4C4OA

Structure of carbonyl reductase cpcr2 from candida parapsilosis in complex with nadh
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
334
structure length
326
Chain Sequence
IPSSQYGFVFNKQSGLNLRNDLPVHKPKAGQLLLKVDAVGLHSDLHIYEGLCGDNYVMGHEIAGTVAAVGDDVINYKVGDRVACVGPNGCGGCKYCRGAIDNVCKNAFGDWFGLGYDGGYQQYLLVTRPRNLSRIPDNVSADVAAASTDAVLTPYHAIKMAQVSPTSNILLIGAGGLGGNAIQVAKAFGAKVTVLDKKKEARDQAKKLGADAVYETLPESISPGSFSACFDFVSVQATFDVCQKYVEPKGVIMPVGLGAPNLSFNLGDLALREIRILGSFWGTTNDLDDVLKLVSEGKVKPVVRSAKLKELPEYIEKLRNNVVFNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBONYL REDUCTASE CPCR2
publication title Structure of Nadh-Dependent Carbonyl Reductase (Cpcr2) from Candida Parapsilosis Provides Insight Into Mutations that Improve Catalytic Properties
doi rcsb
source organism Candida parapsilosis
molecule tags Oxidoreductase
total genus 98
structure length 326
sequence length 334
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2013-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4c4oA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4c4oA01
3M6IA 4YBZA 2O3TA 3EY4A 2P9GA 2ZB3A 1H0KA 1DEHA 1Z75A 3TF5A 1UZLA 4YJFB 3UCXA 4E6PA 4WOKA 3U49A 4F6LA 3PHJA 1FDWA 3SLKA 4II2A 5K6AC 1XYGA 3PLRA 3WYBA 4B3IA 2DBQA 1XDWA 1ONOA 3GDFA 2A4KA 2Q2VA 1OZAA 3HHPA 3HB5X 3H65A 4M54A 2XOXA 4O1MA 3PGXA 4CMAA 4IIUA 4UREA 4G65A 1ZJYA 2HMTA 3JD2A 3EVTA 5ES3A 1HZJA 3E48A 9LDTA 5CDTA 1ZK1A 3BMQB 4MP8A 1NAHA 4AJ2A 1G6KA 4D43A 2QYSA 4GAEA 4ALLA 4BO4A 4ZD6A 4BNLA 2OBYA 2JCVA 3P2YA 4DQVA 1KVUA 1M66A 2ZATA 1E7WA 3RFXA 3H9JA 1U1IA 2VUTA 1IHXA 3LYLA 2BI8A 3MJTA 5BSHA 5JPIA 2W2LD 4RORA 4TRNA 2CF6A 3B1JA 4G81A 4J91A 4NFYA 1PGQA 3BA1A 1Y8RA 3QIVA 5A9RA 5DZSA 1R66A 4J9UE 1XLTA 2JHGA 4EJMA 5IG2A 1HDRA 1ULSA 1V3TA 4L75A 3QVWA 4Z9FA 3WGTA 1SB8A 3X2FA 3K5PA 4WLEA 4Y6SA 5AVOA 4FDAA 4CLEA 3JQAD 1JVSA 4A2CA 4ZICA 3L0DA 2HCTA 1U7TA 5TGDA 4OQYA 2Q3EA 1K2WA 2EERA 3TZ6A 3ADOA 3SEFA 5IXSA 4R54A 4ZA2A 3I23A 3CINA 2DPHA 1PWXA 3G1TA 2CFCA 4AJJA 4BO9A 1PSDA 2YFHA 3VPXA 1YVEI 3OJLA 3MJVA 1DIHA 1VJTA 3ITKA 1YOVA 5JSFA 2VHVA 3SC6A 3D4PA 1EEHA 2JCYA 1BVRA 4XQ9A 2Q50A 3G0OA 2CDCA 3KEQA 4FPXA 4OXNA 1BW9B 1I5RA 5EIOA 3BHJA 3DFZA 1C0IA 1X1TA 7ADHA 2I9PA 2GZ3A 1YB5A 1U28A 1KEWA 4HKTA 2X8LA 3CZMA 4NBTA 5L7TA 4B4WA 3F1LA 1R4NB 3F6YA 4GX1A 1W6UA 4CLOA 5JC1A 4DIOA 1SOVA 5F5LA 2ZB8A 2D5CA 3UGKA 4YPOA 3AUTA 2OXIA 2PZJA 1X0XA 3C8MA 3IC5A 3MCVA 5A5EA 3RQSA 5FEUA 2RCYA 5L9AA 1GZ6A 1NAIA 2VT3A 5IFLA 3VH4A 4JBIA 2PGLA 1IZ0A 4IGEA 2TMDA 3U4IA 3ZCXA 4HNGA 4NU6A 2O23A 5L7YA 4C7KA 3GDOA 3I1JA 1M75A 3K8ZA 4RQTA 3WOHA 2VRBA 3GK3A 5B1YA 1A27A 4CMBA 3CXRA 1GYPA 3NGXA 1RM4A 3VZPA 4OL9A 2NNLD 5EN4A 3ZI0A 2UV8A 3K92A 1PX0A 3ETDA 3FWZA 3WB9A 3UH1A 3ZWBA 5KVCA 4RVUA 5ILOA 4A0SA 2PD6A 3K30A 3O38A 1UXGA 1E1KA 2XF8A 4LCJA 3LQFA 5I9LA 1YS4A 1E1LA 4XA8A 4DIBA 3A4VA 3ROPA 4WEQA 2O4UX 2RAFA 2BI7A 3DZGA 3R1IA 3E8XA 5LC1A 4MVJD 1BXZA 3ZU5A 1MUUA 1ZNQO 3N74A 4ND3A 5ITVA 4E4YA 1SEVA 3GVHA 4K6CA 2BELA 2RH4A 3DZIA 2YDYA 5LDGA 2J8ZA 4NNJA 1P33A 3BZUA 2ZB4A 4IBOA 5TT1A 5F3RA 1GCUA 1AGNA 3DTYA 4ZHSA 4FN4A 2I5PO 2E4AA 3GNQA 3PHHA 4CUKA 4UVIA 4IDEA 1FXSA 4KWIA 5ICSA 2YV3A 4N7RA 3QWHA 3SBOA 2QIOA 1ISFA 4R1NA 3OMLA 5IN5A 1PS8A 4NQZA 4PRLA 2EGGA 3AI2A 4DRYA 1IULA 4TRRA 4AJLA 2VYVA 3RKRA 4YT2A 3FBTA 8ADHA 1EDOA 1C14A 4IGFA 4XGNA 4GVXA 4IY1A 3O26A 3NAQA 2P5UA 4IDCA 4W4TA 2C0CA 3H9UA 3L4BC 2NV6A 2X1HA 3H9EO 4LMRA 3HDHA 3SJ7A 4EUFA 2G76A 4BKUA 8LDHA 4HFRA 1FMCA 2C54A 2QX7A 3FWNA 1NVMB 3ROKA 4BQRA 3JQ7A 4R1SA 2W8ZA 1B3BA 3ZWYA 5B4VA 1U5AA 1XHLA 2DAPA 1H9AA 2YV2A 3ANMA 1H5QA 4ZRMA 3U09A 1WPQA 4BGEA 3NV9A 1ZBQA 4KOAA 2JJYA 1HE5A 1Q7BA 4CL3A 3VVBA 1Y7TA 3KB6A 3O03A 4MO2A 1H2HA 1RYEA 3H2SA 4BKQA 4XDYA 4B3HA 3AY7A 1O9BA 1JWBB 1X13A 5COAA 1YDWA 3JQFA 5A06A 3GRKA 4XIJA 4CM1A 2G82A 4CUJA 3OJOA 3TZHA 1NPYA 1R6DA 1U8FO 4JJFA 1M76A 1SNYA 1WAMA 3RJ9A 2HAEA 5COQA 3ROQA 2Y0EA 1NR7A 4MIYA 5CFZA 2EP7A 1UXIA 1PR3A 1PS0A 2FPGA 2WJPA 4U0KA 1UDBA 1P77A 2NQ8A 1D7OA 1N1EA 3VVCA 4O59O 5C7LO 1IYZA 3IIEA 4DLBA 4BO6A 1RM5A 4BNXA 4CV2A 2B0JA 4AJOA 4BGIA 4FCCA 4ND2A 4E33A 2X9GA 1LU9A 2DUUA 3E03A 4S3MA 3WQRA 4OJNA 2FPIA 5HS6A 4UEOA 3L07A 1EVYA 4RZHA 4DIFA 3P7MA 4J43A 1L1FA 4J4HA 1R16A 3FHLA 4UEJA 4Z3KA 2RHCA 3ZH2A 3TPCA 2B5WA 3L6EA 4HUJA 3TOZA 4OAQA 1DXYA 3CZRA 1DC4A 3KXDA 4DTIA 2WTBA 2D4AA 1E6EA 1H94A 2ZYDA 3D3WA 4GH5A 4BNMA 4BV9A 4E5YA 1YOVB 4Q3BA 4R3WA 3E5MA 2YQ4A 1EVJA 4CM4A 5T57A 3AFNA 5B4UA 1DJNA 3ZW8A 4K6FA 1TXGA 3S8MA 2C20A 2Z95A 2CVQA 3EK2A 1L7DA 2QW8A 3L9XA 3DO5A 1PTJA 3G49A 1E5QA 3WDSA 1R0SA 2C2YA 3IP3A 1VL0A 2QRKA 5H83A 4RCVA 4CLOB 2OOSA 2B69A 2I65A 2NU7A 4GWKA 2Z1NA 3OQ6A 3CMCO 1FDUA 2WYUA 1OC4A 4IDAA 3UCEA 2EKPA 3WJAA 4DLLA 3L6OO 1R15A 2ZQYA 1O94A 4X54A 4QECA 2GF2A 4QEDA 1ZSYA 1JKIA 4JCOA 4NDNE 2R2GA 2Y1EA 4AICA 4BMNA 4DQXA 3U4HA 1ENPA 1EE9A 4U8GA 5CP8A 4BO7A 4WOJA 5KJEA 1JAXA 1T2AA 3E9MA 3PEFA 5L53A 2GASA 1GUYA 3PWSA 2JAHA 3OQBA 4J6FA 3QWAA 2E49A 3W6UA 4B4UA 1E3WA 5IDXA 2P9EA 3NX4A 5KNLA 1Q0LA 3K2EA 3HSKA 1H9BA 2W4QA 2H6EA 2OP0A 3KEOA 2ZYAA 4Z0PA 1CQIA 5LCXA 1UXJA 4DLAA 1B15A 1EUZA 1A9YA 1PJ3A 3P5SA 3DZBA 4RVHA 2YYYA 4PZEA 5G4KA 2NVBA 4DBVO 2NM0A 2AEFA 1I3MA 3CUKA 3PQDA 4BO3A 4NU5A 2WM3A 2X58A 1XSEA 1MA0A 3RD5A 2BFMA 2O2SA 4OH1A 4IINA 4XRRA 1UJMA 1GADO 2HK9A 5CDUA 5KJFA 1KS9A 1H6BA 1P1KA 2XXJA 4GGPA 4ALMA 1PWZA 2BGLA 4HWKA 1IOLA 5CEJA 1N5DA 3I9KA 4K9DA 3TN7A 5TF4A 4AG3A 1BMDA 3EZYA 4NK5A 1X1EA 4WJZA 3RUHA 3F5QA 1CDOA 3SXPA 4BO1A 4BNGA 4GL4A 1CERA 2O3RA 1B26A 2R00A 1HLPA 1KY4A 3WR5A 2ZK7A 4R1TA 4DC1A 3CSDA 3LZ6A 1HE3A 3OHSX 5GZ3A 1Y8QB 3Q0EA 4R5HA 5G0UA 4W7IA 5EL0A 1DAOA 3PYXA 1IE3A 3LDHA 4D3DA 3T4XA 1QV7A 1HLDA 3DTTA 2JKVA 5I9NA 1T1RA 1J4AA 4DC0A 1UDAA 4J90A 2P4HX 4XYLA 3DBRB 5THQA 1H6AA 1LLDA 1WVGA 3LU1A 3GEDA 3LC2O 4RVDA 1I3NA 2Q4EA 4OMUA 5B4TA 5AQ1A 1LDYA 3GLQA 4MKRA 3QSGA 4MINA 4Y9DA 4I5DA 3TDKA 4WLNA 1YXMA 3GF4A 2DKNA 1GYQA 4LVUA 2OZPA 4KQXA 1W73A 1ZXLA 2NQTA 4B4OA 1WWKA 1U3UA 2VZ8A 4E31A 5EQDA 1MXHA 2AQ8A 1JU9A 4Q9NA 3FCOA 4R9RA 3DC2A 5IF3A 1V6AA 3ZU2A 4DWVA 2ZCUA 4XR4A 4E32A 3WGQA 3DONA 1XCBA 4LN1A 3JQ7B 3EDMA 3QA9A 2R6JA 2UYYA 1E3SA 3ZV6A 4FS3A 4HV4A 5KCZA 1O6ZA 3JQCA 1VKNA 4P4LA 3GN2A 4I8XA 1A4UA 5TT0A 3R3JA 5ICMA 1E7SA 5KJCA 3KYCA 4HNHA 4L8VA 3D64A 5L4LA 4IS2A 3CH6A 3WGOA 4GSKA 2EF1A 2A94A 4CM5A 2JFGA 2P91A 3PDJA 4WLUA 5U1PA 5F1OA 4OSPA 1E3LA 3DWFA 4E2XA 5I7FA 5K1SA 2Q99A 1E92A 2I6TA 3E9NA 3B6ZA 3E6AA 4ZQHA 1GYRA 1CIVA 3QVTA 1E7RA 4BNNA 3GNSA 4C7JA 1RWBA 4P38A 2E37A 1NXQA 1XKQA 3ONEA 3IQDB 3H8VA 3ETGA 4MVJE 2YQ5A 4CJXA 1ZIDA 2Y0CA 2HMUA 3EGOA 3BYZA 4YVFA 2PKRA 3JV7A 3GOHA 2HUNA 3KLMX 4ZGWA 1SBYA 4LISA 1AE1A 1U4OA 1HT0A 2O3QA 2Q49A 3AM4A 1DFHA 4OSOA 4YXFA 3GQVA 3HN7A 2O3JA 3WYEA 3DEYX 3D5QA 3JYLA 3V1TC 1PL6A 1DSSG 4RVFA 3C1TA 3K31A 3WWYA 4FD3A 5I8ZA 4ALNA 5I7SA 3H9GA 5L51A 2OORA 2J5RA 1OMOA 2DTEA 3ABIA 1KY5A 2YW9A 3D3WB 1ADGA 2A92A 1EFKA 3WQQA 4BNTA 3CE6A 4CM4B 4EW6A 3PHIA 2NADA 4IDFA 5BSFA 3UN1A 1LJ8A 4FFPA 3A1NA 2EXXA 2WYVA 1QORA 3UKOA 5BSGA 2EW2A 3AM3A 5I7VA 1FDSA 1T4BA 4LK3A 2VHXA 3F4LA 2EG9A 4MJLA 1HYHA 2G0TA 1DLJA 2GDZA 5CDSA 1ENYA 1K3TA 3PP8A 1EQUA 4IS3A 1A4IA 4NJMA 1PU2A 3V2GA 3ETEA 2Y1GA 3JQFC 1Z7EA 4YA6A 4BB6A 1ZZEA 3Q11A 4PGFA 2JFHA 3QW2A 1HRDA 2VYNA 1GR0A 3VTZA 3JQ8A 4GX2A 1XEAA 4WCDA 4XYMA 4BNVA 4WUVA 2PV7A 4ZRNA 3HUDA 1DFIA 1GD1O 1CJCA 2PZMA 5HRUA 5KKCA 2Y1FA 2NACA 1HETA 1ZO8A 5KKAA 5TJHA 4ALKA 3H3JA 1GCOA 3SC4A 2V6BA 5HBRA 5TNXA 2J3HA 4WCFA 1NFQA 3Q9UA 3F3SA 5G4KB 1V0JA 1LDNA 4QTZA 4RO0A 4DPMA 1YH3A 4XJTA 3AI3A 4GPD1 4RGBA 5GZ6A 5A3JA 1HZZA 4ZU3A 1T24A 3W4JA 4J16A 5L45A 3ZNNA 1ISJA 5JAIA 5BNIA 6ADHA 3OEWA 3WGGA 3ZWCA 2A9FA 3U0BA 4PLZA 3B20A 1JAYA 4YAGA 4WNCA 1HSZA 3KETA 2O4CA 3UVEA 4B8WA 4YAKA 1U3VA 2AMFA 1VKOA 2IZZA 2FZWA 1MLDA 2GUGA 5A4DA 3ITDA 4PG8A 3Q2KA 4WE3A 1NP3A 1X7HA 1GZ4A 4CM9A 4XDZA 1WMBA 5T6BA 2ZYGA 3H6KA 4CODB 1AUPA 1W0CA 4IXTA 3ZGYA 5T67A 4WASA 3P19A 3CMMA 1YBVA 2EWMA 2PH3A 4M49A 4Q3AA 4DL9A 3AUUA 1RJWA 2P68A 3VDRA 4JK3A 2POQX 3ZHXA 3L4SO 4IIVA 3U4DA 2NTJA 4J3FA 1F0YA 1SEPA 4KWHA 2HMWA 1A9ZA 3IP1A 4GBJA 1TVEA 3MTGA 4OIMA 5JDIA 1GQYA 4TWRA 2PKQP 4XYGA 1XU9A 3PYLA 1CYDA 2ZJ1A 1Z82A 1HDYA 2UAGA 2EHDA 4J4BA 3ZW9A 5JO9A 1EUCA 3IUPA 1NPTO 2VNSA 4DPLA 3KUXA 4PG4A 4K26A 1VJ0A 4IJUA 3HN2A 4LRSB 2WSBA 4R69A 3V2HA 4H16A 1WLYA 4OOEA 3FI9A 2B5VA 1XWFA 3AOEA 3G3EA 1DRVA 4BKRA 4KUHA 4OKNA 4CMEA 2VRCA 3NT4A 1D8AA 1OFGA 1P3DA 3PZRA 4DREA 1X14A 1I2CA 3MJ4A 2NTNA 3SX2A 4AJHA 4GGOA 1E3JA 1UP6A 5TLSA 4L4SA 4A7PA 4FFMA 4IZIA 3HADA 3VZQA 1QMGA 1Z73A 4PRKA 3CIFA 3W8EA 1EZ4A 4FJ2A 1HE4A 1LRKA 1N2SA 3VKVA 1ORRA 4BQPA 4A10A 3FPCA 1EK5A 4PFJA 1A5ZA 3KYCB 3INGA 4FQ8A 3COSA 4RPLA 5G2OA 4XCVA 3WMXA 1PJ4A 2NU8A 2JAPA 4JN6B 2ET6A 4ZVVA 2O48X 2R00C 3TOXA 5CG1A 3FN4A 3DAFA 4PZDA 4K1LA 4F3YA 5JFOA 1LLUA 2VYVD 4XX0A 3AUAA 4WEOA 3T7EA 1VC2A 5EJ2A 3C85A 1YJ8A 3TWOA 1ZUD1 4WECA 1P44A 2F1KA 3PQEA 4DYVA 2IYOA 2GD1O 3WXBA 4YRBA 3OF2A 5HWSA 1FF9A 1LA2A 1EBFA 5JLAA 4J4TA 2O3UA 5T8KA 1O0SA 1LUAA 4JQCA 2YHUA 1CQJA 3WGIA 3GH3A 4BHTA 4KUGA 1JTVA 5C5IA 1I30A 4PLFA 3QVXA 3N58A 1KBZA 1NWHA 2VCYA 3QHAA 5DP2A 3JCZA 2E82A 2ZTMA 3NTRA 4Q39A 1HWYA 4FFLA 4KQWA 4YQZA 2QZZA 3H7AA 5KWEA 1ISGA 3EC7A 1CRWG 1A7AA 5AXAA 4AVYA 4ZJUA 3AY3A 4E5MA 1I32A 5C7OO 1DOHA 4W7HA 1YGYA 4RQUA 5JW6A 3GVCA 4JBGA 5HTOA 4NBRA 3GVXA 2X5JO 2QZ9A 1WDLA 3I9MA 4N5NA 4OGWA 4BNYA 2FP4A 1I0ZA 3RROA 3WWZA 5CG2A 2NVUB 5EERA 3WBFA 3HQ4O 3PI7A 4CMCA 1B0AA 4GWGA 1XG5A 2FWMX 3RKUA 4NJMB 3PJFA 1YONA 2QG4A 3PJDA 2GN6A 3F46A 1CWUA 4OYRA 5JCXA 1KVRA 4YDRA 1BDBA 4BKPA 5KVSA 3OH8A 1LBEA 2AG5A 1ZK4A 3JQ8B 1WW8A 4CLRA 1I8TA 1P31A 1T2FA 2CSUA 4Q3DA 1JDJA 1LLCA 4YYZA 4LRTB 3PWKA 5IDYA 1KETA 2QRJA 2H9IA 4GKVA 4BV8A 4D3SA 1Z74A 1BWSA 1E6UA 3RU7A 1MFZA 3RSHA 2BF7A 5AXDA 4QT0A 2WD8A 5G0VA 3R6DA 1WZIA 3GHHA 3UFXA 3V8BA 3AK4A 1CETA 4ILKA 2JHFA 2HK7A 2IXAA 1P1HA 1I3KA 4TKMA 2EJVA 4KDFA 3HE3A 3KYBA 4XZ3A 3ULKA 4KUEA 3HB4X 2QQ5A 3MEQA 3LT4A 2I76A 2ZIZA 3G17A 1QYDA 3OECA 1HYGA 2DBZA 2LDBA 4IDDA 3W4KA 2W2LA 3GRPA 2RIRA 3O9ZA 4EUEA 3VZRA 1GQQA 4L4XA 2GGSA 3ZWWA 1FDTA 2NWQA 4WK6A 4ZQBA 4RPJA 4UUNA 3KV3O 3DBLA 4BKOA 4I9NA 5CDYA 3GGGA 1F8FA 2YY7A 1QSGA 4BNJA 2IODA 4E2WA 1PEDA 2ZCVA 1GL3A 3UW3A 3JD3A 3B70A 5F5NA 4IJVA 1IB6A 1D3AA 2FMUA 4CQMA 3VOSA 3JQAA 4O6VA 3IKTA 5TSDA 5ER6A 4J2OA 1DIAA 3JQDA 2ZTVA 2V65A 2J3IA 3TSCA 2O50A 4UUMA 4IMRA 3KSUA 2CMDA 2OGUA 1MG0A 1C0PA 2I3AA 3HDYA 4FC6A 4HXYA 1FK8A 4NH4A 3RASA 3LT0A 3UHAA 2PK3A 3FR7A 5L95A 3WFJA 1N7GA 3DXFA 5MGBA 5C7IO 5T5QA 2OO5A 5L40A 1AXGA 1M67A 3IL2A 5IDQA 2NUAA 4XGKA 4YRAA 4L73A 3WNQA 4FGWA 2D5AA 3UOGA 1Z7BA 2DTDA 4TVBA 4DA9A 2PA3A 3OIGA 3RC7A 3PVZA 1LI4A 1AHHA 3DZJA 3IOYA 5JCJD 1J5PA 2PD4A 5HM8A 2F00A 1U2GA 1U9JA 5EINA 3W1VA 4Q3EA 1ZKMA 1Y8RB 1H93A 1RM0A 2D8AA 1ENZA 4Z6KA 4AJPA 3PYMA 3ZV4A 2Z5LA 3BIOA 3JD1A 4GMFA 4BIIA 1ZSVA 3KO8A 1F17A 1JWAB 2UUOA 3QWFA 3EMKA 3WBBA 3MJCA 2JD0A 1QLJA 3ZWMA 4E5NA 4M8SA 2DUWA 2QRLA 3C24A 4HFJA 3I52A 1ENOA 3IJPA 1C3VA 2JD1A 1M6HA 1Y5RA 4XR9A 5DOVA 1NFRA 2IZ1A 4RF5A 3ZWXA 4BNHA 1XELA 4BNKA 4CMIA 4AJIA 4YR9A 3VPSA 4P8RA 4B3JA 1DC6A 2WEKA 1NVTA 4JROA 2WDZA 3JTMA 1T26A 4BNIA 3PHGA 3ZHYA 3PXXA 1IPEA 2AE1A 5BNTA 1A72A 1UXHA 1EBUA 4D42A 1UDCA 2CVOA 3HJAA 4RF2A 1EK6A 3U3XA 1WMAA 3WQSB 3BAZA 3ZWVA 2O2YA 2GNAA 4MP3A 1D1TA 2UVDA 1PS9A 4FOOA 5B37A 4DYDA 5JXWA 5JDIC 1AN9A 3C1AA 1QG6A 4PZCA 1QKIA 1M6WA 4MVJF 1IUKA 5DCUA 1YB4A 1JW9B 3ZWAA 1AHIA 4J9VA 1XGKA 1WZEA 1UR5A 3BXXA 4YT8A 4PVDA 1MP0A 1QYVA 4GVLA 3PFWO 3AOEC 4FJ1A 3W8FA 4E12A 1PJCA 1C1DA 3RBZA 3ZZNA 4YEDA 5FF9A 4Y8VA 4CMEC 2V7PA 2OFPA 2GZ1A 4TVOA 4CR8A 2UDPA 3NT5A 4RV9A 4TKLA 4BNFA 3DMTA 1P1IA 4RL6A 2BD0A 4EEZA 4CMJA 2EGHA 2EKLA 4A03A 5AXCA 1ZMTA 4W6ZA 4B79A 4M89A 3ONFA 2YZ7A 4BB5A 2PZKA 1Y9EA 3WIEA 3TJRA 1A7KA 4IQGA 1F8GA 3P2OA 2C29D 4WLVA 1MC5A 2B37A 1MX3A 1PJSA 3ENNA 3AWDA 4EUHA 2AE2A 1IZ9A 4EJ0A 3JQBA 3DDNA 3WX0A 4XRGA 3LVFO 3CEAA 4BO5A 3E18A 2HU2A 4B7UA 4I5EA 3LLSA 5DCWA 3ASUA 3EW7A 3OSUA 4NZ9A 2C5EA 4LVCA 4PVCA 4WLOA 1VL8A 5KOIA 1I33A 1NQAO 5I9MA 4ND4A 4HFMA 5KVQA 4ESOA 5ER9A 4HP8A 1SB9A 5K9ZA 4HADA 3OQ1A 3KOUA 2C5AA 2HQ1A 3KLPX 1Y6JA 1UP7A 1SOWA 1BDMA 1ZSNA 2GN9A 3U4CA 4CLRB 3NJ8A 2C7VA 4EITA 2VOJA 1LSOA 4AJNA 3WTCA 4CV1A 1NNUA 4DMMA 5A03A 1Q0QA 4FC7A 3ZU4A 5JNLA 2DPGA 4FR5A 1G0NA 5GMOA 5T8KC 3PGJA 3ONDA 3A28A 3I4CA 1H6CA 2IXBA 5GZ1A 3AU8A 4A26A 1GV0A 1HEUA 5TX7A 4E13A 1PZHA 2P4QA 3NT2A 4YT5A 1GZ3A 4U7WA 3H5RA 1LEHA 1ZK0A 2W2KA 2DM6A 2FRDA 5JE8A 1K6XA 4MVJM 1YBAA 4UULA 3V1UA 1B8VA 4GLLA 1LQTA 3GZNA 3RUEA 2OP1A 1U3WA 1P9LA 3Q9NA 4IJKA 3DBLB 2LDXA 4UVHA 4MKXA 4R1UA 3Q2IA 2VYND 3OETA 5KVVA 3QLJA 5A3VA 3ICPA 1HTBA 1YBMA 2VWQA 1E7YA 3FNGA 4E2ZA 3TFOA 5DBGA 4ZQFA 3FNEA 2DU8A 3NEPX 4CQMB 3JQAB 5JMWA 1ZJZA 2GR9A 3HFGA 1Q2XA 3ZNPA 4D45A 4XQEA 4BO0A 2GCGA 4EI2A 2C82A 1EUDA 1PJQA 3I9LA 3WGYA 3BTSA 2PGJA 4CV3A 3FF4A 1K5HA 1LQUA 3K2BA 3R3SA 4P4NA 3RUCA 2HSDA 3GA0A 2CZCA 3OFSA 1JKFA 4R5MA 5A9TA 3PIDA 4R3NA 2JL1A 2YFQA 1O95A 4E3ZA 2BFOA 1YO6A 1GPJA 2WE8A 2GLXA 2AXQA 4MIEA 4IMPA 3AU9A 3K6JA 2OHXA 5DF1A 1X15A 2VZ0A 4YJGA 2IEDA 3GVIA 2G1UA 3GPIA 4FFNA 3X2EA 1BXGA 2IE0A 2Z1MA 4GX0A 5ENVA 3WICA 2FZEA 2IRWA 2V6GA 4P4GA 2B4QA 1PR9A 3BMNA 5FI5A 3C3XA 3ZNQA 4J0EA 4JBHA 4JNKA 5ENDA 3PJEA 1K6IA 1PQPA 4G5HA 1YQXA 1P0CA 3KRTA 4B7CA 1O5IA 4O0LA 5A5FA 1DHRA 2CD9A 2AHRA 2Q2WA 4CM9D 1GU7A 1YL7A 3WS7A 1C0LA 5ITWA 2IZ0A 4J7XA 1ZW1A 1NM5A 3OA2A 3VH1A 1PZFA 4ZQGA 4IDGA 1TT5A 2C7GA 1R0KA 3C1OA 3NRCA 4IQ8A 3MOGA 2GZ2A 2P9CA 3PJGA 2GPTA 3UCFA 4R68A 5JAQA 4CMIB 2HJRA 3BTUA 1BTOA 3QQPA 3PDUA 3T7CA 5AXBA 2RH8A 2X9VA 4AJKA 5KIAA 4GX5A 4LSWA 4XWYA 3KSDO 4DBZA 5U4QA 2E6UX 4I08A 3S2IA 1GFSA 4W99A 1TA4A 4RDIA 2C07A 3DAGA 1VSVA 1DBVO 2GERA 1SC6A 3BMCA 4BNUA 1JQBA 1O89A 2OBNA 2PTGA 4RVSA 2VRCD 4QUKA 1DO8A 5CPFA 3WMWA 4MPDA 4BO8A 1UAYA 2PKQO 2CF5A 1PZEA 2OMEA 2YV1A 3ZV5A 3R0IA 2DT5A 4PLTA 4U0JA 3RAJA 3F47A 3FNFA 1Q7CA 3QVSA 4JIGA 1DHTA 2I67A 3N7UA 3NKLA 5IAAA 3W4IA 4IDBA 1G1AA 1QR6A 3AFMA 3NUGA 3DOJA 1ONPA 4LMPA 2X6TA 4IM7A 1PQWA 4A27A 2GRAA 1C1DB 3SLGA 3A06A 3IUSA 4XGIA 3GG2A 2IEBA 1B2LA 3HWRA 1ADCA 1T4DA 4J7UA 1E1NA 4HFNA 1KC1A 4OM8A 3GPDG 2PFGA 4FJ0A 1E7MA 5DULA 4HX5A 4NMHA 2FY8A 3INRA 2DQ4A 5HS4A 4MVJG 3RIHA 2FOIA 1YKFA 5KJ6A 4S1VA 2GO1A 1JN0A 1U2DA 3FR8A 4ALJA 4D79A 4IJWA 3V5NA 1R12A 2ZTLA 4CMGA 1E3WB 4CUZA 3UF0A 1TB4A 3EYWA 4BNZA 1Q7GA 2D2IA 1UH5A 3FSRA 4AJ4A 1IY8A 4NR0A 4CL8A 1VRWA 4RPKA 1C0KA 4KTVE 1ADFA 5K0ZA 1NR1A 2Q1TA 5LDHA 2Q4BA 5I8WA 4CR6A 2Y66A 4Z3DA 5CEFA 5JS6A 3D0OA 5IZ4A 1BXKA 1VL6A 4YQYA 3RWBA 2VTEA 4RF3A 3JQ6A 2RHRA 2VUSA 5G0SA 4F45A 2HKIA 5DDIP 2P2SA 1GY8A 5TQVA 1Q0HA 4BVAA 4N5MA 4OKIA 3VAZA 3HG7A 1Q1NA 4H15A 2FHSA 4E21A 4FB5A 1VM6A 1PZGA 1LXCA 3DBHA 5DBFA 3WYCA 4NHEA 5IJZA 3OJ0A 4Z0TA 2DBRA 2BGKA 4O5OA 2GN4A 1LLQA 1KVQA 2AQIA 1MG5A 1MV8A 1A71A 3QJ5A 1LDGA 2IYPA 2PH5A 3KM0A 5TJ9A 2W2KB 4OXYA 2AW5A 4PLVA 4E5KA 4MOWA 4WPGA 4PLPA 2YJZA 2VNAA 5KJ1A 3GZNB 1G0OA 1PGOA 3DMTC 4O63O 5BSEA 4ND1A 3GY0A 3Q6IA 1OC2A 4CLDA 4GKBA 4JXKA 3KYDA 3JQ9A 1E3EA 3ENKA 2J3JA 1GDHA 1NQTA 4DUPA 5A1TA 3W6ZA 1PIWA 1Z6ZA 4YJDA 2Y1OA 5JDCA 4NG5A 3DOOA 3D4OA 3QWBA 3JQBC 1Z45A 2Q45A 2TMGA 5F1KA 1SMKA 2XAAA 3LC1O 3DZFA 3H9QA 5A04A 3BHMA 1YWGO 3H2ZA 2VHYA 1GQ2A 3DHEA 4D44A 4Z0HO 1N8KA 5DCYA 1IHYA 5HA5A 1DC5A 3MWEB 4N5LA 5JMPA 4RLSA 4U6SA 3V1YA 3IS3A 5L4NA 2EW8A 3L9WA 1Y1PA 2BMAA 3ZNOA 3DHYA 3C7CB 1VE9A 3T4EA 1DRWA 4L4RA 1BVUA 1NVGA 4AJEA 2H5LA 4R9SA 4IXWA 1O8CA 3LF2A 2Y1DA 4YJGB 2NVWA 1E6WA 2FPPA 1SZJG 2P5YA 1NFFA 3BMOA 1BXGB 4Y98A 2X0IA 3FD8A 3A9WA 4QSMA 1ZVMA 2PGDA 4W9NA 2CUKA 3BMNB 4CLXA 1DC3A 4N18A 3PWZA 1NHWA 4D46A 3SVTA 2O3SA 1XR3A 3NYWA 1KEPA 3FNHA 2XXBA 4MVJI 4JGBA 3GFGA 3RUDA 5I7EA 3D3EA 4CQMD 5TRTA 1J6UA 3NTOA 4ROSA 5IDWA 3MJSA 2HRBA 4FGSA 3L6DA 3GHYA 4R01A 1T2EA 2FN7A 5CDGA 1TT5B 2AQKA 1DIBA 1MC4A 2OUIA 1HDGO 1P1RA 3PHLA 2FR0A 2X9NA 4H7PA 2D59A 2D0IA 4J1TA 3GZ4A 3ZWNA 4C4OA 2Y67A 1X7GA 4XYBA 4CMHA 1YL5A 1NHGA 1ZH8A 1GV1A 4TRMA 1QXSA 1EE2A 3UXYA 2PNFA 5JC8A 4CM8A 4DXHA 3HDQA 2J5KA 3E9QA 1DDOA 3ICCA 1ONNA 1SCUA 3OM9A 1YE3A 3BMCB 5AOVA 2IDZA 3RUAA 5TIIA 1QV6A 1XA0A 3H5NA 4RZIA 2VHWA 3GEMA 2HK8A 4Z9XA 1B3RA 4MKZA 4DGSA 4DVJA 3LC7O 4D41A 1PGPA 3OIFA 1EMDA 2J3KA 5A9SA 4QQRA 2W98A 3RJ5A 1HDZA 1V3VA 1E0DA 5EPOA 1BGVA 1HXHA 4NFSA 5EESA 3VPFA 4YB8A 1PJLA 4D7AA 4UUPA 1EFLA 3D4NA 2D1YA 1E7QA 2Q2QA 3O8QA 3PZBA 3QVOA 4XD2A 4BMVA 4G2NA 1TT7A 1ZK2A 4J1SA 3VPGA 2X0RA 4RJTA 1ISMA 1HSOA 3GG9A 2FR1A 1LSSA 3AUSA 3Q3CA 1HDOA 2VWGA 1KC3A 4I1IA 3F4BA 4RPHA 2NU9A 1JLLA 3PPIA 3VC7A 1N1GA 1PJ2A 1U8XX 4BO2A 2HMVA 3WIDA 1LC0A 3NDIA 4OHUA 7MDHA 4L76A 3MWDB 5JO0A 2NLOA 4YWJA 3WSVA 1CF2O 4WKGA 3IDSA 3S55A 4PLWA 4HBGA 1OOEA 5BT9A 1ZK3A 2HLPA 4D0RA 1V8BA 1ZEMA 3I9NA 2AQHA 3PQFA 1EVZA 1RM3A 1NTOA 3C7AA 2O7SA 4IPTA 4NI5A 4B4VA 2B4RO 1N9GA 2BRUA 2UUPA 3I9OA 5G0TA 4D0SA 1WNTA 3QRWA 5ILGA 2BFAA 4BGVA 2YDXA 3ON5A 3H3FA 4WCFB 1UAGA 1KEVA 2J5QA 3DL2A 1U5CA 3D1LA 4GQAA 3JQGA 1ISHA 1E77A 5GY7A 3H4VA 1PGNA 3KBOA 4DPKA 2GSDA 3S2GA 1S6YA 3HNPA 2EJWA 1LDMA 3D5TA 3K9QO 4NBWA 4E2YA 3AJRA 1LSUA 4Y67A 4Z9YA 2Y0DA 4OO3A 1YB1A 3RFVA 4EDFA 4YAJA 4CM6A 3OJFA 4U6QA 3JYOA 4XQCA 4MIOA 4BMSA 4BOYA 3JD4A 4GLOA 1QLHA 1ID1A 1YL6A 1Y8QA 1JKJA 3B1FA 4QO8A 5IZCA 3DZKA 1HDXA 4BNWA 3GT0A 5CPBA 3MTJA 4IUYA 3RU9A 3DBHB 4K28A 2H63A 5FI3A 4F6CA 3FTNA 5DP1A 2PR2A 3AY6A 2V6FA 1GEEA 1UP4A 1WDMA 3INTA 4PLHA 2HO5A 4TSKA 3G79A 5F1PA 2BH9A 1VPDA 5IN4A 2X5KO 4J1QA 2Q1UA 3WLFA 3DBRA 3GR6A 3KZVA 1ZMOA 3NGLA 3ORFA 4ITUA 4A5OA 4B7XA 3ZWOA 3QV1A 2EP5A 4QX6A 2J6IA 4CR7A 1ML3A 1U4SA 1E1MA 4BGUA 1LDBA 2ZQZA 1BSVA 4B8ZA 1DAPA 1I01A 1RKXA 1CEQA 3KYDB 3MJEA 1UZMA 1R4MA 4M87A 3FPLA 4F46A 3WGHA 3S2EA 2V6MA 5BQFA 4JJIA 3D7LA 3LT2A 4YJHA 1ZXBA 1LC3A 2O7QA 1DIRA 3M2TA 3JQEA 4PLGA 5H81A 4LGVA 3RCBA 5JY6A 1B8UA 3RC1A 2JFFA 2A35A 3F5SA 1MXFA 2YHIA 2Y93A 2C59A 3OA0A 1OBFO 1S7CA 4WCFC 1R37A 2ZKLA 3FBGA 3JYQA 3VDQA 2CNBA 2FSVA 1I24A 1GUFA 5EQFA 3IJRA 4D3FA 1V3UA 4JJGA 5FFFA 1LTHR 3WGZA 4XQGA 3GNTA 4TRJA 5MDHA 4NPCA 3Q1LA 1HYEA 1AXEA 3U5TA 3GMSA 1KYQA 3TL2A 1HL3A 3M2PA 4JX8A 3S2FA 2DFVA 1DRUA 4LW8A 3ZV3A 4QFDA 5COBA 3PTZA 1GUZA 1R0LA 3CTMA 3DMYA 4XEHA 2HDHA 2WD7A 4CQLA 4YAIA 1SO8A 1C1XA 3BMOB 4NBVA 4TZKA 3EUWA 2XPCA 1N92A 2G5CA 3RBXA 1WP4A 4FBGA 4XB2A 4E0BA 3ZHBA 3LSYA 3IAHA 1YDEA 2FR8A 1UUFA 4YRDA 3WTBA 2HMSA 2JCXA 3EVNA 1E3IA 3BTVA 3WG9A 3RUIA 3I5MA 1ULUA 2EIHA 3VH3A 4IZHA 1H6DA 1PJTA 1GAEO 1YRLA 3TL3A 1KIFA 3JQ9C 2I66A 3ST7A 4RLHA 3TZQA 4RVGA 1EVIA 5B12A 3TRIA 3ZN2A 3PK0A 5JDCC 4EBFA 2X0NA 4II3A 2YUTA 3IMFA 4LCEA 3UAGA 4QXMA 1P1FA 2X5OA 3L77A 4KDEA 5A05A 5DBIA 4MVJA 4L74A 1B16A 1XQ6A 4WLFA 4PG7A 1KEUA 2Q46A 5JAMA 4CM8B 2QHXA 3FTPA 3RI3A 4FFOA 2DC1A 1PGJA 5JAZA 2VWHA 3JYPA 3DR3A 4EJ6A 2ZTUA 4ZQEA 2VUUA 1ADBA 4N54A 3VKUA 1TI7A 4TQGA 5A9SB 1IPFA 3BHIA 4PG6A 3WSWA 4PN3A 5K6AA 4LSMA 3OIDA 3B1KA 4GMGA 1B7GO 2X4GA 4GSLA 3ZWPA 4HY3A 5L4SA 5CAEA 1DJQA 1I36A 1X0VA 1X7DA 3BTOA 3V2UA 4CPDA 3O8QB 1V35A 3TFQA 4OOFA 2Q1WA 4FW8A 1BHSA 4R41A 3GC6A 2PZLA 4UEKA 1F06A 9LDBA 2DLDA 3ZDFA 3EZLA 2WE7A 3ZHZA 1NQ5A 1PL8A 1VI2A 2ZJ0A 4UVGA 3GUCA 4W9NC 5JYDA 1HDCA 2PLAA 3DOCA 2AG8A 5L3ZA 3NDJA 2JD2A 2DBVO 4OQZA 2H1SA 4R4JA 1WXDA 1F12A 3KTDA 4IQ0A 1J0XO 1VSUA 2ILTA 3ADPA 3CKYA 4KP7A 2VT2A 2AEJA 5FWNA 3DQPA 3I83A 3HFSA 1QRRA 5AYVA 2BFPA 4PG5A 1N9GB 4WNIA 4E5PA 3W8DA 1HF3A 4BL5A 4J49A 3G1UA 3I3OA 4GI2A 5JYEA 3JYNA 3OEYA 4MP6A 4URFA 2VWPA 2Y05A 1NBOA 3ANNA 4U5QA 4QFCA 5H82A 3JQGB 1DIGA 1QYWA 4AFNA 1PL7A 5CHEA 3DBVO 1FJHA 2EEZA 1SPXA 2Y68A 1V9LA 5DNAA 1PQUA 1NASA 1LX6A 1NPDA 3QY9A 5JCJA 1J49A 1BG6A 1Y9AA 1DLIA 3GGOA 4NJOA 4BS9A 4NBUA 1I10A 4YJFA 1EDZA 1GEGA 5IXYA 1NWCA 2X86A 5T64A 1Y81A 4J7CA 3MZ0A 4DMLA 3GAZA 1T2CA 3RVDA 1RPNA 1NQOA 2C2XA 1E5LA 1M2WA 3OP4A 1YQGA 5C3MA 2VHZA 3VPHA 6LDHA 1D1SA 5G0WA 2WYWA 2BKAA 2PY6A 4YT4A 1WDKA 4XB1A 3I4FA 2ZB7A 4ND5A 1T1SA 1TLTA 5FYDA 4YACA 1NX6A 3BMQA 3E5RA 3AI1A 2EKQA 2DTXA 4PLCA 4R51A 3FRJA 1B14A 1I3LA 3ANLA 1D4FA 3GN1A 3M1LA 3OICA 1RYDA 4WGGA 2B35A 1LRLA 1LRJA 1DPGA 3JSAA 2Y99A 1R4MB 3MOIA 4R16A 3LT1A 4MVJP 4YJHB 3U9LA 1HE2A 1KVSA 4CV0A 4L0QA 5C37A 1XU7A 1LDEA 1K0UA 2I3GA 4TROA 4J2HA 4QO7A 1UZNA 1LNQA 2YHIB 3GEGA 3UICA 5L7WA 4NIMA 2VTDA 5TC4A 2BLLA 4KMSA 5F21A 5JBIA 4Q3NA 5DN9A 4ALIA 1P0FA 3K73O 3EAGA 3K96A 4ID9A 1XIVA 3GGPA 5CEEA 3RFTA 2VN8A 2Q1SA 2RBEA 3F9IA 2VZ9A 4JP2A 1H2BA 1JVBA 1BRMA 5KTKA 4J0FA 2CVZA 4JP3A 4AL4A 4Y6PA 3I6QA 1ZEJA 3WLEA 4YCAA 3F1KA 3NTQA 4TZTA 1K89A 1T25A 4CM7A 4RF4A 4EYEA 4CMKA 1SAYA 5IZCC 2CY0A 4Q3CA 3C7DB 3LLVA 3QP9A 1ARZA 4MVJH 1P45A 2I99A 2WD7B 3KSZO 4M55A 4M1QA 3PRJA 4XKJA 4CQLB 1C1XB 1MGOA 2X0JA 4XJSA 3WFIA 3I6IA 4INAA 3M1AA 3S1LA 3AM5A 1T2DA 1Y5MA 3PFFA 4BUCA 4EZBA 1KERA 2GYYA 4ZN6A 1YJQA 1BW9A 3PLNA 4UUOA 1DB3A 2BGMA 3KVOA 4CLHA 1P1JA 3GVPA 1ISIA 1I2ZA 2E48A 3AW9A 2B36A 1R4NA 2G17A 3DHNA 3GAFA 1FDVA 2PD3A 1B8PA 4RDHA 3TNLA 2NU6A 3ROMA 4YTEA 1NYTA 1OAAA 2W90A 1QP8A 1W4ZA 3GFBA 3OJEA 2QYTA 2GN8A 3GMDA 2PWZA 2NSDA 1VLLA 4I5GA 5DT9A 2VOEA 2BHLA 5J23A 4XYEA 1IL0A 3DFUA 5A02A 1KVTA 1GPDG 3SJUA 1VJ1A 3A14A 3H5AA 4FOSA 2Y1CA 3ASVA 1QYCA 4FSHA 3TZKA 4UAGA 2X23A 3CPSA 4I5FA 4I9HA 3RUFA 4P22A 3QE3A 1UXKA 3LF1A 2WWRA 1I2BA 3TZCA 1EQ2A 3VHRA 1F14A 3OBBA 4FIZA 5EMHA 2SCUA 5BR7A 4XIYA 2AEMA 3L4BA 2CDAA 2NVUA 3O4RA 5DOZA 2DFDA 3GDGA 3NDRA 4TMFA 3UUWA 4DQUA 1OI7A 5THKA 4KTTE 3IKVA 4AJ1A 4Y6RA 4UVDA 3PIIA 1W8DA 3VZSA 5U9CA 2EV9A 4MDHA 4CM3A 1KOLA 1P74A 3RC9A 4PLYA 3VH2A 3DB2A 1JA9A 2FSSA 2DVMA 4ONEA 3I9JA 2B83A 4UVEA 4EGFA 1DFGA 4PCVA 5JY1A 5BNFA 2D3TA 4E30A 1N7HA 1MFPA 3DAPA 3VTFA 4JLWA 4A73A 3ZU3A 5ADHA 3NJ4A 1GTMA 1ZCJA 4KZPA 3RC2A 3E82A 1TEHA 4FFRA 4L9RA 4EEXA 4RPGA 2AA3A 1MB4A 2NTVA 3EHEA 1U7HA 3KHUA 4I9UA 3WNVA 4NFHA 2B4TO 2CDBA 1QYXA 3LK7A 4YAEA 2X22A 2OL4A 4OXKA 2WMDA 5TS3A 2HJSA 4J1NA 4W82A 3HZZA 3AOGA 3WJ7A 3JD0A 2X7HA 3U62A 4H3VA 3E1KA 5G4LA 1PJBA 3STHA 1L7EA 3TQHA 1HKUA 3DZHA 3GUYA 1LSJA 1XQ1A 2HRZA 1U3TA 1ZFNA 4NK4A 3QWIA 3RBVA 3HDJA 1YQDA 4PIVA 4M86A 2VQ3A 1K6JA
chains in the Genus database with same CATH superfamily
1II8A 2CD7A 3EY4A 2P9GA 1RACA 4HC4A 3I39X 1H0KA 4Y1GA 2H7XA 4A36A 2CXQA 1P81A 2CL5A 4YJFB 4DIDA 1ODIA 4E6PA 3U49A 5EP1A 1P7VA 9ABPA 1BS9A 3LOPA 1W48A 3PXCX 5LP1A 4DSTA 4ITVA 4Q7EA 4GYYA 3SR0A 3WYBA 3CN7A 1WU7A 3DMHA 3G8CA 3NIDB 1N5KA 4OQ4A 4YPVA 4R3UC 3GDFA 4FI3C 1X86B 1F2UA 2AYXA 2P4UA 3WYNA 2Q2VA 3ZI7A 1DIOB 2AJDA 2JFWA 2RHGB 3FBWA 3HB5X 3C3CA 3HHPA 2PL1A 4LJ8A 4M54A 4A0GA 1WUKS 3D6NB 1NA5A 4X1YB 2UUCB 2HMTA 1QR2A 3EVTA 2ADMA 1HZJA 1WCWA 4IIJF 1WNFA 1ZK1A 2NO1A 1D0SA 1XAIA 2GA8A 2Q5IA 4M0DA 3C70A 1GRQA 1I6KA 4CKZA 4IJQA 1OBCA 1BJTA 2IU4A 1GUDA 2QYSA 2ZIFA 4GAEA 5HE8A 4BLUA 5FPKA 5KTOA 1ST2A 3EEOA 4BNLA 3DV0A 4L0DA 4DNFA 1KVUA 1L5ZA 3QJYA 4K9PA 1E4VA 3FPFA 2IPNA 4CXMA 5K6TA 1FP1D 1E2DA 1LPNA 4Y2GA 3CN9A 2BI8A 5EIHA 1B73A 1E20A 1ZLXA 2B1JA 4RORA 4LF7B 1KPGA 1R50A 2EX4A 3QMWA 2BCGY 3PC7A 4G81A 4J91A 4NFYA 4H4CA 4D8XA 4EB0A 3BA1A 3EG9A 2AC4A 3KE8A 4HYEA 5A9RA 4ZWNA 3HMKA 4X41A 5LN1A 2JHGA 5B1DA 5EJ6A 1HDRA 1ULSA 4L75A 2A1UA 3AEUA 3K8OE 4BVHA 3PXDA 2FN4A 5KYVA 4E46A 1G9TA 3EYAA 4QXAA 4TTPA 2XXAB 1YZYA 5JYCA 3Q3EA 3X2FA 3DJFA 5AKLA 3VR0A 4Y6SA 3ZHCA 4G5RA 4XM0A 4AZ3B 4S1WA 2IHTA 5HVNA 5HPYB 1XL0A 1S8AA 1JLKA 2B5OA 3HPRA 2BJHA 5IH3A 3ZQ4A 1XNRB 5KYGA 2A57A 3AR2A 3JQAD 1X7YA 5CHYA 2VT7A 4ZICA 2V3CC 1U04A 2C2MA 3VUEA 3D7NA 1U7TA 5BWNA 3OCYA 4GPTA 1KIMA 1RJ9B 3JRXA 4WT7A 4UAVA 4F85A 5DLEA 2R6FA 1SOAA 3UT5A 1CUWA 4NXMB 5D01A 3E7FA 1L7VC 3CINA 3HU3A 3IYLW 3RH0A 4BLQA 5CJJA 1PWXA 1DX4A 2EEPA 4TL9A 1JDVA 1JDSA 2G4LA 3C87A 5BRNA 1G3MA 2FK7A 4HD8A 2IV2X 3RF7A 1XMXA 4FMBB 3VPXA 1XF1A 3UK0A 1UJCA 2VJDA 3LA8A 1QP7A 2BHTA 3WL6A 2QN3A 4H2DA 2HU8A 1CF4A 4ETMA 1DT3A 2GM9A 5FWYA 1EEHA 3N2ZB 5CVUA 2JCYA 3U44B 1BVRA 3W90A 3DWIA 4D6PA 2CDCA 3FDFA 4OXNA 3FOZA 1RYMA 3PG5A 2XKJE 5EIOA 3DFZA 1FS5A 2I9PA 2ZE5A 5JANA 2GZ3A 2B7CA 3UJCA 3SFZA 1AUXA 2HO4A 4NYIQ 3MINB 1G6Q1 4NBTA 4F5YA 1M10A 4B4WA 2BW0A 3F6YA 1J1IA 1FQOA 1IHOA 2PX4A 1CUZA 3USCS 4CLOA 5IVPA 3UGJA 3Q7EA 1JEQB 4RTKA 4GR9A 1FRQA 5F5LA 1GN9A 2ZB8A 2O1EA 4JJ7A 3UGKA 2J3DA 4G37A 2OXIA 2PZJA 2VAWA 1QGUA 4KVGA 1S3IA 3DQQA 3FMVA 1Y8ZA 3TLJA 5A5EA 1E1RD 4HGYA 3VSCA 3W5IA 1NBAA 1QQ7A 2I7DA 4EMBA 4MV5A 1XZMA 1P0PA 2ORWA 1IONA 4IIGA 4LK2A 3RS9A 2VT3A 1SC3A 1T4MA 4L2IB 3UMVA 5L9AA 8MHTA 4X24A 4LSGA 5F7OA 3CH4B 1Z13A 4NEHB 1P6XA 2VH2A 1IZ0A 1RRFA 3KC2A 5DM2A 2A86A 5FUQA 1MAVA 4TYYA 3GBSA 1TF5A 3TE6A 4KSCA 3KU1A 3KOXA 4HNAB 3ZCXA 4MR7A 3KQWA 4C4PA 1F51E 3GDOA 4C7KA 4H77A 4HVLA 5BN5A 1AA9A 3B89A 2VRBA 3WOHA 4D97A 4KR3A 3CXRA 3NGXA 1KWKA 2HXGA 1RM4A 2DKFA 4GE3A 3DV2A 1W8IA 4JWTA 2QTZA 4L9WA 5GJWC 1KHTA 5HZKA 4YFYA 3IAS1 4I3FA 3ETDA 1K63A 3NIWA 1UBSB 1Z4NA 4UNQA 5DASA 4RVUA 1NVBA 2JIRA 2EFGA 4A0SA 3RE1A 5A7FA 5EOVA 5FOSA 1U6KA 2FVXA 4LCJA 5IFKA 5I9LA 4J3NA 1DAMA 1W36B 1YS4A 4JL6A 4PQFA 4OHVA 3LG2A 4Q9IA 1JJAA 3GLSA 4OY3A 3FFXA 1C2YA 3GYBA 4NBNA 4I6EA 3ASYA 3N2LA 2WM9B 4IHJB 2PKWA 3T4PA 5BY2A 2C84A 3CS3A 4LHVA 3GJ0A 5TQ2B 3KPYA 1SOMA 4RHXA 1DTSA 5LC1A 3C5EA 2H1WA 4KO4S 2PX8A 2JLCA 3QOFA 4EHKA 1T8TA 3LM8A 4IZOA 2RGEA 1CLUA 1EXDA 1MUUA 1W5BA 2OFFA 4ZYUA 2YFKA 4ND3A 3CCFA 1HNXB 3R2JA 2OOKA 3S2YA 2FFQA 1C8KA 1THTA 3C16C 3A4YA 3QMVA 5CX4A 2BELA 2JFUA 2NQ2C 4IGAA 5ALEA 3M3PA 3GU3A 2UVPB 4NNJA 3I6ZA 4PC1A 3FDJA 4QXOA 2ZB4A 2R85A 1M74A 5F3RA 4UUQA 3L4EA 2ZI7A 1L5HB 2YFYA 4JU8A 2QTBA 3DFKA 3EMDA 5G1OA 1L4GA 3SXUA 1ESZA 1TA0A 1U7XA 1WXXA 3C8DA 1DEAA 3DTYA 4NZNA 5JSQA 2E4AA 2W2VA 2EZ9A 5ERYA 4PZ0A 1W29A 1A8PA 4KWIA 4MRAA 3V7NA 2LD4A 1GPKA 1L7MA 1TYZA 1VPTA 4HNSA 4X3CA 1HM5A 4M4SA 5IMBA 4NQZA 4MAAA 4B8YA 4AY2A 3HI4A 4YT2A 1HEIA 1OGIA 2B8WA 2XBUA 1SR8A 4GVXA 4KQKA 4IY1A 3O26A 4MCAA 4UUBA 4XGNA 3SSNA 3TLCA 2HK6A 3I76A 3MD9A 1FUKA 2C0CA 5KC9A 3F6PA 3L4BC 4QNNA 1XWWA 4LRYA 5JWOA 2ZULA 3ZJ4A 3K6SB 1ZGAA 1ACMA 2VG8A 4RABA 4L78A 3PC8C 2Z0MA 4BE9A 2G76A 4L3OA 3TS1A 3B1XA 5LUBA 4B0PA 4BQRA 4CEJA 4UNSA 1U8UA 4QATA 3PUHA 5E1MA 1B3BA 3JR3A 4MW9A 2WUWE 4JI7B 4WDQA 1AZWA 4YRJA 4GP9A 4NXNB 2XUPA 3G23A 4Y2XA 5JZ9A 1RCTE 2DAPA 3KD3A 1H9AA 3QEMB 4NMMA 3ANMA 3EIOA 3Q5GA 4C43A 1ANKA 2N47A 2WIBA 4EMUA 3BIFA 4BGEA 1NXXA 3NV9A 4NH0A 4DB4A 4N39A 5A6SB 5KOJA 2AJTA 1JE0A 4B7ZA 4DUZB 3EDCA 3SBXA 4CL3A 3ELBA 5IYZF 3C6QA 3O83A 4X90A 2ZUWA 1QKKA 1RYEA 2EVWX 4BKQA 3HU2A 4XDYA 1JR6A 1SUPA 4G25A 2IV7A 1LV8A 1MX1A 3FJYA 4OQDA 3GRKA 3R3ZA 4HRYA 3SF0A 5IAGA 3TZHA 4Q4HA 1NPYA 3N5KA 3A0RB 2AOUB 2GDJA 4KO2S 3ROQA 2WWTA 3RJ9A 5CFZA 2ZYHA 1CDDA 4JJKA 3BFJA 3IUJA 5J4VA 1UXIA 1PR3A 2HA7A 2WJPA 3LH5A 4U0KA 4QQNA 2JAQA 3X43A 4HTAA 1N1EA 4GBMA 5LQAA 3OCVA 5C7LO 4ZDJA 4JLDA 2D7CA 4C4AA 4DLBA 5KYUB 2R4TA 2V1UA 3E9YA 2OHFA 3X44A 2B0JA 2E4UA 4JEIA 1VKHA 4DF3A 3IAS6 1WL8A 1LU9A 2FX5A 1FYWA 3PHBE 4RESA 3KTAA 4ZMBA 3E03A 2Q9UA 1G4UR 1V5GA 4S3MA 4OJNA 3KQUA 1SCDA 1RR6A 1YQEA 2ZYTX 3HBMA 1Y7LA 3FWKA 4HLQB 4AS2A 2OBXA 4PGAA 2IXTA 1JILA 2MOKA 3IBCA 3L07A 3TTTA 4CNQA 1LVUA 3RYCB 4L0CA 3EFBA 1UKVY 3O1LA 2QTVA 4J4HA 4XW2A 4PRYA 1RS0A 3VX3A 1EFRD 2HF2A 2GPNA 1GCGA 1Y3HA 3O7WA 1EP1B 3D0KA 3IUEA 3FCEA 3L6EA 3IBSA 1OFUA 4V2UA 1DZ3A 4MYTA 3Q87B 4KW7A 5LA6B 3KXDA 3WL7A 1DINA 3ZTYA 4C0SA 3PUKA 1E6EA 3D3WA 1CS4C 4GH5A 1N5MA 4NCBA 3LGAA 2XMDA 4OSEA 3E5MA 2YQ4A 4CM4A 3Q7TA 3ECSA 4PAQA 4U00A 2HN9A 2PRZA 2XT6A 4HB2A 4EO4A 1DJNA 3ENQA 1XVLA 4PBRA 5MFZA 1IVYA 1Z5ZA 5JCPA 1CULC 1TXGA 3DP9A 1G59A 2XNCA 1L7DA 1VXRA 1ZOIA 3WLTA 2XZLA 3MUEA 3WE7A 4TUYB 3SF8A 1H69A 1BD4A 2MSKA 1U0HC 5H70A 4OJKA 1R0SA 2CVHA 1I1OA 1Y3CE 2PQ6A 1E9VA 2C2YA 2P7HA 3HYRA 2OV6A 1SPBS 2QRKA 3FYUA 3P32A 5CW2A 4K9RA 3VHXA 4CCSA 3EXHC 3ADDA 1T10A 2HSEA 2OOSA 3CG4A 2LIPA 2WC1A 3URKA 4ERNA 2Z1NA 1VKZA 1E4EA 1T13A 1X38A 2OILA 2Q7XA 2IBMA 2VF4X 3A7EA 3NBMA 3WJAA 2ASVA 5B5SA 5JH7F 1C29B 1O77A 4WZZA 1U94A 3IOBA 2KW5A 1XZAA 4RE5A 1NLYA 2GF2A 2BKUA 3W5UA 4J3JA 4CEHB 4XOUA 3ZHTA 2Y1EA 4OI2A 4ANFA 4BMNA 4C2AA 1I7LA 3IQIX 1ZIPA 1ENPA 3U4HA 1EE9A 3QE2A 4DQXA 5EP3A 5CP8A 4LV6A 3DLPX 4H6PA 3ZPXA 4BO7A 4E1AA 2ZRLA 4LOAA 3NH9A 2HWUA 2X3UA 1JAXA 4YO7A 2C3PA 1T2AA 1JJIA 2J9XB 2WZDA 1ECJA 2PLNA 3SX0A 3OQBA 4J6FA 3FVVA 1Q0RA 4F5ZA 5KNLA 2AR0A 3KL2A 3OE7D 5KQGA 1I1NA 3HSKA 2DCUA 3AERA 3CX3A 3MIZA 1YU9A 4R6WA 4Z0PA 2XMBA 1YD7A 5CT8A 2WV7A 2DR3A 3P5SA 5KU7A 1XZIA 1K86A 3L7LA 4HGPA 4E4RA 4D98A 2JFZA 4IRUB 2NVBA 4DBVO 2AEFA 1GZHB 5DLDA 4B82A 5ALWA 2ZVJA 1Y9ZA 2JA1A 3GXOA 3I73A 2CLHB 2OG1A 4L3WA 5EYPB 3RTBA 4XRRA 1UJMA 1W52X 2YIVX 1GPLA 2XXJA 4GRIA 1NBEA 1PWZA 5FBRB 2XLBA 2BGLA 3QU5A 1SURA 1DJLA 1IOLA 4HWKA 3UAWA 5BT8A 5C5CA 4G26A 5CW1A 2QTWB 1T43A 4BAUA 3N8HA 3ZYCA 1ZCZA 1N2GA 4EG7A 1BMDA 3IIKA 1GA1A 1LBIA 3EA0A 3O4FA 4HVTA 1W4LA 4QOSA 4WJZA 3IIIA 3G0CA 3G8DA 3MGAA 3SDSA 2YMLA 4UZEA 1U28C 2R00A 2BF4A 1HLPA 3MFYA 1KY4A 1IBCA 3KJXA 2WSLA 3NTUA 1TKCA 3JVDA 4MYCA 4HDMA 4PZZA 4QXRA 5FIUA 2NYAA 1E9CA 4KB5A 4BWVA 3MTQA 2LTAA 3X1ZA 2WZCA 5GZ3A 5JD3A 1Y8QB 3Q0EA 2VDRB 5G0UA 4D9GA 4EHJA 3N5CA 1S9DA 3FPJA 1K9VF 5IX8A 3DTTA 3HRKA 3U4QB 4RIHA 4KR2A 1MJNA 5C80A 5I5EA 4F3TA 1QBGA 2W6MA 1L4YA 2H29A 2W8BB 1J4AA 3TNFA 4C14A 4CKEB 1KZ1A 3TIVA 4AF6A 3NP9A 2MINA 2NZJA 1RHRA 1UDAA 4J90A 3O8RA 3K9CA 3WMGA 2GEDA 3HFJA 2IXFA 1H6AA 1WVGA 2LKCA 3EEQA 4FINA 3OC6A 4MW4A 3CVOA 4Y0VA 5FTKA 2WSYB 3HJHA 2ZAGA 4MRRA 4YY3B 4OGKA 1I3NA 2XWBF 2AVNA 5B4TA 5K20A 5AQ1A 3QHPA 3RKSA 3WLLA 3ZDCA 1CJSA 1GVHA 2XD4A 3CX8A 1S96A 2PXAA 3QNWA 4P83A 3II6X 5KQPA 1CLEA 1NUPA 3GF4A 3CO5A 1L3BA 4MWTA 5DXJA 3TB6A 3UAYA 1OYYA 1A2OA 1K06A 4U7HA 3ITNA 1WWKA 1D07A 1WTCA 3O6VA 1T9HA 3OFND 1MXHA 5EQDA 1J9ZA 4IJMA 4NCAA 1HBJA 4R84A 1T6YA 1MVOA 4JSRA 3HXOA 1IM5A 5C5EA 4DWVA 4WZBA 3TW4A 4RD4A 4XR4A 4PQGA 2NNWB 1XCBA 4O33A 5TEWA 1N78A 4G5SA 1QS0B 4UASA 1ZM2A 4LI3X 2OV1A 1UPXA 3OEEA 4I8DA 3TNDA 3L8ZA 3QA9A 4IG9A 2UYYA 1E3SA 1CUVA 2HEGA 3IPRA 5BR8B 3ESAA 1PDVA 3ZV6A 5JISA 4UHHA 3ETLA 1KI9A 1P5FA 3K0CA 1BMFA 4RULA 2Q5HA 3KPVA 1CJUC 3CIOA 3H1PA 1F9EA 4EB8A 3GN2A 3ND7A 4HLUA 2H3EA 2ETXA 1P8JA 3QW4B 4Z49A 4ZI7A 2WJVA 2VJMB 4XFKA 1XZNA 2G9RA 3KHKA 3KYCA 4B2LA 3HR4A 3D64A 1P9OA 3BH7A 4IS2A 2CNWA 4PONA 4YASA 4RD0A 2WICA 1RXSA 5L4LA 3TIXB 5A62A 4YMHA 3T4UA 4WNAB 2JFGA 1MDBA 3S4YA 1C3OB 1YNSA 5JCOC 1E2GA 2FW7A 1J20A 1NMQA 1ZI9A 3E2IA 1Q0ZA 4ZDWA 5BSTA 2G09A 3B78A 3LHFA 4TX1A 3LW8A 4WVLA 1E92A 1ZCBA 3KR9A 2C5BA 4LAFA 4KE6A 4FHDA 1GYRA 1CR2A 1NUAA 2VDWB 3OE5A 5ALRA 3T61A 4ZDIA 5HOEA 5FT9A 3ZTWA 4B80A 2VEOA 3P4XA 2C42A 4C7JA 1BCSB 3GJ6A 3P9RA 3V33A 7REQA 3CJRA 2E37A 5LQSA 1NXQA 1XKQA 1MC1A 2BTQA 3N53A 4XSHA 2FPGB 2O52A 1P19A 2FZVA 3STWA 2A6PA 1TJNA 1NL3A 2GXQA 3BFVA 3KDPA 3RIEA 4IOKA 3UQZA 1M8GA 1YKSA 4TMVA 3BILA 3SEAA 1YHZA 2PKRA 2H18A 1S8OA 2V59A 1YCHA 1ABFA 2X77A 2ZPUA 1Z33A 3KLMX 1RHQA 4KDCA 4RZ3A 3W0LB 5GVSA 5DE3A 2QUKA 1HT0A 2O3QA 5ARCA 1B42A 1V11B 3LLMA 3PQ3A 4HN2A 4OSOA 3AWIA 2O3JA 3SN6A 2NXJA 3RVBA 3UEOA 4B5LA 5BORA 5I51A 4EYGA 1NXSA 4LJ5A 4B3SB 4F3NA 3JYLA 2R11A 3V1TC 1DSSG 1G8SA 1OT5A 3T41A 1GTJ1 1RBYA 3C1TA 1FJGB 5CFRA 4ALNA 4RHFA 3K0FA 3P0IA 4HMQA 4D25A 3OLQA 2J5RA 1OMOA 1Y3AA 1Z6PA 3EPPA 3R44A 4KMOA 4ER3A 3ROXA 5AUQA 1A7UA 2DHEA 3UUGA 5C32A 4ZCIA 2WDPA 1VBKA 2P6OA 4JVLA 3VJMA 4EW6A 4QPJC 5CFMA 1Q19A 1FTSA 1WG8A 2PT5A 2GKGA 1LJ8A 3BWDD 4FFPA 1BIFA 2BFDB 1YB6A 2WYVA 1QORA 3UKOA 4I5IA 5BSGA 4B6JA 4UBOA 3SQWA 1FDSA 1T4BA 3DF7A 4LK3A 5BWLA 4RDXA 3F4LA 2EG9A 2II6A 2PV0A 3DL4A 3ACDA 4QPZA 5F2NA 2YWCA 3NIFB 3OI7A 3AR6A 2G0TA 2ONZA 3IEMA 3Q3HA 4LF8B 5JRDS 3E9EA 5CDSA 2NU7B 3NVDA 3K70C 3PP8A 1DAGA 2IZ5A 4IOMA 4NJMA 5BOVA 1UKAA 1MZPA 3V2GA 2ATIA 3ETEA 3SU8A 2JZOA 3JQFC 3V4PB 1VE3A 4R1QA 1WPXA 2I4IA 3DVAA 4YA6A 1NJ2A 1YVDA 4L95C 4NHOA 1ZWLA 1BROA 4X94A 4WNYA 5EXSA 4CKXA 1IBRA 4PGFA 3TINA 4U9HS 3KVNA 2YVUA 1HRDA 2VYNA 2G4VA 4GX2A 4V0ME 2OBMA 1XEAA 2E55A 4LZWA 4BNVA 5JH7B 2TSYB 1PK7A 3O3NB 3RSZA 2IF0A 3IT1A 3TTYA 2XA2A 2ZWPA 4FYXA 1GZ5A 1NP6A 4ASUA 1CJCA 4EX6A 1ML4A 2H1CA 2PZMA 2GBLC 2I0FA 5I7RA 1L4KA 2H06A 1YS6A 3VU9A 1QZUA 1Y0BA 1ZO8A 3JPYA 4GOJA 5GINE 2XJ9A 4MS1B 1PR6A 3G7NA 2N0SA 5IUKC 4Z4GA 1ADYA 1SC9A 2P77A 1W49A 4UHCA 1K7SN 3CF2A 4NECA 5BYAA 4WCFA 1NFQA 3BCUA 4Q16A 4CIBA 2P6NA 2H7YA 1MQ9A 4Z9BA 5G4KB 1V0JA 2N1MA 1LDNA 2IYEA 2IP1A 1Y82A 4RO0A 3E3NA 4BQQA 4XJTA 2NP7A 5GZ6A 1E8NA 3TSOA 3SAJA 2DPYA 3Q10A 4BUZA 2CNLA 4N12A 1QZXA 2BGNA 3GRZA 4ZT6A 3LQ4A 1Z8HA 2A9JA 3O91A 2WQZA 1OGJA 5EKUA 3VTKA 1NI3A 1KMMA 4LZAA 2W22A 3RTEA 1S2IA 3JVIA 3P4UA 3A6EA 4PLZA 3B20A 1Y63A 3ENWA 3R41A 4G0XA 4WK2B 3CC8A 4YAKA 4PIMA 4KQFA 2IHNA 4ZYVA 3EPRA 1XZFA 1N57A 2DHDA 1NNSA 1RJEA 3HLKA 5EWMB 3IQFA 5A4DA 1HTTA 5FOTA 1L9XA 4CKCB 1SVKA 3PDHA 4LECA 1BFUA 4URXR 2WIJA 3BEDA 3D0QA 5T6BA 3WZ2A 4CKWB 4D57A 1V26A 3EVAA 2FW0A 5IT5A 3CVVA 1EG7A 3HP1A 2CFOA 2GZMA 2PUTA 4HS4A 1YI8A 4TQAA 1VJCA 3AZOA 3GELA 4IXTA 4WASA 2XEXA 1MJGM 3ESXA 3P19A 4G9EA 5F76A 2XWSA 2FEAA 5HOQA 2PH3A 4UAUA 1VHDA 1CU1A 3AUUA 4P2BA 4O4LF 1F4PA 4JK3A 4Q21A 3IHTA 3UH0A 1K7YA 4A1FA 4ZQIA 1DQZA 2BFBB 5K2MA 1E0KA 1A9ZA 4MI3A 1TVEA 3MTGA 3OF3A 5AVKA 1JHDA 1W85B 4XYGA 1MKYA 2WF9A 1APBA 1XUOA 2ZJ1A 2DSTA 1Z82A 1WM1A 4J4BA 4MRMB 3D9QX 4L50A 3DMNA 2QDXA 3F90A 4S04A 4K26A 1VJ0A 2BC9A 4IJUA 2C5LA 2ZIGA 4QGBA 4GNRA 4H7IA 4IIJA 3V2HA 1UK9A 3MHPA 4G24A 5F23A 1WLYA 4OOEA 3JRNA 3MUFA 4C6TB 1KSJA 2JIZD 4G0YA 3G3EA 4BKRA 5T3UA 4DV3B 1XCMA 1ZQ1A 2XUQA 1A9QA 2YW2A 2IHUA 4L4SA 4M76B 3BWXA 1RLOA 2HYIC 1L3CA 2DY1A 1G17A 3JRWA 1VRCA 2CFTA 4HUTA 1RWXA 4PRKA 3GLRA 1ZWKA 3CIFA 2ZBEA 3TG8A 4HNUA 1HE4A 2ZW9A 4RZQA 3S2SA 1LRKA 3VKVA 1ORRA 4LZPA 3I01M 2YASA 4V03A 1AUQA 3FFWA 2F8LA 1NULA 5JZBA 1SUEA 1EK5A 2YWRA 2P9QA 5JBQA 4HZUA 5HDQA 2C04A 1T4GA 3USZA 3IVAA 1XQYA 4XLLA 5B58T 2YZKA 1RKUA 3O84A 5B3LA 2H85A 2GPYA 3CG0A 4GXQA 2NU8A 1X1RA 1VCIA 1K3UB 5T6MA 1XCGB 3G59A 3O9VA 5CG1A 2C5HA 4EM6A 5AVVA 3AP2A 1NY6A 4OV6B 5DX8A 3AR5A 1Y7PA 3LVRE 3L7NA 4OP3A 1LLUA 2EGUA 2VYVD 4XX0A 1J8QA 4UU1A 2J85A 2J33A 1RPJA 3C3BA 4JITA 1VHTA 2VL7A 2GBFA 3T7EA 4YCNA 4LHZA 2JS7A 5D51S 5EJ2A 2W6JA 4LVOA 3WL4A 1YJ8A 4EPWA 4GLBA 3TVYA 1WB6A 4WECA 4BMPB 4QM7A 1X1SA 3MCTA 1KSHA 3L1VA 1QRUA 1WXQA 2GD1O 5C4IA 3IQXA 2F2TA 4YMIA 3R7WB 1LA2A 3OPYB 1EBFA 2V1XA 1AX9A 4I9GA 2QXYA 3PA8A 2BBSA 1EHCA 1UOOA 1RHKA 1QCYA 1ZRSA 1LUAA 3HXLA 4UZFA 5DFAA 1IN6A 1EWRA 4JVOA 2A5FA 1IJFA 2X7JA 3K1ZA 2FV8A 5FBWB 4BHTA 3PT5A 3RTAA 1JTVA 3ZYZA 3TBFA 3N58A 2JK1A 4OXQA 3QOXA 1WB9A 2OKGA 1G5IA 1Q77A 1ZOSA 4A82A 2QT9A 3P97A 2E82A 2BR3A 3ESDA 2EOAA 4MUBA 1DU4A 1U6JA 5HF9A 2M1ZA 2MCFA 4YQZA 1A88A 2Z30A 2QZZA 2IX3A 1ZYUA 4C5BA 1SGWA 4XM1A 3N0VA 4B76A 1EX9A 2QUHA 5AXAA 1OSNA 3G9TA 1OIVA 6YASA 1SCIA 1NZJA 1WMEA 2D74A 5ILQA 1K68A 1DOHA 5C7OO 4W7HA 1YGYA 4G07A 4ID3A 5IHXA 4YUXA 4ZAFA 4GFDA 4P3KA 1P39A 4YXWA 3GVCA 5JW6A 1E1QD 4MS4B 4Z4QA 1KOGA 1COWD 1D4OA 2IYSA 3DT6A 3DYIA 3LQRA 1SBNE 2X5JO 1X7ZB 1P6QA 1WDLA 2IUEA 4DLTA 3FPAA 5JXGA 3P2KA 4J94A 4BP8A 1SHKA 4Z99A 1G55A 4ND7A 4M99A 2CV1A 3QUTA 2FW8A 2GF9A 2REOA 4F4UA 2NVUB 2E18A 1XE3A 1RZRD 3G8YA 4GWGA 2AMLA 5HCNA 5BV0A 4GMHA 2XRMA 2V6JA 3RKUA 1SCKA 5IVKA 3WMFA 3FNBA 4Q1BA 2QQFA 1YSCA 2E4WA 3TRKA 1Z07A 1FFWA 2JI4A 2QG4A 3TM5A 1VLMA 2GN6A 1CWUA 3OQIA 2NZ2A 3RJTA 5G41A 2FA9A 4BKPA 1A82A 5THXA 3ESZA 3O8LA 4GQIA 4DIUA 2IW3A 1LBEA 3S27A 2OESA 5CCXA 3B6KA 4CLRA 1P31A 1ODTC 2PFKA 3SNHA 1R6BX 1U1FA 4KG7A 3WIOA 5I7HA 4TTJA 4U7DA 5IDYA 3PWKA 1IVNA 1KAEA 4AROA 3AEXA 4GKVA 3CUTA 1YOBA 3M9WA 3PKIA 2F64A 3FCUB 1EFUA 4G1CA 4BVKA 1E3MA 1QJ4A 4R1PA 4WBSA 4W1SA 2WAOA 4QHYA 2FQXA 2J5BA 4JP1A 1T6BY 2QLTA 4M9QA 4S0XA 4RTPA 2D7DA 4B46A 2WSMA 2PGOA 3IDFA 4NZMA 4MW7A 1C80A 2I2FA 1CETA 1QH8A 1RWQA 3FDXA 1E9EA 2IXAA 4ILKA 1I3KA 2YXPX 3H5TA 4PO3X 4WFKA 1WE2A 5EWLB 3HE3A 5D2CA 3TGLA 3VNRA 2JFNA 5EUMA 3ULKA 3U1BA 3FOEC 5AK3A 4RENA 2QQ5A 3MEQA 3LT4A 2DR2A 4QTYA 3CRQA 3FFAA 2FMKA 5EQTA 5HR5A 3HCDA 3OECA 1HYGA 2DBZA 4PNZA 3EGXB 3W4KA 3GRPA 2RIRA 3WK8A 5AHKA 3K9BA 2GGSA 4WK6A 4I4TF 4ZQBA 4UUNA 2ZUEA 5DI3A 3ROEA 1TQDA 3PL1A 4P0QB 4F9EA 5CDYA 3BE5A 5JXHA 3GZTB 2RE8A 2BFCA 1QSGA 5IABA 1N8SA 3DBIA 3RVNA 3WGKA 1KH3A 4E2WA 4QODA 1K4KA 1V48A 4D81A 3R0QA 4PO8A 1IM8A 4ROTA 4RE6A 2O8DA 1JQDA 5F5NA 5CA1F 2H9YA 4QRHA 1D3AA 2PLWA 4KH1A 3RLFA 5IT0A 1U1EA 1GA4A 1GNLA 1QE0A 1ZLYA 2AOTA 4HPXB 4QQKA 3OM8A 4AS3A 4CDRA 1IHPA 1Z35A 2ZROA 1K8XB 1DIAA 4KIJA 2JLZA 3ZXSA 5HHTA 4BTEA 3HWX1 4MAMA 4Q1AA 1JB9A 4Y2JA 5D85A 3F9RA 5C5DA 1NV9A 1QHSA 1HQDA 1Q20A 4RW0A 1EVQA 1P0IA 5BN4A 1EIZA 3U16A 2OGUA 3FG9A 3IMKA 4HXYA 4NH4A 3IUYA 3UHAA 2DEUA 2Z58A 5GONA 5HGXA 3FR7A 2IE8A 2JF0A 1PCXA 3LY9A 2REQA 2A0XA 1N7GA 3DXFA 4KXYA 1X8JA 3IPYA 4FTWA 2ZYRA 3OD5A 4O4LB 1L2TA 3I34X 2AUTA 4KQCA 4OMFG 2J0QA 1AXGA 1M67A 3FWHA 2GOYA 1RLTA 1KDOA 1YB2A 1LPPA 1I9CA 2GB4A 2V6IA 4JC5A 4JUIA 1VLQA 3DV0B 4ZXFA 1S5PA 4MK4A 3UATA 1M2OA 1C5KA 1UC5B 2QVCA 2L2QA 1RYBA 3B3QA 4Q4AA 3UOGA 3KWJA 3GEHA 2DTDA 3AVXA 2XV1A 3TSYA 3LBHA 4ZAYA 5BMOA 4IHAA 2PA3A 2DJIA 3GQBB 4L57A 5IXJA 3FCAA 1G3RA 1K4MA 1MOSA 1SU7A 4KLAA 2B94A 4LJ4A 5IYZA 1XO1A 4RXTA 4ZAGA 1EJ6A 5HM8A 4LFAB 3EEIA 2F00A 4CNBA 2F48A 2GHRA 1DWQA 4MGEA 4AG6A 2I62A 4Q3EA 4RNCA 1K92A 2C4KA 3IAAA 1H93A 5KU1A 3MERA 1F48A 2Z5LA 3GJ8A 3PX3A 4GMFA 1HZZC 1FTYA 2IIPA 4J16C 5T41A 2BGJA 2UUOA 1Z34A 3EMKA 4S35A 1OTXA 2JD0A 3GLTA 3KFXA 3KSMA 3MWFA 1XNGA 4D8TA 4E5NA 4YRZA 4M8SA 5KJCA 2XBMA 2R5FA 2O54A 1SHTX 4Q3KA 3I52A 1USUA 3STVA 2A4MA 3DW1X 3TLYA 5TR9A 2EJUA 4BIMA 2AG0A 3TK1A 3OY2A 3RVRA 4DHEA 2QAGA 3AESA 3G7UA 3IJPA 5J4YA 3BWCA 1ZMRA 1NFRA 3NNDA 3VQTA 4B3BA 4BNHA 1XELA 4GYWA 5E4FA 3PB3A 1FQWA 1MIHA 1Q1AA 3U9SA 1JEYA 3N39C 3P9XA 4IRXA 3PHGA 2H1HA 4R8LA 3BM5A 3PXXA 3N7TA 3ZHYA 4CL2A 4HPWA 3T7AA 2AE1A 1UXHA 4BFWA 3R6GA 1X9IA 5AVXA 3DOFA 4JJ6A 3U3ZA 1LPBB 5AW0A 1QH1B 3HJAA 4RF2A 1YZKA 4V02A 1EK6A 1YU6A 1M5UA 5CT6A 3PUIA 4CU2A 3G88A 3WQSB 4YP1A 3UYLA 3I04M 2O2YA 3ZVNA 5JXWA 2UVDA 3PD1A 5B37A 5AHWA 3Q1KA 4DYDA 3HEAA 4IIFA 5K8LA 4L9AA 1PNQA 2DLNA 2V5UA 2EDAA 3EGIA 3WWPA 1QG6A 3WMRA 1C4XA 2ZUCA 3S81A 5HF5A 2QVYX 1LZKA 2O0JA 4LXIA 4LZLA 3L5KA 1CQJB 1YB4A 1JW9B 3BXOA 3FHCB 4JQYA 4P4SB 1ECFA 1XGKA 2Q4DA 1JE1A 1WZEA 2GZHA 2WWVD 1QHEA 2R1VB 1NJ5A 4YHHB 2OCBA 1GQFA 2PUHA 2XUAA 4FJ1A 3EDOA 4WJLA 2GUWA 1XMJA 3ZZNA 5FF9A 2H00A 3PNPA 3JAMA 3KAPA 3BSWA 1C0EA 1J0CA 2GZ1A 2OFPA 1AIPA 3GUHA 4U9IS 5BQ5A 4O2RA 5BSRA 3U4GA 1QHGA 3U48A 4AM8A 3DMTA 4D6YA 4LF4B 3B1YA 2BD0A 3WXMA 2XIQA 2RG7A 4HATA 4JKIA 3S2ZA 1T9GS 3L0ZA 3T7SA 1Y4ZA 1N0HA 3NWBA 4FGLA 3L8HA 4FI3F 4W6ZA 2I34A 4M89A 2IH5A 1HORA 5CNMA 5J5AA 1KYTA 2ONJA 4K8RB 2PZKA 1Y9EA 3DMRA 4ND8B 4DGSA 4IQGA 3LS2A 2F3QA 2Y1XA 2W2NA 4MDFA 1UBUS 2B37A 1MX3A 1PJSA 2ZWAA 3AWDA 4UMEA 2AE2A 1IZ9A 4X7MA 5AWFC 1FYFA 3JQBA 3DDNA 5HEKA 3TMYA 1UAAA 1H65A 2XH8A 4OU5A 2VJLA 1C7ZA 2QL9A 4NDZA 3CB4A 2Z5GA 2GVDC 4JBWA 4L27A 1H2XA 3M83A 4L51A 4MUKA 4F4JA 1ORDA 1OHHD 1QGDA 4B7UA 4CDMA 4EMTA 2E4YA 3B6JA 3SFVA 5JPDA 3EW7A 4KXWA 4C3ZA 2QGNA 2QY6A 3JWHA 5FP0A 5K7SA 2WHQA 3WA6A 1NQAO 5I9MA 2ODWA 4QU5A 4BLPA 2C4MA 1NIPA 1YS2X 4ENVA 4CCYA 1KR5A 5SYNA 3OQ1A 1QQTA 3MC1A 2C5AA 2JBAA 2R8XA 3EQ6A 3O8CA 3AG5A 5PNTA 1BDMA 4PX3A 2GN9A 3BD7A 1Z39A 3BPSA 1WOYA 2VOJA 5IP5A 4AJNA 3C8HA 5IK2A 5JNLA 5DIZA 3ZCQA 1VBMA 2OZLA 1U9YA 4KR0A 5T8KC 3OZVA 5E9JA 3TQFA 5FBQB 3S5UA 1XQVA 3PGJA 3DA8A 3ONDA 3A28A 1SXJB 5F7JA 3SDZA 2I6QA 1TYEB 2O0MA 2QY9A 2VKQA 4B7AA 5GAJA 1PZHA 4P5DA 3U26A 4V0MA 1IG3A 4YT5A 3SVLA 1ZONA 4U7WA 4CTJA 1G3UA 3OE4A 4M38A 2BEVA 5DTQA 2QU7A 4Y0NA 4YMTA 3T9DA 2DM6A 3O8NA 4OBBA 4PM4A 4RYDA 4IWNA 1EK0A 3ESQA 3EXIB 4GM0A 5AM1A 4MVJM 1YBAA 2QYOA 3OSZA 4FNMA 5J40A 1LQTA 3O21A 1GGVA 3AILA 3AF5A 4UEQA 3BA6A 2H54A 4JB8A 5ALDA 1GM5A 1U3WA 4LXQA 2X1VA 4CW7A 1JPNA 3DBLB 3KZ1E 4I6GA 1UBJS 3ZWDA 1Q44A 3D6UA 3KQMA 3WK4A 2VRNA 1MAWA 4FWTA 2VEDA 3A1TA 3I64A 5B6JA 1E6KA 2Z8YA 5KVVA 4DQKA 3QLJA 3SJAA 1U99A 2B78A 1ZICA 3DTVB 5HIJA 3WLHA 1N34B 4DHWA 3STTA 3ZZUA 2VWQA 1E7YA 4IUDS 3OM1A 3TFOA 4Z4EA 5DBGA 1BE1A 3FNEA 2WHXA 3E4CA 3JQAB 4EYOA 2O8BA 1PUJA 3HFGA 1Q2XA 2D3WA 3HWSA 3N86A 3OZFA 3UK6A 3VI3B 3ZNPA 1VP3A 1V47A 4BO0A 5CA1B 3I9LA 4PAWA 1V8OA 1VPLA 4RTMA 4PGHA 1U6IA 3BTSA 2GZRA 2PGJA 4M9SA 2AKYA 4CV3A 3FF4A 3QUCA 1J99A 5IKPA 4J2TA 1C9JA 5AHXA 2O2CA 3GA0A 6AT1A 2DRIA 4PF1A 4DWJA 3CVWA 4M0UA 1MO6A 3T7IA 3ND9A 4R3NA 3JYHA 3VR5H 3A27A 2BYTA 3HA3A 3EVFA 1OVGA 5AKKA 2WE8A 121PA 3ORSA 4B44A 5DSTA 1KI6A 5DF1A 1X15A 5LU8A 3RM3A 3GVIA 2RMKA 3UO8B 4HT3B 5I48A 3X2EA 1BXGA 1GSHA 2VTKA 3UENA 2WF5A 2QRGA 2BUBA 4ZJZA 3V8EA 2IRWA 4P4GA 4YP5A 2A9VA 4U39A 1QPZA 3ZNQA 1M1XB 5ENDA 3PJEA 1PQPA 2PX2A 4BMXA 1P0CA 2ZVPX 2QD3A 1M34E 4ND6A 4B7CA 1R9JA 4O0LA 1B00A 3A7DA 1BZYA 2FUEA 2CD9A 3CW2A 5JLJA 1PN3A 2R2AA 1A5SB 3T0GA 1YL7A 5AW5A 4B3GA 3PE3A 5EUQB 1W4CA 1STOA 1P2TA 5EWJA 5J5CA 4B6OA 1DAEA 3VH1A 3SYMA 1W1UA 4YREA 1XEWY 5J59A 4TV9B 3N87A 1NVFA 2C7GA 5EG5A 1PD0A 5JNVA 2FWAA 2SNIE 1CXZA 3A9VA 4RK6A 5C3UA 1NBME 1DBWA 4GG1A 4AYXA 4R68A 2XUGA 1L5NA 2HJRA 2FFBA 1QIIA 2H5IA 3K4HA 4KH0A 1YULA 2X9VA 3B9PA 4Q4JA 3OVMA 1KYZA 1YZ3A 5EKSA 1A97A 3HCAA 4HB4A 4RFSB 1EWVA 3UAOA 3RWOA 2Y9PB 2HQOA 4DCVA 1H8EA 5U4QA 3WRYA 2BPOA 2GH1A 4MUYA 3S2IA 1GFSA 1KOJA 1YNOA 1NVAA 4RDIA 5EIBC 2C07A 4R2MA 3B2NA 4Y2UA 4RNDB 2GERA 2CXRA 2W6IA 3LI2A 3WRXA 3ZE1B 3NHPA 5DGTA 1JQBA 3BMXA 3LL4A 3VTAA 5IS2A 3S8EA 3VM6A 3ET4A 4ISBA 4LBWA 2WWFA 4KK4A 4MPDA 3RC8A 3TJMA 1LLFA 3JVEA 1BYUA 2YCLA 4Z0NA 2E6KA 2Z8ZA 4Q0MA 3K16A 1PZEA 2A5LA 2R4QA 2CFIA 3PCXA 1PK9A 2DT5A 4TMXA 4C3VA 3RAJA 4DXAA 3R9KA 4FHZA 2OO5C