2C0CA

Structure of the mgc45594 gene product
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
353
structure length
353
Chain Sequence
GVDLGTENLYFQSMMQKLVVTRLSPNFREAVTLSRDCPVPLPGDGDLLVRNRFVGVNASDINYSAGRYDPSVKPPFDIGFEGIGEVVALGLSASARYTVGQAVAYMAPGSFAEYTVVPASIATPVPSVKPEYLTLLVSGTTAYISLKELGGLSEGKKVLVTAAAGGTGQFAMQLSKKAKCHVIGTCSSDEKSAFLKSLGCDRPINYKTEPVGTVLKQEYPEGVDVVYESVGGAMFDLAVDALATKGRLIVIGFISGYQTPTGLSPVKAGTLPAKLLKKSASVQGFFLNHYLSKYQAAMSHLLEMCVSGDLVCEVDLGDLSPEGRFTGLESIFRAVNYMYMGKNTGKIVVELPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ZINC BINDING ALCOHOL DEHYDROGENASE, DOMAIN CONTAINING 2
publication title The Structure of Mgc45594 Gene Product
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 124
structure length 353
sequence length 353
chains with identical sequence B
ec nomenclature ec 1.3.1.48: 15-oxoprostaglandin 13-reductase.
pdb deposition date 2005-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2c0cA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2c0cA01
4DRYA 2DQ4A 5CEEA 1XWFA 1PU2A 3GVHA 1OC4A 4A03A 2B5VA 4AJPA 5GZ1A 1ZXLA 4HWKA 3LT0A 1UXKA 2CF6A 2RH4A 1L1FA 1C3VA 4MP3A 5LCXA 1NWHA 1Q0LA 1Q7GA 5CDUA 5L7TA 4CODB 2V6BA 2PKQP 3BIOA 3DZHA 2FPPA 5JO9A 2BI8A 1M67A 5IDYA 3RBVA 4BNXA 4XDZA 2Y0CA 3WJ7A 3AOEA 2AHRA 4KDEA 1UZLA 3OQBA 5GZ6A 2XF8A 2Z1MA 2B83A 3IMFA 2FRDA 1BGVA 3C24A 4CMIA 5FYDA 1GUFA 3WLFA 4AICA 4A0SA 5GMOA 3UXYA 4IUYA 4CMHA 2IODA 1O9BA 1HE5A 1VM6A 2GCGA 1XA0A 4R01A 5TIIA 2J3HA 1ZCJA 5IDQA 4CLDA 1LLUA 5JCXA 4E5YA 4LSWA 1EDOA 3JQGA 5A05A 4WEOA 4XQGA 1J0XO 1PJTA 3OEWA 2NQTA 1R4MB 1MFPA 3ON5A 3IL2A 3KV3O 1MG0A 4PZDA 4QTZA 1GZ6A 3ZWAA 2HK7A 4WJZA 4I08A 5JW6A 2YY7A 1F12A 3A06A 1MX3A 3GG2A 3PQFA 4Z3KA 1DIHA 1TI7A 1LLQA 8LDHA 1T2FA 2I76A 2WMDA 1I30A 4XRRA 4NG5A 1HLPA 4AJJA 5EIOA 3D4OA 1PGOA 4Q3EA 5THQA 5LDHA 4Y6PA 5L7WA 2UUOA 1MLDA 3WBFA 3WQSB 3ZNPA 4TWRA 2Y0EA 4INAA 3GH3A 4XQ9A 4JP2A 3Q9NA 3WGYA 2VHVA 4WLEA 5T8KA 1UUFA 3NJ4A 1P0CA 4MVJI 1NVGA 2B36A 2LDXA 1NR1A 3M2PA 2DBVO 2WD8A 5EQFA 3B1JA 4J4HA 1B7GO 1PQPA 4OMUA 4DVJA 4ZU3A 1CIVA 1PX0A 1NVTA 1QKIA 1TEHA 4WUVA 4IIUA 4W6ZA 3GN1A 4AJ4A 2IYPA 3KEQA 1Z6ZA 4R1NA 1O95A 4DMMA 5IJZA 5HA5A 3BHMA 1I5RA 2B4QA 1ZSYA 5KJEA 1RPNA 5F3RA 1P33A 4XIYA 1KVUA 3NT4A 2Y66A 2QYTA 3CZRA 4B4UA 1LDEA 2X5KO 3H9EO 1VL6A 2FMUA 1BG6A 1LDMA 2FZWA 5JCJD 2VZ0A 3INRA 2GN4A 5TRTA 4I9UA 1UR5A 1Y8QB 1NASA 4ESOA 3HB4X 2C2YA 4J1TA 4LMPA 1JDJA 4CQLA 3F47A 1BMDA 1DRUA 4YCAA 4GVLA 5LC1A 5KJFA 3OQ1A 1KVRA 1BW9B 4EEXA 1GR0A 2VCYA 4FFRA 3ZU5A 4MVJH 5H81A 1U8FO 3ABIA 5ER6A 2Q3EA 4R9RA 5JAZA 3JD1A 3E5MA 1IZ0A 5T5QA 4CL3A 1EBUA 4EYEA 2OORA 5JO0A 1E1MA 1J49A 1Q0HA 3GZNB 1L7DA 3QJ5A 4Y98A 1W4ZA 1CYDA 2I3GA 3AOEC 4IJUA 4U5QA 3UOGA 3HDYA 2HMTA 4XGIA 3OQ6A 5TJ9A 4BOYA 5TGDA 1KEWA 4EUHA 3IJRA 1JKIA 1GYRA 1RM4A 5K6AA 4FGWA 2NUAA 4UEOA 1RKXA 5JCJA 1BDMA 3PGJA 2D4AA 4JBHA 3WGGA 3KOUA 3U09A 4BKRA 4M54A 3C1OA 2CSUA 2GLXA 4WOKA 5DNAA 1RYEA 3CSDA 1DFGA 1QG6A 3EZLA 4BO7A 1BVRA 3L6OO 1VJ0A 1PZFA 1C0IA 2QZZA 3K96A 4WLNA 3LC7O 1XU7A 1BXGB 5EL0A 3RJ5A 3INGA 3RU7A 1YONA 3EYWA 4B8ZA 3DMYA 2FWMX 3RC7A 4F45A 2BLLA 4DREA 4NBWA 1DLJA 3WXBA 4WLFA 4QFCA 4WK6A 2I9PA 2FR0A 4M55A 1ISGA 5I9MA 5BNFA 4DL9A 1A7AA 5HS6A 1LUAA 2HKIA 2A94A 2C82A 3ZWCA 4CR6A 1YB1A 1U2GA 3GVCA 3OA0A 5T8KC 2AG8A 1VLLA 5K9ZA 3QWFA 4R68A 4IMRA 4FCCA 1L7EA 3B20A 1ISMA 3FRJA 3FSRA 3OIGA 4E5PA 4KDFA 4D41A 1HLDA 4CM3A 3RAJA 2JKVA 1EUDA 1RYDA 3I6IA 3JD2A 1DSSG 2GNAA 1A71A 1C1XB 4BNLA 3ULKA 4I5EA 4OGWA 2JAPA 1K5HA 4QQRA 3QLJA 1RM0A 1U2DA 3M1LA 1AXGA 1E1NA 3F5SA 1ZFNA 1HE3A 1ZVMA 2HJSA 3KETA 5F1PA 2DU8A 3RUHA 4BO0A 2YDXA 3A1NA 4K28A 1YQXA 1PQUA 1IY8A 3STHA 2W2KB 1CWUA 2CVQA 4BB6A 1WP4A 1UAGA 4C4OA 1VRWA 5AXDA 2YDYA 1SCUA 1PIWA 1TB4A 3JYOA 4RVGA 1I01A 2SCUA 3BTSA 1ML3A 2ZJ0A 1GD1O 1E77A 4BHTA 1NFFA 1OAAA 2IZ1A 4BO5A 3OHSX 3H9JA 3HUDA 1LXCA 1U28A 4OO3A 1YBAA 2PH3A 3KYBA 4BNMA 1GV1A 4TRNA 3LT4A 3VOSA 3TRIA 1G0OA 3GY0A 3WYEA 1DPGA 3OSUA 1Q7BA 4DWVA 2VTEA 4PG5A 4KQXA 3Q6IA 3ZWYA 4RGBA 4BMVA 4FD3A 4FFLA 3TL2A 1IZ9A 3U0BA 5JY6A 3RVDA 3ST7A 1A9YA 4KTVE 2HU2A 5JXWA 2NU9A 4E21A 5GZ3A 2P4QA 3GVXA 3PPIA 2C54A 2PZMA 3OJEA 4Q3DA 1Z7BA 4YRAA 2AQ8A 4IBOA 1P1HA 1Q7CA 2DPGA 3GNQA 1I33A 5IZCC 4JLWA 3GUCA 3WIEA 3L4BA 3IKTA 3H3FA 4UUMA 4XR9A 3UICA 1NP3A 2GZ2A 2DAPA 1U3TA 3ANNA 3UFXA 1H6CA 4DTIA 1V6AA 5G4KB 2IE0A 4PVDA 4RQUA 2X9NA 3D1LA 3LC1O 5DCUA 3TFQA 3WYBA 4DQXA 3K8ZA 1ZMTA 3OP4A 4Y6SA 2X22A 5JDIC 1DLIA 3PQDA 1KY4A 2X0JA 3DBLB 5BQFA 5CDSA 1Z75A 3KB6A 2TMDA 4UUPA 2C07A 3SJUA 1XLTA 3ZU3A 3E03A 4GKVA 2P9EA 4CM7A 3A14A 1NQTA 2QX7A 4NFYA 1PR3A 5I7EA 3NEPX 4WGGA 1VL0A 4BO6A 3W6UA 4E0BA 5HWSA 1GZ3A 4FFNA 3GG9A 3JQ9A 5IN5A 5I7VA 1DC4A 4HP8A 1R15A 1T24A 3SC6A 3GVPA 2ILTA 1PJQA 1R6DA 4YXFA 2X0NA 3Q0EA 1GY8A 1YB4A 3E18A 1FMCA 4TROA 4O63O 5JMWA 3JD4A 5A03A 2PTGA 1F14A 2EW8A 5A3VA 5AYVA 5ICSA 4RO0A 3JQBC 3LF2A 1H2BA 5B4UA 2ZTUA 3ZI0A 3QVOA 3DZFA 3EVNA 3GEMA 3F4LA 3H3JA 3L9WA 3RFVA 1NHWA 3JQFA 2RHCA 1K2WA 1XIVA 2AXQA 3VH4A 1NAIA 4ALNA 3IJPA 1AHHA 3TJRA 2JCXA 2B0JA 1U1IA 4NZ9A 1E3IA 2HUNA 5L95A 5KKCA 5KVCA 4GX5A 2FP4A 4L4SA 4RDIA 4BKPA 3PHJA 2OBYA 1LNQA 5TF4A 4KUHA 3TL3A 5L53A 1YJ8A 3OJLA 1I3MA 1HDRA 2VWGA 3SJ7A 3ZNNA 2R00C 1YWGO 1OFGA 2FHSA 3KRTA 1DC5A 2E49A 2Q4EA 1XELA 3PWSA 3GDOA 2RAFA 4E4YA 4AJ1A 3GK3A 1EMDA 1GPJA 1NYTA 4BKQA 3R6DA 1FDTA 4YT4A 4XA8A 1IL0A 1AN9A 2YV2A 5EQDA 1EQ2A 4PLHA 4PRLA 2BGLA 2D8AA 2I6TA 3FNEA 4PGFA 2VHWA 4B4VA 1JVBA 2H1SA 3DTYA 3O9ZA 3H2ZA 4FFPA 4BO8A 4HX5A 2ZIZA 1VJTA 3QY9A 3S2GA 5JBIA 1R16A 1PGNA 4YJHB 3OIFA 3WTBA 1DEHA 2AA3A 3KVOA 2W2KA 3AM5A 1O6ZA 1U5CA 1WMAA 5GY7A 3QSGA 1XGKA 1HEUA 2G1UA 4E3ZA 2Y1CA 3UUWA 1IYZA 4XDYA 1PWXA 5EMHA 1OMOA 2HK9A 2HMWA 4GMGA 4II3A 4W7HA 4J0EA 1YVEI 3EZYA 1EFLA 2Q50A 1UDCA 3PEFA 3ZWVA 1QMGA 1NFRA 4PZEA 3G0OA 4N18A 4GVXA 4J2HA 2C59A 5JS6A 2Q2WA 4DPLA 4IJVA 3DZIA 3LVFO 5COAA 1E0DA 4YT8A 2YJZA 3AY3A 3ASUA 3ETDA 3C3XA 2XXBA 4NK5A 5A9SA 3PHGA 1P74A 3ITDA 1J5PA 4NBTA 4WEQA 3OM9A 2JD2A 3W8DA 4FN4A 4FGSA 3ZV3A 4HXYA 5F1OA 3LT2A 4IXTA 1NVMB 3FI9A 3GN2A 4FSHA 4XB1A 3JQ9C 1B8UA 5CPFA 1Y9AA 2H6EA 2YHUA 4FC7A 4Q3NA 3VPXA 4BNGA 4DPMA 4G5HA 1ISHA 1XQ1A 1E7RA 5ES3A 5KNLA 3CMMA 1G1AA 3RIHA 3OICA 1LC3A 4MVJE 1U8XX 1YRLA 3LU1A 4RPKA 1N1GA 1NNUA 3V2HA 1U5AA 4YAGA 2I67A 3UKOA 3JTMA 1LQTA 3JQFC 1Q2XA 2HMVA 4XYMA 3FBGA 1C0LA 3L0DA 2XAAA 3PYMA 3D3WB 1M76A 5TX7A 1UJMA 1CEQA 4O1MA 2DBZA 1R37A 2GASA 3DBLA 3DTTA 1ISIA 3L6DA 2VHZA 3DQPA 1CQJA 1UDBA 3E6AA 4NJMB 5JE8A 5TSDA 4B8WA 4RZHA 4BV9A 3DB2A 3PP8A 3TPCA 1MUUA 1EFKA 3NDJA 3EVTA 1T2EA 2PFGA 4P4NA 2EV9A 3GQVA 4U0JA 1KVSA 1ZEJA 1Y7TA 3CEAA 4FPXA 1KOLA 4CM9A 3LYLA 4GKBA 1ZNQO 2O3SA 5CG1A 1HDOA 4BGIA 3I9NA 1LI4A 3PGXA 1Y81A 2FOIA 2VZ8A 1M75A 4PZCA 1E92A 3RSHA 1T2CA 4P8RA 4MVJG 2ET6A 3HB5X 4LRSB 4OSOA 1HE2A 1IPEA 3COSA 1HSOA 4IQ8A 1F8GA 4BUCA 1PSDA 1K6XA 2NV6A 4OXNA 4R3WA 3JQ7A 4BL5A 5JFOA 4D45A 1MB4A 3IC5A 3W4JA 1XG5A 4BO4A 4DC1A 4E5NA 3EGOA 3ROMA 4XKJA 2VQ3A 1EQUA 1LC0A 3KTDA 2DUUA 4HKTA 2RH8A 4MOWA 2YYYA 4CQLB 2O3JA 2AQHA 3QWBA 1E3SA 4N5LA 1PJLA 2UUPA 3HQ4O 4EDFA 4JXKA 1PZHA 1O89A 4ND4A 5TLSA 4AL4A 1PR9A 1E7WA 4IM7A 3F46A 4ZQBA 1IOLA 4OOFA 3KZVA 5CDGA 4HFRA 4ALJA 4WE3A 5HM8A 4IY1A 3RUFA 4AJIA 1HKUA 1B8VA 2X4GA 3NT5A 4FJ1A 2B4RO 4GLOA 1QP8A 1SNYA 4OOEA 4GWKA 3WX0A 4R1TA 3GA0A 3D3EA 5G4LA 1FDWA 5HRUA 3AFMA 5L4SA 1HDCA 5EINA 1ADBA 3R3JA 3WWZA 4CMAA 2GN8A 3K2BA 1P44A 3DEYX 1Y1PA 3B70A 1DIAA 1E5QA 1EK6A 3RI3A 3U49A 4IDEA 4ONEA 4BNJA 1V3TA 2EJWA 1YS4A 4FC6A 3IUSA 2W4QA 3GDFA 4MVJM 4AJLA 3F4BA 3I3OA 4FW8A 4J9VA 5ENVA 1ARZA 4RCVA 3PJGA 1NQ5A 2E82A 2O4CA 1T4DA 3RASA 3ENNA 4IQGA 1Y5RA 2X9VA 4BV8A 4HADA 4IDAA 2OZPA 2O48X 4XJTA 2NTVA 1C1DA 1AHIA 1G0NA 1G6KA 4BS9A 1B3RA 3PWKA 4B4WA 4CUJA 1V9LA 1CERA 4IZIA 3HG7A 4PLGA 2EXXA 3Q2KA 2HDHA 2G5CA 4RF4A 3AFNA 4DC0A 1YL6A 1GUZA 4PLVA 3TF5A 3IP1A 3RFTA 5FFFA 4IDBA 5CAEA 4ZRNA 1O0SA 4Q3CA 3ZWXA 4WECA 1KEUA 1QYDA 3MWEB 4J6FA 3BMQA 2BKAA 1HTBA 1SAYA 2JJYA 2CVZA 3PHHA 4PLTA 4NBUA 4D0RA 4HUJA 4EJ6A 1YBVA 2CY0A 2ZK7A 1DRVA 1GCUA 4HFNA 4J16A 4J2OA 4PLZA 3WGTA 1GDHA 4KP7A 1OI7A 1X1EA 2EGHA 2GGSA 3V1UA 4YBZA 5I8WA 1DFIA 1HDYA 2BFMA 1JQBA 2B69A 2E37A 5AOVA 4JQCA 4ND5A 3TWOA 5IN4A 2PGJA 3NRCA 1W8DA 2PZKA 3C1AA 5IXYA 4XYEA 4DYVA 3LZ6A 4I1IA 3TZCA 2DUWA 4EBFA 4B7XA 4BNTA 1PJ2A 1H5QA 3D0OA 3D3WA 3D64A 2FN7A 4O59O 4EUEA 4F46A 5DZSA 6LDHA 1UXGA 3K6JA 4RVSA 5F21A 4YAIA 4NFSA 3AUTA 4NJMA 2F00A 3F1KA 2BGKA 2HMUA 1PJCA 5TT0A 1T1SA 3NYWA 2B5WA 2H5LA 4LCEA 5IFLA 3GNTA 4S3MA 4DPKA 4F6LA 3PXXA 4J9UE 1TVEA 1LU9A 3GRPA 1FXSA 1BWSA 3ADPA 4HV4A 1F8FA 1SBYA 3H6KA 4J7UA 1HT0A 1S7CA 4UULA 4RJTA 4EZBA 2O2YA 1R66A 2Y1GA 4R4JA 3KYCA 2UYYA 4RF5A 5A06A 5JMPA 5A9RA 1H93A 1QYXA 3O4RA 1XHLA 4Q3AA 4QX6A 4BNUA 4CJXA 4YAJA 1E7QA 2Q49A 1Z82A 1ONNA 5TQVA 3ROPA 5CFZA 2DFDA 2G17A 2VYVD 3GDGA 4TRJA 1ZBQA 3GZ4A 2HJRA 4CL8A 3BTUA 5JYDA 2PKQO 3G1UA 3JYNA 3PJEA 5CEFA 3QQPA 5CEJA 2NU8A 5FWNA 4RVDA 2HAEA 3U4DA 2PD6A 4L0QA 2UAGA 3WQQA 5IDXA 1N5DA 1V35A 2V6GA 1PQWA 4M1QA 5EERA 4CMBA 3TOZA 4CM8B 5TS3A 3I4CA 4NBRA 4W4TA 2OFPA 4MP6A 1YOVB 1LDYA 2V6FA 1GCOA 1GTMA 5FI5A 2Q1TA 4JJGA 4MIOA 4TRMA 3ITKA 3F6YA 2DFVA 2WM3A 3F9IA 1PTJA 5AXCA 4EJMA 3ICCA 1EK5A 1P3DA 4IXWA 2J8ZA 5KKAA 3H9GA 3ZW9A 1PGJA 3RUDA 4DBVO 4JCOA 5BSHA 4BNHA 2AQIA 3PHLA 5DDIP 1M6HA 4TKMA 4DQUA 3GC6A 2VYVA 1DIBA 2QIOA 4U6SA 4IPTA 5ITVA 4UVGA 2IEBA 4BNKA 4A2CA 1GL3A 1KEPA 3RBZA 4BQPA 5B4TA 1WDLA 4RPJA 2BFOA 4YR9A 5DP1A 2IEDA 3TOXA 1EDZA 4YAEA 2Y1DA 2BRUA 2DTXA 4GPD1 3AJRA 4I8XA 2B35A 3TFOA 2D1YA 3ZZNA 5ITWA 1SC6A 5IZCA 3MJEA 5DF1A 3FPLA 3UCXA 1HL3A 1B3BA 5JPIA 4EGFA 2WE7A 2G82A 3ONFA 5JYEA 1U7HA 4ID9A 1ENOA 5L51A 2POQX 3AI2A 5DCWA 1RM5A 2VYND 1M6WA 1H94A 3EHEA 3WGIA 2F1KA 3BA1A 3R1IA 5JDIA 4TZTA 3QVTA 3GEDA 4ALMA 2GF2A 2RIRA 3T4XA 4LCJA 1K3TA 1K6IA 1ZJYA 3KLPX 4BGUA 4CV3A 4OAQA 2CZCA 4MKZA 1VL8A 4J43A 3K92A 3W8EA 2WTBA 3IOYA 4NU5A 3IDSA 1YQGA 1FDSA 1XEAA 2CVOA 1J6UA 1DIGA 4RPHA 5AXBA 3ONDA 1A27A 2GUGA 3VH1A 4EI2A 3RCBA 2HCTA 1E6EA 2VRBA 4J4TA 1DRWA 3ZWMA 4M89A 4MIYA 2C7GA 3O38A 4Y6RA 3DC2A 4IMPA 4KTTE 4BMNA 3ZWPA 2ZB4A 1NBOA 3VC7A 4PG4A 3S2IA 4FOOA 3A28A 3V5NA 1YKFA 1JU9A 3P19A 2IDZA 3DAFA 3JQBA 2PGDA 4QUKA 4D3FA 4BO1A 2HK8A 1PWZA 3E9NA 3VPHA 2VWQA 1QV6A 1FK8A 4HBGA 1NHGA 4C7KA 1I36A 5JDCA 3B6ZA 1O5IA 4GMFA 2VT2A 2VYNA 3LSYA 2D5AA 1HDXA 3NKLA 1I3NA 4RORA 1TLTA 1ISFA 3MJCA 4L74A 3P2OA 1R4NB 4J1QA 4YACA 2AE1A 3TDKA 1IE3A 3AUUA 4PN3A 2ZQZA 3E9MA 4ZN6A 5C5IA 3RWBA 1E7YA 2QG4A 3MOIA 4ND1A 3JD0A 4YDRA 4IGFA 1LDNA 1HSZA 1VSVA 2H9IA 2R00A 3HN7A 4Z0PA 4BNVA 3ORFA 3ZW8A 1C0KA 4L76A 1Y5MA 3OF2A 4A5OA 1MGOA 3AUAA 2Q99A 2Y68A 2FY8A 1P1JA 1Q0QA 2JCVA 3FTNA 5A9SB 2Y99A 1N8KA 3ZHBA 2Q45A 3ROQA 1EVYA 4J7XA 3DXFA 3PJDA 4HY3A 4KUGA 3GGOA 5JY1A 3VHRA 1PJBA 2C29D 4II2A 1F17A 4NK4A 1WWKA 4W82A 4UREA 3OEYA 2CFCA 2EKQA 1J4AA 1KS9A 1E6UA 2CDCA 3GLQA 3JSAA 5JAMA 1I2BA 2J3KA 4R5HA 4XEHA 3CE6A 4BKOA 2WEKA 5KOIA 4KOAA 5KVVA 3H7AA 5JLAA 3FD8A 4UEJA 1KERA 1WDKA 4JGBA 4RVFA 4XYGA 4BVAA 4CLHA 4CLOB 5CG2A 4JIGA 4XJSA 3DMTC 3IAHA 4CM8A 4E5KA 3KM0A 1S6YA 1E3LA 1MC4A 1X7GA 1B0AA 1YOVA 4WCDA 3HFSA 2FSVA 5EJ2A 3CPSA 5CDTA 3PI7A 3RUIA 3AUSA 1I2ZA 4XR4A 4JBIA 2YHIA 4FB5A 1ENZA 1KBZA 4LRTB 2Q2VA 1T2DA 3JQAD 4XX0A 3S2EA 1NM5A 4BNNA 1HZJA 1GQ2A 2DPHA 3O03A 4RF2A 1GEEA 4I5DA 3GGGA 3DZJA 1LSJA 3W4IA 5A4DA 3DOOA 1WLYA 3BZUA 3SEFA 3WBBA 5BSGA 4L73A 2ZYAA 4QT0A 4AJ2A 1QRRA 3D4NA 2VUUA 1GV0A 1FDUA 4K9DA 4HNGA 1YQDA 5KTKA 1ZUD1 4E2WA 3TZ6A 2J6IA 3LT1A 4IIVA 2IZZA 4R41A 1E1KA 3WMWA 1IUKA 4I9NA 4D79A 5FEUA 3WOHA 1MP0A 1QLHA 2QRJA 1LBEA 1Y9EA 1ZMOA 1DOHA 1A7KA 3PDJA 4IDDA 4UEKA 4PVCA 4E2ZA 4CV1A 3EUWA 5ILOA 3EDMA 3ONEA 4K1LA 4GL4A 1N7HA 1YDWA 3DBRB 3C85A 3RUCA 2W8ZA 3JQ7B 3GFBA 1WW8A 4S1VA 4WCFA 5JDCC 5CPBA 3N7UA 2AMFA 2WD7B 1A72A 1ZK2A 4AJHA 2Y1OA 4IJKA 2AEFA 4MINA 4AJNA 4M49A 2GN9A 4L8VA 4A27A 1T4BA 3D5QA 4TVBA 1W73A 5ICMA 1P1FA 4R54A 3OJ0A 1N7GA 2JAHA 2O3UA 3EMKA 2P9GA 1KC3A 3T7CA 1HETA 2GPTA 2OXIA 2D59A 5MGBA 2EHDA 2JD0A 3HDQA 1SB8A 3I9LA 1I8TA 2GDZA 1CJCA 2XOXA 1TT5B 1DB3A 1XYGA 1R0LA 1EUCA 2EP7A 1UDAA 2GZ3A 3O8QA 2JL1A 3UGKA 2D3TA 1UP4A 2ZJ1A 3F3SA 4J49A 4U7WA 1VI2A 1HZZA 2DC1A 1LA2A 5L9AA 2NTNA 2EIHA 2RCYA 2ZCUA 3BYZA 4RF3A 1Z74A 3RKRA 1PEDA 2VRCD 1HXHA 1BVUA 2HLPA 4PLFA 1EBFA 4OL9A 1A4UA 4G2NA 2CNBA 5DN9A 1NPYA 5H83A 3N74A 4XGNA 1HYEA 2QRKA 3MJVA 4PLCA 4ILKA 4I9HA 4XZ3A 2V7PA 2GR9A 1T26A 3P2YA 4OYRA 2O3TA 3NTRA 3RJ9A 1OZAA 4JN6B 1I3LA 3KYDB 2HQ1A 1EUZA 2NVUA 1U7TA 2WYWA 1R4NA 3ENKA 3ZDFA 3VDQA 3FN4A 1MFZA 4HNHA 1NWCA 4PG6A 4RVHA 4EUFA 3I6QA 3OECA 1C1DB 3OFSA 1SOVA 1P9LA 2BFPA 1ZXBA 3EAGA 3QP9A 2W90A 4ND2A 1IB6A 4PIVA 3WDSA 4LN1A 4W99A 1VJ1A 1UZMA 3OETA 4HFJA 3NGXA 3LC2O 4NMHA 3BMOA 3CKYA 4RQTA 4XB2A 3ZNOA 3VDRA 5C7IO 1FF9A 2GYYA 2TMGA 3AM4A 3CXRA 3GPDG 3IP3A 3PTZA 5J23A 2C0CA 3QWHA 3P5SA 5L7YA 3LK7A 3I9JA 3P7MA 1KETA 5JC8A 1MC5A 2BFAA 4YT5A 5ADHA 5KWEA 1JVSA 2B37A 3NDIA 3ZH2A 3BMQB 1YGYA 4FJ2A 1ZK3A 3SXPA 4ITUA 4A7PA 4YRDA 4JJFA 4B3JA 2W2LD 1KEVA 1X7DA 2X86A 4NQZA 2D2IA 2WDZA 3V1TC 3WNQA 5JAQA 3ZV5A 4CMEA 1W6UA 1YL7A 2GERA 4UAGA 2NU7A 5TJHA 4CQMD 4XQEA 1DBVO 1BDBA 1F0YA 5U4QA 3NTQA 1QV7A 2CDBA 1UXIA 2R2GA 4CLOA 2CD9A 1ZIDA 3WIDA 4GBJA 1E3EA 1E6WA 4MPDA 5I9LA 1QYCA 4E13A 1YE3A 4L9RA 3H5AA 4WCFC 1AGNA 4PG7A 3TNLA 5L45A 2CMDA 4A26A 5KVQA 5EPOA 3VH2A 4OKIA 1A4IA 3MWDB 2PR2A 4ZQGA 3FBTA 1YB5A 3TZHA 2Q4BA 3GEGA 1H6AA 5CHEA 1D1TA 4EITA 3AY6A 4CM6A 4NFHA 1UP7A 2VT3A 4BNWA 3UW3A 2B4TO 2ZB8A 3BMNA 4DMLA 4Z3DA 4IDGA 1H9AA 2W2LA 3HDJA 4F3YA 1ZEMA 5A1TA 3DZGA 3B1FA 5G0WA 3VPGA 2YV3A 3HWRA 5L40A 3DBHA 1JN0A 2FPGA 2NSDA 4YEDA 5KCZA 3H5RA 1OOEA 3WGHA 4NBVA 2RHRA 3KYCB 3ZGYA 3DDNA 1QYVA 4L4XA 2PKRA 3GF4A 2V65A 3T4EA 2C20A 1WVGA 3I23A 4R1UA 1P1KA 1ORRA 2GO1A 3JYPA 1P1RA 1E5LA 1I3KA 1HYGA 1ENPA 4ZA2A 5C7OO 3E9QA 1TA4A 3DBRA 4YPOA 4U8GA 4OXKA 3KLMX 4MJLA 5L3ZA 3EY4A 4CMJA 2WE8A 2YFQA 2WD7A 4OHUA 3H4VA 3AU8A 4Q39A 4D7AA 3L77A 3BTOA 5G0SA 5C7LO 4GI2A 4MKRA 2CUKA 1LEHA 1ID1A 1WDMA 3UN1A 1OC2A 2LDBA 3PZBA 3JQEA 4D3SA 4DLLA 1C14A 1SZJG 3ZWOA 4Z9XA 1TT5A 4L4RA 1EVIA 1PL7A 2EJVA 4ALIA 2X0IA 3CH6A 2YV1A 2A92A 4FR5A 4YJDA 1I2CA 4WKGA 2J5QA 5IXSA 2HRZA 3NAQA 5I7SA 4QO8A 2JFHA 2I99A 4CM1A 4H15A 1PJ4A 2OBNA 3U4HA 5DOVA 4CMEC 2AQKA 2VNSA 3HZZA 3O26A 2FR8A 4AG3A 1ENYA 1ONPA 4WNIA 3JQ8A 1WNTA 3QVWA 1LSUA 3GOHA 2ZCVA 3AY7A 3WMXA 5EESA 5KJ1A 4RPLA 3D5TA 4H3VA 2E4AA 3KYDA 3LLVA 1LDGA 4Q9NA 2Z5LA 9LDTA 2WYUA 4PCVA 3Q11A 3V2UA 3UHAA 4IDCA 2EP5A 1AXEA 3OA2A 1Z7EA 1E7SA 1Z45A 2P2SA 3W1VA 3E8XA 1RJWA 3DOCA 3HSKA 5HBRA 1SMKA 1UXJA 1HYHA 3VZPA 3EK2A 4AJKA 3DZKA 3PK0A 2JHFA 2X7HA 1Y8RB 2Z95A 2O4UX 3ZN2A 2FPIA 2I65A 3BHJA 4CV0A 3ZHZA 3GMDA 3U4CA 1DO8A 3DFUA 4CV2A 2AE2A 4JBGA 5AXAA 1SB9A 2PD3A 4CMGA 4LGVA 2HRBA 3VTFA 3WSVA 3FCOA 4R3NA 4FFMA 2P4HX 2YFHA 4RL6A 1WMBA 3MTGA 2Q1UA 4K26A 2VUSA 3NX4A 3GUYA 3H2SA 1UP6A 2VHXA 2ZTMA 4UUNA 5DBGA 1LX6A 3PLNA 4LVUA 3AI1A 2X9GA 1T1RA 1CETA 2H63A 4R5MA 4WLVA 2DT5A 2EWMA 4QSMA 3OH8A 4J91A 3BMCA 2Y67A 3DZBA 2OMEA 5I8ZA 2DTDA 2ZB7A 3GGPA 3MZ0A 3NJ8A 1PGPA 1GQQA 1N9GB 5TC4A 5G0TA 2OP0A 4GSLA 4JX8A 5A04A 3KSDO 5BNTA 1EE9A 2DBQA 1TT7A 3RUAA 4KWIA 5U1PA 1B14A 1JLLA 3VZSA 4FIZA 2IZ0A 3JQ6A 4E32A 4CLXA 9LDBA 3G1TA 1UXHA 3HFGA 1VPDA 1JWBB 2NVWA 4DXHA 2WWRA 2E6UX 5H82A 2CDAA 1LLCA 2OOSA 1X14A 3WICA 1XDWA 2NTJA 3PFFA 1SO8A 1LSOA 1DXYA 4AVYA 4JROA 1X1TA 4BO2A 3GVIA 4ZVVA 1KVQA 3T7EA 2NACA 3HE3A 3WGZA 2VTDA 3RC9A 4BKUA 5B1YA 1U3WA 1U3UA 5EN4A 3PVZA 3ZU2A 2PD4A 3IUPA 5G2OA 4B3HA 1VC2A 4CM4B 4P38A 1WAMA 2O7QA 1GUYA 3QHAA 4UVEA 1LRLA 2PZJA 4BGEA 5DULA 3DONA 3WS7A 5COBA 1QXSA 5DT9A 2Q1WA 3TN7A 3CMCO 4LMRA 1CDOA 4YTEA 4BO3A 1AUPA 3QW2A 3VZRA 3BAZA 1YH3A 3VVCA 3WR5A 2P9CA 4D0SA 5K1SA 2CF5A 1LJ8A 2EKLA 1VKOA 4JP3A 4Y9DA 1IPFA 3Q1LA 1KC1A 2YQ4A 4YQZA 4E12A 2PWZA 4GLLA 4KUEA 3FWNA 4O5OA 4F6CA 2VWPA 5T57A 3MTJA 2HSDA 4M8SA 1LRKA 3CTMA 4H16A 1R0KA 5F5NA 3HNPA 1O94A 3E48A 4UUOA 5L4LA 3VPSA 1BXKA 2V6MA 3DR3A 1B2LA 1K89A 2Y93A 3I4FA 4DYDA 3U9LA 1YO6A 4JNKA 1EVJA 2NLOA 1MV8A 4YJFA 4IDFA 4PLWA 5CDYA 3AOGA 3K31A 1Q1NA 1VE9A 3GFGA 2X6TA 7ADHA 2YHIB 4UVIA 4Y8VA 3KSZO 2EKPA 3ZNQA 3AU9A 1JAXA 1XR3A 3WQRA 3WJAA 2PK3A 3QV1A 4FQ8A 4RVUA 3VPFA 3WLEA 3RU9A 3ASVA 2NM0A 4XQCA 1DJQA 3W6ZA 1IHYA 2X58A 4M87A 4ZJUA 4R16A 1GPDG 5G0VA 3GT0A 4BQRA 2GRAA 5AQ1A 2VOJA 1ZK4A 2NWQA 2YZ7A 4OH1A 4ZHSA 5A5EA 2A9FA 2BI7A 5TT1A 3FNHA 1B16A 5JNLA 2GD1O 3G17A 2VUTA 3MCVA 1QLJA 5DBIA 3Q3CA 1ZKMA 4UVDA 4PRKA 1DJNA 5F1KA 4WASA 2BMAA 4YYZA 1ULSA 2A4KA 2HO5A 3DMTA 3KUXA 1H6BA 1KVTA 2X1HA 4GX2A 3VKVA 4OSPA 5A3JA 4DIFA 5C3MA 4RV9A 3I83A 2C2XA 2WYVA 4D42A 4BB5A 1JKJA 3GHYA 1JW9B 3C7AA 3H9QA 3PZRA 4WCFB 4K6FA 4ALKA 4XGKA 1ZK1A 1Y8RA 1RM3A 2QQ5A 4QO7A 3JQAB 1P1IA 3FNGA 3DAGA 1DIRA 3FR7A 4CMKA 5IAAA 3RBXA 5DP2A 2VOEA 3ANLA 4WLUA 1VSUA 2PNFA 2I5PO 1E7MA 3QRWA 5F5LA 3H8VA 2O2SA 5ENDA 3F5QA 4BO9A 4TMFA 1XKQA 3C7DB 5THKA 3WFIA 5A9TA 4W9NA 3ZWWA 1D8AA 3L07A 1BXZA 1ZSVA 1OBFO 2P68A 3K5PA 4Z6KA 1UAYA 4OXYA 1ISJA 2BELA 4YWJA 3S1LA 5I7FA 4XRGA 1CF2O 4PFJA 3O8QB 4FBGA 4GGPA 4XD2A 2ZKLA 3N58A 4OQYA 4BNYA 1M2WA 4J0FA 3FPCA 1LLDA 3DHEA 3V1YA 3JV7A 1NQAO 2X23A 3OMLA 2O7SA 1I0ZA 3R3SA 3JQDA 2Y05A 3QE3A 3GR6A 1C0PA 1N1EA 2UVDA 4NH4A 1N9GA 3NDRA 2FZEA 2NQ8A 3NT2A 4NR0A 3VVBA 5B12A 3FWZA 3I9KA 3RC2A 4UVHA 1PGQA 1DAPA 2PH5A 2Y1EA 5T6BA 3AW9A 3PQEA 1ZSNA 1WZIA 1R0SA 3K9QO 4LK3A 3PRJA 3GMSA 2BF7A 2G0TA 3I52A 3X2EA 2UV8A 3HADA 3WSWA 3MEQA 5DOZA 2ZB3A 5IF3A 2Z1NA 4URFA 4BIIA 4NDNE 2DKNA 3L9XA 5TNXA 4A73A 4CLRB 1DFHA 4YT2A 2NNLD 2NVUB 2ZQYA 3RC1A 2C7VA 4RLHA 2AG5A 1DHRA 4BMSA 1DC3A 2D0IA 3MJSA 3ZCXA 2O3RA 1R4MA 1FJHA 1NR7A 4LSMA 4NIMA 4XYLA 3RFXA 3DFZA 2WJPA 3JCZA 1I10A 4ALLA 4YAKA 4E2XA 3TQHA 3H5NA 3UAGA 2UDPA 1X15A 3DAPA 2RBEA 1K0UA 3K30A 3FF4A 4CR7A 3BMOB 4FS3A 4CM4A 4PLYA 3MJ4A 1QR6A 5JSFA 4ND3A 3U4IA 3DL2A 2EGGA 2XPCA 3QA9A 3FHLA 1JWAB 2PZLA 3BTVA 2BH9A 2IXBA 2IYOA 4GWGA 2BHLA 4DIOA 5BSEA 1P45A 2PV7A 1T25A 4TQGA 4M86A 3Q2IA 3SVTA 3HJAA 3KSUA 2QW8A 1V3VA 3FTPA 4WOJA 4MP8A 1KIFA 3NTOA 2ZATA 3WTCA 4B3IA 3G79A 4R69A 1QORA 3I9OA 5COQA 4AJOA 1H2HA 3CZMA 3Q9UA 3NV9A 1B26A 1E1LA 1NX6A 1CQIA 3HN2A 4NU6A 3SX2A 5U9CA 4DLBA 4ZD6A 5JC1A 3C8MA 3S55A 4DQVA 1BRMA 1LDBA 1E3WB 1XU9A 2GSDA 3I1JA 3U62A 4DLAA 5K6AC 1U9JA 2O3QA 4U6QA 3UCFA 3IS3A 1NTOA 5A02A 4NJOA 1MXFA 1ULUA 3AM3A 4FFOA 4J3FA 1YBMA 1V3UA 3ZV4A 2OHXA 3VTZA 3NGLA 1GU7A 1Y8QA 3LLSA 4P22A 7MDHA 4MDHA 1UH5A 1ZO8A 2J5KA 3MJTA 3DO5A 4YRBA 1N92A 2DTEA 4AFNA 3H9UA 1X7HA 2Q1SA 1U4OA 5G0UA 4R9SA 1BW9A 4U0KA 4I5FA 1EZ4A 3GHHA 1JA9A 4PLPA 2P91A 3BMNB 3JYQA 4W9NC 5L4NA 4DBZA 4N54A 1Z73A 2OP1A 5BT9A 2PGLA 2YUTA 4MVJF 1ZZEA 2I66A 4YVFA 3E5RA 3GZNA 4J1SA 4RLSA 4TKLA 1NPDA 4P4GA 3DBHB 3PIIA 3K73O 1A5ZA 3C7CB 2X0RA 4K6CA 4CQMB 4Z9FA 3ZU4A 4E31A 4H7PA 4OJNA 5K0ZA 3NUGA 4X54A 3ICPA 4YQYA 1PZEA 2QYSA 1X0VA 1HDGO 4CLEA 3LDHA 2AW5A 4J90A 1N2SA 3JYLA 1EEHA 4FDAA 3RD5A 2Q46A 5LDGA 3UH1A 2EERA 1NFQA 2XXJA 3LF1A 2P5YA 3S2FA 3PIDA 4ZQFA 1DC6A 1NPTO 3A9WA 1T2AA 4J7CA 4KZPA 2OL4A 1H6DA 4GQAA 1B15A 1PL8A 2ZTVA 3JQAA 1PS0A 2ZYDA 1JTVA 2DBRA 1PL6A 1YDEA 5KIAA 1ADFA 4D43A 1PZGA 1BXGA 4Z0TA 3OBBA 4WNCA 2O23A 2QRLA 3E1KA 2OUIA 2P5UA 3JD3A 5IZ4A 2AEJA 1SOWA 4OIMA 1DHTA 3HDHA 1LQUA 4D3DA 4DUPA 2I3AA 5I9NA 1KYQA 3W8FA 3W4KA 5BSFA 4CPDA 4RPGA 2NVBA 4J4BA 1R12A 1E3JA 3MOGA 4FOSA 3QIVA 3PDUA 6ADHA 1H9BA 3L4SO 4AJEA 4DA9A 5JAIA 1QSGA 1X13A 3C1TA 4JJIA 1UZNA 5C37A 4TSKA 3EC7A 3PFWO 3KEOA 4NHEA 3VKUA 5KJ6A 1ZJZA 3I5MA 4OQZA 1U3VA 4LW8A 5KVSA 3GAFA 4NI5A 3BHIA 4CUZA 4IJWA 2FR1A 3KBOA 4B4OA 3ETGA 2BGMA 1GYPA 3V2GA 3D7LA 3QVSA 1ADCA 3LQFA 3M6IA 2JFGA 4LVCA 3TZQA 3JQ8B 3H65A 4NNJA 5B4VA 4IINA 1C1XA 1GFSA 4CLRA 1K6JA 1I24A 3AK4A 4CM5A 3OJOA 4E2YA 3E82A 1FDVA 3DWFA 1ONOA 4CMCA 5CP8A 3PJFA 1A9ZA 4OKNA 3TSCA 4QEDA 4YA6A 4YJGB 3DOJA 5B37A 4CR8A 3WG9A 2E48A 4ZRMA 3PHIA 4E6PA 4XYBA 1D4FA 4G81A 5HTOA 2QHXA 4GAEA 4NPCA 1VKNA 1YJQA 4WLOA 1NQOA 8ADHA 2OO5A 4I5GA 4MO2A 4G65A 2A35A 5BR7A 4MIEA 2FSSA 3L4BC 1V0JA 2X5JO 3INTA 3A4VA 4D46A 3KO8A 3WYCA 1SEVA 4XCVA 2VRCA 1YL5A 3FNFA 4QXMA 3G3EA 2GN6A 1LSSA 5A5FA 2VN8A 1HE4A 1I32A 3ROKA 5FF9A 2ZYGA 5BNIA 4MVJD 3L6EA 4E30A 1NAHA 1PS9A 3ZHXA 3QWAA 4GSKA 4KQWA 3UVEA 3M2TA 3PLRA 1XSEA 4HFMA 3WB9A 2HMSA 3EW7A 1GAEO 5MDHA 4IGEA 4JK3A 4O0LA 4ZQEA 4J1NA 4L75A 4MVJP 2VNAA 4XIJA 5DBFA 2QZ9A 3AI3A 1BTOA 4WPGA 4ZICA 3QWIA 4N7RA 4Q3BA 4YB8A 3BMCB 4DGSA 2J5RA 3U5TA 1E3WA 2NADA 1M66A 2JCYA 1JKFA 3D4PA 3RKUA 3S8MA 3SC4A 4FJ0A 1XQ6A 1U4SA 1P0FA 3SLKA 4BNFA 4CMIB 4KMSA 3WFJA 2BD0A 3G49A 2X5OA 1D3AA 4ROSA 4CM9D 1YXMA 3ZV6A 4B79A 4GH5A 4TVOA 1LRJA 1W0CA 1EVZA 4LISA 2GZ1A 1X0XA 3ETEA 3B1KA 3VAZA 2EF1A 3ZWBA 2Y0DA 2G76A 2NU6A 4TZKA 5KJCA 1SPXA 2DVMA 3DHNA 3ANMA 4B7UA 2J3JA 3JQGB 4W7IA 4IQ0A 3KHUA 1P31A 1RWBA 1HDZA 1WXDA 1O8CA 2Q2QA 3DHYA 2VZ9A 3GPIA 4MVJA 5G4KA 3QVXA 2EW2A 1PS8A 3CIFA 1NXQA 5IG2A 1ZK0A 2VWHA 4IZHA 4EEZA 5IDWA 1H0KA 1SEPA 3IIEA 1GADO 2Y1FA 2C5AA 3OIDA 4CQMA 1EE2A 2EG9A 3JQCA 3GAZA 3M1AA 1WZEA 4E33A 1IHXA 1P77A 4P4LA 1MXHA 2PLAA 3SLGA 2YQ5A 2D5CA 1V8BA 4QFDA 2EEZA 4PG8A 1WPQA 3ZHYA 2WSBA 1KY5A 3F1LA 1XCBA 4IS3A 3RUEA 1BSVA 1PJ3A 2AEMA 4KWHA 3GRKA 1DAOA 3TZKA 3PYLA 3UCEA 4BNZA 3HHPA 2PA3A 2DLDA 2DM6A 2ZTLA 4OM8A 1MA0A 1ZH8A 3X2FA 1D1SA 3PWZA 4DIBA 5T64A 3UF0A 1B8PA 4GX0A 4N5MA 3RQSA 4E5MA 2W98A 5ILGA 3U3XA 1HF3A 1GEGA 4B7CA 1GYQA 3FR8A 1CRWG 4GX1A 1HWYA 2YW9A 4YJFB 4R1SA 1ZW1A 3CINA 4Z9YA 3BXXA 1MG5A 5ER9A 3I9MA 4A10A 3RROA 4CUKA 2R6JA 2J3IA 1TXGA 5T67A 4EJ0A 3ADOA 4Z0HO 5DCYA 2JFFA 3K2EA 4O6VA 5AVOA 4ZGWA 1LTHR 3IQDB 4N5NA 3WGQA 4Y67A 4QECA 1QYWA 4D44A 3KXDA 4RDHA 3WNVA 4BGVA 5HS4A 3ZWNA 1BHSA 2JHGA 3PYXA 1Y6JA 2OGUA 2IXAA 4RZIA 5FI3A 4GGOA 3V8BA 2C5EA 4MKXA 3IKVA 3AWDA 1PJSA 4ZQHA 3CUKA 4C7JA 2PY6A 4BNIA 1GZ4A 1ADGA 1DDOA 1HRDA 2JD1A 1GQYA 1AE1A 1F06A 2VHYA 2O50A 4TRRA 4R51A 3R0IA 1JAYA 4YJGA 3GNSA 4YJHA 3SBOA 1D7OA 1IULA 4IS2A 3WGOA 3WWYA 2IRWA 3DBVO 3OJFA 3VZQA 4XWYA 4EW6A 3VH3A 2X8LA
chains in the Genus database with same CATH superfamily
5FUMA 5J2TF 4G5FA 3L1JA 3EZFA 5LYJF 1PDOA 3FCUB 1OC4A 2V4ZA 4IDNA 5K7SA 4RK6A 3IO5A 3NZEA 3IQIX 2CXTA 2B5VA 1D6NA 4P3XA 2JPDA 1S9HA 3RRBA 3SDSA 3SYKA 3UJ6A 3LUGA 3JWHA 1YIAA 5A7FA 2VHJA 4A0RA 3ZHCA 2JFQA 2QLNA 3HKDB 4J8PA 4HDSA 4EG4A 2ATVA 1A0OA 3EGXB 3VTAA 4CODB 2V6BA 3D6TB 3ENWA 3LY8A 2PKQP 5AJXA 3DZHA 4HBZA 4UCFA 2CV0A 2BI8A 1R0ZA 3E7DA 2GBCA 4RSGA 5K6RA 4LZZA 1KE2A 1XD9A 3KUCA 4BNXA 3WJ7A 2ZSEA 2PH7A 4D4LA 4MSUA 1WXHA 2NGRA 3VR4D 4ECAA 2FAXA 1TM7E 2ZBEA 4MR8A 3T94A 1N4DA 5DSXA 1R6XA 3ZHOA 5EUMA 5EMJA 3IMFA 3FROA 3A9SA 3K3PA 4S1TA 1V26A 2MMCA 4F04A 3AB8A 5ECYA 3WLFA 3AONB 4AICA 3ECAA 5C31A 1ESEA 1ESMA 2FZKA 3GJRA 3UXYA 2GEVA 1EWVA 4WUTA 2IODA 4K9MA 1RQGA 2ZR0A 2XWPA 1DKNA 4Z8YA 5TPZA 1EUDB 2FFHA 1Q74A 3PU6A 3KZMA 2B2NA 5BMVA 2VDOB 5A5DA 1ZD2P 5IDQA 4CLDA 1NIJA 4TLCA 2P90A 1JQEA 3CB2A 2JANA 3CPJB 3DQQA 3LP8A 3P32A 3QXJA 3KL2A 1EDOA 4KQKA 4LSWA 3FMGA 4FHCA 1NMQA 4QYIB 4WEOA 2JLXA 4LF9B 4DLTA 2QZJA 1KJNA 3IL2A 1UM8A 1WS6A 2NSYA 4M9ZA 4URUR 3ZWAA 4AWXA 4QDZA 1QIMA 4I08A 8ADHA 4HH3C 1YFLA 1MTOA 5IK2A 1MX3A 4NYJR 2XW6A 4TV8A 1SBNE 3A4IA 3GIDA 4HNTA 1TIBA 3N2GA 1TI7A 2RGRA 1LLQA 1T2FA 3OZTA 4RS4A 2O8FB 3VMFA 3ZLTA 2O0KA 3DMHA 4Y6PA 3D6VA 3VR3A 3WQSB 3IMKA 3TD2A 2VJQA 4DABA 4B2LA 3KC2A 3PNBA 2SCUB 4EPYA 1GLVA 4JP2A 4DS3A 1EK0A 5IKXA 1QCDA 5DI9A 3WGYA 3ZIAD 4ZGBA 1MO2A 2CMKA 1P0CA 2O5EA 1CY4A 1NVGA 2B36A 2CV1A 3M2PA 3RHZA 2DBVO 2WD8A 2EFEB 3IP5A 5EQFA 4K81B 5CB4A 5E6SB 1ZUWA 1C7EA 2XDYA 3DMDA 2AFIA 2OFXA 6NULA 5C52B 2QM0A 1ZW6A 1QKIA 2V54A 2IELA 1M2VB 4IIUA 4W6ZA 2WWWA 1JQLB 1NJ8A 1UFOA 1SCNE 2EZUA 3GN1A 3VSDA 4L50A 4TXHA 1CQIB 5E7JA 4GNKA 5HA5A 2X3YA 1YDHA 3BHMA 5F76A 1NXXA 4IZ6A 3NAMA 5KJEA 2AWNA 5LZ9A 4P7BA 3NHKA 1P33A 1OA1A 3EASA 3RSLA 1XRPA 3GX1A 2CHFA 3NT4A 4ME6A 2DGDA 4YRLA 4QU9A 3L8MA 1RYFA 5ESRA 5F7JA 3VHXA 3CZRA 2NO9A 3ZOKA 1LDEA 1X74A 3H9EO 4FZJA 3VC2A 4KIWA 1LDMA 4G0QA 3SEAA 1T91A 2FWBA 1JQDA 5JCJD 3INRA 1RTTA 2P9HA 1TVMA 2ZRAA 2W48A 1B0PA 4NEHB 1U8ZA 4O4JF 4I9UA 5TRTA 1LVUA 3SGLA 4EGSA 1X1RA 2JLSA 3GYGA 3VYRB 4YCNA 1N57A 3U37A 1XEFA 2C2YA 1MRNA 4J1TA 1NVKA 1YZGA 3JATA 5AO9A 5ELMA 4WK0B 5KYNA 5DYWA 1YS2X 4LTNA 5LC1A 2GM3A 1KVRA 1BW9B 4I2VA 1Y0BA 3BMXA 4FFRA 4MMXB 1H2YA 3ZU5A 2JGFA 2O8BA 1U8FO 3ABIA 3AFGA 4XX1A 3QYJA 2QBYB 1EK1A 4L5YA 5T5QA 4B75A 3PXBA 4EKGA 4L5JA 3N3AC 3HJHA 1DKQA 2P9TA 1Q0HA 4MCIA 3IEIA 4PCUA 5EC8A 1W4ZA 2MSDB 1QMPA 1CYDA 3EDQA 5IMBA 3S44A 4IJUA 4Z99A 3TLZA 2PAFA 4LEIA 4XSHA 4XGIA 2XDQB 1RE0A 2GCIA 1Q16A 2V74B 2PUBA 4IUDS 2FMIA 3D4BA 1GPUA 3IJRA 1GYRA 1T0UA 3UB2A 1NP7A 1PL0A 2VR1A 3MQFA 5JALA 4DEXA 2E1RA 3HNRA 3TRFA 5K6AA 2NUTA 4FGWA 1YI8A 2NUAA 1C1HA 3BWMA 4LGMA 2NZXA 4NCNA 1NLZA 1R0WA 4OHXA 5I4IA 3I1YA 3PGJA 2ATXA 4JI0B 3OLYA 3WBKA 2ZWVA 4UFOA 5IAJA 1KWGA 1T2UA 4BKRA 1OLXB 4P3KA 4PRZA 4M1SA 4WIAA 4WOKA 3FUWA 4YV2A 1DFGA 2W6ID 3DZCA 5FWAA 1QHNA 1VJ0A 4JDUA 3NXSA 5HDBB 3ZKWA 1XU7A 4TYWA 1QHXA 3RC8A 1R8SA 2HFKA 3DEJA 4BCCA 4Y2TA 5A0FA 2R5WA 1CE8B 3EYWA 1UOQA 2FWMX 4TKUB 1YQWA 2DG2A 2G04A 4RIIA 4EJSB 1UAAA 4ZOLA 4D4MA 4EZEA 2AZXA 3R5FA 2BLLA 4US0R 4MQFA 3G5UA 4DREA 3L0PA 3WLRA 2YWRA 1KJZA 5F2EA 1DLJA 1QE0A 2FEOA 4BRUA 4QOHA 4WLFA 1BCRA 4QFCA 4WK6A 5FBZA 3L0YA 3QG1A 4IOKA 4C2AA 2FR0A 4N3GA 1ISGA 1XTIA 1SQ0A 2AG0A 2G09A 1LUAA 2AOTA 1OH8A 1J9ZA 2A94A 2C82A 1PV4A 3U60B 1YB1A 4WNAB 3GVCA 3K7EA 2VJDA 2WIAA 2IS6A 1FTNA 1KWKA 1BEUB 2CFRA 2NZWA 3SC2B 3G0GA 4NU0A 3CLKA 5ALFA 4V0LA 5BRJA 3EIUA 1EXMA 1E0JA 3SNHA 3S5UA 1W76A 4MW0A 1VSTA 1L7EA 3B20A 4FCCA 4TMWA 5DH9A 1L7MA 3IVCA 4S0ZA 3SYMA 1G42A 3A6DA 3H8WA 3U4GA 4IXMA 5AM1A 2AFHB 4N0EA 4I4IA 3RAJA 2JKVA 4EA7A 3RC3A 1E4EB 3B1WA 3V6MA 2YXLA 3WYFA 4S04A 3TBHA 4I5EA 2EZ8A 3E3MA 4RM2A 1K5HA 4EPVA 4F84A 2AN5A 1BOFA 1I4WA 1U2DA 4OLAA 2P4EA 3F5SA 3RRZA 1X8LA 1HE3A 1NR5A 4EVQA 1B1CA 2BOVA 4NDAA 1CHDA 4G85A 4I55A 4OXIA 2OXRA 4CDNA 3A1NA 3BGSA 4J94A 1GG8A 4JLAA 1L4BA 3HUTA 3NHUA 4MV6A 1YQXA 1YUNA 4NSNA 1PQUA 4B3DA 1T0JB 4BLQA 4E94A 3CFYA 3U3ZA 3X3HA 4BBPA 3H6HA 3S2SA 2ONKA 4OHRA 1N3YA 4YUWA 1XF1A 4GHWA 5K8IA 4MRMB 2VP6A 3S27A 2Z30A 4H0CA 1DEXA 1XVTA 2VPPA 3FJ1A 2PVCA 1T29A 3PUXA 2COKA 3H1PA 4NECA 4ZZ3A 5F2OA 4JI8B 3DR5A 1I01A 3CF2A 1T3TA 2EBFX 2ZJ0A 5AVYA 2HXGA 4P7GA 1P7PA 4H35A 1IBMB 1XXHB 4L8YA 2HW8A 2IZ1A 4WFIA 4Y30A 4ESHA 1ZGHA 4I6GA 3HUDA 4D9EA 1LPOA 3LP5A 4OO3A 2VDPB 1NULA 3R7DA 1ODKA 3K70C 3OZFA 4Z9AA 1YR3A 2Y77A 4TRNA 4Z2YA 3RTCA 3RG2A 4WTOA 3CZ4A 3VOSA 1G0OA 1Z4OA 2DX7A 4PQGA 3OSUA 4AAYA 4EMTA 5JJCA 2QUZA 4E5YA 1ZISA 4KQXA 4JC5A 4DSAA 2QR3A 3ZWYA 2ODWA 3LX4A 2YZKA 5A4IS 1A9RA 2HM7A 3IAS6 3TL2A 2BFDB 3U0BA 3K0BA 2HQRA 3ST7A 1K7EB 3K6SA 1II9A 4IV5A 2HU2A 2MWMA 1X1SA 1KGSA 3LQ1A 2JARA 3WLQA 2P4QA 3L1KA 1I7DA 3MCTA 5LKRA 3GVXA 5CVDA 3TN7A 3KQQA 1CP2A 3DE3X 1ZYUA 2PZMA 4F2GA 3IIJA 3OOEA 4YRAA 3D7NA 5LQCA 4M0EA 1Q7CA 4LY9A 2DPGA 3UA3A 1U7DA 4RADA 4YUVA 1O0CA 3WIEA 1XTTA 3GUCA 4JEUA 5IJXA 3L4BA 3SAJA 3ZWKA 1U2ZA 1OT5A 4XR9A 2GZ2A 4FMBB 2DAPA 1U3TA 2ZU0C 4HUQA 3ANNA 1Z5WA 3ND8A 3UFXA 1BD4A 2QL9A 3OF3A 4GEKA 4PVDA 4FCTA 4RQUA 1NVFA 2QW1A 2TMKA 3UT0A 3ZD7A 3WYBA 4BZPA 5DCUA 4IHAA 1WY7A 4BYGA 4G0UA 1A4RA 1EJ2A 1RHMA 2CXOA 3VMMA 1R0YA 3G9XA 3V8RA 3K8ZA 4G2TA 3QVMA 3CRNA 1AKVA 2HNKA 5E3JA 1KAEA 4Y6SA 4H7IA 3WB1A 1ZICA 3FMVA 4P81A 4I1RA 1DLIA 1BJTA 2X0JA 4XDHA 4O8ZA 2F8LA 1Z75A 1IONA 2VQDA 3KB6A 3ZU3A 3GLIE 4TPKA 3IQZA 5JATA 4I50F 1GFIA 2F59A 3ZDAA 5IHPA 5I7HA 4JFRA 3WLTA 2I7XA 2HCJB 2H57A 1NI3A 3HY6A 3PDIB 1CY0A 1KJIA 2QX7A 4HB4A 2V7BA 4K7JA 4RVCA 5FBVB 1X1QA 3AH8A 5I7EA 3W6UA 5ALNA 3HCWA 1ECLA 1H85A 2VXBA 1WMDA 1U3DA 3GG9A 5KI6A 3TNFA 5I7VA 5JASA 1GM5A 1N78A 1DC4A 2ZBRA 3EFHA 4KQ9A 1T24A 1E6KA 2YNMD 3OZGA 4A2QA 3V7YA 1FUYB 3N8DA 2J3LA 2WJ4A 4Q4JB 5K0GA 1PNQA 1ZESA 3BVPA 3HYRA 4V3CA 5IAOA 1CCWA 3S28A 1OFVA 4O63O 4EPXA 5EHXA 5EP2A 4B3SB 5AIBA 5JAUA 1VYHA 5E2AA 5A3VA 3UGTA 2OG2A 4F7WA 4CFZA 3AKEA 2HQOA 1S2NA 4OSEA 4ZVOA 5B4UA 2ZTUA 3AF1A 3II6X 1JQ5A 3QVOA 5H9VA 4QUDA 5KBYA 2X4IA 3GEMA 2C4HA 3RREA 3DE4X 5J5AA 3FTEA 4MYCA 3C6ZA 5F7OA 2GXAA 1K2WA 4C08A 1QYRA 2AXQA 3VH4A 1NAIA 3WNCA 3QVJA 3EXHC 1IY0A 2JCXA 2B0JA 2PTHA 4H77A 2KHZA 3A32A 1NG9A 1ID8A 3O74A 2AIRA 3T5CA 1NKVA 2A5GA 2ZE7A 3VR6D 4RH1A 4PZPA 3GEPA 1AQNA 2IOFK 3OMXA 4K6OA 2Z6VA 4L4SA 4RDIA 1EA5A 3H18A 1OYWA 2GK4A 3I6ZA 3QE4A 3TL3A 5B7GA 4NMMA 3U61B 3SDBA 4U1RA 1KMHA 2OESA 2BDEA 2QUJA 1XDDA 2VG8A 3PUWA 3S99A 1QC5B 4HS4A 3EBLA 4IR7A 3T95A 3RYCB 3AGPA 4UU8A 1Q0ZA 2FHSA 3KRTA 3KAKA 2VUIB 3GDOA 5CB6A 4GI1A 1ZVJA 3P9PA 3R76A 4AJ1A 3IPAA 1NYTA 1RRPA 2LUOA 2W8BA 2P8SA 4BKQA 4YRZA 2NQ2C 3C41J 2BY4A 2WSYB 3L06A 3R3WA 2J0EA 5FL7A 2WB4A 3PA6A 5C8DA 5I5GA 3NMUF 1R0BA 2PYIA 4H1UA 1V7ZA 2QVGA 5EZQA 4B17A 4EI7A 1EQ2A 3T9BA 1SVNA 2BGLA 3FNEA 3BICA 3GUUA 4HPXB 5DGDA 5FLKA 1WVMA 1Z6QA 4ZKDA 3HBFA 2PA0A 4I19A 1G1MA 4PZLA 2I91A 1PT5A 3KDAA 5E7MA 4BN0A 1XZEA 3QY9A 2FQYA 3OG9A 4M0DA 4EG8A 2BMVA 3SYNA 4AKSA 4OHWA 5EXSA 2PT5A 4GIBA 5IBCA 4OHMA 3LD9A 2AA3A 3A9VA 1Z4MA 1Q1BA 5KYUB 3RK1A 3I9V6 1JHXA 1CRZA 1U5CA 4CDRA 4X8LA 1R6UA 3K4HA 4E3ZA 3OD5A 1XL1A 3T9FA 2YKGA 4XDYA 4HVCA 1LVHA 3P9SA 4QEKA 2HRRA 2NV0A 3LPLA 1RXVA 5LB4A 1BHQ1 1MOSA 3Q1KA 3RAFC 1U65A 2F43B 3G5AA 4FGZA 1OBVA 1AS0A 2Q50A 5JVDA 2CJWB 1LF5A 3M83A 5DRTA 3ZWVA 1SKMA 1QMGA 1YSCA 4DJAA 4YIHA 2HA2A 3HJUA 4PZEA 1G64A 2ZWPA 1RVV1 1UIRA 1BA3A 3SU8A 1K9SA 4H1VA 4OJTA 1BMTA 1IQ0A 4KN6A 3ER6A 4JLBA 3QUSA 4Y2QA 1M2OA 5COAA 2YOHA 3DLPX 1E0DA 2G40A 3AY3A 2RGYA 1JTEA 3JVIA 3T5BA 1S3FA 3C7TA 4RKFA 1G41A 2K5UA 3FPFA 5BSMA 3GLFB 5A7HA 2CVPA 2XXBA 4UD6A 3VNUA 4FTWA 2NP6A 3ITDA 3JAWA 1Z25A 1FNCA 1GPAA 2ZU6A 3LY5A 2E89A 5G53C 4FN4A 5AVVA 1DAHA 3BJEA 3ZV3A 2I4NA 3PEVA 4HXYA 4IXTA 1PO7A 3EW9A 5IXJA 2VC2B 2XJ9A 2JLBA 3GN2A 4Z1MD 3MRTA 2FF5A 2O0MA 4Q3NA 4MROA 3NDPA 1NV8A 1A9XB 2NOAA 2JHCA 1OWNA 2F6RA 1XQ1A 4JSTA 1E7RA 2DUJA 4A1FA 4BP8A 4PXSA 5ES3A 1PYDA 3FDZB 3S2UA 2G5TA 3D31A 3RIHA 2W2VA 1PT8A 4GOXA 2VDVE 2REQB 3EJWA 1QU2A 4MVJE 1M7GA 4WOPA 1P19A 5CVTA 3VOAA 2VDMB 4RPKA 3IQGX 1NJGA 2BFCA 3BXEA 5K2MA 4QBGB 2PZAA 1BS1A 2KQUA 2XYVA 3HXKA 1X70A 4J7AA 3V2HA 1WKCA 2B8EA 4YAGA 3JTMA 3BXZA 2XOKD 4D9KA 3FVRA 2MYUA 4WOBA 3JQFC 2A86A 4W5QA 1OGYA 1ZUNA 1Q2XA 3GT4A 1K7XB 4K6HA 2CVFA 2PUHA 5F51A 5IJAA 1UJMA 3HLKA 4LGYA 1YCDA 1CEQA 2NPOA 3NI2A 2XGMA 4RKEA 3WL6A 1R37A 1U0HC 2BGUA 4FVTA 4DG5A 3F3YA 3DTTA 2DWPA 1UQRA 3QEJA 4RFSA 4NZYA 1D6JA 3T41A 4DARA 1UDBA 5TSDA 1XALA 2BZ1A 2GWHA 4WACA 3TQRA 3D8NA 1U2QA 3V55A 3T9EA 3W1EA 3D7RA 1EFKA 3PPXA 2OE2A 4Y0AA 1G7CA 3CIOA 4P4NA 4ZAFA 1GPNA 4QXAA 4AQDA 3HA2A 3IVGA 3M49A 3IAUA 4MVYA 4U0JA 3STUA 3HC7A 1KDZA 2IPAB 5CT6A 3STYA 1AH2A 3HFRA 2YNMC 5AW0A 4X1KA 5KU1A 1TZJA 1O4VA 4P3PA 1ZNQO 1Y8CA 3HH8A 1UMKA 4ISCA 4NOJA 3I9NA 4PCLA 3TPFA 2IK8A 3UNXA 1LI4A 3PGXA 5KTPA 1G4AE 1K3FA 3KEMA 4Z7JA 1EVLA 2FOIA 1T9BA 3H5VA 1UBUS 3EA0A 4PO9A 3RSHA 3TQFA 4QYWA 4OX9Y 2WW8A 5FPSA 4MVJG 1GU1A 2ET6A 3HB5X 4LRSB 5F2NA 4RK1A 2YIMA 2ZRIA 3I0NA 4D98A 1Q3KA 1F8GA 5EMMA 3AVOA 2Q3BA 4BUCA 2RHHA 4X1IB 1WVIA 2YWCA 3HJCA 1XJ5A 2AT1A 4R3WA 1BROA 5LXTF 3IUMA 3NCHA 1CR4A 4BL5A 3QEKA 5JFOA 4ZXPA 2C04A 4D45A 1ABEA 4EHDA 1SWVA 4HQ6A 4RHEA 4E5NA 1HA3A 5CFNA 3BRWD 4WZ6A 3ROMA 4GC9A 3VU9A 4L27A 5FTNA 4IJ6A 4XD7A 2ZRQA 4DCGA 5JPCA 3W7AA 4EHAA 2F1JA 4LOHA 1T3SA 3Q4GA 1P5RA 4UNRA 1OX6A 3UJDA 2YYYA 2ZJAA 4ITRC 4CQLB 2AQHA 1YR9A 3EMVA 3HPQA 2KYRA 4N5LA 3QBVA 1XRMA 4GYJA 4JL8A 2R65A 4L6IA 3DV0A 2G4LA 2G4VA 5DBOA 4ND4A 4BBJA 1YJAA 3RLIA 4MW1A 3SWWA 2C4VA 4E1AA 3I37X 4ALJA 5DMXA 1YE8A 4Q01A 2OCDA 3OQJA 4XWTA 1HKUA 2YZNA 1MBZA 3NASA 4ENUA 3STVA 4Q7EA 3CRW1 2W2MA 4RKWA 3KDPA 4GWKA 2GYVA 3EC1A 2IA5A 4KNWA 2QUAA 5EMLA 1XF9A 5T6MA 3EJ6A 5CFRA 3RSQA 1E1DA 1L4KA 1HDCA 1RZVA 3HLTA 4PXAA 5EINA 2O5RA 2OVBA 4ZT4A 3UT6A 4DLXA 4MDFA 1N5RA 4CIXA 2W6ZA 1WB4A 1V16B 2WUFA 2ZUVA 3CNNA 4YH1A 2FMFA 3WWZA 2FW8A 2FFAA 2G9VA 5K4AA 1Y1PA 3HCCA 4BMPB 3I1FA 1C50A 1DIAA 1EK6A 1Q84A 4NZZA 5B6IA 4ONEA 4BNJA 1V3TA 2EJWA 3NBQA 4P6VF 3GJTA 2E7ZA 2H8KA 1YS4A 1ACJA 4LNAA 1RXCA 2WBLC 4B3BA 2P3SA 4LIPD 4COKA 3ANXA 1OTYA 4GM1A 1P9WA 2EFJA 4DZRA 2GEFA 3KV1A 2FP3A 2ZUBA 2W70A 2E82A 3NUZA 5IYZA 4TT3A 2D7DA 3OEHA 1KY3A 3VQTA 4BV8A 4HADA 2MINA 1Y1TA 1YQEA 4IDAA 2VSOA 2WSMA 3OCYA 2Z8XA 4XJTA 3B7WA 1SU8A 1J0DA 1US8B 3R7WB 2NZ8A 4RVOA 2YWHA 4PYIA 2J0SA 2GMWA 1IU9A 2MCFA 1NQXA 1JP7A 1TO2E 1R00A 1HQDA 4MITA 1RP7A 4RF4A 2G5CA 3GXOA 2P2YA 2WUVA 3JTEA 4V0ME 3WHIA 3TF5A 3KSBC 1L8AA 1SBIA 3KELA 1TM4E 2E4UA 3HYCA 1PEKE 3I04A 3EWAA 3KR0A 1JV2B 3CG0A 1H69A 3ORQA 3QELB 3QOYA 3AZQA 1YIDA 1I6WA 4LYEA 4X61A 4KU4A 3Q12A 5FA6A 2RGUA 1XRRA 2VSYA 4WECA 2O52A 2G63A 1Z15A 1QYDA 3MSCA 1OT3A 2WVGA 3BMQA 4JIMA 3MXOA 1QBGA 2OC4A 4NX2A 4JUCA 2JJ2A 2PIDA 4TLDA 2H1RA 5A6SA 5AW9A 5LZ8A 2C2HA 4M1WA 2I22A 4EJ6A 4FE4A 3KWJA 1P0IA 2CY0A 2ZK7A 1MO3A 4RGYA 3CUWA 3ZXYA 1XHFA 4KNVA 1OI7A 2LPMA 5F52A 2GGSA 3BOSA 1NU6A 2HRQA 3L7LA 5KTRA 1WUYA 1DFIA 3LUHA 3OU7A 3E23A 1GP2A 2W7TA 2ZJ7A 1AGPA 2BFMA 3EQ8A 1NGSA 4QJ4A 4QYSA 2HIGA 1IN6A 1DAMA 1M1NA 3NBYC 3LVBA 3LZ6A 4IVNA 1GKIA 2Z3VA 1T0IA 3TZCA 2DUWA 3GRFA 2C7OA 4BNTA 2GEBA 1H5QA 4CTKA 3D64A 4L7QA 2FN7A 2J0VA 1VLJA 2CWWA 3HWX1 2X8AA 3O4HA 4O59O 4QUIA 3HCFA 4HNSA 1UXGA 1Z56C 2BBWA 3OZCA 4MV8A 1JAHA 1HQCA 1RHUA 4NFSA 4WQMA 3UJCA 7GPBA 1CFJA 2O6LA 3MD0A 2IPLA 3OZXA 2F00A 4NJMA 5A4KA 1PJCA 3L6RA 5F73A 1SVUA 2P30A 4DWJA 5MFZA 1JR4A 3AF3A 1T1SA 3OY7A 4I99A 1M74A 4YJ2A 5JBNA 3W6OA 3MMSA 1K08A 4LCEA 3GZJA 1Z18A 1Z5UA 1U6JA 5IFLA 3A3PA 4OGKA 4S3MA 2J6BA 2QNBA 3GRCA 2B20A 5DV9A 2PT9A 4JLVA 4NE9A 4UOEA 1C3OA 3GRUA 3L7MA 2MYTA 1M2FA 1J8VA 5HQ3A 1K68A 5DLYA 1F48A 3S4YA 1BWSA 1FP2A 1U99A 3H6KA 1XVAA 1HT0A 2HJWA 3GCWA 3OFJA 2QN6A 2J87A 2Z4RA 2O2YA 4JZKA 3AR7A 2QWXA 5I45A 2M6KA 4P2GA 4YMTA 2PT7A 2X2OA 2FPSA 5JZMA 1NLUA 1XHLA 4Q3AA 2F1IA 3TAXA 4C06A 3LHIA 4ZHQB 1IBKB 4DR2B 1E7QA 2Q49A 2RARA 3M4ZA 5TQVA 1JKXA 2HWYA 1KI4A 5CYPA 1YUBA 2ISQA 4Y2YA 4V0KA 4BWGA 3GDGA 1CKEA 3D2BA 4TRJA 3UFBA 2XF2A 3X1JA 3D3KA 1D03A 1C9YA 3FI0A 4P36A 5LWHA 5EP3A 1RC0A 1ESNA 1FPQA 1MNQA 2XCQA 3G1UA 4MRPA 5GP1A 4L5AA 1W46A 3B12A 4AXBA 4E15A 1U2SA 4X20A 1L5KA 3QQPA 3WK7A 2G3YA 2NXWA 3KG2A 4Z49A 2NU8A 5FWNA 4FHDA 4ZVKA 4DEVA 1H65A 1IVSA 3ZK8A 4EY5A 2PD6A 3EOBI 3OSZA 5LP6F 5BWMA 1JBKA 3W6NA 2OQIA 2V6GA 1PQWA 2ZYUX 4FMCB 1S0UA 4LXXA 4M1QA 4CMBA 4HB0A 2XDWA 3MMXA 4M9XA 5ESXA 2EIXA 5EJ6A 3MMZA 3QXGA 4LQ4A 3CBQA 5FFNA 1WCXA 3H75A 5LDHA 1TTTA 3RQIA 2V7QD 3DWGA 1TM1E 2H17A 1GCOA 4GLJA 1GUAA 4L57A 4E46A 4JJGA 2OBLA 5D3KA 4MIOA 1C29B 4TRMA 3F6YA 1N2ZA 4HTFA 1AGYA 2VBGA 3F9IA 3FDIA 2PJUA 1EK5A 1I1HA 3GQBB 4QICA 4AMYA 3WV4A 2ZIEA 3KNZA 5AW6A 5JT1A 2DERA 4YV0A 1H0RA 2FK8A 4TN1A 1LZKA 3RUDA 4JCOA 4A9AA 4Q4DA 2AQIA 3H1BA 1K7YA 1WXGA 4YAWA 3SF8A 3DV2A 4MLZA 1G20E 2EX4A 1DIBA 2JFXA 2QIOA 1LBHA 2VAMA 2VYVA 1DMSA 1ODTC 3NC4A 2PGIA 4U6SA 2BTOA 2C8LA 2Q0SA 3M1YA 1TD9A 1KEPA 3ZDZB 3ZV7A 4LWZA 4MYUA 4FZRA 2BFOA 2BW0A 3BH6A 3Q7RA 3HWSA 2M9MA 1Y82A 5FO0A 3TOXA 3DFIA 4PBRA 4OAPA 1YVPA 4LJYA 1Z36A 4YAEA 2Y1DA 4X24A 2HK6A 2C95A 2DTXA 2Q41A 3TNDA 2NMVA 2ZSIA 4TVKA 2ENWA 2ZVDA 2B35A 1H1TA 2WJ3A 1T36B 3H4IA 4IDHA 4IGKA 4JLDA 1ZONA 3MJEA 1BGWA 1NBEA 2VAWA 4A23A 3F0TA 3UCXA 3FPLA 3R5HA 3BD8A 5JPIA 1HDIA 1GKKA 3MTDA 2WE7A 1OF1A 4WESB 4Y1EA 1XO1A 4G4SO 1RKBA 4CWAA 4V39A 2WKPA 2PQMA 4BZZA 3WY9A 3R2JA 2ZAIA 1FNNA 1QLWA 1IM8A 3UWDA 4A5SA 3QTBA 3VO1A 2R44A 1KK3A 1RM5A 3CEJA 1H94A 1Z83A 4TOIA 1MT0A 3WGIA 3VA7A 1UQUA 3R1IA 2FP4B 3DL4A 4EAQA 4QDXA 2OBFA 2YWEA 3GEDA 4KPUB 2GF2A 2YVAA 3EODA 2PX4A 4KIUA 3AERB 3KLPX 4HH4A 1JG4A 3HNOA 4DGQA 2Q8QA 1ND5A 1TIPA 1RYBA 3IOYA 3K92A 4E08A 1XEAA 4F4IA 1J6UA 2FLVA 3MGKA 3F3KA 3CVOA 1RHRA 4FDLA 4L08A 3RCBA 1PFKA 2W6IA 2VRBA 4J4TA 4JFAA 1Q50A 2RGWA 4PGHA 4LXTA 4Y6RA 4JUDX 2O2JA 2WJWA 3A8TA 4V03A 3K20A 3ICQB 1LLFA 3RSSA 2YMMA 1XD2A 2WJAA 1ECJA 3IQFA 1KFCB 1SCAA 1GNPA 4M9QA 3F8TA 3N2IA 2ZCJA 3H5IA 4PXYA 1VG9B 3ZGOA 3QQ5A 3H5WA 3QFSA 4QUKA 2OPHA 3YASA 4E70A 1DWUA 1RIFA 4M8IA 4D3FA 2HK8A 3HYTA 1GXSA 3BXGA 1OXVA 3OOWA 3VPHA 2XMZA 2VWQA 4N7MA 4HBGA 5AHWA 4L72A 4C7KA 2R751 5IUJC 4OD0A 4LX0A 4DEYA 1JG1A 2Q0HA 2Z57A 2OZVA 3BD7A 2VYNA 3EXHA 5EWJA 2BM0A 1HDXA 3NKLA 1OLUB 4MB0A 2R5NA 5GOTA 3MJCA 2EOAA 3DDHA 1OTXA 4G3XA 5ETJA 2CFSA 3TDKA 4BLUA 3KSMA 3TXXA 3AUUA 4PN3A 3FDFA 5CLFA 1KI6A 2VYQA 3RWBA 2YMPA 1E7YA 2QG4A 3MOIA 3PFHA 3ZQ4A 5K8TA 3ETLA 1D2GA 2IE8A 4IGFA 4F5EA 4F3TA 1O77A 4G0YA 1YFJA 2H9IA 1G5FA 3ZW8A 4L76A 4G0XA 3OF2A 5E4TA 2WZCA 2Y68A 4GW3A 3THXA 1H8HD 1N0HA 3ZDQA 1Q0QA 2BI4A 2JCVA 3CKMA 2OG1A 3CUSA 5CK5A 4KMRA 5MN5A 1RBMA 3DH0A 5E6UB 3LTNC 4ZKEA 1P6QA 2EP8A 4B31A 1JG7A 4FT2A 4J7XA 3DXFA 1EXWA 1A2OA 4C4YA 1MJHA 1E2PA 2VDQB 4KUGA 2Q07A 3PNKA 4P7FA 4NK4A 4D6YA 4DY4A 1FS4A 2NT4A 4JEIA 4FNGA 1KS9A 5JAMA 4UEQA 4D4IA 4MNTA 5DYTA 3GCGA 4PYKA 3BHNA 1IDOA 2OKGA 3NPAA 2FW1A 2Y6VA 4UEJA 3T9DA 1U90A 1KERA 1KOFA 1OPRA 4FZVA 4NENB 3LBAA 4FK8A 4M76B 5ALJA 4ZV7A 3DVQX 4JIGA 4H4DA 5DK6A 2P6MA 4ZC8A 2XZOA 1E8MA 5IC6A 3Q72A 2CGEA 3IAHA 3CUTA 3KM0A 3BE4A 3GLHA 1M10A 3D4LA 3RRFA 1GQFA 3QLEA 1YOVA 2D7JA 4WCDA 4MQ4A 1MJ5A 4X1YA 5CDTA 1FQKA 4KXYA 3AUSA 2G08A 1I2ZA 1FFDA 3OZBA 1YR6A 1RI5A 2GNPA 2NYAA 2Z04A 3OZ7A 4GOOD 4KXUA 1GZSA 2Q3CA 3K0CA 5CLGA 5H16A 2YHIA 1ENZA 2MYPA 4K1XA 1OHHD 1T2DA 4XX0A 4YXWA 2PE5A 3VR4H 1HZJA 1GQ2A 1IRXA 3HVKA 3O03A 5EKDA 5LP1A 1AKQA 3FVQA 5KTOA 4D0NA 2AFVA 1CQJB 1L4HA 2IYWA 1I4DD 1QX4A 3AHEA 4ID3A 2RGDA 3ANTA 1QIJA 1XJ0A 4IKOA 1YA6A 3IP6A 3G2NA 4G5SA 2JAWA 4L73A 2GETA 3IIMA 3VSCA 2FFRA 3DE5X 3J80A 4Q48A 3X1YA 2G9NA 4E4RA 3C3DA 4K9DA 5K4GA 4HNGA 4MJXA 3KPUA 1HFJA 1YVDA 3MM4A 2RB4A 4RQBA 3PG5A 2XZLA 3KJEA 5E1MA 3OE5A 4TTPA 2Q5OA 1RPTA 2XA1A 4UQPA 1TPZA 4YY3B 3RAEC 4NEQA 2J6IA 1XLWA 1SN7A 3ND9A 4F9FA 4OGLA 1DS6A 1EVQA 1ZRSA 4D79A 1T8UA 3CG4A 2GCOA 3NOVA 3LM8A 5FEUA 3WOHA 3PNQA 4MKIA 4TXMA 3TTXA 1KYYA 2OHJA 3TVDA 1Y9EA 3BQ9A 1DOHA 5J40A 4P92A 1BDIA 3L84A 3LLUA 1JYSA 2AJ8A 4N3CA 2FX5A 1BJRE 1FYWA 3EUWA 4IHJF 4K05A 3ZIDA 4CG3A 4EFDA 2HHCA 2AVNA 2ZYTX 1XDSA 4K1LA 4LHWA 4ZYWA 2JZNA 3C85A 4KYVA 3IXLA 4S1VA 1WW8A 4L0MA 1NQUA 2AMFA 4D57A 4OA8A 4B46A 1MOZA 4AJHA 4EPTA 4LRXA 4NJEA 2Y1OA 3EEYA 5DYIA 3GBPA 3GBSA 2Q28A 4L8VA 3RVQA 4A27A 5KQMA 3W5HA 1L1QA 2FHPA 2I78A 5M2QA 2FSUA 5KO2A 2ZWAA 4KFUA 1OASA 2OCPA 3JZMA 2OKCA 4FCVA 3KZKA 4DRXA 4JWKA 4OREX 2P9GA 1E4YA 1KC3A 2PZBA 1JRLA 3FHCB 2OXIA 1JJBA 4DUGD 5FWDA 4XVRA 3C3MA 4YRPA 3WKDA 2EHDA 5AJZA 5KS2A 2X9QA 3PTAA 3I9LA 1SB8A 3ZEIA 5KQLA 4I3HA 1DB3A 3RAGA 2YNMA 1XTUA 1DKOA 2AOVA 1CZRA 5IULC 4OY3A 4W7SA 3WIVA 4A8JC 2D3TA 4J49A 4U7WA 1ACLA 3F3SA 1VL2A 2P4SA 2R79A 3IYLW 5KTTA 2R8ZA 3PNYA 1VI2A 1TPYA 3ETJA 4Y7DA 3N8HA 1AK9A 1CT9A 4CF4A 2EIHA 2JI9A 2ZCUA 4RF3A 4U7FA 1QG2A 1Z74A 3RKRA 4XWOA 1TQ4A 1WXQA 1HXHA 5BUSA 4IWNA 5KB3A 1K88A 3JALB 4DQLA 5IJ0B 2GD0A 4G2NA 2J0UA 3P9RA 2HBQA 4XGNA 1XQ9A 4BP3A 3MJVA 3KJHA 5EZ6B 5LP6C 1W88B 4NCAA 2V7PA 1B43A 2GR9A 1T26A 3DTNA 4RFLA 3RT1A 1OXXK 1SM4A 2H1IA 1ES9A 1U1CA 1XEXA 1J07A 3FIUA 1OZAA 1XXHE 3N6RA 4GR4A 4JOQA 3VR6A 1NV9A 4M6WB 2LNDA 3ENKA 2C5GA 2XUFA 2M32A 3GFSA 4ZO4A 1A8PA 2LR0A 3FDJA 1CUIA 4RVHA 4EUFA 4TTQA 1U7WA 1IVNA 2PANA 3CJTA 3OECA 1C1DB 1LCIA 2CLMB 3HEBA 1KZGB 3H4TA 3OFSA 4JELA 1P9LA 3RS3A 8OHMA 5HJ5A 5KYXB 2PJRA 3EGEA 2IW1A 3EAGA 4YP7A 1RLIA 3CLVA 4G8JA 2WWVD 2F1HA 2COEA 4LN1A 1VJ1A 1KBOA 3RVPA 2QJWA 3LPDA 3OETA 4Y6GB 3PT5A 4B3RB 1RWQA 3BMOA 3U26A 3JARA 5DN6D 2EFCB 3CVWA 1Q1GA 5FBQB 5C7IO 1LNSA 5J1SB 5CD9A 2HD4A 4BLWA 3ML1A 4PGAA 4YRMA 2YIDA 5ICGA 2B2CA 1EEXB 3P7MA 2GD2A 4XWGA 5JJIA 5E2BA 2BFAA 5KWEA 2O1EA 4JI6B 1JVSA 1F2VA 2B37A 3AQ4A 1WV0A 3KXLA 1C30A 5BR1A 1ZK3A 4P3YA 3SXPA 1V7QA 4WA7A 5CCDA 4E7OA 4KQEA 1W4LA 4EHJA 4AMBA 2W2LD 1M34E 2X86A 5EXTA 2QDXA 3HPRA 4MWZA 4X8MA 1TEVA 1W6UA 4ZVNA 5SY6A 3V1KA 3LAWA 1TU3A 5CCBA 1F9AA 5EJGA 1VHQA 2R1VB 5M5BA 4XQEA 1L8OA 1BDBA 2WFLA 1F0YA 2WWHA 4H1TA 5U4QA 4C07A 1U04A 1L8QA 2ZRCA 2CD9A 3K35A 2REXB 4F5YA 2J59A 3NALA 1ZIDA 1HLGA 1G5TA 4EATA 1QYCA 5UKDA 4DNOA 2R6GA 1S3GA 2FA9A 2ZR8A 1NVDA 3C5WP 1GPMA 1H8ED 2GI4A 4D82A 3KT0A 1C3LA 4EF4A 3JU3A 1RP1A 4YECA 1KPIA 2P41A 3QUQA 3B89A 3NWEA 2CMDA 4PG7A 3WGMA 3TX6A 4LJAA 5EPOA 2EFHB 3I2GA 5HR5A 3CN7A 1YB5A 4KKXB 2BGWA 3TZHA 3R9IA 2UU9B 1XAHA 1BFDA 3ACBA 4H7EA 3O7MA 1N7JA 3PXCX 2RAVA 1MJNA 1UP7A 2R6AA 2R96A 4GXRA 2NYUA 5FTMA 4HVLA 5LQNA 1RJFA 4JXXA 1R8XA 5CUQA 4ZOEA 1ZCAA 5DTJA 5LR6A 1DO0A 4Z1MA 4Z3DA 5JHGB 1SC9A 1JDVA 4U2CA 3C3BA 3RYIB 5HGXA 3HCRA 4AZSA 4F3YA 1AKEA 1SBTA 1CDEA 1L7BA 2VRWA 4ZOAA 2OLKA 1N3IA 3DZGA 5A1TA 1K63A 4M53A 1YB6A 3E22A 4Y6QA 5FADA 5FPHA 1OYVA 3Q5EA 2FPGA 3TLAA 1IEXA 2WP0A 5AJVB 4B5LA 4JA0A 4C0SA 2GBIA 5KCZA 1PNOA 2H2HA 2I2FA 4DDHA 1QYVA 2OFWA 1E63A 3MCWA 5AOBA 2QN7A 1NXTA 1R0RE 4YJ3F 4JB2A 4MQMA 5DVZA 2LD4A 3MC1A 3ZKAA 3MLEA 2E9SA 3J7TA 4N3BA 1ORRA 2GO1A 2WILA 1XNGA 4M1EA 1Y3CE 3OE7D 5KWJA 1I3KA 4ZA2A 5C7OO 3C4VA 2ZI3A 1JDNA 3DBRA 1OW3B 1YRAA 4IOLA 3THRA 1GRNA 3LKDA 5AD1A 3RWMB 3ZJYA 5L3ZA 4ZYVA 2O07A 3EY4A 3ZCSA 5K20A 1WU8A 3T3GA 2H4ZA 2HNAA 3IAXA 2D2VA 4Q39A 2GFHA 1YU9A 1TYAE 5C46F 3L40A 2UXBB 1U3FA 1OLOA 2ZOSA 4MKRA 4BECA 4AY4A 5EJ5A 4CCYB 3L49A 4IG9A 3W7VA 1WDMA 4QUJA 4CN8A 3PZBA 4D3SA 4FYIA 3TKLA 3TW6A 4XI9A 4ZK6A 2ON6A 1SZJG 2C77A 3CH7A 1IDN1 3LIPA 3IR6A 2CNWD 3KWMA 3MUOA 4C05A 3G8YA 3LCRA 2X0KA 1XTRA 5DYGA 3B2EA 3T7SA 5AW3A 3ENVA 2X0IA 3IAFA 1EXNA 2Z43A 2YV1A 1EM8B 2A92A