2C0CA

Structure of the mgc45594 gene product
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
353
structure length
353
Chain Sequence
GVDLGTENLYFQSMMQKLVVTRLSPNFREAVTLSRDCPVPLPGDGDLLVRNRFVGVNASDINYSAGRYDPSVKPPFDIGFEGIGEVVALGLSASARYTVGQAVAYMAPGSFAEYTVVPASIATPVPSVKPEYLTLLVSGTTAYISLKELGGLSEGKKVLVTAAAGGTGQFAMQLSKKAKCHVIGTCSSDEKSAFLKSLGCDRPINYKTEPVGTVLKQEYPEGVDVVYESVGGAMFDLAVDALATKGRLIVIGFISGYQTPTGLSPVKAGTLPAKLLKKSASVQGFFLNHYLSKYQAAMSHLLEMCVSGDLVCEVDLGDLSPEGRFTGLESIFRAVNYMYMGKNTGKIVVELPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of Mgc45594 Gene Product
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords ZINC BINDING ALCOHOL DEHYDROGENASE, DOMAIN CONTAINING 2
total genus 124
structure length 353
sequence length 353
chains with identical sequence B
ec nomenclature ec 1.3.1.48: 15-oxoprostaglandin 13-reductase.
pdb deposition date 2005-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2c0cA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2c0cA01
1KBZA 3ST7A 5FEUA 4AJ4A 4WLNA 4HWKA 1XR3A 1EQ2A 4A10A 1XIVA 4RF2A 3QVXA 4CM7A 1V3VA 3GNQA 2JD2A 1DHRA 5A1TA 4DLLA 4YT8A 3TRIA 1OBFO 4KQWA 3I9KA 2X7HA 1C3VA 3NTQA 4JN6B 2QZ9A 3QV1A 4RPGA 1WPQA 1RPNA 2OMEA 1TT5B 2DTEA 4DIFA 3WWYA 1ADFA 2AG5A 2ZIZA 1O6ZA 1NX6A 1YGYA 1DXYA 2FSSA 2Y99A 4KP7A 1PJTA 4BNXA 3ZWXA 2J8ZA 4O6VA 3ZZNA 5DULA 1T26A 5I9LA 1MLDA 3SC4A 4XZ3A 4J2OA 3ROPA 1WMAA 2GO1A 4CLRA 3JQBA 4IJUA 4WGGA 5I9MA 5JYEA 3U62A 4NFHA 1YDWA 3WBFA 3VC7A 4II2A 5MDHA 3GNSA 1NPYA 2YHIA 4XX0A 3JD2A 2ZK7A 4RVFA 1ZK1A 4M8SA 4YQYA 3UUWA 4FGSA 1E3JA 4U6SA 4W6ZA 4E4YA 4GX2A 4NZ9A 4BNMA 3AOEA 4PG8A 4CM9A 2WYWA 4M1QA 3UKOA 3LC2O 1QMGA 2VOJA 1NBOA 1QRRA 3TNLA 3NAQA 4BNKA 5EERA 3DHEA 1UZNA 4XGKA 5L53A 4XRGA 4J7UA 4AVYA 1R15A 5AXCA 3DZKA 2AHRA 3GPIA 4EW6A 4XKJA 2A9FA 2CDBA 4W7IA 2R2GA 1XDWA 5JO0A 1KIFA 1FMCA 1DBVO 2HU2A 4J9UE 1IY8A 5EINA 1HTBA 4BNFA 1D4FA 1E7WA 1TXGA 3KSDO 4UUNA 4CQLA 3C3XA 3W4KA 1U3UA 3EHEA 1R4NB 3D3EA 3GZNA 4AJ2A 4FB5A 1VKOA 2DBQA 7MDHA 3CEAA 1KETA 3IJPA 4II3A 2OL4A 4M49A 4R9SA 4UUPA 2VYND 1Z7BA 1LU9A 3G1UA 3NJ4A 1AXGA 4NHEA 1V0JA 2HJRA 4E2XA 3IMFA 4G5HA 4D3FA 2D5CA 1Q1NA 4KUGA 4NK5A 4CODB 4OKNA 2V65A 4P22A 2PK3A 2ZQZA 3ZHYA 3GA0A 3O38A 3NDRA 4CMKA 4I08A 5DP1A 5KJEA 9LDTA 1HT0A 3STHA 4RL6A 5H82A 3AI1A 2VNSA 4J9VA 3BMNB 5L7WA 1DRUA 4AJJA 5K9ZA 3WGOA 4YJFA 3OA0A 4BMSA 2I9PA 4BNUA 3DOJA 1ONPA 3WG9A 3L6DA 2RAFA 1NQOA 2JHFA 4XYGA 2DU8A 2NACA 4YAEA 2AQ8A 2WE7A 4CMEC 1CETA 3WSVA 1WLYA 3DHYA 3H5RA 3G49A 4BO1A 4ZQEA 4OXYA 1E7YA 3GHYA 1CQIA 4D3DA 3I9LA 2G76A 1B16A 1Y8QA 1I36A 4Z0HO 2GN6A 3SC6A 4L0QA 4XR9A 4JX8A 2XXJA 3RFTA 2C07A 4QFDA 5CDUA 5TS3A 2CFCA 3P2OA 4GL4A 2WYUA 4PVDA 3HB5X 5JFOA 4R4JA 2FZEA 1K6XA 4W7HA 4WNIA 1X7HA 4Z0PA 5BQFA 3GMDA 7ADHA 1XYGA 1ZKMA 2ZYGA 4WCFB 4XEHA 1G6KA 3DTYA 2R00C 3OIFA 1GQQA 2NVUB 1ENPA 2VUTA 3S55A 2E6UX 3DOCA 4UVHA 3L77A 3UGKA 1FDVA 2WD7A 4Y6RA 4RJTA 5FFFA 2VHXA 2C5AA 3GZ4A 1CRWG 1I2BA 3KSZO 3Q0EA 5L40A 1K5HA 3DZBA 4NNJA 3OQ6A 1VL8A 3KTDA 4NH4A 4B8WA 1WDMA 1I3MA 1BMDA 2HSDA 3JQFA 4E5KA 3FI9A 3F1LA 3B70A 4RVUA 4BVAA 3GGPA 3FBGA 5EIOA 1YB4A 3JD4A 3UXYA 1R4MB 3VZSA 3KETA 4LVCA 2GR9A 2YV3A 1PTJA 3ICPA 2ZYDA 4IJWA 3F1KA 4YAKA 3DXFA 4TVOA 3PWZA 3EY4A 1LDEA 1LLDA 1PJCA 5H81A 4OM8A 3SVTA 4RLSA 2WD7B 3JQ8A 4RQUA 4FGWA 2VQ3A 1TA4A 2O3TA 1Z6ZA 2IZ0A 1JVBA 4FCCA 4W99A 4OSOA 4WCFA 3NEPX 4BIIA 1V3UA 5AXBA 4FC6A 4U7WA 1P31A 3KV3O 2BGMA 3FRJA 4BB5A 1UP6A 3ZU5A 2Q1SA 2NLOA 2Y1CA 1EE9A 2W2KB 4Q3AA 2PKQP 4IQ8A 1ZO8A 3HADA 5LCXA 2X6TA 1YWGO 1KVSA 2B36A 2CDAA 3CH6A 5T8KA 3CSDA 3FTPA 4GQAA 3FR8A 1BVUA 3KYCB 1KOLA 3GGGA 2HO5A 5TJ9A 3FHLA 4TQGA 3B1FA 1F17A 2DFVA 4IDDA 1L7DA 2VRBA 4DPKA 4NMHA 3SJ7A 3MCVA 1U3VA 4YXFA 4N5MA 1ZXBA 3E1KA 3L9XA 1M67A 5IDXA 4D44A 2ILTA 1K3TA 1GUZA 4PVCA 5TIIA 2QRJA 3KHUA 4B8ZA 5A5FA 1P1KA 1R12A 2X1HA 1Q0QA 4MVJD 3GR6A 3JYQA 4XYMA 4XDZA 2D5AA 1UXKA 2X9VA 2ZB7A 3ANMA 2PKQO 3HZZA 1H9AA 2X0NA 4M87A 5JNLA 2C59A 5L7TA 3PQEA 1QYXA 2B5VA 4QX6A 5B4VA 1W8DA 3D5TA 1BW9B 2HMSA 2JCYA 3EDMA 4DQUA 4IJVA 3ZHXA 3ZWYA 1IPEA 2JCXA 2PLAA 1NPDA 1MUUA 1ENYA 3GVHA 3H2SA 4IDGA 1ZH8A 3U5TA 3K2EA 5EPOA 4RVHA 4XD2A 4XYLA 1E6WA 3WFJA 3EW7A 5JSFA 1BXGB 3IAHA 3COSA 1TT5A 3WDSA 3C1OA 2I76A 1UZMA 2HRBA 1AE1A 8LDHA 2OP1A 1BGVA 4YDRA 1QYDA 3SX2A 5IJZA 1ENZA 2VYVA 3V1UA 2GGSA 4CM6A 3GVCA 2BFMA 2EXXA 5I9NA 2V6GA 4M89A 4XYBA 1JLLA 4KZPA 2HKIA 4DLAA 1TEHA 2JAPA 3UW3A 2DKNA 1PQUA 3CMMA 3E8XA 1GL3A 3LSYA 1HE5A 3A06A 4J91A 3C7DB 4LRSB 4K6FA 1IHXA 4CMEA 4MKXA 2DTDA 3OIGA 5JS6A 3VDRA 4RV9A 1PJLA 4C7JA 1DC5A 1I0ZA 1SAYA 1M76A 2QYSA 4RLHA 2BI8A 5KVQA 2PGLA 3F5QA 3G3EA 4MKRA 2AE2A 2CUKA 1Y5MA 2OZPA 1OC2A 4BV9A 1SMKA 2GD1O 1NFRA 1X0VA 1PS8A 3DBVO 4ZQHA 4OOFA 1XWFA 4CPDA 4IS2A 1A72A 3S2IA 3ZU4A 3QA9A 1O5IA 3GRPA 1Z73A 4LK3A 1DEHA 1H2BA 1RYEA 3HG7A 6LDHA 2DPGA 1LQUA 3GUYA 1ADGA 2AG8A 5F1OA 1PJSA 5CG1A 3BMOB 5IG2A 1F8GA 4YAIA 2NSDA 4XJTA 1Y1PA 4GAEA 2HMTA 3PP8A 1XQ6A 3I6QA 1GYQA 3LT0A 1DJNA 2RIRA 4I5GA 3F4BA 1DSSG 3HE3A 3TL2A 3B1KA 1P44A 4ALNA 4XGIA 4FFLA 4CM8A 1LEHA 3H5NA 5COQA 2X8LA 3QWFA 1RYDA 1ZSVA 1X7GA 4ITUA 5DBGA 1I2CA 4EUEA 3PJFA 3WGHA 3EYWA 4RO0A 1M6HA 2OP0A 4D42A 4CMGA 1E5LA 1E7SA 5G0VA 4U5QA 4PLFA 4R68A 3DMTA 3ROKA 1ISHA 4BO6A 5BT9A 3E9NA 5LDGA 1CDOA 1CJCA 4BNIA 1YKFA 1B2LA 2YW9A 1ZEMA 1J0XO 1Y7TA 3LF2A 4HX5A 4B7XA 1SB9A 1W0CA 1IPFA 3GHHA 4ONEA 3S8MA 2Z1MA 1MX3A 3I9OA 4NBWA 2VHVA 4Q3NA 5JC8A 1QP8A 3WYCA 4QUKA 1LDGA 3BAZA 4B4UA 4TRMA 4MDHA 3HDQA 1S6YA 3OSUA 3ZV3A 4W4TA 3GQVA 4WKGA 1ADCA 3INTA 2AA3A 3DQPA 4RF4A 4XQ9A 1B8VA 4RGBA 5ILGA 2YFHA 2IE0A 1VRWA 2IYOA 4RF5A 1QLJA 4EZBA 5F21A 3WTCA 1YXMA 3ZWCA 3JQGA 4RCVA 4XQEA 2O48X 3L4BA 3KBOA 3OM9A 3OA2A 1WWKA 3DZFA 1AHIA 1H6DA 3KYBA 1E6EA 4FN4A 2GLXA 2QG4A 2PD3A 3RU7A 2VTEA 1AHHA 1ONNA 1GDHA 3CIFA 4A03A 4YRDA 4TRJA 4CM4A 4MP3A 1XU9A 1U28A 1WDKA 2NU9A 2PFGA 3NX4A 4GX0A 2TMGA 1P45A 1HDOA 4TROA 5DT9A 3DR3A 4IMRA 4HV4A 1GD1O 2D1YA 4IUYA 1NHGA 2EV9A 4CUZA 4EITA 5A06A 3K6JA 2O7QA 1AGNA 2VWQA 4NDNE 1A5ZA 5DCUA 5KJ6A 3LZ6A 4DIOA 4H3VA 1DO8A 1F0YA 2W90A 4NJMB 5CDYA 5DCWA 3CZRA 4BO8A 1O94A 4UULA 4YRBA 4HFRA 1V9LA 1PR3A 2PH3A 4ILKA 4YT5A 3RJ5A 4OL9A 4D7AA 3I4FA 3BMNA 4LW8A 4XA8A 1C1DB 1B0AA 3VH4A 2IEBA 2NQTA 4HUJA 1PZGA 3ENNA 1IB6A 3GG2A 1P1FA 3LVFO 2X0JA 4XYEA 5LDHA 3I23A 1SNYA 4FFNA 1SEVA 4FSHA 3DAFA 1IUKA 1M2WA 1Q2XA 3P19A 4F6LA 4P8RA 5IXSA 1M75A 5JE8A 4NBTA 4R3NA 1T2DA 4IS3A 1LX6A 4S1VA 5G0WA 1MB4A 5CDSA 1M66A 3GVIA 3NGLA 3NJ8A 3RUFA 1NWHA 5COBA 1G0NA 5L7YA 1F8FA 1U4SA 2IEDA 2JCVA 4BNGA 4I9HA 2ZTVA 1ISJA 3GLQA 2JD1A 4BNZA 1HE4A 4BKUA 6ADHA 1EVZA 2CSUA 3RVDA 4BNWA 3PLRA 5JO9A 1MA0A 1GR0A 2Y1EA 2EP5A 3K5PA 2GN9A 1T2EA 2EERA 2X23A 4LGVA 3ZV6A 2XAAA 2Y93A 4IDCA 2P9GA 1VSVA 3MOIA 2P5YA 3MJTA 3GZNB 2FR8A 4W9NA 4K6CA 2WEKA 1WDLA 1DAPA 1R37A 2WWRA 3AWDA 4H15A 3W6UA 2Q2QA 2AEJA 1V3TA 2GCGA 1XKQA 1GZ6A 4JBHA 2EJVA 4YPOA 5HA5A 2FSVA 1DIBA 3DL2A 1GQYA 1RKXA 1PWXA 4BO9A 5A9SA 2HK7A 3WBBA 3RKUA 2ZTLA 5BSEA 1XSEA 3ENKA 1KC3A 4Z6KA 4BNNA 5T5QA 2RH4A 2BGKA 3JQCA 3U0BA 3ZWPA 2Q4EA 4IDAA 3ZDFA 2D0IA 3I9JA 3UICA 3EK2A 1W6UA 4FFRA 3WXBA 3WYBA 4TMFA 3H8VA 3LT2A 4IZHA 3TOXA 5JDCA 3BYZA 3RUDA 2C5EA 3OQBA 4GMFA 3N7UA 2J3IA 4LCEA 4U0KA 3U4CA 5GY7A 2B4RO 1A71A 1QSGA 4J3FA 3E9MA 1XELA 2NU6A 1H93A 5IXYA 4DRYA 3NTOA 3VPSA 4CM8B 1A4UA 3DZJA 1DHTA 3ONFA 5CHEA 1RJWA 3X2FA 4ZHSA 4CV2A 5I8WA 3WX0A 3VDQA 5IDYA 1D8AA 4KQXA 2O3QA 3Q9NA 4OO3A 1R4NA 3TSCA 5ICMA 1K6JA 4MKZA 2PZLA 5IAAA 4L73A 3ZNQA 2I6TA 5U9CA 3FR7A 3CINA 3U4IA 3WMWA 3NV9A 1X1EA 4PZDA 4BGEA 4WUVA 2GZ2A 3AU9A 3PWSA 2PNFA 1ZVMA 1IZ9A 3K92A 1W4ZA 4R5MA 4XCVA 4K26A 2D2IA 4I9NA 1FK8A 2HRZA 1MC4A 2JFFA 1HZZA 3AM5A 1OZAA 4OJNA 4JIGA 4BNYA 1GZ4A 3M6IA 3UHAA 4K1LA 3C7CB 3I6IA 3WIDA 4NFSA 3JQFC 3DMYA 2GPTA 1I3LA 3DWFA 3TZHA 2G1UA 1LBEA 1OAAA 4UUMA 5ER9A 2ZATA 4WLFA 1HETA 3ZN2A 4E5NA 4E2WA 1I2ZA 1YH3A 5JCJD 1SO8A 3ZU2A 4IINA 3P7MA 5G0SA 2FN7A 4Q3CA 3T7CA 3GDGA 3KEQA 2IZ1A 5CEJA 2HLPA 2IYPA 4HNHA 4D0SA 1BHSA 3S2GA 4R1NA 4R41A 3R6DA 1D1TA 5T64A 5T8KC 3H9JA 1PWZA 4R1SA 1MC5A 4BKQA 4XWYA 5JY6A 1PJ2A 5F1PA 1P9LA 3C85A 1DLIA 1HDGO 3C1TA 3E18A 2VHWA 2GZ3A 4BUCA 3FNFA 1LJ8A 1NXQA 3WGQA 4OAQA 1YJQA 5A9SB 4Q3DA 2C82A 2VWPA 3RSHA 4DL9A 2NWQA 5K1SA 5HBRA 5TLSA 4GSKA 1BXZA 3ZCXA 1I32A 3MEQA 2J3HA 2P68A 5C3MA 4B3HA 4NU6A 3GF4A 3A28A 3JQEA 2JFHA 4WK6A 3TZCA 2CF5A 2P2SA 2RHRA 1VJ0A 5JC1A 1DB3A 3RI3A 1ENOA 4O0LA 3W6ZA 4OIMA 1IZ0A 1NR7A 2O4CA 3TL3A 3HFGA 3OETA 3WICA 2WD8A 1ISFA 3ROMA 2O23A 3NYWA 3PFFA 4DQVA 4RDIA 2Q49A 1XHLA 4TZKA 4Y8VA 3WLEA 1HWYA 2I5PO 4PLYA 4UVDA 5BSGA 3TFQA 4RDHA 3BTOA 4J2HA 5KJCA 3NRCA 3FWZA 1TT7A 2GSDA 1FJHA 3BXXA 1T1SA 1PJQA 4J49A 4ZD6A 1ZK3A 2YY7A 3EC7A 2EHDA 1R0LA 4YWJA 3WNQA 3OJFA 4W9NC 3IP3A 4ID9A 4D43A 1HYGA 1PR9A 2B69A 2BKAA 2B0JA 4QEDA 3Q3CA 1KEPA 4WOKA 2AQKA 3JQ9A 4L75A 5JDCC 4A26A 3FN4A 1NTOA 4Z0TA 3E48A 1KY4A 5TT0A 3O8QA 2D59A 4GBJA 2BRUA 2OGUA 4GLOA 3GNTA 3GY0A 3KRTA 1LSSA 3HB4X 3DAPA 3TJRA 3NT4A 4Q3BA 4Z9YA 4CQMD 3E9QA 5I7SA 2AQHA 5FYDA 3WR5A 1N2SA 2CDCA 2FMUA 3AUTA 3ETEA 1E3LA 2Y1DA 4GVXA 3GRKA 4UUOA 1VSUA 3B20A 1PEDA 5TC4A 3TDKA 4P4NA 5L4SA 4H7PA 4OH1A 4KWIA 3VTFA 3ONEA 2OO5A 1T25A 4QT0A 4WPGA 4CQLB 1UP7A 2EKLA 1CQJA 1Q7CA 3AY6A 4AJPA 5KJFA 4OOEA 5TJHA 3L6EA 2Q2WA 1EK5A 3QRWA 4U6QA 1YB5A 1ZBQA 3PPIA 1JDJA 4DIBA 4BNLA 1Q0LA 5K0ZA 2Q4BA 2HJSA 1RWBA 1ZW1A 4B3IA 1E3IA 1EE2A 1HKUA 4KUEA 5H83A 2UUPA 1GEEA 4GMGA 1KVUA 2VNAA 1PL7A 3K9QO 4KTTE 2P4HX 4BOYA 4E31A 2OHXA 4FW8A 1BXKA 1B8UA 5KKCA 2YV2A 3PHHA 3DBRB 3FPCA 3IP1A 3AJRA 5BR7A 1KEVA 2O3SA 4RF3A 5L9AA 2NVUA 4HFJA 2WMDA 3PHJA 4CMJA 3I3OA 3I9MA 3IJRA 4MVJI 4ALMA 4XRRA 3CXRA 2UV8A 5DDIP 1X15A 4HNGA 3GN1A 9LDBA 4GKBA 1KEWA 1DDOA 3OP4A 1HE2A 2EW8A 2QX7A 1ZJYA 4J1QA 2Y1GA 4IGFA 1LTHR 3WGZA 4NG5A 5HWSA 1O9BA 1WNTA 4WEOA 2YDXA 3PGJA 3SLGA 1H9BA 2VZ8A 3V2HA 2HMVA 1GCOA 4JROA 5TF4A 3VKVA 5FWNA 1Q0HA 1S7CA 3CUKA 2H6EA 3QIVA 4WASA 2EKPA 2J5KA 3GVPA 4YVFA 3UCEA 1QORA 3D4NA 3H2ZA 3JQ9C 3FBTA 5KVCA 1N1GA 4CM3A 3PZBA 5EMHA 1GAEO 1ZK4A 5F5LA 4ZJUA 4AJNA 1JN0A 3DMTC 3H9UA 3Q11A 1LUAA 3OBBA 2C2XA 1T24A 3I4CA 4MP6A 4J6FA 2GN8A 3IL2A 3OEYA 3CKYA 1I10A 5G0UA 5IDWA 5I7FA 2QHXA 3TZ6A 3ZWVA 5JYDA 3WNVA 2Z95A 1EBFA 1E7QA 1QV7A 1YQXA 3W8DA 2E37A 1FF9A 4ZQGA 2CMDA 2I67A 2O7SA 3GEDA 4PLWA 5FF9A 2EWMA 4MP8A 3PHLA 3SBOA 4F3YA 3ZWMA 4L4SA 4CLHA 3D64A 4L76A 4YR9A 1T4DA 2C20A 4Z9FA 2XF8A 3JYPA 3PK0A 4NBUA 4NR0A 4W82A 4D41A 1EFLA 1WXDA 2FHSA 2ZTMA 1Y6JA 1N9GA 2OOSA 3ZU3A 1Z75A 3RCBA 4TVBA 2C29D 1B7GO 3ADOA 1YBAA 1LI4A 4CUJA 3MJ4A 1G1AA 1EMDA 3M1LA 4FIZA 1ZNQO 3LQFA 4BO5A 3KVOA 4FD3A 1JKIA 3OF2A 4DYVA 3E5RA 1F14A 3D1LA 1X0XA 3ZW8A 4DWVA 3I1JA 5A04A 5B4TA 1YOVA 2BHLA 1E3WB 3DEYX 4MINA 4AJOA 1U7TA 2H63A 3RQSA 3MJSA 4IBOA 1R0KA 3O8QB 4M86A 2X9NA 2YHUA 2FZWA 3A9WA 1Q7GA 3TF5A 4ZICA 2ZB3A 4XDYA 4CR6A 1HYEA 3C7AA 3G17A 2CVQA 2VUUA 1ZK0A 8ADHA 3AI3A 1OC4A 4QFCA 2VT2A 3HWRA 4BKPA 1ID1A 4DUPA 1HSOA 4Z3KA 5B37A 3GVXA 3HHPA 1J6UA 4YAJA 4BO4A 1ADBA 4CM9D 4AJ1A 4CV0A 1YJ8A 1UXJA 4O63O 2HK9A 2J3KA 3JYLA 2X86A 5A4DA 5KWEA 2PA3A 1PJ3A 4QECA 5J23A 4PRKA 1JTVA 1XGKA 2PH5A 1DLJA 4RPKA 3TPCA 3GFBA 2Y67A 4BNVA 3GGOA 4IY1A 2C0CA 4KOAA 3ORFA 4BMVA 5JAZA 5THQA 2FPPA 4NQZA 1GPDG 3JQDA 4PG7A 4CLOA 2W98A 1P1RA 3ITDA 4UREA 3RBZA 4E21A 4DMMA 2H9IA 3PVZA 4DVJA 1HLPA 3CTMA 3H7AA 4NI5A 2R00A 4E33A 4IGEA 3JV7A 1FDWA 3M2PA 3U4HA 3H5AA 5JAIA 4TZTA 1UAYA 4OYRA 3DBRA 3GFGA 1PIWA 4YB8A 4EGFA 3RFVA 4XGNA 3VPHA 4AJIA 3ZNPA 1SOWA 3JSAA 3MZ0A 1BXGA 4S3MA 1F12A 4ND3A 1GCUA 1YQGA 2HUNA 2E82A 1LRJA 2CD9A 2VHZA 4J90A 3ON5A 3Q2IA 1SZJG 3JTMA 1E7RA 4BKOA 3OFSA 3PQFA 4YAGA 5TSDA 3DZHA 1SOVA 2O3JA 2PKRA 3IUSA 3ONDA 1Q7BA 2ZTUA 4P4GA 3BHJA 3DFUA 1T2CA 4UEJA 4UVEA 4LN1A 1H6CA 4PLVA 1N9GB 3LDHA 4CV3A 1QLHA 2OFPA 4MVJA 1KVTA 3A14A 1ORRA 2AEFA 3PTZA 1Z82A 3H4VA 4IJKA 2BELA 1LLCA 1XEAA 3GEGA 5TGDA 4OQYA 2NTJA 1HE3A 2J5RA 3U3XA 1U5AA 3VHRA 2Q46A 3E03A 1P1JA 3TFOA 2EIHA 1GTMA 4YT4A 1PGOA 5DCYA 3QP9A 1R66A 3L6OO 2Z1NA 1B14A 2GERA 3GDFA 4EEXA 4ZU3A 1BRMA 3GEMA 5HRUA 3GG9A 3R3JA 1XQ1A 3GAZA 1O95A 1YE3A 2W8ZA 2YUTA 3C24A 3BMQB 1NASA 2FP4A 3GMSA 3WQRA 3MOGA 1P0CA 2PD6A 3DBHB 1QYVA 4NIMA 4UEOA 5TX7A 1BVRA 4FC7A 1VL6A 1ISIA 4PRLA 1MG5A 4J4TA 3K8ZA 2W4QA 4DA9A 3D3WA 2AXQA 3MWEB 2IXBA 3ANNA 1BWSA 1JQBA 1YO6A 3N74A 1UH5A 4JP2A 3V2GA 5THKA 3U9LA 1SEPA 2IODA 4B7UA 3ULKA 3VH2A 1BSVA 3ZWNA 1E7MA 3ASUA 1H6AA 4OMUA 1I33A 3BTUA 1E0DA 2PY6A 2V6MA 1MV8A 1ZCJA 3PWKA 1AN9A 4DQXA 2C7VA 4QXMA 4BMNA 1NFFA 1H2HA 2DAPA 5DN9A 1HDZA 4D79A 3JQ6A 3V1YA 3UFXA 3W1VA 1GQ2A 1O89A 3AY7A 3ZHBA 4F46A 3U09A 4IDFA 4CLRB 1OFGA 3DO5A 4P4LA 4QSMA 1V8BA 1HYHA 1ONOA 1PZFA 2NUAA 3OIDA 1QG6A 1BDMA 3INRA 5A5EA 3OJEA 4PLGA 3GAFA 2PV7A 3RAJA 3I83A 3FF4A 2ET6A 2H5LA 2QZZA 1NVTA 3QE3A 2Y68A 1TVEA 2DUUA 3HQ4O 2FPIA 2RH8A 3GUCA 3WGGA 4A7PA 1EFKA 2NQ8A 4EI2A 1R0SA 3GDOA 3QSGA 3BMOA 3ZW9A 4XQGA 2I3AA 2P4QA 5KVSA 1LSUA 5JBIA 1SBYA 4E5PA 1HDCA 2X0IA 4Q3EA 3VH3A 5ITVA 1PJ4A 2I66A 2LDBA 4CM4B 4UAGA 4PGFA 5TT1A 1YBVA 4N18A 1LXCA 1Y5RA 4WLOA 3RKRA 4WJZA 1UR5A 2QRLA 1YBMA 3C8MA 4DPMA 5DP2A 1U5CA 2NU7A 1ISMA 2POQX 2YYYA 1IOLA 3IDSA 1E77A 3TZQA 3T7EA 4MIEA 3AUUA 3HN7A 4D45A 1LQTA 4ND4A 3VTZA 4FJ0A 3KM0A 4KUHA 3D4PA 4WNCA 2DFDA 3RBVA 2WE8A 3PEFA 1K0UA 4URFA 4PG4A 1EVJA 4PZEA 4R69A 4OSPA 3DONA 1Y9AA 4FS3A 3PDUA 1EZ4A 3KXDA 3E5MA 2CY0A 2NVBA 3AM3A 1X7DA 3FSRA 2CF6A 4R54A 5CG2A 4E32A 3NT2A 4RPJA 2BGLA 2I65A 3KOUA 4L8VA 4YCAA 3UN1A 2QQ5A 4LVUA 4RORA 1PZHA 1IE3A 3F5SA 4WLVA 5U1PA 3HSKA 1JAXA 3L9WA 2QW8A 2XOXA 3D7LA 4MVJP 5GZ6A 1A7AA 5T67A 1KC1A 4BNTA 4MVJE 4D46A 3QWHA 5G2OA 1E5QA 2X5OA 3E82A 4IM7A 1UDCA 4ESOA 1U4OA 4L9RA 1IULA 4RQTA 5JLAA 3AUSA 2FY8A 3DZIA 1SB8A 1GUYA 5ENVA 3RC1A 2C7GA 1PGNA 4O59O 3U4DA 3UH1A 3AFNA 2B5WA 3RROA 2GRAA 4BO0A 3PGXA 4YJFB 4R9RA 2DM6A 1W73A 3H9QA 1DFHA 1Z7EA 3WJ7A 4DMLA 4J43A 1VJTA 2CZCA 3VOSA 3WTBA 2FR0A 5TQVA 5ADHA 4RPLA 4DYDA 1UDBA 4CV1A 3HFSA 2ZB8A 4PG6A 3JQAD 3EMKA 4E13A 2A92A 3FPLA 4UEKA 4CMIB 2EGGA 1DC4A 4PLHA 1UAGA 3EUWA 1B3RA 4PLCA 2BMAA 2O50A 1GU7A 4R01A 1L1FA 4DC1A 4OHUA 1DFIA 3H6KA 5EQDA 3F6YA 3O26A 2IZZA 3QWAA 3GN2A 4N5NA 2XPCA 2UAGA 2JAHA 3DBLA 3T4EA 3RFXA 4EEZA 1CYDA 3S2EA 1OMOA 2QYTA 1ZSYA 4KMSA 5JCJA 1J49A 1VI2A 3G1TA 3AY3A 5JXWA 1PGQA 1R6DA 1UDAA 3QVWA 1ZK2A 4GX1A 1IYZA 1NWCA 1ZEJA 4CMBA 1HDYA 2F1KA 3F4LA 1BTOA 4JJIA 4ZGWA 4QO7A 1Z74A 5AXDA 3UCFA 4DGSA 2A4KA 1LSJA 2FR1A 1UXHA 4EYEA 4JXKA 3OHSX 4CLDA 3L4BC 2SCUA 5U4QA 1HRDA 1MG0A 3WIEA 3LT1A 4TSKA 4EJMA 3ZHZA 4A73A 3X2EA 5JY1A 3ADPA 2DT5A 2O2YA 3OJ0A 2BLLA 4BB6A 5CEFA 4FFPA 3TZKA 3VZRA 1B15A 3FNHA 3L0DA 3OICA 4JGBA 4YYZA 4JQCA 4ZVVA 1IHYA 3QVOA 1D7OA 2GDZA 2O4UX 5K6AA 1C1XB 1Y8QB 3QVTA 2HMUA 3ZGYA 2LDXA 1NVMB 2YHIB 2DUWA 1CWUA 2F00A 1DC3A 5ER6A 4IXWA 1DIRA 3ANLA 4B4VA 1JKJA 3INGA 4MPDA 4ALKA 3PJEA 4J1TA 4HADA 1KEUA 3R3SA 3GOHA 2O3UA 1HL3A 4RVGA 4ALJA 3DZGA 1CERA 1UXGA 3OH8A 4A2CA 1I01A 3PQDA 1T2AA 2W2KA 3PLNA 3OJLA 1KVQA 3K31A 4E12A 1O0SA 1VLLA 5C7OO 1SPXA 3KZVA 3V8BA 5DZSA 3LC1O 3I5MA 5A9RA 1ZXLA 4JCOA 3JD1A 3O9ZA 4AICA 1NQAO 5ICSA 3WOHA 2ZCVA 4O5OA 1D3AA 1AXEA 4J0EA 3PXXA 3IUPA 2IDZA 3W8FA 4CUKA 4JNKA 1YS4A 4CQMB 4GGPA 2VZ9A 2AW5A 3HDHA 3N58A 3PZRA 1GYRA 4AJKA 1OI7A 3NUGA 2VTDA 4P38A 4BGUA 5L95A 1E1NA 4Y6PA 1G0OA 5DBIA 4IIUA 4BGVA 5F3RA 1V6AA 2G82A 5IN4A 4EJ6A 4MVJM 1GY8A 3K96A 5CFZA 1XLTA 3DOOA 4BNJA 3IC5A 1GPJA 1HF3A 3RD5A 3PJGA 1HDXA 2EF1A 3PDJA 2FRDA 1GEGA 1XG5A 1CF2O 2VYNA 5ILOA 3G79A 4YBZA 5DOVA 1NQ5A 5C37A 5CPFA 1HDRA 3V2UA 3EZLA 4HFNA 2GASA 4GWKA 4XIJA 1LDMA 3MWDB 1LLQA 2J6IA 2JFGA 4FOSA 4D3SA 1EBUA 1O8CA 1F06A 1C0LA 5JMWA 4OXNA 5TRTA 4E5YA 1PL6A 1X14A 5A3VA 3WGYA 5A03A 3GK3A 4PFJA 1EEHA 1C0PA 3DFZA 2RCYA 5G4KB 3F47A 4B4WA 2DTXA 1BW9A 5CPBA 2RHCA 3LU1A 3H65A 3KSUA 1MP0A 4ZQFA 3RASA 3S1LA 2NTVA 2DLDA 3HJAA 4EJ0A 1WMBA 2VT3A 4RVDA 2X9GA 3JYNA 1E6UA 4NBRA 2DBRA 3VZPA 4TWRA 2P5UA 3VPFA 4M54A 4Q39A 2Y0CA 1K89A 3KYDA 3RUCA 3WGIA 1EVYA 3FWNA 5FI5A 4MOWA 2B4TO 3RWBA 2WTBA 5CP8A 4IPTA 3GH3A 3AU8A 3O4RA 2PGJA 2AE1A 1GYPA 1HXHA 2CVOA 3RUHA 3V5NA 3BA1A 5EN4A 2IRWA 2ZJ1A 3LLVA 4DREA 1NAIA 1DIAA 5JMPA 3TN7A 2ZYAA 3WMXA 1PZEA 1U3WA 1E3EA 5IF3A 4K28A 4O1MA 1C0IA 1EDZA 5F5NA 1WAMA 4F6CA 1EQUA 2RBEA 2J5QA 2YQ4A 3RUAA 4GPD1 2YQ5A 2HK8A 1U7HA 1TLTA 4CLEA 1A27A 5LC1A 4BO3A 4E0BA 1J5PA 4U0JA 1U1IA 4NJMA 3LT4A 2Q50A 1NHWA 4MVJG 1FDTA 1EVIA 1N8KA 1P1HA 2PTGA 2AEMA 2ZCUA 5A9TA 4IQ0A 3MTJA 1RM5A 2Q1UA 4GGOA 5FI3A 3NGXA 2DBZA 5IFLA 1GV1A 4OKIA 4YJHA 4M55A 1PSDA 1B3BA 2OORA 2DC1A 4GSLA 4IDBA 4DLBA 3ZV5A 2GN4A 1RM3A 1UXIA 4E3ZA 3KEOA 4OGWA 4F45A 3W4IA 2ZQYA 4GVLA 3DB2A 3GC6A 5CAEA 1QYWA 3JD0A 1H6BA 3OECA 2B35A 3BMCB 3KLMX 3RJ9A 4EUFA 5CEEA 3AFMA 4YEDA 2O3RA 2JL1A 4XIYA 4MIYA 4PIVA 3ETDA 2Q3EA 4H16A 3KLPX 2HAEA 1K6IA 4FOOA 3FTNA 3WYEA 1U8FO 1NFQA 2VRCD 3JYOA 1RM4A 5EL0A 4AFNA 3P2YA 2P9CA 4XJSA 4IZIA 2BH9A 3E6AA 5IDQA 3BMQA 2C54A 4NBVA 3H9EO 2A94A 4ZRMA 3ZNNA 3EGOA 1CEQA 4NJOA 1XU7A 4IQGA 3LLSA 3IOYA 3M1AA 4C4OA 3QVSA 4PG5A 1LC0A 5I7EA 3RC2A 2PZKA 3FNGA 1P77A 1R4MA 3G0OA 2X58A 3ICCA 1DAOA 1DC6A 2VUSA 1LDBA 5L4NA 3LC7O 3MJVA 5KOIA 4I9UA 3WFIA 4BQRA 2D3TA 4I1IA 1JWAB 4WEQA 4TRNA 4YJHB 3CPSA 1UP4A 1ZIDA 5HS6A 3H9GA 2R6JA 4HFMA 2H1SA 5JW6A 2G5CA 2Z5LA 3H3JA 1YDEA 3K30A 1ARZA 1GUFA 2Q1TA 3BIOA 3DAGA 3MTGA 1HSZA 2JHGA 3R1IA 2GZ1A 4CM5A 4QTZA 3PIIA 1TB4A 3D0OA 1ZMOA 2QRKA 4TRRA 2AMFA 1E1LA 1PU2A 3PHGA 4BKRA 5JAMA 4JK3A 3AUAA 4RVSA 1D1SA 1GV0A 5JAQA 1GADO 3Q2KA 2ZKLA 4HXYA 5G4LA 3NT5A 4CM1A 4LRTB 1ISGA 3QLJA 4CL8A 1LRLA 2W2LA 3RU9A 3ZH2A 1PS0A 4GWGA 3W4JA 2CNBA 1IL0A 2GF2A 1EUZA 1JU9A 1KERA 1N5DA 1JW9B 4FBGA 4IDEA 3OEWA 4UVIA 3QWIA 3SEFA 3VZQA 5GZ1A 4INAA 4G65A 4CR7A 4TKMA 4ROSA 4WCFC 3AM4A 4BQPA 4KDFA 1A7KA 3DHNA 4R5HA 2WSBA 4AJEA 5KVVA 4FJ1A 2Y05A 3QJ5A 4YTEA 3JQBC 4Y67A 3HDJA 3Q6IA 1YOVB 1Y81A 1LNQA 5KKAA 1PJBA 3OJOA 4B79A 3TWOA 5KNLA 3QQPA 4WLUA 4R1TA 1N7GA 2NVWA 5BNIA 1VPDA 2FPGA 3VVBA 2B37A 2ZB4A 3ABIA 3PYMA 1HZJA 3ZV4A 1XA0A 1QR6A 1TI7A 4FPXA 2NTNA 3CZMA 2EGHA 4IIVA 5BNFA 3VPXA 2Q2VA 1DFGA 3AOGA 4OQZA 1H5QA 3WS7A 3B1JA 1L7EA 3WWZA 4QO8A 4JBGA 3K2BA 4I8XA 3W8EA 4CMCA 2OXIA 5AQ1A 4HBGA 1NR1A 1M6WA 4CMAA 1JKFA 2G17A 2AQIA 3PI7A 1Y8RA 1NNUA 2NNLD 3LK7A 1WZEA 3NTRA 2UVDA 2BFOA 2EKQA 3T4XA 5IZCC 1P74A 3KYCA 1E3WA 4E2YA 3F3SA 1B8PA 1LA2A 3MJEA 3PRJA 1GFSA 5BSFA 4J4BA 5EQFA 1H0KA 2B4QA 2UYYA 5G0TA 3BTVA 4N7RA 1CIVA 3NKLA 3VVCA 3QY9A 3NDJA 4FQ8A 4A5OA 3ZI0A 4YACA 1ZJZA 4L4RA 4DXHA 5C5IA 5IZCA 2JKVA 2DBVO 4WECA 2VWGA 5EESA 5JPIA 5T57A 1YRLA 4HP8A 2GYYA 3IKVA 4IXTA 4CMIA 3PJDA 1DOHA 4MIOA 1YVEI 1ULSA 2Y1FA 1T1RA 1C1XA 1ML3A 1YQDA 4R16A 4C7KA 1Z45A 3WLFA 4KWHA 4MO2A 4R3WA 3I9NA 4BNHA 2V6FA 2X5KO 3FNEA 1U3TA 3JQ7B 4E6PA 3RBXA 3WQQA 4K9DA 4A27A 3ASVA 2EG9A 3WGTA 3BHIA 4BGIA 2YDYA 4L4XA 3GPDG 2BF7A 1I24A 4GH5A 4YJDA 1C0KA 1NPTO 1A9ZA 3BHMA 3AOEC 4Z3DA 1SCUA 4NU5A 3RUIA 4CJXA 3PYLA 1NM5A 3JQAA 1NP3A 1PGJA 4HY3A 5KTKA 3QWBA 4I5EA 1Y8RB 1WZIA 2Q1WA 5T6BA 4ND1A 3DTTA 2Y0EA 2PR2A 3HDYA 1AUPA 5JDIC 3AI2A 2EJWA 3KUXA 1P0FA 1PL8A 3IQDB 2EP7A 4J0FA 1Y9EA 2HDHA 1NQTA 1P1IA 3SXPA 1U8XX 2A35A 3ZWOA 2OUIA 4ALIA 1N7HA 3EAGA 3LF1A 4NPCA 4CLOB 4YQZA 1VKNA 3ZWWA 4PZCA 4FJ2A 2Y66A 3A4VA 4B3JA 2B83A 4DPLA 4YT2A 5KIAA 1NYTA 4XR4A 5AXAA 4PLPA 3ZWAA 5A05A 4CLXA 2DPHA 1YL6A 1E1KA 3VAZA 3H3FA 1T4BA 2Q45A 1QXSA 1QKIA 2VCYA 4GKVA 2JD0A 3S2FA 3DBLB 1DPGA 3OQ1A 1ZFNA 3L07A 1ZSNA 3M2TA 5CDTA 2I3GA 4ZQBA 5CDGA 1VE9A 1YONA 2X4GA 2X0RA 4YRAA 1PX0A 3QW2A 1I3NA 5F1KA 3JQGB 4G2NA 3VH1A 5AVOA 5C7IO 3JQ8B 4QQRA 1RM0A 1KY5A 3Q9UA 5A3JA 1JA9A 2J3JA 4AL4A 1EK6A 4DC0A 3JCZA 5GZ3A 4FDAA 4CL3A 3IIEA 4EDFA 3AK4A 3GT0A 2I99A 1V35A 3R0IA 4YA6A 1U2GA 3HN2A 1JAYA 4CMHA 2PWZA 1LRKA 4AG3A 2D8AA 1C1DA 3BZUA 1E3SA 5KCZA 2E4AA 2OBYA 3SJUA 3VPGA 2W2LD 4BS9A 4LSWA 3UOGA 2ZJ0A 2YZ7A 2IXAA 3IS3A 3WJAA 3UAGA 4FFOA 2GNAA 1FDUA 2X5JO 1BG6A 3L4SO 2PZMA 3TOZA 3ITKA 4JJFA 2UUOA 1FXSA 4PCVA 4JJGA 1DRVA 3D3WB 3RC9A 4DTIA 5DOZA 3A1NA 3HUDA 1J4AA 2P9EA 1KS9A 2OBNA 5IZ4A 2BD0A 3EZYA 1EUCA 1EUDA 1KVRA 3HNPA 4TKLA 2VYVD 5AOVA 2Y0DA 3IKTA 1K2WA 2UDPA 3KO8A 4J7XA 4PLTA 2NV6A 4J7CA 4BV8A 4D0RA 5ITWA 5TNXA 1EDOA 4PLZA 4G81A 4WLEA 2DQ4A 2NM0A 4AJHA 1B26A 2VZ0A 1ULUA 1LDNA 4UVGA 4WOJA 4NK4A 4Y9DA 2GUGA 5KJ1A 4LMRA 4J4HA 4I5FA 5B1YA 1DRWA 5L45A 1HEUA 1R16A 3AW9A 5DF1A 3RC7A 3F46A 1VL0A 2V6BA 2PD4A 4DBZA 2E48A 3KYDB 1OOEA 2D4AA 1BDBA 2WM3A 4KTVE 5ENDA 4XQCA 4LISA 4E30A 4RZIA 3JD3A 3UCXA 4ZN6A 2BI7A 4J1SA 3Q1LA 4HKTA 3OMLA 4Y6SA 4JBIA 4BO7A 1MXHA 3I52A 5B4UA 3U49A 1MXFA 4LMPA 1DIHA 1PS9A 1NAHA 1ZMTA 4WCDA 3WQSB 3D4OA 5K6AC 2EW2A 2TMDA 1UZLA 4ZA2A 1JWBB 3ZWBA 4EBFA 5MGBA 3DDNA 3CMCO 1P33A 4Y98A 4RPHA 1DIGA 4I5DA 5B12A 1U9JA 2CVZA 5DBFA 4DBVO 3DBHA 4N5LA 3ROQA 3B6ZA 1FDSA 2BFAA 1VJ1A 5G4KA 1YL5A 1PQPA 4XB1A 5GMOA 3JQAB 1JVSA 4WE3A 5HTOA 1E92A 1P3DA 2NADA 4GX5A 2FWMX 4N54A 4Z9XA 2WYVA 3SLKA 4B7CA 5BNTA 2VOEA 3PYXA 4B4OA 4BO2A 5C7LO 1N92A 2YV1A 4MVJH 1ZZEA 3FD8A 2YFQA 1I8TA 4FFMA 4ALLA 4PN3A 1WW8A 2Q99A 1MGOA 4J1NA 2FOIA 5IN5A 1I5RA 2PGDA 3MJCA 1UUFA 3K73O 1I3KA 4GLLA 4OXKA 4XB2A 4E5MA 4ZRNA 4CQMA 4MVJF 3CE6A 3P5SA 1VC2A 1A9YA 3QHAA 3EVTA 4LCJA 3V1TC 1PGPA 1ZUD1 1T2FA 1LDYA 1SC6A 2VRCA 1KYQA 5BSHA 3BMCA 3ETGA 2C2YA 2V7PA 4U8GA 4JP3A 2NU8A 5I7VA 3RUEA 2WJPA 4BL5A 5AYVA 1YL7A 1U2DA 1MFPA 3EVNA 5EJ2A 4MJLA 2X22A 3FCOA 3WB9A 4ND5A 4IMPA 5HM8A 1WP4A 1WVGA 5I8ZA 1XCBA 4BHTA 5A02A 1QYCA 3C1AA 4E2ZA 1YB1A 1A4IA 1N1EA 1H94A 3PIDA 4A0SA 1C14A 1DJQA 4CR8A 2VHYA 3PHIA 3ZNOA 1LSOA 4YJGB 1UJMA 5COAA 4X54A 4ND2A 3UVEA 1GZ3A 1LC3A 4NFYA 1E1MA 1NVGA 2DVMA 4YJGA 2VN8A 5L4LA 3LYLA 5L3ZA 2P91A 5JCXA 1I30A 4LSMA 2Y1OA 5JDIA 4RZHA 3UF0A 5L51A 2HCTA 3NDIA 3VKUA 1MFZA 2O2SA 2XXBA 4J16A 4AJLA 2JJYA 2BFPA 2EEZA 2QIOA 2VWHA 3DC2A 4GI2A 1LLUA 5ES3A 4Q9NA 3PFWO 2G0TA 2WDZA 4KDEA 4JLWA 4EUHA 3KB6A 4FR5A 4L74A 1HLDA 4R1UA 3O03A 3TQHA 5DNAA 1PQWA 3WSWA 2YJZA 3F9IA 1VM6A 2PZJA 2HQ1A 3D5QA 4R51A 3RIHA 5HS4A 3JQ7A 3BTSA 1QV6A 2HMWA 1X1TA 1X13A 2E49A
chains in the Genus database with same CATH superfamily
4ZAGA 1I7LA 1L8OA 1QQAA 5F76A 3CB4A 4ZPJA 4WLNA 3TIVA 1XR3A 3LHKA 3RS0A 1XIVA 4RF2A 5DKFA 3L1JA 1V3VA 4NYJR 1GT6A 2P5SA 5MN5A 1A9TA 2CFTA 1XRSB 2JD2A 4RLFA 4BRWA 3BD8A 4DV6B 1Y6FA 5LQRA 5C18A 1TFUA 2DETA 4KN8A 1N5KA 4OAPA 4RKRA 3PUYA 4Z9BA 1F1BA 3PDWA 2X7HA 1C3VA 2YJ6A 1KR2A 4A2WA 3ZQJA 5K0NA 1GFZA 2QT9A 1F1JA 3B8HA 5BPFA 5ICEA 1TT5B 1WM1A 1MIOB 3OOSA 4LOJA 3FRHA 3WWYA 4BDTA 4DIFA 1OH8A 3BSWA 3P0IA 1L5LA 2N46A 1O6ZA 4MUMA 1J5XA 3KQHA 1NX6A 1YGYA 4IVNA 2FSSA 4GYKA 1NUAA 4F4HA 2I80A 2F8LA 3T5GA 4BNXA 2EFHB 1SULA 3QHQA 3ZZNA 5DULA 4Z4FA 1ZA1A 1MLDA 1SRRA 2P9ZA 3SC4A 2Q9BA 3WNCA 2VVTA 4MKHA 1IIBA 4YMSA 1N0VC 2ZSDA 1Z6AA 1XD2A 2D06A 3I28A 3LXUX 4PX5A 3KB2A 4MKGA 3A10A 1O03A 4ZVTA 4JLAA 3PGA1 4UHBA 1IJBA 2JVIA 5MDHA 2COEA 1P72A 3BSSA 3GNSA 3HGMA 3WL7A 2EX0A 4NG4A 2XVAA 3FVVA 2DKFA 5C8ZA 2LNDA 2X41A 3U7HB 3B1XA 4M8SA 3AVUA 1U1FA 2OLJA 3DFIA 5G41A 4FGSA 2AZTA 3C70A 1QGZA 2WT9A 2JI9A 1LH0A 4AMYA 4E4YA 4H3HB 7MHTA 3R7NA 1Z4OA 1LK7A 5CX4A 2AV6A 3CUVA 3ESDA 5CMLA 5C51B 3H84A 1CG6A 2D6FA 2QPLA 3CZ4A 2PS1A 3DHEA 4XGKA 4IFTA 3ZY4A 4C4PA 4XRGA 1V5IA 1I6LA 5C34B 4WL0A 1R15A 5AXCA 2ZULA 5CGZA 3L4KA 1Y3BE 3OSZA 4D9GA 1VJ5A 3IQIX 4EW6A 2ZJ6A 3TKAA 3WDKA 4F4FA 1OY1A 2EJTA 1RCTE 2H2DA 2VF7A 2R2GA 1QP0A 1Z2NX 1JG6A 1FMCA 2YJNA 4NARA 1IY8A 1TO2E 4PPYA 2JLUA 3RWOA 3EW9A 3C8ZA 3K4PA 4GIBA 2WVGA 4MUGA 4O4JB 1OSNA 2CE2X 3EBOA 1C8VB 1VGVA 3R5JA 4QXAA 4FNOA 5LZ8A 2EFDB 3QTTA 3CRW1 5C3UA 3VU3A 3OLQA 3GZNA 2NXNA 3A1CA 4FB5A 2PPVA 4RTSA 5IHXA 4FX5A 5IT4A 1Q57A 1ZH6A 1VCOA 7MDHA 4BRZA 2OL4A 4NZZA 4UUPA 3G1WA 2VYND 3DL7A 3I64A 3I8SA 3PC4A 1Z7BA 3VU1A 3FSJX 1LU9A 3L3BA 4HWRA 3W9SA 3WK6A 1U0FA 3MINA 1V0JA 2YMQA 4NHEA 3TEJA 4D8WA 4JITA 4EFLA 5I51A 1T36B 1R27A 4LXHA 5C53B 2D5CA 1TAQA 2YIMA 2P6OA 4TWBA 5LQUA 2W70A 3B7PA 2C7RA 3IBFA 3SHVA 1KDRA 3ZEIA 1KJNA 3O38A 1QAMA 2EWVA 5KJEA 4ZAZA 4AQDA 4WK0B 5TF0A 4EYSA 4NV3A 3MMNA 2X2PA 2PSHA 1UBHS 4BMSA 2A8YA 3ZJYA 4X00A 4BKMA 3KYJB 1GPLA 2DPMA 5CJPA 4F8YA 2IOHA 1GL7A 1XMXA 1NQOA 2FZCA 2VJYA 3TECE 1WPXA 1GPAA 4L07A 2EVWX 2IWHA 1O9GA 1UK9A 1TOAA 1ST3A 2L17A 4K5QA 4UEWA 4G4SO 3WSVA 2RJNA 3DHYA 1BFUA 1E58A 1FBNA 2X5XA 3G49A 4BO1A 4EBBA 4OXYA 2WQ6A 4OXIA 3QK7A 3MK31 2G76A 2H0QA 1Y8QA 4DCCA 1G8SA 3OCUA 1LW6E 1O5TA 4GLJA 4Z0HO 4F9GA 3HDTA 3SC6A 4PZAA 3FZEA 4HX9A 3SI7A 1IRXA 1TL7C 2Y4OA 3F5DA 1PHRA 5F73A 4POOA 1BOFA 4R4JA 4NENB 1OIXA 1NULA 4NNPA 4D98A 4W7HA 1T2NA 2ZBDA 2RHTA 5BN1A 2XZLA 2HWYA 4C05A 3GMDA 4BNDA 5BQFA 2PCJA 1W87A 3NHZA 3AEUB 5SYAA 3MMZA 3QVMA 1IEXA 1N57A 1XYGA 2PHZA 4FQ7A 4WCFB 1G6KA 4AYTA 1DS6A 1QIHA 1A04A 3OIFA 4MEBA 4QOGA 2NUPB 3L6BA 2VUTA 5JZ9A 3VUFA 4HSGA 4UBKA 2GAJA 3S1AA 1FDVA 2WD7A 1RWMA 3C6MA 3EXHA 4A0RA 1IAQA 4N7JA 1WV1A 3MTQA 5MHTA 1J42A 4IIJF 5TQJA 1QHSA 3Q0EA 3LFTA 3UJ3X 1K5HA 4Z86A 1D4ZA 3DZBA 3LMKA 4NNJA 1C1HA 1ORTA 4RZ3A 4EHKA 4B5LA 2A1TR 4NH4A 4YRRA 4PYIA 1WDMA 2J08A 1QCZA 5DNVA 4KODA 1BMDA 1ZOSA 3IAUA 3LKZA 2OO5C 4XD7A 1AS3A 2IYWA 3DM9B 3H1BA 1X1SA 3I04A 3JQFA 4KKXB 3T99A 4E5KA 4EUSA 5F7OA 2B5OA 3E27A 1ZRSA 4RVUA 5CK4A 4QASA 4OIFA 1FQKA 5ECYA 1YB4A 3UXYA 2NAFA 4A2QA 3VC2A 4FDLA 2WHQA 2XCSB 1JSCA 1R8QA 3LKBA 4OREX 2R6FA 4BVHA 1PTJA 3NV7A 2ZYDA 5K4AA 3GLIE 2GEJA 4C78A 2ONYA 4RUKA 4J0DA 5H02A 2Q27A 3DV2A 3DVQX 4TVOA 2QRMA 2VZEA 2JIPA 2ZAYA 3KHTA 1KO8A 4DG9A 3QTBA 3BG5A 4G24A 1XJCA 3FWYA 4PAQA 4X8OA 3M6FA 5K0GA 5C46F 5FADA 3HVRA 4B3SB 2WMOB 1OV4A 1VHWA 2PSDA 3K4QA 3OPYB 4NL4H 2NXJA 2OC4A 3FVRA 4FCCA 1P29A 1JVBA 1N3IA 1FP4B 3RS9A 4J8PA 2J9YB 4BV3A 3TLZA 4EHAA 5AXBA 5L3VA 4FC6A 4U7WA 1NC1A 1MHPA 3TLCA 2V7TA 3QY0A 2BGMA 1P2VA 4BB5A 4AUMA 2PTHA 4WDQA 2IV2X 3R7WB 4WW0A 2PWAA 4GI3A 2ZRJA 5ITZB 2BFDA 2CXUA 2NO9A 1AKRA 1JHAA 1Z0KA 4QPDA 3CONA 5AM1A 2XJ9A 2QP4A 3VYVA 1ZISA 3QYFA 3M7IA 4OF4A 3OQOA 1WB9A 3B52X 4U3JA 5CITA 1YWGO 4HVLA 3P9KA 2HBQA 3FTPA 3B1YA 2VXBA 1QHHB 1MH1A 1JLRA 4EHNA 5LZ2A 4MUJA 3PEVA 4FZRA 4TXNA 3GGGA 4QELA 5TJ9A 2B1JA 3PE4A 3T61A 1F17A 3AIKA 1DX4A 4IDDA 1QH1A 3G2NA 2CMFA 1B43A 4NMHA 3SJ7A 2XD9A 1N75A 2BR5A 4YXFA 5ICCA 1XHEA 5C5IA 4IWNA 1QB7A 2RHJA 4C0WA 5HNKA 1K4MA 1D0IA 4PCUA 1M67A 4OJKA 4D44A 1JU4A 3A2MA 3ADCA 4YJ2A 1W0JA 4PVCA 1SUIA 3KHUA 4BFZA 5A5FA 3GZTB 1P1KA 1R12A 2MSDB 3OTIA 2JIDA 4RMHA 3T5MA 4C7BA 5J58A 4KNVA 3K9FC 1BDJA 2II6A 1RIIA 3IUJA 4KHPB 3FMPB 2PZAA 3JYQA 1KJQA 2ISSD 2X9VA 4CN8A 3B5JA 3HZZA 4O2BB 4EKNB 2FSFA 3KR9A 1KH2A 4M1OA 5JVDA 4M87A 3CZAA 2C59A 4N8EA 4OLHA 1T6YA 3F2IA 3CPHA 1VDZA 1F0PA 3MFYA 3VSCA 1O94C 4QX6A 5B4VA 1BX3A 3ILHA 2XTMA 3D5TA 4DQUA 2QR2A 2Q9CA 2G1AA 1YJAA 3HR8A 2BN4A 4O4IA 1PN3A 4QDZA 1NPDA 4X64B 4TMTA 3CXUA 3OZTA 4IDGA 1ENYA 3H2SA 1ZH8A 2YOHA 4OM7A 5M2QA 1YS2X 4HLNA 1PT8A 4XD2A 1E6WA 4AKGA 3WFJA 3EW7A 1YDFA 1BXGB 1AO3A 1BWQA 2FFQA 3P20A 2O8CA 3CT4A 3ZIAA 4BWYA 3TI7A 4COOA 1TT5A 1DU4A 3AVOA 4CDMA 4JIMA 5C4MA 2WMYA 1E2FA 1ESNA 1NBWB 3K5IA 5F33A 1DBIA 4OB6A 3FDIA 5FKJA 5A0FA 1J99A 2Q6OA 3LUKA 5D1HA 4EY4A 2XVMA 4YRDA 3H9BA 4G5FA 5I7OA 3K5WA 2JG3A 5CB8A 1BGVA 3IBSA 1P8AA 1SQ6A 3NPAA 4JEUA 1ENZA 4RANA 1T1IA 4RV4A 1U0JA 1UBTS 3GJ7A 3BE8A 1C3OB 3RYTC 2IHNA 4HGPA 4ZAXA 1V8FA 1MN6A 3TCXB 3W2TA 2W11A 1HURA 1M8JA 1NT4A 3IDAA 1NBHA 3WGKA 2CLSA 5DNYB 2AG1A 2DFNA 5HEKA 3ZHRA 1ZJ6A 1TYEB 2Z09A 4AIIA 5G1NA 4NDZA 4ND6A 5HUQA 5H80A 3F96A 4LNUB 5F52A 3W5AA 3A9SA 3NWEA 4L4ZA 2B34A 3AH8A 3A1TA 3AHJA 4J91A 4NX2A 2ERCA 2C96A 2ZSHA 4ERNA 4K6FA 4QODA 2XNHA 3BFPA 1YD7A 1G8YA 5JS6A 4PN7A 2M6SA 1D1PA 1YZHA 3QENA 4C7JA 1I0ZA 2R5FA 1M76A 1VCHA 4ZVKA 1RZRA 4Y6GB 4HXEB 3IUYA 5FP0A 2CUKA 5FYQA 4QYMA 4MPRA 1Y5MA 2H3EA 2ZAGA 5ISMA 3EIXA 5HZGA 1KMHB 1THZA 2L19A 4DLRA 3LYUA 4PZYA 5A71A 4C1BA 1BS9A 2GZHA 1FZQA 4E15A 1FQOA 1HEIA 4ZQHA 5ALSA 2WJWA 1XWFA 4CPDA 1RPZA 3S2IA 3ZU4A 3QA9A 1O5IA 2ID4A 4GI5A 5AKJA 1ILWA 1DG1G 1KYZA 2H2WA 4DV0B 1H2BA 2GXSA 2YNMC 3FUXA 3HG7A 5AM4A 2X8JA 2ZLBA 4KVAA 2ZSKA 3GUYA 4PXSA 5HIAA 5F1OA 3PFHA 4I6EA 4PR0A 3TD6A 3UQYS 4BFCA 1PJSA 1PJRA 2Z83A 5DYIA 1A9SA 3M1YA 4F7WA 1Q3HA 2EX4A 1F8GA 1U3FA 2IUEA 1XRLA 3MBIA 3Q7QA 3I73A 1RLJA 5EOVA 4JI8B 5DLPA 3DD5A 1DP4A 4KI0A 1WXHA 4GAEA 2HMTA 2DQYA 4KMOA 4BQIA 5MFPA 1RLOA 3KB1A 3OJWA 4NH0A 2OECA 2FQWA 3B1VA 4NFLA 3H2GA 3HE3A 3VO2A 3B1KA 3BILA 4BUZA 4OHYA 2V7UA 4I3FA 1U7WA 4O4JF 4QVGA 5CRIA 4CM8A 5EVCA 4N4AA 3HM9A 1ZVVA 1ZCAA 1R3UA 2X8LA 2WJGA 3KLOA 1RYDA 1P4HA 3V4VB 1L7QA 3VR4A 1II0A 3U13A 4XARA 3RYFA 2FP3A 1WB6A 1VFPA 1Z16A 2RDMA 3COVA 4M1WA 4C06A 3CLRC 3TR5A 2I34A 3U44B 1YR8A 4D42A 1GN8A 4CMGA 3FHJA 4QOSA 5G0VA 3WADA 3ZV7A 3A1WA 3IQFA 3SQDA 4PLFA 3DMTA 3ROKA 1JIQA 3HKDA 2PX3A 2Y1KA 4LKRA 1CHDA 1TYBE 3GLSA 1ZOOA 3BGDA 1RVDA 3LBIA 1CJCA 4U2DA 5KYYA 3A9UA 3LF2A 5DTMA 1YDMA 5H3HA 1IPFA 1UBFA 5JECA 1A7JA 1G6Q1 3ZQKA 3D2CA 1B42A 4ZV9A 1SVNA 1WO8A 5EG5A 1FLDA 2N1MA 4L5AA 4W1SA 5FPQA 1Y80A 3OKAA 4NDAA 5EYPB 1JI0A 1GA6A 1S6YA 2XRYA 3OSUA 3ZV3A 1M0TA 3D9QX 5CVTA 4W4TA 4L57A 3GQVA 1X1CA 4WKGA 1Z6PA 4EEKA 1T4CA 1H42A 2QSUA 1B8VA 4RGBA 3L7DA 3N9IA 4HN4B 1D03A 2F3RA 3QXCA 4UU7A 1OAOA 5HMMA 2FMIA 3EDOA 4PHHA 2M6LA 1R0RE 3JQGA 4CL2A 3U56A 2O48X 2VPQA 3I32A 4GG1A 3SE7A 2YJ4A 1QB8A 3CB2A 4HQKA 1LS1A 3K0FA 4NS1A 3VVLA 2RKWA 1V9SA 1HMPA 1UINA 1CP3A 3CEMA 2ZI5A 2GYUA 3KYBA 2NZUG 1E6EA 2AFHE 5AUOB 1RHJA 2PWYA 2PD3A 2PGAA 2YN2A 2TMKA 4KNWA 3P9QA 4BP8A 5A4KA 4LS3A 2IX3A 5E3JA 1VJDA 2BE9A 5DPMA 5DIFA 4CM4A 4FX2A 1XU9A 1U28A 2V03A 3N0TA 4S04A 1WDKA 4I19A 2WU4A 1O8BA 3PPYA 3QMVA 2QUBA 3R24A 2UUBB 5FUXA 4AJ9A 4MAAA 5PGMA 1JE0A 3DR3A 4HXFB 4LHZA 4BBJA 4E5DA 1PUIA 2D1YA 4EITA 4YI5A 2XHEA 4CUZA 5JFTA 1KYIA 3TZEA 3K6JA 1NATA 5A1JA 1DBQA 4JELA 3OCVA 1Z5UA 2VWQA 3R6GA 3RVQA 4J1TC 2J41A 1A5ZA 3L8DA 2EYQA 2IZ6A 2J0UA 4UZSA 5DCUA 1AU9A 1SKQA 2VPWA 3ZHQA 4RTNA 2OQ2A 1KI9A 3HB9A 2WUFA 4O29A 5CDYA 2ZFUA 3IEMA 2QTRA 4GC5A 2CLLB 1KDTA 2I6GA 2VT7A 4JY7A 1XAHA 4HYTA 1V9LA 2PH3A 4YT5A 2A1TS 4KXXA 2ZUTA 2M9MA 4D7AA 1NBME 4ZI7F 1KQPA 3I4FA 3VM6A 4NE2A 3BMNA 4EMUA 1C1DB 1G9SA 1YVUA 4JC8A 1T8SA 3EDCA 1TJ5A 5DXJA 4B3DA 1N25A 1ZGAA 1DAEA 1FCJA 3GA5A 1RCUA 4KN9S 4MZXA 5FTWA 4DBLC 1GPUA 2XCQA 4MNTA 3GG2A 4MR7B 1LFAA 4RS3A 2GD6A 1FLNA 3PNLA 1SEVA 5D51S 1BJTA 4WVLA 1OIWA 1PSZA 3A4IA 3G59A 1MOZA 3P9NA 3EUFA 5IXSA 1RABA 1W5AA 1QRSA 1F7UA 5JE8A 1G38A 1Y6QA 3RRNA 1T2DA 2PX5A 4CW7A 1ZXXA 1E1RD 3IV9A 1CUAA 4MQ4A 4RY9A 3Q8KA 5KDDA 5G0WA 1MB4A 5AKIA 5CT6A 2G8LA 5CDSA 1CQPA 3L0IB 3EDYA 1GZVA 3NGLA 3NJ8A 3TLAA 1H2YA 3PKIA 1G0NA 1WP9A 1F8FA 3M6XA 4MTCA 1A3CA 1VJGA 5LFAA 3X0DA 1ZOIA 3GLQA 1YUMA 2WU1A 4EG4A 1AQNA 3AQ4A 1UIMA 3DOUA 3KKPA 6ADHA 4NTZA 1EVZA 4NULA 2CSUA 4GNKA 4DYDA 3RVDA 5C4IA 1AF4A 3WZ2A 4JYAB 1GR0A 3N2KA 2XR1A 4HD8A 3SOZA 2EP5A 4U63A 3KEFA 1XNRB 2XYVA 1PHPA 2GI4A 2GN9A 3VKFA 5G3YA 2R8YA 3ZV6A 1QPBA 5HJ7A 1C41A 4TLMB 1FRFS 1MAWA 2P9GA 1DKMA 2ZE7A 3MOIA 2P5YA 3O3OB 3PFBA 4GD3Q 1M5UA 1KSHA 2Y1XA 3U2QA 4B74A 2FR8A 2PZFA 2XRMA 1ZI9A 4K6CA 1KEEA 3AIOA 4G4GA 3HGQA 2AIRA 1Y5LA 4I1OA 1P5JA 1OT5A 4L15A 3V80A 4FCVA 4G3XA 3IVRA 3KPVA 3PNYA 4YP5A 3EEFA 1L3BA 3GLFB 4WY2A 5KQRA 4JQYA 4WKNA 3RVJA 4C3VA 4TYNA 3VJMA 4QU0A 4B3BA 2D7JA 3WBBA 3RKUA 4X41A 4PS1A 3B9PA 2RGNA 2ZWIA 3ENKA 4Z6KA 4MB2A 4RABA 4BNNA 2ZR7A 4MAMA 4PINA 3BWVA 2BGKA 2XQGA 1K98A 4IIFA 4ZYTA 5EJ7A 1EQAA 5FV4A 2UVQA 3G9ZA 1E79A 1IHOA 3T9CA 4Q05A 5JJCA 2E5LB 4TMFA 5GM2A 3EXEA 3B51X 4MS1A 3B38A 4LX0A 3RUDA 1KA9H 1TIKA 4Q24A 4LCEA 4YMUA 2J48A 3QE9Y 3V7UA 1J39A 4MR8A 1QSGA 2G4CA 2QMOA 4P3NA 1VIMA 4LSGA 2H5JA 4V39A 3SBEA 5IWAB 4B83A 1YR6A 4ND8A 2E3JA 2GPJA 1OTHA 4KE8A 3H5IA 2PN1A 5F4ZA 2Q3HA 5DCLA 1LPBB 1DHTA 1XTPA 4BLOA 5K5EA 2ZT8A 3PS9A 5I8WA 1JFVA 3PVCA 5IW8A 2BTOA 4MW1A 1VGRA 3GT7A 1E9VA 1X2EA 3F7OA 3T0GA 8GPBA 3TSCA 5ICMA 2IW1A 1ABFA 1G4UR 4MKZA 2CLOB 2PZLA 3OX3A 1I6WA 2FX2A 4H6PA 4L73A 4TTSA 3ZNQA 5IAAA 4DSOA 4LJAA 1JFRA 4KQ9A 5U9CA 1X8XA 4BGEA 2WKSA 3WMWA 1X1EA 3A6GA 3UMMA 4M88A 4WUVA 4C7XA 2H16A 2GZ2A 5ESWA 3AU9A 3PWSA 4HNUA 2JJ8A 3TG8A 1IZ9A 2CLCX 1G2PA 4XCVA 4E1VA 4K26A 3RHZA 4ROTA 2F7SA 3G2LA 4JOQA 2IU4A 1VDMA 1Z4QA 2W71A 4G23A 2FW0A 2NV2B 2XT9A 2ZRNA 2BTEA 4OJNA 2XRFA 4URHA 3C7CB 3A26A 1T3GA 1Y48E 3GP5A 4LXYA 2P6NA 1JLKA 4JC4A 4JJ4A 3RDPA 3WIDA 3BQMB 3A9VA 4AO7A 3DWFA 1LBEA 3B6IA 2JKYA 3IUMA 2ZATA 4RA9A 1QCYA 4EHLA 3ZKAA 4LYEA 4YRGA 3ABOB 3CCCA 1UDXA 1DG3A 1SO8A 2PH1A 3CZ5A 3ZU2A 1Z8DA 4A8TA 2OBLA 2RH9B 4XB6B 3O6VA 3NATA 4MUBA 3NIWA 3PNPA 5CCXA 2Z6QA 3VPAA 5CEJA 2HLPA 4D0SA 1BHSA 1D6MA 3I1FA 1DAGA 4R41A 2K6GA 3TSZA 1X3LA 3PQ5A 1KKUA 2Q9UA 4ZPXA 1IAVA 1PV2A 3PSHA 5B2EA 2DE0X 4OBXA 3EFBA 3WLSA 3MLAA 3NBAA 3GFFA 4O4LB 1P5HA 5JAUA 2M2IA 1HDGO 1ISRA 3E18A 3U7JA 2QBYA 1PG5A 2OHVA 2OO3A 4HWOA 4QLBA 4CEJA 3HV0A 1E2KA 2GZ3A 3WLOA 3ZKWB 1NJFA 1NXQA 3DTVD 4Q3DA 4RHEA 1SCAA 4IGKA 2C82A 4YUYA 1N34B 1QNLA 3I37X 3TQQA 1BGXT 2CL6X 3JPYA 4I81A 4ZI7A 3V7WA 2P68A 3PE6A 5EHNA 4B3HA 3I58A 3A28A 1L5HA 1J8FA 2JFHA 2XGOA 3TZCA 1TUEA 3UUGA 3WZMA 3AM1A 2OD7A 5ALPA 4N47A 2P2SA 2RHRA 1K7EB 2WYIA 4AY3A 3KTAB 5JC1A 1ZBDA 3SSAA 2BBOA 3W3AH 1ENOA 5EFOA 3ECCA 3STVA 4DABA 1IZ0A 2O4CA 1I7NA 1WULS 1ZD2P 1U94A 5DXAA 3WICA 4OHOA 3MMXA 2CLMB 3BH0A 4QGBA 3ROMA 2O23A 3NYWA 2CCGA 4RDIA 5LP6A 2I4OA 4JKOA 4WA8A 3WLEA 4U2BA 2I5PO 5DASA 4ARZB 5AJHA 1EP9A 5BSGA 1DKUA 3T12A 1IXYA 3WYNA 2GEUA 4J2HA 2VF2A 1GPYA 3SS8A 1QKKA 4Q4HA 3HA5A 4AZ0B 1UDWA 2GSDA 1FJHA 2P9BA 1DQSA 3N3AC 5F78A 3S5UA 1C3JA 1LY1A 2B94A 1WSAA 1GLNA 2A67A 5ALEA 1ZK3A 2V54A 1RCFA 2R97A 1WXWA 3NWJA 4RELA 1YULA 4F84A 3T7IA 3JRWA 2DECA 1J8YF 4I6GA 1W36C 3C7TA 5I7UA 3RYHB 2E55A 1PR9A 1BA3A 3R3UA 5IBQA 2AHOA 2B0JA 3PCRB 3VNUA 2AQKA 3LJKA 3A9CA 5JDCC 2QLTA 2W2MA 1MQAA 16PKA 2DX7A 3HMQA 3INNA 4INJA 4Z0TA 1KY4A 4S24A 3O8QA 1N4AA 1UMBB 1VIVA 2D59A 2V3VA 2X4LA 1EWTA 2ID7A 2QPOA 5JWOA 2DB3A 2HBRA 1L7AA 1OYYA 1Z7GA 1N2ZA 2XOKA 3KRTA 1LSSA 3QHPA 3HB4X 4FDUA 1KGSA 1UIRA 3AFGA 3DAPA 3DFKA 3V32A 3VU8A 1MD9A 5CVEA 1WNFA 3CFYA 3WR5A 1ZM7A 4X71A 1XXLA 4GWLA 5C52B 3AVYA 4EVQA 4R2JA 2X0EA 4A16A 3EQ9A 4L7QA 3VFDA 1PDOA 1L0BA 4GQBA 2QM0A 2F9LA 4F2DA 1SD5A 2P35A 1JJIA 2VQDA 3IIKA 1CR4A 4GVXA 1YB6A 2E1RA 3IALA 4UUOA 2Y0BA 1OF1A 3D8UA 4LDAA 3KWJA 4YP0A 3VA7A 1H2WA 3EWAA 3KKNA 2BGRA 4LVOA 5L4SA 1A76A 3OX2A 4H7PA 2HGSA 4Y6LA 4ZYWA 4RTQA 4KMMA 5FNZA 2V45A 1VP9A 3FYTA 4Q01A 4WPGA 4Y0AA 4CQLB 3HXQA 3RTCA 1B23P 3AY6A 3MM4A 4N3AA 4UAVA 3TLKA 4MWBA 1EK5A 2C42A 4DCJA 1AJEA 1JDJA 3U7EB 3EEOA 4DIBA 4FHDA 2XV1A 2W6CX 2CB9A 1PL0A 1Q0TA 3TQRA 4B6FA 1ZW1A 2VP3A 3BKWA 5F5XA 3K94A 3T1YB 1UBOS 2GVNA 4DNQA 4O4JA 2OVBA 5H83A 5TQ0B 4K05A 2IEZA 5I4CA 1KXJA 4DANA 3P9ZA 3CH4B 1U8CB 1U3GA 3UC5A 4ZI7B 5AW2A 1BXKA 4FNGA 1K8ZB 1P7WA 4MDYA 1R88A 2HFJA 1OYWA 4DCUA 1LZLA 1N36B 2QX8A 3OCZA 5T4HA 1QUEA 3P0HA 3V7FA 1CKEA 1KEVA 5D7NA 1SCKA 2GEKA 2OXCA 4PRZA 4A6PA 3EDRA 2O3SA 3F8SA 3T35A 3GRRA 1YRYE 4CMJA 2JI7A 1G3RA 5K0SA 4HGQA 3BX1A 3U0VA 5LQSA 1PT6A 1U28C 2AJTA 4L95C 1PAUA 4XDGA 1S1MA 5EJ9A 4HNGA 3GN1A 4WUTA 4GKBA 2OCPA 1CX9B 2XCRB 3IHTA 1J9ZA 1HE2A 1M10A 1QNFA 1W5TA 2Y1GA 1LTHR 1ICEA 2Y9MB 2ZIVB 3HYLA 1CCWA 3I39X 4IGFA 3EEIA 2X8WA 1O9BA 4WQMA 5CVUA 3B7WA 3L79A 3C6KA 3QVVA 1TF7A 1NXXA 5HOEA 4KH0A 3V2IA 1H9BA 3AT1A 1OWOA 3V2HA 2C9ZA 1GCOA 3BORA 3RC8A 2IF0A 3ZCTA 4FSDA 5LYJB 1Q0HA 1S4MA 2FF5A 2H6EA 3QIVA 5FPSA 1C3XA 5LBTA 2EKPA 4JEHA 3NIGB 1FUEA 5ED0A 4YVFA 4DUGA 2DHRA 1OWLA 1XUOA 2VQSA 1CE8B 1MQ9A 4F4UA 1EFVA 3SM9A 5BMVA 2HBYA 1L7XA 3FW1A 5EMHA 5E1DA 1ZK4A 1V4VA 2OCYC 5F5LA 5FIUA 1CK4A 5LA6A 3F7NA 4AJNA 1JN0A 5FA5A 4AM8A 3DCYA 1R6UA 3H9UA 4GU5A 3Q11A 3U61B 2B6HA 1KDZA 4DXDA 1MH9A 5CCDA 1QK4A 1N8SA 2GN8A 1IDN1 3SZMA 4GP6A 3TAHA 3GFVA 4C3ZA 3IL2A 4QU5A 5T4EA 3V55A 1C9NA 3K1AA 1BCSA 3DF9A 3RIGA 6NULA 1ECLA 4J29A 4S35A 2O20A 1EBFA 1DWQA 5SZIA 3W8DA 5KQSA 4KBFA 1H05A 4YCDA 3VYRB 2BEWA 4U9IS 1KOGA 1FF9A 2EP8A 2QP3A 1TC1A 1TCVA 3N75A 3TLGA 1Q91A 2OCLA 2P65A 4BVFA 2VJPA 3AERA 1Q0RA 3PQ6A 3QFTA 3ZE2B 3SBOA 4ZGBA 2C88A 4CLHA 2NZVG 1KDVA 2YY5A 3KXLA 3OZRA 4P3XA 4YR9A 1P18A 1A7UA 2WLTA 4QRIA 4Z9FA 1KMCA 2XF8A 3JYPA 3LX6A 1PD0A 4UCXA 4UHCA 3M6LA 1WXDA 2ZTMA 4PTLA 5DW0A 4QVIA 4OHXA 3Q72A 1PNQA 5AI6A 1OA1A 1QO7A 1RC0A 2OOSA 3ELUA 821PA 4TVBA 5TGTA 3CU5A 1JMYA 2C29D 4EB8A 3QYJA 1YBAA 4BN5A 1THGA 2H0AA 3OPYI 3LQFA 4BXOA 5E7JA 3PDHA 5ALVA 1J9GA 1M2VB 4TT3D 4DYVA 3GJRA 3DWGA 3E5RA 3D1LA 4XVCA 1X0XA 2XOKD 2FGJA 4HLUC 4LE1A 1RT9A 4EP1A 4AI6A 3I1JA 3RRJA 4XWKA 1RAEA 4ZU1X 5B4TA 1H2FA 3OZXA 2GM9A 3M6MD 4IHJF 4L5YA 4AJOA 1QFMA 3RQSA 3GFQA 5HZHA 1PLLA 2B3DA 5KOHB 4QIHA 5K3OA 2IH4A 3W5BA 2J0SA 3S81A 3O8QB 4M86A 2X9NA 4C30A 2FZWA 3ELBA 1ZU4A 2AG0A 5LU8A 4OB8A 5KOHA 1HYEA 2QJRA 1QC5A 3C7AA 3G17A 2VUUA 4L5CA 5CB4A 3MWEA 3L46A 3AVWA 1Z0AA 5EQTA 3RHTA 2BONA 3FYUB 3R3XA 3I5UA 4IQFA 4KVGA 4YAJA 5HJEA 1A9XA 4QNRA 1QHGA 5B2ZA 2O8DB 2QX9A 3TUIC 4QUHA 4U1RA 2E5FA 2J87A 3SJCA 1VOTA 1YR3A 4B46A 4C4ZA 5AHXA 4R8LA 2P41A 1RHRA 2HK9A 2J3KA 1T29A 4POAA 4W1RA 2HPAA 4KWCA 4OFWA 4ZTUB 4UUAA 2G70A 3LY9A 5C8YB 4ZDWA 1DWPA 4RIFA 4QECA 1RQ7A 2GLTA 4YV0A 2WC1A 1R0CA 3TPCA 4KACA 2J6HA 2O2HA 3KSRA 3ECSA 4MUNA 3ABQB 1O77A 3T1TA 3IMEA 2IYAA 1AA9A 2DG2A 4RFSB 4BMVA 1U02A 5JAZA 1WY7A 3EYAA 1MNQA 1ZI8A 1TLLA 5IASA 1N7JA 3Q41A 5BSWA 1XKLA 4GXTA 4U8HA 4UREA 3RBZA 1SKUA 3SHFA 3L92A 5IABA 3PVZA 1HLPA 3C6QA 1DAFA 3CTMA 3H7AA 5LVAA 3G0DA 2UYCA 5F3WB 2ODTX 3X1DA 4EY8A 2QS9A 4E33A 1S01A 3M2PA 3SEZA 2PXHA 3U4HA 1E4EB 1UAYA 3V6MA 1YF3A 1QP4A 4OK6A 2QTCA 1PR1A 3EF0A 1VKRA 4LHVA 4M6WB 4YB8A 2JCGA 2NUTA 3RFVA 4EGFA 2IXTA 4EA7A 4AJIA 3STUA 3MZ0A 1MO5A 2P79A 5DRYA 3RTDA 1V71A 3TLMA 5JQGB 4FR0A 1NRJB 5K6RA 4JODA 2YZNA 1P60A 2YYAA 3HVJA 3ICQB 4YC7A 3WNDA 2E82A 3ETCA 3PBKA 4C5BA 1K68A 1KI2A 2CD9A 1TW3A 3PF8A 4LUCA 3ON5A 4J0IA 1SZJG 3LPMA 3K1AB 4I6JA 2QM7A 4MGHA 1Y1KE 3VR2A 4BKOA 3PQFA 3IAFA 5TSDA 4YAGA 2XSZD 3PGMA 2PKRA 3NIDB 2DSTA 2ZTUA 3DFUA 1VHTA 5JH7B 2DH5A 1N9GB 2Y1WA 2WAMA 3JVUA 2XX3A 2JFUA 3L5KA 4CV3A 2IQIA 3BXOA 2G3YA 2X4DA 4XX1A 3NVMB 1SIOA 2XQIA 1ZVJA 3A14A 2AEFA 2PZ8A 3BXZA 1GTZA 1N2IA 3H4VA 4KZKA 5B1SA 3T94A 3KQVA 1QWOA 5TGDA 4Y2PA 3TPFA 4C88A 2ASEA 1K7FB 13PKA 2VSYA 1Z4KA 3CNLA 3H4IA 4NLLA 2J5RA 1T9CA 4TLBA 4RFSA 4HAVA 1N32B 1P1JA 4X8HA 4EPWA 5EIWA 2ZOSA 5AVUA 3CBGA 5EGSA 2L82A 2Q6LA 2R6CA 2AYYA 2G9UA 3RU2A 4YT4A 5DCYA 2H4FA 2QN6A 3CISA 4UHHA 1Q44A 4GO1A 3WKCA 4EEXA 1OWMA 1F2UA 4E1AA 1ZUNB 5H59A 4KH1A 1XQ1A 5FUQA 1O95A 2KW5A 3C24A 3CY6A 1OW3B 1PT5A 3IGFA 3HCPA 3MOGA 4K6OA 3IT2A 1IM2A 3KCNA 1EZZA 2O8DA 1QYVA 2ICAA 1WTAA 3A25A 1T0HB 2VJKA 4BLRA 3QX3A 5TX7A 5DHPA 1MG5A 2CHQA 3VZDA 2R8BA 1RRKA 2O07A 2BFDB 3D54D 4DA9A 3TH5A 2Y76A 3MWEB 4BVGA 5KREA 2OFWA 1I7DA 3QPDA 4J0JA 1M1ZA 1UK7A 1Y7PA 1HOTA 1PP4A 1ZL2A 4GLBA 5AK3A 5KX5A 4JP2A 1HV8A 4JXZA 3ITEA 5THKA 3U9LA 4B7UA 4EFMA 2QOEA 2ZUFA 1Y8CA 3ZWNA 5K0FA 1BDIA 1VYTA 1WXFA 3A7DA 3ASUA 2RGXA 3EVGA 2HNKA 1I33A 5AM3A 3OLYA 3BTUA 1ZCJA 2I0FA 1FNSA 4PHTA 4KPFC 2ENUA 1YMUA 1XZHA 2O7VA 3DEKA 3IH5A 3QU9A 5HHTA 3SZOA 3KR1A 2FA9A 2DAPA 3FE2A 1ADJA 1U0HC 2X15A 3ZHBA 2IX9A 4F46A 1UWKA 4CLRB 5D3MA 2BEJA 1V8BA 3SDSA 4I99A 4INZA 2FI1A 3INRA 5A5EA 4QQKA 4LPSA 5DGIA 3RAJA 5BORA 2C5LA 2WDPA 1W2WB 2Q5QA 4Z4GA 2ET6A 2H5LA 2QZZA 3H16A 4LF8B 1NVTA 3QE3A 2IOFA 3OPVA 1XLUA 1ZOPA 2Y68A 4MO9A 4Q12A 3E5NA 4ZZ2A 4Q6WA 1NVVQ 1Z5VA 4WZAB 1BQ3A 1RDFA 2HD4A 5ENZA 3L6RA 3RS5A 2IEGA 1QRTA 1P61B 3MUFA 2VC2B 4LZNA 2HFKA 4TXHA 1PVOA 2IY8A 4ZDKA 3AUJB 1R0SA 3GDOA 2QL9A 3FCCA 3ZZ0A 4L50A 1NYLA 3B8EA 3H11A 3QYPA 5KVSA 1PTJC 1SBYA 2AJLI 3BREA 1DOAA 4P32A 5ITVA 3DO8A 4IDNA 2I66A 4Q47A 4BVLA 3ILSA 4UAGA 1KEKA 1YBVA 4N18A 1UKBA 4ZDIA 2ZPUA 1FNNA 4V0SA 3ZYCA 4P31A 3MYYA 1YBMA 3C8MA 4AKEA 4HCJA 4GM1A 2JAWA 2UZIR 2VKQA 2VYFA 3IEPA 5TXGA 1IOLA 1N2GA 1E77A 2NYRA 3IDSA 3V1NA 4MIEA 5T3YA 4YPFA 4D81A 3M4JA 3LCCA 1LQTA 1SXQA 3OFND 4URWR 5BUQA 2BVNA 2V9CA 1YZGA 4F6RB 1TKCA 3Q2OA 4RQBA 1Q14A 1K6MA 3NPMA 1LPNA 4WA7A 5K0LA 3RBVA 5DGTA 1ANKA 3L7NA 3ORRA 3U3ZA 2Q3MA 2QENA 3DE2X 3FLBA 3DDCA 2O06A 3ZDEA 3MXTA 2RGUA 2DR3A 3LPNA 2C4HA 4I3HA 3D6JA 3MTBA 4YRLA 3EGXA 4AY2A 3TO5A 2D4HA 3AM3A 3FSRA 2EKZA 2P90A 3Q8XB 3U37A 5J3JA 3D59A 1SCNE 2QTAA 3FFBA 3N39C 3SNHA 2ATCA 2BGLA 2XGSA 3AB8A 3BXEA 3FGNA 3PXBA 1E1RA 2I65A 3C5EA 2E89A 1C7IA 4YCAA 4JJ6A 1RXCA 4OBWA 3KQLA 2EJCA 5EXXA 1M8KA 2I2XB 3DGFC 2OBXA 1ORWA 5DTIA 3W9UA 2Q7DA 4OV6B 4NQRA 3DUWA 2Q5CA 4O1IA 3U3JA 5BYKA 2QW8A 4GE0A 2EBFX 5FWDA 5K6TA 1U0NA 4MVJP 5GZ6A 4B47A 2YWEA 1Z4IA 1Q11A 1UM8A 4BNTA 5A4IS 4D46A 2V1UA 2CLHB 2GAIA 1EI9A 1NOIA 2P4UA 2UVPA 3LVQE 4EO7A 4OVKA 1E89A 2G4LA 4S1WA 4NSNA 2DFPA 1I13A 4R8VA 4A36A 3C6YA 2JDIA 3ZPXA 1BVYF 2FY8A 3BE4A 2IBMA 2QGNA 3OCXA 3RC1A 1QGUB 2QTTA 5AVTA 4HR7A 1ULAA 3KEMA 3AFNA 4JBYA 5ECWA 4YJFB 4BO0A 3N28A 3KQWA 2CFOA 1DFHA 1WXQA 1WUTA 2HJWA 1VE3A 2VJDA 2ZIWB 3JRNA 3JW8A 5D7BA 4ARSA 4DMLA 4J43A 4QZVA 3DAYA 4RADA 4ZAYA 1MX5A 1TQ4A 4NJEA 4QPPA 2FR0A 3B89A 4DDKA 1JI3A 1I0IA 2Z4SA 4LPKA 2O1EA 2OHGA 1UDBA 3FOCA 5EEHA 3LRPA 4CV1A 3DXXA 5A6SA 2QX4A 4EH1A 4X8MA 5C4GB 1BMTA 2WF7A 3G2IA 3REQA 2OCAA 4CMIB 2F1RA 2H2HA 4D96A 4LC9A 2ORED 2CSXA 5IS2A 1PNOA 2OD9A 3P9XA 5FL3A 1N6KA 4D9BA 2ZAIA 4I4NA 4PLCA 5EKTA 4Q7QA 1Z35A 5JXHA 1K08A 1SUPA 1L1FA 3LM8A 4GOLD 3ZJ4A 1H4TA 3RRZA 3EGCA 5CA0B 5B64A 2JGJA 4KLZA 3QWAA 4WD3A 3UXMA 1SZPA 1NJSA 1NMYA 4ERXA 4AF6A 2IS2A 3T4EA 3BGVA 4JU8A 1KXZA 3QKWA 4FYPA 4MQBA 4R2KA 3TIFA 4DLNA 1J49A 1VI2A 4YHBA 3K6SA 3AY3A 3MMPA 1USKA 1OTYA 4V1CB 1U2QA 1IY9A 1BC5A 1EJBA 1IYZA 5IU6A 5EQJB