Q41A 4C01A 4E33A 2HO4A 5TMPA 3TMKA 2ETXA 2CZGA 5SV2A 3U17A 4BLUA 3FMIA 3ND8A 1NURA 2OD2A 1LBHA 3IAHA 4X91A 2G5CA 4UE6A 5H83A 2OXFA 3R8CA 4WLFA 3QSYA 2O07A 4AC9A 1E4YA 2I6FA 1QV9A 1VE3A 3HDJA 2EU8A 1JWLA 1XMQB 4A26A 4E6EA 3U37A 1Z34A 3B7PA 4YUVA 1XROA 3TFOA 3X2FA 2ZI6A 3LQQA 3I0ZA 1GUBA 1UK7A 2PJUA 3PFGA 3WDSA 3PTLA 3MWGA 4JL6A 2PLFA 2D1RA 4F3KA 4L0CA 3V7WA 1ONNA 1XXLA 3FLEA 1BE1A 1AN0A 1O94D 2HIHA 4NMMA 1FZQA 4X8OA 3FFTA 5G0SA 3L93A 1F0KA 4E4RA 5LMNB 1CBUA 4DA4A 1VSBA 2G36A 4Z1MD 1N57A 4CNQA 3L0IB 2FUEA 4Y2UA 3GMIA 4IQFA 1ZZGA 2BEJA 3NTXA 4WK0B 5DHUA 1YRBA 3U1TA 2H2DA 2VDMB 2Z98A 4QL3A 1W5EA 3CEJA 4XYGA 3WOVA 4O4LA 5LUAA 2OL4A 4D74A 3SICE 1GNVA 1W9HA 2FZVA 3AI7A 3CGWA 3AEQB 3KAKA 4LOJA 4Y2VA 3D6MA 4RV9A 1XYVA 3KWLA 4IG4A 4XASA 2VYNA 2PZMA 5HMMA 4C2TA 2W22A 4Q82A 3X0DA 3EYAA 1X7DA 3PNMA 1ZCJA 5E7MA 4UBKA 3ETLA 4BKPA 4GXQA 3NVMB 1IPEA 2OZPA 3V33A 2Z09A 2AFRA 4LPKA 4U5QA 1RACA 2Z9DA 3U3JA 1T5HX 4HH1A 1RZRA 3LDUA 4FI3F 3JALA 3Q5GA 1E4EB 4NTZA 4D43A 1L5OA 1QSGA 1JXOA 2A0XA 5U9CA 3H7IA 3C1OA 3U1VA 4TTQA 2BF7A 2GPYA 4PLPA 3Q6IA 5JVDF 1XEWX 3UXMA 4LWZA 4YLEA 3W2IA 1M8JA 1ACLA 2EFDB 4TQAA 5DHRA 1U2DC 2VBFA 3EYWA 2PWPA 4F85A 1BGXT 5CD9A 4NV1A 2CL7X 5FA5A 1DWPA 1L5GB 4DSTA 1T34A 3DMPA 3C2QA 1HE4A 2XOXA 3DEYX 3E0QA 3JRXA 3KQVA 1BFKA 3FPSA 3KLNA 5EIBD 3KB2A 3UKDA 1GUZA 2B1JA 4QTUB 3AR2A 4RTNA 3NMUF 2CNDA 1X0XA 2PPVA 4LI3X 4Y1RB 3C15C 2I66A 4PHHA 5AVJA 4ZVRA 2YFHA 4ENUA 1N33B 2D2FA 3EVAA 4BQEA 1CNFA 4YAKA 2OO7A 4QU5A 1DCFA 4HFNA 1GUAA 2F48A 4JGBA 3S44A 1P4HA 2YMMA 1I7PA 1P3DA 1QAMA 2GLXA 2HL6A 2O23A 3NEPX 4GUDA 4RK4A 4ZT4A 4BC1A 1REQB 1F2VA 1ZD9A 3JY6A 4LJRA 1P1FA 2CGEA 4PANA 1LGYA 2BFPA 3IBSA 1EX1A 2Y0DA 4N40A 5F98A 1Q3HA 1DPFA 5JDCC 5K0GA 3QEMA 2CFOA 2FQWA 1TD1A 4RZXA 5DTMA 4JWKA 3BL8A 3E9RA 2J7KA 3MTJA 5D7NA 4GE3A 1BDBA 4KTVE 4MIOA 4RZSA 2FGJA 3ZCVA 3ZEIA 4ZYTA 1DXOA 3DCNA 1U7HA 3TZKA 3SFTA 3FOEC 2WWIA 3W6NA 1QO0D 2AMLA 3AU9A 4XAQA 2HHCA 2GYVA 5JYBA 4OSEA 2ZDHA 4LJ5A 2VOEA 2QLNA 1AGNA 2WJJA 4M9QA 4HYYA 4CLRA 1RWPA 3H5IA 4RSGA 4NE2A 3K20A 5CT4A 1JBKA 3BVPA 4G9GA 5GJCA 3OEEA 3FHJA 1KAHA 2AR7A 4N49A 5F52A 2IIVA 5BV1A 2D4AA 4PGGA 4MUEA 3T12A 1T5IA 2IOHA 1UDCA 3OBIA 4RH1A 1IN5A 1L5NA 2PH3A 3UK1A 5CA0B 4FT4A 4TYMA 5EXXA 4HN4B 3FYUB 4YUZA 1SZPA 4KWEA 4MTCA 1NVFA 4XQ0A 4N5LA 4OGLA 5KYTA 1K7CA 2P40A 3MCWA 1GLVA 5LYJB 2ZVQX 3BE4A 3N8KA 3RVRA 1SUSA 1OXSC 2IVZA 3ZHTA 1RI5A 3NUZA 3RC3A 5EXEA 5IZCA 3WDLA 1G5IA 1L5MA 4LFBB 1OGIA 4C6RA 1XU7A 1OT3A 4F5EA 4MW7A 4LHVA 1PQPA 2HBYA 3D8BA 3DDCA 3H0EA 3LLCA 5HZMA 3ZKWA 4L4YA 2QN2A 3HO6A 3KJQA 3L7IA 1FVXA 1BHQ1 2FZLA 2REXB 3IIKA 1GDHA 2YJGA 3QVLA 4H1UA 3CRRA 4KIFA 1BW9A 1G4UR 5IYZA 5KX5B 1O5OA 2LRHA 3IUQA 3M4ZA 4RA6B 3BWDD 1GDTA 3TOSA 1GFZA 2CBXA 2C2KA 4X0EA 4YJ2F 1SC6A 1E8MA 2IPXA 3B6JA 1EWRA 1LLQA 3N28A 2QPLA 4RVFA 1NJ1A 3CR8A 4ZT2A 4YRDA 1QH1A 2XRYA 2A86A 1UPTA 1TJ3A 5FA8A 4CPDA 2NQTA 5DLDA 1CY4A 3DEKA 5FCDA 4JYAB 2X86A 1APBA 2IYTA 3KNZA 3UH1A 3F46A 3DCIA 4CDRA 2GKGA 3S1LA 2HUPA 4AYTA 1PDOA 4WEQA 5HBGA 4EFKA 3EPLA 4DSUA 1J4AA 1PJQA 4F8YA 2IOQA 1TGVA 1NVWQ 1OF1A 3CLTC 3TW8B 3PC2A 3A3PA 5EZSA 1Z2AA 3ZE9A 1U0HC 1RBZA 1U6JA 1YR6A 2G82A 1E6WA 4KQ2A 5HKKA 5BSTA 2WU0A 3F8WA 5D3KA 4B4WA 2BDUA 3FX2A 1C7QA 4BEWA 5CG2A 2FK7A 2PJRA 3DEFA 3PPXA 3IO5A 2AOUA 3O7WA 5HGJA 4GZLA 1GKIA 2YVLA 3QQPA 3QWAA 1JIKA 1ZGAA 4IIYA 4M8KA 1QFMA 4YT5A 3QW2A 4PHCA 4KMRA 5CA0F 3K16A 4DEYA 1CF4A 4CKBB 1G18A 4AJ9A 3EIOA 4CM6A 1D5WA 2BH9A 2PX5A 2Y71A 3H6HA 2HRRA 3KQOA 3KP1A 3QUTA 4H7EA 3B1WA 4AW9A 2AZXA 1U9CA 4MQ5A 3I4LA 5BSFA 4QUBA 4PLWA 1WZCA 5TT1A 1P5RA 1MFZA 3O9ZA 1IIBA 3OAAA 3WV4A 4F84A 4D3YA 2I4MA 3COJA 3QG1A 3KPJA 3D4NA 4M54A 2YNMC 2OD7A 1ENPA 1ZUIA 2XNJA 1BVYF 3I5UA 4MVJM 1RC1A 3RO7A 3UJ6A 3J81k 4KXYA 1GP2A 1SVUA 2F8MA 2GK6A 3S29A 3DE5X 1L8LA 2Y2VA 1SD2A 3KKPA 3V8VA 4A6XA 3ZQKA 2XVZA 3RYCB 4B35A 3KQNA 2QTAA 1M6HA 1L4HA 2JFQA 2WLTA 2ACWA 5IJ9A 2BMJA 1IIRA 3GZJA 3QA3E 3FZNA 1X1BA 1SK9A 3O9MA 4DBZA 4OJTA 4YR7A 2WAMA 3VHXB 1L5ZA 2C0QA 2YYAA 5L95A 1HETA 3LOUA 3MD0A 3BMOB 3R8XA 5BVGA 3GPCA 3T3EA 1EVIA 3R7FA 3K9BA 3ZCXA 1LWNA 3I0MA 2IU6A 4PC7A 1ESCA 3IR5A 1X8XA 5CVDA 1BYIA 1PJTA 2BF4A 2C5HA 4X7MA 2GZMA 2BMAA 2OP0A 3HSYA 3TI9A 2PSFA 1VI6A 4Q7EA 4YJHA 2FP3A 2WRZA 2EIXA 4N5NA 4EYGA 4PLHA 5J4LA 3RVOA 2O5CA 2FUKA 3NS7A 3FMGA 4H18A 2ZDGA 3EG5A 2CY0A 4IGKA 4N5IX 4RUKA 5KTSA 4G07A 1N0HA 2AZTA 4P92A 3I9LA 4J0CA 1CT9A 2A57A 2BGNA 4RF5A 1MIOB 1U3VA 2WWXA 2AYYA 2GD2A 5KCZA 4OP1A 2TMDA 1U2ZA 3V4RA 2AG6A 4YRFA 1J2YA 2L82A 3G9ZA 3A4YA 4HZUA 1T6YA 2BEKA 2DT5A 2GCGA 3E1SA 3N2LA 2H1SA 2ZXEA 1MQSA 3EVGA 1NR1A 1C0KA 3QVJA 3CM0A 4G0OA 1XDUA 1TFUA 4F5WA 5CLJA 3AL2A 3CE6A 1G2PA 4E08A 3R5TA 4MJ7A 3SN6A 5BR7A 1C0IA 1VI2A 4H59A 1UK6A 1C9JA 2F1OA 3DZGA 1F8XA 4H7PA 2OB1A 2WICA 5K5EA 4LC9A 3ZHOA 1L3IA 2ADMA 4U9UA 2R11A 5A4MS 2OHOA 3GUYA 1KHTA 2HA5A 1PK7A 2YMQA 3COYA 3RIHA 2KB0A 2H51A 1UDWA 1P4AA 3NBUA 4BFUA 2AF4C 3B3JA 4BB9A 5B1EA 5BN1A 3LWNA 4IDPA 1A9OA 2RK6A 3D3KA 4BO0A 2H18A 5C32A 2TMKA 1TT7A 3NNDA 3D8NA 2OG2A 2PXHA 1E6EA 3F6SA 3STHA 5LIRA 3WGIA 5FI3A 2ECQA 3HWWA 2WKWA 1LBSA 3OCUA 4EFNA 3PZBA 1TW2A 1L7EA 1MT0A 1YZTA 2V0NA 4QUHA 1W30A 4W82A 1BQ3A 4I1IA 3CX3A 1AKQA 2PT6A 1JHOA 1SCUB 1V9CA 2HNBA 1MKYA 5EINA 1F8YA 3IEPA 2YMPA 3N8HA 1UQUA 3QBDA 1L7OA 2IHVA 3TGWA 1CQJA 2JD2A 4QRIA 5K1SA 2ZIZA 3SXUB 3QY0A 1U63A 1U7PA 2JZCA 3M6WA 4TTIA 2OBYA 5HQJA 1I9GA 4KP7A 2D3WA 3L82B 4CZ2A 1PFYA 1NLMA 1U7ZA 4I36A 2Q4EA 4QWMA 3QEKA 1Z7WA 5DVZA 3OT1B 2H8KA 1T9KA 4LKRA 3IE0A 4OK3A 1W1UA 2FFBA 4ARZA 4B17A 1T9GR 1YCFA 3GMSA 4NMWA 1SXJC 2RBKA 1JHDA 3IUEA 2H5LA 4MGHA 4O4JB 1V1RA 1WB6A 2EL9A 3DOUA 4P3PA 4YJ3B 2WTXA 4XYEA 3COPA 4F5ZA 2DE0X 2VYND 1UZAA 2FOLA 2V9PA 1Y6JA 1R0KA 2RBGA 5EE1A 1KBQA 4C5AA 2O5RA 3L02A 5HBRA 2ZUFA 1RI3A 2CLOB 4ZEVA 4R71A 1U1CA 1V26A 2BFBB 2PKQP 2WVAA 4ED9A 4Y2SA 2UZ4A 2QN3A 3JAWB 1K68A 1K1EA 1RZRD 4LMRA 4IH1A 5LR6A 3UJBA 3WB2A 1TJPB 2HEGA 1RHUA 3WO1A 2HLNA 3AM3A 3T94A 3H4MA 3HVKA 3INNA 4UDNA 2OC4A 5K0EA 3JYOA 1DV1A 1KSJA 3KKOA 4PFJA 4BNMA 2ONZA 5EQFA 1RBYA 4UCFA 3VX3A 5KMGA 2HIAA 4JBHA 3ZYZA 2NVWA 1R0XA 1GQSA 1Z0IA 5FNZA 3TNFA 1MB2A 3THXA 1YQWA 2W0SA 3WGNA 2QZJA 2CUNA 2M6SA 1I7LA 4P22A 4AMBA 3IDAA 3HVJA 5KNCA 1Q0TA 3C1TA 4Y1EA 3W5HA 2GZ2A 1QH8A 2ZE7A 5IDWA 5TY0A 3T6KA 2NNWB 2YC4C 4HNAB 2HSGA 4O2BF 3JQGB 4M86A 4EHJA 3GNSA 4EVSA 2O2SA 4NOKA 2EGGA 5LLSA 5AW1A 4X63A 3MCTA 1N0WA 2CLHB 2ZCJA 1IMJA 2I2BA 3IP5A 5LKRA 3DMTA 1O4VA 3UMGA 1R8JA 1O95A 2HWUA 4AZTA 3BD8A 1P9OA 2YWHA 4DNFA 2RGEA 1M2EA 3SU8A 5G1OA 4QO7A 3G13A 4YV1A 2VBIA 1QE5A 5LQRA 3KAQA 4JLKA 1G9TA 1EUDB 2C98A 1M2GA 2WIAA 3H97A 3OM1A 1W85B 3OOEA 4BPRA 4C1BA 3HMKA 1T8WA 1ZQ9A 1KI7A 4ZT6A 1AVTA 2I54A 1BE8A 3JD4A 5BWMA 2QYTA 3D5TA 2FSVA 4YJ3F 4KZPA 4MDEA 4I55A 4IQ0A 2I8CA 1Z74A 3W6UA 2ZP1A 3IAM6 1EDOA 3PUKA 3TFWA 2O48X 2QL7A 3L01A 2ST1A 4DIDA 5JR3A 3D7LA 3D2CA 3PUYA 2ENUA 3I9JA 1T8YA 2I6QA 2V7XA 3RW9A 3AEUB 5F9FA 4RFSB 3CH6A 4GEKA 2YIDA 5E6RB 3OEED 4WWHA 4P6VF 1MDFA 1T1SA 5CH8A 5JCOA 2D62A 1KYXA 3MUOA 5BW4A 5AVQA 1Y1PA 3R6LA 3UA4A 1NULA 4KLNA 3IMEA 1W581 1VLQA 5M2QA 4B48A 3QU4A 2NXJA 4MUHA 4ENQA 3AERB 4LRXA 4MR8A 1L1RA 2VG8A 5FBWB 5KKCA 1M9NA 3BX1A 4NKRA 3K8YA 5B1IA 5BSUA 1YTLA 3EEOA 2JEZA 4S05A 2VUUA 3C8DA 3AUXA 3AHDA 3LXXA 3QV2A 5CDSA 2RGNA 3UNXA 2HF8A 2V1UA 3FWYA 3HYNA 5KJCA 1WULS 3LRPA 1DJOA 1OBVA 3UMVA 5FV4A 1BD4A 1NXTA 1MGPA 1PTKA 1WVMA 1XMXA 2E18A 2WPDA 2XOEA 3RYFB 2F9MA 1K06A 1ODSA 1IOLA 1TKCA 3K92A 2Y4NA 3EJWA 1TA9A 3Q6NA 2OKCA 3RWOA 3UMRA 1V7ZA 4XGKA 1Z56C 1M2OB 2AE1A 1NRJB 3R5KA 2VHCA 4JYZA 3H5OA 4M9CA 1QCCA 2XNHA 1SKQA 3JZDA 2FG6C 4HDMA 4LQCA 4O2LA 3HYTA 4UXJA 4X1IA 1T0JB 5GGXA 4A0SA 3CMCO 2GZ3A 3W7VA 1T4DA 4DRYA 5HJEA 1N9KA 4Y6PA 4ZA2A 3CKYA 3OF2A 2WJIA 2Z8YA 3EFBA 5AW4A 5D3QA 2PUEA 2H6EA 2E48A 4IDNA 1JFRA 1ZO8A 1N6IA 4OKIA 3UPDA 2B2XA 3WZ2A 4AJKA 1EFKA 3W9UA 1DC6A 2C88A 3GRYA 2O5EA 1G7TA 2G83A 4WDQA 1N2CE 3ZQ4A 4EKEA 4PSDA 3DL4A 1NM5A 1Z08A 3MHPA 4QYTA 4ZI3A 5DHQA 1NSYA 3FTCA 1Q1GA 2FPXA 2H59A 4RKRA 1XC7A 5DCWA 3ZKAA 1V1MB 3RB8A 2MINB 3PHCA 1P2SA 4ZVUA 5L3QB 3BA1A 4V3CA 1B16A 4I4IA 3BCHA 1UOQA 2JGFA 1EFTA 1X87A 5HKKD 5KYWA 2P9HA 1N3IA 1A2BA 3NUGA 4LHEA 5A4JA 1TM2A 2ON6A 3RTAA 2O7NA 4E5NA 3DJFA 1YQ9A 2HN9A 4FDVA 4RVOA 4UHKA 4AY6A 3GUZA 3MG9A 2CKDA 4FYVA 1AQYA 1F6WA 3PENA 5JROA 1ZH2A 2QAIA 5ELXA 1N2SA 4Q4JB 4JCOA 2DTDA 4E2YA 4L6CA 2XUKA 2NTEA 4FR2A 4P4UA 4EG5A 1QOPB 4BV3A 1Z75A 3EW7A 1SUAA 1KY4A 1Z2DA 4FE4A 4KMOA 1UINA 2OO5A 4QUIA 2FPSA 3O8QB 1C2YA 5BN5A 1A8IA 5HA5A 3OAAD 2WD7A 3B82A 5FFMA 2J9ZB 1T35A 2G67A 3F3YA 3P26A 2Q3DA 4Q03A 3HFSA 5CBKA 3KG2A 2RHHA 2V3WA 5ALDA 1QQAA 3FKJA 3DTNA 1UXKA 2QL6A 1XZFA 4J03A 4UEQA 5H02A 4BC0A 3G8AA 1G5QA 3W4KA 5KYXB 2O8CB 5K4AA 2QTCA 2GBIA 3N86A 4MPRA 3C6KA 3D64A 4Y9UA 3A05A 2E5WA 5KQRA 3QYPA 3IBTA 4EJFA 2QORA 5C5DA 4KPGA 1W0JA 1J0CA 1FDWA 2NO6A 4NH0A 3W3AA 5CFQA 3EH2A 3QLVC 4LVNA 4NQZA 3AW8A 4KSCA 4OLHA 1LJLA 1QKIA 4MV3A 1KRHA 1NOIA 4NNJA 4JODA 2H9AA 1P60A 2GFHA 1UODA 1MAUA 2SNIE 1DQNA 4KO3S 1KE1A 4JXZA 4Q1CA 3GU3A 5LZ5A 5LZ9A 1V45E 4FN4A 4LYYA 1MB9A 1GGNA 1IHYA 4MWOA 5LZ4A 4F3TA 3LZDA 4J0EA 3HV2A 2FX3A 3ECAA 4Q93A 5B3JA 1FP4A 4YJDA 2D6FA 1M10A 3OJWA 2B6HA 5GJVC 1EXWA 1U0OC 2BMVA 4I9FA 4XM1A 5C8YA 1NG9A 1YKGA 4HL6A 1ODFA 4NH4A 3HP1A 4MW4A 1IZYA 3VR5A 3AVQA 1MOQA 4GG1A 1I3LA 4FMPA 4JQCA 3SDBA 1PI3A 4CM8A 3IB6A 1OLXA 1NOJA 5CNIA 3EZGA 4I4TB 3T34A 1XVLA 5LU9A 3KSAC 2EAUA 4MUXA 1MZPA 2V6BA 5KTKA 1SK8A 2BY4A 3G5MA 3MS2A 1FTNA 5IH3A 1JQAA 3N0VA 1EWYA 1RCFA 2HHLA 1A8HA 4WN9A 1G8SA 2EJTA 1Y6ZA 4EA6A 1W4AA 3CRNA 1Q77A 4ZAWA 3TQHA 2RKBA 1UBNA 4DSAA 4I7EA 1JHUA 1QVZA 1YCGA 3ISJA 3JATA 1YJAA 2HMYB 3HEMA 2FPWA 1C1XB 3WK9A 4YS6A 4WH0A 3AC0A 1EVZA 1KMCA 3DE7X 3SSMA 4KGXA 4WNAB 1J5XA 2O8FA 3CNEA 5KVQA 3GLFE 3RAEC 1WNTA 3FDXA 3B6IA 3IOMA 3IQXA 2V9ZA 3OEYA 4J90A 5KHLB 2OT3B 3TR0A 1FNMA 1ZBDA 2P2CA 2I8LA 3AVYA 2SICE 5DI3B 1D3AA 4BGDA 5JJLA 1GQOA 1YDFA 1ZU4A 3VSBA 3T52A 1KZ6A 1YVPA 4DMKA 4RY8A 2V9CA 4MIEA 4BPBA 2AI2A 1I30A 1OIXA 2L19A 5KINB 1A4RA 3KUDA 3EXIB 4Q1EA 5H5JA 1UC8A 3JR3A 1SCAA 2O0KA 4XWOA 1V8FA 2IYZA 4FR5A 4KVFA 2OQIA 3IPLA 4DT1A 2DFTA 4YDRA 4MEJA 3TEFA 4GXNA 4HS4A 1UXIA 5TGTA 1D03A 3E2IA 1RW4A 3U19A 1G42A 1NR5A 1MQ8B 1Q7TA 2EG5A 3GRKA 4MA0A 4CKXA 1RAEA 4Y1GA 5IJWA 1TEZA 2O8BB 3Q8KA 2CVFA 5PGMA 5A4AA 3FDZA 3PWKA 1ZNQO 2BJWA 2O4UX 1XQXA 1M8FA 1QK3A 3NXKA 4QAQA 3RVNA 1MNQA 5EI5A 2QUBA 2WSIA 4E7PA 3ZY6A 3GPDG 1QF7A 4HDAA 5JS2A 3VJKA 1EGQA 2ISQA 3RVJA 1H3FA 3U56A 1M2KA 3FTNA 3ILVA 1LFAA 1ZL2A 1RE1A 3OURA 4JIGA 3T9CA 4ENWA 4ZVTA 5L40A 1B73A 1OLUA 1SCJA 4RAOA 1R0ZA 2XB8A 5EWLB 1F4LA 5K2MA 3REFA 4LBYA 1V3UA 3TOCA 5K01A 5EMJA 3F90A 3H16A 3O31A 1VBFA 2VDLB 5TEVA 2YS6A 2GJ8A 4Q3CA 3DS8A 1L5HA 1L7NA 2HQ1A 2W98A 1FNNA 3NC0C 4KO4S 3SQMA 2P77A 5D7BA 1ESEA 3A6GA 2ECKA 3FJOA 3AHFA 1ABFA 2NTNA 1R0CA 3AIIA 1N8NA 3CUKA 1NX6A 3IBCA 3OJLA 4M0LA 4HNTA 1T6ZA 3TNDA 2JAXA 3MYRA 1D7AA 1QNFA 1SHKA 2AN4A 1DLIA 1ZH6A 2GEFA 1W8IA 3M82A 1RRGA 1NE2A 1S5PA 4CLOB 3KPUA 2NO7A 2GT1A 1N77A 3QH4A 3MTAA 5D3MB 3LW7A 3NVDA 5AJZA 2IY8A 5KNCD 2V7PA 1UPXA 2ZR7A 3S3TA 4BNTA 1PGQA 5IH7A 3DPUA 3DSRA 4N65A 2K7ZA 2NO1A 1DX6A 4XIFA 5F1KA 2IBMA 1XZPA 4ASUA 3T3OA 2W6CX 5FFNA 4A1OA 7AT1A 3B1XA 3PHLA 4JYCA 1XIVA 4AI6A 4DS3A 2GCOB 4XH9B 1SG0A 2JH9A 1T6NA 4IVPA 4LBWA 4H6PA 1BCRB 4PZEA 3NX4A 1JX6A 1SC3A 1TXGA 3FSJX 5F5XA 1DG1G 6REQB 3B70A 3GVIA 3BJZA 2JNWA 3TCNA 4ZEXA 4MQFB 1NNSA 1J9EA 4WZAE 4D3SA 4EY5A 1JQ3A 3FKSA 1WXXA 1GKYA 1NZFA 4WBNB 1M6NA 1YS4A 5GOZA 4A8HA 1E5LA 2CKMA 2BTOA 3WK5A 1NC3A 2VDPB 3A58B 4FC7A 4HSEA 4C7OB 1SVSA 3NEJA 1X7ZB 1ZI9A 4FD3A 1UWLA 1RAIA 1QIIA 1U8TA 2EW8A 4FYXA 1UP6A 1UP4A 2W6NA 3P7MA 4KYTA 5FADA 2K2QB 4RXTA 4N39A 5IXJA 2PD3A 3WLTA 1KYWA 1CLEA 3FYHA 3KTAA 2XE8A 4LMAA 3O4IA 1U1FA 2J59A 1V6AA 2HK9A 5JQGF 5G4KB 1MMFB 3IIMA 4L08A 2N9UA 1KDYA 1U4NA 3LBFA 4PO3X 2LW7A 4URUR 3BILA 2GAIA 1MCZA 2DP4E 2VT2A 2WT8A 3E23A 3E61A 4WK6A 3QHQA 2NPFA 3RARA 5JNSA 3ZZNA 1L8XA 3N07A 2ORYA 3ONVA 1PYGA 4MWTA 2G9UA 3X1DA 2PGXA 4X64B 3KB1A 2SKEA 3PR2B 1QUFA 1RKUA 1U1IA 1GZDA 4WLOA 3VOBA 4HVTA 4BB5A 2BGIA 3I9V6 2BBOA 1S02A 1QTNA 3P2KA 4Q7KA 5HS6A 4N18A 3TD9A 3BA6A 1WR8A 2QGFA 2A1UA 4Q48A 3T7EA 1IZ7A 4HP8A 5FPPA 3RTGA 3SEFA 3TIGA 3ZD8A 2HA0A 1RRVA 4EY7A 3C3KA 3NIBA 3PRJA 2RDMA 2E82A 3V3KA 5JSQA 1Q0SA 1YBAA 4GGPA 5AKZA 2PG3A 3TPCA 3W0LB 4MPTA 2QNRA 4HXFB 1A9RA 5B4UA 5KSOA 3B1JA 2RAVA 1HQKA 3HU2A 3A1UA 1K6EA 2BM0A 1PO7A 1XE3A 2C2YA 2WPDD 2X41A 5LB4A 1ZZEA 2GK4A 2Y1LA 2EEZA 3E9QA 3IAUA 1JP7A 4J0IA 3U4CA 3M81A 2C3UA 2O0LA 1Y48E 2NZ2A 3RBXA 1M6EX 4FDMA 2G28A 3K0AA 2DAPA 3HYSA 2PA3A 5L8VA 1F7UA 2QTRA 3AZPA 5BWLA 1YH3A 3KHSA 5DB4A 1M1ZA 4OHWA 5ENVA 1WS6A 1YFJA 1LLUA 1VP3A 2DLCX 3NW9A 4IQGA 4OU4A 4OX9B 4NZMA 4WACA 3VH2A 3SKVA 4F5YA 1E4EA 1L1QA 4MLDA 3VTKA 1G17A 4AJLA 3KQUA 1BA3A 1CB0A 1ADCA 3BXXA 2EJCA 2PLRA 5F5NA 5HEKA 5LP1A 4IICA 2P6UA 1LPPA 4WFIA 3QMWA 1OBCA 3BYZA 3ETDA 4U8HA 5CH3A 3TMAA 3ZWPA 2BFDB 5HWSA 5FTKA 5DYIA 2FFHA 1XTJA 2J33A 4REQB 1ISGA 3AEXA 3QKRA 5CYFA 2BM8A 3H2JA 1TYAE 2QVLA 2PWZA 4Q3OA 3ZXXA 2O59A 2EF0A 1B6TA 1AZSC 1GUDA 4AWBA 2BFCB 2HA6A 2ZWVA 1IXSB 3P4UA 4OFBA 3QBVA 3TKLA 2ZWOA 2WJYA 3BTSA 2ZT6A 1IZ0A 2H31A 3CC8A 3FZEA 2ZULA 4UHFA 2JG3A 3EDOA 3L0ZA 1RAHA 2HA3A 4FBLA 1NXVA 1NW5A 2RH8A 4CMAA 2AF3C 4OK6A 1OT5A 2IYXA 1REQA 2P7HA 5AXCA 4I8DA 3OJ0A 4EPXA 1XTIA 4Q4HB 1D6NA 1QPBA 1T2AA 1VHWA 3ND6A 3R3HA 4FK8A 4OREX 2B8JA 1G1AA 2GD0A 3AQIA 3HA5A 3P2EA 1E64A 1KVQA 4RNDB 2PKEA 4QJ5A 3RWBA 3R74A 3BB4A 5TMDA 3P2MA 2EP7A 2VPWA 5BXQC 1XQYA 1UBLS 3M9LA 1U7XA 2UYQA 4PEVA 1VCNA 2R48A 1BU5A 1R6VA 2OCPA 5CCEA 1M67A 2Y1EA 3KB8A 4TM8A 5H8WA 2B69A 3AW9A 3PQFA 4HKTA 3TB6A 1VKNA 1NN3A 1J7KA 3U4AA 2C7VA 1GAXA 3Q40A 2DWCA 1ZR4A 4JAVC 1Q7CA 5CM8B 1EYZA 1W0JD 3PEUA 4LZAA 4C0BA 1VBKA 1GU7A 1U0LA 2VFAA 4B87A 4RTLA 3W3AD 1MJHA 3ENZA 1H6BA 3I1FA 4NPCA 1ZIXA 4XQEA 4ZO8A 4I9HA 3FPEA 3U62A 2JZNA 1I3MA 4X7RA 3RUEA 1DL5A 1ZR2A 1VRCA 5CA0A 1PFUA 3NAMA 3FYUA 4QU8A 3UAYA 4EGQA 1FTYA 1ORRA 5GZ6A 1JLRA 4P38A 2CCJA 4B6QA 3CVWA 4LC1A 3VI3B 4GQAA 1ZUWA 5JS6A 3CKLA 1BJKA 1V7CA 4YV7A 5LYJA 2IC5A 1YFLA 1MQAA 4AP6A 2K4MA 3P9RA 1CVRA 4UARA 3QM1A 1WIWA 2XMDA 3PDHA 1GLNA 2Z3WA 3USCS 3A0RB 1K88A 4K1LA 4FP9A 4WNCA 4E3ZA 4RORA 3VR5D 4X9XA 1H2EA 5LFAA 1CQPA 3WGUA 2W90A 4FQ5A 4OFWA 3VH3A 4ZJZA 2HQBA 1NQVA 3RLFA 1ZRMA 4K81B 3Q3CA 4OBXA 5EQTA 5KX5A 1I14A 5G2OA 5IMSA 3OPYA 2PUAA 2J85A 4BNYA 4BV2A 3MSCA 4RA6A 3GGDA 1WUYA 1H42A 2HBZA 4I19A 3FGNA 5CTAA 3BQNB 4DLZA 4G4GA 1KF0A 3DZBA 1XRLA 5FP0A 1G5PA 4OGFA 1BVUA 1OWNA 5C7IO 4MSUA 2V55B 3BF7A 4XTCS 4Y6SA 4JB8A 2B98A 5L4LA 3VXKA 1Q57A 1XL0A 4DBVO 5LC1A 5HF6A 3PXBA 1SMKA 1EUQA 3OZ7A 2B2CA 2FSGA 1ULAA 5F7JA 1UKAA 3TZQA 4FLEA 1HGXA 3EZ2A 5EL0A 5HZHA 4XIIA 3VTFA 3D8TA 2QQ0A 5COQA 5C1OA 4JA2A 5JEDA 1XHFA 3I04M 1Y7LA 2IU3A 3A25A 5JIBA 2C2GA 5LCXA 4MLCA 3NWBA 4YTEA 4XYBA 3G1WA 3JQBC 1K3TA 4LNAA 5LQCA 2KX7A 1YD7A 5CFZA 3HXMA 5TJHA 1JG2A 4NPHA 4OQPA 1UMBB 3J7TA 1AUVA 3KBOA 4LZPA 3NHWA 4AU1A 5JSUA 2WG0A 5HUHA 4MLPA 1FFSA 1U7UA 3L4BA 1PU2A 3BJMA 2RGDA 3LBHA 3MW8A 3UZUA 3WKEA 4BMVA 1A5BB 2I6SA 4ZYVA 1XZKA 2CXHA 4HAWA 4P82A 2XKJE 3EW9A 3PFNA 1ZW1A 4ZP1A 5AK0A 4Y9TA 5ALKA 3IMKA 2HPZA 1XRJA 3UWSA 2NU7A 3X44A 1AJEA 1MA3A 4BGUA 3SJ7A 1NFFA 3N3AC 3TZBA 1PR6A 3F6RA 3V2HA 1H9CA 2DLDA 1JA0A 2F3TA 4UM5A 3RD5A 2DPHA 1M66A 2OR3A 4Q3EA 4YCNA 4YDQA 1G5HA 2RHBA 3TS1A 1TTQB 4I8IA 4HBGA 3BE8A 4M1ZA 4C43A 1DBSA 4B3SB 1P0QA 5B53A 1F9EA 3TBFA 4ZTZB 1GVHA 5K9ZA 1JMKC 1F8UA 3UPTA 5ED4A 1U9JA 1XVTA 2XDAA 4P4NA 4J6FA 3COVA 4HDKA 3RYCA 2WZCA 1O57A 4DSNA 4QG3A 2WFAA 3NBAA 3AT1A 3NP9A 1AQ6A 5HF9A 5F33A 3TX2A 1J0AA 3AGPA 3IT1A 2B8NA 3LQ1A 3Q11A 5DCUA 3TBKA 2W2KA 1EM8B 1IH8A 3D3WB 1WBJB 3VHXA 3CVXA 3BRWA 4RHTA 1K66A 3OX3A 1IRIA 3R3VA 3BMOA 4IWYA 4MVJH 1VHJA 4MVJF 4ONEA 3ZJVA 1O89A 1QIEA 4Y9SA 4RVHA 4A0FA 4DQLA 3MNFA 2FE4A 3UH0A 9ATCA 3B20A 5FTMA 2HB6A 2X42A 5AKJA 3I6YA 2WB2A 1VLLA 4KC0A 2W37A 1SO8A 4OL9A 1EVLA 4CIBA 2EQAA 3M1IA 4GM1A 3U7JA 3AINA 3NC1C 1U0TA 3MELA 3C3BA 4LV6A 1I1HA 3TL3A 2TECE 4AMUA 2JCYA 4MITA 4XRRA 1OXUA 3WNDA 1ZMRA 3N2NA 3T7CA 4Z0HO 4LJLA 2ID8A 4OKNA 1JQLB 2PUCA 1CUFA 1E4OA 1MIOA 1U81A 3CUYA 3PEEA 4XVRA 1KKLA 4CMGA 1XZEA 1Y33E 2WAXA 3OFJA 3ROZA 1P2VA 1CRWG 1E4VA 2FG7C 2QU7A 4K6CA 4OB8A 4ASUD 2RGGA 2UYGA 1N5OX 4I14A 4ZN6A 3QX7A 3NASA 1RZUA 1XZNA 1D9ZA 1ETUA 2EKDA 3O4JA 4UBIA 2MMCA 3JV7A 1MG0A 3GARA 3A6ZA 5DNVA 10MHA 2AG0A 2IHJA 2GBLC 2JJYA 2NUAA 2YCBA 3VDNB 4D4JA 5H4GA 4OBWA 4MAMA 1OH5A 3A2NA 4OH1A 1O03A 1XD2B 2ERYA 3NHBA 4H4CA 4GYKA 4A27A 4FYWA 5I7AA 2E49A 3GVCA 4BQIA 2IE8A 4YUYA 3FKSD 4K9RA 2BGKA 3HYCA 5EFOA 4ZMBA 4XWGA 3K9HA 2XOKA 3R5FA 4LJ9A 4LX0A 4A2CA 4DLNA 3SXJA 1XZJA 4KQFA 5G02A 2AD5A 1OX4B 1VJ0A 1SVLA 1Y3FE 4JSRA 4I50F 1GTVA 2F90A 4J3NA 1F1BA 2H00A 3B6ZA 1UM9B 3O8LA 3LVQE 3SX2A 3C3WA 4LSGA 3RUCA 4YJKA 2J0VA 2RKOA 3IR7A 4BFXA 4TYYA 1VJRA 1Q12A 2WT4A 4UE3S 1YIDA 2NV2B 3TOVA 1Q3KA 1Y9JA 2ODTX 4C4YA 4AO7A 2GX6A 2D1YA 4BFYA 4TLEA 4PRLA 3BCSA 3K73O 4B85A 2YOGA 4FJ0A 1PR2A