1YKFA

Nadp-dependent alcohol dehydrogenase from thermoanaerobium brockii
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
352
structure length
352
Chain Sequence
MKGFAMLSIGKVGWIEKEKPAPGPFDAIVRPLAVAPCTSDIHTVFEGAIGERHNMILGHEAVGEVVEVGSEVKDFKPGDRVVVPAITPDWRTSEVQRGYHQHSGGMLAGWKFSNVKDGVFGEFFHVNDADMNLAHLPKEIPLEAAVMIPDMMTTGFHGAELADIELGATVAVLGIGPVGLMAVAGAKLRGAGRIIAVGSRPVCVDAAKYYGATDIVNYKDGPIESQIMNLTEGKGVDAAIIAGGNADIMATAVKIVKPGGTIANVNYFGEGEVLPVPRLEWGCGMAHKTIKGGLCPGGRLRMERLIDLVFYKRVDPSKLVTHVFRGFDNIEKAFMLMKDKPKDLIKPVVILA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADP-DEPENDENT ALCOHOL DEHYDROGENASE
publication title NADP-dependent bacterial alcohol dehydrogenases: crystal structure, cofactor-binding and cofactor specificity of the ADHs of Clostridium beijerinckii and Thermoanaerobacter brockii.
pubmed doi rcsb
source organism Thermoanaerobacter brockii
molecule tags Oxidoreductase
total genus 112
structure length 352
sequence length 352
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.80: Isopropanol dehydrogenase (NADP(+)).
pdb deposition date 1996-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ykfA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1ykfA01
2E82A 5ER6A 2Q3EA 3UVEA 5EIOA 4G2NA 2AQ8A 3QY9A 3ZWXA 1FMCA 2FRDA 2Q1UA 4L4RA 3JQEA 4RZHA 4TVBA 4CM9A 1S7CA 3JQGA 4RQTA 3TL2A 4LMPA 1HE3A 4YQYA 1ENYA 2X5JO 4HADA 4PLFA 4QO7A 3ULKA 4YJGB 3CXRA 3EW7A 3ZU5A 5FEUA 1O95A 3FNHA 1I8TA 1QP8A 1PWZA 4LVCA 3OFSA 5EN4A 3TN7A 2Q46A 2BGKA 5IXYA 4YAIA 1PS0A 1HE4A 3HE3A 5B4TA 2ZQYA 4HUJA 4JGBA 2X1HA 4PIVA 2FPGA 4QUKA 3IKVA 5GZ3A 1GTMA 1YONA 3AM3A 1XLTA 2ZATA 3WBBA 4JX8A 2BLLA 4TROA 4CMKA 1KEVA 3I9OA 1DO8A 1J5PA 4ZQEA 2O3SA 4FJ0A 5JS6A 3P2OA 3U5TA 3FTNA 4RCVA 3GUYA 3H5AA 4ND2A 4QECA 1BVUA 1B0AA 4WECA 2EW8A 2RAFA 2G17A 3T7EA 2X86A 2O23A 1TT5A 5A02A 3UKOA 2LDBA 3K92A 3M1LA 3TRIA 1NR7A 2AEJA 1CQJA 3W4KA 3WYCA 1MLDA 3OBBA 1LC0A 1MV8A 4ND3A 3AY7A 3MZ0A 3BHMA 3FF4A 4TWRA 4FGSA 1LJ8A 3ETDA 3K5PA 4ESOA 3WOHA 3AW9A 3DBVO 3DZJA 1EDOA 4CUKA 3ZZNA 1NHGA 1I33A 2NTVA 4PG6A 1HL3A 5AXBA 1T2EA 1VL6A 1QKIA 3NDRA 4TQGA 1C3VA 1KVSA 2GN6A 1P1RA 4AVYA 5F5NA 1BG6A 1C1XB 1WZIA 5HA5A 2AQKA 1JAXA 5F1KA 4BO1A 1DLJA 5KNLA 1H9AA 3Q11A 1Y6JA 3DONA 1NP3A 4RL6A 4BNVA 3GGPA 2ZJ1A 1WPQA 3C7DB 3CSDA 4H15A 5KJEA 3PQDA 1AN9A 3PYLA 3RVDA 3IDSA 3JQDA 1JKJA 4GPD1 4BNYA 1H2HA 1RJWA 2UVDA 1GQ2A 5TLSA 1E7MA 4FIZA 3WB9A 3WXBA 4PRLA 1Y9AA 1R12A 3NJ8A 5KJ1A 3DAPA 2NSDA 1P1IA 1QLJA 2GGSA 3U62A 1HLPA 1V8BA 2TMGA 5CDTA 1VSVA 2QX7A 4UUMA 2EGHA 3GDOA 1EVJA 3OP4A 1R0LA 1JDJA 1ZK1A 2V6BA 4L8VA 3TFOA 3MCVA 2IRWA 4FFMA 4MVJE 1O5IA 4CV2A 1ZSVA 3DAFA 4R5HA 4LCJA 1S6YA 3VKVA 3JQAB 2BFMA 3LC2O 1LLCA 2CFCA 1X0VA 4PFJA 1E1MA 1Z7BA 2BMAA 5JO9A 5JBIA 1BXKA 4RV9A 1FJHA 3DBLA 1ONPA 4H16A 4XR9A 1J49A 3UAGA 3HJAA 4XDZA 4E5YA 1X7HA 4BS9A 3U4HA 2HDHA 1U5AA 5L4NA 2DAPA 1EFKA 5CDUA 4D46A 1K3TA 1EVYA 1QLHA 3GMDA 3GLQA 1F12A 4NJOA 4P4GA 1CEQA 1SOWA 3JD1A 5FI5A 4WLFA 4ZGWA 1LRLA 4Y6RA 3G1TA 1E1NA 3LDHA 1Y8QB 2Y1GA 3INGA 3KYCA 4YACA 2E37A 3RC1A 2WM3A 5BSGA 4BNIA 1VPDA 1R66A 3ROMA 2YW9A 3AOEC 2O4UX 1SEPA 1VKNA 4RF2A 4IIUA 1C1DB 2FSVA 3AY3A 2VRCD 5LDGA 4IQ8A 2NQTA 1NVTA 1GQQA 1RM4A 4J4BA 3EYWA 4JNKA 1YDWA 2GZ2A 3B70A 3I23A 3CZMA 5BR7A 4RPGA 2X0NA 3F46A 4BNFA 1XWFA 3RD5A 1UZLA 4O6VA 1I2CA 2D0IA 5G0SA 1O9BA 1GADO 1UDAA 3OIDA 3MJSA 1JVSA 4G5HA 1P44A 2GRAA 2AE1A 4BMSA 4IPTA 2J3JA 3OMLA 4UEJA 3WIEA 5KIAA 3OQ6A 3HN7A 1M76A 5AXCA 4BMVA 3BIOA 1H6AA 2HRBA 1DFIA 4FFLA 5BSHA 2P5YA 4R1NA 4MVJM 4RLSA 2TMDA 3Q2IA 4B3HA 4NBUA 1H5QA 5CFZA 4IINA 1ZZEA 1HE5A 1BTOA 4WCFC 2WE8A 4GMFA 1MC4A 4MP6A 2ZCVA 4YA6A 4BO9A 4WLUA 3H9EO 3GRKA 2AEMA 2EV9A 3SVTA 3EAGA 1NWCA 3WNQA 4BGUA 2YV1A 1B8UA 5DCUA 2W4QA 2PD3A 4XDYA 1P74A 1N2SA 3FPCA 1NFQA 2WEKA 3PZBA 5I8ZA 3RI3A 5COQA 4LGVA 1R6DA 3NDJA 4QO8A 3RUAA 1KBZA 3INRA 3UH1A 2HKIA 3PJDA 4DC0A 1YGYA 1PQUA 3JQ7A 3KEOA 3GVIA 1E1KA 3O03A 3UCXA 2IZ0A 4AJKA 3Q9UA 4TRMA 1GZ4A 2X9NA 4MKZA 4YBZA 3VHRA 5A1TA 1R16A 4IBOA 4DUPA 3KLMX 4A27A 1NFFA 4A03A 2W8ZA 2X7HA 2Y0CA 5L40A 2GNAA 3DHYA 2D5AA 3G79A 3PWZA 1PGQA 4UVEA 4EEXA 4RDHA 2HAEA 3PQEA 4IDBA 1BXZA 1XEAA 4GX5A 1AGNA 1JKIA 4DYDA 2WD8A 3EY4A 4NI5A 2IDZA 4BKRA 4JP2A 3W8FA 2VYNA 1IOLA 3QWAA 2PGLA 3RAJA 4YT5A 1AHHA 5GZ6A 1DIRA 2IODA 4S1VA 3WSVA 1B3BA 3AK4A 1Z82A 1SB8A 3ZU4A 1YL7A 3PLRA 4CV0A 4R01A 4PLPA 3PI7A 4DWVA 1ZH8A 1CYDA 3GHYA 4M1QA 1DFHA 4CQMA 5A3JA 4XB2A 3JD2A 1IY8A 4R3NA 4U5QA 2HO5A 4XA8A 3RUIA 5TS3A 4PG5A 5TT0A 4WEQA 5B1YA 1P1KA 3TPCA 2FPIA 3UXYA 3E1KA 1U5CA 4EBFA 1RYDA 4HKTA 3ZWAA 3ZWVA 1XHLA 3G49A 4PLYA 1BSVA 2VTDA 5B4VA 5K1SA 4WUVA 3PHHA 1I36A 2RHCA 5L9AA 1HEUA 2AE2A 3GVPA 4FGWA 4NNJA 4ZA2A 3DHEA 2DBVO 3RU9A 1DOHA 2JCXA 5C7LO 3GK3A 1ZXBA 3GN2A 2ET6A 1G1AA 1VSUA 1HDYA 4B3IA 1SNYA 4RVGA 1XA0A 4KQXA 4PGFA 4YJGA 1GV0A 1DAOA 1XCBA 4B7XA 3OECA 1T1SA 2P2SA 4CM9D 2CMDA 4MIYA 3WNVA 1MB4A 3RC2A 1UP4A 3FHLA 4CLOB 4BQPA 3AU9A 2YFQA 1AHIA 1V9LA 3IAHA 2JD0A 4ALKA 4OYRA 3SEFA 2FY8A 2JHFA 3D1LA 3GG9A 4CMEA 2AMFA 2O2YA 2RBEA 4FJ1A 4BB5A 1ADBA 2Y99A 5HRUA 3KETA 4AFNA 1PZEA 1OBFO 1VKOA 3NEPX 3MTGA 2QYSA 4YAEA 1WAMA 5ICMA 1XG5A 1N1EA 2JL1A 4FS3A 3OJ0A 1Z73A 3V1TC 2BI7A 2D59A 3UCEA 3Q6IA 4IMRA 3OIGA 2BELA 4XR4A 5JDCC 1EVIA 1NR1A 2C5EA 4BNMA 2NUAA 4OOFA 3LQFA 5G0VA 2JFHA 1I01A 2B4QA 4P38A 5TF4A 5TRTA 4E3ZA 4WLNA 2J3HA 3DWFA 3EDMA 3AFNA 1YL6A 3K73O 9LDTA 3WYEA 2J5QA 4GLLA 4CM3A 5IDWA 3P5SA 3S1LA 3WS7A 4DL9A 1WMAA 4KWIA 3ONDA 2FSSA 1HLDA 3F4LA 1LA2A 3RUHA 4YPOA 1QG6A 2XAAA 3HNPA 1C1XA 2D3TA 3QVSA 3GDFA 3NUGA 3WGHA 1W6UA 3WGGA 4IGEA 4MVJI 4BO7A 4WCFB 3AOGA 1GU7A 1I10A 3PEFA 1QMGA 4CM8B 1OAAA 4FJ2A 4I1IA 1PJBA 4M49A 4DLBA 1RPNA 1TVEA 2VHXA 2X22A 1TA4A 4M55A 3V2GA 4R41A 4PLTA 1LSSA 4B7CA 2H6EA 1HDRA 3KRTA 4ONEA 3JYLA 4N54A 1FDWA 1B14A 3QV1A 3H9JA 3RUDA 2QRKA 3SX2A 3MWEB 3H8VA 3O26A 4IZIA 1DB3A 2R00C 1TT7A 2JD1A 2PZKA 3AWDA 2W90A 4R1SA 4FR5A 1WDLA 1V3TA 4GBJA 5A03A 3ONFA 4R9SA 1P3DA 4EDFA 3B1FA 4NQZA 4L4XA 4QEDA 4E2YA 1J0XO 1D7OA 3ITKA 4DQVA 4INAA 4RORA 1VRWA 1QYDA 1QR6A 2CF6A 1YVEI 3RC7A 3LF2A 5EPOA 3JQAA 3D7LA 1GV1A 2DT5A 2GPTA 3B1KA 3IP3A 4CMJA 4Z6KA 1XR3A 4NG5A 4CMCA 5JW6A 1N92A 1X15A 1EBUA 2EP7A 1LNQA 2VHWA 3TZQA 1RM5A 4UVIA 3LF1A 1U3VA 2O3QA 2CVOA 1KETA 3PTZA 2CY0A 2PGDA 1MA0A 1KEWA 3OETA 2DTXA 4CUZA 1FK8A 3V2UA 5EQFA 4BO6A 3JV7A 4R51A 2HU2A 4GKVA 4E33A 3ANMA 4BKUA 5THKA 1TI7A 3ENKA 3OJLA 1Y8QA 1E0DA 1K2WA 1N7HA 5BNFA 5JC8A 5JXWA 1DC5A 4EZBA 3KEQA 4CMIB 1BHSA 1WMBA 3IJRA 3PJFA 1VM6A 4OSPA 3L4SO 1K6IA 1C1DA 2VN8A 3TSCA 4ID9A 1T4BA 1I0ZA 2D4AA 3VDQA 3DFUA 3IMFA 1EZ4A 2D5CA 2NTNA 2IEBA 2V7PA 2WMDA 3N58A 5K6AC 2PTGA 4E2WA 2PZLA 3JQ8B 3GVHA 3DHNA 4XQ9A 3TOXA 3VC7A 4CM4B 1KY5A 2VT3A 1VLLA 1J4AA 1YWGO 3UW3A 3VH3A 3OSUA 3U0BA 3W8EA 1I3MA 3JQFC 1B8PA 1HE2A 1XYGA 2DBQA 4E5MA 4J9UE 1V35A 3RSHA 2X8LA 5L4LA 4ZQBA 2WYVA 1NXQA 3WGTA 2QRLA 3V8BA 1PTJA 3TZKA 1GQYA 8LDHA 2YY7A 3JCZA 2P68A 2BFAA 1LTHR 3ETGA 4DA9A 1E7YA 3LLSA 1U7HA 1L1FA 3GNQA 1SMKA 5EJ2A 3GNSA 3GGOA 2NU6A 4NBVA 1VJ0A 2E6UX 2UV8A 4IM7A 3WX0A 2NTJA 3DQPA 3NDIA 4O0LA 4E5NA 4PG7A 1GYRA 1NQOA 2VUTA 4I9HA 4D0SA 1JLLA 3OHSX 1LQUA 4GQAA 4BGIA 3ZWNA 1PZGA 1DHRA 5COBA 2P91A 5CDYA 1Y5RA 3AI1A 3KSUA 3A1NA 4R16A 4Q3BA 4CL8A 4CMAA 1UXJA 1IHYA 4PZEA 5IG2A 5G0UA 4YWJA 3STHA 3I3OA 5DOZA 2EGGA 2PH3A 3D64A 5TJHA 2FZWA 3SC6A 1E6EA 4J2OA 3O9ZA 3GPIA 6ADHA 1KEPA 4FN4A 3WGQA 5JNLA 1B8VA 4P4LA 1UXIA 4RDIA 4AJ4A 5ER9A 1C14A 2VZ8A 3D3EA 2Z1NA 1YBMA 3E8XA 3U4CA 4IQGA 4YAKA 2DFVA 1B26A 1A9YA 1EUDA 1RM3A 3NRCA 4A10A 5G4KB 2I99A 3GR6A 2VOEA 4AJNA 3N74A 4MO2A 2WWRA 1NFRA 1QV7A 4WK6A 5AXDA 3QVXA 4BNZA 4XB1A 3UHAA 3AM4A 2HK8A 4OXNA 3RWBA 2YQ4A 3Q3CA 5G2OA 2J5KA 4HXYA 3BHJA 1P0FA 1GFSA 3ZDFA 3JQBA 1A72A 1DC3A 3RFXA 1P1FA 1I5RA 1QRRA 3Q2KA 1E3SA 1DIBA 4HFNA 3DMYA 1I3LA 4GMGA 3ZWYA 2VYND 4YJHB 1BWSA 4MJLA 3JQ9C 4RVSA 2B37A 3NYWA 5CG1A 2HJRA 1RWBA 3L07A 4JBGA 1TEHA 1YDEA 4A73A 1OI7A 3EC7A 5AYVA 1ADGA 4YXFA 1XELA 4B4UA 5IF3A 3JSAA 2H63A 1WXDA 4J2HA 2E49A 1NPYA 1B2LA 1C0PA 4W4TA 4OXKA 5CEFA 4N7RA 4BO4A 1WLYA 1HDZA 5TSDA 5DP1A 3RFVA 2VT2A 3VPXA 2DUUA 2NU9A 3LK7A 4Q3EA 1L7DA 4XD2A 2DLDA 3TOZA 4CQMD 4E6PA 2PKQP 3MJ4A 4KP7A 3ZNPA 5CAEA 4RO0A 3D4OA 4R9RA 1H6CA 3ZU2A 4DBZA 2FR1A 5A06A 2XXBA 4J6FA 5J23A 3R0IA 2OP1A 1A4IA 4PZDA 3OJOA 2WD7B 3IIEA 4XEHA 4MIOA 4E4YA 3F6YA 4DLLA 1U8XX 1K89A 4E5KA 4KDEA 2VUUA 3KLPX 1Z7EA 5FF9A 1Y7TA 5H81A 5TJ9A 2B35A 4HWKA 1QYCA 2C7GA 3E18A 4I5EA 5A3VA 4OH1A 4PLGA 2A35A 4GX1A 1WDMA 1Y9EA 4IXTA 5JAIA 2JAHA 4TMFA 4PVDA 2O50A 3ZCXA 1ORRA 2WJPA 1ZNQO 3GEMA 3R3JA 2HRZA 1PJSA 1WNTA 1X1EA 1UP6A 3PYMA 1PJ2A 4HFMA 2QG4A 4MVJP 5IDYA 4KWHA 2P9CA 1Z75A 3S2FA 5IFLA 1YQXA 5DULA 1EFLA 4TRRA 2C07A 4RZIA 4DXHA 1M66A 1O8CA 1Y5MA 4CLOA 4GSKA 3BMCB 2IXAA 4BNHA 3GG2A 4DQUA 3AOEA 1H2BA 3E03A 3PHLA 1EUCA 5JYDA 5KJ6A 1N5DA 4P22A 1G6KA 1NYTA 1O94A 3BMQB 4J16A 5EL0A 3ICCA 1HDXA 1HKUA 4Z9YA 4WCDA 5H82A 3HSKA 3RC9A 4EJ0A 2CVZA 3LSYA 5C7OO 2B4RO 4HV4A 3ZGYA 3DBRB 1KC3A 2PNFA 5GZ1A 5T6BA 1YQDA 4DPMA 2J3KA 4I5DA 3UFXA 4P8RA 2Q2VA 4BV8A 4FSHA 4J7UA 4J49A 2BGMA 3EVNA 4YCAA 3M6IA 4ZU3A 3OEWA 4L9RA 2YQ5A 4MKXA 1Q2XA 4M86A 2OBNA 4R68A 4XIYA 4XGKA 2G1UA 4DIOA 1ONOA 1E77A 2DFDA 1YOVB 3D0OA 2I65A 3C85A 3I9KA 2WSBA 5KJFA 2J8ZA 4LW8A 3ITDA 3ON5A 3EMKA 4IZHA 5JY6A 3C7AA 3JQBC 5L51A 4E32A 4WKGA 4FOSA 3H9UA 1ISFA 4BNKA 1ZKMA 4AJ1A 4BHTA 3NGXA 4YR9A 1ADFA 3DOOA 3EUWA 3R6DA 2VWGA 5KKCA 2QRJA 1GYQA 3DC2A 3MEQA 1VJTA 4NHEA 2C0CA 4EGFA 2X9GA 3L6DA 4J4TA 1JQBA 1ZUD1 4EUEA 5ES3A 4YYZA 1H94A 3PIIA 4E2XA 4WCFA 2JFGA 1R0SA 3RUCA 4BO5A 1NQ5A 1T26A 1E3EA 1ZJYA 3NT5A 5ILOA 4CM8A 4KUEA 4ZQFA 3V1YA 5K9ZA 1ZW1A 2YHIB 4AJIA 5T5QA 2C2YA 2HJSA 1QYWA 4PLVA 1D4FA 2OO5A 3P2YA 4UUOA 4Q39A 4RVDA 3LZ6A 3HFSA 3VZRA 1T25A 1U2GA 1O6ZA 5CDSA 3QVOA 1Q7GA 1U9JA 5EERA 4BOYA 2JJYA 4CLXA 2FHSA 3CIFA 4FD3A 3RBXA 3NX4A 1Q0LA 4W82A 4MOWA 2JAPA 5HTOA 1BDBA 3AUTA 1MFZA 4I9UA 4E12A 2ZK7A 2PZJA 5JAQA 2PY6A 3N7UA 3DTTA 3TJRA 3I6IA 1E3JA 5LC1A 3CE6A 1PL6A 3D4PA 3ZU3A 2VWHA 4O63O 4IJKA 2G0TA 2O3JA 2CVQA 3M1AA 4YEDA 4GLOA 2ZB4A 4XJSA 5KWEA 2WYUA 1Y8RB 3CMMA 4DLAA 2ZYAA 3I9MA 4MIEA 3FTPA 3H3JA 4B79A 4EUHA 1KERA 4EW6A 3NAQA 2EG9A 3H4VA 1EQ2A 2CDBA 1SAYA 1NPTO 2W2LD 1AE1A 4D41A 4M87A 3CTMA 2A94A 4L73A 1W8DA 3M2PA 1LXCA 2DUWA 3INTA 3JD0A 4CQLB 4U0JA 4PZCA 1YO6A 3HFGA 1ULSA 1P33A 2CZCA 4OMUA 2DBRA 4TKMA 5DBIA 2DM6A 4W9NC 1XU9A 1CETA 1JN0A 4UVDA 1M67A 3B6ZA 4CLDA 4JQCA 4CMIA 3PFWO 3GZNB 1P31A 3FNGA 3AY6A 3WWZA 4BL5A 1A71A 1HDCA 1IPFA 1YH3A 4KTVE 1K6XA 3A4VA 4LRSB 3NTRA 5THQA 1DSSG 4NBRA 3WQRA 4JCOA 3GH3A 4GGPA 3JQ8A 3TWOA 1K6JA 2Y67A 4PVCA 4Y67A 3GDGA 4NDNE 4WNIA 5CEJA 1D1TA 5U9CA 2ZKLA 5I7EA 4CM4A 4QFCA 2W2KB 2NADA 4F6CA 1WZEA 3A9WA 1GPJA 4CMHA 3MJEA 5AXAA 3H5RA 4ZD6A 1VI2A 2QW8A 3MJVA 5DBFA 4WLEA 4J1TA 5AVOA 3HUDA 4EI2A 5B12A 2X0RA 1D1SA 1GZ6A 3H5NA 4Y98A 4NR0A 1XSEA 3FN4A 4IGFA 2O48X 1PL7A 2OORA 3H9QA 2X9VA 4Z3DA 4B4VA 2CSUA 4RF3A 1PU2A 2P9EA 4BNGA 1Y81A 3DMTC 1NVMB 1IZ0A 5ITVA 1UAYA 1NVGA 1DRVA 4XGIA 4IDFA 5H83A 2NM0A 1NNUA 1GYPA 1P9LA 5TGDA 1M2WA 2ZTVA 3ZWPA 1DIGA 2CUKA 1E7QA 3P19A 4MDHA 3IP1A 5U1PA 3UN1A 4BV9A 4BNNA 3HZZA 5DDIP 2C54A 3MTJA 2HMVA 3SC4A 4DYVA 2I3AA 4J7CA 4ZRNA 4LK3A 3UF0A 4EEZA 3FPLA 2O4CA 2YUTA 4ZICA 4J1QA 4QSMA 2OL4A 4A7PA 5JDCA 3ROKA 1W0CA 3KHUA 2AG5A 4NBTA 2X58A 4RF4A 4P4NA 2WDZA 2GERA 3KVOA 1GDHA 2DKNA 1EDZA 3K9QO 1Q7BA 1HXHA 1KYQA 1LRKA 3LC7O 3DFZA 1YL5A 2GASA 3Q0EA 1PR9A 2EKQA 3FI9A 1H6BA 2EIHA 4DPKA 4YQZA 1A27A 5B4UA 5DBGA 3VAZA 1RKXA 1BGVA 4TKLA 2AEFA 5G4KA 5A04A 3GAFA 5BSEA 1PGOA 4D42A 3FWZA 4JJGA 5TC4A 2OUIA 3SJUA 3V2HA 1T2AA 3R3SA 4W7IA 2V6MA 1D8AA 4L0QA 5IDQA 1HYGA 4JLWA 3C3XA 3FRJA 4ALLA 1U3UA 4OM8A 4YJHA 4CUJA 1IPEA 4D3FA 4Q9NA 4WOJA 4Z0PA 2EP5A 1PL8A 3BAZA 2I6TA 2NNLD 1IE3A 2R00A 1KC1A 1EK5A 2BD0A 3X2EA 1JU9A 4B7UA 2SCUA 3CINA 5T57A 2OOSA 4Q3AA 2HQ1A 4LN1A 1T24A 1FDSA 3QA9A 4FQ8A 5C3MA 3QWFA 1HDOA 1DRUA 3DEYX 2VTEA 1X13A 3BTUA 5KVVA 5IZCC 2OHXA 4X54A 1ZCJA 3HDQA 3GNTA 3W6ZA 1KVUA 3F5QA 3NV9A 4TRNA 4OQYA 1PJ4A 3WTBA 1ISJA 1W4ZA 4CPDA 2EJVA 1PS8A 4HBGA 1ZEJA 4LISA 1XIVA 2WD7A 5DCWA 4U0KA 3ZV5A 1UZNA 2A92A 5EINA 4GVLA 2Y1EA 1KVRA 1DRWA 5CPBA 3GMSA 1NBOA 3ADPA 3B1JA 3WR5A 4HX5A 1PGJA 4IS2A 5JLAA 1O0SA 1J6UA 1BXGB 4R1UA 3ZI0A 1B3RA 4PN3A 2HSDA 2IYPA 1YKFA 1QORA 3DDNA 4K6CA 4TZKA 4Z0TA 1CWUA 3WGOA 4AJEA 1EUZA 1T2CA 3RUEA 4R54A 1KVTA 3BMCA 5I9MA 1BVRA 1A5ZA 1BMDA 4DC1A 3WGIA 2IEDA 4CL3A 3BMQA 4OGWA 1MFPA 3I6QA 3L77A 4ND5A 4QQRA 3OF2A 4CR6A 5K6AA 1Q0HA 4N5NA 2BFPA 4A2CA 4JBHA 1I30A 3DBRA 3F47A 4ILKA 1GUFA 2GCGA 4M89A 1ZSYA 3LU1A 3W4JA 1QYXA 2ZB8A 4DIBA 2F1KA 2O2SA 3QLJA 1P77A 3JQFA 1QYVA 4JN6B 1JTVA 2Q4BA 1QXSA 4FC7A 4XGNA 3PHIA 3ABIA 4CLRB 5IJZA 4NK5A 1YOVA 4XYGA 2RIRA 3GGGA 3K30A 3V1UA 4AL4A 4A5OA 3JQ6A 4DMMA 3ZWBA 1D3AA 2HMUA 2H1SA 4II2A 2NV6A 4MINA 2C5AA 2NWQA 1I2ZA 2Q99A 3LT1A 5F21A 5JY1A 5L95A 1ZK2A 4ROSA 4GAEA 3U9LA 4BO2A 1PS9A 5JO0A 4U8GA 3C1OA 4W99A 1ML3A 1E1LA 2R6JA 1EBFA 2HK9A 3VKUA 1OZAA 5JSFA 3R1IA 2FR8A 2RH8A 3H3FA 5CEEA 2EW2A 3PGJA 1YE3A 3E9MA 1H9BA 2Y1FA 4BVAA 4I8XA 2X0JA 3F1KA 3L4BC 3IKTA 1SEVA 1HSZA 4UEKA 4YRAA 3U4IA 3ZHYA 2OMEA 2YHIA 1Q1NA 3PHJA 2QHXA 3WMWA 3WICA 2UUOA 2PFGA 1LU9A 1U3WA 2HLPA 3RJ5A 2QZ9A 3IOYA 4IJUA 2CNBA 2VNSA 2HCTA 5F5LA 3ZH2A 2ZJ0A 1OC2A 3MOIA 2X0IA 2PH5A 2VHZA 3DR3A 3I4FA 1GD1O 4A0SA 4YB8A 1PR3A 2C82A 5ADHA 2EEZA 2QQ5A 2IYOA 1QV6A 2GN9A 1N9GB 3F3SA 1SOVA 3ORFA 1M6WA 1PJLA 3KV3O 3PWKA 4CV3A 5JCXA 2OZPA 3RIHA 4DGSA 3KYBA 2CD9A 1Y1PA 2VRCA 1UJMA 3S2IA 3OQ1A 2FP4A 1TXGA 3VZSA 4BO3A 3GF4A 3PJEA 5ITWA 3I1JA 4IQ0A 3PP8A 3JTMA 2C7VA 2I67A 3E9QA 4C7KA 4IDEA 1Y8RA 3OEYA 4CODB 1SBYA 2GN8A 2D1YA 3GEDA 3WLEA 4ALNA 1BDMA 2DPHA 2G82A 2DBZA 4BUCA 5JE8A 2J3IA 5GMOA 3FNFA 4MP8A 1VC2A 2GUGA 3T7CA 1DLIA 3VDRA 3BMOB 4WLVA 3E6AA 4DVJA 3ZWOA 1Q0QA 4FDAA 2QZZA 4CQLA 3H6KA 4FBGA 3JQ9A 4Z9FA 4BGEA 4FPXA 1GZ3A 3I9JA 3PZRA 3I9NA 1YB1A 2HMWA 3U09A 5ICSA 2VYVA 3NJ4A 5L7TA 2YHUA 4IY1A 2O7QA 4J9VA 2O3TA 2DTEA 3GZNA 4NFYA 4RPKA 4ZQHA 3CEAA 2PD4A 4MVJA 4YJFB 4ND1A 3OIFA 5U4QA 3O38A 3IC5A 3ZWWA 3BZUA 1Z74A 1ENPA 1LI4A 3KZVA 4YT4A 1PJTA 1HRDA 3EK2A 3I83A 3GEGA 1NTOA 3I9LA 4B8ZA 1LC3A 3OJEA 1K5HA 4E21A 2Q1TA 4CJXA 3RROA 3MWDB 2P9GA 2W2KA 3D4NA 5DOVA 4URFA 1LLUA 4KUGA 1L7EA 3W1VA 5KVSA 4J1SA 1E7WA 3RJ9A 2EWMA 4A26A 1WW8A 4MP3A 5TIIA 1PGNA 1C0KA 3ZWCA 2ZB3A 4XCVA 3U49A 2YV2A 1B16A 3O8QB 3TZ6A 3FR8A 2G76A 2GF2A 5JAZA 3FR7A 1VE9A 4L75A 2FR0A 3AI3A 4I5GA 3ZW9A 3ZHXA 4IDAA 1VL8A 3SXPA 5I7VA 2Y1DA 3SLKA 2PKQO 4Y8VA 5BSFA 1E7RA 4J4HA 4NJMB 1XU7A 1HT0A 1F0YA 1U2DA 1ID1A 1Q7CA 4WLOA 2D8AA 5KCZA 4UULA 4YRBA 1PEDA 1UH5A 4BNXA 1ARZA 1DC6A 1PX0A 5L53A 3L6OO 3AU8A 4OOEA 2XPCA 4OAQA 4FFPA 3COSA 1DAPA 2PR2A 1ISGA 1ZO8A 1XQ1A 3OICA 2J5RA 5DN9A 1X7DA 1IYZA 1YB4A 3JD4A 1FF9A 1ISMA 4I5FA 5TX7A 1GY8A 2AXQA 2XF8A 4QT0A 3QQPA 3SBOA 2WE7A 2PV7A 4WEOA 1C0IA 1XGKA 2C2XA 3GUCA 5G0WA 3AJRA 3GQVA 1LX6A 3OJFA 4CM7A 4K6FA 3DZKA 4IS3A 5IZ4A 3Q1LA 3PQFA 2VZ0A 1O89A 1LDNA 3OQBA 4E0BA 1OOEA 2X5KO 4XQEA 3LLVA 1R4NB 4BO8A 5HWSA 4ALJA 1SO8A 4XQCA 3VPGA 1WWKA 1GPDG 4PLCA 2VZ9A 5DT9A 3RASA 5EESA 4BIIA 1GR0A 2BGLA 3L0DA 4O5OA 4RQUA 1B15A 1PSDA 3OA0A 3F9IA 1KVQA 2OP0A 3DL2A 3JD3A 4U6SA 1IZ9A 1DC4A 2I66A 4ZRMA 4XRRA 2HMSA 4Z0HO 4CV1A 1MG0A 3IS3A 1E6UA 1WP4A 4J3FA 4G65A 1U8FO 3BMNB 2AW5A 2ZB7A 2I5PO 4R5MA 2GZ3A 1LUAA 4HNGA 5AQ1A 1LLDA 4XYBA 3G1UA 1MGOA 1U4SA 3DB2A 3Q9NA 4D45A 3LT0A 4UUNA 1ZK0A 3DZFA 1KS9A 1WVGA 1YS4A 2X23A 6LDHA 3KUXA 4MKRA 4DTIA 2BHLA 4CM5A 3DBHB 3TFQA 3WJAA 2HMTA 1HYHA 5JMPA 1H0KA 2VOJA 3PLNA 2I76A 2NU8A 4OKIA 4JIGA 3UUWA 4D7AA 2Z5LA 1CF2O 2CF5A 4N5MA 5DP2A 1Z6ZA 3MJTA 1U4OA 2Q1WA 1LDEA 5EMHA 1PWXA 1X1TA 1UXKA 1YRLA 3CH6A 2NVUB 2VCYA 3OH8A 1NAIA 3BYZA 3CZRA 4B8WA 4RF5A 1MXFA 3ROQA 4NFHA 3ZNQA 1ISHA 4Z3KA 5G0TA 3NT2A 2E4AA 3CKYA 2P4HX 2BI8A 4LCEA 4OJNA 3ZHZA 1HZZA 3G17A 5A4DA 4HP8A 5BNTA 1BW9B 5L3ZA 1DDOA 4LRTB 2QIOA 3PRJA 3IL2A 2BRUA 2IE0A 3CMCO 1A9ZA 5G4LA 2BF7A 3TL3A 1BXGA 2P5UA 2Y1OA 1GEGA 5KKAA 3DXFA 2NVWA 3FCOA 1NWHA 3GT0A 4W9NA 3G3EA 3F1LA 3MJCA 1X14A 4FB5A 3GY0A 2PGJA 5T8KC 4BB6A 3QW2A 5JDIC 1TB4A 4U6QA 3QSGA 4AJPA 2OBYA 3FBTA 4E2ZA 2VNAA 1UXHA 1NX6A 4ITUA 4EYEA 3WTCA 5TQVA 4HY3A 5DNAA 5CG2A 3W6UA 1U28A 1R37A 3I4CA 3LT4A 2DVMA 1JA9A 4IDDA 4J7XA 2FOIA 4RPJA 5JAMA 3T4XA 2OGUA 3E9NA 2C20A 4CR7A 1UDCA 2EF1A 4R4JA 2VQ3A 4GSLA 2HUNA 4IDGA 1ZK3A 1CIVA 3IUPA 4CLRA 3SLGA 4PLZA 3FBGA 4WPGA 2Q45A 3UCFA 3VOSA 4CM1A 4AJOA 1A7AA 2P4QA 4D43A 4K9DA 3GPDG 1E3WB 3GHHA 5JCJA 2GN4A 3RBZA 3E5MA 3KYDB 3DMTA 3L6EA 3K96A 4FCCA 1HWYA 2VHYA 4JROA 4RJTA 4DREA 3LVFO 4J1NA 2POQX 2EKPA 3QHAA 4D79A 2ZYDA 4UREA 2DU8A 3RUFA 3WYBA 4U7WA 1YJQA 4MVJG 1WDKA 1ONNA 3QWBA 1B7GO 4XYLA 5I8WA 1YXMA 1N1GA 4RVFA 4XWYA 1LDMA 2JFFA 4R3WA 4AJHA 1HYEA 1I32A 3PWSA 4Y9DA 4TRJA 1JWAB 1P1HA 1I3NA 2YYYA 4GL4A 4L74A 4N5LA 1H93A 1NASA 5I9LA 2EKLA 2E48A 5C7IO 5CDGA 5A9SB 3AFMA 4GI2A 5DCYA 3D5QA 1ISIA 4CMGA 3TZCA 1YBVA 4OL9A 4UEOA 3RBVA 3WFIA 2FZEA 2UAGA 4BNJA 1N9GA 5L4SA 5KJCA 1Z45A 1N7GA 3JYOA 5BNIA 1V3VA 4XJTA 3X2FA 4F46A 3DAGA 4F3YA 4XRGA 1PIWA 2DTDA 3JQAD 4KUHA 4BNWA 1JAYA 1GUZA 2I3GA 4K28A 3LYLA 1BRMA 2NACA 1E5QA 1E5LA 1XDWA 4UAGA 1E3LA 3B20A 4G81A 3PPIA 2B5VA 3AI2A 4K26A 1X7GA 1V0JA 4YAJA 2UUPA 4RVHA 2OXIA 4Z9XA 3GFBA 1DPGA 3E48A 5JMWA 2GSDA 3C1AA 2Y0DA 4I08A 4JJIA 3QP9A 4YJDA 2VWPA 5IN5A 3OA2A 3PYXA 3VTFA 1M6HA 3V5NA 4CLEA 4Q3DA 4ND4A 3BMOA 4RPHA 4LMRA 3EVTA 3QVWA 4ZJUA 1ZFNA 2JHGA 5IN4A 2H9IA 2GYYA 3GVXA 3VTZA 4IDCA 2O3RA 1IB6A 2GDZA 1YB5A 3WGZA 1PJCA 4LSWA 2NQ8A 4E31A 2UDPA 4AJJA 4YJFA 4AJLA 1LSUA 3PHGA 2HK7A 1GCUA 1F17A 3ONEA 5CP8A 1OMOA 3IJPA 3LC1O 4XIJA 2OFPA 1DFGA 2AA3A 2B83A 2QYTA 5IZCA 2VYVD 5JFOA 3K2EA 4MVJH 1EE9A 1I2BA 3ZV6A 3VVCA 3H9GA 4IMPA 2ZCUA 1MX3A 1W73A 3CUKA 3L9WA 2AG8A 5MGBA 2R2GA 5EQDA 4MVJD 3ZHBA 2GR9A 3F5SA 4OHUA 1GEEA 3VH4A 2PZMA 3PK0A 1P0CA 3HHPA 1ZEMA 2B36A 3C8MA 1MC5A 4O59O 3HB4X 5FFFA 2IXBA 2LDXA 1F8FA 1ENZA 3AM5A 2GZ1A 1PGPA 2PLAA 1GL3A 1CRWG 4BNTA 3A06A 3EZYA 3QRWA 3C24A 3O8QA 1DJQA 3H7AA 3PDUA 3ZWMA 1E3IA 3I52A 3ETEA 1MG5A 4I9NA 2YFHA 4J43A 3VPHA 3QVTA 3C7CB 2X4GA 2V6GA 4W6ZA 1LLQA 5DZSA 3WQQA 3JYNA 4HFJA 3M2TA 4NU6A 4BQRA 4W7HA 4NJMA 1ZSNA 3QIVA 1DIHA 2X6TA 1DJNA 1SB9A 3HADA 1YBAA 3D3WB 4FFNA 3FSRA 2O3UA 1PZFA 4EUFA 3HG7A 4HFRA 2AQHA 4H3VA 4PLWA 2EERA 4BO0A 2Q4EA 3O4RA 4BNUA 1ZIDA 4JK3A 4MVJF 1T2FA 1PJ3A 3FNEA 4BKOA 4GKBA 2FPPA 1EQUA 4GWKA 3HDHA 4GVXA 1KEUA 5A5EA 1T2DA 2ILTA 5F3RA 1R4MB 2PD6A 3GAZA 3KB6A 4Y6SA 2GO1A 1LDYA 5KVQA 3K8ZA 3DZBA 4CR8A 3IUSA 4NZ9A 1EVZA 2YDYA 3AUSA 5C5IA 3KXDA 5L7WA 4KZPA 2PA3A 4NPCA 1R4NA 4ZVVA 4CMBA 4OO3A 3EZLA 1IL0A 4YVFA 3JQGB 3KTDA 3IQDB 5HS4A 3BTOA 3A28A 5IXSA 1JVBA 1LDGA 1KY4A 4NH4A 4GGOA 4QXMA 1HETA 4FFRA 4O1MA 4C4OA 1A4UA 3VZQA 3L4BA 2JD2A 3UOGA 1U3TA 3WIDA 5JYEA 4XYEA 4RPLA 2ZTLA 4D44A 2VWQA 5KVCA 3ENNA 3EHEA 1DIAA 3UICA 4WJZA 3PVZA 3BMNA 2GLXA 1U1IA 3A14A 2EXXA 5CPFA 5KOIA 1F14A 2Y66A 2ZTUA 1SZJG 3WG9A 5HM8A 3JQCA 1DHTA 4BNLA 4KMSA 4CM6A 5K0ZA 3WSWA 1HSOA 1R15A 3NT4A 1M75A 3NTQA 1UAGA 1PJQA 3DBHA 4B4OA 2WTBA 4YT2A 2XOXA 1UP7A 1NHWA 1EMDA 7ADHA 4M54A 3TF5A 4QFDA 1TT5B 1ZVMA 3QE3A 4Q3NA 2JKVA 3K6JA 4E13A 4LSMA 5CHEA 2Q50A 3S8MA 4RVUA 4R69A 1ZMTA 3ADOA 3GN1A 2NVUA 3GFGA 5AOVA 4WASA 4XYMA 1JKFA 4L76A 4ZN6A 1C0LA 2Y05A 5GY7A 3S55A 4E30A 3E5RA 2Z95A 3DZHA 5FI3A 2JCYA 3HN2A 3ST7A 1GUYA 5A9TA 3MOGA 3U3XA 1BW9A 5ILGA 4PG8A 1ENOA 2B69A 1OFGA 3PDJA 2WYWA 4NFSA 4ALMA 1I24A 3JYQA 2Y93A 1PZHA 1JWBB 2DQ4A 1P45A 3C1TA 2CDAA 3WFJA 3D5TA 4IIVA 3ANNA 1UZMA 5LCXA 4E5PA 1FDTA 1X0XA 4QX6A 5FYDA 3WGYA 3KBOA 4PG4A 5B37A 4JP3A 2VUSA 3GA0A 1AUPA 3ASUA 4BGVA 4II3A 3VVBA 2CDCA 4EJMA 3ASVA 1EK6A 4ALIA 3WBFA 2C29D 4J90A 2YZ7A 3GRPA 3ROPA 3VPFA 1LBEA 1UXGA 4DQXA 1JW9B 9LDBA 3TNLA 1I3KA 4IJVA 4UVGA 4NBWA 4BKPA 2B5WA 4Q3CA 3HWRA 4KOAA 3RU7A 1YJ8A 1KIFA 4GWGA 2Y1CA 4PRKA 4F6LA 4D3DA 4DRYA 1CDOA 2NVBA 2ZIZA 1E3WA 2IZZA 5T64A 4OQZA 4K1LA 4PCVA 4J0EA 3KYDA 4MPDA 5TT1A 1F06A 3TZHA 5ENDA 1VL0A 4BKQA 1HZJA 1K0UA 1G0NA 3DBLB 3HDJA 4FOOA 3VPSA 4JBIA 1DBVO 4WE3A 3U4DA 2DC1A 3BTSA 3DZIA 2O7SA 3KOUA 4LVUA 5IAAA 3VZPA 4XZ3A 1FDVA 4GH5A 5JCJD 2YJZA 4Y6PA 4OSOA 4IXWA 3KO8A 3WJ7A 3KSZO 1U7TA 3K2BA 3TQHA 3ZN2A 5JPIA 1NQTA 2W2LA 3BHIA 4BMNA 3QWHA 4WOKA 5FWNA 3PFFA 5A5FA 3BXXA 5A9RA 4FW8A 1LEHA 4UVHA 4WNCA 1NM5A 1PQWA 3NTOA 1EE2A 3S2GA 3KYCB 1P1JA 1VJ1A 3T4EA 2UYYA 5MDHA 1HTBA 4GX2A 5BT9A 1YQGA 1XQ6A 4J91A 1DXYA 5A9SA 3E82A 3KSDO 1T1RA 3OM9A 4TZTA 4YRDA 4CMEC 3ZV3A 2IZ1A 4OIMA 5I7FA 3H2ZA 3SJ7A 3DZGA 3W8DA 3RQSA 1IUKA 1MXHA 4OKNA 5F1OA 5A05A 5DF1A 1QSGA 3PJGA 2EHDA 4OXYA 1V6AA 1LRJA 4D3SA 1NPDA 4H7PA 4KTTE 3WDSA 4EJ6A 2B4TO 1ULUA 4L4SA 2JCVA 3W4IA 1XKQA 4YDRA 1E6WA 2H5LA 3ZW8A 2ZTMA 4J0FA 5T67A 2RHRA 3DTYA 4CLHA 2J6IA 3GZ4A 2RH4A 1CQIA 4N18A 2D2IA 2FN7A 3PIDA 4JXKA 1IHXA 1NAHA 3FD8A 3FWNA 3LT2A 1FXSA 2I9PA 2Z1MA 4NIMA 1CJCA 4ZQGA 2BKAA 4UUPA 2FMUA 2YV3A 3ANLA 5HS6A 2EJWA 3HQ4O 1MP0A 4QTZA 1SCUA 4R1TA 1ZJZA 2Q49A 3K31A 5JC1A 2BH9A 4YTEA 3F4BA 3NGLA 3GVCA 1SC6A 1ZBQA 1A7KA 4WGGA 1ZXLA 3HDYA 4TSKA 4JJFA 3P7MA 3H2SA 4IJWA 4NK4A 2PKRA 1ZK4A 2F00A 4KQWA 3JYPA 3WLFA 5BQFA 5C37A 3RKRA 5IDXA 8ADHA 1E7SA 2NU7A 3PXXA 3I5MA 5F1PA 2C59A 5L45A 1ZMOA 2NLOA 4RGBA 4EITA 1PQPA 5ENVA 4F45A 5LDHA 4GX0A 3UGKA 1T4DA 4HNHA 4PLHA 3VH2A 2VHVA 3DO5A 1TLTA 2Y0EA 4NU5A 1UUFA 5COAA 3G0OA 3H65A 3PGXA 5KTKA 3JQ7B 1CERA 2V6FA 2AHRA 3RCBA 5TNXA 2Q2QA 4B3JA 4DPLA 1RYEA 3ZV4A 1ADCA 4YAGA 4M8SA 3S2EA 4AJ2A 4C7JA 1RM0A 1UR5A 5HBRA 4XQGA 4XKJA 3ZNOA 4AICA 1UDBA 4FFOA 1NQAO 1GAEO 4DMLA 2PK3A 2PWZA 3CPSA 1LSJA 3EGOA 3DOCA 3TDKA 1F8GA 4FC6A 3GOHA 1AXGA 5L7YA 2BFOA 3ICPA 2ZQZA 5T8KA 2G5CA 5JDIA 3VH1A 3DOJA 5I7SA 4B4WA 4KDFA 4ZHSA 1AXEA 1H6DA 4RLHA 4S3MA 4DBVO 3D3WA 4XX0A 1GCOA 2A4KA 4IUYA 3WMXA 3WQSB 1HDGO 5I9NA 2AQIA 1OC4A 3BTVA 2ZYGA 7MDHA 3QWIA 1LSOA 2YDXA 2GD1O 3NKLA 1V3UA 3QJ5A 1LDBA 2RCYA 2V65A 4YT8A 2Q2WA 1LQTA 1R0KA 4CQMB 2Y68A 3BA1A 4TVOA 1MUUA 2FWMX 3KM0A 2B0JA 2Q1SA 4NMHA 4DIFA 1N8KA 1G0OA 2DPGA 1DEHA 4AG3A 1EEHA 3WWYA 3L9XA 1KOLA 1IULA 2A9FA 1FDUA 2VRBA 3HB5X 4D0RA 2X5OA 1HF3A 1SPXA 1E92A 1R4MA 2W98A 2XXJA 3RKUA 3AUUA 3ZNNA 3RFTA 3GC6A 3AUAA
chains in the Genus database with same CATH superfamily
2IUTA 3HWSA 1M2OB 2ZBDA 3E3NA 4LYHA 2Q3EA 3JARA 3IPCA 4NFLA 4HB0A 4G2NA 2GKSA 4YY3B 2P0AA 1XALA 1WIWA 4Q1CA 3L7YA 4BLVA 2CCKA 3HUUA 4QVIA 3LDAA 2PVSA 3REGA 3BH0A 1M1NA 4F3NA 3VOAA 2X8WA 3C48A 3I04A 4TTVA 3T9FA 3TL2A 4X65B 4KQJA 1HOTA 4LNUA 3LL7A 1ENYA 4YRJA 2OXRA 4RTSA 1DAHA 3DHWC 4WCVA 1OD6A 3PD7A 4HL6A 3BCUA 1H05A 1ABEA 2VHUA 2Z0MA 4IEIA 1TYAE 4M1SA 4KBYA 3ULKA 3PGVA 1JI0A 4IWYA 2H5JA 4BN0A 1SU6A 1TW3A 3QKSB 2QY6A 4EMTA 5BORA 3DKKA 1Y3AA 3G2PA 1I8TA 2DH5A 3S29A 1T13A 3O91A 4GVPA 3SR3A 1X92A 1YCGA 3TN7A 2XMSA 4L15A 2CXPA 5HHTA 4RA6A 1CY2A 1PS0A 1XQ9A 4PQRA 5IXYA 1VP3A 5F9HA 2H8GA 4PIVA 2FPGA 3GRZA 2ZAMA 5H70A 1AJEA 1JR3D 1ZDMA 4EJSA 1JLMA 4P4UA 3J7AC 2C5BA 5H5JA 5AJWA 4ZMBA 2ZATA 5C8VA 3HK2A 3WBBA 4CMKA 2BLLA 1SVWA 1ULZA 3MTQA 3CRZA 3I9OA 5FTMA 4F3CA 4W5TA 4O2RA 2AC7A 2O3SA 4XXHA 5EINA 5FKJA 3SHFA 3MQ2A 3FTNA 3GUYA 1XQYA 4ND2A 4REQB 4MV7A 5IAEA 4Z4GA 1FTQA 2I87A 4B3XA 2IU6A 2ZUWA 1QYRA 2RAFA 4JOBA 3WHPA 3T7EA 2XNSA 1WZCA 3EFOB 1V11A 4WSOA 2ZPTX 2LDBA 3K92A 1N3LA 3UKOA 2O0HA 3V7NA 3M1LA 5KX5F 4Z4EA 2X1MA 4KDCA 2AEJA 2WSLA 4RE5A 2Q9UA 1T4CB 3HI6A 4ZJPA 4JIMA 1MNAA 1IWOA 4ZOBA 1B6GA 1LV8A 1R5NA 5JHGB 4GWLA 3RDPA 3LW8A 4R1QA 1LC0A 1A5TA 1KXJA 2OLEA 4AXBA 1JXQA 2GLTA 4HQ0A 1I9GA 5BW4A 5K8CA 3BHMA 4TWRA 1LJ8A 4QOIA 5AK5A 3HWWA 3H6HA 1OLOA 3TIVA 3CLUC 5FL7D 4ESOA 2BFEB 3DBVO 4KQ2A 4HT3B 3DE0X 1VCOA 2OCIA 1VCIA 4M9QA 2HF8A 4YRIA 2CLFB 1QP4A 4HXEB 4AURA 2AL7A 1I33A 1C3OB 5AXBA 4G85A 5P21A 2YXLA 5BV1A 1E9RA 3UTDA 4GMXA 5CA0F 3HVKA 1O8BA 3NDRA 4TQGA 5LYYA 2C9OA 4I19A 2C1ZA 3ZY3A 2GN6A 3J81k 1G8KA 4NYIR 1B74A 2JBAA 2JDIA 2W6JD 1CV2A 1WZIA 3OZGA 4JUIA 4P7FA 2AQKA 4RULA 4DUYB 5DSZA 1UC9A 4BO1A 2Z9DA 4J94A 1SXJE 1H9AA 1SCAA 2NPFA 1YJBA 2FF5A 1SXQA 1P4AA 1TAHA 4BNVA 4F4CA 3JQQA 1GOTA 1HG1A 1NDHA 3PFIA 4OQLA 3LCJA 3EXAA 3MCZA 3CV3A 4FLEA 4NCIA 3C7DB 3CSDA 3BVPA 3QE0A 5KJEA 3ZQ6A 1AN9A 1PNTA 1YA6A 3KQSA 3IDSA 3U31A 2R6GA 4C4SA 1XD2A 4I1UA 1IEXA 1T5LA 1MNQA 2XNDD 1OHHA 3NWBA 3HEMA 3WLNA 3HB0A 2D7JA 2WNSA 1JHAA 2VEDA 3WXBA 3WJ2A 1JG1A 4XPZA 4N7JA 1T29A 3ESBA 2C9DA 1WS6A 2NSDA 4WAUA 5DT2A 1KZ9A 1QLJA 1UQRA 3C39A 3R9WA 3OTQA 2HGSA 2EWVA 2E3JA 3BD9A 1CZKA 2TMGA 1L7VC 1YCDA 1ISPA 3C3AA 4FDTA 1U2PA 3IAFA 1FYFA 4PANA 4LIPD 3F7TA 3ZDXB 4JBWA 4M1TA 1FA9A 1P4GA 2EGHA 3CUTA 4RK4A 2ZUFA 1ZZGA 3PFCA 4HRVA 4MUYA 1CUIA 4L8VA 3TFOA 1QFXA 1RCTE 2BFDA 1YUMA 3K9NA 3MCVA 2DX7A 2QUKA 2G9QA 3IE0A 5D7NA 1ZSVA 3R3XA 2NP6A 1JBQA 3I0ZA 4LZOA 1OXUA 4EF6A 1W9HA 4IIYA 3SIPA 1LLCA 2CFCA 4R8VA 4XOIA 1BAPA 1A76A 4U1RA 2CLOB 1BXKA 3HA7A 1N75A 1XLTC 4XR9A 1ONPA 4FUQA 1BEEA 2WQZA 5HDBB 3OPYI 3R4CA 4RUKA 2GLUA 2AC2A 3UT5B 3C14C 3GJ7A 4HO1X 3CA8A 2J6HA 4PZUA 4Q6BA 5AW7A 2QTVB 1Y6ZA 3IEKA 3GLFE 1FL9A 2B25A 4OFBA 2RKWA 3I2GA 4L5AA 3F74A 1JEDA 1WBBA 2Q3JA 4D46A 4EFLA 1K3TA 1QLHA 3NMUF 2BKLA 1ORWA 1SOWA 2XWPA 1CEXA 1DI0A 3GJ8A 3HJHA 1CJMA 3O9MA 5FI5A 3TQIA 4BEVA 1E4EB 1NP6A 1H8HD 3FYDA 2UU9B 4YMWA 1KOGA 2OA0A 3D0RA 2JF0A 4Y6RA 3G1TA 3ELDA 3LD9A 4IQ4A 1Y8QB 3IODA 5LQKA 1AV7A 4O8CA 5M34A 3CN7A 1X7XA 2E37A 3VDXA 4Y0AA 5JFTA 2WM3A 3CTPA 1W52X 3QPDA 4G07A 1A98A 2XQGA 2YW9A 3P9ZA 4Y2YA 1FRNA 1SEPA 1XV5A 1YZLA 3I09A 1TK9A 5TGZA 2HU8A 3AY3A 1WBJB 2Y0BA 2ZUUA 3CG0A 4D57A 1JNXX 5SY6A 2PSEA 4NS4A 4C43A 5DK4A 4ZC1A 4EAAA 3MTIA 1NVTA 4YUZA 2QW0X 1XF1A 1GQQA 2V55B 3RNLA 4RXTA 3KYIB 1MN6A 3PVCA 1RWVA 1UBRS 1YDWA 2GZ2A 2YCLA 3L8HA 4I9GA 2PUVA 4Y2RA 5AJUA 3V8PA 5BR7A 5EG5A 2NX2A 1R0BA 3AZQA 3GFRA 3P4UA 2GHTA 1UZLA 1I2CA 4JLOA 1KARA 2IF2A 2ZUVA 5G0SA 1GADO 1MX5A 3OIDA 3MJSA 1R4ZA 4XQ0A 1KKMA 2N75A 4G63A 4TMTA 2FRVA 4IPTA 2J3JA 3GJ5A 4EFNA 1BJRE 5E2BA 4ZDWA 1TGVA 1O1YA 4JI3B 3WIEA 1V8OA 3B3JA 3N8KA 1DOAA 3ADKA 5KIAA 2RGXA 2PV0A 1SU7A 3DLCA 3MUFA 1M76A 5FO1A 1U0EA 4NKRA 2IP1A 1H6AA 2HRBA 2R85A 2I4RA 3UMSA 4RTPA 1NY5A 3B7WA 4JZYA 2JLSA 1P5FA 5TPZD 5BSHA 3A04A 3EQZA 4R1NA 4MVJM 3WZLA 5KQMA 2HXYA 4KFRA 2RHJA 4MXDA 4FEAA 2XMQA 4ZREA 2TMDA 4LHYA 4NBUA 5CFZA 3GJYA 5FPPA 2JANA 3KWFA 4OUDB 4YRQA 1N5MA 1DTSA 4Q1AA 1BTOA 2J9ZB 3V46A 3WBJA 5BSWA 4I4TA 1MC4A 4IGKA 1AT1A 4WV3A 4MP6A 4V0LA 4KVZA 2ETVA 2AEEA 4MARA 5FUYA 4WLUA 5EXEA 1W5TA 3GRKA 2JI6A 4MUEA 2R4UA 2A7QA 2KLBA 5FI1B 3A10A 4G26A 4QGAA 3HKDA 4LJYA 1VI5A 2OO5C 4A82A 4M4SA 3FPCA 5E0OA 2RONA 1ZMBA 1ITZA 1UMKA 2ZXFA 3A36A 1R6DA 3NG1A 2JZCA 4KQHA 3AEZA 1KBZA 4KZKA 2HKIA 4KVGA 3RM3A 1YGYA 1PQUA 3JQ7A 4DC0A 3GVIA 3SSNA 1PQYA 4BMOB 3OKFA 1XRRA 2XZDA 5B64A 3FCEA 4XARA 2YYSA 3ED5A 5A1TA 3PRKE 1R16A 3RAEC 1G4UR 2HA6A 3KLMX 1RQGA 4G01B 4GPAA 3ZHSA 4GBGA 3D4IA 3UMMA 5L40A 3DHYA 2DR3A 3G79A 3UAOA 2A9JA 1PGQA 3AHHA 2JPDA 4WN3A 1LBHA 2R8BA 2XKJE 1BXZA 1XEAA 3EQ9A 2VBIA 1EUDB 2XSZD 4XFJA 1U7ZA 3UHPA 1F3LA 2WD8A 4OTZA 5F23A 4GW3A 3U16A 3NP9A 4UZEA 1OFUA 3W8FA 2JJ8A 1J07A 1XCMA 1JGTA 5C8ZA 3B6JA 3N8DA 1KBOA 2MR6A 3P27A 2CNDA 5K3CA 2IODA 3BSFA 1JFTA 1V5IA 5DGDA 1YFKA 2FSVC 3W79A 3U7JA 3R4VA 3CX3A 5KSWB 1DCKA 3VO9A 3H5OA 1FFGA 2PRYA 5F5XA 1RXYA 2QI9F 3LQRA 5ARBA 3ELYA 4PLPA 1A2OA 4FX2A 421PA 1MH1A 1ZH8A 1Y4DE 5CTJA 1ADJA 3GHYA 2ZXEA 4HDOB 4M1QA 1EVEA 2P6OA 3ABQB 4RW0A 2GK7A 4IH4A 4ZHQB 3UV7A 1I1HA 4CQMA 1DT5A 3ZK8A 4WD3A 4YPFA 3K9LA 4U7HA 3RUIA 1E9VA 4PG5A 5GV7A 4H7IA 2ZR7A 3M5CA 1SM4A 4FFBB 5G02A 2AN3A 3THSA 2HRDA 2H00A 5JZMA 3L79A 5F98A 1JSRA 2PU5A 1L7NA 4WNAA 3UXYA 3BIFA 1JALA 2CNWA 4PINA 1D9ZA 3FUWA 4OAOA 2ZPUA 4HKTA 4C4PA 5FBHA 2EHJA 2WOJA 4N3CA 2NU9B 1EH5A 1BSVA 5HDQA 3DG9A 5EIXA 4E07A 2JVKA 3UK6A 1YFJA 5CAEB 4IFIA 1IEWA 3UMGA 5AP9A 5K8LA 2ECOA 4MLCA 1Q1AA 1OUMA 3OLXA 3DXYA 4FGWA 5HZGA 1OJLA 2L17A 3EJ6A 4PHTA 3DYBA 4JLAA 1DOHA 4ZI5A 3RU9A 4O2AB 2REOA 5DK6A 5C7LO 2DETA 3GN2A 3O90A 2QR2A 2FMIA 1VSUA 2YY5A 3LBAA 3KTOA 3AHFA 2IP2A 4HI0E 3LSTA 2J41A 4EQ6B 4PGFA 4KQGA 4UHKA 3A70A 2CSXA 1IOZA 1GV0A 3EGXB 3K4HA 2VPTA 3OFJA 4PHFA 2OBBA 1U81A 2F3QA 4FMCB 1KDOA 3OECA 4GI5A 2P2SA 3SOZA 3NGMA 3GAMA 2ZT6A 3DMRA 1OB5A 1OFIA 2CMDA 1P4JA 3F8SA 3IP7A 3N8GA 1UP4A 2QAGA 3NWPA 3FPEA 3L1KA 1MHTA 2YIMA 4R31A 2I4MA 2G9ZA 4BQPA 2A5YB 2Z8XA 3AU9A 4MQFB 3K0CA 1SQ5A 2YFQA 3GFSA 3KQYA 1AHIA 1EUCB 4EI9A 4WRRA 1V9LA 1GSIA 3B1ZA 4EY6A 4RFLA 4X91A 1BYUA 4K8RB 2WU0A 2LIPA 3X1DA 1P5HA 2RBEA 4MWCA 1FVHA 4FT2A 4KOEC 1YR9A 3WNBA 4AMVA 4R9VA 4YCDA 1F51E 2HCRA 4UTPA 1GTZA 4OK5A 3NW9A 1MO5A 3GFFA 4R3UC 4BTVA 4YAEA 2ODNA 1MB3A 3D5EA 2IYEA 1CUSA 1J20A 1N1EA 2JL1A 3C8HA 4LBZA 5CBKA 4N12A 1FYEA 4X44A 3V9PA 2BI7A 4LE0A 3Q6IA 1U1GA 2R2AA 5CHYA 5JEEA 4ER5A 3C3BA 1UBLS 5JNUA 4BNMA 3A9TA 5DKFA 1L1QA 1QHIA 5TRTA 4PHCA 1PX2A 3ZGZA 1RI5A 1IXKA 2J3HA 1G21B 2YRFA 3DWFA 3EDMA 2HRCA 1IAQA 3AFNA 1H5NA 4IVPA 5E95A 3WYEA 3X44A 2C99A 1V1JA 1NY6A 4GLLA 5BUCA 3MB5A 3RABA 4G4JA 1SA0A 3O4IA 3WS7A 1Q50A 4OG2A 1T0PA 1WMAA 5FUVA 3BULA 3AQIA 2FSSA 1HLDA 3F4LA 4HH4A 4X7MA 2FAXA 1H1TA 4DABA 2B4AA 3CZ9A 1XZJA 1X74A 1Z4KA 2XAAA 2D3TA 1MAHA 2VTBA 1NR5A 2WAMA 3GDFA 5AVKA 5CFQA 4MVJI 4S04A 1WKCA 2YY6A 3RSZA 4US1R 5FDFA 3RSCA 4LJKA 4D02A 2HT6A 3PEFA 2A5FA 5B1IA 4CM8B 1DC7A 2FLWA 4YHBA 3TPZA 1D07A 1T8UA 4DLBA 1P2DA 1TVEA 4NU8X 2FMTA 1FRFS 2WNHA 1GVHA 3FYTA 5CA1A 3DNMA 3DXXA 1QFSA 1F1JA 1X70A 4FGJA 5I3ZA 4PLTA 5CCXA 2WTUA 1HDRA 3HB1A 3ZE8A 5KKNB 4EX7A 2H85A 5KTPA 4AUNA 1B14A 1R3DA 3KUUA 2I8AA 1C1YA 2QRKA 3L04A 4L4UA 2ACWA 5HUJA 3EVCA 3KZKA 1QRSA 1E2EA 5DEIA 4A15A 4JKIA 3NAMA 1DB3A 4HVTA 2FU5C 4RD6A 1MO6A 1TT7A 3JAKB 4KW7A 5AW8A 1DCTA 4BMZA 3PPXA 4PC6A 2C5GA 5FQNA 5HXAA 1KYTA 2CJWA 4GOND 4R1SA 1WDLA 1HNZB 3FWHA 2O5EA 1P3DA 3ECAA 1OHHD 2AH5A 2CK3D 4FNOA 5IKOA 2IZOA 3OLWA 1X8LA 4RGYA 2OYRA 1VDZA 1WMSA 2C4KA 3BRCA 4LTDA 3JALB 1E0KA 4GR4A 4E15A 3RSOA 1Z0ZA 2W6NA 5K6RA 1VRWA 1YF3A 2VCEA 4YJ2A 5KQSA 2CF6A 2C84A 1YVEI 2H08A 3PFGA 1US8A 4AECA 3DMNA 5E8RA 1XZNA 1HY3A 3AGPA 3D7LA 4MUHA 2JATA 4HAUA 1U7DA 1L4LA 4C7OB 1XR3A 2ZAGA 1NBAA 4NG5A 4DMFA 1DINA 2NO5A 3AO0B 4EKEA 4ZDIA 4KAXA 5EKSA 1VHTA 2VHWA 4OJYA 4XASA 3TZQA 5BVHB 4X6YA 3L05A 4OHOA 4LE1A 2XTAA 4YAUA 1U90A 5K0CA 5K51A 3H1TA 1U3VA 5AM4A 3CZ5A 2GM3A 4JQYA 4ZVLA 3O21A 2FXIA 4HD8A 4I4LA 2CY0A 1PLKA 3FTQA 5EJ9A 4KNVA 3VR4A 2Q3HA 3OETA 1Q0SA 3T7AA 3LQQA 3IUYA 2ETXA 3JV7A 3RFFA 4E33A 4BKUA 2BGIA 2Y76A 1I6LA 5AVTA 2G40A 3IBCA 4DSUA 2V1UA 4AKSA 5JC8A 4AY3A 2QGFA 2ZU6A 3CHYA 2WWWA 4ZJZA 4Z5XA 3C3CA 2HSWA 4RJJA 3QNUA 2O14A 3SYRA 3L0YA 3PJFA 1VM6A 4QDUA 2H1IA 1AURA 2VN8A 2JI7A 1CUHA 1DMSA 1T4BA 1C7JA 2PEZA 5DXJA 1SELA 3DFUA 2I7CA 4DR2B 2D5CA 4Q4JB 2WMDA 4BGDA 3N58A 2CXNA 1QE5A 3KE9A 2V5VA 3FUCA 1ATZA 1STOA 2H2IA 3GVHA 4XQ9A 1OFVA 1ZN8A 5JD6A 2YBEA 3G8AA 1G7CA 1K8YB 2VSYA 3EEFA 2HH9A 1DNPA 1XO1A 2WG1A 3DDUA 3S1AA 1PNQA 5JH7A 2ERYA 1IZ8A 2O5VA 5ALWA 3W8EA 2WU3A 1XYGA 5E2AA 1UKYA 4E5MA 1TEVA 1J1UA 1V35A 2QV7A 2VVTA 3O0DA 2X8LA 4UM8B 1HBJA 4X1IB 1JAIA 2GCPA 4KMMA 3R7NA 2QBYB 4RA9B 3WNDA 4EMUA 1T8WA 1VXRA 4P2BA 3WXMA 1GTVA 3LXXA 3MFYA 2R1TA 4YJ3A 2CHVA 5HVNA 1GQYA 3UWDA 1GGFA 1PG5A 1QE0A 3JCZA 3RYFB 8LDHA 2FZ5A 3OQMA 2J0SA 2V4MA 3KQVA 3ETGA 1GNQA 1TUEA 3QI7A 2H1HA 4JC0A 1OAOA 2FFBA 1YQTA 3PGLA 1U7HA 4TXJA 5LLSA 4DB4A 1X87A 5CXUA 5EWLB 3ROTA 3UB4A 4YRFA 1VLJA 1FIUA 5IAOA 3ZGNA 3PENA 3PVSA 2NU6A 1QCZA 5AJZA 2VXCA 3DDOA 1VJ0A 2DWQA 2UV8A 5JSZA 3IP6A 3DQPA 3MA0A 2M6RA 3OD1A 5DIFA 2EDAA 4E5NA 1NRWA 4JZKA 1ZG3A 4NZNA 5CIQA 1N2EA 3OPYB 1SG9A 2MJLA 2I4LA 1LQUA 2V1XA 4HQOA 4FYMA 4R8MA 1JR3E 1R3UA 1XXHB 2QRUA 3IE2A 4H60A 1GRRA 5M5BA 4EG7A 3RYHA 1G20E 3IUEA 4K86A 1DHRA 2WAAA 4RZ3A 2PLRA 5HQTA 2ZWVA 1ULAA 2QTAA 2IOFA 1ZGZA 1Y5RA 2VYQA 3AI1A 3EY9A 4BATA 1VHLA 4UNIA 3OKPA 1W88A 1IHYA 1EWYA 3EA4A 5DWQA 1DRKA 2Q5HA 1JEAA 4L9AA 3M6WA 3CWCA 5A4AA 4KL8S 2EGGA 2OMKA 5AFSA 1DELA 2FZWA 1ZU5A 4N8DA 2NYAA 1G18A 1P39A 4NYMQ 3UUGA 4HVLA 1ZC3A 1PRYA 4YV1A 2FE4A 1T9HA 2X7JA 3P4XA 1QO0A 2XVXA 3GPIA 4NESA 1KEPA 1ODJA 3W7BA 5K5EA 1U8ZA 4MVWA 1B8VA 1UXIA 1JH8A 1ZHFA 3JQPA 4L0DA 3GEPA 3KAPA 1TJYA 1I2AA 1VGRA 1V5WA 3U3ZA 1Y34E 2ARKA 2GN2A 3U4CA 4B6SA 5JAOA 1FP1D 2PHZA 5H8WA 1W5FA 1B8OA 2VPQA 3FZNA 1L5WA 2DFVA 1K8XB 4MPJA 5E7IA 3NRCA 4RELA 3G8CA 3F9CA 2WIBA 3UYLA 2EZ4A 2I99A 2JA2A 2OCLA 2VOEA 3CO0S 3WZMA 4BVKA 4HLNA 4FONA 3UMVA 1MKYA 1N0UA 4MEBA 1J06A 3JWGA 4BNZA 2I91A 4FM9A 3RWBA 5BMOA 2C5SA 1FFYA 3Q3CA 4G41A 1J21A 1IBKB 3CUYA 4QELA 4HXYA 3BHJA 1P0FA 4HWPA 4CQNA 1E6CA 4TLAA 1GN8A 1IM8A 1GFSA 3B60A 3C16C 3JVEA 2G1JA 1DUIA 3BD8A 1Z0DA 1ZD8A 2BE9A 2FOLA 3BXEA 4MJLA 3ZWYA 2I1QA 3JQ9C 4MCIA 5DO9A 2IXFA 5HJ5A 5ALOA 1T9CA 4URHA 2VPZA 4HX2A 2PMBA 4IIJB 4A73A 1E9CA 4BN4A 3T0FA 1XVLA 2ZZMA 4JCCA 1XELA 2G4VA 2P4EA 3PD1A 1BMTA 4MIKA 2H63A 4IG4A 5L3SB 3PQ7A 2I1LA 1U5BA 5LVAA 2CKDA 2NZ8A 1NPYA 1B2LA 2J85A 5K0BA 4TWBA 1FEZA 2IZ6A 2C0QA 3WLSA 3GXBA 4D9NA 4BO4A 5K3AA 2ODTX 3EVEA 4RKEA 5LBUA 3RFVA 4KGZA 1QX4A 1U8EA 3L7NA 1D8TA 4DRZA 1JR6A 4KIWA 1GZ7A 1YOBA 3BWDD 4TL8A 5H4HA 2EX4A 4CQMD 2DEUA 4OX9B 3HO8A 3ZNPA 5IM4A 4QOFA 1MRZA 2CFIA 2W93A 4FILA 2V4UA 4O4LA 1I1NA 4TPKA 2BR5A 4WESB 3HO6A 3OTIA 1DVRA 4E1AA 2GFIA 2BPOA 2BHNA 2VJQA 3GARA 1CIJA 1X77A 2CNWD 2VR1A 2Y71A 1YACA 3OJOA 4P9NA 4XEHA 1GSHA 1VIAA 4DUGA 3NNDA 3KL2A 4E4YA 3USCS 2GXAA 3JY6A 3BQ9A 1U8XX 4E5KA 3UBTA 4KDEA 4G0NA 1CY1A 1KI9A 1Z7EA 3KLPX 2J4CA 1WCWA 4HWKA 5TJ9A 1B23P 1MB9A 3KPYA 3MB8A 5A3VA 2BHSA 3MUNA 2EYUA 3ORSA 5JAIA 3TM4A 3MG9A 1AQYA 1ODCA 2PLWA 1GUAA 2P8JA 3BK2A 3U4QA 2O50A 1XA3A 1ZMRA 1ORRA 2ZW9A 3HGQA 4KQ1A 3R3JA 3GEMA 4GI7A 3E05A 2HRZA 4D98A 5I3CA 3ILXA 2OFWA 4MB0A 3SM3A 4HFMA 5IFLA 5ESRA 2F59A 2FCAA 1XRQA 2P9CA 2Q6KA 4PSAA 2VHJA 3FKJA 5DULA 4TRRA 3ZDRA 2C07A 4DXHA 5AIBA 1GN9A 1O6GA 1ADYA 2WBLC 4CLOA 1FUEA 2HWUA 3QQ5A 4GSKA 4X1KB 3EIXA 4Y2JA 4E7OA 2EARA 4TWAA 2C1XA 3E03A 3QITA 4JJZA 2PZAA 5CB4B 5JYDA 3U4MA 4F11A 5KJ6A 3Q72A 1N5DA 2IS6A 3LQ2A 1G6KA 1NYTA 3BMQB 1XN1A 2XGOA 1ILEA 1XAJA 5JASA 2V7TA 2PVPA 4OXQA 2FB9A 3MLBA 3CT4A 4PX9A 3F96A 3HSKA 4D56A 4LCBA 3ZGYA 3UTCA 4HV4A 2V0NA 2PNFA 2WFAA 1EFCA 2CFRA 3K1AB 2GK6A 2J3KA 1GPNA 1QIJA 4I5DA 3B1XA 2CYCA 4J7UA 3K09A 2ATCA 2BGMA 3EVNA 4MRVA 2ZZKA 4R2HA 4RWEA 5ITSA 2P27A 3SEAA 4MKXA 1Q2XA 3T1QA 2OBNA 2O5CA 1POXA 5EYPA 1CUDA 4DIOA 5KSOA 3OCWA 4CW7A 1OWLA 2CEAA 2EATA 3MS2A 2I65A 4MQ6A 4UU7A 3R9XA 3IAS1 2J8ZA 1Z4JA 4C7VA 3ITDA 4PWZA 4LC0A 5BURA 4YIHA 4RTLA 2R6AA 3PCRB 3JQBC 5L51A 1XVUA 1UCFA 2HTFA 3WL4A 1TJ3A 1Y9JA 1ZKMA 4AJ1A 4BHTA 3CSSA 4YR9A 4D8XA 1G6OA 2LPMA 4DW8A 2WA1A 1UFKA 1KI6B 1P2TA 4DCPA 3QPUA 1VJTA 2X0DA 5AW4A 1J5XA 1ZUD1 1UOEA 3D6HA 2GEUA 4TT3A 1SHLA 3JAWA 1R0SA 1X2EA 5D3ZA 3RUCA 2I34A 1IEVA 1T26A 1E3EA 1N2CB 2W2XA 4BU1A 5ILOA 4KUEA 1FFDA 3BD7A 3U7QB 2DGDA 3HDVA 3OEHD 2M9MA 4C01A 1ZW1A 2YHIB 4AMUA 4TN1A 2UYHA 5FHQA 4DTCA 4X71A 3WLKX 1AK9A 3A3YA 2C2YA 2IX9A 3HO1A 3BJRA 2OO5A 2JIBA 3BH6A 3P2YA 5AKIA 4ZCIA 4GZLA 4AZ0A 5EZ6B 3OU2A 4QNMA 1UPBA 1OGJA 1NDQA 2E4XA 2JH9A 5DASA 1L7OA 3TKLA 5K0LA 5CD9A 5F3WB 3RVLA 1T25A 4LXTA 3CGGA 4DJFC 1KZ4A 4NL4H 1Q7GA 4A0QA 5EERA 2C95A 3GFQA 1ZOOA 4Y1FA 2JJYA 3CNBA 5ALQA 2FHSA 1L5SA 3KPWA 3M89A 4CLXA 2A3NA 4M0UA 4FD3A 1D6JA 1ABBA 4GQIA 3NX4A 2N0SA 4W82A 2JAPA 5ECGC 4A23A 5HTOA 5FAXA 3BB1A 3LP8A 3OT1B 2VJOA 4X8OA 4S35A 4ZEOA 4J29A 4AY4A 2PZJA 2ZWPA 4JYAB 1YU9A 2PY6A 5JAQA 2FP4B 3DTTA 3X1YA 2VPPA 5KO2A 3CE6A 1PL6A 3OLYA 3QPWA 3PDIB 2VWHA 1UJCA 2XDYA 1SY7A 2CVQA 3M1AA 1HNXB 3FDIA 2GXQA 2ZB4A 4OB7A 5A4FS 5KWEA 5CCDA 1SULA 3ZK7A 4G6ZA 2ZYAA 4JS0A 3FTPA 3AF1A 3H3JA 2DZDA 2BUBA 4EUHA 4KQCA 1QVVA 1E64A 3NAQA 2ATVA 5FULA 4IJ6A 1EQ2A 3SZ3A 5CDFE 4AZ3A 3KOXA 2J4DA 3I8OA 4TMZA 4ZGGA 3Q0IA 3E8MA 1ZR4A 3M9XA 4M87A 3CTMA 5F9FA 2A94A 4TKUA 3AEYA 4UE3S 4L73A 3AYZB 3IT1A 3JD0A 4AU1A 3KU1A 2O2EA 1OI2A 2Y1KA 3A4IA 2RHWA 4NENA 3X43A 3PRHA 1EXMA 2PX3A 1EX7A 3O4FA 3HCBA 4X6XA 4GOKA 4Y1RA 5DBIA 4U9UA 4W9NC 5CA1F 3O0TA 2AK2A 1XU9A 3CGWA 3RVOA 5KYKA 3LLCA 4QUEA 1L5KA 5AW0A 4CLDA 1YIOA 3B6ZA 5LP6B 4JQCA 4OHBA 2PE5A 4JI1B 1LWOA 3LS2A 4C4YA 1A71A 2PS9A 4L9SA 3I28A 4EELA 1K6XA 1QGDA 4R2IA 1AXRA 5THQA 2YS6A 1YIAA 3RKSA 4IOLA 4DUZB 1KIAA 3O8DA 2JIQA 3AJ9A 3AZOA 4FXOA 4GGPA 1Q83A 4J0JA 4EMBA 2PPVA 3OLZA 4MCHA 1SVKA 1XRJA 2LE0A 5CVUA 4DMCA 1FNCA 5CT8A 4LECA 3RYCB 4Y67A 1D1TA 2QOEA 4GMDA 5U9CA 1ZXXA 2XXAA 3RRXA 1Q14A 2EVWX 2WZCA 2R5NA 5I4BA 5LQSA 4CKCA 4GFDA 3BFJA 5LN1A 3MJEA 5AXAA 2EX1A 5AJXA 4D4HA 1XD8A 2QORA 3MJVA 3X1MA 5AVOA 4AI6A 5DX8A 2C7RA 2DMRA 2XYGA 3KC2A 1GA4A 2XE6A 1D1SA 1GZ6A 4IILA 4NR0A 1XSEA 1LBSA 3L0IB 5TVGA 3ORHA 2O48X 2LCIA 3GJ0A 4R1PA 4QJ3A 4GYYA 1PL7A 2I6QA 4Z3DA 4B4VA 3N6RA 4R83A 1XUOA 4S1NA 2C57A 1TC2A 3CB4A 4B84A 4BJ6A 4MI9A 1I4LD 2KX7A 4G4SP 1QIDA 4H08A 1NBEA 4ZI7A 1IZ0A 3A2NA 5CLGA 3R20A 1B1CA 2W43A 4QG3A 1WULS 4KNYA 2GCEA 3WV4A 4V0MA 4QM7A 1DRVA 1SRRA 2GXSA 1IXZA 1W35A 2X6RA 4AT1A 1ZM3A 2DH6A 3G5MA 1NNUA 2AJLI 1N2GA 1GYPA 3U17A 1ES9A 1P9LA 5EWMB 2ST1A 2QYOA 4MDHA 3MGCA 4BV9A 2PZ8A 3F7MA 3JZFA 2FEKA 3SJZA 4YP5A 3OFVA 2ADMA 1H4VB 4GMKA 4DYVA 4ZRNA 1GNPA 3STXA 4LK3A 3UF0A 4F4UA 4QTYA 2O4CA 3JR3A 4YI5A 1EVKA 2UYQA 4JLMA 2H48A 2OL4A 3THOA 2CNKA 4A7PA 3ROKA 1ZIYA 2AG5A 4NBTA 2IUUA 5EGNA 3CNQS 1HMPA 2FOXA 2R7KA 2VDJA 4DY6A 2DCUA 1C4OA 1BWRA 2DKNA 1A88A 3MNFA 2IGTA 3T52A 1EDZA 1S96A 3K9QO 4RPCA 2HDNB 1Q7BA 1HXHA 5HJ2A 4N47A 5AMXA 4QARA 5NLLA 4C0AC 2L2QA 1JU3A 4I8IA 5JH7F 3LC7O 4KR9A 1RHKA 1CDDA 1UJBA 3LQ1A 3OZDA 3P97A 3EX7C 3KZ1E 1VL2A 5LMCA 4GE3A 2BUCA 3KTAB 3ZZ0A 4DAOA 3LG2A 1PCXA 1FLDA 1QHYA 3CLUD 3G9QA 5DBGA 5GJWC 3FZQA 3IJ5A 3UA4A 4TKLA 2AEFA 1W4BA 5G4KA 4DRXB 1RLMA 2WOOA 1QO0D 4ZVTA 3FJ1A 3LCUA 3CVOA 5IJXA 1OVGA 1G66A 3EH2A 4OHZA 4REOA 4L6AA 3QFFA 3FSJX 2J9RA 1C4KA 3MT9A 4Q4AB 4EHNA 2SICE 4ZQIA 3L8CA 4FU0A 4BQFA 2FCRA 2I8LA 5JS1A 1DEXA 3OE5A 1Q22A 1E9EA 3O2JA 4JLWA 5AI6A 4XVUA 3B6KA 3WMRA 2B82A 2H3EA 3G23A 2B6NA 3QF7A 1KFCB 2DCMA 3ELBA 3WJ1A 2CUNA 2J0UA 4HNVA 3BORA 1IN4A 4KQMA 4MKIA 3TLMA 2CFTA 4EG5A 4LF9B 1CF4A 4ZAFA 2BD0A 4DANA 1YCFA 2BISA 3U4GA 1ZP6A 1N6RA 4N82A 2WSMA 5A7GA 3FB1A 2YVLA 3KOWA 2F62A 3UBMA 4Q82A 4G0QA 4PPGA 3U3KA 4Q3AA 4ZVKA 1GARA 1OXMA 1T24A 3GBPA 2NU8B 5C3MA 2XE7A 4QSHA 1DRUA 2QTTA 2VTEA 3DEYX 2JGMA 3IT3A 3OU6A 4XTCS 4Z1MA 1T5OA 4B5LA 1D2NA 1QVZA 3R5SA 1QX3A 3SYNA 4C1NA 4W5OA 2OHXA 3CR3C 2JJMA 1K66A 3ISVA 2PMCA 4DG5A 1HFKA 2NYRA 2YIDA 3VKHA 4P84A 3LYHA 3WNZA 1KVUA 4OQYA 1PJ4A 1KF0A 1CUBA 5AW1A 4MZXA 2KQUA 3FYCA 4LRUA 3CKMA 2X8BA 4QBIA 1UFOA 4HBGA 2PZEA 1FVFA 1XIVA 2WD7A 3NQ41 4XIFA 4U0KA 2ZIUB 3OLVA 3SDZA 5I6DA 4FMDB 3OCCA 1XC7A 2W8BB 1DXHA 3HZOA 3KIPA 4UEWA 4YAFA 3OT4A 2H1VA 5DTQA 3RWMB 1QONA 2DHEA 2V3WA 4QIHA 1NBOA 3B1JA 4NEGA 1BJTA 4NBNA 5JLJA 1JIVA 4PYOA 1O0SA 2GA8A 1DG3A 5IT0A 1BXGB 1CQJB 2B78A 1ZX1A 4UFNA 4XOUA 4HDRA 3ZY2A 1B3RA 3FXAA 4PN3A 4MV8A 4PZPA 4YV2A 2HSDA 3OFKA 4DUGD 2K7ZA 3A37A 1QTNA 1T35A 1WRBA 4K6CA 1G9TA 1CWUA 2E4ZA 3EFEA 1WJGA 2J48A 3L1IA 4P7KA 5HNKA 4AUKA 2NT4A 2WINI 5EZSA 3WLMA 1A5ZA 4TS9A 4LF7B 3B8HA 1W2GA 3QKWA 3D59A 2OE2A 1RJ9A 4NOMA 4OGWA 1MFPA 3L77A 3OIYA 2PMWB 4UXJA 1HLFA 4KLCA 5HYVA 1L9KA 3OF2A 3UENA 3GJQA 4JVMA 3LGSA 1U9IC 1CRLA 1Q16A 3CVVA 2G04A 1MU0A 2ZJ7A 4A2CA 3EXHC 3I2FA 4H1WA 1YB2A 4ILKA 4I36A 4IVNA 3R3UA 4P3XA 4C5CA 3E2IA 4PTLA 3TD6A 3X1XA 3KBBA 1DBRA 3A1EA 1AS2A 3N3AC 3SR4A 3QLJA 5K3SA 1JTVA 3O47A 2EL9A 5IM4F 1QXSA 3UXMA 4CLRB 4I50A 1KYIA 5F2KA 1ESCA 1EHIA 1YOVA 2J30A 2RIRA 3I92A 4LE2A 4AL4A 2B9VA 1F6WA 2FSHA 2VSXA 4YP6A 2ZROA 1YZUA 2BFBA 1SWVA 2A86A 3O83A 1I2ZA 3CZQA 4IVQA 3LT1A 1FX0A 3CY6A 1IY1A 2ZYIA 5KDDA 3BDIA 3LP5A 4ROSA 3U9LA 4BO2A 4DLPA 1E3DA 5JO0A 3ND8A 5H4GA 4KFUA 1I5OA 3EPJA 2V7UA 1E1LA 1G98A 2R6JA 1EBFA 2F4NA 2HK9A 2XADA 4MB6A 4MQMA 2NUTA 8ABPA 1NDUA 4QGBA 2EJCA 3O3NB 4WY5A 4HN9A 5B7GA 1R8SA 4QJBA 1M8PA 3U60B 1YE3A 1RU3A 1X7YB 1H9BA 2DOKA 2Y1FA 3FM9A 1TKCA 3QBTA 3ESDA 4RMHA 1W2HA 2QLBA 1CY0A 4BVAA 5BWOA 1T5SA 1HSZA 4YRAA 1WD5A 5BN3A 3B53X 3AYXB 5JSUA 1L9XA 1S9DA 1B41A 3FH0A 2ZSUA 4CKEB 2ZANA 1E62A 3G7UA 2OPHA 3S5JA 3DTVA 1WB9A 2QTMA 2GFHA 2WKPA 1XDBA 5IUKC 4O1HA 3E22B 4UM9B 3G2LA 1Q1GA 2O8BB 3WK8A 1DUSA 3IOYA 2RSLA 2WJYA 2CNBA 1RHQA 1THMA 2CXXA 4JLNA 4I1VA 4KH1A 2WVHA 4R1OA 3VPDA 2OV4A 3AL0C 2OD9A 2RHMA 1NVBA 4JEIA 1BDJA 4OQQA 5EEHA 3F3SA 1UPAA 4XWAA 2VDUE 2SKDA 3ORFA 4CV3A 5I7WA 1N7IA 2NGRA 2ZI5A 4RSRA 2B21A 3QEAZ 2DFKB 3ANSA 4CI0B 2GHQA 1B6SA 1WDTA 2N3ZA 5TY0A 3TZEA 1I0LA 4EHIA 1Y1PA 1Z56C 2OCPA 3D1JA 5ALHA 1HT2E 3VZSA 1PNRA 3R75A 3HR4A 1LK0A 2PL9A 2GRJA 5KTTA 1VL5A 1QO7A 1GAQA 1UJ6A 2RAUA 1F0PA 3A3KA 2JRLA 3PDWA 3PP8A 1J8MF 2C7VA 3EIQA 4N9WA 4IDEA 3DP9A 2QN6A 5PNTA 1WXEA 4CODB 3L4JA 4DR3B 1NRIA 1HUQA 2GN8A 2ATXA 5HIIA 2D1YA 3GEDA 3S4YA 4ALNA 1BDMA 1IU9A 2DPHA 1EXDA 2V7BA 3HVUA 2DBZA 1G8GA 1M83A 2H57A 1P3JA 2J3IA 3ZJVA 1D2MA 1QTQA 4G0WA 4MP8A 1VC2A 3T7CA 1DLIA 3GZJA 3VDRA 1ORHA 3CLRC 3DL7A 3E6AA 3HLYA 4BZZA 2YKGA 1KJNA 1SC3A 1Q0QA 4H0FA 4JI5B 4CQLA 1Z0AA 2QJWA 5HUHA 1A8IA 2Q8QA 4C07A 2JAWA 4YI3A 4HGYA 3JQ9A 2W42A 3AEQB 1LPBB 1DQZA 3M3DA 3GP8A 1JDBC 3PZRA 5T6MA 1IUNA 3I9NA 4MW1A 5HUQA 1W2WB 3BK1A 3CWZA 1E9FA 3A6HA 3NJ4A 1V1MA 1OYVA 1RLOA 2O7QA 4J9VA 3O8BA 4P7GA 2D6FA 1UZAA 3BICA 2DTEA 2RKOA 2YN4A 2W9XA 2Z09A 3ZQUA 4RPKA 1JHDA 1KY3A 2PD4A 3GD7A 4HDKA 2BM8A 3OIFA 5KQRA 3RFUA 1JR4A 2WM8A 3AR3A 3IC5A 3O38A 1RRPA 3PU6A 4DLSA 2FMXA 4EUSA 4F8YA 1Y1QA 2PS1A 4P1ZA 2BF4A 5AT1A 3RGGA 4YT4A 3ROFA 1HRDA 3I83A 4YRLA 3I9LA 1E1CA 4AQDA 3CBGA 4F38A 3P26A 2ZRKA 1K5HA 4ZIRB 4TYWA 4CJXA 5IUJC 5DHTA 3RROA 4G23A 2YZMA 4URFA 4B3RB 3KUDA 4OMCA 5HKOA 3IVCA 4JLJA 1MIOB 4DCUA 3AETB 1MW9X 4CCYB