2CD9A

Sulfolobus solfataricus glucose dehydrogenase 1 - apo form
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
366
structure length
363
Chain Sequence
MKAIIVKPPNAGVQVKDVDEKKLDSYGKIKIRTIYNGICGTDREIVNGKLTLSKGKDFLVLGHEAIGVVEESYHGFSQGDLVMPVNRRGCGICRNCLVGRPDFCETGEFGEAGIHKMDGFMREWWYDDPKYLVKIPKSIEDIGILAQPLADIEKSIEEILEVQKRVPVWTCDDGTLNCRKVLVVGTGPIGVLFTLLFRTYGLEVWMANRREPTEVEQTVIEETKTNYYNSSNGYDKLKDSVGKFDVIIDATGADVNILGNVIPLLGRNGVLGLFGFSTSGSVPLDYKTLQEIVHTNKTIIGLVNGQKPHFQQAVVHLASWKTLYPKAAKMLITKTVSINDEKELLKVLREKEHGEIKIRILWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUCOSE DEHYDROGENASE
publication title The Structural Basis of Substrate Promiscuity in Glucose Dehydrogenase from the Hyperthermophilic Archaeon Sulfolobus Solfataricus.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Oxidoreductase
total genus 112
structure length 363
sequence length 366
chains with identical sequence B
ec nomenclature ec 1.1.1.120: Galactose 1-dehydrogenase (NADP(+)).
pdb deposition date 2006-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
A PF16912 Glu_dehyd_C Glucose dehydrogenase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2cd9A02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2cd9A01
3JYOA 3VPSA 3Q2IA 2Z5LA 5KVSA 5THQA 5CP8A 1MC5A 5A3JA 2FWMX 1F0YA 3FNHA 3GPDG 4J7CA 3BTOA 2P5UA 3TF5A 1PJ3A 3OQBA 4FOSA 2GYYA 4GMGA 4JQCA 5TX7A 4FFRA 4INAA 4PN3A 2ZJ0A 2C07A 1U3TA 3Q2KA 1UDBA 1T1RA 3PJEA 4QO7A 1EUZA 4C7JA 3BTSA 4OJNA 2EF1A 1NAHA 2PNFA 5AXCA 3ZV3A 2Y67A 3PP8A 4E0BA 1X7HA 3A06A 3PLNA 3UOGA 4BNIA 3ZWAA 2GRAA 3UUWA 4F46A 2IYPA 3KZVA 4IDGA 4HNHA 4UVDA 1H5QA 1YOVA 1NX6A 3H65A 4LRSB 3KBOA 3ETDA 1YRLA 2OBYA 4J4HA 3HE3A 4PIVA 3I1JA 2PZKA 2VHVA 1I5RA 1NVMB 1X0VA 2NU7A 1LRJA 1P1JA 1O95A 3Q6IA 3EUWA 2EKPA 1RM4A 3G17A 2OFPA 2Q49A 3ZW9A 3QWHA 4E33A 4OH1A 3I9LA 4RPLA 3D4PA 2VWHA 1X1TA 5AXBA 2Y66A 2QX7A 2VHXA 2ZKLA 1KBZA 1M76A 3DONA 1W0CA 4A5OA 3C1OA 2EGGA 3KSZO 4I5EA 2DC1A 3QV1A 3F6YA 3LLSA 2XF8A 1CYDA 3ZHYA 4M8SA 3C7CB 1DC5A 1IUKA 1PZFA 1K6XA 4G5HA 3FN4A 3M2PA 2HRZA 4FJ1A 1LLDA 4MVJF 5JW6A 3GAZA 2JHFA 3NDRA 1DC4A 2YFHA 4CM8A 3OA2A 4CM1A 2FMUA 3VH4A 1VL0A 3C24A 3KXDA 2I6TA 5DP1A 1P0CA 2I3GA 3GF4A 1A9YA 1DHTA 1VJ0A 4FQ8A 3QY9A 4W7IA 1R4MA 4YACA 3LF2A 4J9UE 5JXWA 2RBEA 4BGIA 1B8VA 1K6IA 1Y7TA 4G2NA 1GZ6A 1H6BA 1LBEA 4CL3A 2E48A 3RBXA 4DRYA 1LLCA 3M1AA 1F8GA 5DCWA 1E5LA 3AM3A 2X23A 3GEMA 4II2A 3IJPA 4Q3BA 1Q2XA 2HU2A 4NH4A 1I3NA 2GZ3A 1ISFA 3LC2O 4IINA 2JD1A 3GAFA 4RVFA 4L9RA 3TRIA 1I8TA 4K26A 1I32A 1PZHA 1B7GO 2VOEA 5KTKA 1QRRA 5K6AC 3ZZNA 1ZMTA 4WGGA 3ZNPA 8ADHA 4WEQA 2X22A 4QTZA 2YQ4A 3ZNOA 3O8QB 3FBTA 2Y0DA 2YY7A 1MC4A 4HFNA 2PH3A 4BNJA 5L7TA 1IULA 1GU7A 2AQKA 4B7XA 2DT5A 4PLPA 4S1VA 5L40A 3I23A 1H2BA 4TSKA 4XR4A 5JO9A 3KOUA 4P4LA 2QRJA 1ZSVA 4DPMA 4PLHA 3BHMA 5GY7A 3TL3A 1QYVA 1E3WB 1PGOA 2X9VA 3WBFA 5C7LO 1VJTA 1ZZEA 4BV8A 3IMFA 5I9NA 2OHXA 1ZNQO 3ZI0A 2RH8A 4JCOA 4ZQHA 4BKRA 1ONPA 1BGVA 3F9IA 1B0AA 3UH1A 1R12A 1IPFA 4LSMA 2FPIA 3ON5A 3X2EA 3U09A 1IYZA 1E3EA 1J6UA 4XEHA 4YAIA 3OETA 1DPGA 1V9LA 3Q9NA 5JLAA 1XU7A 4H3VA 2O50A 3EK2A 4B7UA 1GV1A 1F14A 3DBRA 3KB6A 5IJZA 3KV3O 4IS3A 1WMAA 5AXDA 2OP0A 5CDYA 3DAFA 3HG7A 4KWHA 2D8AA 3WYCA 2P4HX 1OFGA 2G76A 3CKYA 3KO8A 4O5OA 3GZ4A 2O3UA 3A1NA 3NGLA 1U5CA 3ITDA 3TZHA 1E7QA 3JV7A 1NR7A 2VT2A 3H8VA 1XKQA 4J91A 3UVEA 1BW9B 4AJPA 4D42A 2RCYA 4G81A 2VNSA 1AXEA 3GDGA 1NAIA 4KTVE 4N54A 2P9CA 3QWBA 1H9BA 1U7HA 1PWXA 3ZU3A 1DRUA 4YT4A 1E1KA 5IDWA 3FPLA 3OIFA 5BNTA 2B4TO 3DQPA 4J1SA 5A06A 1OI7A 2X5OA 4E21A 4OL9A 1YBMA 4ILKA 3EVTA 1M2WA 2V6FA 4GMFA 3VPHA 2RH4A 1IL0A 3FF4A 4CLRB 4DLLA 4FGWA 3SX2A 4IDFA 5BSHA 2XPCA 3IDSA 3L9XA 1DAPA 3AWDA 4YVFA 3JQGB 5BT9A 4YJDA 3WS7A 1B26A 5I9MA 2VYVA 3GVHA 2VOJA 1LSSA 1GZ3A 3HN7A 4CQLB 4FFLA 2GNAA 2IZ1A 3QHAA 1QYXA 2AE2A 4HFRA 5I9LA 3LT4A 4GLOA 3ANLA 1NBOA 3IUPA 2EIHA 5F1KA 1ZK1A 1M67A 2F00A 5DCYA 3ST7A 4ZGWA 4JP2A 1ISIA 3KSUA 5EN4A 3JQAD 1XQ1A 5F5NA 4ALJA 5A9RA 3DMTA 3RFXA 4BB5A 1HZJA 3OHSX 4NU5A 4OXNA 2IZ0A 4FJ0A 1GYPA 2ZB8A 4R9RA 1V8BA 4Z9FA 2RHRA 4OHUA 2DM6A 3R0IA 1LJ8A 3RKRA 3ZHZA 3WIEA 3TL2A 4FFPA 2UUOA 4J6FA 4A10A 1A4UA 4D3SA 2NWQA 3K9QO 4FCCA 3PLRA 4R16A 5TC4A 3RC1A 4NDNE 4MP3A 1MB4A 4ZQFA 2QZ9A 5DP2A 4IJUA 2H63A 3K30A 5TJHA 4RCVA 1U1IA 1CRWG 4BQPA 2IEDA 4WLUA 2E4AA 2W98A 2EP7A 1ZSYA 2DUUA 4ND5A 5EL0A 4CLOB 3WGHA 4DREA 2JAHA 4CMBA 2GN6A 3HFGA 2H1SA 3IIEA 1EVJA 1KEVA 2IZZA 2ZIZA 5KIAA 3VTFA 4IDBA 1KERA 3E1KA 2QW8A 1QYDA 3JQFA 4FIZA 1NASA 3VTZA 4Z0HO 5B4UA 3WYEA 1E0DA 3NTRA 4E32A 1YQGA 3NAQA 2CF5A 3N7UA 1M66A 3P19A 3VZPA 2B4QA 3KM0A 1N9GA 2AA3A 2EKQA 3JQ7A 1UUFA 1J4AA 3DEYX 4XJTA 2OXIA 5IN5A 1C1DA 3QVOA 4DBVO 3AFNA 5A04A 1R4NB 1H94A 3MOGA 3DZIA 2BLLA 4TRNA 1Z7BA 4HV4A 2W2KB 2O3JA 3RUHA 3WOHA 1CIVA 1UJMA 3DOCA 1DRWA 3H9JA 1PL7A 1Z45A 5CAEA 1O9BA 4PVDA 1T4BA 3VC7A 3JQ9A 3GDOA 4DPKA 3TDKA 3DAPA 3FSRA 3BMCA 1HLDA 3E9QA 1ZXBA 1KEWA 3PYMA 3SBOA 1XU9A 1PGNA 3T7EA 1EE9A 2CVZA 2HKIA 4NBUA 4XR9A 5GZ3A 2FSSA 1VPDA 1JW9B 3NJ4A 4B3HA 2DPHA 4PLWA 3GUYA 4CJXA 5L7WA 3BMNB 1V3TA 2BFPA 5L4NA 3FTPA 1PIWA 1OC4A 4KP7A 4HXYA 1IOLA 1CQJA 5COBA 2NVUA 3E8XA 4L0QA 3SXPA 4FGSA 5KJEA 4CLEA 2HMWA 2OZPA 3RVDA 1DIHA 3ENNA 3JYNA 2IDZA 1Z82A 3OA0A 4KDEA 3OEYA 5F5LA 4PZEA 3C85A 3DMTC 1T2CA 4XGNA 3RFTA 1LSOA 4Y6PA 3PJGA 2X5JO 5JAQA 4I5FA 4RV9A 2W90A 1PTJA 4OYRA 1EMDA 1MA0A 1WNTA 3K31A 3QVWA 1EVZA 3AUAA 4LISA 3JQ8B 1N92A 4JP3A 3HSKA 5G4KB 4QXMA 2WM3A 4PRKA 1RPNA 1HRDA 5H81A 1LDNA 2PGDA 1IZ0A 1ISHA 2VN8A 3WFJA 2TMGA 3PJDA 1DC3A 4FFMA 1B16A 1ZK3A 1WDKA 3WWYA 3JCZA 3O26A 2OMEA 3BTUA 4IBOA 4GSLA 2Q2QA 4BNZA 1E3JA 2Y1FA 1YQXA 2ZYGA 1CF2O 1GQQA 1YB5A 3G1TA 3GLQA 1YO6A 2FPPA 4YAGA 4MDHA 2ZYDA 1DSSG 3CZMA 1BG6A 3OSUA 4YT2A 1JKIA 1R16A 3CUKA 4Y6SA 4BMVA 1PWZA 4BOYA 4UAGA 3E5RA 3IUSA 4IIUA 4YJFA 4AICA 4CM9D 4HWKA 1MV8A 3V1UA 4QQRA 4JJGA 5KVVA 2QG4A 1WP4A 1F06A 3E82A 2NADA 3DBLA 4AJ4A 2Y1CA 4BNHA 5ENVA 2GR9A 4L74A 1Q7GA 1UXKA 2VYND 4D45A 5JS6A 3BHJA 1K5HA 3DTYA 3V2UA 3KLMX 4KZPA 4MJLA 1ZVMA 4AJKA 1KETA 2D2IA 2PLAA 4I5GA 5T8KA 1K3TA 1UXIA 4GGPA 3PVZA 4HFJA 3PYXA 4DA9A 1D8AA 3L4BA 5TLSA 4HADA 1P77A 4MP8A 2E6UX 4OMUA 1TI7A 1U3UA 2RIRA 4JJFA 1ZXLA 3INGA 4NMHA 2YUTA 4RVSA 4UULA 5DT9A 3UKOA 4EDFA 5A9SB 1LC3A 2CF6A 3WLEA 4E5KA 3O38A 3ZU4A 4IJWA 1H0KA 2PFGA 1JWBB 2UAGA 4BNXA 1WLYA 4LSWA 2VTDA 1GYQA 4ITUA 2F1KA 2DAPA 1ADCA 5ILOA 4R68A 4GX1A 3FI9A 4RZIA 4XCVA 3ULKA 2G82A 3H3FA 3OJEA 4MVJH 4IPTA 4OO3A 4DIOA 3WSVA 3D3WB 4OM8A 3H9UA 3JQBC 1RM0A 4MKXA 2Q46A 2DQ4A 4M54A 2PZLA 3W6ZA 3RWBA 1A5ZA 3JD3A 4PLTA 4CV3A 2YZ7A 4GBJA 1EUDA 4ZU3A 5HWSA 2DKNA 2C29D 5BNFA 1NTOA 4J4TA 1P3DA 1CQIA 4TZTA 2GUGA 3WQQA 2BRUA 2D5CA 3PPIA 4HY3A 3DZKA 4IUYA 1AHIA 4TWRA 5JYEA 1U8XX 4A7PA 1BDMA 2QRKA 1O0SA 3G0OA 4AJLA 4QFDA 4NHEA 4PLCA 1BHSA 1UP4A 6ADHA 4YBZA 2PGLA 2WD8A 3FR7A 1P33A 5TS3A 3DO5A 1Y8QB 4WK6A 4NZ9A 3JYQA 2C20A 4KUEA 3GR6A 3EVNA 2FR1A 4AJ2A 3WJ7A 2JAPA 4Y9DA 1VM6A 2B36A 3QVTA 4I9UA 1S7CA 1C0PA 3PYLA 5L7YA 1PJ2A 4B8WA 1DEHA 2JCXA 4GLLA 2DFVA 3EZYA 3IC5A 1U2GA 2NNLD 2LDXA 5TJ9A 1BDBA 2VZ9A 3U4CA 5KJFA 3PTZA 1KVSA 2FR0A 3RC2A 3U4HA 3MJ4A 1K2WA 1BVRA 4ZJUA 1KY4A 3JQAA 4BO9A 3QQPA 4DMMA 1PZGA 1CERA 1P0FA 3WSWA 4CMHA 1MUUA 3EDMA 3STHA 4WECA 3S2IA 3W4KA 3L77A 3IJRA 3ZWVA 1NFRA 2NQ8A 2DTXA 4TROA 2X6TA 2ZB3A 1EBFA 2Y1EA 4MIYA 2X9GA 3QWIA 2YHIA 3ZU5A 3I9JA 1Z73A 4TRRA 1LRLA 1SBYA 1ULSA 3JD2A 1I36A 3KYCA 3LT2A 3PWKA 4FC6A 5EJ2A 1OBFO 4D46A 1AN9A 3EY4A 4B7CA 5K1SA 1DIBA 4GVLA 5T8KC 3S8MA 3ZW8A 2B4RO 1RKXA 2GO1A 1LI4A 1AXGA 1Y1PA 2PWZA 4LK3A 4UUOA 4XWYA 1E6EA 3Q0EA 3ABIA 4NPCA 1Q0LA 4JBIA 1MXFA 5DNAA 2VWGA 1H9AA 1I2ZA 1U5AA 3D7LA 4XB2A 1YKFA 2P9EA 1N2SA 1P44A 2PY6A 3ZV6A 5COQA 1Z75A 2E37A 2QYTA 2HJRA 4M1QA 5K6AA 3W8DA 3DTTA 1EFLA 1HYHA 1VKOA 4W99A 1SEPA 3WGGA 3WFIA 4EW6A 1GDHA 3BMQA 1N5DA 2P5YA 2Z1NA 4P4NA 4MVJP 1UZLA 4CMIA 4CUKA 1PGJA 4JBHA 4X54A 4D79A 2WYVA 4WPGA 1GPDG 2VWPA 3C8MA 4UUMA 3S2GA 3VOSA 2WEKA 3DWFA 5LDHA 2IYOA 2IE0A 3FHLA 1MFPA 1GD1O 4A27A 3MTGA 1C0KA 4E13A 5EQFA 1G6KA 5JNLA 4W6ZA 3D4OA 4FS3A 4XIYA 1WVGA 4PLZA 1PGQA 2HMTA 3TPCA 1R4MB 4QFCA 2NUAA 4IXWA 5BR7A 2IRWA 2FY8A 3BAZA 3ROMA 2P9GA 3ICPA 1GUFA 1UZNA 4BQRA 4CQMB 1UZMA 5JY6A 1GUYA 1VSUA 3CIFA 4IM7A 4R51A 4K28A 4CM4A 2FPGA 4MVJE 3CTMA 1S6YA 4CUZA 1HKUA 4XYBA 5CEEA 3TSCA 3LK7A 4QEDA 1OAAA 4BO6A 2ZCUA 5CDSA 3NT2A 4W9NC 2NU8A 5BQFA 4XYMA 5L3ZA 3RJ5A 3ROPA 3RSHA 2UDPA 1ONOA 5H82A 4D3FA 1ARZA 3TFQA 1HE5A 2DTEA 4XDZA 1Y5RA 4BNYA 4EITA 4WCFA 3NX4A 1SMKA 3ZGYA 1U7TA 1M6WA 3S2FA 5IXSA 1KYQA 3MZ0A 4XDYA 3IQDB 4XYGA 1NHWA 2CZCA 1Q7BA 4BKPA 3QWAA 4ND4A 4E5MA 5FI5A 4KDFA 3MCVA 4XYEA 3RU7A 1PJTA 2I9PA 3BMOA 4XRRA 3NGXA 5L51A 4JN6B 4QECA 2IXAA 5K0ZA 2JCYA 3WWZA 4UREA 3I3OA 4NFYA 4RVUA 1K89A 2WD7B 4NBVA 3GNSA 5B4VA 2HMVA 4Y98A 3GC6A 1SEVA 4WLEA 3WICA 3ZHBA 1UDAA 4EUHA 4JK3A 2POQX 3DZHA 3QE3A 2NM0A 1FDUA 1QV7A 2VNAA 4GAEA 2J3IA 2Q3EA 4BS9A 4MVJI 4D43A 4A03A 2EJVA 3PJFA 4RPHA 1FMCA 4RLSA 2PD3A 3ORFA 4ONEA 4FB5A 1NHGA 4YAEA 3AUSA 2Z95A 4RPGA 5C7IO 4DTIA 4EJ0A 3ZCXA 3QJ5A 2VCYA 3EYWA 2CY0A 5T64A 3K8ZA 4FFNA 5T57A 1SZJG 5ICSA 3VZRA 2NV6A 1SOWA 2JHGA 2A4KA 4F6LA 2PKRA 4MO2A 1D1TA 5AOVA 4WE3A 1V6AA 5HBRA 1I30A 5HA5A 3WIDA 3G49A 4BNGA 3TFOA 3AUUA 4IQGA 1ADGA 4TVBA 1UXGA 4IZHA 5CHEA 1J5PA 4Y8VA 1Z7EA 1LXCA 5JAIA 3DHYA 3EZLA 2Q2WA 1DLJA 3PWSA 4KQWA 1YB1A 4OKNA 2OUIA 4PLYA 2VRBA 3H9EO 2BFMA 1MG0A 1V35A 3B1KA 3F1KA 1XHLA 1GY8A 5B1YA 3K6JA 1HXHA 1ZO8A 4CM9A 5LDGA 1F17A 2HDHA 2HK8A 1TXGA 4B4OA 4CV1A 2V65A 1SPXA 1T1SA 1PQWA 3JD4A 4ND2A 2JD2A 4CPDA 4K6CA 1KY5A 2VYNA 5L4LA 4XQ9A 1JDJA 1WAMA 3BHIA 4OXKA 1RYDA 3PHIA 4E3ZA 1T2FA 4E2ZA 4CLDA 4H7PA 3ONDA 4WASA 5B4TA 2RAFA 2V6GA 2CUKA 3ETGA 2WMDA 2DVMA 4U6QA 2CVQA 5GZ1A 3E6AA 4FC7A 4FW8A 3E03A 1QLHA 1XA0A 5HS4A 2FSVA 2I67A 1DIGA 3NDJA 2JFFA 3PWZA 1DIAA 4TRMA 4BUCA 2NU6A 4EJ6A 1DHRA 1ZIDA 1E7RA 4B8ZA 3DZBA 4WCFC 4E6PA 1E7MA 4P38A 1MG5A 1DFIA 4NK5A 3OIGA 4L4RA 5F21A 4MPDA 3PHLA 4J1QA 5KJ1A 2NTJA 5IF3A 1YQDA 1ZEJA 3DC2A 1ZK4A 2UV8A 2FZEA 1AGNA 3GK3A 2Q99A 3U4IA 3P5SA 3F1LA 1KVTA 1EFKA 3R1IA 4BO7A 1ZUD1 2R2GA 1ID1A 1DDOA 1H6AA 3QVSA 1YH3A 1HYEA 1VRWA 3V5NA 3L6EA 2D4AA 3KTDA 2NTNA 1GTMA 3ZWMA 2OOSA 6LDHA 3INRA 4AJ1A 3ZWNA 3UCFA 1DXYA 2O4UX 3HDYA 2ZTUA 3JQEA 2CSUA 2J3JA 1LTHR 4DGSA 5JO0A 2AE1A 1WDMA 2X8LA 1NWCA 3E9MA 4U0JA 3N74A 4XKJA 2QZZA 3WYBA 3IL2A 2CDAA 5CDUA 1PJCA 4UEJA 4XYLA 4RLHA 3GFGA 1ISJA 3O8QA 4RVGA 4PZDA 5U1PA 5ITVA 2GZ1A 3L9WA 3HNPA 4JNKA 1N1EA 4XGIA 2GASA 1Y81A 4R5MA 2ET6A 3WX0A 3I4FA 3TZQA 4ZRMA 2EW2A 2PD6A 4L73A 3HDJA 2EG9A 3WLFA 4N5NA 1QXSA 4BKUA 5EIOA 2CDCA 1E3WA 4ZQBA 4LCEA 1ZKMA 1I01A 3L6DA 1PEDA 2QIOA 4YEDA 3IS3A 1SOVA 5JC1A 4J90A 5AYVA 1ENYA 3H5NA 3GOHA 4RO0A 5TSDA 1PS0A 3QW2A 3EC7A 2O3RA 4H15A 2VUUA 2IXBA 5KVCA 1NQ5A 2Z1MA 4DQVA 2OP1A 1T26A 3OBBA 3PZRA 4CR8A 1LNQA 1LSUA 5JE8A 5KNLA 4MINA 5TGDA 5ITWA 5JPIA 2LDBA 3W4JA 3ZWYA 4J0EA 4F3YA 1FDWA 4R5HA 1FJHA 3Q11A 3DR3A 4KUHA 5TT1A 1XQ6A 3GVIA 4QSMA 4I8XA 3KYDB 4R3NA 3RU9A 1GCUA 4Z9XA 4IIVA 3UF0A 3KRTA 1TT7A 3RFVA 2GN8A 1Y8RB 2JL1A 4XA8A 4L8VA 1L7EA 5IZCC 1A4IA 3GNTA 3CH6A 1DLIA 2J5KA 4BNKA 2JFGA 4O63O 5JDCA 1VSVA 4AVYA 4DQUA 3ZH2A 3RUEA 2PKQP 4CMKA 3I9KA 1NVTA 3F3SA 3TWOA 2A94A 1WWKA 3K2EA 4NJMB 3H3JA 3JQCA 3GQVA 1UDCA 3ONEA 5C3MA 3LQFA 2Q2VA 2EEZA 4OKIA 2D1YA 3B1JA 3KEOA 4FSHA 1GEGA 1R0SA 4MKZA 1ENZA 5K9ZA 1KC3A 3H5AA 3V1TC 4AJIA 5MDHA 3OECA 3OH8A 4YB8A 4B3JA 5KKCA 4Z9YA 2P2SA 2X0IA 1W8DA 3HDHA 3WR5A 1HF3A 4E5YA 4HX5A 1QYWA 1W73A 1E7WA 3R3JA 3VDRA 4RL6A 1DB3A 3BTVA 5B37A 5CDTA 2Y0EA 1Y9AA 5DDIP 4A2CA 1EEHA 4CLRA 1VLLA 4KOAA 4GPD1 3PQEA 3ADOA 4TMFA 5LC1A 3JQGA 4NBRA 5EINA 1C1XB 5BSFA 4KWIA 3LT1A 3QWFA 4JX8A 2PZMA 4YJHB 3GHHA 3A14A 1IB6A 1BXZA 3EW7A 1P1FA 3JYPA 3VZQA 3DXFA 3PIDA 1QP8A 3K73O 1R66A 5CEFA 1I33A 4E2XA 1BXGB 1JAXA 2J5QA 3I4CA 3E48A 5A5EA 3EGOA 1O6ZA 1LRKA 3GZNA 3ANMA 4P4GA 4F45A 1EE2A 2B69A 3WXBA 3AOEC 3SC6A 2V7PA 5IZ4A 3PDJA 4WLVA 3A4VA 2BGKA 1IHXA 4BNTA 2PGJA 2PV7A 1LDBA 2B35A 3COSA 4O1MA 4WLFA 3PK0A 1HETA 3GUCA 1LA2A 4HKTA 4ZQGA 4YDRA 1MFZA 4OQYA 4BO1A 1IE3A 3OJOA 1HSOA 1LX6A 4UVGA 5HTOA 2ZK7A 3FNEA 1WZIA 2OO5A 5TIIA 3OQ1A 3JQBA 3G79A 1VC2A 3NV9A 3I9OA 1E77A 3DB2A 3PHJA 3AK4A 4LW8A 3DBLB 3S55A 3UAGA 5F3RA 2A92A 4R41A 4IDAA 4ND3A 3KEQA 1W4ZA 2E49A 1YE3A 3F46A 3JTMA 2B5VA 3MJSA 3BXXA 3C7DB 2E82A 4NQZA 2FR8A 4PGFA 2PZJA 1VL6A 4AJOA 4CLOA 1PR3A 4BGVA 1SNYA 3RKUA 3DAGA 3AU9A 4IY1A 4EI2A 4GGOA 5CG2A 2X0JA 3KUXA 4BMNA 4YQZA 2AQIA 1K6JA 4R3WA 1P31A 4XX0A 1CDOA 4KMSA 1TLTA 2BD0A 2CDBA 4OOEA 5G0WA 4WNCA 3I6IA 1T24A 4CM6A 2CMDA 4GX2A 1YVEI 3FCOA 5F1PA 3K96A 4B4WA 4C7KA 1YJ8A 3KHUA 4GH5A 1B14A 5JDCC 1PS8A 2J3KA 1T4DA 4PZCA 4BNVA 1H6CA 3DMYA 3F47A 3KVOA 5COAA 4AL4A 4CQMD 3TN7A 4R4JA 1QSGA 1P1IA 2YDXA 1HSZA 5FYDA 4YJGB 1B8PA 1LQTA 4OIMA 5DULA 2ILTA 3SJ7A 3TOZA 1E7SA 5JMWA 1ZH8A 3JQ6A 3SVTA 5DBFA 2W2KA 2Y99A 1J49A 2BI7A 1ULUA 1PU2A 3WGZA 3QSGA 4CMEC 3OJFA 2VUTA 4Z3KA 5ES3A 3GVXA 2C5EA 3RI3A 2O3QA 3Q1LA 3QVXA 1DOHA 3GDFA 3MTJA 2V6BA 3DDNA 3NT4A 4QX6A 4Q3DA 3TNLA 3L4SO 4JLWA 3T4XA 3ZNQA 4JROA 2HK7A 4DYDA 3WJAA 4I5DA 4CUJA 4E4YA 3GMDA 4WJZA 2B5WA 5THKA 3VH2A 3RAJA 2GERA 4FJ2A 5CDGA 3A9WA 3M1LA 2P91A 3PI7A 3RD5A 3VH1A 1X1EA 2AEFA 5AVOA 2WDZA 1F12A 3SJUA 4YTEA 1YL5A 3BMNA 3FBGA 4NBTA 4XJSA 2Q1UA 2AG8A 4L75A 3VHRA 5BSEA 2D0IA 3GH3A 3IP3A 5JYDA 3BA1A 2JD0A 4ZD6A 5A5FA 1TT5A 2HCTA 1IY8A 4TZKA 5JDIC 5L45A 3PFFA 3V2GA 4BO4A 1O89A 2BI8A 3KETA 3AI2A 5KJ6A 1E1NA 1FDSA 3LLVA 4PG6A 2GN9A 1EDZA 1GYRA 4Z0TA 3RUCA 4RDHA 1GL3A 4DMLA 3JD1A 3PQDA 3GRPA 4HNGA 1R6DA 1X13A 1ZJYA 4FN4A 4BVAA 5BNIA 3E5MA 2CNBA 3U9LA 3JQ8A 4PG4A 4J49A 5G4KA 5JC8A 5L9AA 5JSFA 4MVJM 2W8ZA 1KEPA 2EERA 2WYWA 2DBZA 2NACA 5A1TA 1EUCA 5CEJA 4BL5A 4IGFA 5DF1A 4W4TA 4DXHA 5IXYA 2WE8A 3B20A 1XR3A 4Z3DA 2YHIB 1MP0A 3VVCA 4QO8A 3VZSA 3ANNA 4ID9A 4R1TA 4EGFA 1Q0HA 2O3SA 3AM5A 1JTVA 1V0JA 3R6DA 1HE3A 4B3IA 2C2XA 4IGEA 3NEPX 3WQSB 5ADHA 2SCUA 4ALIA 2Y05A 4CMJA 3AOGA 3VPFA 1BTOA 3BIOA 3PGXA 4MIOA 1UAGA 2AEMA 4LMPA 4PVCA 4TQGA 5FF9A 3HJAA 5JFOA 2X0NA 2EXXA 3W6UA 4W9NA 1DBVO 4CV0A 4PRLA 2PKQO 2BGLA 1ENPA 1R37A 2WWRA 4MKRA 1JU9A 3ZDFA 5T6BA 3WNQA 3CINA 3GFBA 1XSEA 4ESOA 1YL6A 2YV2A 2GLXA 1ZK2A 3FWZA 4L76A 4EBFA 4RVDA 3L07A 1DIRA 2I65A 3RQSA 2W4QA 1PJLA 3TZ6A 2CD9A 3IOYA 1JVBA 5JY1A 3ROQA 1GR0A 1PX0A 5G0UA 4J7UA 2YHUA 5JCXA 4E12A 2EV9A 3RROA 5U9CA 1QV6A 3G3EA 1SC6A 3DFUA 2JCVA 3ASVA 1YOVB 2X5KO 4IJVA 1HDGO 4DWVA 5KJCA 3AU8A 4LVCA 1YDEA 5DBGA 1AE1A 1ZMOA 1EVIA 5A9SA 4N5MA 3UW3A 3DZGA 1NPYA 4CM4B 4FBGA 1FXSA 2AG5A 3RUFA 3P2OA 5I8WA 5AQ1A 2ZTLA 4LVUA 5FEUA 4EEXA 5JAMA 1CETA 2PD4A 3CXRA 1EQUA 2C0CA 2NTVA 4R1SA 1U2DA 1PL6A 3Q9UA 1NQTA 4JGBA 3I52A 4BGEA 1I2CA 5A05A 4YR9A 5A4DA 1PSDA 5G0VA 3VAZA 4OGWA 1N8KA 1SB8A 3S2EA 1YL7A 1BXKA 1GFSA 3IAHA 4Q39A 5IAAA 4UUPA 3GPIA 3LU1A 4BMSA 3VKVA 2GF2A 2R00C 2VRCD 1NM5A 1UAYA 3RUDA 1W6UA 4I08A 1N7HA 3EAGA 3ZN2A 1I2BA 4WLNA 1HZZA 1EK6A 4Q3AA 4IMRA 5HS6A 2VZ0A 3D4NA 1HL3A 3AM4A 2A35A 4R01A 2DBVO 2O4CA 4HUJA 4E2WA 2Q1WA 4CLXA 4UVEA 2VTEA 1HDYA 4J7XA 2I99A 4WOJA 5BSGA 4CM8B 1U4SA 3GVPA 3H2SA 3PEFA 4YAKA 2OGUA 1B3RA 5T67A 3SEFA 4J1TA 2YV3A 3GA0A 4BIIA 3PRJA 1U3VA 3L6OO 4YA6A 1ADBA 1Y8QA 2CVOA 3DBHA 1G0NA 2GD1O 3TQHA 3UHAA 2H6EA 1UXJA 4LRTB 3ONFA 4ZQEA 4YT8A 2Y1GA 1IHYA 4WKGA 9LDTA 4FR5A 4UVHA 3U4DA 4DUPA 1B2LA 3T4EA 4II3A 5TT0A 3DFZA 5F1OA 2A9FA 1GQYA 3ZV4A 2GCGA 3H4VA 4NBWA 4UVIA 1XIVA 2BH9A 3GGGA 1EK5A 1KC1A 4OOFA 3GN2A 2I76A 1PJSA 3GVCA 2YW9A 5EESA 4GWKA 2XOXA 4QUKA 3U49A 2J8ZA 2I5PO 4M87A 1A7KA 4U0KA 2D3TA 4CR7A 4D44A 2C54A 1U9JA 4YPOA 4JXKA 2ZJ1A 4E5PA 4M49A 2B0JA 4Q3CA 4D3DA 4BNMA 4PLVA 4E31A 4E5NA 4YRBA 5L53A 1A71A 3OFSA 4IDEA 1A72A 3LT0A 4KTTE 2UYYA 4K9DA 1JN0A 4PCVA 4ALNA 1WXDA 3PGJA 4EYEA 4JIGA 3U0BA 1NYTA 3OIDA 2AQ8A 4PFJA 4YYZA 2G0TA 3K2BA 4WLOA 5DOVA 4J4BA 1TEHA 5ILGA 5EERA 1WDLA 1YDWA 3ASUA 4LN1A 4YWJA 1X15A 1I3MA 2J6IA 4B4VA 3VH3A 3AY6A 3EMKA 2ZYAA 1NQAO 3DZFA 2NVBA 4I1IA 4BO3A 1BRMA 1OC2A 4G65A 4M86A 1RWBA 2HQ1A 4K6FA 3WGYA 4P8RA 4R1NA 1LDGA 3M6IA 2IEBA 4LMRA 1E6WA 4EUFA 3HFSA 1R0KA 4DQXA 3VDQA 1KOLA 2P4QA 5TQVA 4CR6A 2VQ3A 3HQ4O 3DBRB 1UP6A 3TOXA 4AJNA 5A03A 3NJ8A 2YDYA 2Q1SA 3X2FA 4E2YA 1NFQA 1EBUA 2Y93A 3GY0A 2HMSA 3QP9A 3RUIA 2XXBA 1Q0QA 3HHPA 1QG6A 3ZWBA 2J5RA 1DC6A 1Q1NA 4DIBA 1L7DA 1NPTO 1YWGO 4NIMA 2Y1DA 2VWQA 4R54A 1E1MA 4BO0A 5IDYA 4GX5A 4CQMA 2OBNA 2EKLA 3FPCA 5IFLA 2WTBA 1P1RA 4ND1A 3L0DA 3OJLA 4J2HA 3CPSA 4YT5A 4CL8A 2Y0CA 1UP7A 1U3WA 1JAYA 3WQRA 1YGYA 3K5PA 3WNVA 1QYCA 4RF2A 1SCUA 2C59A 2YJZA 1OMOA 3FWNA 3H9QA 3NDIA 4DLBA 2X0RA 1CWUA 3OICA 4PLGA 3V2HA 1ZW1A 3SC4A 2YFQA 1HDOA 5ER6A 1UR5A 1T2DA 1ORRA 3F5SA 3HUDA 2X1HA 4N7RA 3RC9A 5A02A 5IZCA 3WGIA 1HDCA 4DBZA 4DC0A 1R15A 3H2ZA 2B37A 3FNGA 2FRDA 1LEHA 3GT0A 5L4SA 4AJHA 2PTGA 3ZHXA 4J9VA 4XQGA 2IODA 4DC1A 1HE4A 1V3UA 1FK8A 3G1UA 1M6HA 3DOJA 2WD7A 2FP4A 3PQFA 1HDXA 2HJSA 4E30A 3ZWPA 4XZ3A 1O5IA 1CJCA 1I3KA 2G5CA 3TZCA 3MWEB 1O94A 1LDMA 1LLUA 4MIEA 4KQXA 3RASA 2H9IA 1DFGA 3E18A 4NJOA 2GDZA 3F4BA 1E5QA 4EJMA 3MJTA 5IG2A 4MVJG 3MJCA 2GZ2A 4XGKA 4R9SA 2VHZA 3ENKA 3UN1A 2HUNA 2O2SA 2AW5A 3PHGA 4BKQA 1GQ2A 1FDTA 4ZHSA 4ZRNA 2EJWA 2AMFA 2C7GA 4A0SA 2YQ5A 1TA4A 4GQAA 4WOKA 2NQTA 4NI5A 2HAEA 2Q4BA 2X4GA 1GCOA 1L1FA 4XRGA 4FFOA 3OP4A 5T5QA 4CODB 1XG5A 2VT3A 4O6VA 2HK9A 3Q3CA 1B3BA 3DZJA 4IQ8A 3UCXA 3IKTA 1I0ZA 3GGOA 4R1UA 3WTCA 2ZTMA 1P45A 1H6DA 4KUGA 1YONA 2Q4EA 3D3EA 1T25A 3PZBA 4ALKA 2NVWA 3AOEA 5KWEA 5G0TA 1GADO 4NFHA 1BVUA 1XGKA 1GEEA 3B70A 3NUGA 3U62A 1EZ4A 3RBZA 3A28A 5AXAA 3WBBA 1P9LA 4RQTA 4UEOA 2H5LA 2I66A 1ENOA 1NNUA 4Q3EA 4F6CA 4YXFA 1RJWA 1JQBA 2C5AA 2QQ5A 4CLHA 4IS2A 3D1LA 1HLPA 4LCJA 3D5TA 3OMLA 3C1AA 3TJRA 1VE9A 4MVJD 4IJKA 4UEKA 2W2LD 4AJJA 5TRTA 5I7VA 2R6JA 3W1VA 2WJPA 2X86A 3DL2A 1B8UA 4AFNA 3ZWCA 3CSDA 4GKVA 1N9GB 4BHTA 5U4QA 1GAEO 1RM5A 4RJTA 3JQ7B 3CMMA 4AG3A 3UXYA 1QORA 1IPEA 1C1DB 2CFCA 3INTA 1HYGA 1EDOA 5KVQA 4Z6KA 1QLJA 1MLDA 2BKAA 4NK4A 5A9TA 1EVYA 4BV9A 1JLLA 2ZQZA 2D5AA 1ZBQA 3RIHA 1U8FO 2O3TA 4FPXA 3GZNB 5CG1A 3CZRA 4NR0A 1TB4A 3FNFA 4I9HA 1HDZA 8LDHA 3W4IA 4YRAA 4RF4A 4B4UA 3OEWA 3WG9A 3BMCB 1JWAB 4XQCA 4URFA 3N58A 5GMOA 1GPJA 3KSDO 3MJEA 4WNIA 1YB4A 1BW9A 5J23A 3CEAA 1DJNA 4J0FA 4R69A 1PQUA 1PS9A 4TRJA 5JCJD 1PQPA 4OQZA 2G17A 4LGVA 4YAJA 4B79A 3AI3A 3UGKA 1HT0A 3I6QA 2VRCA 2NVUB 3ZV5A 2BF7A 4CV2A 4WEOA 1C14A 3SLGA 4U8GA 5C7OO 1G0OA 1DO8A 4CMEA 4M55A 1Y9EA 1WW8A 5CPBA 3DHNA 1RYEA 3DOOA 2B83A 4BO8A 2YYYA 3F5QA 3LC7O 3GN1A 2DBQA 1NR1A 2VHWA 1I10A 3D0OA 3FRJA 1CEQA 1B15A 2GN4A 4XB1A 1A9ZA 1WPQA 3PXXA 5ENDA 3P2YA 2EWMA 2HRBA 1I3LA 3TZKA 2BHLA 2DUWA 1JA9A 1H93A 4HBGA 4J43A 9LDBA 4CQLA 1U4OA 2VUSA 1P1HA 5I7EA 5IDQA 1U28A 1C0IA 1LQUA 2JKVA 4GI2A 3O4RA 5EMHA 3AY3A 4FDAA 5TF4A 4Z0PA 1ONNA 4QT0A 3KYBA 4IMPA 1D4FA 1HEUA 2GSDA 2P68A 4TKLA 1AUPA 3C7AA 3WGQA 5JDIA 3HB4X 1TVEA 3LYLA 3EHEA 5ICMA 1KIFA 2AHRA 3GEGA 3P7MA 4D0RA 2Q1TA 2WYUA 3RBVA 3NYWA 1ISGA 4J16A 3GHYA 3IKVA 4GKBA 4PG5A 5JBIA 2C7VA 2BMAA 4JBGA 3O9ZA 1VL8A 2Y1OA 1PR9A 4O59O 1UH5A 2D59A 4MOWA 2O7QA 2WSBA 3V1YA 1FF9A 1LU9A 1FDVA 5A3VA 4DVJA 1E1LA 3KYDA 2ZCVA 3LZ6A 4OSOA 3KLPX 1UXHA 4YJFB 1ML3A 1Y8RA 1H2HA 4Y6RA 3RJ9A 3VVBA 1MXHA 3WMWA 1K0UA 2QRLA 4NG5A 4GL4A 5FFFA 1OZAA 3B6ZA 3AY7A 4U7WA 4A73A 4NJMA 4AJEA 5C37A 1Z74A 2EP5A 1G1AA 3C1TA 5KKAA 1DRVA 2JFHA 3SLKA 3UICA 1KS9A 1IZ9A 4D0SA 2HMUA 1BMDA 1T2AA 1VI2A 1AHHA 1TT5B 2VHYA 3ZWWA 3OQ6A 3GG2A 4RF5A 2ZQYA 2JJYA 1BSVA 1HDRA 1ZSNA 4D41A 2FZWA 1PL8A 1Y5MA 2OORA 4N18A 4C4OA 2DTDA 4EEZA 4ZICA 2PK3A 2AQHA 2BGMA 1HTBA 2O2YA 1NWHA 3ICCA 1XEAA 3K92A 2GPTA 5DN9A 1ZK0A 1XELA 3WDSA 2XXJA 5DOZA 1C1XA 2NLOA 2QHXA 2ZTVA 5L95A 5TNXA 4IQ0A 1DAOA 4YJHA 3ZWOA 3ETEA 3MOIA 4BB6A 3NKLA 1R4NA 1WZEA 1C0LA 2WE7A 1O8CA 4W7HA 1BXGA 2BFOA 3WGOA 1PJ4A 1E92A 4GX0A 4PLFA 2EGHA 2ZB4A 3I9MA 3T7CA 4D7AA 2DU8A 1ZCJA 1WMBA 4BNNA 2AEJA 1ZFNA 4Y67A 3HADA 3HWRA 2PH5A 4RZHA 2X7HA 4RF3A 3FD8A 3LC1O 2HLPA 4BNUA 2UUPA 4DIFA 1PJQA 7ADHA 2ZB7A 1ISMA 1ZJZA 3H9GA 3NTOA 4YRDA 3VPGA 5DBIA 3DHEA 3OF2A 5G4LA 1Z6ZA 3W8EA 4BGUA 2YV1A 2Q50A 2Q45A 3GEDA 3QRWA 1LDEA 4UUNA 3RC7A 1X0XA 3FR8A 1VKNA 3NTQA 4TVOA 4YCAA 4CM5A 5CFZA 3CMCO 1JKFA 4CM7A 3QA9A 4BNWA 3JQFC 1JVSA 1E3SA 1MGOA 4YQYA 4CM3A 5IN4A 1LDYA 2EHDA 1P1KA 4HP8A 3PFWO 1EQ2A 2R00A 4A26A 5DZSA 1YS4A 1SO8A 5HRUA 3H5RA 3NRCA 1YBAA 1M75A 1RM3A 3O03A 4L4SA 4ALLA 3FTNA 3U3XA 4H16A 4XIJA 3HB5X 5EQDA 3BYZA 3AI1A 3LVFO 3QIVA 2HO5A 3QLJA 3HDQA 4ROSA 3V8BA 3W8FA 3GMSA 4PG7A 2J3HA 5H83A 1X7GA 3AJRA 3HZZA 3JQAB 4DL9A 3JYLA 5I7FA 4RPJA 2O23A 2V6MA 3PDUA 5CPFA 3S1LA 1Q7CA 1KEUA 2BFAA 4RGBA 3JQ9C 1X14A 3B1FA 4I9NA 4TKMA 4WCDA 5ER9A 3WGTA 1SB9A 3GNQA 4RPKA 3RUAA 3ITKA 4IDCA 2FOIA 2NU9A 5KCZA 2C82A 5JMPA 4EUEA 3VKUA 4EZBA 1Y6JA 3R3SA 3JSAA 5FWNA 4RDIA 1V3VA 4FD3A 3KYCB 5I8ZA 1N7GA 2AXQA 4GVXA 3LF1A 1KVUA 3CE6A 1BWSA 1C3VA 1E6UA 1GV0A 1MX3A 4OAQA 4YJGA 4CMCA 1PJBA 1D3AA 1X7DA 1QR6A 1YJQA 4BNFA 4GSKA 1E3IA 4IDDA 3I83A 4Q3NA 3UCEA 3GRKA 1E3LA 1PGPA 1NQOA 3JQDA 3GG9A 1KVQA 3BMQB 5I7SA 4IXTA 3UFXA 3ZU2A 1NFFA 1LUAA 3BZUA 5B12A 2C2YA 2X9NA 4CMIB 3JD0A 1T2EA 2RHCA 3H6KA 4ZA2A 4DLAA 1OOEA 4NNJA 3D64A 5C5IA 4Q9NA 4N5LA 2DPGA 3OM9A 1SAYA 3WB9A 4L4XA 4BO2A 1XCBA 4W82A 4ZN6A 1ADFA 4BO5A 3DBHB 3MJVA 4GWGA 1ZEMA 4MVJA 5FI3A 3OJ0A 3PHHA 5HM8A 2W2LA 1F8FA 3AW9A 4RORA 2VYVD 3ADPA 5MGBA 1I24A 4P22A 2DLDA 2HSDA 3MEQA 1XDWA 3F4LA 4CMGA 5EPOA 1GZ4A 1DJQA 3M2TA 4RVHA 4WUVA 3ROKA 4OSPA 4O0LA 3E9NA 1YBVA 4J3FA 2Y68A 3RCBA 1DFHA 3GGPA 3LSYA 2G1UA 2PA3A 4BKOA 2EW8A 3IP1A 4DYVA 3U5TA 3AUTA 1GUZA 2UVDA 4NFSA 4NU6A 2TMDA 2FHSA 3VPXA 3WTBA 1LSJA 4DPLA 3DBVO 4IZIA 4CMAA 3D3WA 3D5QA 2QYSA 5G2OA 4M89A 1R0LA 4FOOA 4WCFB 1P74A 1J0XO 5G0SA 3LDHA 1VJ1A 1XWFA 4OXYA 1XLTA 4XQEA 4PG8A 2VZ8A 1HE2A 1NP3A 4HFMA 5IDXA 3NT5A 3C3XA 5DCUA 1KVRA 5KOIA 1E7YA 1QMGA 4MP6A 2X58A 4K1LA 5JCJA 3BMOB 1JKJA 3MWDB 1PZEA 3I5MA 1A7AA 1A27A 1QKIA 2I3AA 4J2OA 1YXMA 3H7AA 1LC0A 1XYGA 4U5QA 1NXQA 2DBRA 2PR2A 4XD2A 4BNLA 2BELA 2O48X 3PIIA 4ALMA 5GZ6A 2GGSA 3AFMA 5LCXA 4ZVVA 3ZNNA 3L4BC 2ZATA 2FN7A 1N1GA 1NVGA 7MDHA 1D1SA 5JAZA 1HWYA 1D7OA 4JJIA 2DFDA 2NSDA 2OL4A 3HN2A 4U6SA 4RQUA 4J1NA 2XAAA 3ZWXA 1LLQA 4S3MA 3WMXA 2O7SA 3I9NA 1NPDA
chains in the Genus database with same CATH superfamily
4WD3A 3MJDA 3MMPA 5GJBA 1KJZA 2Z5LA 3WMGA 4I19A 1GDDA 5JCOC 1A82A 1X1SA 3SHQA 5FA6A 4OFWA 2BC9A 3SF0A 2ISQA 4J7CA 2H51A 1FVFA 2E2WA 3OQBA 3TF5A 1DV2A 3WRXC 4MI9A 5IUNC 5JYCA 3UC9A 1POXA 1XZEA 4F6RB 2PCJA 3Q2KA 3LOPA 5BVHA 2WSSA 1EUZA 4WKBA 5FBLB 4C7JA 3V3KA 4OJNA 4OK6A 3ICEA 3AJEA 4AS3A 2Y67A 2ZANA 1QQBA 2E1RA 3PLNA 2IZ7A 4U2KA 5EGNA 3UOGA 1Z0UA 1ZUWA 4LTMA 2QZPA 5EIXA 4PYIA 4F84A 3DLIA 1A8UA 4IDGA 4L50A 2PR7A 4TXJA 1I80A 2EARA 3TVYA 1BROA 1NX6A 1PR2A 1YRLA 5HMLA 2G72A 2AUNA 2FUG6 5AOCA 3IE1A 1CUSA 4UW9A 3ZD7A 1R8XA 5L3RA 5BO5A 4OUDB 4E46A 4IICA 3FW1A 3GRZA 5FPPA 3VHQA 2GT1A 2AZXA 1Z83A 4AYXA 2NYAA 4DQ0A 5M5BA 3LKBA 1RWPA 4OBEA 1OAKA 2FWIA 5LLTA 1QGOA 2NU7A 5H3LA 2BFDA 2FV8A 1G41A 5KYVA 1PJ8A 3S7ZA 3RVOA 4JR1A 2MSWA 1XDUA 4UEOA 3T7IA 1QVWA 1T0UA 1OY1A 3QKRB 4E33A 2OCIA 1NN0A 3AX6A 3I9LA 2YMQA 1LKZA 1ISSA 1X1TA 2VWHA 4H3HB 2BIFA 2F9FA 2C7PA 3SQXA 2A88A 5B3AA 2A33A 2FHPA 2Y66A 1QHSA 1KI4A 5LM3A 2VHXA 1M0EA 1FLAA 4CKWB 4LWQA 3K4HA 1XO1A 1F9EA 1MRSA 2V59A 3MAJA 4HH0A 4JI0B 3C1OA 2EGGA 1M2VB 3EWAA 3G0CA 3OCUA 2XY4A 4HXGA 3GUZA 3ORYA 4L78A 3ELUA 5BT8A 4NXMB 3N2ZB 3KHTA 4IIJF 1ZLXA 3P9SA 4XUEA 2IYSA 3HJTA 3F7NA 5EIEA 1TTHA 4Z4EA 2XR1A 4REOA 1YVDA 4FJ1A 1LLDA 4FMCB 3GAZA 3T1OA 2V3WA 1DC4A 3K9BA 4P3OA 3FTDA 1B76A 1GPYA 1ZJ4A 3NBKA 4CM8A 4L95C 4Z4FA 3VKHA 3DPUA 3A4YA 2VJCA 4RZXA 3VPBA 2FMUA 4K7JA 3MC1A 3EIQA 1Y1RA 3OZ7A 5GOTA 1QCCA 4A8JB 3T0FA 5JARA 3GF4A 1A9YA 1DHTA 1FRVA 1Y3CE 3EARA 5B1SA 2AEEA 4W7IA 3WB2A 4F5EA 1X80B 1JU4A 2OHIA 3LF2A 3RIEA 5JXWA 2D7JA 4W9MC 1V2HE 4WNAB 5DYTA 4MX8A 1NUHA 5JANA 4ZKEA 2HK6A 4G2NA 3RS8A 3AVUA 2P5SA 5FUBA 4OHRA 1R4ZA 4URXR 2FDRA 3H5LA 1VMKA 3KQNA 3L7KA 2J48A 3UYKA 3UT6A 3LVQE 3T5AA 5LLSA 2H4JA 3AY0A 3GEMA 3GGSA 1XMOB 3V6MA 4XUDA 1RWKA 3ZD8A 5C1BA 1I3NA 3LVRE 3PE6A 4LX8A 4BJ5A 4DV2B 2I1VB 2JD1A 5G3ZA 3EF3A 3RS4A 1IG3A 4GMXA 3COZA 4K26A 3I05A 2VOEA 1B7GO 3WDKA 4Y0VA 1O5TA 3HA7A 4WGGA 2Q0HA 2VG8A 2ONKA 2X22A 4HQLA 5KWVA 3HVRA 2BH2A 4X1OA 1T0HB 1Z33A 4OA8A 4O4JB 1PUJA 3K94A 3ESXA 4TLDA 2IBTA 1OT5A 1MC4A 4BNJA 1EIZA 1MB3A 2UZIR 1TNDA 1UMDA 5F7OA 3RWMB 5KUTA 1GU7A 5J1SB 4PCLA 2AWNA 3D43A 1V1JA 1V48A 3I23A 4DC9A 1NUSA 1H2BA 1T6ZA 4MRRA 4DAEA 2DH6A 4E6EA 2GWHA 5JH7B 1TMYA 3FOBA 3KOUA 1CUWA 1ZSVA 5SYMA 1SUWA 1V4BA 2ZI3A 4BBAA 1CFJA 3BHMA 3LPLA 3CZ4A 3P52A 1CJSA 2AR9A 1PGOA 2O2HA 1XMVA 4AZWA 1EUYA 5K8CA 3OX3A 4BV8A 5J58A 1KQGA 1Y6QA 1Z56C 2ENWA 2QU7A 2H31A 2UZ0A 3HJHA 1B6GA 4H18A 4KN6A 4Y9SA 1BGVA 4ZQHA 5F7ZA 4IQFA 4UTOA 4JCCA 4EF4A 3B60A 2O5EA 1T9AA 4C78A 1TA0A 5EKUA 5HIJA 1D5WA 5LP6A 3CPHA 1AKUA 3IUNA 1GNRA 3ON5A 3GLSA 1W5FA 3PG5A 3U09A 1IYZA 2RGUA 4ENVA 4HWSA 3QLUC 1DPGA 1KR2A 1P19A 3PDCA 3Q9NA 1H0RA 1XU7A 1GGEA 2B30A 4C88A 2OZVA 3HWWA 5IT5A 4RY9A 5HKOA 2FDCA 1COWD 1EVQA 3PCXA 5K0SA 3H2HA 2AF3C 2O50A 3EK2A 1ABFA 4B6GA 4JV5B 1SUDA 4F4HA 4B7UA 2NO6A 2PMCA 1CX9B 1GV1A 3K9NA 3V7NA 4DGQA 3KV3O 2BDUA 4B1FA 2W42A 9MHTA 4ER3A 3FVVA 5EUBA 3T5DA 3A36A 1RAHA 3NM5A 1CF4A 2WIDA 1F2TB 1Q57A 2OP0A 1DTWA 1SM4A 2CZGA 3HCRA 4MR8B 3DC7A 1GAWA 3R2JA 2P8SA 5JS2A 4QT4A 5KTRA 2OMKA 1R0WA 5HQTA 3FPFA 2Y76A 3W8NA 4BVGA 2X0EA 1FQJA 3JARB 4JP1A 5BN4A 3GZ4A 3A1NA 1YRHA 2XXAA 1KKMA 4QFMA 4DXAA 1EFRA 2XMQA 1XKQA 1ELOA 1SKYE 2H92A 1PR6A 3H8VA 1G55A 2QAGA 3JVIA 1JEEA 1XEWY 1FA9A 5M29A 2BGUA 3MTDA 1LCIA 3RSFA 2B2NA 4B31A 2OHHA 3TTWA 4ER0A 4KTVE 4O4IF 3GDWA 1MJGM 4MPPA 3QWBA 1H9BA 2XCLA 1PWXA 2GJ9A 1W6RA 3UATA 2VYCA 2EVWX 5K3SA 3D7SA 3OIFA 1M2OA 4MULA 5LZ8A 1QH8B 3PC8A 3VX4A 5BNTA 4C2TA 2G71A 3GFPA 2JGNA 4MJXA 4TYPA 2QVYX 5C8YF 1U0NA 1TJNA 1Q17A 5A06A 3TX2A 1NZDA 4UUBA 3GWGA 4O2AF 3DBOB 3KYBA 5ISMA 4KRGA 4OL9A 4AKIA 1VECA 5IANA 2YXBA 2FUKA 4MCAA 4BX9A 4LIPD 4E94A 3GO4A 3EVTA 1NF3A 1Y6GA 2V6FA 3VPHA 1PK8A 1AQJA 4M0DA 3T3IA 3K6SA 4Y6LA 2XPCA 3IDSA 3USZA 1AMOA 1YR7A 3E9CA 5KDLA 3AWDA 3IP6A 4KQMA 3VC3A 4YVFA 4BAZA 2XE6A 3E0QA 1N0UA 3F67A 4J7AA 1YZQA 4HEQA 5J4YA 1T9KA 1TYEB 3CW8X 3P2EA 3GVHA 2PRIA 4HLNA 2VOJA 2WWHA 1J0DA 1XTIA 3HN7A 5DHFA 2AJBA 4CQLB 3FWPA 4Q4JB 3W79A 1SXJA 3F4KA 3FA2A 4BRUA 3ROFA 5C4GB 1G9TA 3EXIB 3H1TA 5K0GA 3ANLA 2JFPA 2X8AA 2JK1A 3A6FA 1ZK1A 2F00A 3PSHA 2J7KA 1ADYA 2QVGA 3CX3A 1J8DA 3FPGA 4NOKA 5IBRA 4ALJA 5A9RA 2J6BA 4W5QA 2I55A 1R7RA 3DMTA 1V8FA 3D9QX 4IG4A 1JR3A 4INZA 1T6NA 3ABZA 4NU5A 1GNTA 2XODA 1VL1A 2BM8A 1S8FA 5IAKA 1RNLA 1V8BA 2CV2A 4Z4IA 2Q7XA 5LZ5A 2IJGX 1FNNA 4FLEA 4Z9FA 4BZPA 2DB3A 1ULHA 4M9QA 3JZDA 1Q3HA 3ED5A 4XIFA 3RKRA 5KEIA 4ZT2A 3SKYA 1ICEA 3MT9A 3C97A 3L7LA 2UUOA 2J0SA 3U56A 1DWUA 1FX0A 4J75A 4FX5A 1E63A 3QFHA 4EPXA 1TADA 4LF5B 3A0UA 5AW8A 1IJFA 4ML3A 3B52X 4ZT6A 4AUEA 4IMJB 4RDXA 1JHUA 4UTXA 5F9HA 1G5HA 3K30A 4DMCA 4PYQA 1P7YA 3PB3A 8AT1A 4BQPA 2JVKA 4KLCA 2IEDA 3MJRA 3CVXA 2E4AA 3U7FB 4LY3A 1WKBA 1PG2A 4ND5A 5EL0A 2XWSA 3WGHA 4DREA 2JAHA 4CIYA 3HFGA 4DS3A 1ZN7A 1IXZA 3L43A 4CTKA 1EVJA 5ED4A 1JDBC 1M2FA 1SCDA 1HNZB 1EGMB 2IZZA 3BXZA 3HKCA 3AKZA 3BFXA 3VTFA 4IDBA 3ET5A 3FCYA 3PFCA 3E1KA 4HAUA 2R5FA 2QM7A 1QYDA 5B58C 3GPBA 4CBVA 4JSRA 1RDFA 4BN0A 4O5AA 5JROA 3PXUA 3A4MA 4AQDA 4QPNA 4C7VA 1QCYA 5B4UA 4PAOA 4WK2B 4RCYA 5E4TA 3W6PA 3WYEA 4ZIRB 1YQGA 2ZR7A 2ORWA 2WKQA 4G23A 3V8VA 2RD2A 4X1YB 2AN9A 4OH7A 1ZDMA 2EKQA 4LRUA 2W2PA 1O7JA 1GRNA 2MSEB 1XV5A 1WBJB 3AR7A 3JQ7A 4CL0A 1L5ZA 3DEYX 3AVXA 4FZRA 4IFBA 4MV1A 3CA8A 3QVOA 3PEUA 1L5OA 4P92A 1J8QA 4FK8A 3AFNA 5A04A 2IYVA 4KV7A 3II6X 1I1QB 4Z9BA 4AUMA 1I5OA 2QRUA 3PRHA 3WLPA 4PPQA 4ALLA 2O3JA 2WT4A 3RUHA 4L9WA 3VR5A 3AH8A 1JHQA 1RBZA 1S3IA 1UBSB 3DOCA 4WN9B 2GK7A 1DRWA 5CYOA 1H3EA 2DSTA 1J00A 1V5FA 1DOAA 5IEBA 2H4WA 4NH0A 1GAJA 4BU0A 4PVDA 2WK1A 3GEHA 1U7DA 2P3OA 1W4CA 1Q0ZA 2Q5HA 1HLDA 1BGWA 3PYMA 3N87A 3KKKA 1HYQA 2IOYA 1AUVA 1PT5A 2GXQA 3RNLA 3ZZMA 2HZBA 5HM6A 2HKIA 5GZ3A 2VLBA 4XR9A 4ZHQA 9ATCA 4DCPA 2X5NA 4GYWA 5B1EA 1ESCA 1JW9B 4B3HA 1M8FA 4F9FA 2V7GA 1SHKA 2Q2NA 3GP5A 4RLQA 3PTLA 3BMNB 3WP0A 3SR4A 3E23A 2CVHA 1PIWA 3FTPA 4KP7A 5KYXB 2FG5A 2J9FA 2V96A 1IOLA 3B9BA 4NZYA 4OQ4A 5K3FA 5JHGB 1JR3E 2HCFA 4L0QA 4OHFA 1R3DA 3AF5A 4NICA 4AECA 1JFTA 5IVKA 2OZPA 2PO7A 3VPAA 5B2EA 3LIPA 4ZYTA 4V1CB 3SX0A 2O19A 3O2SB 3OE1A 2IDZA 3OA0A 4HWPA 4QJBA 3WSTA 2K2QB 3A0RB 3OEYA 5F5LA 2JIPA 3BCRA 1U8AA 3C85A 2HY7A 2N0SA 1OA0A 1JIUA 3QE2A 1TM4E 1TQDA 2WPDD 4P81A 5TQ2A 2GDJA 1BXRA 3V3TA 1Q12A 4HH3C 4U1RA 1WPRA 1XDZA 3BREA 3CRW1 5FOSA 4PYOA 1YA4A 4EA8A 1MA0A 3K31A 4GO1A 1EVZA 3E9DA 2POCA 4LISA 4K87A 1U0OC 2BM9A 5IHXA 1VJDA 4QXMA 4PRKA 4A2PA 1EXDA 1WBBA 1V71A 3MWGA 2G4LA 1UF9A 2HX1A 4IOMA 1HRDA 1LVGA 3RS9A 3UNXA 1LDNA 2QD5A 4R0VA 1P2FA 3G7SA 1W30A 1HOTA 2TMGA 1DC3A 3PJDA 4JR2A 4E7OA 1B16A 1GGNA 2XBMA 1NVKA 2IY8A 1XTUA 3JPWA 2B3TA 4EEKA 3MQFA 3O26A 1RFGE 4CN8A 2OCAA 3K0HA 5KMGA 2Z08A 2G40A 1G6OA 2Y1FA 3G5AA 2ZYGA 1AKNA 1GQQA 1WCIA 3G1TA 3NKVA 1KBOA 10MHA 4AX4A 4HDNB 4I4NA 1W1WA 4MDHA 4QU8A 1HFKA 4JLKA 1P9NA 1FQKA 4I55A 1SBHA 3W5CA 3NBZC 2DCMA 3V9PA 3U3JA 1G8YA 3LXRA 1A9RA 4IKPA 5H0IA 4TQ9A 4IH1A 3V55A 1P1CA 4Q15A 2W8BB 3ZE8A 1WUYA 3HUTA 4YJ3F 2X1VA 4IIUA 2P90A 2JEYA 4L22A 4LXXA 4AICA 3O8BA 4CM9D 1JR2A 2VJDA 2Z98A 5J59A 1MV8A 2GEUA 4A36A 4NOJA 4MLPA 1OPRA 1F06A 1UEIA 3CONA 2ECPA 1WM1A 2NADA 3D1VA 4NV3A 5HKLA 4AJ4A 1XC7A 2GR9A 2QI9C 4L74A 1UXKA 2QRHA 2VYND 4K9QA 3UPDA 4F06A 1I2DA 4BECA 5JS6A 5IS2A 3KB8A 3H4MA 2CXHA 1TEXA 3DTYA 3OQPA 3SP1A 2AMLA 3LCCA 4FZJA 1IBCA 4B84A 2QNIA 1V11B 1KETA 2D2IA 3FMIA 1V1MA 1ZUNB 1GFZA 2VJMB 4ZAGA 3MTIA 2P6MA 3PVZA 2ES4A 3CRMA 1M2JA 3SG0A 1KRWA 4B5LA 1U6KA 1X9HA 4HADA 4MP8A 3Q5DA 3B53X 4MDYA 4RESA 1LX7A 3EGXA 3JZAA 1HPLA 4ESHA 4ENSA 1TDJA 2GBCA 3LRTA 3MD0A 4UULA 2I22A 4X1IB 3UKOA 1SKAA 2EBFX 3Q3IA 2P6PA 1KGSA 3NDBB 2CF6A 2ZEJA 3O38A 3O84A 4HWGA 1N7IA 3LGXA 3FHCB 3TIVA 2NSYA 5T4HA 3RAPR 4CF6A 2Z9BA 5JCOA 5E7JA 2O8CA 1VLZA 2ATEA 3ZDYB 2WTAA 1WLYA 1T5BA 4BNXA 2H2IA 2HIHA 1BDIA 4R68A 3NH6A 2V5UA 3FI9A 2CJYA 3ZXSA 3U7QB 3W3AH 2ETVA 3ULKA 2G82A 2M1ZA 4I2VA 4OKSA 3KCNA 4HTFB 3WIUA 3GL9A 2AOTA 4CU2A 2QZJA 1P7PA 3DUFA 3EPLA 1RCTE 1II8A 2YN0A 1RM0A 3QYFA 1GOTA 1GPBA 1QFMA 1VE6A 4P82A 3W6ZA 3RWBA 1HT1E 4FB4A 5LQUA 2O0KA 2ZSBA 4R9VA 1JQEA 4CV3A 4LJ9A 3H3XA 1EUDA 4ZU3A 3JX9A 4COKA 4A92A 2R8OA 5J5CA 5BNFA 3UMMA 5J9FA 1XZQA 5CW2A 5CT4A 1CQIA 1IUNA 2F90A 4TZTA 2G77B 3IUBA 1Z4KA 2W5UA 2D5CA 1RAFA 3MCWA 4IUYA 2ZAOA 3OKCA 1JPUA 2OAQ1 4QGAA 2W2QA 5DNVA 5JT1A 2RHWA 4ED9A 4AJLA 4PLCA 4W9RA 2E4UA 2Q5JA 2WJZB 4S05A 3KAKA 3P9NA 4IHKA 4YBZA 3SYLA 4EG1A 3SVZA 2QLLA 1P33A 4X92A 4EO9A 3VYWA 4NYJR 1KSFX 3IOMA 1E3TA 3ZJVA 4JJ4A 2O8DB 1KIAA 1JG2A 4KUEA 1NJ8A 1QCZA 3K9WA 3NPAA 1AV7A 2QTMA 4UTNA 5CDFA 1JJIA 3ZBTA 4AJ2A 4X8OA 4OX9Y 3FSEA 3WJ7A 1NXOA 1S7CA 1C0PA 1M34A 2EFYA 2JI6A 3SGLA 4KO2S 4B8WA 4ENTA 5AQEA 1QB7A 3HYTA 4RAQA 3DL7A 3EZYA 3MCUA 4TLAA 3KVNA 1GGMA 5DTMA 2P5TB 4CG3A 1BDBA 5HSGA 2VTVA 4BDTA 3IA2A 1M7HA 1OBVA 2G0NA 4EKEA 3OUUA 4UJ5A 5CU7A 2F8SA 1W9HA 3K9GA 3MIZA 3RC2A 4INOA 4Z2AA 1XTBA 2JIZA 1EG2A 3F8SA 4I50F 4BEVA 4DMMA 4AZ0A 1C81A 3UAVA 1PR1A 2XEDA 2QJFA 4M1KA 1UBCA 1MUUA 3DD1A 3EWNA 3I0MA 3WL3A 1DARA 1GCGA 1SG0A 4WECA 3RH0A 3S2IA 4BTLA 2UXDB 1OWLA 2YXEA 1E1RA 3AZPA 4YRMA 3NC4A 2O8EB 2NQ8A 1CR6A 1YZVA 3S7TA 2DTXA 2WBLC 1YS1X 2XMBA 3Q12A 2Y1EA 2HMAA 2X9GA 3JQRA 4Y2TA 5DBOA 1XF9A 3WZLA 3FRIA 5HTKA 3NCHA 5I3ZA 3ZWKA 1YFJA 1LRLA 4GOXA 2XCUA 3V9AA 4XVUA 3BF7A 3G68A 3LT2A 5AM1A 5K20A 3DO8A 1RZ3A 1OBFO 1W35A 4HS9A 4RD1A 2SKDA 3EBLA 1D2GA 1RPTA 5T8KC 5C32A 4UUOA 1Y1PA 4BQNA 2P6OA 3KWLA 1E6EA 4H1TA 4XIGS 1K8QA 3PF9A 3BDVA 1MXFA 4H7DA 1SVMA 3A3OA 1U5AA 3D7LA 1YKFA 2PY6A 2VBGA 1U7ZA 4IIGA 2QYTA 1TMOA 2HJRA 3DE3X 3WYNA 3IUQA 4GD3Q 4W99A 6GPBA 1HYHA 1TM5E 2CK3A 3WGGA 5SICE 3WFIA 4YV1A 1U8ZA 4KIGA 3BMQA 2GHTA 1N5DA 3C3JA 3JQPA 3M6VA 1BA3A 2OXFA 1QP0A 2AUMA 2VBFA 3NVDA 1T9CA 4P98A 3WAJA 1H5NA 4CMIA 3N39C 3E9EA 4JBHA 4X8LA 5LDHA 1GPDG 3C8MA 1YQ9A 1EFPA 4CF7A 1MFPA 3TRKA 1GD1O 2Y1XA 1TQ4A 3OM0A 5D01A 4BJHB 4YO8A 4E13A 1J7KA 3D6UA 2Q3MA 1TGYA 3BVPA 2XDAA 3DMFA 4N12A 2F9LA 5EQFA 3CUVA 1SKYB 2XQJA 5IJ9A 2C57A 3TYXA 4AZVA 4BMDA 2Q8QA 4FS3A 3A6JA 4V3BA 1U99A 2D7CA 1FP4B 4PLZA 3SHFA 4MB6A 5SY6A 4L3WA 4DDKA 5DYYA 3L18A 4BRZA 2NUAA 4Q3LA 16PKA 5AJWA 3MLEA 2FY8A 2NYUA 3K6KA 2XECA 2P9GA 1SQ5A 4OHBA 2WJGA 3LTEA 3W5UA 1UZNA 3LQ4A 2IT1A 5KYUA 3VR6D 1Z4MA 5IH3A 3DJFA 3RRXA 1P0PA 1VP3A 4MS3B 1OE0A 1OAOC 4MVJE 3GARA 2NXCA 3VFDA 4AKHA 1QTIA 4CKEB 2J85A 1EIWA 1TF2A 2VHUA 4EGSA 4EG6A 4QEDA 2PGAA 5D3MA 3LUKA 4QXOA 1CUIA 4HGRA 3NT2A 1WXXA 2QDKA 4QEZA 4EW2A 2BMEA 4B6PA 4KXLA 1PFWA 1UPCA 3EXAA 4DUGD 3FB4A 2CXRA 1ONOA 1ARZA 5AJYA 3VHLB 5LMCA 3TFQA 3OPYB 4EITA 3NX4A 4LNUA 3ZGYA 5EJIA 3G2JA 2AK3A 2IC5A 2ADMA 2Z4SA 4KH1A 5FXMA 2IIPA 1H1DA 4D4LA 4XDYA 1CVRA 4KSBA 1P39A 2ZJFA 3IQDB 1PL0A 3NC0C 3NETA 4L5JA 4UHCA 5KYTA 2FYTA 2CLEB 5FI5A 2ZR0A 1NJFA 3NZEA 3Q8XB 5CT8A 3PCRB 3RU7A 1PJTA 1T5OA 2I9PA 3MWDA 3NGXA 3DLTA 3EGDB 1Z08A 4FKBA 2IXAA 3DBIA 3TOCA 5HJ2A 3RRJA 1RWXA 4BMXA 3PNLA 4KH0A 2OVBA 3A58B 1T8WA 4RMJA 3ZCRA 3CYFA 4GLJA 4UREA 1AKMA 1HFEL 4NFYA 4BV2A 4DLKA 1NF2A 3NIWA 2GM3A 5B4VA 3FYHA 1S2GA 1GXSA 4NCJA 2WUVA 2F4NA 5GJWC 2VK4A 2XVXA 4DG8A 3TB6A 3HO6A 4QTUB 5ARCA 1MEJA 3EOAI 3OMWA 1AH2A 2PS1A 2QTHA 2Y0PA 3BEDA 2I34A 2HU5A 4LZOA 4AO7A 5LP6B 2ZSJA 5L3QA 1GA6A 2YQZA 3PJFA 3QU9A 4MYSA 4NMWA 1FMCA 3E22B 3M5CA 5E7IA 3V8RA 9ABPA 2RI6A 4ONEA 1C3JA 4AAYA 3OZAA 4FYIA 4YAEA 4ETIA 3CF6R 4ENUA 2OB1A 4XD7A 1XVVA 3PPYA 2WF6A 1D6JA 2OV3A 1P2UA 3ANSA 3QJ5A 3SYNA 3OU7A 4M1TA 3U9TA 3EYWA 1DMSA 1NSYA 1RMQA 4EVQA 2AIRA 1RHQA 1SQ6A 1XZDA 2PSFA 3CLTC 2PUAA 4EELA 2CHEA 5C52B 1SZJG 1MOZA 4MCIA 2XUQA 4C3ZA 3Q6MA 1DTWB 3C74A 3VZRA 2A4KA 1D1TA 4WE3A 1KF0A 1R50A 4RZ3A 4EP1A 1I30A 1VLQA 2Y0BA 4RHUA 2ECKA 3IMKA 4KQEA 4RJJA 1NM5C 4QOHA 2DQZA 4U2FA 1TUEA 5BXQC 2GPYA 4AULA 4AXBA 3N6XA 4UDYX 5LQRA 1V39A 1GNPA 1V2GA 1J5PA 2QM3A 4NVRA 4WOBA 1Z7EA 1IQ0A 3FCSB 3D2BA 3WYGA 1Z6YA 2JRLA 3KWFA 1KZGB 3TW6A 2WICA 3M1IA 4P80A 1MEOA 1TMGE 2J1LA 4HYQA 3VTAA 4DIEA 1M83A 3I2JA 3PWSA 4OKNA 1A2KC 3KK0A 4IWNA 5KTYA 4N3CA 2NVOA 1RSZA 4URVR 5FCDA 2FA9A 2VRBA 1PFUA 1N9ZA 3DPIA 4W1QA 5BV8A 5K0TA 3B1KA 5AKEA 1M2OB 1BQEA 3UHFA 5IUKC 3SZGA 5CHEA 3ZQ4A 2AZMA 3TAUA 4X97A 4KVFA 1L9XA 4CV1A 4NCBA 1DAKA 1VG1A 1NUQA 3P27A 1T1SA 4L8GA 5AKJA 4KWTA 1L4MA 3HA2A 3JD4A 3QBJA 3N59A 1JL3A 1X1DA 4K6CA 3WK9A 4W5WA 5FNVA 1IJEA 5JWOA 2C4HA 4XQ9A 4QJ3A 1N33B 2ZBVA 4GICA 4NEQA 4IKEA 4LHSA 4OXKA 3TQQA 1FQWA 5A6SA 4TKUA 3MF4A 4PGAA 4CLDA 5JVDF 4YGYA 4ODIA 5B4TA 2IGBA 7REQA 1KXZA 2CUKA 3FCEA 2RHTA 4QD3A 3VZBA 3ETGA 4R2HA 4C14A 5B3LA 4G36A 2MYUA 1FTWA 1PN3A 4FC7A 3HZRA 4R8RA 1CS0A 1WLSA 5DFAA 4AIRA 2FSFA 3E03A 5DSZA 1XPRA 2J41A 1FNMA 2YUIA 2GZAA 2O0MA 3H2GA 3KKPA 4IZ6A 4KR3A 2B8JA 3FGPA 1QK5A 5HS4A 4I1UA 2I67A 3NDJA 4EJ6A 3OUTA 1ZIDA 1E7RA 4DHWA 4MW7A 4WCFC 4OD0A 4QYTA 4E6PA 1E7MA 2OC4A 4JC0A 2VDUE 4P38A 5EE0A 1PK9A 4CT5A 4JDUA 3KR0A 3ZJUA 1M6VA 1NY6A 1FFEA 2NO1A 1LGYA 1SH7A 1ZK4A 3A9VA 4YRIA 1FFYA 3SCZA 4HT3B 2JIQA 2BSAA 2EFHB 3I2GA 3R1IA 4W63A 3GLIE 5KNCD 1J8FA 1DDOA 2IV3A 1YH3A 1L8XA 2AX3A 5KOJB 1Z16A 5E2AA 3V5NA 3L6EA 3FNIA 2JASA 3D0KA 3FYUC 2B78A 2VF5X 3I5AA 4IXDA 1KZ1A 4K6HA 2X0FA 4PANA 2NTNA 2V7QD 2QLMA 3UIEA 4B32A 1J0EA 1OX5A 2WU3A 1CDEA 3O74A 3N7TA 2HQOA 4ZOAA 3ZWNA 2OM6A 4CQJA 4ZEMA 4R1PA 1DXYA 1FX0B 2ZTUA 4DLXA 3CRVA 3RS7A 5M34A 4G0XA 4X93A 3T5MA 5A4JA 5C51B 4E08A 4C4PA 1BMFA 2G06A 3N2IA 5JO0A 2YC4C 2OV2A 2YNMD 1G8AA 2X8LA 2AUTA 3E9MA 5AI8A 3SLRA 3ZQKA 5IKPA 2V1UA 1IJBA 2CDAA 5E6UA 4FCTA 3HXLA 1GRVA 1TAQA 3IR6A 4RK0A 1G7TA 2ZUUA 3GFGA 3KQMA 4N82A 1NZFA 3PXEA 3QGMA 1YUBA 5IYZF 3HTXA 1L0BA 2YWHA 1C3LA 2GARA 4QOJA 2BFEA 3DP9A 3MWFA 5ITVA 2DFTA 2IH4A 3GJ7A 4QDUA 2PUVA 3MILA 1MQ8B 1FRFS 1TCAA 1C7RA 5LQSA 3DNFA 3H2YA 2V6JA 4H0NA 2IW1A 1J33A 1N1EA 3NFYA 2GASA 2HJ9A 3B1XA 3LUAA 4KVAA 4R5MA 4R1QA 3RRZA 4D5EA 1R0XA 2BN4A 1PFVA 3I4FA 4N5NA 1QXSA 1XRQA 4TV8A 5BV0A 2I7DA 2IVFA 4FE3A 4DARA 3A04A 3T5PA 2IYAA 1I01A 3KP1A 2X4DA 1L3CA 3OFNA 2AN5A 4MW5A 4DLZA 3O75A 3QE4A 3ESQA 1V25A 1G3QA 3A3YA 5SYAA 1SOVA 3CH7A 4QHYA 1J1UA 2VQSA 5BSVA 1TJPB 1L4FA 1EE1A 3MWEA 1I5EA 1OLOA 4REMA 4CEIB 3V34A 5BV7A 3R77A 3EC7A 2XB9A 4H15A 3WNZA 4P4SA 1DJLA 1ZAYA 1IG0A 2ZJAA 2IXBA 4OM7A 5ALTA 4DQVA 2OP1A 4WL0A 4TV9B 4CR8A 1A2QA 5AW7A 2EP8A 1XMJA 2XD9A 3OPMA 2JFUA 2FXIA 1SVLA 2LDBA 2OK8A 4KGZA 1FDWA 4LSZA 5DLEA 1HTWA 3UKJA 5K8VA 2Z5FA 2CFOA 1ZGBA 4L72A 3GVIA 5BP7A 4QSMA 3BJMA 2OE2A 4R3NA 1UPXA 4H3SA 4IIVA 5FTLA 4B5KA 1Q7EA 3NNNA 3CRQA 2GN8A 3UMJA 4EPWA 2OEPA 4FMPA 1MO6A 3IQXA 1JFRA 3OZBA 1YRWA 2DF8A 4GM4A 4ZO6A 3CH6A 4PWZA 3UMVA 1N4DA 3DSRA 4GLFA 4BNKA 5JDCA 5DXJA 3ZH2A 3V00A 3F5MA 3CR8A 3I9KA 3GT4A 4NECA 4EPRA 2Q4DA 3BG5A 1MMFB 3TWOA 1BJTA 2PT5A 3A1DA 4FVTA 1CB7A 4S0ZA 1WWKA 3CZ9A 3K2EA 5J47A 2V3VA 3JQCA 1JDUA 4A1OA 1I6WA 2J3LA 4RK5A 1OGIA 3OTIA 3ONEA 2J9FB 3G9UA 5K3FB 3TD2A 4OKIA 4TL6A 1JV2B 2QSUA 3KEOA 1GEGA 5K9ZA 1ENZA 3VR5H 1KC3A 2NO5A 3H5AA 3K0BA 3TXAA 3QE9Y 2H5EA 3SD7A 1YZYA 1Y7IA 3A27A 3IVAA 4R2WA 3CJRA 4XCXA 4Z9YA 2IX3A 3U1TA 1NGSA 3WR5A 4JC4A 1HF3A 4F2PA 1GAXA 2G83A 2ZE7A 5E2BA 4YQFA 1KQNA 4C1NA 2REBA 1DB3A 2JLAA 4FWIB 4M1YA 4WFJA 4FMCF 3TR6A 2XHEA 3AP3A 5J5AA 4ZMSA 5BSWA 5DDIP 3ZVKA 1A2OA 5ALXA 1EEHA 3QBDA 5ITZA 1VLLA 2ESRA 1ACLA 2Q3HA 3VM6A 3CLVA 1P3JA 3ZU6A 5B30A 4LF8B 3J7AC 2J0VA 2X2FA 4URZR 2JK0A 1PT8A 5IW8A 1FP6A 3PXGA 1V8OA 3ZEIA 5CFRA 2BDTA 1IB6A 1LBIA 3SJZA 3EW7A 3X1MA 1CF9A 1JDSA 1MBZA 4ER6A 2JJQA 5K8LA 2C2HA 5HE8A 3TPFA 3EGVA 3K73O 5FLEX 1DUIA 1R66A 4LDNA 4KMOA 5EZYB 2C4TA 521PA 1H4SA 2J5QA 3I4CA 2A9RA 1JGTA 5DMXA 3DJYA 3EGOA 1AQYA 4LWOA 4P4GA 1DG3A 4GPIB 2IWRA 5LP1A 1EE2A 2QXTA 3DTVD 4BLRA 2DWOA 5KMGB 4RZQA 1YUNA 2ZWPA 4B4KA 4C7MA 4HYYA 4KBGA 4MGHA 4PZZA 3QJYA 1A4XA 3RG8A 3IP7A 3L40A 2X7JA 1X87A 4ZVRA 4B6FA 1ZH4A 2XZPA 3DD5A 3IQEA 4M99A 4IJMA 2C42A 2PGJA 2ZT7A 1EM8B 4FGLA 3C8ZA 5GONA 4O1MA 5JXJA 3COSA 2QXUA 2Y2UA 3PK0A 4ZQGA 4HKTA 5IHPA 4KQ6A 4OQYA 1U2ZA 2RIPA 4YDRA 4B6JA 1LX6A 2PNJA 1FP7A 1MR3F 3BERA 1I7PA 2ZK7A 1CZNA 1USIA 2BI4A 2OO5A 5TIIA 3S8EA 4MRNA 3FKSA 3P4XA 5CLIA 2GJKA 2JFOA 2YZKA 5EMKA 3SJCA 1E77A 1DL5A 2FX3A 4LW8A 3LBYA 1MVOA 3COJA 1G4UR 2JARA 5F3RA 2ZWOA 1TYBE 1XNGA 2A92A 4G4IA 4NV1A 2FMKA 4IDAA 2RHGB 2HBZA 3KEQA 5JH7F 1L7XA 3HZHA 4L4ZA 1HRKA 2VJYA 4QU5A 3BXXA 5T3YA 5CB6A 3HFRA 3E81A 4LNHA 1U1FA 2WMYA 3EQ6A 3IOBA 1F1JA 2V7VA 1OGJA 1V1MB 2ODQA 2PZJA 4Y2HA 2RHDA 1B73A 4QODA 1F4VA 2RG1A 1RTKA 3Q40A 4UBKA 4D9KA 3OZIA 1K6JA 2GEFA 1P31A 4H59A 3M8KA 3PEEA 4KMSA 4R3WA 4XX0A 2OA0A 5JAOA 2NP7A 2QVXX 1UM9A 4JMLA 4CCYA 3W7VA 1KO8A 4CM6A 2XWBF 4QBKA 2GCOA 4WV3A 1J56A 3FPSA 1XQXA 2H65A 5FUYA 3H1PA 2IYZA 3KU4A 4BBJA 2QBYA 3GFTA 4F21A 1L4NA 2P0AA 3KHUA 2HF8A 2Y6UA 1BCRA 2GK4A 3F47A 1JUDA 3LO8A 5DSTA 4ZALA 1BYUA 4Z51A 1HL7A 3M33A 5TPZA 1AMNA 4CQMD 3C3YA 4RMHA 3VYRB 4C2UA 4P3XA 1S1MA 2OCKA 2FUEA 5LB4A 1Y8ZA 1QSGA 1WEKA 4BVEA 4RTNA 1JAIA 3DUFB 4PONA 3GLUA 1N5OX 2B4AA 3A4IA 2AZTA 3HU3A 3MGAA 2WHXA 3TOZA 2C7RA 3AESA 3JQ6A 4S35A 2Y99A 1J49A 4EKGA 4XM1A 4CMEC 2FH5B 4HWTA 5EWMA 4HATA 5B5SA 3W1EA 1U2RA 4J29A 3UFBA 4Z3KA 1EUDB 2MSKA 2A2ZA 2O3QA 2Y1KA 4X95A 1GZ7A 2Q3BA 4P5PA 1E0JA 3TLXA 5HNKA 1Z26A 3MTJA 3DDNA 4QX6A 4C6RA 3B2QA 1H2EA 3PT5A 4KQGA 4ZU1X 3ZNQA 1W48A 1Z0KA 4DYDA 2GPWA 5DH9A 5EWLA 4E4YA 2ZRDA 4WJZA 2GERA 2G80A 1EFHA 2OBLA 5T41A 3GFVA 4QUIA 3P9PA 1FBTA 9GPBA 2AEFA 3AEQB 4QQNA 3G2QA 3JR7A 3V8EA 3RVRA 3P8ZA 1O5OA 1YL5A 1U28C 3CRNA 3ND9A 4WY2A 1QH9A 3AGQA 1VJRA 1QQ6A 2JATA 3X1KA 3R3ZA 5EE1A 5JYDA 4EENA 4G5XA 1YZNA 3BA1A 2ACKA 3NTUA 3U44A 5EP2A 1TT5A 3LNTA 4XVCA 3BGIA 2I62A 1IY8A 2AS0A 2BTOA 3ELYA 2A5FA 3R3HA 4C22A 5EHXA 5JDIC 5L45A 1H2FA 1O9HA 3SOZA 4ZCTA 3LUHA 2BHTA 5ENZA 2YV4A 4EG0A 3AI2A 1E1NA 1FDSA 2XLBA 2IL1A 1SBQA 1NRJB 1SJ9A 2GN9A 2PRSA 1GYRA 1RRPA 1FU8A 1PE0A 1GL3A 1I7NA 1QFJA 4HQKA 4R9UC 4HVLA 3T5CA 1R27A 4DMLA 1XE3A 3C3EA 3KPUA 2FX5A 2NTEA 3NHYA 4J16C 2PMKA 3PPWA 1R6DA 1X13A 4LQ4A 4XFJA 5HK9A 2YWGA 4Q5IA 4ZAVA 2JFVA 2O2CA 3GD5A 1E1QD 1UBNA 2CNBA 3U9LA 3V4ZA 4J49A 1OASA 1J70A 3IHTA 3QPAA 4PO1A 1G6HA 2FPWA 3T7AA 3BWMA 1BX1A 4OQXA 1NN1A 4G6ZA 1B6RA 1WB6A 2JIOA 4QDKA 5DB4A 4FYVA 1GKIA 5A1TA 1ATZA 1YR8A 2O2JA 2JNWA 3P32A 4BL5A 4W4TA 3QG5A 3PHBE 4OXRA 2WE8A 3JXEA 4PCAA 4F2HA 3DDWA 3WOVA 1DBRA 3QV2A 5C81A 2ZAYA 1T9HA 3FYTA 3VZSA 4B74A 5AD1A 2XT0A 4GECA 5AI0A 121PA 4X6YA 1ZHHA 3MWJA 1CYEA 3TBKA 2C2XA 3BRCA 4DDTA 1O8BA 4IGEA 2XAUA 4URUR 2FR8C 2ODBA 5K3OA 3MJFA 1OAOA 2SCUA 4ALIA 3DE5X 2WM8A 3BM5A 2WHPB 2C2KA 1BTOA 3BIOA 4V03A 4LC0A 3WKDA 1ZGZA 5IAJA 5BY2A 1RWNA 2AEMA 5FF9A 3R7SA 4DR5B 5IM4A 2I7TA 3HJAA 3IVMA 2X0NA 2EXXA 3LL7A 3BXEA 4RUKA 3W6UA 3QPBA 1QF9A 2QE7A 2BGLA 1R37A 2EJCA 1QP4A 4LOJA 3ZXIA 5DNYB 1TVKA 4LF6B 4LJKA 2C0QA 3MGGA 4G0MA 4KPEC 4DDHA 5HFNA 5DLDA 3ETNA 3EA4A 4LDZA 4YO7A 4E5UA 1UJNA 1YNOA 1N9KA 2HHLA 4GXRA 2HYIC 2XSZA 2WF7A 3L0YA 1Y1QA 1C0EA 3GFBA 4LZWA 4YMWA 1ZWLA 2IUSA 3KAPA 2JKYA 4BFYA 2NZUG 4BVBA 4RX1A 5AP9A 4ESOA 4YV7A 3CF4G 3VKFA 4OUKX 2YV2A 1T4CB 3OAAA 4WSOA 2GLXA 4MUFA 3LL4A 4JD5A 1ZK2A 2OAEA 4KFCA 3T99A 3IBYA 4IOKA 4JI3B 4AMZA 5CNMA 1G20A 1DIRA 1SHUX 1I0LA 2W4QA 1K0FA 1WHTA 2IITA 1JVBA 3DVAA 1ECJA 2FQQA 3B3JA 3LFTA 5IJ9B 4AXXA 2RSLA 2YHUA 1QE0A 1U0SY 4E12A 5KTOA 3G2LA 1ZNZA 3UPTA 2A3NA 5U9CA 3UXEA 1SC9A 4V0SA 4MRPA 2NUAB 2Q6KA 1E8NA 3WGNA 4JB8A 2VKQA 2HF7A 1UKZA 1YOVB 2BKXA 2QDXA 4D96A 2QUKA 2ZI9A 3OURA