1YKFA

Nadp-dependent alcohol dehydrogenase from thermoanaerobium brockii
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
352
structure length
352
Chain Sequence
b'MKGFAMLSIGKVGWIEKEKPAPGPFDAIVRPLAVAPCTSDIHTVFEGAIGERHNMILGHEAVGEVVEVGSEVKDFKPGDRVVVPAITPDWRTSEVQRGYHQHSGGMLAGWKFSNVKDGVFGEFFHVNDADMNLAHLPKEIPLEAAVMIPDMMTTGFHGAELADIELGATVAVLGIGPVGLMAVAGAKLRGAGRIIAVGSRPVCVDAAKYYGATDIVNYKDGPIESQIMNLTEGKGVDAAIIAGGNADIMATAVKIVKPGGTIANVNYFGEGEVLPVPRLEWGCGMAHKTIKGGLCPGGRLRMERLIDLVFYKRVDPSKLVTHVFRGFDNIEKAFMLMKDKPKDLIKPVVILA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADP-DEPENDENT ALCOHOL DEHYDROGENASE
publication title NADP-dependent bacterial alcohol dehydrogenases: crystal structure, cofactor-binding and cofactor specificity of the ADHs of Clostridium beijerinckii and Thermoanaerobacter brockii.
pubmed doi rcsb
source organism Thermoanaerobacter brockii
molecule tags Oxidoreductase
total genus 112
structure length 352
sequence length 352
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.80: Isopropanol dehydrogenase (NADP(+)).
pdb deposition date 1996-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ykfA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1ykfA01
1KVQA 4M49A 2QG4A 5F1PA 2D3TA 1I2BA 1X1EA 1I01A 2CVOA 4GPD1 5H83A 1ZSVA 3B20A 3O9ZA 3ADPA 3JCZA 1EZ4A 1LSOA 1XHLA 4YTEA 3WGYA 3HDQA 4MVJI 3HE3A 2AXQA 2ZQZA 4FN4A 5IJZA 1C1DA 4LMPA 1KS9A 1PJCA 1ZXBA 3VH1A 3KSUA 4DLBA 1LC0A 2XAAA 4FGWA 3VTZA 3DMTC 2X6TA 2PD6A 1SOWA 1SC6A 3GC6A 3MZ0A 4B4WA 2P5YA 8LDHA 3HJAA 3HDJA 4QFCA 3RUFA 1P1RA 5H82A 4MIEA 4O63O 3Q2KA 1KIFA 3OETA 1Z75A 3JQ9A 4BNLA 1BDMA 3SX2A 2NQ8A 3NKLA 4NNJA 3LT4A 5BNIA 3MEQA 2X4GA 2VZ9A 3KB6A 4WOJA 3I9MA 3S2EA 4CM9A 1Q2XA 1N1EA 2E82A 2X0JA 3IIEA 3AI1A 1Z82A 1U3UA 4YA6A 1O94A 5EL0A 1X1TA 2Q99A 3F5SA 2BHLA 1WZEA 1GR0A 4BKUA 4EJ0A 5L7TA 1X7GA 4QTZA 5FYDA 2J3IA 2VYVA 5MDHA 1P33A 1Y81A 3Q2IA 4NMHA 2CSUA 3PLNA 4IJKA 5TRTA 5DCYA 4CLEA 4DREA 5K6AA 4RF2A 3TOZA 3DBLB 4J0FA 4F6LA 4ND2A 1HYEA 4ROSA 4W7HA 5KVSA 1GADO 2DUWA 3TRIA 5F21A 3PDUA 4YACA 1NR7A 2E6UX 3I9NA 4R41A 4XQEA 2VRCA 4XZ3A 4AFNA 3B1KA 3AUTA 1PX0A 4XD2A 1EE9A 4XB2A 2RH4A 1B7GO 4R69A 3S55A 4ZQGA 2X23A 3H9JA 3CUKA 3U5TA 1NVTA 4OJNA 1Q0HA 4TKMA 4R01A 2W2KA 5C37A 4IXWA 2VHWA 2ZYDA 3NDRA 2DC1A 2D8AA 1YONA 4HKTA 4CL3A 3A9WA 7ADHA 1V35A 1NWHA 2ZATA 1JLLA 4FCCA 5C7IO 2AG5A 4ND5A 2P9EA 5B1YA 3JYOA 4BNHA 4DIFA 1EEHA 1HSOA 1VPDA 1UZLA 1B8VA 2X1HA 3I9JA 2NSDA 1PGJA 4O59O 1GY8A 1Y9AA 3ASVA 3ZV3A 4TRRA 1U28A 3JTMA 5G0VA 3V8BA 1KETA 1EVJA 1T4DA 4CV3A 5JNLA 1MXFA 1DHRA 1C3VA 1E7SA 3K9QO 4W7IA 3WDSA 1R16A 1VSUA 2WE8A 4Q9NA 3JD0A 4A5OA 1PIWA 1Y7TA 1HT0A 2C20A 3JYQA 4Y9DA 3ZU5A 1KBZA 2PK3A 1E7WA 3OIDA 4H15A 1EVYA 4BO7A 3BMCA 3FN4A 4XDYA 1N8KA 4A0SA 3W6ZA 2HAEA 5JC1A 4OO3A 5HS4A 1T2CA 4IDEA 1ADBA 5KJEA 4R1NA 3GMDA 1NQAO 4BNTA 2OBNA 3D5TA 2BKAA 4BNMA 3TNLA 2PZLA 3ZU2A 4BO6A 3SLKA 5ADHA 2GZ2A 4RVFA 4BKPA 3PK0A 3U0BA 4Y67A 1DDOA 4MVJF 4DMMA 3D4NA 1AHIA 2W2LD 3QWIA 4NJMA 2HRZA 1ZUD1 1KYQA 1XU9A 4DRYA 4XR9A 3OP4A 5IN4A 4ZA2A 3RUAA 2HK9A 1A71A 3TJRA 3V1UA 4R68A 2QRJA 3WWYA 2VN8A 3UHAA 4CMIA 4CPDA 4M89A 4G5HA 4J7XA 3D4OA 1GV0A 3FNGA 3GUYA 3BXXA 5IDXA 2A94A 3WQQA 1NFFA 1FDVA 3PHIA 4Z3DA 4J6FA 3I6IA 2UDPA 5DF1A 1GV1A 4J4HA 2O4CA 3EC7A 1GDHA 1D1TA 3NGLA 4YQYA 4AJEA 4Q3NA 4JJFA 3WJ7A 1CEQA 2EJWA 1C1DB 2UUOA 2FR1A 1A7KA 2PV7A 2O2SA 2ZB7A 4UEKA 2GSDA 4AJOA 4BNYA 5FWNA 3E6AA 3ZHYA 5GZ6A 3FNHA 1PJTA 3GHYA 1I33A 1UXJA 4EI2A 5EJ2A 2Y1DA 3DBRA 4J1TA 1ZNQO 1ZSYA 2B35A 4I5EA 3PPIA 4WCFC 1QV6A 1FK8A 3P7MA 4CM9D 1E77A 4BNJA 3WB9A 1A4UA 1KEWA 4NBVA 5I9NA 1PGNA 4E6PA 1BW9A 1RKXA 3CIFA 1WDLA 2EP7A 1GCUA 3TOXA 4E32A 4YVFA 4UUOA 4BO5A 3RC1A 3JQEA 4UUNA 3TFQA 2I5PO 2G0TA 1EMDA 2VYVD 2YZ7A 1ZMOA 2ZTLA 3FPCA 5ITVA 3AM3A 1Z45A 1F12A 1SAYA 3ULKA 3IMFA 4Z3KA 2O48X 3M2PA 3WXBA 1YH3A 3IJRA 3OJ0A 2EXXA 2OUIA 3EVTA 1KC1A 1PL7A 2V7PA 1IULA 3ROPA 3UW3A 1X0VA 3KLPX 5AXBA 4BKQA 3HZZA 3LT1A 4TZTA 5BNTA 4ZVVA 2VRCD 4NG5A 4ILKA 3T4EA 3NGXA 3DMTA 3WS7A 4B7CA 4E3ZA 1WMBA 3K73O 1CJCA 4LCJA 4W4TA 1WLYA 4I5GA 3PRJA 3ZHBA 4H3VA 3N58A 2CZCA 3HHPA 1B3RA 3BHMA 2NLOA 2IDZA 4ZGWA 3MCVA 2I67A 2C2YA 1W4ZA 3QVXA 3AJRA 4PG8A 3DZJA 4A73A 3JQ8A 4BMSA 4EYEA 4KP7A 4BGEA 4TVBA 1K5HA 1PWZA 3AUAA 3OJEA 4CMAA 3RKUA 4YPOA 2W2KB 1HDGO 3WQSB 5IF3A 4CL8A 1PZFA 1E1KA 2GERA 2FHSA 3DBVO 2J3KA 2Z1NA 3I5MA 3K5PA 4O5OA 4AICA 4CJXA 2VUTA 5TJ9A 1PGQA 3LC1O 4WLFA 3NX4A 4PG4A 2EF1A 2NU9A 1N5DA 1DC6A 1EFKA 3DZHA 3WGTA 3DAFA 2Y93A 1H6AA 1I8TA 3AUSA 3GVHA 4XWYA 4XJTA 1C14A 3EY4A 1H6CA 1P77A 4E5KA 4NFSA 3DO5A 4PG6A 1YQGA 1ZBQA 3E5MA 3JQFA 1OFGA 4U6SA 4FJ0A 4DPMA 1HE3A 5G2OA 3ZW9A 1ENYA 4U7WA 3EZLA 5KWEA 2RHRA 4DC0A 5L40A 1YQDA 3VHRA 2DPGA 3L07A 3R6DA 5T57A 1HXHA 5AYVA 1UZMA 3BMCB 3E8XA 3HFSA 4Q39A 2DLDA 1RM4A 3CZRA 3OECA 3L4BC 4BO4A 3BTVA 3L9XA 1VKNA 4ZD6A 1ID1A 3K8ZA 4II2A 2Q4EA 3UCFA 3VC7A 1YGYA 4GKVA 1VJTA 1TEHA 4Q3CA 3PGJA 4CMHA 2ZIZA 3ORFA 2HMUA 4A26A 1Z7EA 1KERA 1BGVA 1F14A 2PZJA 3PHHA 2VNAA 4D3FA 3TZCA 1EK6A 1JAYA 2DTDA 2TMGA 2IEBA 4J91A 3OICA 4RV9A 5DDIP 2P91A 1MFZA 4KUEA 4CMGA 3TF5A 1YL6A 1KEUA 4CUZA 2JAHA 2JKVA 1Z6ZA 1UXGA 3GF4A 3JD1A 3QVSA 3FBGA 2AQ8A 3IC5A 1LDYA 4D3DA 3RBZA 3D1LA 2NTNA 3IUSA 2ZK7A 1K6JA 4CMIB 1EUDA 2DBVO 2ILTA 2PR2A 4BMNA 3LF1A 5CDYA 1A9ZA 1QV7A 3W6UA 4NFHA 3HB4X 4XGNA 3ENNA 4DPKA 3GHHA 4IZIA 2VZ8A 3ZWOA 3SJUA 2YDXA 3AK4A 3NTQA 4YXFA 5GZ1A 1Z74A 5AOVA 3UN1A 2YFHA 3UFXA 1VL8A 3GY0A 3ZWWA 4CMBA 3WX0A 2AQIA 4OOFA 5U9CA 2RBEA 3GPIA 4U0KA 4HFJA 2GD1O 3QWAA 2VOEA 1L7DA 1VRWA 3JQAA 1FDWA 1E3EA 1FDSA 1NHGA 4ZRMA 1HZJA 3DBRB 1W6UA 4GX1A 4PG7A 2FOIA 1MGOA 4D3SA 1TA4A 3DXFA 3JYNA 4K6CA 3HDHA 2HDHA 4D45A 1BW9B 3PQEA 1FMCA 3KYDA 1I36A 3RD5A 4E33A 2VNSA 3WG9A 2BFOA 4Y6PA 2D5AA 4ALMA 5I9MA 2DBRA 2VUSA 4CM6A 1GYQA 4LK3A 1E3WA 2C5EA 3VAZA 4YJFA 1FDUA 4OGWA 3TL3A 3CTMA 4IMPA 2HMTA 1U7HA 1E3IA 5ICSA 4KWHA 1HLPA 4J1NA 2FPPA 3OSUA 2XF8A 5IZ4A 1DIBA 3HNPA 1DJNA 4Z9XA 4WLOA 4BNGA 1DFIA 1E92A 3WNVA 2Z1MA 4RVDA 2OP0A 4CQMA 1LNQA 2TMDA 3DONA 4WPGA 3GVPA 4RVGA 3DBHA 4PCVA 5F5LA 5A9SA 2X58A 3TPCA 1O5IA 3VPGA 1VL0A 4P22A 2AEMA 3JQ9C 4GWGA 1EE2A 5HBRA 4NK4A 1BMDA 5L7YA 4LRSB 3DFUA 4RF3A 3GK3A 3KLMX 1YS4A 4AJKA 1GPJA 5ER6A 1LDEA 4LW8A 4YWJA 3U4CA 4IZHA 2F1KA 1DLIA 1N92A 3UCXA 1HYHA 2NACA 1ISMA 4R1UA 5JFOA 3GAZA 3GA0A 1GEEA 3AFNA 1TVEA 1NQOA 1DFHA 2PLAA 2R00A 3EHEA 3KRTA 5BSFA 1O8CA 3LLVA 4K26A 2XXBA 3QWFA 1E0DA 2HQ1A 4E13A 1RM5A 1ZK2A 5JY1A 3EUWA 4FD3A 4LRTB 3GQVA 5A3VA 1V6AA 5K6AC 1I10A 5JMPA 1IZ9A 4XYMA 4GX0A 2BGMA 3BZUA 2GLXA 4I5DA 4TKLA 5DBFA 3KYCA 2VTEA 4DBVO 1ZFNA 5FI3A 3KO8A 1XGKA 1W0CA 1DBVO 4XYGA 3S2IA 1ZJYA 3CINA 4OYRA 3GN2A 6ADHA 3OQBA 3GFGA 1KC3A 1WWKA 1U5AA 3CXRA 3L6DA 2Q1SA 2IXBA 4IM7A 1SOVA 1T25A 5LDGA 2PKQP 2VYNA 3C7CB 2CNBA 2Y1GA 2GASA 5JCJA 1LC3A 1MA0A 5TGDA 1DRVA 1N7GA 2DU8A 1QYCA 4FJ2A 4KTVE 3OF2A 1GZ3A 3ZWBA 1O89A 2GRAA 1MLDA 3D0OA 3SBOA 4IXTA 3FWZA 1HE4A 3NTRA 2DBQA 1NAIA 3GN1A 4ND4A 3T4XA 3VZRA 2JL1A 3RQSA 3G1TA 1I30A 3BA1A 1BSVA 3KEQA 3O26A 2BF7A 4RL6A 1DXYA 3FCOA 1I3KA 2NTJA 5A9TA 4ALLA 4NBTA 1L7EA 5KKAA 2X5JO 3ZWNA 4NR0A 4P4GA 3RC9A 5A1TA 1T2AA 3VZSA 3WR5A 3E48A 3EGOA 2D4AA 4RDHA 1NPTO 4YT2A 1B3BA 1JN0A 1YBMA 1PR3A 3DDNA 3JQAD 1U3VA 5B4TA 3STHA 4FR5A 5T8KA 5DNAA 1DPGA 5CEJA 1UP6A 2O7SA 1TLTA 2WWRA 1OMOA 4OXNA 3JQAB 4AG3A 1HDYA 1NBOA 5CG2A 1ISHA 3U62A 5KJ6A 5HRUA 1YB5A 1FJHA 3DQPA 5THKA 3ZWPA 3JD2A 1LXCA 4II3A 2RCYA 1ZZEA 1BXZA 2Y67A 4DVJA 1NVGA 9LDTA 2QYTA 3FR8A 1H9AA 2V6FA 3QVOA 4KQWA 3UCEA 2Q50A 1GU7A 1HE2A 5EQFA 3KYDB 5DP1A 4E31A 1Q1NA 3RUHA 4AL4A 1KY5A 2ZYAA 2YV2A 4Y98A 2EW2A 5EERA 1XELA 1HDZA 4XJSA 3RWBA 1F0YA 4ESOA 2J5QA 3QLJA 4QSMA 4PLWA 4BO8A 3ZV4A 2EKLA 1LDNA 1E3WB 1PS8A 3KV3O 3S2GA 2EIHA 4YJFB 3K31A 2Q1WA 3FNFA 3SJ7A 4TZKA 5MGBA 1JAXA 1DIAA 1E7RA 3DWFA 4CQMD 4E5YA 2Y99A 2HUNA 1Z73A 4YAIA 3GDGA 1XYGA 2EG9A 3F6YA 3ASUA 4HXYA 4NDNE 4IIVA 2YV3A 4CQMB 4J2HA 5CPBA 4BO2A 3M2TA 5H81A 4E2ZA 4DYDA 1ZVMA 2EWMA 1JDJA 1DEHA 4UVHA 4BNNA 4B79A 4K1LA 5F1KA 4AJ2A 3DBHB 4P4LA 1GUFA 1CYDA 5A9SB 1DFGA 5IDQA 3INTA 2G82A 3MOIA 1IUKA 2EEZA 1J6UA 1NWCA 4YJHA 2GO1A 2F00A 1YJ8A 1QRRA 4QQRA 2IE0A 3QVWA 4YJGA 1PJ3A 2GZ3A 3KTDA 1P45A 1ZK4A 5CDUA 1MUUA 3MJTA 1EUZA 2E37A 3CEAA 3X2EA 4MP6A 4YRDA 1DAOA 1IHYA 2G1UA 2V6BA 3RROA 2JD2A 1VE9A 3O03A 3O4RA 3BYZA 4DWVA 2D5CA 3G1UA 4MOWA 1T4BA 1ZK1A 2CMDA 4PRKA 3OA0A 2AW5A 3RUCA 3ZH2A 1E6UA 2V6GA 2V65A 1PTJA 2O3QA 3C7DB 3WTBA 2WMDA 3G49A 3OJLA 1LLUA 2FY8A 1BVUA 4O1MA 4LISA 4FSHA 1C1XA 1E3SA 4GX5A 4TSKA 2PWZA 1H94A 3BMQB 3TZ6A 3KYCB 4N18A 4PLVA 1ONPA 4YAJA 4BO0A 4R9SA 5LC1A 1P1FA 4I8XA 3CZMA 1B8PA 5L95A 3COSA 5TLSA 2IXAA 2Q2VA 1A9YA 1XIVA 3KVOA 4CQLA 3VPSA 1QYWA 1ULSA 4BL5A 1HF3A 2VYND 5GMOA 2X9GA 3BTUA 2X22A 5JCJD 3I9KA 1KOLA 2Y1OA 4GVLA 2J6IA 3Q9NA 1MG0A 1TB4A 4K28A 4JNKA 4AJIA 2PH5A 1KVTA 1TT5A 3K6JA 4GMFA 4JN6B 1SB9A 1ENPA 3B1FA 2QIOA 1D1SA 2BMAA 1AUPA 5JO0A 2UUPA 4XR4A 2BFMA 4GAEA 4LCEA 4YDRA 4CUKA 4RPKA 1UZNA 2P4QA 3H5NA 1LTHR 2P68A 1P3DA 2NNLD 3NT4A 3QY9A 3FPLA 3L4SO 3JQFC 3JQ7A 4WUVA 2CFCA 3NUGA 4BNIA 3ABIA 1CWUA 4MKRA 3LF2A 2IYPA 2O3SA 3LVFO 3RUDA 1SBYA 1U4SA 1GUYA 3RVDA 5K1SA 1DHTA 2JFGA 3DFZA 3FRJA 4JXKA 4R51A 5KCZA 1CDOA 3TFOA 5JPIA 3WGOA 3GVCA 4J1QA 4YYZA 5I8WA 2WJPA 5I8ZA 4YQZA 1E5LA 1ZO8A 4Y6RA 1MC5A 1F8FA 4IIUA 1YDEA 1ZEJA 2QX7A 5AQ1A 2JJYA 5KOIA 2VHVA 2O2YA 3GGGA 3ZHZA 4ALIA 4FC7A 5DBGA 4CODB 1S7CA 4M55A 3HQ4O 2ZB8A 4PLHA 1XEAA 1OOEA 3SLGA 1JWAB 3NEPX 3AFMA 4WNCA 5COBA 1PJBA 2E4AA 3H9GA 2I65A 4RGBA 2IZZA 2LDXA 4R9RA 5IAAA 4ND1A 1DSSG 4WK6A 3K92A 4RVUA 2WEKA 1U3WA 2NU8A 1Y8QA 3OHSX 3QE3A 2PNFA 3UKOA 1ISIA 3ZNNA 5K0ZA 3ON5A 3I1JA 4A27A 4IPTA 4XYBA 4DIOA 4TWRA 4CM4A 3GRPA 1ISGA 1OZAA 4Z6KA 1P1HA 4MIYA 4L76A 4MPDA 4D41A 2FR8A 1ZK0A 5IXYA 5AXCA 4DPLA 3OBBA 1UUFA 5L4LA 1R6DA 4RPJA 1UAGA 3GVIA 4N5MA 4FOOA 4HNGA 5K9ZA 5JAQA 2C2XA 1DOHA 2QRLA 4RORA 2R6JA 1WAMA 2W90A 4ALJA 3UAGA 4B8ZA 4CR7A 4J9UE 4YJHB 3PHJA 5EESA 2VUUA 3OJOA 4OM8A 4BNXA 1NQ5A 3K96A 4YJGB 4K9DA 3GEMA 5CFZA 1YBVA 6LDHA 1X14A 2AQKA 3ST7A 4QO8A 1F17A 2NU7A 4RPLA 7MDHA 1H5QA 2CVZA 3D5QA 4PZDA 1NPDA 4IQ0A 4ZQHA 2HMVA 5G4KA 2RAFA 3ANMA 5DP2A 3V2HA 2NUAA 4IQ8A 4N54A 4HFNA 3ITKA 1HL3A 4IDBA 5F3RA 4J2OA 4RLSA 4FFOA 3D4PA 4XKJA 1QLJA 4NK5A 4MKZA 2FP4A 3WGHA 2J8ZA 1C1XB 4IS2A 4J3FA 4CMCA 3NT5A 5COQA 3WJAA 4UEJA 1JWBB 4BNWA 1B0AA 3OJFA 1P1IA 3KUXA 3AWDA 4IQGA 4GLOA 4RZHA 3JQBA 3LC7O 3BMNA 1ADGA 5T5QA 2O3UA 5AXAA 1HLDA 4JIGA 4E2YA 4E21A 3WWZA 2NWQA 1DB3A 3A28A 4OKIA 5FEUA 1I0ZA 1R37A 3C85A 1FXSA 2DFVA 2FZWA 3FWNA 4CQLB 2Z95A 4KWIA 5JW6A 4QUKA 4H7PA 1YL7A 4URFA 5A06A 1UH5A 2WTBA 4CM5A 4B7UA 4EITA 1IPFA 1M2WA 4JROA 5I7EA 5A3JA 4FBGA 1D7OA 1YBAA 2VOJA 1UAYA 3RIHA 2D0IA 3D3WA 1C0PA 5JE8A 4DQUA 1PZHA 3VH3A 1QYVA 1TT5B 5AXDA 4UULA 1EVZA 4WE3A 2R00C 2RIRA 1U7TA 3RFVA 3G17A 4IDGA 1U8FO 1PS9A 3MOGA 4BO1A 1M6WA 2OXIA 2PFGA 3ONEA 3R3SA 4KOAA 2WD7A 3JQ7B 3GNSA 1ZXLA 3DHYA 3U4DA 2HRBA 1IYZA 3ICCA 4LVUA 2BELA 1YJQA 4BIIA 1PQWA 1LRJA 1EFLA 1LSUA 1U2DA 3V1TC 3PJEA 1N9GA 4IJVA 3W1VA 2X0NA 8ADHA 5DULA 4RVHA 5I7VA 3H3FA 3TDKA 3INGA 5BSGA 5CPFA 2PTGA 2GNAA 3DL2A 4D79A 2R2GA 1Q7BA 3ZWAA 3GEDA 1P1JA 4XCVA 4IDFA 4W99A 2BFPA 4UEOA 4BO3A 2BFAA 2X86A 2ZB4A 5JSFA 4MVJM 2LDBA 2GCGA 4OL9A 5LDHA 1T2DA 2ZCUA 1NX6A 4E30A 4PLYA 4CMJA 4CR6A 4E4YA 3G3EA 1E1LA 4OIMA 1IL0A 4OQZA 1QP8A 4U0JA 3H5AA 4XQCA 3VPFA 5ITWA 3ZHXA 1LX6A 1ZIDA 4HP8A 3M1LA 3ZDFA 2NV6A 2WYVA 4PLPA 1U3TA 1DRUA 3PYMA 1UDCA 1E7YA 4YT8A 4E2XA 3PZRA 1Y6JA 4TVOA 1Y8QB 5TNXA 1CF2O 1VLLA 4FOSA 3GGOA 4DBZA 3V5NA 4OXKA 3NTOA 4Q3DA 3PWZA 5G0UA 3GUCA 4E5PA 3T7EA 4CM8A 3DTTA 1E7MA 2Y0EA 4CM4B 2HU2A 1PR9A 4R1SA 4BNVA 3PEFA 4XYEA 3FD8A 4PZEA 1XA0A 5T67A 5L3ZA 3HB5X 5T8KC 1QSGA 3UXYA 4QO7A 2FSVA 1EBFA 1A7AA 1XWFA 4W9NA 1BRMA 1H6DA 3NJ8A 3U4HA 1DC3A 5TC4A 1F8GA 2X9VA 3U9LA 4YJDA 1IB6A 3A14A 1M6HA 3ZW8A 2AEFA 1HDOA 5HS6A 1ADFA 4NH4A 3KSZO 2Q49A 2YDYA 4D46A 3KZVA 3RC2A 1Q7CA 2VHYA 3PXXA 5A5FA 3GZNB 1DJQA 2QHXA 2JHGA 1FDTA 1ZH8A 3LT2A 4B4VA 3WGZA 1I2CA 3IP1A 3NDJA 5CDGA 1D8AA 4BGVA 2IODA 3C8MA 3F46A 5G4KB 3KETA 1IZ0A 1VJ1A 1V0JA 2YV1A 2QRKA 5CAEA 1AXGA 5GZ3A 4HX5A 4NBRA 1YOVA 1HRDA 5TJHA 3ROKA 1WP4A 3D7LA 4PGFA 4FB5A 1NNUA 2E49A 2WYUA 2I3AA 2OOSA 1VL6A 2JFFA 5KIAA 4EUFA 1HKUA 1VC2A 4PVDA 4UVIA 2AG8A 4ID9A 3RJ5A 4J16A 1CERA 3CH6A 3N7UA 5EQDA 5JAIA 5C5IA 2NM0A 2WM3A 3BMNB 3FI9A 3B1JA 5T64A 4E5NA 2Q2WA 3EK2A 2DKNA 3GZ4A 4GGOA 3WGQA 4A03A 1CETA 2GPTA 2YQ5A 3TSCA 1Y9EA 5B4UA 4Y8VA 4ZN6A 2EGHA 1NPYA 4I1IA 4ZQEA 3DZIA 5TF4A 3C1AA 2GR9A 3ICPA 4UREA 3ADOA 4ALNA 4RJTA 1PL8A 4ZHSA 3VZPA 5BR7A 1QORA 3WYBA 1GQQA 2I76A 4DMLA 2WDZA 2P2SA 1I24A 3D3WB 2OZPA 4JJIA 3U3XA 5A9RA 1GPDG 3K2BA 1LQTA 3A1NA 3SEFA 3CSDA 3RUEA 2PA3A 2NVUA 4PLGA 1U5CA 3AI3A 5CDTA 3RFTA 1NYTA 3EAGA 1ZSNA 2JCYA 5ER9A 4A2CA 3SVTA 4KMSA 3KYBA 4PG5A 1XDWA 1PWXA 3H65A 4GH5A 5JLAA 1KVUA 4C7JA 4EUEA 3I6QA 1EQ2A 1RPNA 2V6MA 3PHGA 3F9IA 3JSAA 2VHXA 2BLLA 3KHUA 4E0BA 2WD7B 4J0EA 4AJHA 4IS3A 4WLEA 2YJZA 1LJ8A 2GGSA 1H0KA 1G0OA 4DQXA 1H93A 4F6CA 1P0FA 1PSDA 2QZ9A 3H4VA 4MVJE 5F1OA 1MXHA 4KDFA 3RI3A 1R0KA 1LBEA 1X15A 3DEYX 1N9GB 3L6EA 3K30A 3R1IA 2VTDA 4BKOA 1QG6A 4D42A 4D43A 5B12A 3WYCA 1NP3A 2YW9A 1VSVA 1N1GA 5G0SA 2B36A 3F4LA 5JDIA 5A03A 3ONDA 1PZEA 4L9RA 4CM7A 4MVJG 1YQXA 2P5UA 1UXKA 2QW8A 2H6EA 3QWHA 2J3HA 3DZGA 3WLFA 2VHZA 3U4IA 3OFSA 4O6VA 4F45A 1HETA 1LLDA 5JS6A 3DOCA 2XPCA 1XKQA 5KNLA 1Q0QA 3MJEA 5IZCC 1LSJA 3PI7A 3ZCXA 1KEPA 3DZFA 4J90A 5A5EA 1K0UA 4XEHA 1HDCA 1SO8A 2CF6A 3FHLA 1Z7BA 3CE6A 3WMXA 3ZV6A 3DOOA 1EDZA 1N2SA 4ITUA 2ZB3A 2GDZA 3BMQA 1NFRA 4N5LA 4BV9A 1WDMA 2UV8A 3RCBA 1GTMA 4FDAA 5EMHA 4I9HA 4M54A 4WJZA 4CM8B 4IDDA 1LRKA 1XLTA 2Q1TA 3QSGA 1NR1A 5KVCA 3TWOA 1R0LA 1QKIA 1BXGA 4YAEA 3TL2A 4DQVA 4CR8A 2X7HA 3KEOA 3G79A 4TRNA 2YUTA 4G2NA 4HWKA 1B14A 2SCUA 5KTKA 3AY7A 4BGUA 2AQHA 3H5RA 1MP0A 4B7XA 2E48A 1HYGA 4IY1A 1QYXA 4LMRA 3FR7A 3R0IA 1DC4A 5L7WA 3PQDA 3WYEA 4UVEA 3UICA 3IP3A 4YAKA 1M75A 3WBFA 3LC2O 4K6FA 3OA2A 5TSDA 1GZ6A 4J1SA 4XQGA 1HEUA 5KVQA 4HFMA 2AE2A 2WYWA 3AM5A 2OHXA 3F3SA 4RPHA 4LGVA 1NHWA 4HV4A 4DUPA 3L9WA 2H5LA 1YWGO 2XOXA 5C7LO 2FRDA 5DOVA 5G0WA 4CV1A 2A92A 1MG5A 3AOEA 1BHSA 4EEXA 1P74A 5TX7A 4HFRA 4M87A 2C5AA 2HO5A 5EINA 4WEQA 1YOVB 2OO5A 4RF5A 4EGFA 1QLHA 4Q3EA 1CQIA 4INAA 5L9AA 5TS3A 2EGGA 3RFXA 1ZK3A 4HY3A 5DOZA 3FNEA 4KZPA 4L4SA 4YRBA 1BWSA 1GAEO 1RM3A 4CV0A 5JXWA 1ZMTA 3F4BA 3ITDA 3UVEA 1PEDA 4RZIA 4QXMA 4DTIA 3OM9A 5L4SA 5KJCA 3H2SA 2ZTVA 1HTBA 3AW9A 3ETEA 5IDWA 1UJMA 5A04A 4JLWA 3QP9A 4BOYA 3K2EA 5C3MA 4ALKA 2AEJA 4OAQA 1PQUA 4MP8A 2Q46A 2OL4A 3VDRA 3JQGA 1JKFA 1F06A 4MP3A 4NIMA 3UUWA 4D44A 3I52A 1GFSA 2DPHA 4NHEA 1YRLA 2NVUB 1XG5A 5L45A 1CIVA 4CLHA 3SC4A 4GQAA 2CDBA 3RSHA 3OH8A 3JD4A 1ISJA 4LN1A 2CD9A 3ONFA 4NBUA 2AMFA 4B8WA 3BAZA 5JC8A 5GY7A 3IS3A 3PJFA 5ENDA 2DQ4A 5HA5A 3JQBC 1YKFA 3M6IA 3N74A 3HDYA 1P1KA 4JBIA 1KY4A 3SXPA 3WBBA 2DUUA 1MB4A 3DHNA 2CUKA 2WD8A 3IDSA 4AJNA 3BIOA 5BSEA 2ET6A 2OP1A 3TQHA 1YVEI 5ICMA 1I3LA 4R54A 2X9NA 3P2YA 4EJ6A 4PLTA 2ZCVA 3ZNQA 4D7AA 2X5KO 2Y1EA 3E18A 1T24A 3LU1A 1GCOA 3L6OO 4OKNA 3ZWCA 4GI2A 2FMUA 4JJGA 1T2EA 2AHRA 4YEDA 4U5QA 2VZ0A 4CM3A 4Z0TA 4I9NA 2CDCA 1UDBA 1W8DA 4DL9A 1U9JA 1O95A 2BD0A 5F5NA 1QMGA 1A72A 1BDBA 2X0IA 4WEOA 4FQ8A 2GN9A 4IJWA 1IY8A 4IGEA 3WFIA 4ONEA 3PVZA 1OC4A 1V3TA 4JP2A 2O4UX 4DLLA 5JCXA 4UAGA 4DA9A 4RPGA 4OH1A 3QVTA 4JQCA 5ES3A 4I9UA 1JU9A 2Y05A 3GNTA 1BVRA 4CV2A 1YB1A 4NJOA 1I3MA 1W73A 3VKUA 3ZGYA 1BXGB 3GDOA 3PLRA 3S2FA 2H1SA 3OQ6A 4QEDA 5DCUA 3FSRA 5G4LA 1RM0A 3W8FA 2JD1A 2NVBA 2CDAA 1PL6A 4BVAA 2FPIA 2NVWA 3LT0A 2JHFA 2DBZA 4TMFA 5IG2A 1Y5MA 1T2FA 3BTOA 3C24A 5EN4A 3WGIA 4L0QA 4CLXA 4WOKA 3PP8A 1M76A 3RJ9A 1E6EA 3IOYA 4TQGA 4PVCA 4BO9A 4M8SA 1H2HA 4S3MA 5JAZA 3PYLA 1M67A 3EDMA 4Q3BA 4KUHA 1LDMA 3GOHA 3I4CA 2B69A 4MJLA 4FFRA 4RLHA 5DZSA 3VPXA 3JQ6A 3ROQA 5IZCA 1NASA 5JO9A 4W6ZA 4UUMA 1C0KA 4XX0A 3RASA 5JY6A 5KJ1A 1VJ0A 1O9BA 3L0DA 1YO6A 3LZ6A 1YB4A 1VI2A 2IZ1A 3BMOB 4NBWA 4LSWA 5JMWA 3M1AA 5A02A 1LSSA 3DHEA 4Z0HO 5DT9A 2I9PA 3MTJA 1ISFA 1KVSA 2GZ1A 5FI5A 5LCXA 3QIVA 3EMKA 3TZKA 5I9LA 1G0NA 3GGPA 4GSLA 4XRRA 5TQVA 1TI7A 3S1LA 3VOSA 3W4IA 3O38A 3GNQA 4WKGA 4WNIA 2FZEA 3OIFA 3E82A 4WLUA 1GD1O 2WE7A 4E5MA 5J23A 3W8EA 2RHCA 3NT2A 3F1LA 2IYOA 4C7KA 1FF9A 2DAPA 3MJ4A 3WOHA 4GSKA 4W9NC 1RYDA 3ANNA 4O0LA 1V3UA 2OBYA 5KKCA 1LDBA 4U8GA 4ND3A 4YCAA 3AI2A 1P9LA 5L53A 1E6WA 1WNTA 1UXHA 3QRWA 1X13A 4EW6A 4IGFA 3BTSA 1J49A 1Y1PA 3DMYA 2BI7A 3DB2A 5IDYA 3HFGA 5DCWA 3JQGB 3ZWYA 1K6IA 4XIJA 3NV9A 3LDHA 2EKPA 5KJFA 3MJSA 1QXSA 4I5FA 1E1MA 1D4FA 2EV9A 3LQFA 4CLRA 3PJGA 1ULUA 2HJSA 4NU5A 3DAGA 4MVJA 5A05A 2EW8A 2GF2A 1PGPA 2NU6A 2DM6A 1R4MA 1WVGA 4RDIA 1E5QA 1SB8A 3TZQA 3HADA 4N7RA 2J5RA 4L4XA 5ILOA 4DXHA 1P0CA 3E5RA 3GMSA 4L74A 3I9LA 4IUYA 4LSMA 2PZKA 2I3GA 3BHIA 1ZW1A 3JD3A 4GWKA 1Y5RA 3JQCA 4BQRA 1WDKA 2CVQA 3NDIA 1O0SA 2G76A 2ZJ1A 3LSYA 3C1OA 1PJ4A 4S1VA 3QQPA 1RWBA 3GG9A 1LEHA 1QR6A 2QQ5A 3GZNA 4Y6SA 1CRWG 2P4HX 3RAJA 3E1KA 4E12A 4D0SA 4XB1A 1JA9A 1HE5A 3H8VA 4OSPA 1Q7GA 2Y1CA 2O7QA 2IEDA 1XSEA 2G5CA 1B8UA 2YY7A 1YL5A 3H7AA 2HKIA 3H6KA 1PJ2A 3AY3A 1LA2A 5JYEA 5JDCA 1EQUA 4WGGA 2I99A 2HCTA 3QWBA 3OQ1A 4ZICA 2I66A 2IRWA 3SC6A 4GVXA 5CG1A 1IE3A 3Q6IA 1ML3A 2C59A 5T6BA 3IJPA 2EJVA 3GVXA 1E7QA 1TXGA 3ZWXA 1PQPA 3S8MA 1T1SA 1E1NA 4FFLA 4EEZA 2ZKLA 2VT3A 1R15A 1WPQA 1GQ2A 4DLAA 3RU9A 3ETGA 2D2IA 5EPOA 2QZZA 3TN7A 1HDRA 4XQ9A 5COAA 3NRCA 4X54A 1Y8RA 1V8BA 4B3HA 5ENVA 2A35A 3PDJA 5B37A 3WICA 2CF5A 3DZBA 3T7CA 5JDIC 3VDQA 4HBGA 4TROA 1UXIA 4R3WA 5U1PA 4FPXA 3C3XA 4BNUA 1LU9A 2DTXA 1LQUA 1NVMB 4HADA 2FR0A 4MKXA 3VPHA 5CEEA 4YT5A 1K89A 1TT7A 2O23A 3FF4A 4QECA 2Q2QA 3PFWO 1GUZA 1C0IA 1S6YA 4L75A 3EYWA 3QA9A 3E9NA 3E9MA 1B15A 3W4KA 1SCUA 4R16A 2YHUA 2HK8A 2X5OA 2PGJA 3WGGA 4BNKA 1RJWA 3LYLA 5BQFA 4NU6A 5TT0A 2FPGA 3MWDB 3HN7A 1I2ZA 4Z9YA 4H16A 3RBVA 3VVBA 4DGSA 4L8VA 3V2GA 4DYVA 3KXDA 4RO0A 3IQDB 1XQ1A 4CMEC 4J49A 1ORRA 4YB8A 3U49A 1U8XX 1U1IA 4FFMA 4NQZA 9LDBA 2VCYA 4NPCA 1EUCA 3OIGA 3WQRA 3MWEB 1U2GA 1HSZA 2J3JA 3PFFA 3MJVA 3GR6A 2ZYGA 1JTVA 2NQTA 5KVVA 4FC6A 3I3OA 5FF9A 2B5WA 3F5QA 4GKBA 1ZEMA 1V3VA 4CUJA 1XCBA 3ETDA 2Q45A 3LK7A 1D3AA 4WCDA 4B4UA 4EZBA 3A06A 1V9LA 3WSWA 1ENZA 4R5MA 4BQPA 1SEPA 1ZJZA 2EKQA 2O3TA 4MVJD 3AOEC 2HSDA 5THQA 3OEWA 4BNZA 2ZJ0A 1P31A 2B4TO 4Q3AA 4CLRB 2WSBA 2HK7A 1J5PA 1GZ4A 1A4IA 1G1AA 2VT2A 1R4MB 4RF4A 4PIVA 2A4KA 1NQTA 3G0OA 3I4FA 1PZGA 1SZJG 1H9BA 4PFJA 1N7HA 1NFQA 2BRUA 4AJ1A 5BT9A 2VQ3A 5DBIA 3UGKA 3GPDG 5BNFA 1HDXA 1B26A 2DT5A 4G81A 4XIYA 5CP8A 3TZHA 2PD3A 3PHLA 1GL3A 3GT0A 3AY6A 2YYYA 1ARZA 2VWHA 4FJ1A 2AE1A 4M1QA 3PQFA 1Q0LA 3ZWVA 3IAHA 2JD0A 3RU7A 3B6ZA 3EVNA 1A5ZA 4OSOA 2POQX 2JCXA 4DC1A 3ZWMA 4P4NA 3P2OA 5CEFA 1T26A 3Q3CA 1KEVA 1G6KA 1YDWA 2DTEA 2W4QA 1SMKA 3VH4A 4BKRA 4BS9A 3UH1A 4RQUA 1X0XA 3IKVA 3QHAA 4YBZA 1MC4A 4NJMB 1R4NA 5TIIA 5A4DA 2YQ4A 1WMAA 3GEGA 4PLFA 1WZIA 3KBOA 1OAAA 4J4BA 2C7GA 3JQDA 4J43A 3UOGA 4CM1A 1PJQA 4KDEA 4LVCA 3KM0A 4GMGA 1NXQA 3RC7A 4XRGA 1XU7A 1BG6A 2C07A 4OHUA 1PGOA 3CMMA 3GDFA 2OFPA 3WTCA 4QX6A 4OXYA 4NI5A 3D64A 3DAPA 4MINA 2Y68A 3INRA 2YHIA 2Y0DA 2PZMA 3W4JA 4MO2A 1K2WA 3ENKA 4AVYA 2X8LA 4B4OA 1PJSA 1Y8RB 1AN9A 3CKYA 1DIGA 1DO8A 3DZKA 4MDHA 3HG7A 4BV8A 4FFPA 4F3YA 2FSSA 4C4OA 4QFDA 3PIIA 3AU9A 1EK5A 4A7PA 3LLSA 5EIOA 4HNHA 3IKTA 2O50A 1UR5A 1SEVA 1EDOA 1JQBA 3CMCO 3FTNA 3D3EA 4XGIA 3VH2A 3W8DA 4IJUA 3WSVA 4JK3A 1LUAA 2RH8A 4DIBA 4P8RA 1L1FA 3MTGA 2Y0CA 3QW2A 3VVCA 3ZU3A 2NTVA 3U09A 1XR3A 5JYDA 4WECA 2JAPA 1JW9B 2PKQO 1DLJA 1DRWA 3KOUA 3RUIA 3H3JA 1AHHA 3Q11A 3GG2A 5AVOA 2XXJA 1VKOA 4WLVA 5I7SA 1RYEA 3ANLA 1ZCJA 3AU8A 4B3IA 2H63A 1ONNA 3PIDA 4YT4A 3FTPA 3ZI0A 3A4VA 3AUUA 4JBHA 3BHJA 4GX2A 4OMUA 2GUGA 4KTTE 5ILGA 4OOEA 2Y1FA 1LRLA 2FN7A 1GYPA 2C54A 3QJ5A 1KVRA 1UP7A 3H2ZA 2ZTMA 2C7VA 2O3JA 4E2WA 1ZKMA 1IHXA 2PGDA 1HZZA 3KSDO 2HJRA 4XDZA 3O8QA 4D0RA 4R3NA 4IMRA 2Z5LA 4WCFA 1U4OA 3JYPA 2G17A 4GGPA 3ZZNA 4BB5A 1X7DA 3PTZA 4IINA 4L73A 2BI8A 3JQ8B 2B37A 1LDGA 2A9FA 2GN6A 1OI7A 3Q0EA 4KUGA 3OMLA 3WFJA 2B83A 4IBOA 4RQTA 4CLOA 3FBTA 1GYRA 2HLPA 3PZBA 2GYYA 4JCOA 5IN5A 3Q1LA 1JKIA 3NYWA 3GLQA 4GLLA 1ADCA 4BHTA 1EVIA 2JFHA 4YR9A 1PU2A 3F1KA 4PLZA 4PN3A 2QYSA 2UAGA 3PJDA 3WIEA 3ZU4A 4ZJUA 3PYXA 4BGIA 3JYLA 5IXSA 3VTFA 3DOJA 2OORA 4CMEA 3C7AA 1J4AA 4MVJH 4EBFA 2AA3A 3WIDA 5L4NA 2JCVA 4J4TA 4IDCA 2D1YA 4NFYA 1MX3A 5JBIA 3GH3A 2X0RA 3F47A 3RKRA 1LLQA 4QT0A 2PY6A 3VKVA 3IL2A 2PD4A 2C82A 3V2UA 1K6XA 2W8ZA 4PLCA 2D59A 4UVDA 4P38A 4ZU3A 3ROMA 1O6ZA 4XA8A 4FFNA 1M66A 2B5VA 2ZQYA 3C1TA 3VZQA 3ZV5A 1B2LA 4B3JA 1XQ6A 2PKRA 4BUCA 5CDSA 4M86A 4XYLA 2C0CA 3PWKA 2EERA 4GL4A 1I3NA 1JKJA 2B4RO 1BXKA 3BMOA 3E9QA 2UYYA 3NJ4A 4J7CA 3WLEA 2PGLA 1NTOA 3L77A 1T1RA 2VRBA 2PH3A 3GFBA 1AGNA 3EW7A 1WXDA 4Z9FA 4R5HA 1ONOA 1R4NB 2VWQA 4MIOA 4BB6A 1BTOA 1PJLA 4FIZA 3X2FA 4HUJA 4U6QA 4EJMA 5C7OO 2NADA 4BNFA 4MVJP 4IDAA 1UDAA 1C0LA 2DVMA 4R4JA 3ZNOA 3DBLA 1P44A 1UP4A 1SNYA 1WW8A 3H9UA 3B70A 4NZ9A 1HWYA 1JVBA 3CPSA 4G65A 5L51A 4ZRNA 2FWMX 1IOLA 3QV1A 1LLCA 2P9GA 3DTYA 3PGXA 3ZNPA 3PWSA 3JV7A 4RCVA 2YHIB 4BMVA 4TRJA 2UVDA 1GQYA 3ZN2A 3EZYA 2HMWA 3I83A 4A10A 4OQYA 1PS0A 3HWRA 4AJLA 3V1YA 3L4BA 1CQJA 3DR3A 1K3TA 1DIRA 3E03A 3NAQA 1ENOA 5DN9A 4FW8A 4WLNA 5BSHA 2ZTUA 1YE3A 2C29D 5HM8A 4L4RA 3UF0A 4TRMA 1QYDA 1MV8A 2BH9A 1SPXA 1YXMA 4JX8A 2GN4A 4JP3A 1GEGA 4UVGA 2VWPA 3I23A 1H6BA 1NM5A 3DC2A 1DC5A 5JDCC 3WMWA 4J7UA 4PZCA 4YAGA 4N5NA 2OMEA 3HSKA 4YRAA 3AM4A 4ZQFA 4EDFA 5JAMA 2J5KA 3HUDA 4F46A 1R12A 5HWSA 1X7HA 2OGUA 4XGKA 4PRLA 3WNQA 1VM6A 4EUHA 1EBUA 2W98A 4AJPA 4UUPA 3GAFA 4I08A 2B0JA 1AXEA 2VWGA 4WASA 4Z0PA 1B16A 2H9IA 2Q4BA 1I5RA 4J9VA 1R0SA 2O3RA 4RVSA 2DFDA 3IUPA 1E3LA 4CLDA 5TT1A 3H9EO 3AOGA 5U4QA 1DIHA 1NAHA 4KQXA 4W82A 1J0XO 5CHEA 2CY0A 3R3JA 5B4VA 2YFQA 2BGKA 2Q1UA 3OEYA 3MJCA 1I32A 5G0TA 2EP5A 4R1TA 1IPEA 2B4QA 3HN2A 2IZ0A 3RBXA 4AJJA 5HTOA 1JVSA 1OBFO 3P19A 2EHDA 1LI4A 3O8QB 1MFPA 5FFFA 5I7FA 4WCFB 4GBJA 1OC2A 1R66A 5IFLA 1AE1A 2Y66A 3Q9UA 2HMSA 1DAPA 4JBGA 1A27A 3P5SA 4JGBA 1E3JA 2I6TA 2BGLA 2P9CA 1H2BA 3GRKA 2GN8A 2Q3EA 2W2LA 4CLOB 4CMKA 4FGSA 4FS3A 3H9QA 4AJ4A 3I9OA 4ZQBA
chains in the Genus database with same CATH superfamily
1A4RA 2QG4A 4FUTA 4S12A 5HZHA 1T0BA 5TGZA 1T8PA 3P9RA 4GPD1 2EX0A 1UXOA 1ZSVA 3LT5A 4C0WA 3ADPA 3A1WA 3TLCA 3QU5A 4HEA6 4YTEA 3BSYA 4MHOA 4N4AA 4M36A 2RG7A 2GA9A 5IJZA 1JEQA 4X9XA 5FOSA 5SYNA 1BKDR 2Q3CA 4I55F 5KQSA 1TTQB 4J0KA 2CHUA 4IRMA 2H0AA 2P67A 1GNRA 3KQYA 1NIPA 2IPNA 5DIZA 2P9TA 2RI1A 3LCUA 1KH3A 1QH1A 3WYFA 5FWXB 2C9OA 1QIJA 5BW5A 2P1RA 3A1CA 3BL8A 4OD0A 4QFCA 1P1RA 3X1XA 2WJIA 2GHRA 5HP4A 4O63O 5IKMA 1L7MA 4DLWA 1TEVA 5B2EA 4OX9B 3OETA 5CNMA 4BNLA 1GPAA 1KMHB 3PXAA 3SX2A 1CPYA 2HR1A 3AJDA 2ATXA 3LT4A 3MEQA 4D25A 3SF8B 3LZDA 4RAQA 4PR3A 1M6NA 2V6JA 1C4XA 1GA1A 2VZ9A 4WOJA 5EJ6A 3I9MA 2ZJFA 1UMCA 4ZYYA 2E6KA 2LUOA 1GKKA 5KNBD 4WXPA 3CUTA 1L1EA 1Z56C 2HNKA 3HCRA 1XQ9A 2ADMA 4A8JB 4D57A 5JT1A 1Z82A 2FEKA 3ITNA 4KVZA 2QD2A 1FUKA 2D62A 4R7GA 4MWOA 4ZMSA 4ESVA 1WZEA 3AL3A 1OR8A 5BNWA 5L7TA 4NHOA 1Z0UA 4QTZA 1YR3A 5JEDA 2J3IA 4MKFA 1W76A 1UKAA 1Y81A 4HAIA 4ZDWA 4Q21A 1IOZA 2P11A 1H0SA 3PLNA 4WFJA 1ZH2A 1T4CB 3GJSA 3QXCA 4HAZA 1JZQA 4YECA 5FUBA 2F1JA 4FB4A 1VYUA 4DREA 1YNOA 1RVV1 3TOZA 1XVUA 1ODSA 3DBLB 4J0FA 4D9CA 1CY7A 3AG6A 2J31A 2BRUC 2DUWA 1QCYA 1DUSA 1OTHA 4NEQA 3I30X 3DDOA 1QOQB 4YACA 3WB0A 2D7DA 4II7A 4AZ0B 1J24A 2UUCB 2VRCA 5ARCA 2JIQA 4AFNA 3R9WA 1XQXA 5E95A 3R3XA 5JSYA 2J9RA 2O1XA 4FILA 1V71A 3DFMA 4DJAA 2RH4A 2IYVA 3GFQA 2GK6A 3Q7PA 4KCGA 4TWIA 3MFYA 1P4SA 1IJBA 1CQJB 2HQRA 3H9JA 2CWWA 2X14A 4GLFA 4Q12A 5EYPB 1ABBA 3U5TA 3A2KA 4MPPA 1CDZA 4YUWA 1BU5A 2QE6A 4TKMA 4N0EA 3MGBA 4PZPA 3KWMA 3T1OA 2ZYDA 1D1QA 2D0PB 4KR6A 5IAJA 3ZK8A 3I76A 2FUG1 3A9WA 4H60A 1E6LA 3FFWA 4HMOA 1O5OA 7ADHA 1CTQA 2HBZA 5AUOB 4FFBA 3GJ3A 1FFXB 3LL7A 3M8KA 4BZZA 5F9HA 3TS1A 2IHKA 2F9LA 5JZSA 2P9EA 4AO7A 1YCHA 1G20E 3JYOA 5ECDA 1XMQB 3KK0A 4PO8A 2EOAA 4BNHA 1HSOA 1NKVA 1VBFA 2BC9A 2XE4A 4IKOA 4X90A 5BYAA 5DWDA 1P73A 2XT0A 1GY8A 1Y9AA 1G21B 1JA1A 2CFSA 3A1VA 3EULA 1USIA 3CCBA 3SQOA 1HNXB 1CZUA 2JFWA 3CX7A 2I2XB 4P33A 5HMLA 4I3HA 3OLCX 5JXHA 4M0PA 1KETA 1T4DA 4TV9A 1KF0A 1TJNA 2FN9A 4CF4A 2XBMA 1ULZA 4XIFA 5HUHA 5AK0A 4H17A 3OZGA 4Y30A 1COWA 5MHTA 3NEJA 1X9IA 4W7IA 2G04A 3KB1A 2PS1A 1BWRA 4CG2A 1PIWA 1Y7TA 1EFPA 1HT0A 1NVWQ 3I04A 3JYQA 3K8YA 4P35A 1CVLA 3CCFA 2NO7A 4MW4A 4D8TA 3ZXSA 4JKOA 3QBEA 4QTTB 2BE9A 1EVYA 3NIFB 3OC6A 3PRKE 2ZSEA 3C3KA 5I5EA 3KP1A 3ADBA 1X8XA 1YQQA 2JIRA 1XRQA 3ZXIA 3QPBA 4A0SA 1SKQA 3OT5A 5JBQA 4RPCA 1T2CA 1D2HA 4IDEA 1A2KC 1W34A 1NQAO 3ILXA 5LP6B 5F12A 3I09A 4BNTA 2WYHA 2BKAA 4BNMA 3F7TA 5FLXA 3K0AB 4YQEA 3PU6A 3V4FA 1ZXXA 5BSUA 4CI0B 4TTIA 5JADA 3SLKA 2GZ2A 4IV0A 4RVFA 3PK0A 2HU8A 2W6ZA 3GCWA 3CVOA 3HYCA 4NJMA 1BMQA 3IUMA 3PT5A 3FVRA 4NF2A 4KBYA 3OP4A 4OJMX 3RUAA 2YWJA 2HK9A 3KVVA 3LPMA 1QX3A 4X20A 3MD0A 4D9FA 5JLJA 5EMJA 1HC7A 2G6TA 2VO1A 1U4NA 3LWBA 1XXLA 2A7QA 2RK3A 3M81A 2OFOA 4QYSA 4G5HA 4J7XA 5E2AA 5CBPA 2PBZA 1GV0A 2VPZA 3GUYA 1KZHA 4HS4A 2B4YA 3BXXA 2A94A 3ZZ0A 5IDXA 3OX1A 2XDAA 1T1GA 2QLNA 3I12A 5IJ9A 3PE3A 4AZVA 1GV1A 1VGQA 1OU4A 1UMKA 1YD7A 2R1VA 3GZJA 2SNIE 4OJKA 1QR2A 1UBRS 1XRMA 3CGGA 4CTJA 1N6OA 5EUBA 4GC9A 4JJFA 2J41A 2EJWA 4RA9B 5BW4A 1C1DB 2RGAA 4FWTA 4K6KA 5T4FA 4A0GA 5JZBA 2WT9A 2YJ4A 3E23A 3ZHYA 3BCRA 3FNHA 1PK7A 3GHYA 2HFKA 1WV0A 1UXJA 2YC2C 4EI2A 1NUHA 3STUA 1S2GA 3RAPR 2PQ2A 3DBRA 1VP9A 1IN6A 2LTAA 4RJIA 1L4YA 1XZEA 2ID9A 1WB9A 4WNAB 1Y42X 1ZCZA 4I5EA 4E88A 3EQ9A 5DNCA 1CK4A 2R8YA 5JFGA 1N32B 4R2JA 2F4VB 3EPPA 1K7YA 1E77A 1S1MA 1UMDB 2ECKA 2QM3A 4LNUA 3WB9A 4I4LA 4HVLA 1JXMA 5WRFA 2ORWA 4UBJA 1K2VN 2R8BA 3G8YA 1XUOA 3KR2A 1A7UA 3ZI4A 2Y76A 3JTEA 5DX8A 1J06A 1OAOC 3WV4A 4E32A 1SVNA 2X8AA 4DLSA 2HHHB 1E5VA 2F1IA 3JQEA 1D2MA 2I87A 1CUCA 2NAFA 2YZ7A 1A2QA 3T1VA 1ZMOA 5ITVA 3THXB 1CUGA 3K32A 4MCJA 3OQHA 2O2XA 3C6KA 5B1DA 4UTVA 3VR4D 2E5WA 1MT3A 2ADOA 3IMFA 4L5AA 4NJEA 4LGCA 2O48X 4KQ9A 4O4LF 5CT5A 5KNBH 1OZFA 4GF5A 1BVHA 1W9MA 1II8B 1YH3A 2EXXA 2LNDA 4JODA 3SZLA 2D5BA 1KC1A 4LYHA 1NV9A 1PL7A 3IIJA 2V7PA 1QGUA 3MCZA 5BOSA 2EFHB 4BKQA 3BZWA 4GMKA 1KI6A 1NJ1A 5DYWA 4NG5A 1RYMA 4L9SA 2XVXA 4Q9HA 1M6EX 4QULA 1CJCA 3LQ4A 4LCJA 3CH7A 2Q8PA 3PRJA 4I5GA 4DMGA 3TLGB 1VPTA 2PT7A 4FVTA 1OJ7A 2NZ2A 4EG0A 1DS6A 2VHEA 2J9XB 4NXMB 1A97A 4CLXA 3VA7A 1EVQA 1B3RA 1M34E 2LKDA 2IDZA 3MWYW 4MMXB 4L8GA 4ZGWA 1ECPA 2NZJA 3IT3A 3MCUA 3VX3A 2VH5R 1E1CA 1H2XA 2I67A 1W4ZA 2PX2A 1N2ZA 3IB3A 4PHCA 2G77B 4PG8A 4LG1A 1C1HA 1VIDA 4A73A 3C14C 2R85A 3JQ8A 3E5NA 3EF3A 4KP7A 2QMYA 3KBBA 4TVBA 4UTPA 1JFTA 3GOQA 5TQ2A 4ND8A 2ZANA 4YPOA 2VUIB 2NYRA 1A3CA 1JE1A 2GJKA 1K66A 3G9TA 5IF3A 1U0BB 1PZFA 1E1KA 2FHSA 3Q5GA 4DKXA 2LZ0A 3DDHA 4QDOA 1FUEA 1DAGA 4WLFA 3Q8WA 4G01B 1EB8A 2QD5A 1GQFA 1N5DA 2ZAGA 3DZHA 3QI7A 1I8TA 3GXOA 4LDRA 4E03A 4KO3S 1PT5A 2X3UA 3IEPA 3VKFA 1XMOB 2IHJA 1IATA 1QP4A 1N2JA 3F7OA 2HEIA 3ICEA 2DFLA 4DDHA 4E5KA 2A1UA 3F6CA 3ZVKA 4BXOA 1YQGA 1NBMA 4MR8B 1L8XA 1OFGA 4U6SA 4CCYA 1MAVA 1SJ9A 1HE3A 4FJ0A 5G2OA 2BGWA 1A1SA 3QG1A 4U7WA 4YPFA 5JJ5A 2RHRA 3DD5A 1XDUA 4ZCMA 3A6HA 2MMGA 3F97A 3FSJX 5AW3A 1AQJA 4JV5B 4RIHA 1SQSA 2D74A 1RM4A 3ZDYB 3A4YA 3OECA 3GLHA 4BO4A 1DTEA 2EZUA 5K3OA 1SUSA 1SBCA 5GINE 5AW6A 1ID1A 4DSZA 4G37A 1JEOA 2JCGA 2D1FA 3DWIA 2EWWA 2QTWB 3FUCA 2Q4EA 3UCFA 3VC7A 4XPIA 4GKVA 4NENB 4E09A 3ESRA 4J03A 3PGJA 4R8SA 3RFUA 3ORFA 1H2ZA 4A8HA 1RQGA 4A26A 4W1QA 3EXHB 3RS2A 5JAPA 4QT4A 2QBYB 2QP4A 4Z4CA 3PTAA 5BPFA 1A82A 3QKRB 4G1BA 1NW8A 4HDNA 4HS9A 4HB0A 4KUEA 4UDYX 4B33A 1YL6A 1FVFA 1NL3A 2JKVA 4X1IB 5JS2A 4YXWD 3OZIA 1WG8A 5DEOA 3HJHA 2PZAA 5J1TB 2AQ8A 2IEZA 3DHVA 5DLQC 3IC5A 4Q9LA 5E7JA 3IR5A 4FYKA 5H4GA 4RVOA 2ZK7A 5J3JA 1R5OA 5CDYA 1D4AA 3FI0A 1QV7A 2DKFA 1LK5A 2PAAA 3E27A 2XMCA 3HB4X 3KT8A 1HH4A 4XGNA 3ENNA 1QH8A 1QQ6A 3PVSA 3EDOA 3N7AA 3ZWOA 3U6BA 2ZVJA 2YDXA 4ZT6A 4D4KA 2R84A 3TNDA 2RAUA 3AK4A 3NTQA 4BN0A 3ZU6A 4WQMA 3ZY4A 1XRSB 4RHTA 2PPVA 1GNSA 1J42A 2W93A 5TY0A 3EFHA 1ISPA 1BZYA 2A0YA 3RIYA 3VJMA 4D02A 1SKMA 1TJYA 4RTSA 5I9SA 1CEEA 1LY1A 4OOFA 4EH1A 2IU4A 1YA4A 2FH5B 3FOAA 4GHWA 4JXXA 4HFJA 4WGFA 3EGVA 3QWAA 4NQRA 3TW8B 1VRWA 4NPHA 1RHKA 3LX8A 2CXPA 5CBPB 1FDSA 3PICA 3CW2A 4K46A 1U9CA 3LS2A 4IIXA 4IMIB 4JC0A 4IIJF 3TI7A 1L3CA 5KPDA 5EXDA 3HCBA 3K9LA 4LDZA 3N2YA 4D3SA 4GI7A 1NMXA 4MS4A 2Z8YM 3KHSA 4V1CB 1NMQA 2WINI 3UPTA 1MEEA 1SVKA 3HDHA 3PFIA 2PNJA 3PKZA 2PXHA 4FI3C 4RMIA 2AOTA 3QVGA 1FMCA 3QJGA 3R0XA 3THWA 1WBJB 3KYDA 3RD5A 4WT7A 1B6TA 4E2FA 5HIKA 1W85A 1PVOA 3X44A 1OFIA 3EC2A 4MQEA 5PGMA 3TD2A 3JZDA 4W6QA 1Y82A 3DD1A 1A69A 1IHDA 4U7GA 4QM6A 2ZR8A 4OGWA 1XVAA 3JRXA 1U7HA 7GPBA 2XGJA 1QWSA 4KWHA 3DH0A 4K2HA 1GTZA 1QX4A 2CYBA 4ADSG 1N6RA 1IWOA 2XF8A 4DCJA 1TC1A 4V03A 3HNPA 4FDVA 4Z9XA 1DFIA 1E92A 1WQ4A 5LQUA 1JJ7A 3HB1A 4B71A 4BCDA 3D5EA 4HTFA 1ZJ4A 2OP0A 3Q3HA 3ZTYA 3ZLTA 1LNQA 3VR4H 1Z6GA 2EZ9A 3A4TA 1C80A 1WUHS 5HF5A 2P62A 3UKDA 5IBPA 2CCGA 1EGAA 3LKZA 4O2BB 4PCVA 2J32A 3WJ2A 3HMQA 4BMZA 2XKJE 5F5LA 3ND9A 4M0DA 1FZQA 2ORIA 1VJCA 4HGPA 1DQZA 1EDBA 1Z35A 2HQOA 2FFRA 2Q4RA 4LE1A 1ZVQA 4GZLA 4Y6GB 4PQEA 1N2CE 2PWBA 4KREA 3DOFA 1RAFA 2PKWA 3GK3A 2I29A 3GLFE 1N8SA 1UJ4A 2FWPA 4AJKA 1LDEA 2OC4A 3PR1A 1U1CA 5JAUA 1PO7A 4NP6A 1NQVA 3PUWA 2QMEA 2F1KA 1CUBA 2M6SA 1DLIA 3Q5EA 1N92A 1YR8A 2QN2A 3UCXA 3PSAA 3ZHRA 5CB4F 3ZV7A 3A58B 1ISMA 2ETVA 3WGMA 3EMVA 3GA0A 1GEEA 2P2GA 1CY1A 3AFNA 1AF7A 3NH6A 3MRXA 3EHEA 1T8WA 2R00A 3EZ9A 3JS5A 2E4WA 5BSFA 3EODA 2GKSA 2XZLA 4K26A 3QEAZ 1PBTA 1SC4A 2R7LA 4LEIA 3UAXA 4HAUA 3UYKA 2O8DB 1R10A 3DJFA 2XB9A 3FOCA 5A3VA 2OYRA 5K6AC 2FN8A 3HUFA 4B09A 1NVVQ 2ZXEA 2IF0A 2OZVA 4XYMA 1AM4D 1BN7A 2BGMA 2YOHA 4OU5A 1SXGA 4S1TA 1GO2A 3KYCA 4LHWA 3HB9A 3IOCA 4BRZA 4M1WA 3NIWA 5LA6A 4DBVO 1FE8A 3WA7A 5FI3A 2ZRBA 2JBAB 1Z3IX 3KO8A 2H31A 3E61A 1QDLB 1RZ3A 3DLAA 1D04A 1XTPA 3CINA 3FCSB 1YIAA 3L0PA 4OK5A 2XUFA 3HXLA 1GAWA 1UIMA 3BERA 3HP4A 4RC9A 5DRTA 4IGKA 3HPQA 2ILVA 1PDOA 3ASZA 4IGIA 4KQJA 2Q3MA 3T7DA 3HSSA 3B7GA 4ZO6A 1E20A 3CXRA 3L6DA 1J0CA 3CLHA 3H4MA 2WG1A 4FZRA 4ARVA 4IM7A 4MYRA 1SOVA 3KDAA 4BEJA 4CT4B 4DEXA 2FQYA 4YWHA 1DP4A 2YIDA 5LDGA 5AVTA 3U7JA 1XZPA 2BEWB 2Q0QA 5DTMA 2CNBA 2WJWA 2FPXA 2LR0A 2I4RA 2Q9AA 3B3JA 3RTAA 4CDNA 16PKA 1MA0A 3ONVA 2ZULA 3CCCA 1D6MA 3E3LA 5J59A 4DLYA 2C7RA 1QYCA 4FJ2A 1NGSA 1VHTA 4K3VA 5BW8A 4XWTA 3OF2A 5ERYA 1GZ3A 4Z0NA 2P4SA 3OTHA 1O89A 3ZWBA 1JTEA 3D0OA 3C6QA 3SBOA 2CXSA 4AYXA 1A1VA 2A59A 2DBQA 3TMAA 1VMAA 3GJQA 2XWBF 4RD6A 1LFAA 3OPNA 5LNK1 3GJ7A 1DWOA 1BWQA 1GPUA 3QELB 1OI3A 3CW8X 2QAJA 3IALA 1KYIA 4BLTA 2V98A 4J6EA 3KOXA 3FCOA 1I1QB 4ZCLA 1IHPA 4P84A 3HVUA 5A9TA 2D2FA 3V7NA 2IEIA 4AQDA 2QMHA 3R5TA 1J8QA 2NO6A 1WZ2A 4KODA 4KXMA 3RC9A 1P80A 2GPNA 1VGRA 4GDFA 1SQ5A 4KQFA 2C5HA 2CMFA 3MSXA 2QUAA 2JH9A 3UFXB 3AJAA 3EDQA 4RDHA 2HMYB 1S1CA 3ZWQA 2FEWB 1B3BA 3JQAD 1U3VA 2O8EA 1C8VB 1D1PA 4WESA 5T8KA 4FCTA 2ONJA 2WWRA 3I6BA 1KKLA 4AG3A 5FXMA 4DA8A 2NPOA 1HDYA 1O6GA 3CZAA 3U62A 5KJ6A 3TSZA 3IAUA 1BHJA 2P6UA 3UXMA 1XROA 2FF7A 2GEUA 1L0BA 2CN1A 3DQPA 1NDUA 3JR7A 3ZWPA 5EQJB 3U48A 2GZHA 1BXZA 1V45E 2G3YA 2Y67A 4JYPA 4KJZA 3ZCPA 3IVRA 4B45A 4DVJA 2QYTA 2MJLA 3BXFA 3FR8A 3LUCA 4NZNA 9LDTA 2A6PA 3E7WA 4IDOA 5EQFA 7MHTA 2OCYC 2BJHA 2GEKA 3PEUA 2WA2A 4NU8X 4QRHA 3RUHA 1JBKA 2QJWA 3NU1A 1E1YA 4AL4A 2EW2A 1HDZA 3I8OA 5D3ZA 2PL1A 5CYGA 2IIQA 4RAOA 4KPYA 3NOXA 1X7YB 4QSMA 4IR7A 3U44B 2EIHA 3FJYA 1XLUA 5CLJA 1QIHA 1J0EA 3K31A 2Q1WA 3FNFA 3SJ7A 3PQ2A 2ECFA 4N9QA 3DOEA 5E1BA 3BJEA 3HU2A 3SXJA 4UTRA 1AX9A 2FPPB 3P96A 3V6LA 2HWXA 1D2RA 4EDHA 2PO7A 4LSZA 1Z73A 1XYGA 2PSSA 2W6JD 3ASUA 1IU9A 2CUZA 4IIVA 1VJRA 4Q47A 1ZM3A 3QNWA 1V8ZA 3H5WA 3I2IA 2YV3A 4CQMB 2E18A 1JP7A 3QG5A 3S6JA 4OLBA 2O1WA 3BUSA 2ZJAA 3HO8A 4DYDA 1UBOS 1YZNA 3PFNA 4BNNA 1QGYA 1XBTA 2PCLA 3PUHA 5CM2Z 1VMKA 4B79A 1YZKA 1XMSA 3HPRA 3DBHB 3FDFA 3KQVA 4K1LA 3VV3A 1H3EA 3QPWA 4P4LA 4J1TC 2NXEA 1DFGA 1QJCA 3INTA 1YR2A 2G82A 2Z3ZA 5ITSA 1V26A 2IKQA 1J6UA 1NWCA 4R1LA 2H18A 3C7TA 3OZDA 5ALHA 5T3YA 4QQRA 4D8VA 3QVWA 1B4DA 1G42A 3HCDA 4YJGA 2OC9A 3E2MA 1YK0A 4P54A 5AI5A 4HZUA 1V8FA 4BE4A 4LYEA 1MUUA 5A5DA 4DY4A 3DTVA 1S2DA 1V4VA 1NBIA 1UKYA 3R7LA 2TECE 5F3WB 2E37A 1O58A 3ETJA 1M8PA 1MHTA 4YRDA 2C97A 4Z51A 5ALPA 5LYJF 2H57A 3RROA 1C2TA 1VE9A 3CF2A 4DIUA 5C2JB 2ETXA 1PK9A 1U90A 1HDEA 3BYZA 3EIEA 2PM8A 3LY8A 2D5CA 3G1UA 1E2UA 4JDPA 5J2UA 4JUCA 1V4BA 1P6QA 4DMRA 2AW5A 2JJ8A 3CQ9A 3RUCA 4CGZA 1E6UA 1GRVA 1JVNA 4U4AA 4D8XA 5CB0A 3G49A 2C4MA 4HMQA 4F3NA 4G6ZA 4BV2A 2WVJA 2NT4A 3PHBE 3QPUA 4BQNA 1MENA 2JFZA 1OVMA 3LPLA 2YWBA 3N05A 4ZC8A 2EATA 1TK3A 4QKQA 5KPJA 1NE2A 1TUGA 5G3ZA 4LMBA 1V9CA 1WXXA 4IDNA 1Z0SA 4MUAA 3OUZA 2AEEA 1RQNA 3LFTA 5KNDD 2BGNA 4YJKA 2JNWA 5LC1A 5AHRA 1WL8A 5HILA 3RYTC 2BTEA 1KSGA 1U2DC 1SU4A 3BD7A 4MYDA 5L95A 4DUGD 3COSA 3E15A 3O8RA 3C2QA 5CCDA 1JPNA 5DHTA 1ZJ6A 2WVGA 3KVOA 4HAVA 2VIIA 2YJ6A 4MR9A 4XSVA 4DT1A 2AC7A 4FMCF 3TEMA 1HMPA 4MWGA 2YJTD 3P20A 5GMOA 5CA1A 1LJUA 3BTUA 4PPQA 2X22A 5J9FA 1IPHA 5JCJD 1KZ9A 1EIZA 3AP1A 4OBEA 4GVLA 3H1GA 3Q9NA 5FIUA 3SZMA 4OF4A 4AKTA 1MG0A 1NT4A 5AW0A 2QAGA 1PHRA 3GPCA 4QXRA 2G9VA 1GUBA 2JZNA 3K6JA 4PFQA 5BRJA 2WQ6A 5DMHA 2A5YB 5KTPA 3B1FA 1RACA 3FZQA 2VATA 1AUPA 1GPWB 2XKBA 4I5IA 4NZOA 4NZMA 3RSCA 3SYKA 3V8MA 3HUEA 4NFLA 4PYQA 4XR4A 4GAEA 4YDRA 1CNEA 4IIFA 3K0CC 4HWGA 3NCHA 1UZNA 2P4QA 4POAA 1UMBA 3DL0A 2CL0X 4WDRA 4ZCPA 1XTRA 5JATA 3O83A 2NNLD 2HX1A 1BOOA 1Q2UA 4KIGA 2V0NA 4M0UA 2QRVA 3L4SO 2D06A 1UZAA 3JQFC 1T3GA 4R98A 3JQ7A 2QE7A 2IL1A 3THOA 4Z54A 5KYGA 2QTHA 4N7JA 2VZEA 1ACMA 1FXWF 3Q10A 5FL7D 3ABIA 4MKRA 4EPTA 3CN7A 3D4LA 2EFGA 4JL6A 5LLDA 1U04A 5CVDA 1KI2A 3OCWA 3F6EX 2R751 4QYMA 4C0BA 3KLNA 4YAUA 4PNZA 5BQOA 3GLGE 1DHTA 2JFGA 4RKRA 5K1SA 1FOEB 2Q5LA 3QITA 1CDOA 3GT3A 1TO1E 5JPIA 5M04A 3BWEA 1OLXB 2CFRA 4MS3A 3D0QA 4LZJA 4EL5A 3HL4A 3EZNA 5I8ZA 1YA8A 4ZYLA 4YQZA 4F2HA 1YDMA 3A25A 1QE5A 1E5LA 1ZO8A 3VJRA 4Y6RA 3CWQA 1EFRA 1T1EA 4CFZA 4URVR 5JCOC 1H4TA 3L7IA 2QX7A 5BORA 2PRSA 4GSYA 2JJYA 3CF4G 2AH5A 4EJFA 3GGGA 4LHXA 4TV8A 4QGFA 2WU1A 3HNRA 3ISJA 3ZHZA 2Y9MB 4FC7A 4X1YA 1ZI6A 4HWOA 3B13B 2C88A 4PLHA 1OOEA 1XAGA 2HNBA 2OGWA 4WKCA 2OUKA 1KJNA 4ZEMA 2VR1A 1PFWA 5AOBA 2V0GA 4NBSA 4MW9A 2VUHB 2XZOA 8OHMA 5SZIA 5JRDS 3PENA 2KPOA 5IS2A 2GF0A 3FOZA 5M3BA 1LKZA 3IOMA 3Q15C 5AWFC 3DLBA 3OEED 1DSSG 2JIZD 1RI2A 4X45A 4EKNB 1ZN8A 3IEMA 1UT5A 4RVUA 3COVA 3A2MA 3LQQA 4H7KA 3OHSX 3W5JA 3RIMA 3UKOA 1ISIA 1F0PA 1R8SA 1SBIA 1ZG3A 2A9PA 2BCGY 3AFGA 3B2EA 4JLOA 1E8NA 5K0ZA 2OR3A 3KHTA 2QORA 3CUWA 5FKJA 4F4IA 4XYBA 4DIOA 2FPKA 4CM4A 4XJVA 3LWDA 3W2FA 3QTTA 4IRUB 4JNCA 1G38A 4C22A 3C7KA 1NJ6A 2X0FA 1A88A 1U2TA 2EZ8A 1P1HA 3BSWA 4L76A 4KN5A 4NBNA 5EKSA 1ZK0A 3EGDA 3JAWB 5IXYA 1GQOA 3OBBA 3DE3X 1C7ZA 1R6DA 1BEEA 3D7SA 1N2CA 1E9SA 3PUXA 1GGHA 4HQ6A 4MWZA 5EE9A 4EQZA 1Q22A 1ZJWA 3GLFA 2FG7C 1AMUA 3NMUF 1DOHA 3U3ZA 4C08A 2R6JA 5JH7B 2Y1KA 3I5UA 4HQFA 1Z37A 3QXHA 3UJ8A 2BCEA 3T0FA 1JZSA 3PHJA 3CZ5A 1CFJA 1SUPA 3LCVB 3OJOA 4JASB 3EGXB 4QPCA 1ILWA 3GGSA 4HDKA 2XGMA 1QG2A 5F2EA 5CFZA 1FJGB 1RI1A 4TXHA 4DLTA 3LA6A 3VJKA 2AQKA 2JIBA 5K0JA 3NTLA 3DYIA 4QPPA 2ZJ5A 1R5BA 4FEGA 4G41A 1F17A 1DKPA 1HI9A 2ISQA 2NU7A 2QVYX 3IV6A 3PCRB 3PQCA 5CXSA 3ZHCA 1IUNA 4PZDA 1FIUA 4N6NA 1OW3B 4ENTA 5AVZA 2RAFA 3ANMA 1I4DD 1QGAA 2NUAA 5J5VA 3SHTA 1EG7A 2ZBFA 2YX1A 1Z2CA 3PFGA 5I9IA 1N77A 1XRLA 2I2CA 1VL5A 1N2BA 3OO1A 2WWFA 4FFOA 4RTJA 5ALWA 3RS3A 1PNRA 4EG3A 3AVTA 1XD9A 1X2EA 1LNZA 2QF7A 3UMGA 4GMDA 1JSCA 2H17A 2QTLA 4IF4A 1FRZA 1C1XB 4YJ2B 2OG1A 5F35A 1W93A 4CMCA 5COQA 2JEOA 1VYTA 4BNWA 2YN2A 1XVIA 4NABA 2YZGA 3D4BA 1BC5A 1WKBA 5ALSA 3VPGA 1K3UB 1IQUA 2V58A 4LV6A 2VNHA 1W94A 1ADGA 1L7RA 3D7RA 3L1HA 2OE2A 3DS8A 4IXDA 1HLDA 1C9EA 2VYQA 4JIGA 2Q62A 4K9KA 3HBJA 3WWZA 4E21A 4E2YA 2A5JA 2VF2A 4ZOLB 1W49A 3EVDA 3SEZA 4IICA 2ZEJA 1R37A 4OLJA 1DG3A 1FXSA 2DFVA 5AHKA 3FWNA 1FFEA 3AYXB 4X6UA 5HFNA 3WJ1A 2I33A 4C7OB 4R0NA 4URFA 1UH5A 5KNDH 4B7UA 4EQ6A 1IPFA 2A5LA 3MCWA 2H1RA 5ITZB 1OX5A 4ZI3A 5A3JA 3B9QA 1D7OA 1ZRHA 2VOJA 1UAYA 2ZUUA 1Y1TA 1EDEA 2IH5A 4M8LA 5BUQA 1C0PA 5M5BA 1PZHA 2YWHA 4JT4A 3VH3A 2GAIA 1JQAA 1KNQA 1A76A 1Y1SA 5BN5B 2W4IA 4UULA 4MEAA 3K5IA 2O57A 4EY6A 4WE3A 4IXMA 1GITA 2YC4C 5FTNA 4DCMA 2HF7A 1CXZA 4PO1A 4PZ9A 4ZV4A 3M6FA 4IDGA 4AZ3A 1U8FO 1UJCA 3PF8A 5YASA 1D4OA 1GNVA 2LP4Y 1PS9A 3QSYA 3MOGA 3ZDCA 4JMPA 2OXIA 3UGTA 2O8FB 3VGJA 3LCCA 3ROXA 4J07A 1Z08A 1FTYA 3W8NA 4ZHQA 4G4IA 1JQ3A 2HRBA 3CBGA 1JIJA 4IFEA 3ORSA 4TQAA 3ICCA 3OD1A 2NP6A 1OXUA 2BELA 4C0JA 2H5IA 3HEAA 1LRJA 4LYFA 4OQMA 1EFLA 3A6LA 1U2DA 3DVAA 2QXUA 1OAKA 1N6PA 3KQHA 4IJVA 1BCRB 2X0NA 1MCZA 1Q0ZA 3IUYA 3H3XA 2AI1A 1B41A 2FZ5A 4YRQA 5I7VA 3T38A 3HZHA 3INGA 5E6RB 2F8SA 2C2GA 2ZWAA 1UK9A 2WJAA 3KZ1E 5CT4A 3ESAA 4LX0A 4EKYA 2R2GA 1NUUA 1J20A 3AR9A 2HGSA 4XCVA 4ETNA 1QKJA 3D2AA 3P9NA 3STWA 2HYDA 3MMNA 2PJRA 1R8JA 4X7PA 5FPYA 1PEAA 1QF7A 1A5BB 2BFAA 2GM3A 1R74A 2YBEA 4FEYA 3V33A 1T4GA 1ECBA 4NULA 5JSFA 1MQ8B 4Z1OA 1M8JA 5BWNA 4YRRA 1IVNA 2GCGA 3O2QB 1P5JA 3OMXA 4NCNA 4PYKA 1JG1A 4KFSA 5G40A 1MOPA 5J43A 5KWIA 2ZCUA 2AFIB 1RLUA 2PXAA 4FHGA 5DO9A 4PLYA 4E30A 1ZJ5A 1KKMA 3QF7A 4CMJA 2P0EA 1GZDA 4YUAA 1FA9A 1GSOA 3G3EA 1QIGA 1AIPA 1IL0A 4OQZA 1QP8A 3AV0B 1FMTA 3CUEF 4Q15A 3VI4B 2QP9X 5KQGA 4HP8A 3M1LA 1AV6A 2KW5A 4P7GA 1B00A 1VBKA 2WYVA 3GELA 3NPAA 4TSRA 4OYLA 621PA 1QIFA 3TW4A 1E7YA 4YT8A 1MJHA 4TT3A 3D6TB 4L3OA 3ZCVA 5TNXA 4MX8A 3ZVLA 2Q5HA 5EVJA 1IJKA 4E5PA 421PA 1VHWA 2WTXA 3GUCA 4PZZA 1NUTA 1NXTA 2YTZA 5K0TA 4EX6A 2OO5C 4NCXA 2HT1A 1PR9A 4R1SA 3UJ6A 3SKXA 2IYWA 3AR6A 4Q7MB 4DE5A 1XPJA 4ZREA 1KL7A 2UZAA 4XYEA 1S8NA 5ED0A 5T67A 1OXSC 1J21A 5BN4A 1QSGA 2P3QA 1QF9A 3G2LA 1SU8A 2GEJA 2BAGA 1SZPA 2R5FA 4ILEA 1U2PA 3ABQB 1FX0B 4W9NA 1X1AA 3LSTA 2DFNA 2GJSA 2FPWA 5TC4A 1O9HA 2YWRA 5GWXA 1K06A 4YJDA 1KE2A 1KFEB 3PKJA 3A14A 1O6BA 3ZHOA 3TSWA 3H99A 4ASUD 1L7NA 1HDOA 2IEYA 5HS6A 1BGXT 3KSZO 2YDYA 3KVNA 4U7FA 5ELMA 3RC2A 5IMBA 1T1JA 3GZNB 4PPFA 1YVUA 3F71A 4AJ9A 2ZTSA 3AONB 4IX9A 1EWQA 2ZS7A 1QQ5A 3DE4X 3KWFA 4TMZA 4U6NA 4PO3X 1ZI8A 1BDIA 3NDJA 5CDGA 3QKTA 1QLWA 3WWDA 3QUQA 2IVZA 1X8LA 2FK7A 4UE2A 5G4KB 4HAOA 3ZCTA 4FCVA 1XJCA 3RO7A 4RTPA 3RYCA 5DBEX 5CAEA 3FPSA 1AXGA 5GZ3A 2QSUA 2YFYA 1CB7A 1JXQA 4PFSA 2ECPA 5TJHA 3ROKA 4PGFA 4DYHA 5A4FS 1ZD8A 4FB5A 3KR1A 3BDIA 1E2MA 1Y1RA 2VDUE 2OOSA 2FP4B 3DGFC 4G8JA 1REQA 4L6CA 4NVRA 2F43A 1OVGA 3I6ZA 3PEVA 3PQ7A 3F7MA 1CV2A 4GVPA 2ZUFA 3LJKA 2FLVA 4QU0A 1R0WA 2YFKA 4ID9A 4OQQA 1CUYA 4X60A 2ZWIA 5AICA 1IK4A 4F3RA 5BR1A 3RJ5A 1IQRA 1RHUA 5I3ZA 1U9YA 3FGNA 2BGUA 2P2CA 4PX5A 3ICWA 5IYZF 1KEKA 3O93A 5C5IA 4JHXA 3GJZA 1EFAA 3ESDA 4CU2A 5AW4A 2GBLC 2QPTA 1Z4KA 1UBGA 1EYZA 2FMHA 3EK2A 3GZ4A 4X84A 3BT7A 1CDDA 1UK6A 1ULTA 4EF4A 4YIKA 1Y9EA 4FSXA 3AF5A 2QW1A 4Y8VA 2H00A 2QRQA 1EJBA 2VYFA 2Z2JA 1YK1A 2EGHA 1NPYA 2GLUA 1J2UA 1Z5OA 2H51A 4LBYA 4ML3A 1FFCA 2FFJA 3ICPA 4UREA 3ADOA 5D3KA 1PL8A 1IIRA 4ZHSA 1CRLA 2C61A 1QORA 3EUAA 1Z2PX 2ZE6A 3K9HA 2OZPA 1OPRA 5A9RA 3EIXA 3A1NA 3KLBA 3TDNA 3ZX5A 4K9MA 3RUEA 3D6VA 1NG1A 2BGJA 1JBQA 1PKEA 4GT1A 4LC9A 3AGQA 1GGVA 3E7FA 1FNCA 4L0MA 3EAGA 4ZO8A 2RIPA 4KI7A 1B74A 2JI6A 4KMSA 2ZI7A 5FBKA 4TLBA 5JLAA 1KP9A 1KVUA 3H1FA 4Y0AA 2IUEA 2XX3A 3AUJB 1RPNA 3PHGA 3GLGA 3F9IA 1QRSA 3QF4B 4RZ2A 1A9OA 1CHDA 1E4OA 4KEAA 2BLLA 1JEDA 5E4FA 5GOZA 4MDFA 3ZKAA 3BQNB 4GYYA 4J0EA 1JQ5A 3GAMA 2YJZA 1LJ8A 2YINC 1TKCA 5HE9A 1G0OA 2P78A 5A71A 4DSUA 4S24A 4DQXA 4F6CA 1P0FA 1PSDA 3DXXA 5GGXA 4HUQB 5I48A 3G5MA 3RS7A 1FSFA 1NOIA 1P60A 4QQ8A 1GRCA 2ZYVX 3SYMA 4NCBA 4KDFA 4PANA 1R0KA 2J46A 3DEZA 3CO5A 1N9GB 4FWIB 4TWJA 4Z7QB 3K30A 3R1IA 2VTDA 3CR3C 1OKKD 4RD2A 3U7QA 4E5UA 4D42A 1OBCA 3WYCA 2PFKA 2QN1A 1UM8A 2J7KA 1Y6RA 4KLCA 1VSVA 4N0PA 4WH0A 2Y8EA 1PFYA 5AM0A 5G0SA 4BTLA 2B36A 3WGJA 3H1BA 3Q7IA 5JDIA 1A8IA 3IB6A 2ZSDA 4KRGA 1L7PA 1H2WA 2VHCA 4UJ5A 4H27A 5ELXA 2O2ZA 4FFWA 1Q0UA 4WY2A 1U65A 3BE8A 1XV5A 4F45A 3LC0A 1HETA 4XTCS 1LLDA 1RWPA 1I6KA 5JS6A 1KTIA 3DOCA 4RM2A 5ALKA 5LFAA 3L7DA 3CG0A 3BHNA 4MV8A 5ALGA 3KTFA 2W5UA 3NVAA 4LFBB 1NMEA 3PI7A 1CUJA 2AS0A 2FLKA 2PKEA 4MA5A 4ZP1A 1QAMA 1XZLA 3SSMA 3ZCXA 5A4AA 1N25A 1WSBA 4PBTA 1SO8A 2CF6A 1S01A 4QASA 5E6SB 3WMXA 4ZJPA 1W36B 4LHSA 5AIBA 1CYEA 3L7MA 4C0LA 3RTCA 4Y2TA 4B3FX 4XQ0A 1WDMA 4GXTA 2O06A 2XRYA 4Q34A 1DRJA 3KJFA 3HXTA 2WFLA 1J2YA 2ZYRA 3M49A 4IHQA 3RJZA 4A2WA 3PXBA 3C41J 4N5IX 1Z6YA 1CR1A 3NC1C 4CM8B 4NBKA 4N1AA 4Q93A 2Q3HA 5IW8A 4KWEA 3M3HA 3F0TA 1IUOA 1TU4A 1BXGA 2FK8A 2WJGA 5CHYA 4DQVA 1PFKA 4MCAA 1YJ5A 3RIGA 3I4LA 1UKBA 2B9VA 1K86A 1CY8A 1YMUA 2HJ9A 2UYOA 1QNLA 4HWKA 4XH9B 3W3AD 3IP6A 5KTKA 3BVPA 4B7XA 4BGUA 1E99A 3IHLA 1J0DA 2IS6A 1G55A 4MRVA 5THXA 3QXGA 1B43A 3P2JA 1NQWA 2WD9A 3AFHA 4RHCA 3R40A 2BVNA 3PQDA 4HYQA 5KHOC 1J0AA 2NIPA 2AMJA 2R44A 5CX1B 1SUCA 5I4IA 4K03A 3K6SA 5JZ9A 3G7UA 1LTQA 3KKPA 3H6HA 1HEUA 4I8IA 1UF9A 5DH9A 4DILA 3C3AA 2OHXA 1RCFA 3B5EA 4X1KB 3P9ZA 2CHQA 3RTBA 1NHWA 3ZQ4A 3IHTA 4DUPA 3CONA 4NCJA 4P4SA 1IFXA 3MLBA 3PFCA 1DARA 2CJFA 4RWEA 2FRDA 1XO1A 5DOVA 3KQNA 5HCIA 1CZNA 2VTVA 3AOEA 3M4YA 3RTEA 4ER7A 2AMLA 2F48A 1Z88A 5TX7A 1E79A 2C7PA 4BC1A 2C5AA 2VK1A 2A14A 2HO5A 4GM1A 3ZK9A 2BE7A 4WEQA 2Z9CA 1YOVB 2D8MA 2E4UA 2OO5A 1LFDB 1QLHA 3KVRA 3DP9A 4O5AA 3W5CA 3U7HB 1EESA 1PQ4A 1ZK3A 4HY3A 2ZT5A 4W5NA 1CUXA 3E05A 1MO2A 4WZBB 4PZAA 3UJBA 3NHLA 4RELA 1KU6A 3HEMA 1P81A 1VI5A 1BWSA 2FR8C 3NM5A 4YO7A 4EG4A 4JYBA 1QAQA 1AGPA 1RM3A 1A7JA 2ZITA 3I64A 3F4BA 3HJGA 4UARA 5JXWA 4MHTA 4MWBA 3DAYA