1YKFA

Nadp-dependent alcohol dehydrogenase from thermoanaerobium brockii
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
352
structure length
352
Chain Sequence
MKGFAMLSIGKVGWIEKEKPAPGPFDAIVRPLAVAPCTSDIHTVFEGAIGERHNMILGHEAVGEVVEVGSEVKDFKPGDRVVVPAITPDWRTSEVQRGYHQHSGGMLAGWKFSNVKDGVFGEFFHVNDADMNLAHLPKEIPLEAAVMIPDMMTTGFHGAELADIELGATVAVLGIGPVGLMAVAGAKLRGAGRIIAVGSRPVCVDAAKYYGATDIVNYKDGPIESQIMNLTEGKGVDAAIIAGGNADIMATAVKIVKPGGTIANVNYFGEGEVLPVPRLEWGCGMAHKTIKGGLCPGGRLRMERLIDLVFYKRVDPSKLVTHVFRGFDNIEKAFMLMKDKPKDLIKPVVILA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NADP-dependent bacterial alcohol dehydrogenases: crystal structure, cofactor-binding and cofactor specificity of the ADHs of Clostridium beijerinckii and Thermoanaerobacter brockii.
pubmed doi rcsb
source organism Thermoanaerobacter brockii
molecule tags Oxidoreductase
molecule keywords NADP-DEPENDENT ALCOHOL DEHYDROGENASE
total genus 112
structure length 352
sequence length 352
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.80: Isopropanol dehydrogenase (NADP(+)).
pdb deposition date 1996-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ykfA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1ykfA01
4MP3A 2CVQA 4DC1A 3GUCA 1PGQA 4MKRA 3QJ5A 4TSKA 2AHRA 1JWAB 2CVOA 4OL9A 2PY6A 3GK3A 2FP4A 2DBQA 2WM3A 4CMEC 3UKOA 1B16A 4AJNA 1A7AA 4BKRA 3MJVA 3ORFA 4FFMA 4XWYA 4PLZA 3TZCA 3JD4A 2CY0A 3EK2A 1VJ1A 3PLRA 3G1UA 4IMPA 1EVZA 2VT2A 4Q9NA 4YB8A 5JMWA 3U49A 4CMEA 2EEZA 4MVJF 4D3DA 3WMXA 4WCFC 5K0ZA 2VNAA 1MLDA 4NI5A 1H93A 3FSRA 5J23A 3ZV5A 2NQ8A 4II2A 2Y68A 3F1LA 4P22A 3HB5X 3WLFA 3GOHA 4R3WA 3ULKA 5TLSA 5JFOA 2NM0A 1R0LA 1ONPA 4E2WA 1IY8A 2HAEA 1KC3A 3BMQB 3PZRA 5CDUA 3KYCA 3JD3A 2Y0CA 1N9GB 3D4NA 4ZQFA 3ZWYA 1HSZA 4W4TA 3GDFA 3ASVA 3RUEA 1HSOA 3D64A 4KWIA 4M55A 3RU9A 4BGIA 5CDYA 2P9CA 5L45A 4OKNA 3W4JA 2QW8A 3T7EA 5F1PA 4E0BA 4EEZA 1T4BA 3CINA 1EDOA 5JS6A 2J8ZA 3FNFA 4OOEA 3K73O 5TQVA 4N18A 5EQDA 2ZB7A 3ZWOA 2RAFA 1LLUA 4NQZA 5CEFA 1GDHA 3B1JA 1ZXBA 3QLJA 4DLLA 3LF1A 1GU7A 2POQX 4YQZA 5FYDA 3R0IA 3WOHA 1T2AA 1CEQA 2W98A 1XCBA 1SEVA 2V7PA 5IDXA 4FCCA 1E7SA 3AUTA 2NSDA 3QIVA 3G17A 2Y93A 4XR9A 4JJIA 1IYZA 3OIFA 5TS3A 2BGMA 4J4HA 2V6MA 3IP1A 1PR9A 3JYNA 1NQ5A 3BMOB 3O38A 4PLGA 1SCUA 2E49A 4ZQBA 1Q7CA 3HJAA 4NJMB 2WJPA 3MZ0A 3TZ6A 4YAIA 5CFZA 5JDIC 3DAFA 4JNKA 3ZU4A 3JQGB 8ADHA 5JO9A 1SBYA 3MWEB 4JBHA 2YV1A 1QP8A 4AJLA 2GNAA 1UJMA 5EQFA 2G5CA 4A27A 2BGKA 4PRLA 1WPQA 1ZH8A 3I9LA 2NVUB 3V5NA 2PR2A 3HDJA 1GZ3A 3AJRA 4GAEA 5A4DA 5JAZA 3WWZA 3IL2A 1LJ8A 3CTMA 4IXWA 3TFQA 4IM7A 1MC5A 4XQGA 4D3FA 3H9GA 1LI4A 4PGFA 4I5GA 4R51A 3RJ9A 3PJGA 2GASA 3NAQA 3H5AA 4WNIA 1NAIA 1YXMA 4PG5A 3UICA 2PWZA 4BO1A 1T2CA 4AJPA 4XJTA 1T2DA 1ZIDA 4ITUA 4PLYA 3IKVA 3UN1A 4NBTA 3W4KA 1IB6A 1Z45A 1VRWA 3AY3A 2FZEA 4ZQEA 2GN4A 3ICPA 1X7DA 3I4CA 4B7UA 3A14A 1U5CA 3OECA 2D1YA 2D3TA 3C7AA 3JQEA 5A1TA 1MX3A 1WXDA 2CF6A 2P4QA 1B3BA 4P38A 3TOZA 3SXPA 1NX6A 3VVBA 4YJHA 4J7CA 1EVJA 1PJ3A 2VZ0A 4J1NA 3FBTA 1C0PA 2B35A 4S1VA 4PZDA 2X5KO 3PLNA 3Q2KA 3I52A 4LCEA 4PVCA 3NX4A 3WYCA 2PGLA 4KQWA 1E1LA 1E5LA 1P0CA 4CR6A 1LDGA 1LC0A 3RFVA 1B8PA 1PX0A 1U3TA 1PS9A 4DL9A 1IOLA 1EBUA 1UAYA 4L4XA 1ISJA 4O63O 3RC9A 1U7TA 1PQWA 1V6AA 2AMFA 3AI2A 3DL2A 3TZHA 4BGVA 2BD0A 3C1TA 3GA0A 3WQRA 1DSSG 4GPD1 3KO8A 4B7CA 1I3KA 4HNGA 2PNFA 2GN6A 2O2SA 3DEYX 1YQXA 3MJCA 2O3RA 4YTEA 2RCYA 3SJUA 3T4EA 4UVDA 3TPCA 1JW9B 1JWBB 3G49A 3FNHA 2GN9A 4OAQA 4XZ3A 3GGPA 1W73A 2Z1MA 1I0ZA 3H7AA 5A02A 2EG9A 5BSFA 5JW6A 4B4UA 4ZN6A 3GZ4A 1ADGA 1QYCA 3E03A 4CV0A 2JCXA 4QUKA 1DHTA 4LISA 4WCFB 4R68A 1B7GO 1ADCA 4ZU3A 5HTOA 2X9GA 5AVOA 4MVJE 2A92A 4LW8A 4YAKA 3WB9A 2X0RA 4RQUA 4ONEA 1WW8A 3WSWA 3KB6A 4ALJA 1S7CA 4OSPA 1X7HA 2YHIB 3IIEA 3H9QA 2PKQP 3ZDFA 4DQUA 3AY6A 1PGPA 3ZW9A 2GZ1A 5A9SB 1ZJZA 3RUDA 2RHRA 1C1DA 2OBYA 2W2LD 5G2OA 1SOWA 4JJFA 3GN2A 2Q49A 4BV9A 2DFDA 1PS8A 1QMGA 2C59A 3FF4A 4U0JA 1ZEJA 1YE3A 3OJEA 3GNSA 4LVUA 2C0CA 4CLDA 1PJLA 1C0KA 4G2NA 1ZXLA 3F3SA 1HF3A 1N2SA 2F1KA 3QV1A 1M76A 5C5IA 1O95A 1Z74A 2CSUA 3CZMA 3PQFA 4Z0PA 4BMNA 4NHEA 2PD3A 1GTMA 3OJOA 1W4ZA 3AM5A 4BNJA 2AG5A 2J5KA 3DZFA 1E3SA 5HM8A 2R00A 1YO6A 2P5UA 3K2EA 3DHEA 2ZTLA 3AUSA 4ZICA 1QLJA 1I3LA 3L9WA 1XEAA 2HK9A 4R1UA 2NQTA 3COSA 4IDEA 1FF9A 1ADFA 2GZ2A 4E30A 2OP0A 3GDGA 5COAA 4ZRMA 4EYEA 4L73A 1LDMA 1Y5MA 3OA0A 2C5AA 1H0KA 1AE1A 5DBGA 4BV8A 2D5AA 3BHMA 2P68A 3GAZA 2EF1A 4CODB 3DXFA 4BO9A 2RHCA 2X5JO 3GEMA 4UEJA 3I6IA 4RF4A 4XQCA 1UUFA 4PG6A 1ARZA 5THKA 5B4TA 5I9NA 1BSVA 3E18A 1IUKA 3QWHA 1C0LA 4DIBA 5B1YA 4Z3KA 1Q7BA 5C7OO 2CNBA 1O9BA 3D7LA 4ALIA 1E7RA 4NFHA 4WOJA 2D2IA 3BTUA 3LT4A 3U4IA 4MVJI 1U2GA 5JDCA 4YJFA 1PL8A 2AXQA 4TWRA 1O94A 3LC2O 1GQYA 3D3EA 2EERA 4QQRA 4BNLA 3QHAA 1GADO 3EYWA 4CMIB 3NUGA 1BGVA 4L4SA 3RC7A 4BNZA 4BHTA 5KJFA 5EMHA 3WQSB 1U8FO 4RO0A 5EERA 4DVJA 1H6CA 2OBNA 1E6WA 1OMOA 3RC1A 1K3TA 3OA2A 3FR8A 2ZCUA 1NP3A 2Y99A 1EUZA 3C3XA 2Z95A 1YQDA 4UEKA 1NASA 3VPSA 1T25A 2E82A 4HFNA 4OYRA 4XDZA 5JCJD 5ITVA 1WDKA 2O3UA 2B5WA 4RVUA 3GUYA 1P44A 3ZWWA 2EKQA 2BFOA 3DZHA 2P9GA 4J6FA 2O48X 1E0DA 3V2UA 4CMAA 3EDMA 3E9NA 4ZQGA 2Q1UA 2PFGA 2WTBA 3D5TA 1LA2A 1AN9A 3BYZA 2QIOA 1YB5A 2NWQA 3JTMA 4BNHA 4BO4A 5KVSA 2D0IA 2NVBA 4K9DA 4PRKA 4YJGA 1UDBA 1PQPA 1GY8A 5CPFA 3VKUA 2OP1A 5JCJA 3MOIA 1MXFA 4NG5A 3U4CA 3H4VA 1PJBA 1R15A 3WQQA 2Q2WA 3C1AA 2HO5A 2E37A 4BGEA 3ZNNA 5ENVA 3DBLB 1JQBA 2Q50A 4Y8VA 1PIWA 2BI7A 4Z6KA 2DQ4A 1Y5RA 4AICA 4BB6A 5CDGA 3GVXA 4F46A 4UUPA 3VH2A 4KZPA 4O6VA 3UUWA 3WNVA 1XHLA 1SB8A 2HSDA 4RVGA 3WGZA 3LDHA 1D3AA 3KRTA 1ONNA 2I66A 4YJFB 5A06A 3EUWA 4LSWA 2GERA 3H9JA 2UYYA 3IP3A 4XDYA 4KP7A 4J90A 1LRJA 1YL5A 2VWPA 4KUGA 4LN1A 1PJQA 1H9AA 1GCUA 5H81A 4YXFA 1D8AA 2QHXA 1P74A 2I76A 3DFUA 1K6JA 3VH4A 4D44A 5G4KA 1Y8QB 4CM4B 5FEUA 4FBGA 2XXJA 4RVHA 5L95A 1OC2A 4J4TA 2CDCA 2E6UX 4WLFA 3R3JA 4K1LA 1E1MA 1P0FA 1P3DA 2FR1A 3LC1O 2FRDA 3ONDA 4TRMA 3GLQA 3C7CB 3P2YA 2HLPA 3DWFA 1E1NA 2O7QA 2V6FA 3WFIA 2TMDA 3EGOA 5AYVA 3I4FA 3DTYA 3EHEA 4FN4A 3DQPA 4M8SA 5JE8A 2JFGA 2Q46A 3Q6IA 3WICA 1P31A 2EWMA 2VQ3A 3FNGA 1CETA 2IXAA 1PGJA 3ON5A 4NDNE 4Y6RA 4PG8A 4YT2A 1XG5A 3H6KA 4C7KA 3FTPA 1EUDA 2NVWA 4M1QA 5CHEA 1PR3A 4R69A 3BHIA 3JQ9A 1ML3A 1LDYA 1HYHA 1QYVA 3QQPA 3E48A 5ILGA 1ZUD1 4ZJUA 1DB3A 3RKRA 3N7UA 1PZGA 1HYGA 3VZSA 2B4RO 1O0SA 4E2ZA 2GZ3A 1JLLA 3GG9A 4B7XA 3JYPA 1C3VA 5T67A 3JYLA 4IDFA 1G0OA 3U62A 5B12A 3LF2A 5IDQA 3F9IA 1M6WA 1KIFA 1YKFA 1PJ4A 3TQHA 1QSGA 1RM4A 1SAYA 2IZ0A 5H82A 2IEDA 1DC3A 3S2IA 4JN6B 1I10A 2C29D 4D0SA 3O8QB 3K2BA 1EFLA 1SB9A 4FR5A 4YEDA 3VVCA 1ISMA 1VL8A 2WDZA 1NXQA 3V2GA 3GEGA 5KKAA 2BHLA 3GNTA 1KS9A 4MVJD 4OO3A 3RUFA 5I7VA 4RVDA 2Q1WA 2X22A 2E48A 3VHRA 2JFHA 3Q3CA 3B6ZA 4J49A 1CIVA 3SVTA 3L4SO 4KUEA 4FFOA 4WCDA 1AGNA 2BFPA 1JN0A 2EKPA 1PL7A 2OHXA 4IDDA 4MJLA 5KJ1A 3C85A 2IEBA 4FC7A 2VRCA 5KKCA 3JD2A 2PTGA 3KEQA 4ZQHA 3DFZA 4E5NA 3WGIA 4GSLA 4R41A 1FDTA 2X86A 1PWZA 2X6TA 3ADPA 1HDRA 4BNYA 4U0KA 3ANMA 2VHXA 1LTHR 2ZQZA 3FNEA 4ND2A 3EY4A 7MDHA 3GC6A 3IOYA 1NBOA 3BZUA 4GX0A 4R1TA 4YBZA 4IJVA 5IDYA 4FJ0A 4A03A 1AXEA 4F45A 4XYEA 2ZATA 1UP7A 3OH8A 4NMHA 3KM0A 3HDYA 1MC4A 3I6QA 2X0NA 3GFGA 3HFGA 3OBBA 4KMSA 4FGWA 3PWZA 3E82A 3D1LA 5TJ9A 3EAGA 3PEFA 4GSKA 3RAJA 2I67A 2VTEA 2D4AA 1I2CA 4BO8A 1NQTA 4FC6A 1ZMTA 2EW8A 5CP8A 4CQLA 3TDKA 3VDRA 5CEJA 2C7VA 5T8KC 1UXGA 1KERA 1E3IA 1GYRA 1Y9EA 3NKLA 2Y1GA 1SMKA 4FQ8A 2Y1DA 4HY3A 4Z9YA 1E3EA 5JDCC 1KOLA 2O3SA 3UGKA 1Q0QA 2CF5A 2DTEA 2FY8A 3BMCA 4Y67A 2FMUA 4ID9A 3IUPA 4ND4A 1UAGA 4RVFA 1K0UA 1QV7A 4AJOA 5GZ3A 3GVCA 2X4GA 5JNLA 3DMYA 1RJWA 3T7CA 4RDHA 1YS4A 2X58A 4DYDA 1HT0A 3JQBA 4U6SA 2NVUA 4JROA 2AA3A 5JY6A 2C2XA 2VYVA 1NM5A 1NVTA 3K96A 5JC1A 1KVTA 1WWKA 1T24A 2Z5LA 1DAPA 3PRJA 3QWIA 4OH1A 4R16A 5F5LA 3VZRA 4DWVA 3D4OA 4YT4A 2B0JA 4I5FA 4DLBA 3DOCA 4QECA 4DBVO 3DBRB 1PJ2A 2Q4EA 3GN1A 3ZGYA 4BNIA 4N5NA 4CL8A 3RFTA 4FGSA 3OSUA 1V3VA 5JXWA 3OIGA 2C54A 3H5RA 1T2EA 2QRKA 3WGGA 2AEJA 5JBIA 3UF0A 5TT0A 1BTOA 4MVJM 4EITA 3PHHA 1LSJA 3F5SA 5EJ2A 3VOSA 1X7GA 3LQFA 3AK4A 1Q2XA 3GGOA 1BXZA 2IZZA 3JQ9C 1VKOA 3GHHA 4HNHA 4WK6A 4IMRA 2Q99A 4CLEA 3OJ0A 1TT5A 1ID1A 3PGXA 2X9NA 4XYLA 3VPGA 1C14A 1U28A 2Q3EA 1DAOA 3OMLA 3K30A 4HKTA 2G1UA 4XJSA 1E3JA 3M2TA 4P8RA 4PLWA 3L07A 1Z73A 3UOGA 1X15A 4NH4A 2FSVA 1H2HA 1LUAA 4D42A 4B79A 1AHHA 3INGA 1IL0A 4FOOA 4MP6A 3BMQA 3ZHYA 2NU6A 1SOVA 4OHUA 1JAYA 3D5QA 3KSUA 4OJNA 4GVLA 4UUNA 1PWXA 2ZB4A 1Q1NA 1YL6A 1VLLA 2JD1A 3RU7A 5L3ZA 3ZU3A 1Q7GA 2JD0A 4D41A 4ND3A 1R16A 1ZK4A 5TIIA 2VOEA 2VZ9A 5K6AC 4RCVA 1DXYA 3DAPA 5KWEA 4XRRA 2VCYA 4IQ8A 3WTCA 1BHSA 1H2BA 4XB2A 3TN7A 3QWFA 1CDOA 1L7EA 2X5OA 2OMEA 4CM1A 4DPKA 4KWHA 4CLOB 4MKXA 4WKGA 1V8BA 2I5PO 2WYWA 2V6GA 2JKVA 1ISGA 3MJEA 4CMCA 4DUPA 1ENOA 2FOIA 3ONFA 1HE4A 3WMWA 1TT7A 3I9NA 4LRTB 4YRDA 3WDSA 3PTZA 1YONA 4WLOA 2BELA 4WJZA 1BXGB 3ZWXA 3L77A 4OM8A 4H3VA 4E2XA 1DFHA 1E7YA 3E6AA 3EW7A 3TRIA 1R66A 2O23A 3PJDA 4K26A 5JPIA 3WNQA 3JQAA 1DIRA 2HUNA 4I9UA 3NDRA 3OP4A 5G0UA 3E5MA 3O26A 1N5DA 4WNCA 1NNUA 2ZTVA 5FI3A 2EHDA 4E13A 1BDMA 5KJCA 2JHGA 4II3A 5DCYA 1ZMOA 4MVJA 1MFZA 3B70A 2R2GA 4CQMB 2BFAA 4IGEA 5COBA 5JYDA 1N92A 1JVSA 1L1FA 1HETA 2G76A 1T4DA 1N1GA 4ESOA 2W4QA 1Z7EA 4CM3A 2QYSA 4XIYA 1XQ6A 5EPOA 2NTVA 4A73A 1ZZEA 5DF1A 1GFSA 4DIOA 2EJVA 3RUHA 3DOOA 3ZU2A 1QYDA 1U3WA 5LCXA 1AXGA 4RORA 5BNIA 3EZYA 3VKVA 3H3FA 3INTA 3PQDA 4H16A 3WJ7A 1H6AA 4B4WA 2GDZA 2P4HX 4CLOA 5K9ZA 2HJRA 4CV3A 4CUJA 1RWBA 3VAZA 1KEVA 3UCXA 3HUDA 3E9MA 5DULA 5CDSA 1DJQA 5LC1A 5CG2A 3I1JA 3S2EA 1HXHA 4E5MA 3GY0A 2O3QA 2B83A 2CFCA 2X7HA 3L9XA 5ER9A 1JAXA 4Q3CA 3ZNOA 1UZLA 1DO8A 4Q39A 2PKRA 1Z75A 2DUWA 2EJWA 4I8XA 3PHGA 4ZVVA 3RIHA 1HE5A 1RYEA 3Q9UA 1UZMA 1H5QA 1MFPA 5G4KB 4DGSA 3WGOA 3JQ7A 3UXYA 1O5IA 5FI5A 5BNTA 4WGGA 4GBJA 1VM6A 2V65A 4BNMA 3DMTA 2BLLA 2QRLA 2YDYA 4J9VA 3C8MA 1B3RA 4RDIA 3MOGA 4J1TA 5DBIA 1R0KA 5KVQA 2PLAA 3T4XA 1FDWA 1HEUA 3IC5A 1IPEA 1TA4A 4IS3A 4NBRA 3TL2A 4KTVE 1LQTA 4R1SA 2IYPA 4TRRA 2ZQYA 4DMLA 3GRKA 2YDXA 2IODA 2XAAA 3VC7A 3D0OA 2ET6A 1FJHA 1R4MA 3DBLA 2AQHA 4WPGA 2D5CA 2HK8A 4E4YA 4BKOA 1UXHA 4CQMD 4JQCA 3NT4A 1E77A 1NPDA 2O4UX 4PLTA 1HRDA 4K6CA 4U6QA 1OC4A 1HE2A 3DBRA 3RC2A 3WLEA 3B1KA 1LLDA 3GVPA 3G0OA 1R12A 1YOVA 3LC7O 4BKQA 4FFPA 3AU9A 4WEQA 2JCYA 1HDGO 2D59A 2C7GA 1DC4A 3CMMA 1O6ZA 4O59O 1FDVA 1YB1A 3DO5A 2PGJA 4WLUA 4Q3BA 4MVJP 4R3NA 2AEFA 1YJ8A 3GNQA 1IULA 5BSEA 3PGJA 2I3AA 3MTJA 5LDHA 2WE7A 1B8UA 4GVXA 4HBGA 4E33A 4AFNA 1TVEA 3SEFA 3IKTA 2BI8A 1BW9A 4BQPA 2UV8A 5G0SA 3ANNA 4B3JA 5A3JA 2YY7A 3CPSA 5U9CA 3WIEA 1E5QA 1O89A 1F14A 1Z6ZA 2JL1A 5G0WA 3X2FA 4CQLB 2W8ZA 3GEDA 3AI1A 3ROPA 3ZN2A 4ND1A 2HMVA 4DQVA 2NU8A 4DYVA 3GZNB 2J5RA 1B15A 3GR6A 2AQIA 4A10A 5TGDA 5TSDA 1U4OA 4RPKA 5HS6A 3ZV6A 1B14A 1G6KA 5BNFA 4A7PA 1V3TA 1OAAA 2EP7A 2DBVO 3PVZA 4LK3A 4UULA 3AOEA 3O4RA 1E92A 2OGUA 3TL3A 4EJ6A 4EJMA 4RL6A 1LLCA 4YT8A 1EBFA 2Q45A 3I9OA 4XYBA 4TKLA 4HADA 5A5EA 1J5PA 4OXYA 2A94A 4J91A 4EW6A 5JAMA 3I83A 2EGGA 5KVVA 1NR7A 1O8CA 1ZEMA 3CXRA 4CMGA 2AEMA 4UVGA 5HRUA 4MKZA 4QX6A 4NBUA 2Y66A 4RLHA 4GWGA 2CD9A 1P45A 1E3WA 3FWNA 4WLVA 3WWYA 3GMSA 6ADHA 4NNJA 3JQDA 1KETA 2BFMA 1E7MA 1TI7A 3LT2A 2A9FA 3B1FA 1LRLA 3DTTA 3U3XA 3EVNA 5TF4A 3DMTC 2NTNA 1F0YA 1PU2A 1I3NA 2CUKA 4OKIA 1M6HA 3AM4A 3GRPA 4GQAA 1C1DB 1E7WA 3KBOA 4JXKA 3UCEA 1SEPA 1I33A 5IG2A 3S2FA 3F6YA 4BS9A 3AFMA 4M87A 4W9NC 3RBZA 3QP9A 1GQ2A 1YL7A 2HCTA 4BO6A 4CJXA 2H6EA 2X0IA 3FTNA 4WEOA 3SC4A 4XIJA 3G79A 1E3LA 1P33A 4NZ9A 1EUCA 3JYQA 5AXBA 2I9PA 1HDOA 4ALKA 3JQBC 4PG7A 4EZBA 3PPIA 3VZQA 1BWSA 1LDNA 4M54A 1QYXA 4S3MA 1E3WB 1Z82A 5ENDA 3WGQA 2FPGA 4IDCA 5A3VA 2VHVA 4R5MA 5G0VA 2FPIA 3DR3A 4AVYA 1L7DA 1GUFA 3VTFA 1PTJA 3ITDA 4YJDA 4XGNA 4XEHA 1BXKA 1K89A 3GDOA 1G1AA 1V9LA 3H2ZA 4L8VA 4E21A 5AQ1A 4CV1A 3VH1A 1GV1A 2PH5A 1KEUA 4RPGA 2PZMA 2G0TA 3GVIA 1IZ0A 1ONOA 3OF2A 1T2FA 4GH5A 1P77A 3WBFA 4B3HA 3M1AA 1H6DA 3CH6A 2DC1A 3DHYA 1I32A 5AXAA 4BO0A 1A4IA 2HJSA 3PHLA 3H2SA 3LSYA 4QXMA 5COQA 1EK6A 5DBFA 4BVAA 3FCOA 3OFSA 4L75A 4CLXA 2WE8A 4RF3A 3H3JA 2J3IA 4J0EA 2B69A 1DEHA 3KEOA 3OM9A 4P4NA 4PN3A 3VTZA 1Y8QA 4CM4A 4BO3A 1V0JA 1X13A 1JDJA 3PDUA 5IZ4A 1BVRA 2IYOA 1XU9A 2VOJA 3HSKA 3WYEA 1C0IA 2YFQA 4N54A 3ZWBA 4CMKA 3WS7A 2QYTA 2VTDA 3WGHA 3GFBA 2AG8A 4YAJA 3P2OA 3TOXA 1M66A 3QVWA 2BH9A 4BO7A 4DRYA 3I3OA 4E5PA 4DLAA 4PLCA 3UW3A 2ZYDA 4B4VA 1BW9B 4BQRA 2BGLA 4LVCA 1H9BA 2X9VA 1BVUA 2WSBA 3MJSA 4R4JA 1JTVA 4H7PA 4HP8A 3HQ4O 1DOHA 2H9IA 1PGNA 3I23A 1RPNA 4ALNA 5CPBA 1CRWG 5TNXA 3MCVA 1ZK2A 4J7UA 4CM7A 2Q1SA 3QWAA 4MVJH 1QRRA 4HFJA 4NFYA 2VUTA 3ANLA 1GAEO 3JQCA 2ZK7A 4YJGB 2DPGA 2Y1EA 5IZCC 4ND5A 9LDBA 1U5AA 4L0QA 4X54A 4HV4A 4FS3A 4WASA 3PWSA 4K6FA 1XQ1A 1JU9A 1YOVB 2C20A 3IJPA 3IS3A 3JV7A 3SBOA 1KY5A 2JAHA 3JQGA 2DKNA 3W8EA 3M1LA 3GT0A 1LX6A 1EK5A 5F21A 3A28A 3L4BA 4BB5A 1J0XO 2B5VA 1P1HA 4EEXA 4KQXA 3NDIA 3L4BC 3KXDA 4I1IA 1KY4A 3SC6A 3G1TA 3GHYA 2ILTA 1ENPA 2HMUA 1EE2A 1VJ0A 3IMFA 4RJTA 3KUXA 2PK3A 4L74A 4MOWA 3U4HA 2DFVA 3W6UA 4Q3NA 5IFLA 1GR0A 1P1JA 1PJSA 4BNNA 4TZKA 3QWBA 2VT3A 5C7IO 4J0FA 5GY7A 5EL0A 3I9JA 4CMIA 2F00A 3WFJA 1NWHA 3VPFA 4L9RA 5I7SA 4OGWA 2PA3A 2ZYGA 1YBMA 2CDAA 4MVJG 2VNSA 5TX7A 3TZQA 4DTIA 4M89A 1DBVO 2J3JA 2VHZA 4BL5A 3G3EA 2Q1TA 4U8GA 4ALMA 1RKXA 3W4IA 3F5QA 4XCVA 2DBZA 2Y1CA 2ZCVA 4RQTA 4XR4A 4TRNA 4FSHA 4MO2A 4AJHA 3A4VA 3INRA 2J3KA 2RBEA 3L6DA 3RKUA 3IAHA 3WBBA 2FWMX 3ZI0A 4OQZA 4E2YA 2O3JA 5KNLA 3ETGA 1E6UA 3V1UA 2EIHA 3DB2A 1EDZA 4D0RA 3TZKA 3D3WA 1CF2O 5DP1A 1GYQA 3OICA 4LRSB 1ENZA 3O9ZA 3FR7A 2DAPA 4OQYA 4E12A 4G81A 4IINA 1M2WA 3HE3A 1SZJG 4H15A 1U2DA 1Z7BA 3C24A 3ZWMA 3ASUA 3ETEA 3GPIA 1R6DA 1HDCA 1NQAO 3E1KA 5DOZA 4Z9FA 3ABIA 3CE6A 4Z3DA 2RH4A 5T57A 4IZHA 1QV6A 4R5HA 1KVQA 2AQKA 3BTVA 5L9AA 1W0CA 4NJOA 4Y9DA 4RPHA 1XSEA 4CM8A 4GLLA 1TB4A 2GF2A 8LDHA 1KC1A 2JD2A 4FFNA 3ZCXA 3HHPA 1X1EA 4IDGA 1M75A 1UDAA 4GMFA 1MA0A 4FB5A 2VRCD 4R9SA 1N7HA 4PG4A 3AFNA 5CDTA 4YDRA 4N5MA 3ITKA 3IUSA 1I24A 4BNKA 5A04A 3OEWA 4D43A 3JD1A 5C3MA 1UXJA 4CM6A 4Y6PA 5F5NA 3RASA 1B8VA 1DFIA 1LBEA 3I9KA 2LDBA 4TMFA 3JQAB 3BHJA 4RZHA 1ZSYA 3ENKA 3ZWVA 4YWJA 1W8DA 3QVOA 3EVTA 4HX5A 5BSHA 3RFXA 3BMNA 3NT2A 5BQFA 2A4KA 4FOSA 2CVZA 3GPDG 2B4QA 1BXGA 3PZBA 2ZTMA 1SC6A 3KZVA 3CMCO 5KOIA 3KYBA 3QE3A 2SCUA 1R37A 1XIVA 1PZEA 5TT1A 1AUPA 1ULSA 2HKIA 1A27A 4UUOA 3PYLA 1B26A 4J1QA 4YT5A 4XQ9A 3NDJA 1ZO8A 2WD8A 2HDHA 3DZGA 4GLOA 4GX5A 2NV6A 4DMMA 2GD1O 2YV3A 3VH3A 2IRWA 4P4GA 3ZHXA 3P19A 4CPDA 3AOGA 1U1IA 2P2SA 4XGKA 2OZPA 4URFA 2XPCA 3V2HA 1HWYA 4XKJA 2NU9A 1LU9A 2GCGA 1ZJYA 2ZIZA 4IUYA 3K5PA 4MPDA 2Y0EA 1BRMA 4UAGA 1NFFA 1EMDA 4Z0TA 5JLAA 5CEEA 4BKPA 3HB4X 1XA0A 1NVGA 1WDLA 4FJ2A 4GL4A 4JCOA 4JP2A 4IJWA 1LQUA 2VYVD 4WOKA 3U5TA 4YJHB 4OOFA 1DRWA 4E3ZA 5JO0A 4BNWA 3FN4A 3RBXA 2I3GA 4J16A 1V35A 2W2LA 4BMSA 1DDOA 2A35A 1CJCA 2CMDA 4ZGWA 2OL4A 4AJ1A 2Q2QA 4IJKA 3PJFA 3L6EA 4OSOA 1UZNA 4RZIA 3F4LA 2G82A 2H1SA 5EIOA 3QSGA 5I9MA 1NQOA 5JC8A 1TT5B 2JFFA 2ZB8A 4IDBA 3NGXA 3TNLA 5BR7A 5A05A 3GVHA 3STHA 1I01A 1ORRA 2R00C 2WMDA 5I8WA 3N74A 1OOEA 1G0NA 2B37A 2QRJA 1N1EA 1WLYA 1KYQA 3S55A 3KETA 5LDGA 1T1RA 2NACA 2NLOA 4LCJA 3ADOA 3RVDA 1VKNA 1DJNA 2ZYAA 4CR8A 3DBHA 4NIMA 3HN2A 1VC2A 2FZWA 4LSMA 2FHSA 1MXHA 1TXGA 2DPHA 4GI2A 2AW5A 2UAGA 3PHJA 1F12A 1XU7A 3S1LA 1UXIA 3LT0A 3W8FA 2EKLA 2W90A 3KVOA 3DZBA 5AOVA 1YGYA 4QEDA 1YRLA 4ZRNA 3RUIA 3AI3A 4W7HA 3EZLA 1DRUA 2YYYA 3V1YA 1DHRA 3HN7A 4W7IA 4UVHA 5T6BA 4PZCA 3VZPA 3BA1A 3QVXA 4ZA2A 5I9LA 1KVRA 3KHUA 3PYXA 3ZNQA 4JP3A 3RUCA 2YJZA 5A5FA 1K6XA 1IZ9A 1Y9AA 4XQEA 5CAEA 4YAGA 4YVFA 3BMCB 5K1SA 1VI2A 2G17A 4TKMA 2DUUA 4IGFA 1ZSVA 2AQ8A 1ISIA 3OQ6A 3LLVA 3ZWCA 4PIVA 1NPTO 3TFOA 1WAMA 4DBZA 1KBZA 4BUCA 1GYPA 2H5LA 1KVUA 2BMAA 1XLTA 4AJIA 3Q11A 1QORA 2GUGA 2V6BA 1F17A 3SJ7A 1B2LA 3AM3A 3ZWNA 1PS0A 2WYUA 4NR0A 4AJKA 4OXNA 3A9WA 4J2HA 1LDBA 4E5YA 3FPCA 1HTBA 5IJZA 2LDXA 3NTOA 2VHWA 5BT9A 1QKIA 3DZKA 4UVEA 9LDTA 1HL3A 1HDZA 2YHUA 3ROKA 5KJEA 4NK4A 3M6IA 3IDSA 4N5LA 1RM3A 2VN8A 5L4NA 1DPGA 4A2CA 1VPDA 3QY9A 4M49A 3NJ4A 5L53A 2J3HA 2ZJ0A 4QFCA 5DN9A 2WEKA 1NVMB 5KTKA 3U09A 4BO2A 3PFWO 4CMJA 1CQJA 4U5QA 5GZ6A 2JAPA 3LU1A 5JAQA 4CUZA 2EGHA 3UFXA 1M67A 3WG9A 1QLHA 4NK5A 5GZ1A 3ZHBA 5F1KA 4BIIA 1VSUA 2HMSA 1ULUA 3FI9A 4TZTA 4D46A 3JQFC 3NJ8A 2OUIA 4BKUA 5A9TA 2FPPA 1WZEA 5C37A 2HMWA 1GPDG 1N8KA 4KTTE 3K6JA 4CV2A 1U4SA 3ENNA 4J3FA 1UP4A 3VPHA 1WVGA 4IDAA 2VUSA 5L7YA 3AWDA 4P4LA 3KYDA 1EVIA 5IN4A 4QO7A 3BMNB 2DVMA 4INAA 1ISFA 4M86A 4IJUA 2P9EA 4Z0HO 4FPXA 3O8QA 3Q9NA 4BGUA 2YW9A 3UAGA 2HMTA 2ZTUA 1DIGA 1YVEI 3A1NA 1J6UA 1Y1PA 1ZCJA 2ZB3A 3ROMA 3BXXA 4E32A 2DM6A 3H9UA 4U7WA 1W6UA 4GGPA 5JY1A 3HDQA 1GL3A 4RF5A 3IJRA 4JJGA 4CM5A 2D8AA 1A7KA 4ZD6A 2XOXA 1NR1A 4YCAA 5DT9A 2H63A 5ICMA 5JDIA 1XKQA 1TLTA 4AL4A 1EE9A 3QW2A 3R1IA 2O4CA 3OETA 1I3MA 4PLFA 4R54A 1D7OA 1NWCA 2GR9A 1KVSA 4FD3A 4Z9XA 5L40A 4CR7A 4ILKA 5I8ZA 4CM8B 3CUKA 4C4OA 2AE1A 3QVSA 2X1HA 4O5OA 4IQ0A 2VZ8A 4EGFA 1D1SA 2DTDA 5IXSA 4WE3A 3MTGA 2OXIA 1A71A 4PFJA 3L6OO 4YA6A 3ZU5A 1GEEA 3ROQA 5L7WA 5L4LA 1YB4A 1U8XX 3S2GA 5A03A 3ST7A 2RIRA 1SPXA 1EQ2A 1R4NA 3HWRA 5ITWA 4F3YA 3UH1A 3JSAA 1BMDA 1NAHA 3PWKA 3RSHA 4ZHSA 5ILOA 2HRBA 2I65A 3OQBA 3JQ6A 4XD2A 4I9NA 1U7HA 4GKBA 3D3WB 5AXDA 3PDJA 4IIUA 1DIHA 1CERA 4W6ZA 4WUVA 3QVTA 5THQA 5L4SA 1Q0HA 4KOAA 4EUEA 1T1SA 3B20A 3ZWPA 1XWFA 2VYND 1VSVA 3JYOA 3HNPA 3DZIA 1IHXA 3JCZA 4AJ4A 2BKAA 3AW9A 4GKVA 1CQIA 4I5EA 2NUAA 2UVDA 4JIGA 1YWGO 5G4LA 2PZLA 3DDNA 1CWUA 2Q4BA 4QO8A 3NV9A 2GPTA 3DONA 1FK8A 1ZBQA 4JK3A 3W1VA 4NPCA 3UCFA 4J7XA 2YV2A 1E7QA 5AXCA 5TJHA 2ZKLA 2O3TA 3RUAA 2QZ9A 4CUKA 3K9QO 1ENYA 1LLQA 4DA9A 5GMOA 3FD8A 3ZV4A 3ZV3A 4IXTA 4HWKA 1VL0A 4QFDA 3BAZA 4IIVA 1RYDA 1RM5A 3PQEA 4Y98A 2YFHA 1Y8RB 1F06A 4HFRA 3CSDA 4XX0A 4HUJA 1J49A 1UR5A 4G5HA 1H94A 5JYEA 4F6LA 1WMBA 1WNTA 2Y67A 4JBGA 4CL3A 1ADBA 1JVBA 4C7JA 1YDEA 2DU8A 1C1XA 4WECA 3V1TC 4W99A 3F46A 1X14A 3F1KA 3C1OA 2P5YA 3LVFO 3PJEA 4PLPA 4JBIA 4EI2A 5B4UA 3HG7A 3LYLA 3WX0A 3HFSA 1H6BA 1P1RA 2BRUA 4KDFA 3I5MA 5TRTA 5HBRA 4XYGA 1OI7A 3NTRA 2PZJA 4IS2A 1X0XA 2CZCA 3SX2A 1R0SA 1I2BA 4MIYA 2J6IA 3IQDB 4IQGA 3X2EA 4CLRB 1BG6A 3H8VA 5B4VA 4MINA 4MIEA 2PD6A 4KDEA 3JQFA 3MEQA 1CYDA 4BNFA 1A5ZA 1GZ4A 1HZJA 5KVCA 3KTDA 1LXCA 3KSDO 3KLPX 1GUYA 1IPFA 1MP0A 4B3IA 4CM9D 1NFQA 2VWHA 1XYGA 3FWZA 3JD0A 3WXBA 1ZVMA 1N7GA 4W9NA 4RLSA 2C2YA 1ZKMA 1VJTA 4LGVA 2JHFA 1MB4A 4B8WA 3WR5A 3Q0EA 4BNTA 3P7MA 3CZRA 3GQVA 3OHSX 5IN5A 3BTSA 2W2KA 3RCBA 4G65A 3H65A 5KIAA 1E1KA 1MV8A 4EUHA 2R6JA 3NRCA 2Y0DA 1Y6JA 1A72A 1PZHA 1UP6A 1I30A 3GH3A 2JCVA 2VYNA 1P1IA 1WMAA 3GGGA 4IPTA 5L7TA 5HA5A 3NT5A 5DP2A 5T8KA 2OORA 4CLHA 2DTXA 3V8BA 5F1OA 1ZSNA 3P5SA 1HKUA 2Y1FA 2VWQA 4PCVA 4BNXA 3CKYA 4E6PA 4R1NA 7ADHA 3RI3A 3AU8A 2HRZA 5U4QA 4CMHA 1T26A 2X8LA 3PIDA 3EC7A 4BO5A 3GG2A 3ICCA 4B8ZA 1XR3A 1EQUA 2XXBA 4I08A 5DZSA 1I36A 1GD1O 1YBVA 1F8GA 1NFRA 4E5KA 2IXBA 1LSSA 3BIOA 2PZKA 4R01A 1U3UA 3DHNA 3OJLA 4RV9A 2Y1OA 3F4BA 2B4TO 4YQYA 1DC6A 1NHGA 4NU5A 2J5QA 3HDHA 4WLNA 1P1KA 1KEPA 3GF4A 3TF5A 3JQ8B 1KEWA 4I9HA 2HU2A 3DC2A 2C5EA 2UDPA 4J1SA 2OOSA 3A06A 4NFSA 4F6CA 1OZAA 2NTJA 4TVOA 3UHAA 1A9YA 3NEPX 4HXYA 3AUUA 5B37A 3UVEA 3PYMA 4Q3DA 4O0LA 1K2WA 4FIZA 3KOUA 4GX2A 4QTZA 1FDSA 5JAIA 3FRJA 5G0TA 5DNAA 5KCZA 5A9SA 2FSSA 1WDMA 4NBVA 3OQ1A 2UUOA 2QG4A 2WD7B 1XELA 2RH8A 2YHIA 2O2YA 3FPLA 3RQSA 6LDHA 2YZ7A 4DQXA 2DBRA 4CMBA 5ICSA 2WD7A 2OFPA 4YRBA 5C7LO 3OEYA 3TJRA 1GV0A 1DLIA 3NTQA 1S6YA 2GLXA 3F47A 3H9EO 1PSDA 1I5RA 4Q3EA 4W82A 4DXHA 4WCFA 5T64A 2TMGA 1EVYA 4GMGA 3KV3O 2UUPA 1U3VA 3FBGA 1BDBA 4A5OA 5ER6A 4D45A 1PQUA 4J2OA 1QR6A 1Y81A 5TC4A 4UEOA 1EZ4A 4XRGA 3U0BA 3JQ8A 3WJAA 3ZHZA 2GRAA 1HYEA 3CIFA 5K6AA 1F8FA 5IDWA 1DFGA 4MIOA 3E8XA 3W6ZA 3PFFA 3HADA 5CG1A 1UH5A 1X0VA 4OIMA 4AG3A 2Y05A 5ADHA 1NYTA 4PZEA 3RBVA 3NYWA 1V3UA 2PD4A 3K31A 1FXSA 4UREA 5T5QA 3OJFA 2X0JA 4JLWA 4LMRA 5IXYA 4ALLA 2GO1A 4NBWA 3EMKA 1NTOA 4J43A 5HWSA 5MDHA 3LK7A 3FHLA 1PEDA 1JA9A 3QA9A 4KUHA 2BF7A 2FN7A 3ZZNA 4EJ0A 5BSGA 3GZNA 4N7RA 4YRAA 2QX7A 4GGOA 4DC0A 4YPOA 4E31A 3RJ5A 4J4BA 2W2KB 3KSZO 4K28A 1HLDA 3WYBA 2WYVA 1X1TA 1MG5A 3ZW8A 4FJ1A 1K5HA 4RVSA 3C7DB 2HK7A 1QG6A 3PP8A 3ZH2A 2FR8A 3DZJA 4UVIA 4Y6SA 3VDQA 1PZFA 1Y7TA 1DRVA 1ZK3A 2NNLD 4LMPA 4XB1A 4A26A 4RPJA 4FDAA 4CLRA 5DDIP 1J4AA 3E5RA 5JSFA 1QXSA 2I6TA 1LSUA 2EXXA 1LDEA 2YQ4A 4BNGA 5A9RA 2PV7A 5JCXA 4GX1A 5IF3A 2IE0A 2Q2VA 4Q3AA 1GQQA 1U9JA 1PJTA 1P1FA 4RPLA 5FF9A 4EBFA 1D1TA 1DLJA 1K6IA 1PGOA 1GUZA 2VRBA 4OMUA 2C82A 2VWGA 2GSDA 1WZIA 4YYZA 1UXKA 1SNYA 3RWBA 1VE9A 3WIDA 3GAFA 2Z1NA 5F3RA 4BNUA 1ZK1A 2B36A 1C1XB 2GGSA 3N58A 1JKJA 3Q2IA 4TQGA 3TWOA 1A9ZA 4NJMA 4GWKA 1PJCA 3RROA 3DBVO 4D7AA 3DBHB 4QT0A 3BMOA 4BNVA 1LEHA 3LZ6A 3HZZA 4FW8A 4MDHA 1ISHA 4XYMA 4L4RA 1Y8RA 3U4DA 3U9LA 1JKIA 1P9LA 1R4MB 2WWRA 3S8MA 4D79A 1HE3A 4CM9A 4ROSA 5DCWA 3DOJA 2O50A 1DIAA 4NU6A 1LNQA 4AJJA 3M2PA 4MP8A 4B4OA 1Q0LA 2FR0A 3GMDA 3JQAD 4AJ2A 3K92A 3PK0A 3R3SA 2GYYA 1LC3A 1NPYA 1UDCA 4EUFA 2DT5A 4IY1A 3WTBA 2P91A 2CDBA 1YDWA 4IZIA 5FWNA 3AUAA 1DC5A 4YACA 1YJQA 3MJ4A 1I2ZA 2JJYA 3L0DA 3JQ7B 1N9GA 1YQGA 4BMVA 2ZJ1A 1FMCA 2EW2A 3KYCB 2NU7A 2DLDA 3K8ZA 1EFKA 3NGLA 1D4FA 4YR9A 2EV9A 2O7SA 4TRJA 4DIFA 1A4UA 2E4AA 2I99A 2X23A 5FFFA 1HLPA 1IE3A 4O1MA 5DCUA 1LSOA 5EESA 3ONEA 5I7EA 1GZ6A 3DAGA 3H5NA 1OFGA 5EINA 2IDZA 3R6DA 4I5DA 3PI7A 3ZNPA 3LT1A 4JGBA 4BOYA 2XF8A 4FFLA 2VUUA 3CEAA 5KJ6A 1ZW1A 3AY7A 5MGBA 3VPXA 5DOVA 1VL6A 2YQ5A 2PH3A 1R4NB 2QQ5A 1GCOA 3PXXA 4PLHA 1IHYA 3E9QA 4RGBA 5JMPA 1SO8A 1YBAA 3PIIA 4HFMA 2HQ1A 5EN4A 1TEHA 1E6EA 1OBFO 1QYWA 4WLEA 4D3SA 2AE2A 4FFRA 3SLGA 3D4PA 3PHIA 4PVDA 5H83A 1ZNQO 3Q1LA 4TVBA 1ZFNA 3ZWAA 4JX8A 3LLSA 1YH3A 2C07A 2QZZA 3BTOA 4XA8A 3MJTA 1DIBA 1LRKA 2IZ1A 1AHIA 4L76A 3KLMX 3TSCA 3QRWA 4J9UE 1B0AA 1NHWA 1RM0A 5IAAA 2NADA 1GPJA 4R9RA 1EEHA 4CQMA 4DPLA 3AOEC 3W8DA 4IBOA 3O03A 1ZK0A 4EDFA 1HZZA 4A0SA 1FDUA 1MGOA 2OO5A 1MG0A 5ES3A 1GEGA 3ETDA 2PKQO 4QSMA 5IZCA 1XGKA 4PLVA 4AJEA 1HDXA 2VHYA 1HDYA 2EP5A 2GN8A 5U1PA 5L51A 3WGTA 4DPMA 1PL6A 4YAEA 3SLKA 3I9MA 4UUMA 4DREA 1WP4A 2PGDA 3WSVA 1JKFA 1I8TA 1MUUA 2YUTA 4OXKA 3KYDB 4XGIA 4RF2A 3WGYA 5HS4A 5I7FA 3MWDB 4TROA 1XDWA 3OIDA 3RD5A
chains in the Genus database with same CATH superfamily
3OAAD 3LRTA 4DC1A 1RPTA 4PXAA 3L92A 4DUYB 2QAIA 3CISA 2XRZA 1YSCA 3AEYA 3QJ5A 3VVMA 4ZYXA 5J4VA 3GW8A 4XTRA 2WB2A 1GAXA 4RETA 2PY6A 4V03A 2R2AA 4IFBA 4LBYA 4QXOA 1KDPA 2ZIEA 5JG7A 5SY4A 1B16A 3H4MA 2A9RA 2QMOA 4AJNA 4CKBB 3ZGLA 3MOSA 1GNVA 2G72A 4JC4A 3UWOA 3VR0A 1NKTA 1YFZA 3ORFA 3NBQA 3GAMA 5DXAA 3HLYA 4D9HA 3TZCA 4DUZB 3JD4A 3FYUA 3I34X 1T5IA 3A2NA 3PLRA 4IMPA 5BW6B 5AVWA 4DA4A 3HWX1 4DCUA 2GBFA 2X7JA 5HDQA 4W7SA 2ACWA 1OI2A 5JVDB 3U49A 1E3DA 3G5LA 5A71A 4ZVTA 4MVJF 4CMEA 1GAJA 5KC9A 2XB8A 5KTYA 4D96A 2VNAA 4NI5A 2RHLA 3K0SA 4LF7B 1HURA 1Z2OX 2I1VB 1AQLA 1H93A 3FSRA 3HCOA 1NQWA 1XX6A 3M49A 4MRRA 2SHKA 3KWMA 2DF8A 1Y3AA 3CNQS 4II2A 4D4MA 3PEEA 3F1LA 2C8KA 2ODQA 1OGYA 4R3WA 2V55B 4D4LA 3M4NA 2QTVA 2ENWA 1W19A 3FGPA 3B6MA 1L7BA 2DOKA 4V0OA 2FZLA 5E4FA 4BZXA 9ABPA 3K15A 2AL7A 3NM5A 1HSZA 4LKOA 2WVGA 1I2DA 1HSOA 1TC1A 4BGIA 5CDYA 1XNGA 3G8AA 3IILA 4E7OA 2GOYA 4C3ZA 4C3UA 2WF5A 2AC7A 2YX1A 1X80A 3V4VB 4EEZA 3IT2A 1P7WA 1KY2A 2IIVA 1A8QA 2WJJA 1WPXA 4YC7A 2J8ZA 4YRZA 4OOEA 5FYQA 1K1EA 5JS6A 5BNZA 4XI9A 1N1MA 2ZB7A 4HATA 1Y4AE 4KQHA 2ZP1A 4QJ5A 4X6UA 1QDLB 5CEFA 3R8FA 3HY6A 1GDHA 2PM8A 5K8LA 3QLJA 1FBNA 4DLLA 3PGA1 3RIYA 1GU7A 3UXMA 1QANA 2NO1A 3OCCA 4L50A 3WLLA 1KMNA 4CG2A 1CEQA 4WOPA 1XD2A 1XCBA 3JALA 2V7PA 2VJBA 3AUTA 1CJVC 3ACDA 3G17A 4LHWA 3H16A 2Y93A 4XR9A 2CJXA 3OIFA 5TS3A 4AUMA 1WXIA 1YI8A 3QFFA 3NMUF 2B4AA 2UZ0A 4M7PA 521PA 1AV7A 3S0JA 2HRCA 3BMOB 1FFSA 1NIJA 2E49A 2YR0A 1FXUA 3E22B 4JODA 4ZO7A 1T4MA 1L5LA 1FJGB 3HJAA 4NJMB 2H4HA 4A9AA 2OB1A 3OZUA 1JKJB 5JDIC 1SD5A 3RVKA 4JNKA 3F6PA 2RHWA 1GTRA 2ZBRA 3L7OA 4HDNB 1RZUA 1TDJA 2BFCB 4JBHA 5KCMA 5T6MA 1NYLA 2GNAA 4DCPA 1GOTA 1PJAA 3FROA 1QS0A 2VDJA 3T61A 2BGKA 1WPQA 1ZH8A 4C22A 3EYAA 3I9LA 5L3QB 1XHEA 2F4NA 2GK6A 3VXKA 5B6PA 2F3RA 2ZJ2A 1VFNA 5CCEA 2XT9A 3AJRA 4GAEA 3K4PA 2YW2A 1F2TA 4MUXA 2ZBVA 3EPPA 4NX2A 3OEED 1JKMA 5E9AA 4ZZ2A 2P9TA 5JAZA 5L3VA 4I1PA 1OKKA 3U7HB 2A9VA 4RXMA 5E3HA 3DXYA 1MC5A 1N2EA 4IM7A 5AI8A 5LQMA 1EX6A 2HCJB 1SCQA 1GG2A 2B1QA 3FM9A 1SHKA 3CH7A 3PJGA 4M1TA 4MV7A 5JCOC 3H5AA 1L5OA 4WNIA 1AGPA 5B1SA 1N8TA 3P45A 4YYEA 2FP3A 2QV7A 4HNVA 3PLAE 4CTKA 1I9GA 2PWZA 3FOEC 1RRGA 3B36A 1T2DA 4ITUA 2VTVA 2AKYA 1IB6A 1Z45A 4EENA 4YP5A 1YUMA 2OHVA 2FZEA 4NZOA 2GN4A 1SXJD 2OQVA 3DE7X 3I8XA 5JZSA 3LLMA 1X6VA 2D3TA 3TO5A 1JE0A 2GB4A 5C1BA 4X62B 5A1TA 4MUIA 4UU7A 5IK2D 1TYCA 4LYYA 1B3BA 2QW1A 5C53B 3UMMA 4G89A 3MNFA 3SQDA 1V5FA 2FWIA 4W5QA 1USKA 4J1NA 3LDGA 4I3FA 2ZI3A 4TMKA 1A2KC 3B78A 3DJFA 5J43A 2W2VA 3VU9B 1G5FA 2X5KO 3Q2KA 2K7FA 1V41E 5AK3A 2OHOA 4LCEA 1X86B 3A9CA 1H2WA 1GPKA 1JHZA 4KQWA 4DQKA 1DKPA 1E1LA 1E5LA 3I4LA 2XA1A 1GN9A 1LC0A 4FDMA 3U4QA 5CA1F 5AJUA 1WUYA 2CCJA 4ZEVA 4REQA 1RQ7A 3ESRA 1IOLA 1FP4A 5A4AA 2VBFA 2C99A 1W85B 4G0PA 4OK6A 1V6AA 4K9MA 3AI2A 4BGVA 4DCVA 1QFJA 3OCJA 1OWLA 2GTPA 1R4AA 2B94A 3BRWA 5HE8A 3ZOKA 3IE0A 5CFRA 4LOHA 1YZQA 3P2KA 1GXSA 1VKZA 3HUTA 1WLSA 1I3KA 2IFTA 3G7SA 2O2SA 3HO1A 1YQXA 3SJUA 2XZDA 4YTEA 3T4EA 4F5EA 3COVA 1EUYA 3OPYA 3C6KA 1ORHA 3KEGA 1HDEA 3OTQA 4L6IA 4ZYTA 4RW0A 2I87A 3D59A 5FTWA 2X4IA 4BRSA 3THYB 2R62A 2Z1MA 3T3HA 5BSFA 3SX4A 1WY5A 4ZAXA 4ZN6A 3GZ4A 4CV0A 2CCGA 2JCXA 5EWLA 3QXJA 4HBZA 3STVA 1IEQA 2YCLA 2BEWB 4K05A 2X9GA 4YH1A 5EMNA 1F2UA 1GZVA 1OT3A 3QUQA 4QPZA 5DYNA 1MRZA 3L5OA 4L7QA 5H1YA 3VX3A 4L78A 5C5EA 3BWYA 3WSWA 3KB6A 4ZO6A 1HEIA 5BOSB 1SU4A 1S7CA 1TFRA 5H3HA 2HB6A 3M5WA 1S9DA 4X8HA 1MD9A 1Z5GA 1C9MA 2FPOA 5KYKA 1SPBS 2AG6A 4GLFA 1OR8A 2GZ1A 1Z13A 2PQMA 5ALLA 4NCHA 3QELB 3I0ZA 1I13A 4I1OA 2W2LD 2OBYA 3MFYA 1WMSA 3GJYA 1EFCA 1QV9A 1QF9A 5HIAA 3W2TA 3JR7A 2DFDA 3PGKA 4JA2A 3SSNA 4K6KA 1ZEJA 2KSQA 3T5MA 4LVUA 1L7VC 1Y8CA 2FCAA 3G8YA 4JT2A 4KI0A 2WIFA 1ZXLA 1OX5A 5LBTA 3W7AA 3NHLA 1KTIA 4YJ2A 1PV2A 2F1KA 1O5TA 3QV1A 1CC1S 1DO2A 2COUA 2PXAA 3R0XA 3F6BX 3O3MB 1O95A 5E3IA 1Z74A 3PQFA 3PC6A 4Q16A 3GUHA 3OJOA 1W4ZA 3IBGA 3Q0TA 4BNJA 3SN6A 5LP1A 1AMUA 2XOEA 3MRVA 1QX4A 5IH3A 2DXIA 2IW1A 2I4TA 2ZBQA 1T0HB 3OKPA 2QYOA 2ZTLA 3R5HA 1EUDB 1FPQA 1TQ6A 2R65A 4P2BA 1TJ4A 4R1UA 5EQTA 2NQTA 3JVEA 1KJNA 3IAFA 4RCZA 4FEGA 5I5GA 3TLGB 1XMQB 3AVPA 3FKJA 3TQSA 2LUOA 2P8SA 2BSQA 3VKFA 3GV0A 2W4MA 4JI2B 1IQPA 2IGBA 2MSCB 5COAA 3G89A 5HIJA 2A1IA 1E9BA 4NMLA 1Y5MA 3E3NA 3ORQA 4BX8A 5FPYA 2D5AA 3PUHA 3TIFA 2XX3A 1R27A 4GIBA 1RBZA 2ZXUA 3AZQA 1E4EA 3GLTA 3KZMA 4BO9A 4CODB 5BURA 2DPYA 1O94D 1EVEA 4G1EB 3I6IA 4FFVA 4LYFA 2G28A 1PFYA 2ZJOA 4M0EA 2AR0A 4XQCA 1ARZA 4EYKA 4P0QB 1K7YA 3DUFB 4PYMA 1C81A 4QG7A 1BSVA 3E18A 3MTQA 4XCXA 2NU8B 1SHLA 4BVKA 5B1YA 3FHCB 2RFLA 4Z3KA 5I7AA 3I1YA 4R8RA 3IVXA 5C7OO 1XTZA 1UOOA 2CLCX 2R4QA 3D7LA 1TRKA 4GP7A 1PT9A 1AA9A 1E7RA 1YZNA 1RXWA 2O0KA 3B8HA 4V0KA 4ZOLA 2X8JB 1KEZA 5E38A 4L0CA 4YJFA 5JDCA 2ZRBA 3VR4A 1AMNA 1JSZA 3GJ5A 4QQRA 2NG1A 3PNSA 4JDUA 2I3DA 1GADO 1GKYA 3EYWA 5EIFA 2MSDB 4CMIB 3GEIA 1BGVA 1R8SA 4HYYA 4YALA 3RARA 4BHTA 1NRWA 4Q4HB 3WMGA 5C8XA 1JEQA 2O5EA 3MRXA 3IQFA 2JRLA 4HVLA 3LD9A 4DVJA 2KWIA 1ZQ9A 4RZXA 4YQYA 3T0GA 3DYVA 4YGYA 4C4SA 2ZCUA 1EUZA 2GX6A 2QN9A 3C3XA 2UVQA 2WU3A 2Z95A 4BN5A 1F2VA 3LK6A 3O4VA 4DEYA 4YUXA 3HK2A 4HFNA 1C8BA 2AN4A 3Q7RA 4XDZA 4BQOA 2O8CB 1L4YA 4RVUA 2B5WA 2QLLA 4I66A 4ID3A 1GQFA 4YJ2F 5DMXA 3ZWWA 2P65A 4G0YA 2EKQA 2XNCA 3Q6NA 4HAZA 3DZHA 3SJBA 2JFZA 2P9GA 4R9UC 1V4BA 1K27A 1NA5A 2YC4C 3P9KA 1GPUA 1T8SA 3PD1A 3R4CA 1UOQA 4XGRA 1BVYF 1KI2A 2WT9A 4WNYA 3V2UA 2GAFA 3K6SB 4A0RA 3E9NA 4FMCB 5ELLA 3T7AA 3AVWA 2PFGA 3B13B 2QNIA 1XVIA 3BYZA 2IA5A 3L7BA 4AF6A 3WWPA 5I7FA 4KK3A 1I4DD 4PRKA 2NVBA 2ZBEA 3DFFA 5CPFA 1NJFA 1PQPA 4YO8A 4O2AA 4YUWA 5BVHA 3MOIA 5KB3A 4GPAA 1QIJA 2E4YA 3H4VA 1ZICA 1PJBA 4CTJA 3WQQA 5AW4A 4M99A 1NZDA 4H35A 1P2UA 5CITA 1FMJA 2Q2WA 2VP5A 2J87A 2ABWA 1YDHA 3ZNNA 5ENVA 1WUKS 5BYJA 2RGNA 4Y8VA 1PIWA 2FMIA 2DQ4A 1Z06A 1Y5RA 3LYAA 1E3TA 1UC5B 3GVXA 3HU5A 1ICIA 1EXMA 1U6KA 3X0DA 4O6VA 2J3DA 3GCDA 5HRAA 3TG2A 4P34A 2WYIA 4D9BA 4EFLA 4CU2A 4RVGA 4UXIA 1V5IA 1D3AA 1NI4B 1GA6A 4YJFB 3RF7A 4LZJA 2WLSA 2MYNA 4LSWA 3L0IB 1NT4A 4NBLA 1OFUA 2R87A 2XYVA 3L7MA 4KP7A 4B85A 1UCFA 3N2ZB 4RIFA 3VFDA 4FGUA 1T5BA 1DMRA 2DWCA 3GBSA 3BIFA 4LN1A 1M2NA 4QDJA 1H9AA 2H3EA 1GCUA 1S02A 1UJCA 2FZ5A 3AKYA 4H4CA 4MW5A 1PEYA 2QHXA 3AHDA 2JLCA 5P8WA 4DKXA 5DN6D 2RGWA 2I76A 3DFUA 1IM2A 3JW8A 4B6RA 5JSZA 2F43A 4FYXA 3IFSA 4L5YA 3IUNA 1E99A 3RVQA 2OAGA 4R31A 5L95A 2C2ZA 1TMGE 2E7ZA 1EA5A 5DO9A 4EHLA 4WLFA 2VDUE 4K1LA 3TXAA 3LBAA 3QYPA 4PN7A 2BFEB 5F4BA 1OHHD 4V3CA 3H2YA 3NBZC 4GOMD 4N6OA 3T7IA 4Y9UA 2HK6A 3Q6MA 4EHIA 3U7JA 3HCFA 1AO3A 4R3UC 2TMDA 2OPBA 4IHJF 4F6RB 1XRNA 5BUSA 4BC1A 4I46A 1A5AB 3E9ZA 4M8SA 1Z26A 5JE8A 5FL7A 2XCTB 3V6LA 4P3OA 1P31A 2XNJA 3FKSD 3K6RA 2IXAA 3TLGA 4C7KA 5LZ8A 3FTPA 3FPHA 4CW7A 1JLHA 4M1QA 5CHEA 1DVRA 1PR3A 2PLWA 3NBUA 3GLIE 3JQ9A 4I8DA 1ML3A 1HNWB 3ZGZA 1QYVA 1FLDA 1RTKA 2VP4A 3QQPA 2GHTA 2H00A 1X8XA 1Z18A 3LY9A 2O19A 2QZJA 2ZUFA 1Y4DE 2ZCJA 1L4KA 3EIWA 2HSGA 4E3WA 3OZCA 3R3WA 2EZ8A 3GXBA 3N7UA 4L4YA 4EG4A 2IH5A 5M7EA 2PWPA 5DRTA 4OP1A 2FZKA 3ABRB 5DYTA 5K6TA 1VBNA 1IUPA 3DE3X 3HSYA 5CFOA 2IX9A 5T67A 5KYUA 1YZTA 2PLFA 5EWMB 1HR0B 1NC1A 1OXBB 4IDFA 4NBKA 4BLUA 3R09A 5IDQA 2OV3A 4PC6A 2DGDA 1P2FA 3OOSA 5DYYA 1NR5A 1KIFA 4JFAA 1YKFA 1PJ4A 3M4ZA 1RW4A 1KZGB 3KLNA 3OKAA 4QJBA 4XSGA 5K05A 2IZ0A 2W6NA 2IPLA 3OKFA 2C4VA 2IEDA 4TTJA 3MS2A 2Q4DA 4IYJA 4QVKA 3PFHA 4X6XA 2JZOA 3AYZB 5K0NA 4LFBB 4DADA 4PR3A 2C29D 3IVGA 4IWNA 3Q2OA 4NHOA 4Y6OA 4EO9A 4U2FA 4CKZA 1N77A 2XDQA 5HIMA 1EFLA 3G7UA 1WKBA 1SB9A 2QVXX 4Z5XA 1XTPA 4YEDA 2D7DA 1YR1A 1Z39A 2BMWA 1DEAA 1TM2A 3KQTA 1X8KA 1NXQA 4RE6A 4DLYA 1VRCA 3MMNA 3X3HA 1X8JA 3QU2A 3GNTA 1ATZA 3C3JA 3FSGD 3RUFA 4HUTA 1T0UA 4F1WA 5LQDA 1RP1A 3HEMA 3MMPA 4RVNA 3HP4A 1C9YA 4IJQA 4NXMB 1NV8A 2JFHA 3Q3CA 4RXUA 4WN9B 1CIVA 2ZRJA 1D09A 2QLTA 4KUEA 3R76A 4FFOA 4YV7A 5KNBA 1PL0A 1RC0A 1VLHA 1CV2A 4KCGA 2LWIA 4RD0A 1Z8DA 1U94A 3ECAA 4KFTA 2X8AA 3C8ZA 3LX6A 2XY4A 2VRCA 2QXYA 4ZC8A 3ZLBA 4BRZA 3HFRA 3HJGA 2HQRA 3JD2A 1EFRA 1V6SA 4MKFA 1W85A 4E5NA 3TW6A 3WB2A 1JQAA 3VOTA 4LF4B 3IXMA 1CUIA 1ZLXA 2JFYA 2R6ZA 5A1JA 1CQZA 4REQB 5ALDA 1S7GA 4BPBA 1CR1A 1DQZA 1PT7A 3A0UA 3FCYA 4FEYA 1O3YA 1SQ0A 2C2BA 1UC8A 3EY4A 3FNEA 4ND2A 2VXYA 3KPYA 3OM0A 3W8RA 3Q88A 3GC6A 4OI1A 4UTRA 4FEEA 1NBOA 2OBXA 1H5UA 2FDCA 5IDYA 3JWHA 4M1KA 2PRIA 3S3TA 1TQ2A 2J30A 2ZATA 3ECSA 1UP7A 1CY4A 2GAAA 3DMRA 3FPBA 2FKAA 4NMHA 4QHYA 3TUIC 3HDYA 1MC4A 1NXPA 4YPVA 4JUFA 1U11A 4F5ZA 3GFGA 5EJAA 1J1UA 2BTQA 1BJRE 2ZQ5A 1ZUIA 3D1LA 2N1MA 3L7NA 3QW4B 4KFRA 4NQRA 5TJ9A 4LDJA 5DM0A 3V55A 4BN0A 2UU9B 4D26A 1O96B 1QHFA 2VTEA 1BCRB 2D4AA 4FKZA 4TUYA 3TQFA 4BO8A 4JYAB 3LMKA 5CP8A 4C0HA 4X8MA 2A1UB 1XUOA 3NHYA 3B82A 1GYRA 3CRRA 5IHPA 3FMPB 1SBIA 4BQFA 4DDWA 1VYVA 1VQ1A 3TNDA 2Y1GA 2JVJA 4UM9D 5EJ6A 4FQ8A 4OBBA 5G53C 1SUPA 3QU4A 4GOND 5JDCC 3HN6A 5C8DA 3KKNA 3UGKA 4YRQA 3RS2A 1O08A 5BQ3A 3OZSA 1QTQA 2FUNB 4B3GA 4XLLA 4Y67A 1NVEA 3GFVA 1J5EB 2IVZA 1O57A 1UAGA 4OYYA 5K3FB 4RVFA 1K0UA 1QV7A 1Z08A 2WJGA 1T91A 2OKCA 1OXSC 3EWIA 4U1RA 1JA0A 3OOHA 3C5VA 4KQ2A 2CXXA 5KOYA 4RMNA 4OQDA 1ZNYA 1SXPA 4U6SA 2NVUA 4CT4B 1CKEA 4DR7B 3FDXA 3FLBA 2AA3A 1APBA 4AC9A 1LVUA 5H16A 3S4YA 5JC1A 1AMOA 3KQWA 2Z2XA 2O7RA 3UNXA 4BFLA 3I01M 3PRJA 3O0TA 4DWVA 3RIXA 3D4OA 4HDNA 2NZXA 4Y7CA 1U81A 1YIDA 1SY7A 3DOCA 3IULA 1PWEA 3PXCX 1R9NA 3DBRB 3JPYA 5J9FA 4C6SA 5EP4A 3JATA 1BKDR 1DCFA 1P19A 2IYAA 4Q9AA 3NWJA 3EFHA 4A2QA 2QR5A 2C54A 4JFRA 4OQ4A 2W0SA 5EEHA 2CXNA 2CMHA 3FAZA 3DR5A 1RQXA 2CE2X 4GBED 4GU5A 2VYQA 4HDRB 4MVJM 1ZNWA 3HA2A 1LSJA 1TCAA 4OJTA 5TMDA 3TRHA 1EFVA 2BMVA 3CJQA 4AMVA 5JXGA 3G6WA 4YDSA 1W4CA 1VKOA 2BKLA 5AOCA 3GHHA 4HNHA 4IMRA 2Q99A 3OJ0A 4NG4A 1WO8A 3I8SA 4N0EA 4XB6B 2UYHA 2GYWA 3Q7SA 4ABTA 1JPVA 1YT5A 1P4SA 1LK7A 1Q1GA 4JLBA 5DLPA 1MOSA 1PG2A 3U4GA 2Q3EA 3PIRA 4LJ8A 2GFQA 1K92A 4QHTA 1P80A 3IJEB 2G1UA 3SHWA 4EMUA 2JLVA 2HWXA 1H2ZA 4G0MA 1C8VB 5DHTA 5AT1A 3L07A 2HBQA 1NN3A 3J7TA 1TD9A 4RFSB 1IAQA 1X15A 5AVYA 5BVGA 2E4UA 2B8TA 2GO7A 2O2XA 1DPFA 1AHHA 3INGA 3PF8A 3SQOA 1U7OA 3GJRA 2V3CC 4HGRA 4QBGB 2VIIA 2RH5A 1GUBA 3NCTA 3BSYA 3D1VA 4U2KA 2NU6A 4R2IA 3HCDA 3VOAA 4PV7A 3W5DA 1YVUA 4OJNA 1G20B 1KYVA 4GVLA 2IYQA 3N76A 2AG0A 3E9YA 2Q5CA 4QGHA 1GKUB 2VBCA 3RU7A 2G9ZA 2CHEA 2C1EA 4LOIA 2A8YA 2C9ZA 1OJ7A 3C39A 5CVTA 1FYEA 2QRGA 3DE4X 1R16A 2VOEA 5EIXA 1U8ZA 3AR4A 3B6EA 3QEMA 2OTCA 2UZ3A 3VTAA 1I5EA 4RFLA 5KWEA 2NAPA 2Q5EA 2WJAA 4D0NA 4CIYA 4MRVA 1H2BA 4IO0A 3FYUB 4R2XA 1T1GA 1MZPA 3TN7A 2W42A 2O2DA 3QWFA 5FJJA 5JUWA 1Y1TA 4ZK6A 2X5OA 4O4LF 2OMEA 3EH2A 3SBXA 3N6VA 4KWHA 3OU7A 4UZEA 1D6MA 5B2FA 1VMIA 1WCIA 1FPMA 2N47A 3D6VA 1YR3A 1R5OA 4Q18A 5JR3A 3LFTA 2VPQA 4MGHA 5EXDA 3KHKA 4DUPA 1ENOA 2FOIA 2KMLA 4R1LA 4KH1A 1HE4A 1L9KA 4H3KB 1P2GA 2H06A 2WYOA 1WV1A 2WJZB 2JFWA 3I9NA 3OZTA 4NU0A 4RH1A 4RS4A 2QSUA 2SCUB 3ZEAA 4BFTA 1FS4A 3UBMA 4WLOA 1C9JA 3P0FA 4QQNA 4D8VA 4E6EA 4IL5A 2L69A 4WJZA 3IUJA 3ZWXA 2VQDA 1UQTA 2FE4A 1P81A 2WP0A 5DGXA 4L6CA 5K0LA 3NOOA 4Z7QB 3FNBA 3N2KA 3TRIA 4K26A 3PJDA 4TSFA 5ECWA 1O87A 1KMHB 3HB1A 4RSGA 1R2QA 1XK7A 2HUNA 2JVKA 1AKVA 1AK1A 3CTPA 1OTHA 3D6AA 3GJXC 1KMIY 3G2HA 4U7JA 2Q07A 3RRFA 2J6BA 1XA4A 2GCEA 3OPQA 3IAM6 2YN4A 3QOWA 1J8MF 4YP1A 3QSYA 1DAMA 1NNUA 5DKFA 5AESA 5FI3A 2EHDA 3FJ1A 4PPFA 2QMZA 2DHQA 4KIUA 5KJCA 4RTPA 2UZAA 3VHXB 3IALA 3DXZA 1JSCA 1CUEA 1V39A 4WESA 3T6KA 4G4SP 4ZI2A 1U3DA 4Q02A 3ZCPA 1MFZA 2OCBA 2R2GA 2AXNA 3SP1A 1N92A 1ORVA 1CZNA 3KQPA 4HK4A 1NUSA 2VAXA 4M9XA 5JZMA 1HETA 1T4DA 4UE6A 5G41A 3DEZA 1ZVKA 1X38A 2J3QA 3A3NA 4ARBA 4C04A 2M6KA 4XIYA 1NATA 3G59A 1TLFA 3NNDA 1PJRA 4AMZA 1E8DA 2CXSA 4Q3OA 2G09A 4O2AF 3KB8A 1N2CE 1ZLYA 5GV7A 1QYDA 2QTTA 4LHYA 2COEA 1UJNA 1NMQA 5LCXA 2P0AA 1TU3A 2GLUA 4POAA 4RORA 4XD7A 3INTA 3L8CA 3PQDA 4KX3A 3WJ7A 4B4WA 4CLOA 4E5UA 5IU6A 3HBMA 4CV3A 5I7WA 2OFWA 4CUJA 4GW3A 3EFOA 3UCXA 3IDFA 5HHTA 1UMDB 4AQDA 5CDSA 3B3QA 4TXMA 1NDUA 3I1JA 1VIDA 3RC3A 4B5KA 3A3PA 4UASA 4OUDA 5KOHB 2CDNA 3N8GA 2O3QA 3AWIA 2CFCA 1C29B 1JZTA 2CW5A 2X7HA 3HJTA 1GPH1 1TIKA 2B34A 2C03A 2OD9A 4I2NA 1BQEA 4NS4A 1CZRA 2F1HA 1N7IA 2GM5A 2RBGA 1VOTA 3KX2A 1EWRA 4P35A 1GDTA 1UZLA 4OI0A 1RWWA 3LA6A 5CXUA 2VJMB 4AECA 3LP8A 3HCRA 1DO8A 4Q39A 5TQ2B 2DJ5A 1VGQA 1Z75A 1G20A 4OHWA 2PSDA 3PHGA 3HBFA 1PKEA 1NUPA 1HE5A 1FFBA 4Q7JB 4TLAA 4D9KA 3IE2A 3Q9UA 4JI7B 1UZMA 4OFXA 1MFPA 5G4KB 5JARA 4Q4AB 4MR7A 1D4ZA 2P9FA 1WULS 3ZE9A 3AIOA 3DOFA 1HDIA 1M0TA 2AMLA 4MCIA 3BJIC 3GLHB 1MEOA 1U8CB 4MB0A 4WGGA 1GO2A 1KYTA 1JNYA 3O2SB 3QVJA 4J3NA 2X15A 2GF9A 3DMTA 2QRLA 3IUEA 5F23A 4U9HS 5CX1B 1XXHE 1ZM4A 3WL7A 1YRWA 4J1TA 1VSQA 5DBIA 4D5EA 1L3BA 2JW5A 3FNRA 4TLLB 4C1NA 2YJTD 3EIQA 4HYTA 1H8EA 2P9QA 1FDWA 2CZGA 2FDRA 2ZW9A 4HEHA 5CH8A 5KYNA 4II7A 4Y1EA 1TA4A 1LQTA 1JHDA 4R1SA 4TRRA 3OZFA 3H18A 3G23A 3I8OA 3IOCA 1NXVA 3ER6A 2A4MA 4BLPA 1FJHA 1C4WA 1OIWA 2AQHA 1E9VA 1OE0A 4RZSA 4CTNA 4Y3UA 1JHVA 5SICE 1MRNA 5TPWA 4CQMD 2ARKA 3D8BA 4JQCA 4DFDA 1FRZA 1M2FA 2PJDA 1RE0A 1E77A 1QDUA 1ZDMA 2ZSHA 3PSAA 5CM9C 1EGQA 3PUKA 3TIVA 3TM4A 4F04A 4QTYA 3BX1A 5EE1A 4HQ6A 2O4UX 1NRXA 5FO0A 4L73A 4K6CA 4U6QA 3AIIA 1CULC 3DBRA 2AXEA 1WJGA 3C14C 2WY2D 5KYGA 3BD6A 4URZR 2PZGA 4CKWA 2IUUA 2RJOA 1CZOA 1R5BA 2EWVA 2ZWMA 3SOPA 3T15A 3GVPA 2I2BA 1JQ5A 1JPNA 3BIWA 5LZ4A 4BKQA 8OHMA 3R7BA 1K97A 2QV0A 4OAOA 2HA5A 4CETA 4TYNA 4JNCA 2D2EA 2Z8YA 4RX1A 1U7ZA 2HEIA 4JP5A 5EKSA 3ZDQA 3CMMA 1GRVA 1O6ZA 1OFHA 2PUWA 4O59O 4EJSB 1YB1A 4CG3A 4QODA 2Q7XA 3ABOB 3AEKA 1GFWA 3A6DA 3F6EX 4WLUA 3G85A 1YB6A 2Q6IA 1RBMA 4R3NA 1NC3A 4U2EA 1Z62A 5BSEA 1KQ3A 2IYWA 3BCRA 3P9SA 4I99A 2WE7A 4YLEA 2V4MA 2ZIXB 2PZEA 3F3KA 2IP4A 4JI8B 1YD7A 4WWHA 3IMCA 3ZX5A 1ETHA 4PHHA 4AIIA 5EWJB 1BVHA 2HL6A 4F96A 2Q3JA 3GEBA 2Z3ZA 3NLLA 5FBRB 4CT5A 4E11A 4EHNA 5KTOA 4QDZA 3NR2A 4BJ3A 1K8ZB 2CXUA 2IYYA 4UBIA 3WK8A 3VMFA 4N4AA 3ZXYA 4RTMA 3KUCA 3DKKA 3HVHA 3T06B 2D0DA 2JL1A 4IMIB 3OUUA 1JEJA 3CRVA 3TDNA 2PBRA 1IIBA 3X2FA 2PLRA 1ZD1A 3MMXA 1EXVA 2WG1A 1JDBB 1BCRA 4PFKA 3IHLA 1MB3A 4WSOA 2DX7A 4YXWA 2HMVA 3AJ9A 3QEOA 3FZQA 3A1DA 2VH5R 1NN5A 1B15A 1QX3A 4PZ0A 4QDUA 4TTAA 2PO5A 5TGDA 4BLSA 4QDOA 3OI7A 4RKWA 2I4RA 3DKPA 5JH7B 5HW0A 2G63A 1Z2DA 2GYUA 3WIBA 3ZDDA 1B14A 1G6KA 2NZVG 4OHBA 2XAUA 2VPYA 5BNFA 5J3JA 3FNIA 4O1HA 4UULA 2DBVO 3KD3A 3PVZA 4LK3A 4QAJA 4AZ3A 3C97A 4Q93A 4KYTA 1Z0KA 2OGUA 1M6NA 1UEIA 1QHXA 4KHZA 1EM6A 4TWAA 4UM8B 1EE1A 5C52B 3D6JA 3FSGA 5HPYB 4EG1A 1XDGA 4YT8A 1CLUA 1K4MA 2SBTA 5DNVA 1Q1BA 4YMSA 2RJ3A 3I9OA 3U3RA 3VKWA 1U9CA 1Z4OA 1XJQA 3RSCA 2JH9A 5JAMA 3I83A 4RJIA 2BP7A 2R751 3LXMA 1ZEMA 2OC9A 3OTWA 3MAGA 1I1HA 4KGVA 4R0MA 4WQMA 1SBZA 4V2IA 2H7YA 4MKZA 5HTKA 4NBUA 4G9GA 3T54A 4XARA 5IW8A 4ZVNA 3SMVA 3FWNA 3BB1A 1E3WA 1Z35A 2OORC 2ECFA 5K4AA 5B6JA 1H2RS 3HDTA 4WFQA 5AVKA 1OD6A 5K5EA 3VHQA 3LT2A 3DNFA 2I0FA 4RPCA 4OLFA 4HWOA 5BRJA 3CB4A 4C7VA 1MR3F 4JASB 1KSHA 4OLBA 1IHUA 2BN4A 3FAKA 1E7WA 4JXKA 1SKAA 3I42A 4KU4A 3UCEA 1SEPA 4BVFA 1CVIA 1LNSA 5C4MA 1FFXB 1P2DA 2AYYA 1JR3E 1DAFA 2XF2A 3FYDA 1OLUA 1NOIA 1MU0A 1O6CA 2JC3A 4PFQA 4X85A 4BS9A 4RK0A 3W2GA 4BYMA 5MFZA 2P2ZA 4W9NC 3ZHQA 4AYWA 1V5EA 3PCRB 3B9PA 4URUR 4DE5A 1GQ2A 4IFEA 1W94A 2OBFA 4GZ5A 1DOZA 4BX3A 4F4CA 1MEEA 4MS4B 4BFCA 4XPIA 2OKGA 4YR7A 4A15A 4NZ9A 4L95C 5AW9A 3THXB 5AXBA 3H04A 4NDAA 2A2ZA 1HDOA 2ZTHA 4ZJZA 2XUQA 1CUHA 2CMFA 3L1KA 4WA7A 4F5YA 1HORA 3VZQA 1BWSA 4S05A 4YDRA 2UXDB 4MQEB 1RRVA 3W06A 3LXRA 4GKKB 4D1YA 4YCMA 10MHA 1O0CA 1WBJB 2YXLA 4B9EA 3G2IA 2BRUC 4O8CA 2HRRA 2AJBA 2FPKA 3DQZA 1KQNA 2UXCB 3T99A 4M3NA 1U0EA 4Q1EA 4RMHA 1W2GA 3KS9A 3EVBA 4XEHA 3WRVA 3TIGA 2O2JA 4DUGD 2YXBA 1RKVA 2BM9A 2VYFA 4I4TB 2GVZC 1V9LA 4D9NA 4L8GA 3REQB 4E21A 1J20A 2HREA 3HA5A 5AQ1A 1MZVA 4RPGA 4FHDA 5LUBA 4MRMB 2PZMA 121PA 1M1NB 4OB6A 1IY9A 1T2FA 1IPHA 3AHIA 1P77A 4GH5A 1ODFA 4IOKA 4U4AA 1KSGA 3TBKA 4B3HA 4H2DA 1H6DA 4CI0B 5BUQA 3TPFA 4HB4A 5AI0A 3HU1A 3AGQA 3DHYA 1I32A 1P0QA 2WSSD 3CLSC 5BT8A 3UJPA 3PHLA 4QXMA 5DBFA 1V1RA 3MHPA 4D9MA 4AO8A 2BFEA 2J3IA 4AZVA 2ZRNA 2GCPA 2B69A 4S0XA 2HXGA 2H4ZA 4MWTA 3AHJA 3GEHA 5AKJA 5JEDA 2WWXA 4ZVMA 2FFQA 4XIGS 4AN0A 1V0JA 2OFOA 3T38A 1A97A 2MSWA 2CHUA 2JHCA 1UK8A 5ALNA 5FTJA 2JAXA 2P77A 3HZRA 3T5CA 3QLVA 1MO5A 3HPQA 2QYTA 2G88A 3GFBA 4JLAA 2O6LA 4YAJA 1K7FB 3TOXA 3QVWA 4GRIA 2XCIA 1ZM2A 4DRYA 4TTRA 2YY5A 2ORIA 1L4NA 1NI4A 3A2MA 4G67A 1IWBB 3KALA 1M34E 3JVIA 3PE6A 3QITA 4ZOEA 1ZR2A 4WK2B 2BMEA 1Z5VA 2P3SA 1BW9B 5C1DA 3RVNA 1H9BA 5AKLA 1G60A 2WSBA 4B43A 2R66A 3KQNA 4IZOA 5JQWA 3K0AB 4TV8A 5DK6A 2C92A 1DOHA 5SZIA 1H05A 1RVDA 3MMZA 4ZTBA 4ALNA 2JBHA 2A0KA 4QPNA 1KEKA 1CRWG 5TNXA 4DSZA 1ZK2A 4HLNA 4J7UA 2C2WA 4LV5B 2Q1SA 2FI1A 5I9SA 4CM7A 3BQ9A 4DG8A 2B7LA 5A7GA 2VUTA 3S2ZA 2O1XA 1QK3A 3K71B 3AEUB 1R6AA 5BVHB 2G6TA 5IZCC 2GEKA 4C29A 3ESBA 1YDMA 2Z4SA 3BCUA 1KJIA 3HR7A 3KL4A 4FS3A 4L0QA 4HV4A 2QTGA 2ZITA 1XQ1A 4NZZA 2C20A 2EFYA 1ETUA 3EEQA 1YKGA 5ALPA 3UENA 2B6HA 1NJ5A 5D3MB 3JQGA 3K8YA 2WV7A 4ZYVA 2GPYA 2R7LA 2JGNA 1I1OA 1T34A 5AOAA 3L4BA 1DXHA 1SHTX 3PWTA 1OW3B 1P1HA 2CXRA 3DB1A 3EA5A 4UHCA 3SEQA 5CVVA 2JGLA 4KXQA 2JK0A 1JMYA 3TG8A 2O8CA 2ICAA 1IN1A 1FUYB 1J42A 1IIRA 3W2FA 5KHLB 5DBHX 1ENPA 1LK0A 2EP8A 1EDBA 2R8ZA 5ALHA 2FN3A 4RJTA 3OTOB 3W6UA 4Q3NA 4J16C 3ML1A 4L2IA 4Q3LA 4Q4HA 4TZKA 4Q01A 1YQQA 3IODA 3FA2A 5GY7A 4CMIA 2B2CA 5DHRA 4FYPA 3MB5A 2F00A 2G1AA 1GRNA 2PWYA 4LC1A 1NWHA 1TJYA 5K3OA 4L9RA 3MWYW 2PGXA 2HNBA 4BV2A 2C4KA 4FYVA 1JJBA 2QRZA 3E3LA 1YU9A 5TX7A 1G64A 4KR2A 2VT6A 2ENUA 3AVOA 4K9SA 5CB4A 2CDRA 4DSOA 2REOA 2VHZA 3G3EA 5KAPA 3GMIA 1J8DA 4Q1FA 2OESA 3MGKA 4U8GA 5EIEA 2D5BA 5JIBA 3ILVA 5H8WA 1GUAA 4A6PA 4D9JA 4Y30A 4F3NA 2TMYA 3DD5A 1OH7A 3GZTB 2FPWA 3CS3A 5KINB 5KOJB 4S1PA 1G98A 2EQ5A 5DW0A 2IUYA 3EVFA 1CU1A 3ZI0A 5JALA 4CEJB 4E2YA 3F78A 2O3JA 1E6UA 3IUQA 2HTFA 1Q1EA 2EIHA 3FDFA 2MDTA 5FBKA 4D0RA 3TZKA 2DFPA 3D3WA 3WWEA 5INTA 1FNDA 4LRSB 4H7DA 2FWRA 4O4JB 3RGWS 1R6VA 1W9HA 2HQSA 2QN2A 4I19A 5ITZA 1E1RA 1LNZA 2Y2VA 1V8ZA 4IINA 5FAKA 2HA6A 2R7AA 3IQZA 3I1FA 1M2WA 4RGVA 2E4ZA 4O1IA 1XHFA 2A9OA 1S3SA 4E4RA 2XKJE 4B34A 4JITA 5D5QA 3CIOA 3E1KA 2PL1A 5CVEA 2XYRA 4TQ9A 4FGKA 5KQGA 2A30A 2RH4A 1EGMB 5T57A 2FP4B 5JJ5A 1T9HA 2O5CA 1QCDA 1KVQA 1QO7A 2AQKA 1Y6FA 2BTEA 2XVZA 3EEYA 5B57C 4NYMR 3RTDA 4BB0A 1LBHA 3SFVA 2VDWA 5CH3A 5C32A 1TB4A 3O3NB 2PRJA 3EIXA 1KC1A 5GINE 4FFNA 2VBGA 4YJ2B 2CK3D 1RMQA 3HHPA 4XOUA 3KQHA 3TR5A 4IDGA 4GMFA 1ECBA 1MA0A 3DS8A 1LLFA 2VZEA 3NH6A 2CC2A 4JOCA 4KAAA 4P92A 4PX5A 4LE0A 5FDFA 3PQCA 4ZDIA 4MULA 1EGAA 4MA0A 5CFQA 3H1PA 4XSHA 5BWLA 1I24A 3B3JA 4P0TA 3OEWA 4YP0A 2VDQB 1SUAA 4K9KA 3KEMA 4NABA 5JSZB 1KGSA 4DIEA 2BSAA 2XQGA 3RASA 3IDZA 4CNQA 1DFIA 2IKSA 2EFGA 3CN9A 4HH3C 4EP1A 5MF6A 1YULA 3GFFA 3JQAB 2R48A 2OYSA 2PL3A 5KQMA 1NF9A 3BK2A 3ENKA 4YWJA 1GSOA 4I9GA 5DYGA 3V3KA 1GFIA 2XRYA 1XQVA 3N39C 1AOXA 3O83A 2B4QA 1JDTA 1JGTA 1J33A 1SC6A 1Q3KA 2A58A 2ZTMA 3KZVA 2OVBA 3P0JA 5AKYA 3ZZUA 2PMKA 4ZV4A 2VH1A 1A9PA 1QGUA 5KOIA 1X9HA 4ZCRA 2VAVA 4RULA 4PHTA 2JH8A 3QG1A 2FHPA 2AV6A 4ZVSA 2JIQA 4UUOA 1V8DA 1ZWKA 2A7QA 4YK7A 4H1HA 3IAUA 1TK3A 5CTJA 5GAJA 2BL4A 2ZBGA 1NJ8A 3VGPA 4B3FX 2GPJA 2HDHA 5LN1A 3QLEA 4QJ4A 4UZFA 2MCFA 4GX5A 2BHNA 1P4JA 2O2ZA 2E1RA 4FNMA 4XGQA 4EPYA 4CPDA 2ZYRA 4ECAA 1U1IA 3GJ6A 3S7TA 2AC4A 3Q3JB 2PG3A 3UMCA 3QEKA 1GGNA 2HQOA 2G5TA 2PUJA 4S2UA 1CT9A 5H3CA 3G8CA 3PX3A 1H4VB 3MWGA 1AKR