1YKFA

Nadp-dependent alcohol dehydrogenase from thermoanaerobium brockii
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
352
structure length
352
Chain Sequence
MKGFAMLSIGKVGWIEKEKPAPGPFDAIVRPLAVAPCTSDIHTVFEGAIGERHNMILGHEAVGEVVEVGSEVKDFKPGDRVVVPAITPDWRTSEVQRGYHQHSGGMLAGWKFSNVKDGVFGEFFHVNDADMNLAHLPKEIPLEAAVMIPDMMTTGFHGAELADIELGATVAVLGIGPVGLMAVAGAKLRGAGRIIAVGSRPVCVDAAKYYGATDIVNYKDGPIESQIMNLTEGKGVDAAIIAGGNADIMATAVKIVKPGGTIANVNYFGEGEVLPVPRLEWGCGMAHKTIKGGLCPGGRLRMERLIDLVFYKRVDPSKLVTHVFRGFDNIEKAFMLMKDKPKDLIKPVVILA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NADP-DEPENDENT ALCOHOL DEHYDROGENASE
publication title NADP-dependent bacterial alcohol dehydrogenases: crystal structure, cofactor-binding and cofactor specificity of the ADHs of Clostridium beijerinckii and Thermoanaerobacter brockii.
pubmed doi rcsb
source organism Thermoanaerobacter brockii
total genus 112
structure length 352
sequence length 352
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.80: Isopropanol dehydrogenase (NADP(+)).
pdb deposition date 1996-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ykfA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1ykfA01
5BNFA 1GTMA 4UVHA 4ZN6A 1SB8A 2W4QA 3F6YA 3DOJA 3GNQA 2POQX 1PJLA 1L7EA 1W6UA 4ZGWA 2X7HA 4QUKA 1GY8A 1EVYA 1ZCJA 3QVTA 3I9LA 1DC6A 2IDZA 4GVLA 4EGFA 5L3ZA 2SCUA 4R01A 4RF4A 5ICSA 3R3JA 4L4XA 4NJOA 4LK3A 5A4DA 3NT2A 2D4AA 3F46A 4CM1A 3AU8A 4KDEA 4CLOA 2H6EA 3EY4A 4O5OA 2X23A 3HNPA 1VI2A 4NFYA 5DOVA 4OO3A 1ONPA 3R1IA 9LDBA 1LLUA 3PI7A 2IYPA 2AEMA 3H4VA 2VRCD 3I23A 3QWAA 3F4LA 4L9RA 5KVCA 1TVEA 3AFMA 4XYLA 5CDSA 4TQGA 4Y67A 3OEWA 4KP7A 3AUTA 4RO0A 4CMAA 4IZHA 1EVIA 1P1RA 3EZYA 3GOHA 3P5SA 4E31A 5AVOA 3WSWA 4CL3A 1HL3A 2WD7A 4C7JA 4IIVA 4PVDA 5AOVA 5EINA 1FDWA 4WLOA 3WGOA 2ZYAA 5JY1A 5CAEA 3OP4A 1I33A 2EKQA 2CFCA 1GQYA 1JU9A 1UDCA 1IUKA 5AXDA 4A73A 1SZJG 3TFQA 2PZMA 4XCVA 5A9TA 1GYQA 1XSEA 1ZH8A 3R0IA 5BSFA 4YPOA 4DPMA 3VPHA 2R00A 3RBZA 3VZQA 3WLEA 4DLAA 4TVOA 2X9GA 3DXFA 3BMNA 3FWZA 3B20A 4GLLA 3ZNQA 4WCDA 3AOGA 4IDFA 2J8ZA 3ANNA 2QZ9A 2DTXA 3OH8A 4J49A 5K6AC 4RJTA 4AJIA 3D64A 4DMMA 5JNLA 1GCOA 2IXBA 2VCYA 5CEEA 4FIZA 4FPXA 4LSMA 4MVJP 3ZWAA 2C0CA 3H5AA 2B4QA 4S1VA 2R2GA 3PGXA 5GY7A 4NFHA 2OOSA 2QG4A 4WCFA 4XEHA 3KTDA 4DC0A 4A26A 1GYRA 2X0NA 4WKGA 3M2PA 1U8XX 1A72A 5JY6A 3O38A 4FFMA 1FXSA 2HU2A 3GT0A 1Y5MA 1LQTA 3QJ5A 1DIBA 2NVUB 1YH3A 7MDHA 2RHCA 3NDRA 4GMFA 3NGLA 3MZ0A 2CVOA 3LSYA 2G5CA 4RQUA 5EJ2A 3TRIA 1JAYA 3WXBA 1DIRA 3HSKA 3AJRA 3INGA 1ZXLA 4B4UA 2XXBA 4HFMA 3HDQA 3QHAA 3GN1A 2CVQA 4QFCA 1AN9A 3COSA 4J4HA 5ITWA 2JCXA 3RC2A 4YXFA 5T5QA 5IDQA 1GL3A 1M67A 3GFGA 4J0FA 4B3IA 3NJ8A 1B2LA 4JCOA 4I08A 3WWZA 3WX0A 5JMWA 1ZK2A 1KETA 1YJQA 2ZQYA 1CWUA 4FJ1A 4YBZA 2EJWA 3DZHA 2BHLA 4MVJE 5DBFA 4MO2A 1ISJA 3JD0A 4GAEA 2E4AA 2IZ0A 4YCAA 1Q0HA 2Q49A 2AQHA 3VVCA 4J43A 3GDGA 4BV9A 4E12A 3G79A 3Q3CA 5ER9A 3ZI0A 4MVJD 1PIWA 1RM4A 1L1FA 4HXYA 3I6QA 3RROA 5BNIA 3GVPA 4DLLA 1DPGA 1ADFA 1MB4A 3ITKA 4BVAA 1PZGA 3TZKA 3AU9A 1N92A 1YL6A 1GFSA 2FRDA 1PJSA 4BNXA 4Z0PA 1SB9A 4KTTE 1V3TA 4L4SA 3CTMA 4OOEA 4P4GA 3GC6A 4I9NA 5F1OA 2GD1O 1I24A 1I2CA 1EBUA 2X0JA 3AK4A 3ZZNA 2EG9A 5F3RA 1GAEO 4WLUA 1SPXA 1GV1A 3OBBA 4FOOA 4TKMA 4ZQBA 3W4JA 4EUFA 1BW9B 3JYOA 4R41A 1XWFA 3GEGA 3OF2A 2P4QA 1LRLA 5T8KC 4IDEA 5LDHA 2X6TA 3KUXA 4NQZA 3B70A 3UCXA 1NR1A 3LZ6A 3I52A 4UREA 5L7WA 3VH4A 4BGIA 1AHHA 1P31A 2UVDA 4HADA 3GF4A 4FFNA 2NQTA 3JQ8B 4Q3NA 3U9LA 4NBRA 2PR2A 3GVIA 3JCZA 4NDNE 4OSPA 3RKRA 3WGIA 1Y9EA 4CR7A 5G0SA 3MJSA 3EK2A 4ND3A 4HV4A 2W98A 2A94A 1YGYA 4XIYA 4NH4A 1K6JA 4R5HA 4E5NA 2X9VA 1PTJA 3JQAD 4ILKA 4CPDA 2WE7A 2BFMA 1HEUA 4L8VA 3RJ9A 4EUEA 5JXWA 4L4RA 3A28A 2UV8A 3GLQA 3KV3O 5TSDA 1MXHA 2I66A 4FQ8A 3FBGA 4ZQGA 4BNUA 1LBEA 1DHTA 2AG5A 2BF7A 4D79A 2HK9A 1ZSVA 1ZK0A 2PKQO 4Z9YA 5DN9A 2NVUA 1UUFA 3PJDA 2EP7A 4CM5A 3GUCA 1J0XO 4BMVA 4ALIA 1PWZA 4GQAA 4IPTA 2IE0A 3MEQA 2O3TA 3H9EO 4N5MA 2YHIB 5KKAA 1H6DA 2X0RA 2DBVO 4IDCA 3S2GA 1EQUA 4B8ZA 3DFZA 4XYEA 3DEYX 4RF3A 1OC4A 3RUFA 4ZICA 2CNBA 2Y1FA 4HFJA 1RM0A 1F12A 3KO8A 1U3TA 2UUOA 3ZNOA 4PLTA 3GGOA 1U9JA 2FZEA 4MOWA 3WFIA 5IG2A 1BHSA 1LRKA 1U3VA 5A5FA 1PX0A 1PJ3A 4RDHA 1K3TA 1DC4A 4XWYA 4MVJH 2V6MA 2D0IA 2B4RO 4E2YA 1K89A 3DAGA 4MKZA 4D41A 4U0KA 5I8WA 5JAZA 3M1AA 1BWSA 4IXWA 4JJGA 1I3MA 1JVBA 4Q3BA 4YAJA 5L4NA 4RPHA 4K6FA 4NI5A 1BVRA 3WMWA 2BGKA 4YRDA 1A7AA 3WBFA 2RBEA 4XDYA 2EJVA 3DZBA 4QECA 3KSZO 4RVHA 2QYSA 3M1LA 1BDMA 4CMHA 4X54A 3ZWVA 5A3JA 5HTOA 1T2DA 1HE5A 3GNSA 4IS3A 4J9VA 4EJ0A 5KTKA 5CFZA 3X2EA 3JTMA 1T25A 4Z3KA 3U5TA 3ZWYA 1ADGA 3L77A 1Q0QA 4O6VA 5CG2A 3F1KA 2HSDA 1BW9A 3HADA 4UEKA 3DZIA 1KC3A 3JV7A 3W8DA 3L4SO 2ZB3A 5JLAA 2DTEA 3JQ9A 1NTOA 5F21A 4IS2A 3BZUA 4QO7A 3UW3A 3FNEA 4Y6PA 3JQ8A 5I9NA 1LSUA 1DRWA 3RKUA 1HSZA 5JAQA 4KUGA 4RQTA 5TT0A 1K5HA 4GMGA 4DMLA 1V0JA 3DBLA 1AUPA 3O8QB 4AFNA 2PLAA 3IC5A 4BGVA 4B7UA 3PHGA 3QLJA 2B5WA 2PD4A 3CH6A 4UEOA 4CMCA 3AUAA 3SC6A 3R6DA 2ZYDA 1IULA 3JYPA 4CM7A 1I3KA 2NACA 4M49A 3VC7A 1CYDA 4CV0A 4FGSA 1WDKA 4PRKA 2VWQA 5DF1A 3WJAA 3KYDB 2B83A 3FR7A 1QV6A 1QV7A 3BMOB 4EUHA 4BO4A 1AGNA 2DUUA 2GGSA 3BHJA 2EV9A 4BGUA 2A92A 1TI7A 3CE6A 1D1TA 2YHIA 3C1OA 4IM7A 1YBVA 3SBOA 3W8FA 1O94A 5I7VA 7ADHA 2DPGA 2YQ5A 2FR0A 3GPDG 1IPEA 4RCVA 4B8WA 4TRNA 4CLEA 3D5TA 4MJLA 1T2EA 1D8AA 2Q4BA 1MG5A 4P8RA 3OMLA 3ZN2A 4DREA 5KOIA 1QORA 3VH1A 1B26A 4IZIA 1ZO8A 2HMWA 3Q2KA 3Q6IA 3BTSA 4J4BA 4CR6A 2PNFA 3ETDA 2FR1A 4ALJA 4F6LA 1X0VA 2NWQA 1CIVA 1K2WA 2DPHA 4MKRA 1WLYA 4ND2A 1I3LA 1SNYA 1B8VA 4QQRA 2QX7A 4RDIA 5B4UA 4R69A 3L4BC 3E6AA 3SJ7A 1P1KA 3GRKA 2WSBA 4HY3A 1IHXA 1T1SA 3F9IA 4N5LA 3INTA 3H6KA 1UDBA 4NBUA 4TKLA 1ZSNA 3ST7A 4NK4A 4RLHA 2PKQP 1PQWA 3OJEA 1V35A 4A0SA 2ZB8A 1D3AA 2JD1A 3UICA 1Y9AA 4W7HA 4E6PA 4LRTB 4JP3A 4EBFA 1CJCA 1FDUA 3OECA 1UZLA 2IZZA 3L9WA 4BNVA 3K92A 3U0BA 1DJQA 4GLOA 2CY0A 1JAXA 2GF2A 2ZJ0A 4MKXA 4O1MA 2HKIA 3C8MA 2F1KA 5HS4A 4CM4B 4BGEA 2BH9A 1XKQA 2VHYA 2Y05A 5EPOA 1I0ZA 2JJYA 1HDXA 1JDJA 3WOHA 4GH5A 3PGJA 4GKVA 1X0XA 4GBJA 5JDIA 2J5QA 4E2XA 4NMHA 3ZWWA 1HE2A 1A4IA 3EC7A 2VRCA 3MCVA 1PL6A 1IL0A 5GMOA 3O8QA 2RCYA 4YT8A 4FOSA 1LU9A 2Y1GA 3KBOA 4EI2A 1ZKMA 4E5KA 1WW8A 1ZJYA 4GX5A 1F8FA 4NG5A 4AJPA 5EQDA 3C1TA 1XQ6A 3FSRA 3HFGA 2B0JA 3MJTA 5K0ZA 1E1LA 4RVUA 1YS4A 1QLHA 4IQ8A 3DOCA 3DDNA 2Q1SA 4EYEA 4Z0HO 5BSEA 3KYDA 1LDEA 2G76A 2GERA 3PLRA 3TZ6A 1LA2A 3ASVA 1NX6A 1KY4A 1OOEA 4DC1A 3RC7A 3PHIA 1MP0A 3VDRA 5A9RA 4YVFA 1R0SA 2Q2QA 2NU7A 3KOUA 4IY1A 2CMDA 3H9GA 1HDZA 3LC7O 3VDQA 3PYXA 4DIFA 1MFZA 3ZV3A 4E4YA 1A4UA 1R15A 1B16A 2PA3A 1YB4A 1PL7A 3GK3A 1U5AA 4XD2A 2O3SA 2I65A 1I5RA 2GDZA 4MP8A 1B3BA 2IYOA 3C7DB 4RF5A 5DNAA 1UZMA 1G0NA 3GGPA 1HETA 3Q9UA 3RUDA 2J3HA 3IKTA 4G5HA 1GQ2A 5LC1A 1ENPA 2B37A 3JQAB 2B35A 3GVXA 2VOJA 3FCOA 2GZ1A 4IQ0A 1DC5A 1E7SA 1XEAA 1ENYA 5TS3A 1E5LA 4YJHB 5L95A 3Q2IA 2HMSA 3QSGA 4GWGA 4HWKA 3FRJA 3IL2A 1B0AA 1QR6A 3E1KA 5CHEA 3UCEA 1LDNA 3ITDA 4D0RA 5JCJD 1TB4A 4RZIA 1GUFA 4PLZA 4CR8A 2Q1TA 3H2ZA 4L73A 1EK5A 4XB1A 3AFNA 1JQBA 3FR8A 1LC0A 4CM4A 1K6XA 3WGYA 2AMFA 1ISHA 2QRKA 5JO9A 3AY6A 2JD2A 3U4DA 1YQXA 1PGNA 2NV6A 4J90A 1V8BA 4YAGA 2FN7A 1VKNA 2YDYA 3VH3A 1G1AA 4RVDA 4FJ0A 4ALLA 1P45A 2ZYGA 1ML3A 5L45A 5DBIA 4XYBA 2IEBA 4AL4A 4ID9A 5JE8A 5BNTA 1ZZEA 1W0CA 4PG4A 4GX0A 1QYWA 5C7OO 3ZU4A 2GSDA 1HWYA 1PS0A 1T2CA 5A02A 2B36A 4R1NA 2RH8A 1GDHA 1WMBA 3WQRA 1MXFA 4D0SA 5A9SB 5J23A 2CD9A 3A9WA 1HDGO 3RC1A 5TJHA 4J6FA 3L6DA 2ZQZA 4B7XA 3QQPA 5IDWA 1XQ1A 3RFXA 4M87A 1Y1PA 2EERA 2B5VA 1ADCA 1HZJA 4YAIA 2E6UX 2EIHA 4OL9A 2P9EA 3KHUA 4YJFB 3ABIA 1WZIA 5T8KA 4IXTA 3DAFA 4HNHA 4BNGA 1UJMA 2PV7A 1LDGA 3LT2A 1F17A 4NBTA 2NTJA 3H3JA 1BXKA 4GKBA 4PZEA 1PR3A 3W4IA 1LDMA 3ZHBA 2XXJA 4A10A 3AY7A 3RCBA 1MX3A 3TN7A 1P44A 2C7GA 3A4VA 4CMKA 1R6DA 4E0BA 1WXDA 4NU6A 4PRLA 1O89A 4R51A 1PGOA 1DRVA 3G49A 5G2OA 1JTVA 3VPXA 2VWHA 5ITVA 4CM9A 2JKVA 3GQVA 5THQA 2FR8A 4AJKA 2PD3A 1JN0A 4N5NA 3JQAA 4YB8A 3DZKA 3WQSB 3ZWPA 4RPGA 3WB9A 4Q3EA 4ZJUA 3HDJA 2YZ7A 3KYCB 2VT2A 3MTGA 3PK0A 1R0LA 5IF3A 3VZPA 1PZHA 1UH5A 1E3JA 3GDOA 4M55A 3SLGA 4PG8A 4H7PA 5FWNA 1ISGA 1GPJA 1IZ9A 1GQQA 1TXGA 2Y0CA 2ZKLA 3ORFA 5BQFA 3BTUA 1DOHA 1FJHA 4LISA 4PLHA 3RAJA 2DFVA 1WVGA 5DOZA 4EEZA 3JQFA 2JFHA 3C3XA 1GCUA 3LC2O 3GVHA 3NUGA 4HFNA 1LTHR 4ALMA 4OHUA 1JWAB 3ASUA 3U4IA 3WG9A 4BNHA 1XG5A 4WLFA 1TLTA 1LSJA 4ND1A 4FJ2A 5F5LA 4BIIA 4UUMA 4DBZA 3IIEA 3RBXA 1X1EA 4BQRA 1SBYA 3D3WB 1NFQA 1U8FO 2VHXA 2GN8A 4JP2A 4XGNA 4XJTA 1PJ4A 5FI3A 2AXQA 2PGDA 1YO6A 2JFGA 2VN8A 1WNTA 2A9FA 3STHA 1PS8A 3C85A 1I3NA 1P33A 4TZKA 5COQA 4BNTA 1PEDA 4JBHA 3UGKA 2YW9A 4LVCA 1AXEA 5U9CA 3HZZA 1U4SA 4IBOA 1D1SA 4JLWA 4I5DA 4ITUA 5G0VA 2EF1A 1NVMB 5CEJA 5CDYA 1VLLA 1LLDA 2VOEA 3GZ4A 5I7FA 4IJWA 2FOIA 2YV1A 5IN5A 1MC4A 3PDJA 2PGLA 5CPBA 2VWGA 1GD1O 5A9SA 4E5MA 2O7SA 3G1TA 4NZ9A 5FEUA 4Q39A 1DJNA 1M6WA 4RORA 5B1YA 2PZLA 5JS6A 5TIIA 2PFGA 4R4JA 3PFFA 4KUHA 3ONDA 2VUUA 3JQBC 1O8CA 4YJFA 3AWDA 4QFDA 5T67A 2VRBA 4YJDA 4WECA 5JYDA 1N1GA 2Q3EA 4LMPA 5F1PA 3RJ5A 3VZSA 3K30A 4K6CA 4CQLB 3ZHZA 3O9ZA 4R9SA 3DZJA 5L7YA 1DHRA 4D3SA 1LLQA 2C59A 4MIYA 4ALNA 4W9NA 3NKLA 1DAPA 2X58A 2DM6A 1GEGA 4QX6A 1ARZA 4M89A 5CDGA 1EMDA 2WD8A 5TT1A 1MG0A 1YB1A 3QRWA 1M76A 2VYND 1D7OA 2DKNA 5G0WA 1GYPA 1XU7A 4Y6SA 3TZCA 3KLPX 1B7GO 1PGJA 3FNGA 3KYCA 2W2LA 1XA0A 4GSLA 3CEAA 1T1RA 3D4OA 2DFDA 3PHHA 4BB6A 4QXMA 1GZ4A 1PJCA 1Q0LA 3G17A 3QIVA 3GDFA 1FDTA 1WAMA 2XPCA 3KEOA 4CM6A 5BT9A 3S1LA 1ZNQO 1DDOA 2TMDA 3H5NA 4AJEA 1XGKA 5A04A 4DGSA 2X5KO 3TL3A 2I3GA 2VHVA 4WK6A 5COBA 2Z5LA 1PJBA 4CV2A 4Z6KA 4BKQA 4IIUA 2QYTA 1V9LA 3L0DA 3D3WA 2O4UX 3ZGYA 2JD0A 3NDIA 2DLDA 2GN6A 3DBRB 3PRJA 2HLPA 1QSGA 2FPIA 2ET6A 2CVZA 1I30A 3CIFA 2DU8A 1YOVB 1C14A 4BNYA 1XHLA 1HLDA 1MC5A 4FD3A 3JD4A 3K9QO 2HO5A 4M54A 3RUEA 2HJRA 3UVEA 4BNMA 3GUYA 1VSUA 4Q3CA 5DCWA 1IOLA 3UHAA 4DTIA 3AI3A 1S6YA 1JW9B 3K73O 3L07A 1R4NB 1I10A 4CLDA 5JC8A 4Q3DA 1J5PA 1GEEA 2C5AA 1CDOA 2CUKA 2PH3A 1ONNA 4J91A 3RI3A 3SC4A 3WICA 3GVCA 3F3SA 2OBNA 5T64A 4IDDA 4IGEA 1UR5A 2C2XA 3PJGA 3CZMA 4CQMD 5HBRA 1EE9A 4CMIB 1LLCA 1RPNA 2I5PO 3I9MA 4G2NA 4YWJA 4GGOA 2X1HA 1SO8A 4CMJA 4NU5A 3I4FA 4CV3A 2Q1UA 4AJNA 2PKRA 1ENOA 3QE3A 1LDBA 3W8EA 2FP4A 2OXIA 4XRRA 2C07A 4CQLA 1IPFA 1W4ZA 1P9LA 3TJRA 2DUWA 1A5ZA 2XOXA 4LN1A 2DQ4A 2PTGA 4ALKA 3VPFA 4CMEA 1B14A 4G81A 4W6ZA 4BO8A 3FHLA 2PH5A 4KUEA 1MV8A 2ZATA 4U7WA 4W7IA 4E5YA 2AEJA 3HJAA 4UEJA 1BSVA 4OM8A 3JD1A 5GZ3A 4J4TA 2Z95A 2PD6A 3HE3A 3FTPA 5HRUA 1B8PA 2OP1A 3DBLB 4CM9D 3HQ4O 2VYVA 2H9IA 3A14A 3DQPA 4NNJA 4YT2A 1E7RA 5KJFA 3INRA 1ZK4A 4ND5A 2FSVA 1RYEA 4ZU3A 1EE2A 1EVJA 3WTBA 2YV2A 1XELA 3OICA 2WYWA 1ZEMA 1YB5A 2C2YA 4I5GA 1YVEI 4OKNA 1E1KA 1P1JA 4EEXA 3DL2A 4NIMA 3I5MA 2FMUA 3TL2A 4BUCA 2QQ5A 1J49A 4PFJA 1YONA 3CMCO 1UDAA 3BHMA 3DMTC 2VUTA 3FF4A 3EVTA 1XYGA 3VOSA 5HS6A 4RPKA 3DBRA 3AOEC 4YEDA 4PN3A 2GLXA 4CMGA 4OJNA 4XQ9A 5BR7A 1YRLA 1NNUA 2RH4A 4WGGA 1A27A 1YOVA 2G82A 3HUDA 3PEFA 2D59A 4FCCA 5IZCC 2D8AA 3I9KA 5CG1A 1PWXA 2BMAA 3FI9A 3NT4A 1DFGA 1EQ2A 1D4FA 2Y0DA 5COAA 4J7CA 1UP4A 2VZ9A 1C0PA 4JK3A 5H81A 4KMSA 4WJZA 1LNQA 5I8ZA 1N9GA 5TX7A 2Q99A 4AICA 1R4NA 1N7GA 3V1YA 1SEVA 3O03A 1NAHA 1NXQA 3CKYA 4QTZA 4R1UA 1YL7A 2Y93A 3SJUA 2OZPA 1VKOA 4PG6A 1NWCA 3GAFA 4BMNA 3BMCB 3F47A 1KY5A 1O95A 1WDLA 2DT5A 4CMIA 3PDUA 3LF1A 1DFIA 3VKVA 2O4CA 2BGLA 3PQFA 5JCJA 4I5FA 4Z9FA 1R12A 2B69A 2Q46A 4NR0A 1ZEJA 4XQEA 1Y81A 4JQCA 1NVGA 3IQDB 4RL6A 1YJ8A 2Q2WA 4XR9A 2HJSA 5H83A 4DBVO 2VHZA 3VTZA 5CDUA 4PG5A 4GPD1 1UXHA 4BO3A 3HFSA 4URFA 3WGQA 5A03A 1QG6A 1YL5A 3P2OA 1WMAA 1CRWG 2AE1A 2W2KB 5KIAA 3W6ZA 3DBHB 1M2WA 4XDZA 1Z82A 1U3UA 1LUAA 2AQIA 1VJ1A 2D1YA 4IJVA 4BNKA 4BNZA 1P1IA 2O23A 4BO1A 4CM8B 4GVXA 3FN4A 4B3HA 4Q3AA 3M2TA 4Y98A 3I3OA 1M6HA 3FWNA 2W2LD 3ETGA 4B7CA 4R16A 1ZW1A 2Q2VA 2OO5A 1E5QA 3SEFA 4IDBA 4U5QA 1HDYA 3D4PA 2FPGA 4J0EA 1JKFA 1X14A 4WLNA 4GGPA 4BNNA 2I3AA 2R00C 1JA9A 4BKPA 3LQFA 5JAIA 1NM5A 4CLRB 1KBZA 2J6IA 4IUYA 4OQZA 4YQYA 5C7IO 5EN4A 1B15A 3ADPA 4TRJA 1LSSA 1Z73A 3CZRA 3I9OA 1E3LA 4R1TA 5F5NA 1IYZA 4DUPA 3NTOA 2VZ0A 1EDOA 1KERA 4BKUA 3IUSA 3JQ7B 3CSDA 3B1JA 1WWKA 5TJ9A 1A71A 2F00A 3W4KA 1U2DA 4AJ1A 1UZNA 1WZEA 2CDCA 4BO0A 5L40A 1JVSA 2FPPA 4H15A 4R9RA 2HMVA 5ADHA 2H63A 5JC1A 4WCFC 4AJLA 4MVJF 1IZ0A 5IFLA 2UDPA 4GL4A 1SEPA 2NU9A 3Q0EA 3ZU3A 4OGWA 4TMFA 1X7DA 4J2OA 2BLLA 4BO5A 4DQUA 2EKPA 1IE3A 5JDCA 1X7HA 5AXBA 5THKA 1O6ZA 2EW8A 4ZVVA 1JKIA 3E48A 5FYDA 3RUHA 2YUTA 1Q7CA 4EW6A 1KVUA 4F46A 1PGPA 1YWGO 4HUJA 3FNHA 3ROMA 4GX1A 3BMCA 2DBRA 2V6FA 4XZ3A 4YJGB 1E6UA 3KVOA 3OIDA 5KVSA 1BTOA 2QRLA 3E9QA 4FW8A 2YJZA 1GU7A 1CF2O 3DHEA 3GNTA 4M1QA 2VTDA 3TQHA 1P1FA 3KYBA 1Z45A 4MP3A 3VVBA 4MINA 1HKUA 2PGJA 4BO6A 3GHYA 1SOWA 3EDMA 4H16A 4YACA 4YT5A 1IY8A 2JAHA 5KKCA 3EGOA 1NQTA 2LDXA 1NR7A 3EUWA 4XQCA 5G0TA 4DVJA 2W2KA 4KOAA 2G1UA 2P9CA 3DBHA 4OIMA 2ZB4A 3AW9A 2BRUA 1PJ2A 3FTNA 4AJ4A 1ZJZA 4A03A 1YE3A 6ADHA 3GEDA 1Q7BA 5A3VA 2IZ1A 3AM5A 4KTVE 2DAPA 1NPTO 5T6BA 1HE3A 3DB2A 3UAGA 4BL5A 4CM8A 1FK8A 4PLCA 3VKUA 1KVRA 3IJRA 3JQ6A 4FS3A 1UP7A 4JGBA 4YRBA 1LJ8A 2Q45A 5EIOA 4CQMB 2Y1OA 4LGVA 1DBVO 1V3VA 1LI4A 4J3FA 1BVUA 2E48A 1VM6A 1HYGA 3TOZA 2CF5A 2VYVD 3TDKA 4MPDA 1UAYA 3D7LA 4JNKA 4RV9A 3GA0A 4Y9DA 4XJSA 4PVCA 3F5QA 1E3SA 4P4NA 4KWHA 4WASA 3NGXA 2O3UA 3LC1O 2NADA 3H7AA 3WYEA 4YRAA 4CLRA 1J4AA 1HDRA 3PYMA 4AG3A 3N58A 4BKRA 1IB6A 4JIGA 4XB2A 5DZSA 4CUJA 2IXAA 2DC1A 4WOKA 3JQ7A 5K6AA 2X86A 1DEHA 1B3RA 2HMTA 4HP8A 4OKIA 2W8ZA 3E5RA 2EGGA 4CLHA 1U3WA 4E32A 1KYQA 1MFPA 1QXSA 2P5UA 4I9HA 1HYEA 3ENNA 2YDXA 3JYNA 3D1LA 3LVFO 2PY6A 2VYNA 1ULSA 1VJTA 4ZQFA 3UCFA 3AM3A 2V7PA 3WIEA 1DC3A 1WDMA 2PZJA 3IAHA 4FDAA 3A1NA 2XF8A 3AUUA 3GPIA 4PG7A 2C7VA 2GPTA 5DP2A 2D5CA 5T57A 2JAPA 2NTNA 2NTVA 4YDRA 3ZW9A 4TZTA 3WQQA 4BNIA 1ADBA 4FGWA 3ZWMA 1EZ4A 3RWBA 1DO8A 4OQYA 4YJGA 1VRWA 5HWSA 2JFFA 1C3VA 1UXGA 1PZEA 1LXCA 2ZCUA 3GG9A 4WNCA 5DCYA 1RWBA 2WE8A 4CJXA 1HDCA 3QVOA 3D3EA 2OHXA 1GUYA 1GZ3A 4IJKA 3U4HA 3UUWA 1E7WA 1ZK1A 2OBYA 3KSUA 3GAZA 3WYBA 3RD5A 3RU9A 4O63O 1E3WB 1TEHA 2FY8A 4BV8A 1RJWA 1ID1A 2JCVA 4WLEA 4XR4A 4XX0A 5B12A 1Z75A 3TFOA 3GR6A 3MTJA 1E1MA 1TT7A 3TWOA 1NPDA 2WTBA 4NBWA 4ZRMA 2VHWA 4MVJG 1G6KA 2Y1CA 1KC1A 5KJEA 2Q1WA 1UXKA 1BGVA 5AYVA 1KOLA 2VT3A 4A7PA 3ZWBA 3UN1A 2EEZA 1BXGB 2BD0A 5ICMA 5HA5A 3TF5A 5TNXA 2XAAA 1LDYA 1A9ZA 2ZB7A 3HB4X 4IGFA 3ZWXA 4I5EA 2AQ8A 1V6AA 4DIBA 1RM3A 3OETA 1H93A 4KDFA 4K1LA 2ZTVA 2C82A 4CQMA 1GV0A 3PHLA 3N74A 1E3EA 4J1NA 4R3NA 4EZBA 1HYHA 4CODB 3DHNA 1ISIA 1UAGA 2X4GA 1OMOA 3PYLA 4BOYA 5IXSA 4P22A 3L6EA 5JSFA 2E49A 3JQCA 1XDWA 1EBFA 4DXHA 2AA3A 3BXXA 3PQDA 1X7GA 3H9JA 3SVTA 4EJMA 4OYRA 3NEPX 2NQ8A 2O48X 3MOIA 1PJTA 3JQ9C 2HRBA 4D3FA 4E2ZA 4FFPA 4K9DA 2X5JO 5H82A 4K26A 1DXYA 3E82A 3ADOA 1EUZA 2OFPA 5TF4A 5K1SA 3GEMA 3QWHA 1QYCA 4D42A 1NFRA 4WUVA 3DONA 3B6ZA 3GMDA 3SLKA 4RVGA 2O50A 1AHIA 1OFGA 3IP1A 4DYVA 1GADO 1DAOA 4IQGA 1VJ0A 4M8SA 4NHEA 4DPLA 3PJFA 1H94A 4NK5A 4PZDA 4L0QA 3MJCA 2GR9A 5JPIA 3WSVA 3D0OA 2IODA 2D2IA 1H9AA 2Y0EA 2G17A 4B4WA 2R6JA 1MUUA 1YXMA 3WTCA 3GHHA 2Q50A 4OH1A 3KM0A 4GX2A 2GZ3A 1Y8RB 3RUIA 1P77A 3DMTA 5K9ZA 3U09A 4YTEA 1H6BA 4DA9A 3DAPA 1NQ5A 3ICCA 4JJIA 3T4EA 4DRYA 1LEHA 3ZWCA 1E3WA 5LCXA 1PQPA 3U4CA 2HK7A 3OEYA 4NPCA 5IZCA 3BYZA 3DMYA 5G0UA 3U3XA 5G4KB 3F5SA 4E13A 1XU9A 1ISMA 1JLLA 2V65A 3C7CB 3GRPA 2V6BA 1TT5B 1DLIA 4FFRA 4QSMA 4D46A 3JYLA 1HSOA 4PCVA 4MIEA 5C3MA 4IMPA 4AJOA 3E5MA 1PR9A 3NDJA 3WBBA 3H65A 4FFLA 4QEDA 1BXGA 3ZHXA 4XRGA 1NQOA 3OJOA 4BO7A 4CUKA 3RUAA 1T2FA 4KZPA 3WMXA 1PS9A 2OL4A 2Y68A 1E92A 4AJHA 1E7YA 2Z1MA 4JN6B 5KWEA 3S8MA 3EYWA 4E30A 1H0KA 1NFFA 5L51A 3DTTA 1T2AA 1RM5A 4EJ6A 1KS9A 1PSDA 3P19A 3GY0A 5DT9A 1AE1A 4O0LA 4NFSA 1ZSYA 1X15A 1EUCA 1GPDG 1YKFA 1R16A 3WGGA 1U2GA 2DVMA 5HM8A 2WYUA 3KEQA 2C20A 1UXIA 3E18A 1VC2A 3LLSA 3LT0A 3QW2A 4RVSA 2BELA 3OQ6A 2VTEA 4TWRA 4IJUA 3S2FA 5FI5A 1T4BA 3V1TC 5DULA 2WDZA 1NP3A 2EKLA 2X0IA 4F6CA 4UUOA 2AW5A 3WS7A 4XYMA 5JDIC 3X2FA 1E7MA 1SC6A 4BS9A 3ROQA 1LRJA 5CDTA 3NTQA 3AI1A 3GG2A 3U49A 1ONOA 4B79A 9LDTA 5BSGA 1O0SA 3CXRA 2JL1A 2ZIZA 3HN2A 3PWZA 3R3SA 2GO1A 2BFAA 1VPDA 4J1QA 2AHRA 4PIVA 2OP0A 2DTDA 2ZJ1A 2VNSA 3ZWNA 4WEOA 2I67A 4D44A 4N18A 1XIVA 1R4MB 4KQWA 3NYWA 4WLVA 3FNFA 1NHGA 4FR5A 3EHEA 1G0OA 1SOVA 1P0FA 3L6OO 3DZGA 4PLPA 4TRMA 4YAKA 2I76A 1E6EA 1PGQA 1IHYA 3PXXA 3Q9NA 4ZQHA 1DSSG 2OORA 2Z1NA 5FFFA 1N5DA 3QVWA 1T4DA 5CEFA 2WJPA 1Y8RA 3AY3A 3TOXA 4N54A 4YQZA 4Z0TA 3H9UA 4CV1A 2EWMA 2EXXA 4HKTA 2JHGA 2NUAA 4W82A 4JJFA 1EFLA 1E1NA 3VAZA 2J3JA 1DRUA 1Z7BA 4XGKA 2C54A 4CUZA 3RC9A 3B1FA 2P5YA 3BA1A 2P91A 3V2UA 4PLVA 3UF0A 1E7QA 3HDHA 2VWPA 3IJPA 5JAMA 5G4KA 4Q9NA 1NPYA 4UVDA 3OIFA 2X8LA 4YYZA 1TT5A 3JYQA 1DLJA 3E8XA 4BKOA 1E3IA 2P4HX 1XLTA 3OJLA 4W4TA 1K6IA 3EW7A 3LT1A 3WNQA 4QO8A 3VPSA 1UXJA 2YV3A 3WYCA 5DP1A 1NHWA 1P0CA 3G0OA 3L4BA 3DO5A 3DWFA 3KZVA 4ROSA 1N9GB 1H2BA 5AXCA 2AEFA 1NASA 3OA2A 2JCYA 3JD3A 2EP5A 1EEHA 2X9NA 4Y8VA 2WMDA 3LU1A 1DIGA 1Y6JA 2EW2A 1Q1NA 5ER6A 1VL8A 1HT0A 3BTVA 1Q7GA 2H5LA 2EHDA 2QIOA 4FSHA 4I8XA 3OFSA 4ZD6A 4H3VA 4ZRNA 4BO9A 5IDXA 3WIDA 1KVQA 3RFTA 4BNJA 4UVEA 4HBGA 2UUPA 3UH1A 3HDYA 5A1TA 2UYYA 1PU2A 1Z74A 1Y8QB 3E9NA 2O2SA 1QMGA 1ZBQA 3BHIA 4FC6A 1TA4A 3LYLA 4PGFA 3ZDFA 2CZCA 3QA9A 3PHJA 1CERA 4U6SA 2HCTA 3RBVA 5TLSA 3Q11A 1W73A 4UULA 4TRRA 3RUCA 5ILGA 3KLMX 1FDVA 2OMEA 3PJEA 1R4MA 1F14A 3LDHA 4NJMB 4Y6RA 1J6UA 3TZQA 4R68A 3VHRA 3U62A 3KETA 2YHUA 3W6UA 2C29D 2H1SA 1ZMOA 4J1TA 4RLSA 1OAAA 5EESA 4E33A 5L4LA 1T26A 3T7CA 4DLBA 5JW6A 4ONEA 3C24A 1BDBA 4CMBA 1OBFO 4E2WA 2WM3A 4GSKA 4F45A 3ONFA 3WDSA 4PLFA 1I8TA 2VNAA 4ZQEA 2LDBA 4OXNA 4J9UE 2VZ8A 4WOJA 3T4XA 4BMSA 2FSSA 4FFOA 5MGBA 1U28A 4DIOA 1EVZA 3GFBA 2Y1DA 3OQBA 3HWRA 4PZCA 5I9MA 3VPGA 3VH2A 3WFJA 1C0IA 1I2ZA 3PZBA 2I99A 1PZFA 3CINA 3F4BA 3NX4A 5KVVA 2Y1EA 4C7KA 1BRMA 4LW8A 3PFWO 1VE9A 2NU6A 4G65A 3KRTA 4RZHA 4E5PA 4B4VA 3E03A 3MWDB 3ZV6A 2C5EA 1U7HA 1VSVA 3OHSX 1L7DA 2GZ2A 5I7EA 1Z6ZA 3ROPA 2UAGA 2GNAA 1ISFA 5EMHA 2NM0A 4IMRA 3I9JA 3NTRA 5AQ1A 3JQFC 1H2HA 2ZK7A 3ZV4A 3G1UA 3F1LA 3QVXA 1B8UA 4TROA 2J5KA 1H9BA 4XIJA 5ENVA 3D4NA 1SMKA 3MOGA 1FDSA 1YDWA 3JQDA 1H6CA 4JROA 4Z9XA 4LRSB 3ULKA 3OA0A 5DBGA 1Y8QA 3TNLA 2CSUA 2WWRA 3QWFA 4F3YA 1BMDA 2HRZA 3I4CA 4A2CA 2QZZA 3A06A 5TQVA 1MLDA 3E9MA 5IZ4A 3KB6A 1E77A 3LF2A 1NYTA 4ND4A 2CDAA 1C0LA 5ILOA 3VZRA 1BG6A 3IP3A 1KEPA 2NVWA 3OM9A 3UOGA 2Q4EA 3H8VA 3MJVA 1H6AA 2O3JA 3G3EA 4GWKA 1MA0A 4ZHSA 1N1EA 2FHSA 4QT0A 4NJMA 1WPQA 4TSKA 3ZU5A 4BQPA 1P1HA 5IAAA 4PLYA 5L7TA 1JWBB 3JD2A 5IJZA 4JBGA 2TMGA 3TSCA 5BSHA 3ZW8A 4C4OA 3JQGB 5KCZA 1NWHA 2NSDA 3EMKA 3MJ4A 4P4LA 1JKJA 1NBOA 2JHFA 3DC2A 1X13A 1NVTA 1VL6A 2OGUA 3WR5A 3V8BA 3GMSA 1CQIA 3KSDO 3N7UA 1ZIDA 3IKVA 5ES3A 1KVTA 4I9UA 3ICPA 3ZU2A 4AVYA 1QLJA 4DWVA 4DQXA 3QY9A 2QRJA 4W9NC 3V2GA 1O9BA 2BFOA 3PPIA 1YQDA 5TGDA 2O3QA 3PQEA 3HG7A 4E21A 1HRDA 5KJ6A 4MP6A 3MWEB 2YFQA 4LVUA 2Y99A 1T24A 3B1KA 3I83A 4YA6A 1DIHA 4UUPA 4IDAA 3FPCA 2DBZA 1Z7EA 3IDSA 3ONEA 2ZCVA 2V6GA 4MDHA 4WNIA 5EQFA 3PIIA 5B37A 3WGTA 5IN4A 5GZ1A 3C1AA 4RPLA 3NRCA 3NT5A 1FF9A 5B4TA 3RASA 5JBIA 1FMCA 4BNLA 2ZTUA 8ADHA 2GN4A 5B4VA 5TRTA 5FF9A 2VUSA 1A7KA 1U7TA 4R54A 1KEVA 2D5AA 2YQ4A 4W99A 4E3ZA 3L9XA 8LDHA 3BIOA 4DL9A 2A4KA 2VQ3A 3LT4A 2HUNA 4DQVA 2RHRA 3CUKA 4KWIA 4BO2A 4YT4A 3T7EA 3WJ7A 3SX2A 4AJJA 5KJ1A 4JXKA 2O7QA 1H5QA 5C7LO 3RU7A 1KIFA 3EAGA 2GCGA 2NVBA 4BHTA 6LDHA 1HTBA 3LK7A 3DHYA 4OAQA 3ZNPA 3OIGA 4R1SA 4U0JA 2RAFA 4D45A 2NNLD 1LC3A 3S55A 2YY7A 3ZWOA 4XYGA 3PWKA 1P74A 3H5RA 1C0KA 1EUDA 2BGMA 3WGHA 2P2SA 1RYDA 2GN9A 2BKAA 4BB5A 2QW8A 2NU8A 1WP4A 1AXGA 1Y7TA 2I6TA 3DOOA 5U4QA 3OQ1A 2BI8A 3AM4A 4XQGA 5C37A 4ESOA 4HX5A 3M6IA 3ZNNA 3QP9A 4OXYA 5A5EA 3IMFA 4DPKA 4RF2A 1EDZA 2FZWA 3H2SA 3OJ0A 1PJQA 3JQGA 5A05A 1VL0A 4PLWA 3QWIA 5KNLA 3KXDA 5G4LA 1F8GA 1GUZA 1HZZA 3JQBA 3K2EA 5L4SA 1K0UA 3TZHA 4XGIA 4D43A 3PP8A 4O59O 1YBMA 4FC7A 1I01A 1F0YA 1I36A 3PLNA 2BI7A 2YFHA 3DFUA 3K8ZA 3SXPA 3MJEA 3UKOA 1U5CA 5MDHA 4CMEC 2HDHA 1R66A 4IDGA 3FBTA 1HF3A 3LLVA 5EL0A 3H9QA 3Q1LA 1EK6A 4LMRA 1RKXA 3D5QA 3S2IA 4R3WA 3AUSA 3EZLA 3QVSA 3FD8A 3FPLA 3I9NA 4TVBA 4J16A 5L9AA 3PWSA 4PLGA 5JO0A 4FN4A 1U1IA 3ROKA 3IS3A 3QWBA 4CL8A 3EVNA 3GZNB 2EGHA 1NAIA 4Z3DA 1GR0A 3VTFA 5ENDA 1KEWA 1OC2A 2J5RA 1PQUA 1QYDA 5CPFA 1LQUA 3BMOA 2PK3A 3K5PA 4OXKA 5KVQA 3V1UA 4JBIA 3IUPA 3RVDA 4DYDA 2WEKA 1KVSA 3DBVO 2G0TA 1LSOA 4RVFA 3ZCXA 4FB5A 3P2YA 1MGOA 5I7SA 2ILTA 3K31A 1C1XB 3HHPA 1LX6A 5CP8A 1V3UA 3ETEA 1X1TA 3K2BA 1I2BA 1BXZA 4JX8A 3GH3A 1HDOA 3ZHYA 1QKIA 1HE4A 3QV1A 1UP6A 3PTZA 1ZMTA 1CETA 1F06A 2NLOA 2X5OA 3NAQA 3PZRA 3ANLA 2HQ1A 4HFRA 1C1DB 2I9PA 3UFXA 2E37A 3V2HA 4UVIA 1A9YA 1N7HA 3BMQB 3BTOA 4NBVA 5TC4A 1E0DA 4HNGA 1OI7A 1YDEA 3ON5A 1ENZA 1NQAO 2P68A 3ZH2A 2HAEA 1QP8A 1ZFNA 1DIAA 3CMMA 1HLPA 2B4TO 1XCBA 3IOYA 4J7UA 4XA8A 1S7CA 4CM3A 2X22A 4UUNA 4IINA 4J7XA 4OSOA 4YR9A 1KEUA 4MVJI 1QRRA 1I32A 4II2A 4LCEA 3NJ4A 4RPJA 3PIDA 4OOFA 4I1IA 3OJFA 5I9LA 2YYYA 1SCUA 4EITA 3HB5X 1DFHA 1E6WA 1ZK3A 4P38A 2PWZA 4CLXA 5LDGA 4MVJM 3O4RA 5DDIP 2IRWA 1DB3A 4B3JA 5L53A 2O2YA 5JYEA 1P3DA 3JQEA 3O26A 4OMUA 4AJ2A 5IXYA 4UVGA 1CQJA 4A5OA 5JCXA 4CLOB 2P9GA 3P7MA 2GUGA 3HN7A 4ZA2A 2HK8A 5KJCA 3I1JA 3K6JA 4J1SA 3S2EA 2IEDA 4EDFA 4L76A 4XKJA 2FWMX 3DTYA 4MVJA 4BNWA 3GN2A 1ORRA 4D3DA 3GGGA 4WE3A 1ZVMA 4U6QA 2Y66A 3I6IA 2A35A 3WNVA 2D3TA 2GRAA 3DR3A 3UXYA 4YAEA 1W8DA 2J3KA 3BAZA 4GI2A 1N2SA 1QYXA 2GASA 3GZNA 1O5IA 3ZV5A 1QYVA 5JMPA 1YBAA 2W90A 4N7RA 5AXAA 3AI2A 4L74A 1Q2XA 2Y67A 2WD7B 2ZTLA 4M86A 3RFVA 1U4OA 1HXHA 5C5IA 4BNFA 4S3MA 4FBGA 3CPSA 4U8GA 1R0KA 3JSAA 1PL8A 1C1XA 3DZFA 4A27A 1R37A 3V5NA 3TPCA 2RIRA 2O3RA 3W1VA 1M75A 1OZAA 1GZ6A 3WGZA 2DBQA 3K96A 3OSUA 1ZUD1 4L75A 4LCJA 2HMUA 3ENKA 1YQGA 1ULUA 5IDYA 2GYYA 5DCUA 3RIHA 3BMNB 2E82A 5EERA 2BFPA 4WPGA 2QHXA 2ZTMA 1EFKA 3AOEA 2CDBA 4INAA 5GZ6A 3RQSA 4R5MA 1C1DA 2WYVA 4RGBA 4KQXA 3NV9A 2PZKA 3BMQA 4B4OA 4LSWA 1Y5RA 3ANMA 1M66A 2OUIA 4D7AA 4J2HA 3C7AA 4II3A 4WCFB 5F1KA 1SAYA 4YJHA 1XR3A 5JFOA 2AG8A 1N8KA 2CF6A 2J3IA 4K28A 5JDCC 5A06A 5U1PA 2AQKA 4WEQA 4MIOA 4UAGA 3WLFA 3H3FA 1ZXBA 3RSHA 2AE2A 1CEQA 3WWYA 3PVZA
chains in the Genus database with same CATH superfamily
5AVYA 4QBFA 1SUBA 5BNFA 1K86A 1GKLA 2EJBA 2VDVE 2VP4A 3K0CC 3UB2A 3K4QA 2J6BA 2DGDA 3T61A 1Y34E 2Z83A 3O90A 2WQ7A 4KFSA 1V11A 2X7HA 2QAGC 3C3MA 4HG2A 1RHUA 1ZCJA 3AV3A 3I9LA 4N1AA 1E79A 2JEYA 4RX1A 4XVQA 2W5UA 1BCSB 3LV8A 2GBIA 1J56A 5L3ZA 1NW4A 1B6GA 2PX4A 2VH1A 4L4XA 3W6OA 3U3MA 2VVTA 1ZH6A 2H54A 2PSFA 3S99A 2BEKA 2WVAA 4CM1A 1WUHS 1XALA 3N75A 3L0SA 1GG8A 5E1BA 3TLMA 1YZQA 2WQZA 3KB8A 4RTJA 5DYWA 1L5SA 1QVZA 2QTCA 3HNPA 1FTGA 4NFYA 2GD6A 2PWBA 5DOVA 1G8HA 3WHPA 1ONPA 3VKFA 6NULA 4UU8A 5CITA 9LDBA 3RREA 1Z5NA 1WIWA 2AG1A 2IYPA 3OOWA 4LXUA 5GJWC 4MQBA 2JI8A 2ZBGA 4BVEA 3QWAA 2VRCD 4DCVA 5KVCA 1MF7A 1Z18A 1GLVA 3NNSA 3O2NA 5EHGA 3TXXA 3CEMA 4RY0A 5BYAA 6YASA 3S70A 4L16A 1FNNA 1H66A 2VYQA 4FU0A 5IJ0A 3B1VA 3W8RA 3U26A 3RVOA 4F45A 1WVIA 3NJRA 1QAMA 1EVIA 2Z5VA 3HCOA 3HXTA 2RGYA 4IZHA 5J9FA 3HUEA 1Z8HA 3MS7A 4PGHA 4EI7A 1UBEA 2OZEA 2IH4A 4RY9A 3ZCTA 5FYQA 3W34A 1W2GA 4C7JA 3KPJA 4NL4H 2JLYA 3A0UA 2AFVA 3CB2A 3L01A 1YS7A 4ENUA 1E9VA 1O6GA 3OP4A 1AK9A 2EKQA 1H1TA 1MDFA 2CD7A 5CAEA 5HKOA 2F4VB 3PLAE 1JU9A 4PCAA 3BVPA 4RM3A 1VIVA 4QL3A 4Z5XA 3H5IA 3W77A 5A9TA 1MHTA 2PJZA 2CE2X 3R0IA 1OZ0A 2N75A 4JSRA 3T9CA 5BSFA 2XVAA 3L06A 1YR8A 3H99A 4DPMA 2HWKA 3URMA 3VPHA 1ZCAA 1SU4A 3AFGA 1AGYA 1JF8A 4DLAA 2J3EA 2X9GA 1XNRB 2EU8A 4BAZA 3BMNA 3WLOA 4BC0A 4BYMA 1MPXA 3ESDA 1O54A 3RABA 4G9BA 3AOGA 3H16A 3I2IA 3D8SA 5CNIA 5DNEA 1NXTA 2DTXA 2QZ9A 1W0JD 3FMVA 3FVRA 3OH8A 3ROEA 4RJTA 2CV1A 1UPAA 2FUEA 1NQXA 1Z6XA 2A9KA 3MGBA 5FFMA 1TCVA 5CEEA 2KE5A 4FZRA 4CWAA 3DVLA 4FPXA 3G2LA 2QU7A 4S1VA 1ZY2A 1BU5A 4DF3A 5DN6D 3FKJA 4KU4A 1SVLA 2R8YA 2W6QA 4Q34A 4WCFA 3THOA 5K6TA 1PZNA 1S3GA 4A26A 4XVCA 4WI1A 3OIYA 4QQ8A 2F9FA 5KOHA 1OU4A 2XJ4A 5AOCA 3TQSA 2AFIA 4LOKA 4CIAA 5HNKA 3B3FA 2HU2A 4LGMA 4R71A 1USWA 4EMTA 3K1ZA 3OVMA 2WU3A 1YH3A 4MYDA 1QANA 2RHCA 3NDRA 1F3OA 1L4FA 3BDIA 2CVOA 1JHRA 1JAYA 4G8BA 3AINA 4K8OA 4RGYA 4ODIA 5LZ9A 3INGA 1MKYA 1ZXLA 2Y1KA 3OCXA 5MFZA 2XXBA 2YMMA 5EXPA 5FA6A 1C9YA 4QGHA 4GICA 2CVQA 4QFCA 4JBWA 4EYKA 5ITWA 1ZD4A 4RTMA 4YXFA 3BA6A 3E4DA 3MT9A 5C31A 3G68A 2FQYA 3NXKA 1KE2A 4DLSA 1M67A 3CURA 4JCOA 3TS1A 4EFNA 4LVNA 5CFLA 3WWZA 3LUCA 3FOBA 3O4FA 1ECFA 4FJ1A 1ODTC 3ND9A 2PQ0A 1E4VA 4DRXA 3LCUA 4YNBA 1X39A 2BHLA 3DZHA 4MVJE 4MR9A 4OQ4A 3QUSA 5IAKA 4D6XA 5H70A 3CVYA 1MEJA 5IAOA 1Y80A 3S3TA 1QIJA 3HJCA 2G88A 1Q0HA 4YCAA 4Z4EA 2HU8A 4J43A 3AIKA 3LXRA 1O6BA 4GQBA 2AF4C 5MN4A 4DADA 1I7LA 2D1FA 3BL6A 5ALHA 2B1GA 4JLSA 4TKUA 2W2PA 1RWXA 4HDOB 4HXYA 2UZ1A 4UFOA 4RGQA 5REQA 2C31A 1L1FA 3WOVA 5BNIA 2HFJA 3AKCA 4TYNA 1AZTA 5C2JB 1MB4A 1D2AA 2QLLA 3ITKA 4JC5A 3UMFA 1ECJA 1XHFA 3BFKA 3OFJA 3AU9A 3TZKA 1J5XA 4CKBA 3IERA 2O8NA 3P2IA 4GBMA 1SB9A 2AYYA 2IIBA 5KX5F 4L4SA 3TL6A 2P9JA 3EQ6A 2XJ9A 5DHAA 4OOEA 3JXEA 4P4GA 3IHKA 3PJRA 1K5PA 4HNUA 1I24A 1I2CA 2X0JA 3V00A 2FJUA 4G36A 5F3RA 3ABZA 5FTWA 1NW6A 1RQNA 1XD2A 4ENSA 5LLTA 3GJ7A 4EUFA 1FLDA 1P91A 1K3UB 2I78A 2XGSA 3BAFA 4NZOA 1H0HA 1SKAA 2R7KA 2VQSA 1D09A 1LRLA 5ECYA 2Q3JA 3SHTA 3I2HA 4IDEA 2X6TA 3TE7A 1USVA 4DA6A 2FPLA 3HVIA 1KI3A 3PGA1 4D57A 5I8PA 1NR1A 2GVZC 3LZ6A 1AKVA 3R7NA 1KAGA 3HYSA 4GZ3A 4Y2JA 3WK7A 5DRTA 1QQ6A 4BGIA 2IITA 2VNKA 3GF4A 1X70A 4HRYA 4HNVA 5EOVA 4YAFA 3USZA 2PR2A 1ZRHA 2LZ0A 4UOEA 3WGIA 2GPSA 4CR7A 1I7QB 4RWZA 4YCLA 1YI1A 3GLGE 4I1OA 2XKJE 4XIYA 4R5HA 2CYBA 3JQAD 2DKFA 3ANYB 4LYAA 4KYTA 4RD2A 1SPBS 3RJ9A 1JXMA 1NRIA 3CH5A 3TQCA 4DG5A 5C8YB 5ICCA 3CH4B 1QQBA 4I50B 2EQ5A 4FQ8A 4JODA 2PZEA 3FBGA 4ZQGA 4EFKA 2IS2A 5A5VA 1KS2A 3PBKA 4BNUA 4WLNA 1YFJA 3V8PA 2R9VA 3VU1A 4PSAA 4US1R 1ICEA 5MGBA 5LYJB 3AF3A 5DN9A 4KFTA 1N6LA 2GM4A 4JOBA 1GVHA 1KDTA 1UUFA 3PJDA 4V1CA 3OQOA 2EP7A 4CM5A 2QD1A 4MW6A 4BMVA 2Q6KA 1L7XA 3CNNA 4IPTA 4W5WA 4QXAA 5E1MA 5HILA 2O5VA 3G8DA 5JNSA 4A6XA 1C29B 3MGGA 3SU8A 3PKIA 4BLSA 1X77A 4D9NA 2QTVA 3K0SA 4EGQA 5JAUA 4B8ZA 1XVVA 2YWGA 4EHNA 3CGWA 1EH5A 2BBTA 4ZICA 1V8FA 2CNBA 1RM0A 2A5JA 5B7GA 4CYMA 1F12A 3KO8A 5EZYB 5FLEX 1T3HA 2UUOA 3ZBQA 4PLTA 2XTJA 3GGOA 3TLGA 4EY5A 4ZHQF 4DV0B 3ESBA 1W93A 2FZEA 5AMXA 5ALSA 5IG2A 3FUVA 3O31A 3LHSA 3GU3A 2J09A 1UPTA 4JJ8A 1PJ3A 3HYNA 4RDHA 4MVJH 4OHMA 2VPQA 4H7DA 5EYPA 2V6MA 4KO4S 5I5EA 4K0KB 3KNZA 1K89A 1PYOA 4MKZA 5CA0F 2J0SA 2FVYA 3P2KA 4DILA 1ZOOA 2CNDA 3PF9A 1M33A 2A30A 2D2XA 3DLTA 5FEMA 3PNVA 5KCMA 3VJRA 2RH9B 1JVBA 2ZAYA 3AZOA 5E7MA 4RPHA 2AB0A 4K6FA 1QMPA 4KXYA 4NI5A 4UHJA 3WMWA 2VLIA 4IFEA 1SA0B 5BV1A 3MLBA 5FWXA 3G23A 1KZ1A 2BCJQ 2RBEA 3O2QB 4XDYA 2OHVA 4RVHA 3I2KA 1FSZA 1BDMA 1SIOA 4ZZ3A 4QDOA 5BPFA 1U0SY 4Q05A 3M6AA 1UMKA 1NC3A 2HY7A 2WU0A 2XY4A 4EKDA 2W2VA 4EKIA 2CZQA 2FUNB 4YRKA 4RTRA 1FFBA 3OZDA 1OI4A 2Y8EA 5LMUB 1KDZA 4BLRA 2A5YB 2C9MA 3R7BA 3W5UA 3U5TA 1U2GC 3WK9A 3L77A 3K7EA 3M9XA 1UPFA 1K7YA 3AVPA 5CG2A 3GLHA 1CR0A 1WW3A 4KO8A 1BW9A 3R6GA 2OGZA 4ETWA 1YTUA 4WKPA 1JYSA 2I29A 3LUDA 4X90A 4D9CA 3W8DA 5CURA 5JLAA 1XCLA 1NKSA 2GMWA 1AMOA 1LK7A 2CLHB 2WTAA 1TZ2A 4K0RA 1PDWA 5KTRA 4OIFA 4DTCA 3MN1A 5FO1A 5IC6A 1R0ZA 4AQYB 4ZDIA 2QMHA 4JL6A 4TQ9A 5TEVA 1VXOA 1FE8A 3WC4A 5K2OA 1DQYA 2X40A 5JAQA 3QZUA 2IOQA 2EJTA 1K5HA 2XYHA 3UMCA 4CHTA 1H4TA 2CB0A 3DBLA 3I37X 1AUPA 3KOZA 3LLMA 5JSYA 4YCCA 3BX1A 3HCBA 4ENVA 3IC5A 4OXRA 4BGVA 4B7UA 3K0BA 1CHNA 2BUBA 3QLJA 2ZJBA 2X7XA 1YJXA 4CEIB 4CMCA 4J0CA 3FMIA 2AFIE 3K0AB 5MGNA 1HEYA 5BSTA 2FZCA 2IHJA 4DUYB 2VPZA 1G42A 3LYHA 4OD0A 4WVFA 4CM7A 4M49A 3SS8A 4KFUA 4DHWA 1S2GA 2OORC 4MWEA 4BAUA 2CXQA 4CV0A 1C4KA 3E3NA 3KYDB 4PQYA 3MB8A 4LJ6A 2FPSA 5CYGA 2ORYA 5EQJB 1E3QA 4EUHA 2GGSA 3NBMA 3BHJA 1NV8A 5LVAA 2FZ4A 2A92A 2MOKA 3K0HA 3CE6A 4ZT3A 2RGRA 1I1QB 1MCZA 1O1YA 3B85A 3C1OA 5EVJA 1L5WA 1T4GA 1JMKC 5ESRA 1B00A 3W8FA 5E6SB 4AIRA 4BB9A 2PSDA 4NYJQ 3FDIA 2YQ5A 3IAXA 3W04A 4J0KA 3WIUA 1N8TA 1XDZA 3GPDG 1IPEA 3HZOA 4LDQA 1NOIA 1ZITA 3HCDA 1T2EA 4IIJB 2Q4BA 4LDRA 4UNQA 3LY8A 5H4HA 5HK8A 5CDFA 3TMAA 2O8FB 1PG0A 3UH0A 3TX6A 3OEED 1QORA 4DMRA 1JQKA 1YD7A 3CUWA 1SVWA 5ED4A 1ZO8A 3BTSA 3ZY4A 4Z7QB 4BNDA 2PNFA 3ETDA 4Q7MB 1Y5IA 1U2ZA 2Q5CA 3AESA 3LZDA 4RHFA 2WDPA 2RI1A 1WKBA 5JYCA 4O1HA 1IBMB 3QVMA 3QXSA 1K2WA 4LV6A 1WLYA 3NBZC 2EDCA 1MW9X 1SNYA 1B8VA 4QQRA 1W34A 2O59A 3Q7RA 1GPH1 1YQWA 2A0WA 3IVRA 2WSBA 5I48A 5ICEA 1IHXA 1EX1A 4G8JA 3K70B 2ZSUA 3H6KA 3KB2A 4B6RA 5EEGA 1UDBA 5DHFA 2HTFA 121PA 1ZSNA 4NK4A 3RS7A 3OJEA 1PQWA 1V35A 3DBIA 4A0SA 2ZB8A 3U19A 3V7UA 2I6QA 4JUIA 2JD1A 3WGKA 3GEEA 4R8SA 2PX0A 2QRMA 5IWAB 1W9HA 2HHCA 3KDSE 3TFWA 3NHSA 2RGAA 4C0SA 1LK0A 3PXGA 4DM7A 2ZZNA 1CJCA 3OECA 2QM7A 1C9JA 3H83A 2BEVA 4IEIA 2P2CA 3D6JA 3AVVA 1YR3A 1JAXA 2ZJ0A 4IP0A 1R5OA 3OQIA 3C8MA 1ATIA 2EZ9A 4R1PA 2XVXA 3ZXUB 1IHUA 4MCIA 4M9CA 1U2SA 3UW1A 5ICFA 2YJ3A 2JJYA 3VSAA 1TKCA 2FN3A 1ECLA 4BE4A 2VP5A 3WOHA 1EFRA 1CB7A 4OP3A 2QUZA 3F7NA 1N75A 3A1EA 2FX3A 1OUMA 4FMCB 5FJIA 1M2JA 3B1YA 3ZIUA 2WUEA 2JIMA 4URVR 4M9QA 3ZWWA 1M5TA 2XE4A 3T3NA 3EC7A 2WVJA 3UWOA 1GKUB 4PAQA 1IL0A 1XDDA 3JWJA 1XA3A 3W5AA 1BX0A 3QPUA 2OO3A 3HKBB 1Z47A 1LU9A 3PVCA 1R27A 5K45A 5FNZA 1Z4QA 1SG9A 2K2QB 2Q2NA 3EMVA 2NIPA 3CPJB 4JLKA 1F8FA 5EQDA 3LPDA 5EZQA 1XQ6A 2B3DA 4Z0NA 3FSRA 3HFGA 1E1LA 2V9CA 1K8YB 1QLHA 1U9YA 3I45A 4DQLA 4IQ8A 2Q0XA 4Q4HB 3I1FA 3ZLVA 5P8WA 2DERA 1YQQA 2P3QA 3QW4B 4J1TC 3D6HA 3PGKA 5DGIA 1MJNA 1LDEA 1E1QA 3C3AA 5C32A 1L4LA 4I6GA 1C4XA 3PLRA 1LA2A 3ASVA 2FFAA 3I72A 4U2CA 5GONF 2I4NA 4Y1FA 1KY4A 1NW3A 4D9KA 1JWLA 5LOVA 1VE7A 1FYFA 2X9LA 4ZU1X 4BNNA 3PHIA 1JU3A 4TZ6A 4YVFA 1R0SA 2NU7A 2I9KA 1JIXA 3UAZA 3TIFA 1YFZA 3S27A 3H9GA 3N2NA 3ZYCA 4ENTA 1QHGA 2KM1A 4UMEA 3PQ2A 3PYXA 4DIFA 3ZV3A 4E4YA 3CY6A 3D4IA 3E84A 3MAAC 3DFFA 3JRXA 5TMEA 3RHFA 2J41A 4C6TB 4QUIA 3GK3A 2XNHA 4AT1A 4MR8A 2O3SA 3TSOA 5JSZA 1PZXA 2FE4A 2GDZA 2AJTA 4MIKA 3C7DB 3VO8A 5JZ9A 2VF8A 4PZZA 4TLMB 3DKKA 1SUSA 4DSOA 5J2TA 4DR7B 3HL0A 4IGIA 2GETA 1GU0A 3Q9UA 3ED5A 4MUAA 4MHOA 4OGFA 4EABA 1YCGA 2B25A 1D4ZA 1LFDB 1MB9A 3DL7A 4AM8A 1ENPA 2XRFA 2HU7A 1ZAYA 1KEEB 3VU9B 3DPIA 1M7GA 3KOYA 1IQRA 2JFOA 2VPPA 2OHHA 2GZ1A 2A5GA 3G5TA 2Q4TA 1UT6A 3PKZA 1YK0A 1M1YE 1E7SA 5CVDA 1KRXA 1G6OA 2W6JD 1ESEA 1L3CA 5E0OA 3ZD6A 2F6RA 4DCGA 5H9VA 2QPTA 3MWKA 4YJHB 4E14A 5L95A 5AK0A 3U44B 1ODLA 5CXUA 3QSGA 2AN9A 4XSVA 2FDCA 2OCAA 4R2KA 1IBLB 2IPOA 4KREA 1VG0B 3FRJA 1B0AA 3E1KA 4H2DA 1FTSA 1L4NA 3T7TA 2QTLA 2CEAA 5NLLA 5KYTA 1KI9A 2O2EA 3OLXA 4QFMA 5DW3A 3LCCA 5LKAA 2KPOA 3DUWA 3ZXYA 3K2QA 3N9IA 3QKRA 3FDZB 3C3BA 2I55A 3GLHE 1NW5A 3NB0A 1N7JA 2WB4A 2DHCA 2HRDA 3MLEA 4CR8A 4ZCTA 1XTBA 1W6RA 1EK5A 2JI9A 4JITA 2VO1A 2QUIA 3CUSA 1JSZA 3FSGA 3PGLA 2PSJA 4PHTA 4CM4A 1CPYA 3FJOA 3KUUA 3WGYA 6Q21A 5KNCA 5HMLA 1JG4A 2QRKA 4FILA 2BTEA 4KIFA 3CEHA 4LWOA 2P40A 2H2DA 4WFIA 5HFAA 5A7HA 2WWIA 1V8BA 2XTNA 4ZOQI 4US2R 1PP4A 1VKNA 2OZLA 3BSSA 1G1AA 4ALLA 2IHYA 1CJTC 4IIXA 2AC4A 2RK3A 4HK4A 4LNAA 1GAWA 2IEBA 2IC5A 1L5GB 2MU1A 1ZZEA 1W0CA 3CPHA 4H7EA 4IH9A 3HK2A 4L2IB 2W70A 1KU6A 1S4MA 4KQMA 4YMWA 2A9JA 4URZR 5C7OO 1NF2A 5EMJA 2GSDA 3H9BA 3Q6NA 1PS0A 5FWYA 3Q7PA 3C3YA 2F90A 4XAQA 5F9FA 3URKA 1LBSA 5LU9A 3LJKA 4M0PA 2EX4A 3K0FB 1GDHA 1WMBA 2QTFA 1MXFA 3C6YA 3ISTA 3WQRA 2OBBA 3IMGA 2F17A 4KXXA 2IHNA 1YRWA 3SX4A 3A9WA 4CCSA 4ZCIA 4DE5A 4KE9A 1J1UA 3H1AA 3UMVA 4JV5B 4UASA 3VV3A 4DCJA 1QQAA 3U60B 1XQ1A 2GYVA 2IYXA 4WX2B 3EPPA 3RFXA 1Y1PA 3V1NA 4FHZA 3U4GA 2PLNA 1PJAA 2EERA 3ID6C 3L46A 5BVGB 1S3IA 1ADCA 1PR6A 5TV2A 3LYAA 4LQDA 2ZI6A 3ZHTA 4F9EA 4D8WA 5BMOA 4WINA 3BIFA 4BNGA 4HNHA 4F72A 1KFEB 4IIYA 4WDRA 4EG5A 1G2IA 1Z0KA 2QLJA 2PV7A 1Q92A 3G8AA 2G07A 3NONA 3R3XA 4QG3A 1SCIA 1Q1EA 3H3JA 1CUSA 2QK4A 4GKBA 4LJ9A 2DWQA 4S35A 2O0HA 3E35A 1UT8A 1J09A 4IX9A 5CDFE 5DHQA 3Q8KA 4IWXA 1BQ3A 4M0LA 3SJCA 4MUJA 3ZBTA 2H2GA 2VTVA 1FTQA 3OOSA 3PUWA 2V5UA 3F6BX 5C80A 4ZREA 2JHPA 4IHQA 4NU6A 4E0BA 3ZVNA 4R51A 3H6GA 3FPKA 1PGOA 2FMFA 4HAXA 2Y1LA 2C7OA 3HVUA 3G49A 1JTVA 3LCRA 4NCJA 2AOWA 2Y4OA 3HGMA 3ZJYA 4TLCA 2JKVA 4IOJA 5THQA 1DBRA 2FR8A 3ZE1B 2PD3A 1JN0A 1QX4A 2ZSDA 3PEYA 2EFCB 4YMLA 3ZLTA 4X65B 3QX8A 5ALZA 3T94A 1JLHA 1DRJA 3HDJA 3R5HA 1YJ5A 4PC7A 2V97A 13PKA 2CL6X 2XNDA 3P2MA 3PK0A 3VR2D 4OLFA 4D4JA 2C1ZA 3VZPA 4S2EA 1E3JA 1MBZA 3DCNA 1GAJA 2WWGA 4EB6B 1IUNA 1V1MA 3NM6B 2VAVA 1FU4A 3NPAA 4YN3A 2Y0CA 4ZQIA 4B3CA 1CFJA 6ABPA 4E7OA 3KLOA 3W2HA 5BQFA 1H2FA 4RE5A 3R3WA 4ER0A 1FJHA 2AW3A 3FPAA 4G85A 4PLHA 2DFVA 1ZLXA 4Q47A 4YFVA 1N1DA 3RAJA 3JQFA 2IIPA 2YS6A 3IPCA 4B1FA 2FWAA 2C57A 4BX2A 1EP1B 4X6LA 3B7WA 4ALMA 3OPVA 3NYQA 2BY4A 1JWAB 4FMBB 2R97A 1XG5A 1TLTA 4UKDA 3QVLA 3C8UA 4YONB 3EX7C 5LQJA 1NFQA 4QGGA 4XGNA 5E7JA 5B58T 4M1TA 1RJ9B 5FOVA 4EHKA 3OY2A 2I34A 5D00A 1YO6A 4Y1EA 2Z8XA 4ESVA 2A9FA 1C9MA 3STHA 1TGYA 3BXEA 4M38A 4TZKA 4BNTA 1PEDA 3GCZA 3UGKA 5F7XA 4N7JA 4LVCA 1AXEA 3UKDA 2REQA 3EULA 5DE3A 3QTLA 3JRNA 3SNKA 2NYUA 4ITUA 3DVSX 3ZGXA 5G0VA 2EF1A 3WGLA 5I01A 3E22A 1JLSA 3TRKA 2AFHB 2FQXA 2ZS8A 3OIWA 4D5GA 1NMSA 1K6EA 1LLDA 2B5OA 3K1AA 4OI2A 1P1CA 2FOIA 1MC4A 1SXGA 2AKYA 3AYZB 2VWGA 2XQJA 3IAS1 1QIDA 2OAQ1 3V8RA 4E5MA 3KZMA 4IWNA 1OWNA 2E1PA 2VPYA 1DJNA 2WTMA 4G97A 5DCLA 1QBGA 3F5DA 3N7AA 1TTPB 5A4KA 3D8RA 2C5FA 3EGDA 4DIKA 5TIIA 3U3DA 3IRUA 3RYHB 1Z5UA 1N5RA 5D2CA 4C0QC 4P3PA 5CJJA 2WWTA 3FOWA 1HZZC 4NH0A 2FLWA 4UHCA 5IH7A 3JQBC 2GFHA 3QKSA 1RCTE 4INOA 4R7GA 1FDOA 3AZPA 3ELWA 3BRWD 4PXYA 4TYYA 5DM4A 2QE7D 1Y7IA 1SC4A 1XD8A 1ZG3A 2VRBA 4ZT5A 1XZDA 2H0RA 4WECA 5DKFA 5F1PA 4CQLB 1KYXA 3GA7A 1EK2A 1RE0A 3ZHZA 4OHBA 1MOSA 4R9SA 5L7YA 4A2QA 4TL9A 5JISA 3M33A 4L28A 4ZYVA 4KK3A 2AJCA 4JXJA 5J5CA 3F2VA 1DAPA 1XRRA 1KJNA 1ZJ6A 1OI2A 2VYCA 5BP7A 4QX6A 1TZCA 4MV7A 2BYTA 2C03A 2QPAA 3DV2A 4MDYA 1EMDA 1CUFA 4NS1A 2HL6A 5FWAA 4BVJA 1LV8A 1IK6A 3D8NA 2D7JA 1AC5A 2ZAIA 2H3HA 4UUAA 1M76A 2WZBA 4QJ5A 2VYND 3C4VA 1OH8A 4N82A 2Z5FA 4QOJA 4XWGA 2HF7A 2MINB 2WLSA 4X60A 5G0WA 3D7RA 3PIRA 1KMMA 2HXYA 1Z63A 1B7GO 2HDOA 3GWGA 3KYCA 2W2LA 1EUQA 1XA0A 2IS4A 1G98A 2IZOA 3NHBA 3DFIA 2UZ4A 3FYUC 1ZDMA 1FRVA 2ZIAA 4QODA 2FFRA 3G2HA 4PAOA 2PUCA 4YYEA 3RS4A 3OCWA 4QXMA 1GZ4A 2IU6A 2WU1A 3I64A 1VTKA 4AN1A 1II8A 4CM6A 5BT9A 4GM1A 4AMUA 4LRQA 3H5NA 1FJGB 1EJ6A 2PL5A 2VNHA 2O1XA 4TWIA 4AJEA 2O5CA 3LTEA 1XGKA 3RYIA 5LL6P 1PR0A 1G6Q1 1X9GA 1CUHA 4RJKA 3BFJA 3N0TA 4D3YA 2OXCA 1TYZA 1QH8B 4GIBA 4PNHA 2BR3A 4JLNA 4JA2A 5COBA 3HN6A 4JI6B 3W3AD 3X43A 4BKQA 1NUHA 1QC5B 4QDKA 2QYTA 3LO8A 1G8PA 1JPUA 2O4UX 2ZPUA 4QXQA 3ZGYA 1I1NA 3II6X 4V0NA 1ZC3A 4KQCA 2GN6A 3DBRB 3FSEA 2PS0A 3PRJA 4OLJA 5CH5A 4F11A 2OYCA 1MV5A 3V6LA 4PW0A 3M6LA 3C1UA 4M0CA 2FPIA 5HF5A 4A8JC 2J30A 5SZKB 2BTQB 5DNWA 1QRAA 1YOVB 1C14A 5FOTA 4NE7A 2C94A 5ITZB 1PYDA 2Y2VA 1FPMA 1GZ5A 3A9VA 3HZHA 5HYVA 3RUEA 1P0MA 3QMMA 5IM5A 3KT6A 5AWFC 4CETA 4Q3CA 4BJHB 4O02B 4GLJA 4GMDA 4B80A 4ZV7A 4DTIA 4BWGA 3IQIX 1JW9B 5FRDA 3L49A 3NASA 3NATA 2ZYIA 4MEJA 3U13A 2R1ZA 4TXHA 5DWQA 1O97D 4MDEA 4P32A 1J5PA 1TO6A 1ODCA 2JW5A 3WYFA 3CRRA 4EL5A 2P2DA 3I1YA 4ME6A 4AW9A 3RI3A 4PNZA 3EXEB 3SC4A 3SOPA 4A1FA 4Y30A 2FPKA 3F3SA 4NZPA 1ZHFA 2CNWD 2OBNA 3EMDA 1P5HA 4JYCA 3EFOB 1UR5A 5T64A 3SHWA 1TOAA 3CZMA 3GCGA 4BQNA 2WQ6A 5IEBA 1EE9A 4JJKA 3L8ZA 4M1YA 3L92A 1RPNA 5B36A 2P7IA 5BR4A 2W4IA 1EA7A 5AW1A 4ZVUA 2B82A 4XTCS 4G2NA 1NXVA 1UKCA 3NCHA 4GGOA 2X1HA 2OR3A 4YWJA 2GILA 4CV3A 5CB8A 3FOFC 3ROMA 1R6XA 4JR0A 3BWEA 1DEXA 1NKTA 5FP0A 2B8WA 2VBFA 4XDHA 2FP4A 4IJQA 4S1WA 4ZARA 2PL3A 3RANA 1JDBB 1DKPA 5CW1A 3TJRA 1R10A 1T4CA 3WMRA 4F8EA 1QGZA 2IYUA 4W8HA 3MMPA 3R3YA 5FTKA 4PONA 4TLLB 4KDRA 4UQLA 2OHOA 1RQPA 2PGNA 3CF4G 4HEJA 4I3FA 2F1IA 1W1UA 3VDNB 2PRJA 1RCUA 2IP1A 3H86A 4R2WA 4C2AA 3ZJ5A 4OM8A 2BJVA 3VFDA 1G9XA 1RMYA 3N8DA 1O2DA 5ECGC 3ZV7A 2IWRA 3G82C 3T1OA 1UIRA 4J4TA 3W9SA 1E0KA 3HE3A 5LQNA 1C7QA 5HRUA 3M83A 3GCWA 5CUQA 3C3KA 1KEEA 4TMKA 3O8OA 1YJCA 1A1VA 1P60A 4KWTA 3BGWA 3DR5A 1E96A 4PNPA 4KLRA 5LD2B 4NNJA 1KI1A 1E7RA 4H08A 2HPHA 1BHQ1 5FPHA 2AN3A 3EXIB 3WTBA 4CEHA 3NP9A 2PU5A 1N32B 4J0JA 3K5WA 2C96A 1EXDA 1TNDA 1KFJB 2C2YA 1NSFA 2ZUTA 1ZL0A 2R8BA 4RV4A 1E1KA 1P1JA 4EEXA 3CLUC 3DL2A 4Q19A 3THSA 5KTNA 5LUAA 1WV0A 2QQ5A 5KYYA 4TLDA 4PFJA 3AX6A 3CMCO 3UJ8A 3E4CA 1QB7A 2LIPA 3OPXA 3KELA 3I92A 5A7GA 3EVTA 5ICGA 4FD2A 2XEXA 4N8EA 4OVKA 5KNCH 4C7OA 3F96A 1PSZA 3N6XA 4YEDA 1BDHA 1ZS9A 3F78A 1QDLB 4NHOA 3K70C 4V0QA 3VGJA 4URXR 2ZUWA 2AOXA 3JQQA 1NA5A 3A10A 1NNUA 2B99A 1K75A 3EH1A 3QEJA 3TTYA 2GJSA 4Q4AB 2X2OA 5JHGB 2FPOA 2IZ5A 4W1SA 5IZCC 3GLSA 4H3KB 1VA5A 5MN6A 4CXMA 2FTKE 1PWHA 1NSYA 2YOHA 3SM3A 5CG1A 1CR1A 3MSCA 5FUQA 4TV9B 5FOQA 1EQ2A 1D4FA 4RE6A 1UP4A 2R8PA 2VZ9A 5TARA 1KP2A 2JJMA 1AX9A 4C7XA 3KOWA 3U7FB 5PNTA 1Q21A 2X19A 1KXJA 3FWKA 3KKZA 4OUDB 2Q99A 5GGXA 5I8ZA 4D9EA 3M3DA 4QQKA 1MB2A 4AICA 1N7GA 3V1YA 1R8QA 1SEVA 2QRPA 3TNYA 3UMMA 5JV5A 1VDZA 3TJZA 3CRVA 2MSKA 3GJ3A 1UBHS 2JRLA 3CKLA 3QX7A 1YL7A 4PFQA 4S0ZA 5CM2Z 5A4AA 4EUNA 2BHSA 3PEEA 3SJUA 5CB4A 4CIWA 1VKOA 4IRXA 1FVHA 2IVFA 4M6WA 3RV4A 4Y0VA 4EUKA 2HJWA 1KY5A 3F5FA 1NIJA 1Z5OA 3UUGA 1IWBB 3PDUA 3H4TA 5IW8A 5HVNA 3TKAA 1J25A 3G2KA 3M6VA 2O4CA 2QAGB 2QLFA 4M0DA 5FTNA 4B84A 4GP9A 1KAQA 2B69A 3LI2A 3GQBA 1RADA 4MROA 4P53A 3AR9A 2Q46A 1ZEJA 4UW9A 2LE0A 4XQEA 4JQCA 4JBLA 3K72B 4FSXA 1NVGA 2E4YA 2Q6TA 3LD9A 2O2XA 3OO0A 4NDZA 5IK2A 3V4SA 3LY9A 3ZLUA 2AN4A 1EGMB 3JWEA 2PXCA 3R41A 3PITA 2Q2WA 4TM8A 4ZOLF 5JSUA 3KAQA 3PNOA 4XR9A 3WLHA 4DBVO 1PJ8A 3HBAA 1KPGA 1ND6A 1PNVA 2BFFB 2ESRA 2H2AA 2G25A 4LIPD 8ATCA 5JZBA 2IV7A 3HFSA 3H9CA 1RLTA 1UOEA 2NTYC 1QG6A 2WIKA 1N6NA 2L69A 2UVPB 2XDQB 2JAQA 3DTVB 1T6XA 4F5WA 3C48A 5TQ0A 3NHZA 5BY2A 1Z82A 3P52A 2PANA 3BGVA 3ND8A 5AKZA 4K9OA 3E9CA 1O58A 4WIAA 1M0SA 1GLGA 1RSZA 2X6RA 1SC3A 2D1YA 4IJ6A 4IJVA 1WPXA 5LJLA 3UGJA 1TD9A 5CK4A 3C2QA 3CH7A 2D5IA 4BASA 4AULA 3MRXA 4O25A 2WHEA 2FWRA 2K87A 5DPMA 9GPBA 3UJHA 2R0QC 3HH8A 2ZYSA 3Q5EA 1L5QA 2ZVJA 5DYNA 1PI3A 5JVDA 2QDKA 2UXBB 2GKSA 3I3OA 3K4HA 4Q1AA 4YUAA 1NUPA 2W6NA 2VDOB 3FWNA 1SBZA 3HACA 4B7CA 3U7IA 3VYVA 1VJGA 2M32A 3EGEA 2BF4A 4GO1A 2Q2VA 1OYOA 1BDJA 1G3MA 4RU1A 3SNHA 2CEKA 4IDBA 4LDNA 2HBZA 4U5QA 2IOFA 2FPGA 2NXJA 2O9JA 2I3AA 3A1TA 3E81A 1EHIA 5CBKA 1JA9A 3P2EA 3BH6A 1NJSA 4H4CA 5AKGA 1PBNA 3BWDD 4CKWA 2GAOA 1KBZA 1E4EA 2BGNA 4IUYA 4OQZA 5B1DA 5I51A 1I14A 3EXG2 5E6RA 5C7IO 3COWA 1G8GA 1Z73A 2FXIA 3CZRA 3I9OA 3KV1A 5JFGA 2B0CA 2BGJA 4MQFA 1LZLA 5F5NA 5ERGB 4DUPA 1EDOA 2VRWA 3I0ZA 3IUSA 3ZCRA 4GYKA 4BKUA 3NVMB 5IWCA 1Z33A 1WWKA 4RD3A 1UKVY 1Z83A 2FE1A 1U2DA 1TTHA 5L40A 2CDCA 2ENUA 3LDFA 4H15A 2UVQA 4R2XA 1LBIA 2HMVA 2DWUA 4R9RA 4DM3A 4WCFC 2QZJA 3CLTC 1DT3A 3HU2A 4MVJF 1VMEA 3N1UA 1F2UB 2GHQA 3N3BC 5CX4A 4Z99A 4C0WA 1AH2A 3Q0EA 2NU9A 3OZXA 4OGWA 4COOA 1Z4KA 2ERYA 4BO5A 2G9ZA 3AXTA 2GCOA 2EKPA 1IE3A 3DKRA 1FXUA 1RXUA 1X7HA 1YR9A 3K8OE 2EW8A 4L0CA 2VTKA 3MQ4A 4CCYB 4MV4A 2QL6A 2ZSFA 3C5WP 5E6UB 2Q5JA 2HWXA 2YUTA 1Q7CA 2DP4E 4IVNA 1JR3A 5EAIA 3VISA 4B2PA 4EW6A 2ZT8A 1YWGO 3FNHA 1NF3A 2CFOA 1ORTA 4GX1A 4L22A 4PTZA 3HVHA 4RBNA 1LVHA 2FW1A 3ETCA 3GEBA 1O96B 1E6UA 1PT7A 4G6ZA 4L07A 1ACJA 5EZ6B 2GHIA 2W4MA 4MV6A 1BOOA 1TAQA 2DOKA 1BTOA 2F8MA 1V8PA 4GOND 4QWWA 4RY2A 5C0OE 1US8A 3N87A 3PDCA 4F8YA 3IKTA 1KFKB 1GU7A 4F1JA 1Z2OX 2ZBFA 3EVAA 3GNTA 3JZDA 4M1QA 1NZDA 1U31A 3V97A 4C0BA 5AM0A 4LKRA 4EMSA 1HFEL 2ICAA 3KKKA 4MP3A 4MINA 4MPTA 1XTQA 4W9RA 4WXHA 4UU1A 3ZCPA 4HNTA 2RGUA 4MZDA 5DXFA 4G56A 1B93A 1IDN1 2XA1A 3K6KA 4L9SA 3VR1A 3QEKA 5C5CA 1B76A 1QOPB 1WXIA 3LK6A 3R0XA 2BFEB 4QU9A 3VV2A 3AVYA 3M3PA 4MLZA 5TE9A 2QTNA 5FI0B 1TZMA 3F6EX 4AECA 3H75A 4G0NA 4PQGA 4FSDA 3NHPA 5G0TA 1T9GR 1XEXB 4DRZA 2BR4A 2HRQA 1E8NA 3EB9A 5L3RA 1N2JA 4GRIA 1KY3A 3GYBA 5AK6A 4B2YA 4OIMA 5FPYA 2ZB4A 3AW9A 2BRUA 5LZ8A 2AV6A 1UMBB 3FTNA 4AJ4A 4B6GA 1KH1A 1ZJZA 1POWA 1U8ZA 3FPHA 2B4YA 5IKEA 4NXMB 1GGFA 2HDWA 4CG3A 4B3XA 3CB4A 1OXUA 2VJDA 1NPTO 4WT7A 4PLCA 1PCXA 2AVDA 3VKUA 3IJRA 4Y6GB 3JQ6A 4HXGA 1JNYA 4JGBA 2GK7A 3EG9A 4N7BA 3M6WA 3PC8C 3HJBA 3MCZA 3PFGA 4V02A 2M1ZA 2E48A 3PGVA 4TTPA 1KI8A 1J8QA 3PPVA 5HIJA 2VYVD 3TOZA 3RYCB 1FW6A 2ZI9A 3P2JA 1K7CA 4MPDA 5DHSA 1GG2A 2B2NA 1DRKA 3D7LA 2ANCA 2J0VA 4DV7B 3DEJA 4XJSA 1K88A 3JWGA 2I2AA 1E3SA 3F5QA 1NATA 2DFKB 4JA0A 4P4NA 3S1AB 4Q82A 4G0MA 4RVOA 4WASA 2Q7DA 3QOWA 4N40A 4NS4A 4D25A 5KDLA 3M5PA 1M2OA 2W6CX 2YVKA 2CLOB 3F49S 3H7AA 3LUFA 2ODPA 4E5SA 5L8VA 1V1RA 3FVWA 3DUFB 3NALA 1EVLA 3PYMA 2QZ4A 1VLMA 1JJVA 4W5JA 2PT9A 2ZS7A 3AEXA 2YWCA 4JIGA 2IZ7A 2P79A 2VDJA 3E61A 4CUJA 2DC1A 1S4QA 2Z3WA 2ZTHA 2IUEA 1XTVA 4IVPA 1DEHA 4Z4IA 2HMTA 2W8ZA 3E5RA 2OY0A 2XYRA 4UM5A 1HO3A 3JYHA 1MFPA 1QXSA 1RRGA 2A57A 2RHWA 2ZKIA 3ENNA 2WHYA 4I9HA 4DLYA 4RGVA 2C2MA 3LVFO 2BMDA 1V5WA 1ULSA 1Y8AA 3K9LA 4YXWA 5I7HA 2F43B 4H17A 2GK6A 2ZRDA 3AM3A 3UZUA 1RQLA 1M2EA 1WDMA 5D01A 1P81A 2QVGA 3A1NA 4HEA1 4XLZA 2ZJ3A 2NW6A 3GPIA 2WG1A 4C0XA 4E03A 2D5CA 4WNAB 4OP2A 3NNDA 2OESA 3J7TA 4LJSA 3ND7A 1GZDA 4BPRA 1FRQA 3I1IA 3WQQA 4I66A 1GL7A 5EHNA 3A3YA 4UE6A 8AT1A 4EG7A 1EZ4A 5EGSA 5TVGA 3IAS6 2Q2OA 4HRAA 4FGJA 5JD4A 3C0KA 4W8OA 3HV2A 4PRZA 3HM9A 3OT1A 2PVCA 2I8AA 4U2EA 2JFFA 3E7DA 1PZEA 3GG9A 3HU3A 4X44A 3FPFA 2O8BB 4X00A 2CHUA 1RWBA 2H08A 1QOQB 4EDHA 3U4HA 3IXLA 1GUYA 3MCAA 4DCNA 2PZFA 1XVUA 2YWDA 3A25A 3COVA 1ZK1A 2ZRLA 2OBYA 5EXDA 5IC5A 2MT9A 3GAZA 3IBCA 3R5KA 5B53A 5CXXA 3RD5A 1OW3B 1E3WB 1TEHA 1T9AA 4Z4FA 1VP9A 4BATA 5BPHA 1PJZA 4OGGA 2FY8A 2O7NA 1RJWA 2DPYA 1P8AA 4WLEA 4BQFA 3FCXA 5ALWA 4J29A 1MOPA 4GR9A 4NCXA 4R1LA 3LW7A 1C8LA 5JHHB 5DHTA 3G2JA 1E1MA