2C0CA

Structure of the mgc45594 gene product
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
353
structure length
353
Chain Sequence
b'GVDLGTENLYFQSMMQKLVVTRLSPNFREAVTLSRDCPVPLPGDGDLLVRNRFVGVNASDINYSAGRYDPSVKPPFDIGFEGIGEVVALGLSASARYTVGQAVAYMAPGSFAEYTVVPASIATPVPSVKPEYLTLLVSGTTAYISLKELGGLSEGKKVLVTAAAGGTGQFAMQLSKKAKCHVIGTCSSDEKSAFLKSLGCDRPINYKTEPVGTVLKQEYPEGVDVVYESVGGAMFDLAVDALATKGRLIVIGFISGYQTPTGLSPVKAGTLPAKLLKKSASVQGFFLNHYLSKYQAAMSHLLEMCVSGDLVCEVDLGDLSPEGRFTGLESIFRAVNYMYMGKNTGKIVVELPH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ZINC BINDING ALCOHOL DEHYDROGENASE, DOMAIN CONTAINING 2
molecule tags Oxidoreductase
source organism Homo sapiens
publication title The Structure of Mgc45594 Gene Product
rcsb
total genus 124
structure length 353
sequence length 353
chains with identical sequence B
ec nomenclature ec 1.3.1.48: 15-oxoprostaglandin 13-reductase.
pdb deposition date 2005-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2c0cA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2c0cA01
5L3ZA 2ZATA 4K1LA 4MIEA 3S2IA 5ICMA 2PD4A 3UGKA 1PU2A 5ENVA 3UCEA 1FDVA 3H5AA 1MXHA 3FNFA 4DPMA 2O3SA 4BNWA 4J3FA 3WSWA 5ITVA 4HP8A 3WGGA 3QQPA 1IOLA 3DDNA 3DZKA 3BAZA 5KCZA 2QQ5A 2BFPA 1RWBA 4IDFA 4PLTA 3WLEA 1E1KA 4CM8A 2FSSA 3PLNA 4Q3AA 1KC3A 3GQVA 1MGOA 5HWSA 3G3EA 3UUWA 3VC7A 1HF3A 4NHEA 1HE3A 3H2SA 4OMUA 3AK4A 4RL6A 4U6SA 4JLWA 1ZZEA 1A72A 4NZ9A 4B8WA 2Y93A 3WGHA 2J3JA 3OEYA 1OC2A 2GO1A 3KYCA 1RYDA 4CLOB 1E3WB 3GGOA 1ADFA 2Y1FA 3M6IA 4JBHA 1LDGA 1XCBA 4CMBA 3ZV5A 3HDJA 4NI5A 4LRSB 1EE2A 1ZCJA 3QE3A 4WUVA 4O6VA 2Y0CA 3NJ8A 3T4XA 5G4KB 3MOIA 4BMNA 3FD8A 1MG0A 4GVLA 4XEHA 2O3QA 4WLUA 1EEHA 4EJ0A 4N7RA 5GMOA 4I9UA 3BYZA 2LDXA 4TMFA 4BNXA 1DLJA 4UUPA 4W7IA 1KYQA 1ZK4A 4YWJA 1V0JA 2Q2WA 4WNCA 2CVOA 4PG4A 3GAZA 5JDIC 1DRUA 2IODA 2X86A 2PK3A 4BUCA 2GN9A 1VL6A 3PEFA 4TVOA 3RROA 3IDSA 4ROSA 3AU9A 1SB8A 4JROA 3P2YA 4Z9FA 3B1JA 2H6EA 1BTOA 4D7AA 3JQGB 5KTKA 4JXKA 5TJHA 5U4QA 2OORA 1NAIA 3OJ0A 1T26A 5AXAA 1EFKA 4I9HA 3F9IA 1UXGA 3DB2A 1IYZA 3H4VA 4WOJA 3PRJA 5B4UA 1NXQA 4NPCA 4A03A 1ZJZA 2YZ7A 3QIVA 4CMCA 1R66A 3FNEA 3WGTA 3ZNPA 3RQSA 4U0KA 5JE8A 2CVQA 2JAPA 3SJ7A 2V6BA 4FFLA 3ADOA 3WICA 4M49A 4KUHA 1ENPA 1VJTA 4XQGA 4EYEA 3W4JA 2CF6A 4FFNA 4ZRNA 4ZVVA 4BNKA 3MJ4A 4DMLA 3VH2A 5DN9A 1BG6A 4J1NA 2FWMX 1FDUA 4YT5A 1XR3A 4CM9D 4GLOA 2NQ8A 4P8RA 2CFCA 3LYLA 1H5QA 2W4QA 1ISIA 5JAMA 4L74A 2D8AA 3H2ZA 3DMYA 1FMCA 1R0KA 3FR8A 5AVOA 5I7SA 3P7MA 5JAQA 3NX4A 4KTVE 3OQBA 2H5LA 4NQZA 2ZTUA 3EY4A 4Y9DA 1P1KA 2YYYA 2GN4A 1HZJA 3OJFA 3PGXA 3GHHA 1D1TA 4EITA 4RVDA 1T2EA 2JL1A 4LCJA 1KEUA 4LISA 1Z6ZA 4CLDA 4NMHA 3AM4A 3FNHA 3FN4A 4DUPA 2NVBA 3R0IA 1X14A 3WB9A 1CQIA 1XHLA 3LC1O 3D5QA 4XWYA 3STHA 4AJEA 4RQTA 3BTVA 3FR7A 4E2YA 1PR9A 3IMFA 5AQ1A 1IY8A 1DRVA 3AU8A 3RU9A 4BGEA 1ZEJA 4BNZA 4FN4A 4E21A 5CEJA 1BHSA 2BMAA 1HLPA 1YQGA 4QXMA 1U8FO 1T2AA 1LTHR 3DBRB 3I9LA 2NTNA 1N92A 4BO4A 3TQHA 1R16A 1P1RA 5I9MA 4AJJA 4I5FA 3GH3A 2V7PA 1LDYA 1Y5RA 3RC7A 1U3VA 2VYNA 3PJFA 5G0TA 1EQUA 4WEQA 3NGXA 1ENZA 1SEVA 3HQ4O 4PG5A 4IJKA 1EFLA 2Q1UA 2RBEA 3E5RA 3PTZA 3UAGA 3PYXA 5GZ6A 4NU5A 1OMOA 1DC4A 1R4MB 3NGLA 5AOVA 2Y66A 2IYOA 1X1TA 5JC8A 3OECA 1PQPA 4BGIA 3OIFA 2AG5A 4CUZA 5ER9A 2VYND 2VUTA 4ITUA 2C0CA 4RF2A 3HZZA 3SJUA 5IDXA 4UUOA 5EINA 4E0BA 3OJOA 3TZQA 1QLJA 5DOZA 3M2TA 2C29D 2AE1A 5K9ZA 1IB6A 5EMHA 1RYEA 1LRKA 4IMRA 4N5MA 1ZMTA 1VE9A 4DMMA 1JVBA 4NFSA 1U2DA 2B4QA 4FJ1A 5U9CA 2A92A 1Q0QA 1Z7EA 3AWDA 3JQ6A 4ALMA 1NPTO 5IZCC 1O94A 4PRKA 4UVGA 1GEEA 9LDTA 4XD2A 1I33A 4Z9XA 3JD4A 3GEMA 1PJCA 2DBVO 1ZK3A 3A9WA 4GX2A 5G0WA 2PKQO 3VZQA 1F8FA 1KY4A 3AM5A 3RFTA 2VUSA 4W82A 5A06A 4D79A 1NBOA 1DBVO 4FFOA 4E32A 2OP0A 4NU6A 3RUHA 4BNGA 1TXGA 4P22A 2OOSA 2QX7A 1ZO8A 4PLYA 4RZHA 1PS0A 3GUCA 3B6ZA 2EW8A 4CLRA 4W9NC 2VTDA 3K30A 4IJVA 3D0OA 4XB1A 4Z0HO 4BMVA 4MJLA 1NVTA 4D44A 1EUCA 4JNKA 4D42A 1GU7A 2P9GA 2IYPA 3S8MA 1T24A 2I5PO 4MKRA 3DAPA 3LQFA 4W4TA 3KO8A 4XR4A 4Z0PA 4DC1A 1NNUA 1JVSA 4KDFA 4XIJA 4BQRA 3C1TA 5KNLA 2P68A 3B1KA 3GDGA 1JQBA 2VNAA 3PWKA 1FK8A 3BHMA 1QV6A 1C1DB 1UR5A 4R16A 3ZWWA 1GQ2A 1V8BA 1Y7TA 2IE0A 2PNFA 1P1FA 5JMWA 4CV3A 4JQCA 4YT4A 2BFOA 3JQFA 3OHSX 4YRAA 3PZBA 1YWGO 3MJCA 2CF5A 2PFGA 3HDHA 4IBOA 1B3BA 1F14A 4DIOA 4J1SA 2HRBA 1I2BA 1KVUA 5A4DA 1Y8RA 4WKGA 3ITKA 4PLHA 3WMWA 1R0SA 2GRAA 3RSHA 1N7HA 2G5CA 5IN4A 2HMVA 4B7UA 3MWDB 4RO0A 3X2FA 2ZJ0A 2Q1TA 1NR1A 1GTMA 3DTTA 2J5QA 1L7EA 1PS9A 3L07A 1I2CA 3RBVA 3ONFA 3LSYA 4TRNA 4DPLA 4OKNA 1EK5A 3ULKA 2AXQA 3RU7A 1Q7CA 4O1MA 4MPDA 1AGNA 3KB6A 4QTZA 2XOXA 4MVJD 5JXWA 1MG5A 4R5HA 2X5OA 3BMQA 2AHRA 2BFAA 1HETA 2B35A 1A4IA 4NFHA 2EERA 3RVDA 1Y9AA 3UICA 3L4BC 1T2FA 2HKIA 3NTOA 1E1MA 3I9OA 3ZNQA 3A4VA 5K0ZA 2JCVA 1XG5A 4YXFA 3TZHA 3DMTA 3ZI0A 4B4WA 3L9WA 3JQBC 3TOZA 5HTOA 3DTYA 1KY5A 2YFQA 5T6BA 3GFGA 3QLJA 2C2XA 4YACA 3WNQA 3GEDA 4D41A 4L75A 4RVUA 1PJBA 1C1XA 1AHHA 3IC5A 4IDEA 1GFSA 1D1SA 1IHYA 3DOOA 4HNGA 2BF7A 1ARZA 3DAFA 3FCOA 4WNIA 4KDEA 2QHXA 2AMFA 2NU8A 1AXEA 5A9RA 1OFGA 1B8VA 3KLMX 3E1KA 2GN6A 1LX6A 2YV1A 1I30A 3I83A 1RJWA 3AUUA 1UXJA 3IUSA 3O03A 4RF4A 3ABIA 3ZWMA 2DVMA 1VM6A 3WS7A 2X8LA 2Q4EA 3EW7A 3ASVA 3AI1A 4J16A 2FP4A 3D4NA 3N74A 4LVCA 5F5LA 5TRTA 4BV9A 4IDBA 3WG9A 3H5RA 2YHIA 1QG6A 3OBBA 4GSKA 4NFYA 1VL0A 4CV2A 4R51A 4J7CA 3V1YA 1ZK0A 1UXKA 1GAEO 1U3UA 3I6IA 3KYCB 4G2NA 5C3MA 5HA5A 3MOGA 3NT5A 1W6UA 4G81A 4Y6PA 3W6ZA 4CQLA 4L0QA 1JAXA 4RF3A 1C0PA 1KC1A 1UZNA 4O5OA 1XQ1A 5DBGA 5G2OA 5B4TA 2JAHA 5CEEA 2EGGA 4A73A 4BO6A 4CMKA 3KETA 4YQYA 3GVHA 1ZIDA 4BNUA 5EPOA 1KVRA 4EDFA 4GL4A 1M67A 5A03A 3ETDA 4DQXA 1RM5A 3WYBA 2YDYA 4F6CA 5BQFA 2CUKA 5CPFA 3WYEA 3NTQA 5TLSA 2C82A 3G17A 4E2ZA 2BFMA 4B7CA 5EIOA 2UVDA 3BZUA 4BO9A 5DP2A 2ZYDA 3D1LA 4UULA 2FOIA 3FWNA 4N5LA 1X0XA 3CSDA 1YBAA 3ZHYA 1GPJA 2OMEA 4YAEA 3UOGA 1R4NB 3JD1A 1L1FA 4E5NA 4U0JA 3AW9A 3ZV3A 3EYWA 4ZGWA 2HU2A 3ONDA 1BWSA 1NP3A 1E7WA 2YHIB 2EWMA 3NRCA 1K0UA 4OH1A 1YB1A 3CEAA 4S3MA 1E6WA 4BO3A 4J1QA 1LQUA 3KBOA 1H0KA 1ISHA 3MZ0A 3GUYA 1NFRA 3I23A 1K89A 4ZQEA 3ZGYA 5JNLA 1DC3A 1BMDA 1Q7BA 3EVTA 3LVFO 2FPGA 2B69A 3LU1A 2RH4A 4GI2A 4QEDA 4CM4A 4BV8A 3ZWXA 2FR8A 3F1KA 3JYNA 3S2FA 2D4AA 1P1HA 4RJTA 4D3SA 2I99A 4ZJUA 1BW9A 4FJ2A 3RAJA 4GKBA 2C07A 1Z7BA 2OP1A 2JKVA 4A27A 2HMSA 4YAIA 3D3WA 1E1LA 4BNYA 4PZDA 1I32A 5KJ1A 4P4LA 1HRDA 4WASA 4J0FA 3W8FA 2GGSA 1I3KA 4PG8A 3ENKA 3INRA 5BSFA 3GEGA 4J9VA 1MFPA 5T8KC 4ND5A 2PGJA 4CM5A 4HBGA 1SC6A 3R3SA 2PWZA 3HDQA 2I6TA 4DREA 3C1AA 1T4BA 1TB4A 3LT0A 4XQCA 2W90A 3DBHB 4QO8A 4W9NA 2P2SA 3M2PA 2GERA 1Y1PA 3BA1A 3UN1A 2CDAA 4XB2A 3ZHBA 1MXFA 1EVJA 5CAEA 2BGMA 2R00A 4PVDA 1OBFO 1E92A 3DR3A 2V6MA 3LF2A 4ZQGA 5CHEA 5ILGA 3C3XA 4HY3A 5TNXA 4U5QA 3D64A 4BNMA 4TRMA 1BDMA 2JD0A 5T8KA 3D4PA 3V2HA 1VKOA 1E7SA 2VZ9A 3Q1LA 4CR6A 2C7VA 2LDBA 2QYTA 4J1TA 3JD2A 4DRYA 3B70A 4IQGA 1B14A 1CDOA 5KVSA 3VTZA 2BGKA 2YV3A 3UXYA 1LU9A 3ZV6A 5JCXA 1QYVA 5COBA 1ZH8A 1I8TA 3PP8A 3E9QA 3OMLA 4FS3A 4TVBA 2QRKA 3MEQA 1NWHA 4HNHA 1F17A 2PD6A 1MUUA 2NSDA 3L4SO 3KUXA 1CERA 4KUGA 5L7YA 2IDZA 2JHFA 3TJRA 1MV8A 5EQFA 3BMNB 1JW9B 2Q49A 3JYQA 4EBFA 1NHGA 2DPHA 2D3TA 3V5NA 2WYWA 3HHPA 4R68A 2J8ZA 5KKAA 4EJMA 2B4TO 1Q1NA 2ZYGA 1EBFA 4EUHA 5KJCA 3PHLA 2WD8A 2NTJA 4M8SA 2Y1CA 4CODB 4WE3A 5DZSA 5TSDA 3W4IA 2Y0EA 1QKIA 3PWZA 3DZFA 4RDIA 2NTVA 5JDCC 3GZNB 2DU8A 5I7FA 3GNQA 1JTVA 3DHYA 1ZJYA 2VCYA 1I36A 1GCUA 1P1JA 1Y81A 2NU7A 3HADA 4I08A 5EESA 3ICCA 1XIVA 3FPLA 4ESOA 4EZBA 3PIDA 1EUDA 2C59A 3KEQA 4M87A 2AA3A 4BNHA 4J0EA 1Y8QA 2FR0A 3GHYA 5U1PA 4WOKA 4PG7A 2IZ0A 2FN7A 1PR3A 2DAPA 3R6DA 3EMKA 4Y67A 1PZGA 5JAIA 5ER6A 2J5RA 4LVUA 4M89A 5JO0A 2NUAA 3E18A 3ONEA 1BSVA 5BSEA 3K2BA 4NBVA 1ID1A 1ZMOA 2ZTLA 1GD1O 4BNFA 1E77A 2R6JA 3O4RA 2EW2A 3U62A 2OXIA 3I6QA 4O63O 4J43A 4CPDA 2PR2A 1ULSA 4AJKA 4E31A 3D7LA 5KWEA 4XGIA 2SCUA 2VUUA 2ZQYA 1SB9A 4A2CA 3F5QA 2NLOA 5BNTA 5CDSA 2UUPA 4HFNA 4J2OA 5IDYA 1SCUA 3OA2A 1H94A 2GN8A 3WIEA 1UAYA 5DCWA 3L6OO 1DDOA 1T1RA 1ISJA 1Z75A 3DMTC 2P9EA 1EVZA 5JLAA 2NU9A 2O2SA 4GPD1 5I9LA 1R15A 2FMUA 3ADPA 2X9GA 4E3ZA 1CQJA 2GR9A 1DHTA 2BELA 3GDFA 3V2UA 2GCGA 4A26A 3GN2A 1GUZA 1QYDA 3V2GA 1VSVA 4IIUA 3QVXA 2NVWA 2O48X 2YHUA 2EEZA 4YAKA 2HUNA 1PJQA 3PVZA 1UP4A 2ZTMA 3OQ6A 3ZV4A 4QUKA 5BR7A 2HLPA 3MJTA 3OETA 4Q39A 4YB8A 3ZW8A 1BDBA 5I8WA 1PWXA 3F6YA 1E7RA 1IHXA 2VWHA 3GG2A 4DTIA 5CDTA 1EQ2A 3OSUA 2O2YA 5ITWA 1FF9A 1LDMA 3QP9A 4KQXA 4XIYA 3HJAA 1G6KA 1JA9A 3U09A 3SVTA 5K6AC 3OP4A 4E2WA 5L40A 4K9DA 1HKUA 1Y5MA 2BKAA 2A4KA 3DAGA 3Q6IA 5C37A 1T4DA 1N1EA 3PYMA 4YDRA 4ZN6A 1MLDA 1PGJA 1S6YA 4U6QA 2WTBA 2Y1GA 2XXJA 4OXKA 4NJMA 1EK6A 3EGOA 1M66A 1JKFA 1I3NA 4Z0TA 2B37A 3TZKA 1GV1A 3JCZA 5C7IO 2G1UA 4CMIB 4WLNA 2EKQA 3PYLA 4J7UA 1YBVA 1PJ2A 4MVJP 3IIEA 2JD2A 3K96A 3RUEA 4UEKA 3W8DA 4NDNE 4QT0A 2ZJ1A 4AICA 5KKCA 3K5PA 2CNBA 1ZK2A 2HO5A 2P9CA 2UYYA 3JQAD 3ORFA 4GGPA 3KSZO 2AQIA 1N9GA 4L76A 5C7OO 1BVUA 3PJGA 2EKPA 1DC5A 3DBRA 4DYDA 5K6AA 1A7AA 1Q0LA 1GV0A 1T2CA 1Y8RB 2F1KA 1B2LA 3ZWAA 1O8CA 4JK3A 4DLAA 5A5EA 4GBJA 1E3SA 5ILOA 1UH5A 1V35A 4YYZA 3W6UA 5IDWA 4CM6A 1WXDA 1A9YA 5IFLA 1OOEA 2Z1MA 3GNSA 1U2GA 2WMDA 2DBQA 3G1TA 4WCFC 3VPSA 1XLTA 4MKXA 4YAGA 4ID9A 1P45A 3L77A 2DBZA 3H3JA 3HN2A 5KIAA 1DHRA 5FF9A 3KZVA 2CD9A 1HE2A 1CIVA 1GY8A 2AQ8A 3FTPA 2QG4A 3WGOA 4KQWA 1GZ6A 4HFJA 1FDTA 4BKPA 5CDYA 3PXXA 3BMOA 1DRWA 3T4EA 5JY1A 2YFHA 2IXAA 2VHZA 1SZJG 3JQGA 4F46A 1ZKMA 5KVCA 3WR5A 1R37A 1ORRA 2DUWA 5ENDA 4CQMB 1A7KA 3WGIA 2O3RA 5BSGA 4IJUA 1GQQA 1MC4A 1NQ5A 4L8VA 1I01A 2X5JO 3CKYA 1G1AA 3PWSA 4FB5A 2VYVA 2I65A 3IQDB 4I5GA 1IUKA 2PA3A 3LT1A 3UCFA 5CPBA 1BW9B 1TLTA 2GSDA 2TMDA 4B7XA 5JY6A 4FOOA 1GZ3A 1ISMA 1O89A 1QP8A 4YT8A 3VKVA 1HT0A 2EG9A 1ZFNA 1C0KA 1KBZA 2CVZA 1GQYA 5FFFA 3TZ6A 1V9LA 3P19A 1WDLA 4HX5A 4JP2A 1IZ9A 1QORA 3K92A 1YONA 3IS3A 3K31A 1FJHA 4IJWA 4D43A 5C5IA 1R4NA 3P2OA 4AG3A 4OXNA 1C3VA 4UVHA 3BTSA 2VRBA 1IULA 2VQ3A 2WSBA 3H9UA 3ZH2A 1H9BA 2UUOA 3AJRA 4BIIA 3PFWO 1M6WA 1X7DA 2NQTA 3GT0A 4XJSA 4BGVA 5CDGA 5KVQA 3WGQA 5FYDA 3ZWVA 4FCCA 1DPGA 5DCYA 3RC2A 3CMMA 1N2SA 4ZHSA 3FF4A 3LC2O 3INTA 4Y6RA 3JQ8B 3S55A 1DXYA 1YS4A 3E03A 3QRWA 5BNFA 1D8AA 1SO8A 4FSHA 2JFFA 1GPDG 2Q1SA 5DF1A 2WDZA 2BGLA 4YPOA 1LRLA 3S1LA 2ZYAA 2H9IA 4LMPA 3VH4A 3DBLB 2PGLA 3MTJA 1CETA 2A35A 3SLGA 1YDEA 2EKLA 3GN1A 2X5KO 1DJNA 2R2GA 2VWPA 3NYWA 1ZXLA 1HXHA 1QR6A 2E4AA 4CUJA 1LJ8A 2DPGA 2YV2A 1W73A 3H9EO 3KSUA 4WCFA 4YTEA 4ZQHA 1EMDA 1ADGA 3ON5A 3VDRA 1NQAO 1U28A 2O7QA 3GRKA 2WM3A 1C14A 4XZ3A 3OJEA 3TRIA 3TSCA 5F1OA 2GPTA 2J3IA 3GGPA 2JHGA 3EHEA 4E5MA 3U5TA 8ADHA 4Q3NA 5H81A 1PL6A 2Y0DA 3JYPA 2QIOA 1GUYA 1KOLA 2I67A 3OM9A 4RPJA 3TN7A 1NYTA 1SBYA 3QJ5A 4BNVA 3WYCA 1AUPA 3L9XA 4WGGA 1BXZA 2GASA 1UDAA 1PQWA 1ISGA 1LLUA 3CIFA 1WPQA 3E82A 3N7UA 2YUTA 3DBHA 5THKA 3OEWA 5KJ6A 2O7SA 4E13A 5ICSA 4Y6SA 3GLQA 1JDJA 4ZA2A 4HXYA 3SXPA 4JP3A 5B37A 4CMAA 1WMBA 4R69A 5TF4A 2HK9A 3OA0A 3K2EA 1WP4A 3Q2IA 1V3VA 4QSMA 1C0LA 3TPCA 3U4HA 1I10A 1AHIA 4GX0A 3WDSA 4TKLA 4RPLA 4D3DA 2FZWA 4ALLA 5LC1A 1B0AA 3LDHA 4TZTA 1HSZA 3CTMA 1DOHA 3QSGA 1YH3A 4GAEA 2X22A 3AUSA 1GEGA 4E6PA 3VHRA 4JJGA 3SC4A 4LW8A 3WIDA 1U9JA 3ZU4A 4YT2A 5L95A 2DTXA 4PGFA 5DCUA 4N54A 1F12A 3OQ1A 5DULA 1PZEA 2EIHA 3GNTA 4BOYA 1UXHA 3WXBA 3C7DB 2RIRA 4GKVA 4MVJM 4OSOA 2HCTA 4RF5A 3TNLA 2JFHA 3RJ9A 4YJGA 5F1PA 3MJVA 4BGUA 5JDIA 4MP8A 1F8GA 3LT2A 4TSKA 4JX8A 4MVJE 4ND2A 1KEWA 4IINA 4OQYA 1IPFA 4KWHA 1ZW1A 5DT9A 1X7GA 5IJZA 5IDQA 2VHYA 4CLHA 3ICPA 1LRJA 4YJGB 1WMAA 2POQX 4DVJA 1H2HA 4K6CA 3JQAB 4YJHA 1UDCA 4OXYA 4BNTA 3H7AA 1IE3A 3HFGA 1DC6A 4PZCA 3RBZA 1XSEA 2EV9A 1ML3A 2NU6A 3DOJA 1DFGA 1MA0A 4OOFA 4HFMA 2PKRA 1PGQA 3RC1A 2OHXA 4FGSA 2Q3EA 4QO7A 4OL9A 5JW6A 1PL8A 1B8PA 3DHNA 4GX1A 2YY7A 5ES3A 2X58A 3WTCA 3ZNNA 1XELA 4B4UA 2X7HA 5T57A 2AG8A 2PTGA 1DAOA 4CM1A 2CZCA 4LSWA 2ZQZA 1YL7A 2DM6A 4RV9A 1IL0A 4TROA 2D1YA 3AY3A 3K6JA 3ROMA 4IMPA 1ZNQO 3PQEA 2PY6A 4FFRA 4MVJI 3Q11A 3FTNA 1KS9A 1M6HA 4ND1A 4II2A 1FXSA 3OIDA 4XDYA 4PLVA 3ANMA 2NM0A 1Z45A 2OZPA 3RWBA 5MDHA 3WSVA 4MP6A 1WWKA 4Q3BA 3GMSA 1X13A 2BI8A 1HDCA 4JN6B 4AJOA 3KXDA 2I3GA 4ND3A 1NFFA 5T5QA 4XYBA 2HRZA 1X15A 1HDZA 2Z1NA 3DZJA 4NK4A 2GLXA 2Y1EA 3H8VA 3QVWA 4MVJA 3GMDA 3PDUA 1YOVA 3AY7A 3KRTA 3NUGA 2I76A 3FSRA 2Q1WA 2HJRA 4NIMA 5BSHA 1XKQA 1WAMA 4PLWA 2P4QA 2OUIA 4Q3EA 4DPKA 1EVIA 4HWKA 2RHCA 1DIRA 1P3DA 1DFHA 2YW9A 1RKXA 1QLHA 4QQRA 3RIHA 3WGZA 2ET6A 4YVFA 4CQLB 3KEOA 1WZEA 9LDBA 3O26A 2I66A 4CQMD 3CH6A 3CINA 3VTFA 1S7CA 4L4RA 1SAYA 4BKOA 4TRRA 4BNIA 5AXBA 3UKOA 5C7LO 4C7KA 2IEDA 5TIIA 2OO5A 1V3UA 4KMSA 4DLLA 4D46A 3GR6A 4MDHA 3IAHA 3GC6A 3F3SA 3NV9A 5G4KA 2J3HA 4RZIA 5KOIA 4FJ0A 4BB5A 1ENYA 4PLGA 2I9PA 3EZLA 3QWFA 4FBGA 4B4OA 3CUKA 2X0IA 5I8ZA 1HEUA 1PSDA 3COSA 4O59O 4DQVA 2E82A 2QRLA 4G5HA 4MIOA 2D5AA 4DL9A 1VC2A 1VI2A 3AUTA 5JPIA 2WEKA 2W2KA 1DIAA 2X4GA 1LEHA 3BTOA 1X7HA 4QX6A 3ZHZA 4YQZA 3I9KA 1UUFA 5A02A 1HSOA 5JO9A 2G17A 2HDHA 3U3XA 3DZBA 4EEZA 1HYGA 4FC7A 3F5SA 1VJ1A 2ZB7A 2JCYA 1RPNA 3FBGA 1XDWA 4ONEA 4PLPA 3PHIA 4XQEA 1JLLA 3BMCB 4BO5A 4NNJA 1DFIA 4NG5A 1LDNA 1VKNA 2VHVA 3C7AA 6LDHA 4J91A 4ZD6A 4GMFA 1SEPA 1B7GO 4H3VA 3O8QB 2HMWA 5HM8A 4B3JA 4XR9A 1OI7A 1U7TA 4CR8A 5HBRA 4I5EA 5I7EA 1LC3A 4RCVA 5JS6A 1CF2O 5L9AA 4BMSA 2NVUB 1QXSA 4R1UA 4XYMA 4RVFA 4WEOA 3NTRA 2BLLA 3I9NA 2DFDA 2DQ4A 3RC9A 1DJQA 3VZPA 4IPTA 3RFVA 1HWYA 4M1QA 4UREA 4PZEA 1SNYA 3E5MA 2AEMA 1HDRA 2WYVA 3AUAA 3QA9A 3TDKA 2O4CA 3HSKA 1PWZA 2W2KB 5DDIP 1HYEA 3RI3A 4KOAA 1KVTA 2R00C 4ZRMA 1N9GB 5A05A 5IXYA 3RUCA 3FWZA 4B3HA 2ILTA 1UXIA 1PJSA 3VH3A 4OJNA 5LCXA 4R4JA 2J6IA 4DXHA 3JQFC 3O8QA 4BO0A 1N5DA 2ZCVA 2AW5A 2FSVA 3WGYA 3ZU5A 5IZCA 1MB4A 3H65A 3H6KA 3U4DA 4WLVA 4KUEA 1WLYA 5TT0A 1R12A 4JBGA 2VWGA 4WLOA 4Z3KA 3F4LA 2JFGA 1UDBA 5FWNA 4FGWA 2FPPA 1U8XX 3E6AA 3OICA 5DBIA 2X9NA 1E6EA 2NWQA 5A9TA 2HSDA 4XDZA 3GAFA 2AE2A 1NAHA 2ZB4A 4IM7A 3FI9A 4WPGA 5BT9A 4BKUA 4IY1A 5A04A 4MO2A 3AY6A 3LK7A 3IL2A 2WD7B 3NKLA 1ULUA 1AE1A 4UVIA 2Q2QA 4CMJA 2ZCUA 3HNPA 2HAEA 5HRUA 2UDPA 4J4TA 4MIYA 3O38A 1MFZA 1M75A 1UZLA 3KYDB 5IN5A 1YO6A 2E37A 1TEHA 2DFVA 2CDBA 3GGGA 4DA9A 4KTTE 1QYXA 3AOGA 4YAJA 2QW8A 3I5MA 1PGOA 1T1SA 5GZ1A 4OSPA 1VL8A 1NWCA 3PFFA 4YBZA 3RKRA 1J49A 1IZ0A 2Y67A 1T2DA 5CG1A 3T7EA 3ZW9A 2VWQA 4MVJH 3WQQA 2EXXA 3V1UA 3RUIA 3R3JA 4R01A 4W99A 3DBLA 3GPIA 3EAGA 2DTDA 4R3NA 2HMTA 1B16A 3ZCXA 5TQVA 2FR1A 4R41A 3HDYA 5A3VA 3RD5A 3L4BA 3BIOA 3RCBA 1C0IA 5TT1A 1D7OA 2JJYA 2DT5A 4WJZA 2CY0A 1GUFA 3JQ9C 5L53A 1KERA 6ADHA 1I2ZA 1P77A 5L4LA 3DC2A 1A27A 3N58A 3HWRA 4IDAA 4PN3A 1E3EA 2D59A 1VRWA 3I9MA 4PRLA 1U1IA 2VN8A 4O0LA 1Y8QB 1EDZA 1LLCA 3ZDFA 4I5DA 2O3UA 4DWVA 2Y99A 2ZIZA 3O9ZA 1XA0A 2PZKA 1P44A 1GADO 2NNLD 3JQ7A 4ZICA 4TWRA 4CLOA 2DLDA 4INAA 2BH9A 3ASUA 1GYPA 2Q50A 3JQ9A 3FHLA 3Q3CA 5THQA 2V6GA 1HDOA 3ZHXA 4UUNA 3ZWNA 1HE5A 1X0VA 1DEHA 4D0SA 2P4HX 4H16A 4XQ9A 5EL0A 1JN0A 1F0YA 1H9AA 1KVSA 1ADBA 1ONNA 4R1TA 3ZNOA 4IDDA 2ZTVA 4PLCA 1N1GA 1O9BA 3FNGA 1K2WA 1PEDA 3EVNA 3EZYA 2RAFA 4WCDA 2BI7A 5J23A 2G76A 3C7CB 1CWUA 4GMGA 5KVVA 7MDHA 2FHSA 2IEBA 1LSUA 3F4BA 3TFOA 3WWYA 3S2EA 3V8BA 3JD3A 4TZKA 4S1VA 1EBUA 2GF2A 4WK6A 3DO5A 1Z82A 2BHLA 4XYEA 2BRUA 4QECA 1E3IA 3KVOA 1XU7A 1ENOA 3DZHA 5G4LA 4PVCA 3MJEA 4MP3A 1TVEA 3JTMA 2DKNA 5JMPA 4H15A 1O6ZA 2B0JA 1PJTA 3ZU2A 4XCVA 4OM8A 1NM5A 1TT7A 5G0UA 1YBMA 4CL3A 5JYDA 3MTGA 2VT3A 1DIHA 2B36A 3GFBA 3QVOA 4YJHB 3SX2A 3SBOA 4A10A 3F47A 4D3FA 1ZEMA 4FOSA 1GZ4A 1VSUA 3TZCA 4N5NA 1W8DA 3CPSA 5EJ2A 5G0VA 2JCXA 1P74A 4J90A 3VVCA 2J5KA 3PQDA 3I4CA 2X9VA 1AXGA 2IZZA 2Q99A 3I4FA 2E6UX 4WLEA 3AI2A 5TX7A 2VZ0A 5JC1A 3GK3A 5CEFA 5LDHA 3E9MA 2PGDA 2Q46A 1BXKA 2Z95A 4ZQFA 3IKVA 3BTUA 5A3JA 3DOCA 1K5HA 1WVGA 3GA0A 3JV7A 3PZRA 5IZ4A 2DBRA 3CE6A 4NH4A 2W2LA 3AOEA 2AEFA 1QYCA 4LSMA 4E30A 4DGSA 4WECA 2GYYA 1VJ0A 1E3JA 2Y1OA 3TL3A 3E48A 4AJ1A 3GVPA 4GLLA 4NR0A 4Z9YA 3RBXA 3RUDA 4FR5A 2PV7A 1NHWA 5I9NA 5A9SB 4WLFA 3RJ5A 2EHDA 3DZIA 4IGFA 4LN1A 2NV6A 2FZEA 3IOYA 4RLSA 1LNQA 1NPYA 1CYDA 4EW6A 3SC6A 2VYVD 3MWEB 4CV0A 4AJPA 5B4VA 3MCVA 5L45A 4Q3DA 4FPXA 3RKUA 2X0RA 3CZMA 4Y98A 4LCEA 1BGVA 5L4SA 4BKRA 4H7PA 4CM9A 5DOVA 1HZZA 1DSSG 3PLRA 2PD3A 4UAGA 3PJDA 2EP5A 4FFMA 4R3WA 3D5TA 4K26A 2GZ2A 2HJSA 3BHIA 2B5WA 3C24A 5L7WA 2EJWA 3NDIA 1UAGA 2IRWA 4TRJA 1ZBQA 2C54A 1QSGA 2C7GA 1KIFA 1GCOA 1ZSNA 1I24A 2YQ5A 5TGDA 1HDYA 1K3TA 4AJ4A 1PQUA 4P38A 4BQPA 1P31A 1E7MA 4W7HA 3HFSA 3U4CA 4YRBA 1PJ4A 5CDUA 4AVYA 3JQ8A 1E3WA 2VHXA 4J2HA 4BO2A 3OFSA 3Q9UA 3BXXA 1YJQA 3AFNA 2NACA 2X23A 1KVQA 3VPHA 4AJIA 3L6EA 5COAA 3PI7A 5JCJD 4OAQA 3JYLA 1N7GA 4XX0A 4IZHA 4KZPA 4IZIA 2QZZA 3JQBA 4TKMA 2H63A 4ALKA 1XYGA 4U7WA 1NQOA 1P1IA 4RVHA 2GNAA 3F1LA 2WYUA 2VOEA 2X6TA 3WFJA 3TFQA 4BO1A 2PH5A 3EC7A 5DNAA 4Q3CA 3W4KA 2Z5LA 3FRJA 4UUMA 4J6FA 4MVJF 4EEXA 2F00A 2ZB8A 4CJXA 5A1TA 4K28A 4AJ2A 1JKJA 3P5SA 3A1NA 1QMGA 4M86A 4MINA 3UFXA 2GUGA 3GF4A 1ZSYA 4GGOA 3VPXA 4MVJG 4JGBA 4A0SA 2VT2A 2J3KA 3U9LA 4YRDA 1KEPA 1LXCA 1M76A 4NBRA 3HB4X 4DIBA 1E5LA 1E6UA 2HMUA 2OBYA 2WJPA 3LT4A 2UAGA 2YQ4A 4D45A 1I0ZA 4QFCA 1BRMA 4R1SA 5DP1A 1BXGB 1GDHA 4YEDA 1YB4A 1KETA 4J4BA 3IKTA 4J9UE 1CRWG 4RPGA 1GYQA 4JBIA 1ZSVA 1D4FA 5T67A 1ADCA 1T25A 4RORA 4XRRA 1HTBA 4II3A 4NBWA 4NK5A 4EGFA 2VOJA 1UP6A 2V6FA 2DTEA 4AFNA 4EJ6A 3IJRA 4BB6A 3W8EA 1LI4A 5HS4A 5K1SA 1XWFA 4ILKA 2EGHA 4RLHA 3VPGA 2W8ZA 1TT5B 1R6DA 3WJ7A 1E7QA 3DWFA 4W6ZA 1NVMB 2DC1A 1UJMA 3GY0A 4D0RA 3KTDA 3B20A 1PX0A 4R5MA 3IP1A 2EJVA 1YKFA 1VLLA 3DBVO 3UW3A 1XGKA 1A4UA 1DAPA 4Z3DA 1PJLA 3WBFA 3X2EA 4BL5A 5JCJA 4A7PA 4XKJA 4HUJA 2P5YA 8LDHA 1JKIA 4HKTA 3LLSA 3RUFA 4OYRA 1C1XB 1LDBA 1PGNA 1A71A 2WE7A 3PHJA 3C85A 4OO3A 5JDCA 1ONOA 3QHAA 2EP7A 2HK8A 3C8MA 3M1LA 4ZU3A 1I3MA 3WQRA 3TF5A 3H9GA 3M1AA 1PJ3A 1YRLA 2YDXA 3U4IA 1HE4A 1Z74A 4DBVO 1H93A 3WLFA 4NBUA 3CZRA 3G49A 1LLDA 2GZ1A 1LQTA 3GZNA 4BO7A 4Y8VA 1U7HA 4B79A 3PHGA 4PCVA 2CMDA 3A28A 3GVCA 3I9JA 3ETGA 3PQFA 1JU9A 3BMCA 1OAAA 2HK7A 4UVDA 4B8ZA 1K6JA 3G1UA 4OGWA 3DXFA 5FI5A 1V3TA 1J5PA 4CLEA 1ONPA 3IP3A 1X1EA 3VPFA 3DONA 5BNIA 1SMKA 3I3OA 1H6DA 3WBBA 1TT5A 4E12A 4NJMB 3DZGA 1YJ8A 4YJFA 1HLDA 1GYRA 3ZWOA 1PL7A 3EK2A 3WMXA 4CL8A 4F45A 3DL2A 3QW2A 3UVEA 1WW8A 1B15A 1I3LA 3V1TC 4IGEA 3WWZA 3ROKA 4FW8A 3SEFA 3VAZA 2AEJA 1RM4A 2NVUA 2O23A 4RQUA 4B4VA 1M2WA 1YQXA 5T64A 4WCFB 5IAAA 1U3TA 1EZ4A 1NVGA 4M55A 3H5NA 3LLVA 3K73O 3VOSA 2FY8A 1EDOA 4XGKA 4BVAA 2VRCA 4U8GA 3D4OA 4URFA 3A06A 1TI7A 1JWAB 4XYLA 2W2LD 4TQGA 1YL5A 4I1IA 3TL2A 4KP7A 2UV8A 2GD1O 4I9NA 4P4NA 4CV1A 2RH8A 1VPDA 4XJTA 3QWAA 3JYOA 3WFIA 3ENNA 3KOUA 4CMHA 3OF2A 4BHTA 4XA8A 1YQDA 2C5AA 4HADA 2IZ1A 3WX0A 1NFQA 2Q4BA 1O5IA 3L6DA 4R9SA 3I1JA 4RGBA 1LSSA 3ZZNA 3HE3A 3KSDO 2RCYA 3PIIA 3WNVA 4IDGA 4IUYA 2XPCA 4HV4A 3AM3A 1J0XO 1YDWA 5AXDA 1F06A 4M54A 4YCAA 1OZAA 2HQ1A 1WDMA 3QY9A 3E8XA 1DLIA 1QRRA 4R1NA 2W98A 3BHJA 3QV1A 1L7DA 5EERA 4B3IA 1G0NA 4OQZA 5L51A 3WTBA 1EUZA 3QWIA 1YVEI 1K6IA 3KYDA 3GVIA 1Q2XA 3UF0A 3MJSA 1DO8A 2CDCA 1P33A 3D3EA 4XGNA 1QYWA 3JD0A 4IIVA 5GY7A 4LRTB 3JQCA 4JJFA 4AL4A 3KYBA 1EVYA 1MC5A 2GDZA 2XAAA 3GPDG 2B4RO 4K6FA 4AJNA 3BMNA 1ZVMA 4CM8B 2VTEA 4PG6A 2OGUA 2O3TA 1XQ6A 1YOVB 3LC7O 3RFXA 4CUKA 4JJIA 3QWHA 1AN9A 2Y1DA 3OIGA 2P5UA 4FIZA 3G79A 1PTJA 1BVRA 2Y05A 5L4NA 4GH5A 1Q7GA 3F46A 3BMOB 1O95A 4CQMA 1SOVA 2QZ9A 1NPDA 3ZWCA 3JQAA 4PLZA 1FDSA 1H2BA 3VDQA 4N18A 1HDGO 2RHRA 1IPEA 3W1VA 3I52A 4NJOA 2ZK7A 3OJLA 3QVTA 3NDJA 4YJFB 1DIBA 3E9NA 4GWGA 3NEPX 1K6XA 2X0NA 1LUAA 4RVGA 5CG2A 4LMRA 3KV3O 4BNJA 1Y6JA 4E5YA 4RDHA 2CSUA 3NAQA 1YE3A 2D0IA 3PJEA 5KJEA 3Q9NA 4MOWA 1SPXA 4DIFA 5FEUA 1YXMA 4ALJA 2NADA 5JAZA 4IXWA 2O3JA 3H3FA 3WOHA 2AQHA 5F21A 4GVXA 3Q2KA 5DBFA 1R4MA 2ZKLA 3GZ4A 3ZWPA 2YJZA 4OOEA 1E7YA 3WJAA 3JSAA 3S2GA 1H6BA 4YA6A 3VKUA 1ZUD1 4CR7A 1LBEA 4CMEC 4AJHA 1O0SA 2WE8A 4PIVA 3R1IA 2D5CA 4FDAA 1MP0A 2FRDA 5JYEA 4IS3A 4X54A 1YB5A 5IXSA 5F1KA 1KEVA 2Q2VA 4R54A 4BS9A 1B3RA 1I5RA 1NR7A 3EDMA 1LA2A 2A94A 2VRCD 4L4SA 4YJDA 5IG2A 5MGBA 3C1OA 3AFMA 4IQ8A 3KLPX 2V65A 3JQEA 1N8KA 5JSFA 3NT2A 2I3AA 3IUPA 3PPIA 4ND4A 1OC4A 4ALNA 3LF1A 1P9LA 2H1SA 2PZJA 4CM7A 1Y9EA 4NBTA 4GSLA 3G0OA 3TWOA 3L0DA 2VNSA 4EUEA 2Y68A 3Q0EA 4OHUA 4DYVA 4XRGA 3FBTA 1LDEA 1UZMA 1Q0HA 4J4HA 3GDOA 5F3RA 1WNTA 1Z73A 3ITDA 2DUUA 4OIMA 5COQA 1PZHA 2OL4A 3H9QA 3GOHA 5TS3A 3RUAA 4A5OA 4BO8A 1PZFA 4GWKA 4PLFA 3H9JA 4BNLA 4L73A 4YR9A 3D3WB 3ETEA 4E5PA 3HUDA 4JIGA 3RASA 7ADHA 1ZXBA 4LK3A 2XF8A 1HYHA 5TC4A 4AJLA 1J4AA 4CM4B 3K9QO 3DEYX 4GX5A 3PGJA 2O4UX 1E0DA 3VZRA 5HS6A 4Q9NA 1XEAA 3WQSB 2WWRA 3OH8A 2FPIA 4IQ0A 4E4YA 1H6AA 2XXBA 4RVSA 1P0CA 1PIWA 1RM0A 5FI3A 1NQTA 4P4GA 5A5FA 4FFPA 3ROPA 1D3AA 3NT4A 2C20A 3AOEC 5KJFA 2GZ3A 1J6UA 5F5NA 4CM3A 3CMCO 3LZ6A 4MKZA 3GRPA 1HL3A 4IS2A 4FQ8A 2E49A 1NASA 4RPKA 1XU9A 5GZ3A 5JFOA 5G0SA 2PKQP 1R0LA 5AXCA 4HFRA 5CP8A 4CMEA 1U4SA 4UEOA 1WDKA 3U0BA 2AQKA 4E5KA 3K8ZA 1PS8A 4J49A 1UP7A 4G65A 1GL3A 3GG9A 3ST7A 1LSOA 2VZ8A 4ZQBA 1A9ZA 3EUWA 5TJ9A 4E2XA 4OKIA 2VHWA 3QWBA 2QYSA 4UEJA 5L7TA 3DQPA 3CXRA 5EN4A 4UVEA 4ALIA 1GR0A 1U5CA 5JBIA 2X1HA 4CLRB 5CFZA 4L4XA 1JWBB 3KHUA 1MX3A 3A14A 1QV7A 3UHAA 4DC0A 1C1DA 1JAYA 1E3LA 1H6CA 3NJ4A 2IXBA 2X0JA 1NTOA 3PDJA 2E48A 2B5VA 1CEQA 4C7JA 4RPHA 1W4ZA 1B26A 4BNNA 1RM3A 4R9RA 3ROQA 4EUFA 5H82A 3ANLA 3NDRA 2OBNA 3KM0A 1YL6A 2D2IA 1W0CA 2PZMA 2A9FA 4DQUA 1U3WA 1B8UA 1FDWA 3GVXA 2PLAA 3ZWBA 1U5AA 3VZSA 1U4OA 3PK0A 5A9SA 2QRJA 2O50A 1ZK1A 3B1FA 2WD7A 3ZU3A 3FPCA 2OFPA 1P0FA 4F3YA 5B12A 3DHEA 4F6LA 4CMGA 4I8XA 4J7XA 5AYVA 5H83A 1HDXA 1TA4A 4LGVA 1LSJA 2Q45A 4FC6A 5I7VA 1ISFA 3T7CA 1V6AA 3UCXA 3UH1A 4PFJA 2G82A 5ADHA 2ZB3A 3U49A 5IF3A 1A5ZA 3PHHA 1EE9A 2PZLA 3JQDA 1YGYA 4XYGA 3DFUA 5B1YA 1G0OA 3INGA 1DIGA 4QFDA 2PH3A 3ANNA 3BMQB 3QVSA 5EQDA 4Z6KA 4DLBA 1NX6A 1E5QA 3ZWYA 4CMIA 3HN7A 2BD0A 4FD3A 1CJCA 2TMGA 2G0TA 3HG7A 4L9RA 2JD1A 5LDGA 1SOWA 3AI3A 4GQAA 1LLQA 1PGPA 4CLXA 4C4OA 2C5EA 1WZIA 3DFZA 3HB5X 2C2YA 1E1NA 4IXTA 4KWIA 1BXGA 2P91A 4DBZA 2B83A 3TOXA 1DB3A 4BKQA 3ZN2A 3VH1A 1LC0A 3VVBA 2EF1A 3IJPA 4IDCA 4E33A 4JCOA 3JQ7B 3SLKA 4EI2A
chains in the Genus database with same CATH superfamily
2XUPA 3HA5A 2ZATA 2POCA 4K1LA 1G6HA 4MIEA 1MIHA 4U63A 4UXIA 5CU7A 4GYKA 1ZM2A 3DE6X 1O58A 1NVFA 4YJKA 3FJYA 5ENVA 3V6MA 4FYIA 3VZDA 5DT2A 5MFZA 2F3QA 3NIGB 3H5AA 4Y2XA 3AG5A 3ZD8A 2O3SA 1KDZA 3L43A 1MZVA 3R76A 5EKDA 4MW7A 2WUEA 3OE7A 4EG5A 2C8VA 2FWRA 2ZPTX 3FF1A 4RJLA 1PT9A 6YASA 1N6HA 3BAZA 2BZGA 3CZ9A 5JJBA 2IF2A 1KI2A 2BFPA 2LBPA 1LBIA 4IDFA 4NNPA 3TNFA 4B83A 1DJLA 4TYPA 2GJ8A 4CM8A 2FSSA 1E62A 5C46F 1KC3A 2W93A 2YRXA 2QWXA 5FNVB 1MGOA 5CRIA 4F9EA 5HWSA 1OB2A 3G3EA 3KALA 1CZLA 2J85A 3A27A 4Q00A 1P4RA 3H2SA 5I7RA 3R23A 2J6HA 3CJRA 3T1NA 2PRIA 4R84A 4H3SA 4Q6WA 1C81A 4UUQA 3RODA 1DWUA 4CETA 3HU3A 4KIWA 2GO1A 1CS4C 2QTVB 2G6BA 4BBJA 1E3WB 2QT0A 4KDRA 1ADFA 3OPYA 3M6IA 1L5FA 1YBHA 3Q7PA 4KXMA 4MCJA 3LUFA 1EA5A 1OI4A 1KFJB 3CLHA 3ZV5A 1TM1E 1QTIA 5BSRA 3U3RA 5BN5A 5JSHA 4XVQA 2WV7A 2ZSIA 4NI5A 4ZC1A 4G56A 4FE7A 1EE2A 1ZCJA 4G9GA 2C31A 3QE3A 3PUKA 2NMVA 1KF0A 3NJ8A 1KQOA 3T4XA 1TTTA 1M6VB 1KXJA 2OZEA 4MH0R 3UK0A 5CB4A 4AECA 5BOSA 3I9V1 2EWVA 4HDKA 4XARA 2F48A 3I2HA 1JX6A 4B5LA 5TQ2A 2R8PA 3DP7A 1HTWA 1UFOA 3LWZA 2W48A 1G3IA 4L5JA 4WLUA 5CHYA 5GMOA 2LDXA 5HEKA 4Q01A 2XD4A 2YWGA 1VPEA 1H42A 1YJCA 1ZK4A 5E4YA 2H7VA 1T3ZA 3R6GA 4JGIA 3GLFE 1REQA 2F3RA 2QZPA 2FP3A 4RK6A 2WMNB 4LQCA 4TX1A 3C3CA 3ZZUA 1X8LA 4LTNA 1K6MA 3GJ5A 1JECA 2JJ1A 2WHYA 3IDSA 3LQKA 2WLTA 4DM7A 4YV0A 5HNKA 2G88A 1AX9A 2OCYC 3C74A 4P3YA 5EFZA 5AWFC 2ONJA 1OHHA 2D7CA 2ZUTA 4Z9FA 5JVDA 3B1JA 3WAJA 3NXSA 1SVNA 2ZETA 2E0IA 4RHCA 5K2OA 4L0DA 1POXA 4YC7A 3UC5A 2CMHA 3UMBA 4KSCA 1SK9A 1J1IA 3OQHA 3OJ0A 4NZYA 3SJCA 1T26A 3T3HA 1BEUB 1J2JA 2IP1A 1CUFA 1D2MA 2PGOA 4C6RA 1UXGA 1IYZA 3H4VA 4GP7A 5B4UA 2QUZA 4TQ9A 3ZQ4A 4YMGA 4A03A 2VXOA 4HLUA 4LRXA 3HNRA 5CK4A 5DM2A 2XNDD 4M0LA 4CMCA 2RBGA 2R47A 3R5SA 1R0RE 3SQXA 2QUIA 1KDVA 4QGSA 2M98A 3SJ7A 1ILWA 4ZVUA 3ADOA 3OOHA 4MYSA 1XRJA 5KNBA 1ENPA 1T8PA 4B3DA 1QU2A 3WV4A 1ZCBA 1VJTA 2Q28A 3W4JA 1GCGA 4NABA 4QHYA 5TQ2B 1TLFA 2I4NA 4TQAA 1W4AA 5CFRA 2WJHA 3BE5A 2N3ZA 4LOHA 3THWA 2AK2A 1WZNA 2PWBA 3FDFA 1BCSA 1XR3A 3RK4A 2NQ8A 4HRYA 3P1JA 3I2JA 3GLFB 4Y2PA 2CLOB 2MSWA 4CDNA 3MGAA 1KSFX 2D8AA 9ATCA 1FMLA 1WSBA 5JNVA 3DMYA 1V8DA 4G4IA 4DTCA 4IYRA 3PNPA 5BUQA 4QVGA 3P7MA 4B6RA 4RMNA 3WLHA 1NW3A 4F3NA 3OQBA 3DDCA 4ZGGA 2UU9B 3U7QB 3ICQB 4LOJA 4ZALA 1Z7YA 5KTRA 2YYYA 4GP9A 1SG0A 2VHQA 3D8UA 3OJFA 5CH8A 1L0BA 2EARA 3PGMA 3MUEA 2D5LA 3ZVNA 2JL1A 3FPBA 3W1EA 1KPIA 2HUPA 2H2HA 2J09A 3GWGA 4GI7A 4C4XA 1AB6A 1AT1A 1Z2NX 2IHTA 2YXBA 3CF2A 3V9PA 2VZEA 4CT4B 3AERB 3K7EA 1NNEA 1KWGA 4QLAA 4LXIA 4A6EA 1TQ4A 4QAQA 5J47A 4L8GA 2NVBA 4I50A 1X14A 2CEAA 1CQIA 1XHLA 2C7BA 3D5QA 2L17A 3IERA 4FU0A 1P0PA 4HSEA 5E6RA 4RQTA 1JF8A 1GA1A 3MHPA 4J07A 4LZWA 4E2YA 5K8JB 3IMFA 1PZXA 3OZVA 3B52X 4HQRA 3AU8A 1G20E 3RU9A 4E21A 2ZXUA 4FN4A 2HK6A 2H1CA 1FL9A 1UK8A 1R0BA 1HLPA 1YQGA 5DHQA 4DB4A 4W8HA 4O4HA 1U8FO 4B35A 1R4AA 1S2NA 1TVKB 1LTHR 1E58A 4DB2A 1OTHA 1UBSB 2NTNA 3NETA 2I2BA 3R41A 4I3GA 5EYPB 3VR5D 3C15C 3TQHA 1R16A 2VJBA 1GLGA 2V7PA 3BRSA 4D74A 4C6SA 3W6NA 4DR6B 3UFBA 4KPUB 3QTLA 2VK1A 4IDOA 4UFPA 4JSRA 4G1BA 4NCAA 1G21E 4IUDS 2H0AA 1MX9A 1JDSA 5IHXA 1SKYB 3HQ4O 3MS4A 4OMDA 4PG5A 1SK8A 3BMXA 2OESA 2RBEA 3JATA 2GEFA 3PYXA 2VDWA 3UAVA 3OF3A 3LY5A 4D92A 4B3CA 3KWJA 4OHBA 1Y7PA 1UKCA 4DLPA 4GZ3A 1C9NA 1M1UA 1ESNA 3PNOA 1CQPA 3PT5A 4RF2A 4EO7A 1U0HC 3TPZA 4N03A 1RYHA 1TC2A 1K9SA 1U5BA 5HJ7A 3CVXA 3LNCA 3E27A 5DOZA 4LHYA 3HCCA 4R2LA 4FX2A 1SKMA 2C29D 3RU3A 1IB6A 1NRWA 1VL5A 2XB2A 4ICIA 2C2WA 1U2RA 4MA5A 4N5MA 2WFLB 3WLTA 4DMMA 4DUGD 5FH9A 3GRYA 3DB1A 2WUVA 1BX1A 4BUJA 5CCEA 5LP6C 2YXLA 2ZM5A 1DV1A 2WHPB 2IPXA 3U16A 5SY6A 3KQKA 1NPTO 2HLDD 5IZCC 3WRYA 1O94A 4F72A 1N2CA 1A3CA 2XRFA 4D02A 4XD2A 1JU3A 3GEMA 2DBVO 3I61A 1ZK3A 3O47A 3G88A 2PKQO 2ZSUA 3QPBA 3TW4A 5FWXB 2MSDB 1F8FA 2F2TA 3CZCA 2NU9B 3X2SA 3KZMA 3AM5A 5C5CA 1TPZA 2A0FA 2IOHA 3UAYA 4E94A 3BD8A 3UC9A 4US1R 3GYBA 1FCJA 3NAGA 4Q1CA 2A9VA 2HXSA 4X95A 3R44A 1GNRA 3RUHA 1FDOA 1ZGCA 3DBOB 5CLQA 4ATNA 4BNGA 1MIOA 3DXZA 3NBQA 1GR1A 2HZ7A 2YVKA 1ZO8A 4PLYA 2WUDA 4RZHA 4KPFC 1IONA 2EW8A 4DSZA 5KYYB 1PG5A 1RZRD 3K30A 4MYCA 3D0OA 1C8LA 5IT4A 3K4PA 1H2AS 4MAFA 2QG9A 2W00A 5F1YA 3PRKE 4Z0HO 3S7ZA 2Y9MB 4D42A 4DG8A 3KPYA 1T24A 5FADA 1XCGB 2I5PO 2NAFA 2CCJA 2PO5A 2ZSEA 3LQFA 3KO8A 4DC1A 5DN6D 4TYMA 4KAXA 4LXHA 4H3HB 1CQZA 1NNUA 1XTTA 1V16A 1OVGA 2D4HA 3ZWDA 2XZOA 3A6HA 5D7NA 3UXMA 1NQWA 1YR2A 2BEJA 3K05A 3K4HA 4IOKA 1P7PA 1UZAA 5INTA 3WMFA 4KI0A 5IF9A 2HPZA 2PS3A 3C1TA 3X44A 5JJIA 2P68A 4AMGA 3DLBA 4JU9A 4HG2A 1I51A 4RV5A 1JQBA 4MI9A 4JT4A 1G5PA 1FK8A 3O8OA 4OTZA 1OXMA 1I94B 1A5TA 2FFRA 4JJAA 5DMXA 4CF6A 3QOYA 2I1QA 4ND7A 1DELA 2RHBA 3I92A 2R97A 2Y1LA 2MR6A 3N6XA 5K8VA 1M7BA 4BKMA 4JQCA 4RMIA 3S5UA 4AKEA 4P54A 5ITZB 3JQFA 4JYPA 1W2WB 3UH0A 3QEBZ 3AVUA 2PFGA 2W4IA 4NMMA 4J1SA 2HRBA 1I2BA 3KT8A 1Y8RA 4KK3A 4WKGA 3ITKA 4RY0A 4PLHA 3W9UA 4ZANA 5EUMA 2C61A 3WMWA 1OA0A 2ASVA 3BAFA 3VTAA 3O91A 3KXKA 4V0MA 2IGTA 4LGYA 1BS1A 4CKZA 3RSOA 5FULA 3H2JA 4B7UA 1JTEA 3JPYA 3SPXA 2Q1TA 1RXWA 2R5FA 1DBIA 3NBZC 2QLTA 4JP1A 4AMBA 2J5QA 1L7EA 3EEQA 3IP8A 4PQGA 3ZY6A 2Q0SA 4LYGA 4TRNA 5BMVF 4OKNA 4INPA 3CY6A 4QXQA 3ULKA 3RU7A 5HIAA 4M0EA 1JDUA 1GPUA 4M88A 4DCSA 1VL2A 1C5KA 1Z4JA 521PA 4N0DA 3QY0A 3N59A 4QTZA 1KI9A 4D8WA 2CLLB 2H1LA 3CZ4A 1N6IA 1E5VA 4LC9A 1KRXA 3UKDA 2C1XA 2VPYA 3IBCA 1A8SA 2Q62A 4Y2QA 5DGTA 1MDFA 4R5HA 2ODNA 3BMQA 1KI4A 3DAOA 1QOPB 2BFAA 2YINC 2B35A 5J2UF 3RVDA 2DP4E 5TPWA 1G63A 1Y9AA 1DV2A 4TV8B 5EHNA 4H0NA 1O94C 4MR8B 1T2FA 2HKIA 3B7GA 3EAFA 3N86A 4HGPA 2JC3A 3A4VA 2VTVA 4PAGA 4XLZA 2AJLI 2B8TA 3ZNQA 5K0ZA 2ZWMA 1XG5A 5IYZF 3NR2A 1DADA 3RK0A 1W0JD 3TZHA 1K75A 3H1GA 4B4WA 2OAQ1 2DPLA 2HIGA 3PNVA 4HEA6 4DNOA 2P8JA 2WQ6A 4BECA 2RAPA 4NBLA 2JIQA 4P7BA 5LPNA 4W6QA 3KOZA 4G1VA 4BPRA 1RAFA 1ZESA 3OOYA 8OHMA 1K7YA 3IC5A 1DWQA 4NMLA 4U7PB 1IHYA 1XZEA 4HNGA 4H17A 3EGWA 1XN4A 2INGX 4BX3A 1U7PA 2PAAA 3DAFA 2Q3LA 4JENA 4KDEA 5DNUA 4J0KA 4Y2GA 2AMFA 2LCIA 4Y0VA 3RGWS 1Z16A 2VJMA 3PE6A 5A9RA 3E1KA 1M72A 1LX6A 3IA2A 2AOTA 2XKJE 4BX8A 5DLEA 1YHZA 1RJWA 3AUUA 3ASYA 3IUSA 1R8QA 4MUAA 1PUIA 3ABIA 3RS8A 3WB1A 4BMPB 3ZWMA 2DVMA 4QXOA 1VM6A 2EGUA 2EEPA 3J81k 2QX4A 5CFQA 1GGEA 3A4YA 5B2EA 2PHZA 3MB5A 4EI7A 1M10A 2DWOA 3X1ZA 4TYNA 5F5LA 1MOZA 2VAWA 3NORA 2XVMA 4PBRA 1C7QA 3H5RA 2OAP1 3OCWA 4ARBA 3K0BA 4ER7A 3OBBA 4NFYA 4BLTA 3G8CA 1VL0A 3TTYA 1L9KA 5IS2A 1IRXA 4R51A 3BB3A 3VMMA 1WETA 3RC8A 2FI1A 1YD7A 2IYTA 4IQFA 4OHCA 4PSVA 5CYPA 4G0OA 2W2QA 3V32A 1GTSA 5HA5A 4V0NA 3FCXA 3CB2A 3MOGA 3NT5A 3NOXA 5FPTA 1Z4PX 4HNSA 1EFVA 4WHMA 3W7BA 1HK7A 4EI9A 5G3YA 2NP7A 2DQZA 2BFFB 2PQ2A 5FV4A 3QLVC 4CQLA 5AJYA 4L0QA 4Y3UA 3GROA 3QUTA 1RACA 1C0PA 2IYQA 3O93A 4O5OA 3I01M 3DLCA 4WIAA 5G2OA 2BMJA 3RS4A 1V8PA 3DOHA 2B4AA 4MRAA 3T94A 2I6QA 4RTSA 6REQB 1IBCA 2P3SA 2EGGA 3EUFA 2O54A 4MW0A 1MX1A 2Q6OA 4FEGA 4XQ0A 5EPOA 3AVWA 1THTA 4EDFA 1SQ0A 1E98A 2OV8A 2NQ2C 2Z5FA 3PB3A 5EPUA 4ZI2A 4BE9A 3HTXA 5FOQA 4F9FA 4Q1VA 5HFNA 3CPHA 1J8FA 3LX8A 2JGKA 3FOZA 4GOJA 5LQKA 2C82A 3G17A 4OX9Y 2BFMA 1J8MF 2ZVPX 4RWEA 4R1QA 5IKOA 4BO9A 1BEZA 5FA5A 2KX7A 3KKKA 4YRSA 4U2BA 4N5LA 4OK3A 1DKOA 4D8YA 4K9QA 2BDUA 4IFBA 4EA6A 2CFSA 1R4NB 3JD1A 4Y7DA 3GUHA 5TB5A 5CB4B 1TVCA 2O07A 3AW9A 2XVYA 2DUMA 1KY3A 2DF8A 3EYWA 3FAKA 1U1EA 3F6EX 3IKJA 4ZGWA 2IOFK 3DFIA 5AK6A 5C51B 1E7WA 3DEJA 4RK7A 3V8NA 4M0PA 2IJGX 2EWMA 1XMQB 5BWCA 2QVCA 3ESXA 1RI3A 4ZEWA 3MRTA 1II0A 4R0NA 1NVAA 1U1GA 1FSGA 1OBCA 4WFKA 2F67A 1KEKA 2YS6A 1USIA 1A97A 1ZMXA 1FQKA 2WFLA 3CXUA 3DE2X 1K89A 2XXAB 4K1XA 4ZREA 4L8WB 4YCBA 3BIJA 5KCMA 5KOJB 1X7WA 1DC3A 1FDIA 1C3XA 2H57A 3FWPA 4MUXA 1BMDA 3EVTA 4LVOA 4K46A 2FMFA 2FPGA 3LL4A 3GFSA 1BDJA 1Z4OA 3QH4A 5AVVA 4ZJPA 3Q8WA 4AQYB 4GI2A 4QEDA 3MBKA 4CM4A 1U0FA 4UKDA 1VB3A 4QSHA 1T5IA 4ECAA 4F2GA 3HJBA 4FFSA 1JE1A 1ZN8A 4P5DA 4L95C 3EIFA 1G1MA 1ODIA 1DXOA 3HLTA 1BW9A 5CNJA 5EP2A 3UMRA 3UT0A 5IEJA 4BC1A 3HK2A 4MMXB 4M9RA 2DFTA 3AFIA 3TEJA 4TKUA 1ORIA 1T0IA 5BOSB 4DZRA 1WF6A 1DP4A 2I6SA 3HNOA 5BYJA 3TLZA 3DOUA 4CG3A 1WRBA 3PQ5A 3NHFA 5FL7A 1NP6A 1VIDA 4C7OA 2VIIA 4OHKA 5KJ1A 2WG0A 2BSXA 1DAGA 4DHEA 2VHEA 1KYVA 2GGSA 4R3UC 1ND5A 4PG8A 4MDEA 5JYCA 4GPIB 4IIGA 4EIWA 2PUBA 3I1FA 1YTUA 2HJVA 3GT3A 3INRA 3M5CA 4LYHA 1MFPA 1ANKA 1MAVA 1EB8A 2WHXA 3C8HA 3AR5A 3NBAA 4ND5A 4KYVA 5T8KC 2Q7DA 3TE6A 4BGDA 3DYBA 3H1EA 3QFTA 5HZKA 1E8NA 2VNKA 1YNSA 4LJ5A 4DREA 1VMDA 2MYTA 1MVLA 3C1AA 4OQMA 3W05A 2PKCA 1J0CA 1PFYA 3ZQ6A 3CNNA 4OJKA 5FTJA 1Z0UA 2R8OA 2IBSA 3M2PA 3KJZA 2EQAA 4MWSA 1E18A 5AKKA 3C5WP 2H8GA 1KOGA 2CKMA 3FUCA 3N8NA 1ZIPA 3HB1A 2B21A 3DR3A 1RAIA 4MRRA 4XWGA 5ILGA 1TPYA 1A8HA 3C3XA 4FZJA 2QRVA 2B78A 4U5QA 2BFBB 3STYA 4DM4A 4EQZA 4RE6A 1UBCA 3D4PA 3IXQA 3QQ5A 2QTZA 1E7SA 2F3PA 2AX3A 2VZ9A 2C7VA 2I3DA 4QNRA 2LDBA 3LV8A 1C41A 1CY4A 1YJBA 3B70A 4GLBA 1BMTA 1U0NA 2WHQA 4EVRA 1NURA 1BD4A 1EP9A 1SUDA 1G17A 2BGKA 4MV8A 5KPDA 3KQUA 2GJAA 3ZV6A 3FPKA 3FVRA 5COBA 3TDNA 4TVBA 5J4HA 2QRKA 1XXLA 4HNHA 1C4XA 2ZULA 3G85A 4Q1FA 1IN5A 4KUGA 1WPGA 4ZRDA 4IWXA 5L7YA 4C87A 2CYBA 4BX2A 3OJCA 4C2UA 3U1TA 1Z3CA 1CRPA 1WD7A 3SZGA 2IDZA 2JHFA 4GRDA 1FMFA 2HYDA 3WAKA 5B3LA 1YFJA 1VKHA 3H0CA 5LP1A 4X20B 1A96A 4D0LB 3CO5A 2I29A 5BW5A 3V5NA 1NOKA 2IT1A 3N2YA 1QH1B 3NC0C 3AHIA 2B4TO 1MB0A 5KJCA 5MN6A 5LLSA 1FFWA 3SHWA 1KJIA 4CODB 1KP3A 3D4IA 3K5IA 1FXWA 4L02A 3W4IA 2Z4RA 3KAQA 3GUZA 3NKFA 2FLVA 3CUVA 4P3XA 7GPBA 5KTMA 5CIYA 3DZFA 2P2ZA 4C4YA 3L02A 3OJXA 4FDTA 4C03A 3BSYA 4WH0A 4QUEA 2DU8A 2EU8A 5J1TB 2GMWA 4U7FA 4GI5A 3GNQA 1ZJYA 1Z8HA 1I36A 1P1JA 2IYUA 1CF9A 4HTAA 4M1YA 2G6TA 4I08A 5AR1A 1GNLA 4CU2A 4X1YA 3PITA 3BXFA 3H5TA 3OWOA 4HWOA 4MAAA 3WLPA 2IIBA 4G97A 3PKIA 2QUBA 2AFIE 2MSCB 3TQSA 3COPA 4ESOA 2EJBA 1EUDA 4MULA 2Q5JA 3BK7A 4UW9A 1Y8QA 2FR0A 3COYA 1JUDA 2GXSA 4B47A 5JJCA 3WLMA 2W2XA 2HRRA 1PR3A 3THYA 4JUDX 2PSJA 3R6DA 1Q84A 3ZUPA 5FCDA 3U6BA 3ZDBA 4P7KA 4ASUD 3R4VA 3BJEA 2XVXA 1D07A 4LVUA 2CL0X 4M89A 5B1HA 1CQJB 3Q8MA 1T36A 2WRZA 3R24A 3K2BA 2B7LA 5BMOA 1OSNA 4K9OA 3L1UA 3W3AH 1ZMOA 3DCIA 1TQHA 3IQZA 2ZS8A 1H69A 3BWYA 2G28A 3X1MA 1GCIA 4EO9A 2EW2A 2A5JA 3EA5A 3AUKA 1X7ZA 1NQUA 3GPCA 1M2OB 4J43A 2K2WA 2WUFA 4Q34A 4D26A 1U8CB 2DZDA 3D7LA 3ZWKA 2FVYA 3IULA 5KWEA 1XYYA 2Y4NA 4LBYA 2ZQYA 2IP2A 4XUEA 2MSKA 4QDUA 2J1LA 2PJZA 1BYIA 3L1HA 1C7RA 2G5PA 3FG9A 1IAVA 4A2CA 3HSSA 3F9CA 1C8BA 3USZA 1KH2A 3RYFB 3AF6A 1BA2A 2FUKA 3KQYA 4FCTA 3RVPA 8AT1A 3OA2A 2TYSB 1VHTA 3PUYA 3F3YA 4KV9A 5TMDA 1FRZA 1T1RA 1BN7A 5FBQB 1E2QA 3JVIA 2GCIA 4V0SA 4OFWA 2AFIB 3T35A 3DQZA 2SKEA 4MRMA 2O2SA 4HGRA 5ALDA 2FMUA 1M2VA 4MO9A 2X9GA 3DMNA 5AM0A 4F97A 4HBZA 4CG2A 5DASA 1CS0A 1TAGA 2GR9A 3D2AA 3HVUA 4LOAA 3SJBA 3ZHCA 4A26A 4F56A 2B8EA 4B3BA 1GUZA 4BEBA 4S1TA 5FP0A 3OX1A 5HQ3B 2H1VA 3M4NA 2Z1DA 2NVWA 3KDPA 3SZLA 4YAKA 1QIMA 5EIBD 2HUNA 5JQGA 5DTIA 2BGUA 2V9PA 2XMQA 3FGOA 3HYTA 3WGUA 4QUKA 4DUYB 3E3AA 2HLPA 4NV1A 2QAJA 3AF2A 4HX2A 1GQFA 3RSFA 1IOVA 3IEIA 5I8WA 4RKYA 2UVPA 3QFHA 5B30A 1IHXA 3GFFA 3LP8A 1K5GA 1XBTA 2XEDA 4H6WA 2ZZKA 4K81B 3UJ6A 4XPIA 5LMZA 4S04A 1FF9A 1LDMA 3QP9A 1NJ8A 3DMDA 4KQXA 2AG1A 3NRJA 1G6KA 3U09A 2QA5A 3OP4A 2OHIA 5KZMB 4E2WA 2B92A 2CVHA 1H8HA 3MRXA 1HKUA 2C2BA 1Y5MA 4K9DA 5DX8A 5FPPA 1YI0A 2V7WA 2WG2A 1QLWA 2BKAA 3BBPA 1TKAA 3DAGA 1A2BA 1U94A 5HK8A 3S2UA 5B1EA 3QSYA 1KSGA 1IIBA 5E6SA 4QOGA 4U6QA 1PGJA 5JXGA 3ZQKA 4GC9A 1SURA 1NW7A 1O8BA 1ESMA 3EQ9A 1QVWA 3EGOA 4MUJA 4NJMA 2WJGA 4A5SA 1CW2B 2P75A 5D3ZA 4IVRA 2C5SA 5K5EA 2B37A 3HA7A 1QIIA 3TZKA 4MS1B 2XB9A 1LGYA 1MEEA 4LY6A 4PC3A 4G84A 5CYFA 4LF5B 3ZGNA 1TIKA 4X64B 1QIGA 4MVJP 5EJ6A 1XEWX 2JD2A 4UEKA 1V48A 3C5VA 4GGMX 4NDNE 4QT0A 4WZBA 3K15A 1U6JA 4G5RA 3B6JA 4XFDA 4AICA 4FZ3A 2CNBA 2Y92A 2QAIA 3L8DA 2BPOA 1ZK2A 2H92A 4JVMA 5T4EA 4EKGA 2AQIA 2IZ6A 5JS8A 1R3UA 4YAFA 1BVUA 3WVNA 2EKPA 2PJDA 4AJ9A 3K5HA 1OYOA 4DYDA 5ALXA 1GV0A 1OLOA 1XAIA 1NT2A 1UC5B 2O0HA 2X3YA 3AHFA 4GOKA 5AKIA 2C4UA 2P0YA 5ICFA 5IJ9A 1E3SA 3ABOB 3E1GA 4D25A 4RJ2A 4NHOA 1XDSA 1M2EA 4LHEA 2E3JA 3W6UA 4AB1A 2H2FA 1DBRA 5BN1A 2C9DA 2O0MA 3AY0A 4ZDKA 2AMJA 3GYGA 1ZA1A 3MCWA 1WE2A 4DVGA 1Y98A 421PA 2XIJA 4D82A 1CUHA 1XLTA 3K20A 4ID9A 1P5FA 4MW1A 3TMAA 2DBZA 3P9XA 4GICA 1DHRA 2X3UA 3B9BA 4L2IB 1F0KA 1SULA 3KZVA 5KIAA 4RIIA 1TFUA 1GY8A 2GD2A 5IC4A 2F1IA 1GZUA 3NALA 5DIFA 4EF4A 1RJ9B 2G9RA 2V0CA 1U04A 2AQ8A 1DCKA 3BWVA 3FTPA 5DMHA 3UATA 1GAJA 1GZ6A 3WGOA 4HR7A 4NCHA 4NBKA 5IKMA 5AKXA 3GQBA 2YFHA 1G7CA 2IXAA 3OZEA 5FORA 5AI0A 3T4PA 3H5LA 1SZJG 1DQRA 2G67A 1OJLA 1LZKA 1YCHA 2QX6A 3K53A 4HH0A 3LHIA 4X90A 5KVCA 5CBPA 4E1AA 5JZBA 2HHHB 4PZ9A 5LIRA 1ORRA 1Q91A 2XT6A 3WLSA 4BP8A 2RSLA 2DUWA 5KX5A 4ZOCA 4TKVB 3SYKA 2O3RA 3OKCA 4JC0A 3TSZA 4RTOA 5BV1A 2H1OA 4Y6GB 1AV7A 2PBZA 1GQQA 3NRBA 1QCYA 1JT2A 2ZJ7A 2QVYX 4NWIA 2YMMA 1CD5A 3MUOA 4B32A 1G1AA 1DOZA 1I7PA 4ZYYA 1TW2A 1IUKA 2D0OB 2PA3A 2NPOA 2YNMD 3QEAZ 1VJGA 2TMDA 1EG7A 1BEEA 4IDQA 4QWWA 1G2OA 1QP8A 1URPA 4KMMA 1U65A 3IEUA 3KG2A 3VKVA 4EEKA 2EG9A 5THXA 3VNAA 3W5BA 1C0KA 1KBZA 1U6KA 2CVZA 5FFFA 3TZ6A 3K0HA 1WDLA 1L7MA 3IQIX 3ZY5A 3UJBA 2ACVA 2KI5A 3IS3A 2O5RA 3K31A 3K92A 2WWTA 3PKZA 4Q9DA 4UFOA 2GILA 5EQTA 4ABYA 3D8HA 1XRPA 2WWIA 3KE8A 3MGGA 1XRQA 3W04A 2WSBA 1N25A 1U2QA 1USVA 2DECA 4R2XA 3S68A 4LGCA 3PFWO 4UU8A 1M6WA 1E1CA 4JUCA 3ZYZA 4JYAB 4E11A 4F93B 1T3TA 2ZGVA 4BGVA 5I7WA 4F8JA 4HCJA 4NC9A 3CNHA 1OF1A 2JI4A 3OMWA 1DPGA 5DCYA 3K70C 3AONB 3CMMA 4W9RA 4X6UA 1H4QA 3ZY4A 1YF3A 4KFCA 2GKGA 2FSVC 1N6NA 3KUCA 3JQ8B 2JRCA 3V8PA 1FUIA 5A4MS 3I37X 3E03A 5BNFA 3CLRC 3RSLA 5ESWA 1GPDG 1S2MA 2WDZA 4OGKA 5E1OA 3O4FA 4B7AA 4LMPA 1XZPA 5DX0A 4QM6A 4XWAA 3LBHA 2MTBA 4RLFA 1R0CA 2ZBPA 1WOMA 1MHPA 2GHRA 1MCZA 2A35A 1U2EA 3LGAA 3QLTA 4OHPA 2AJCA 4ZZ0A 2EKLA 3GN1A 2ZT8A 3ISTA 5C0OE 1KQ3A 4RK5A 1O4VA 3H2GA 1PUXA 1EUDB 2JBWA 4BE4A 3TTWA 5IJ0A 1R0YA 4DR4B 2FEXA 3NM5A 5JS7A 2DPGA 1Y34E 1SA0A 2NZ8A 2YWFA 3A4LA 3KSUA 2E18A 4QQKA 1EMDA 1XVUA 1VHJA 5ALVA 2I1VB 1GP2A 1MKYA 1NBMA 2FEOA 3P4XA 4YXWA 4K9NA 3V1MA 3VDRA 1NQAO 2ZIWB 4HJRA 4LJKA 4TSFD 3UJDA 3I04M 3QBDA 4KKXB 5P8WA 5IYZB 1D2NA 5K3FA 5KMGB 4G3XA 4UHBA 3QMPA 2FMHA 2RHDA 2J3IA 3GGPA 2BM8A 4LDPA 3EHEA 4MQFA 5G41A 5AIBA 4E5MA 5LXTF 4BX0A 1Q1GA 2PSFA 1AKMA 3LOQA 1EDEA 2XCTB 2JLSA 5H81A 1E1RD 1GPNA 3L92A 2JBAA 2JZNA 2QIOA 4FXPA 3VHLB 5JSYA 1KOLA 4RTKA 2R6DA 2I67A 4Q16A 3ZHQA 2WVHA 5CCBA 1T13A 2PZBA 5EP4A 2NN3C 1EESA 2BHTA 3KKMA 5AUQA 1VHLA 4JJZA 1PQWA 3K35A 4Q0MA 2ZIEA 5DLDA 2L82A 4DDWA 4YRNA 1MTOA 3R9IA 4G09A 4XPZA 5ICSA 1L1QA 2YH2A 3I32A 4Y6SA 4HRAA 4ZA2A 5FIUA 5JD5A 5LJLA 3FRHA 2BWJA 1LS6A 5DGHA 1JEAA 4RY8A 4Q7QA 1BIFA 3ELDA 1Z25A 2HK9A 3PCRB 4NCXA 2PUAA 3EOAI 1KGDA 4KQ2A 3IUBA 3K2EA 4RSGA 4LFCB 5AKJA 1WHTA 3PC8C 5KDDA 3RRBA 2ATCA 4GX0A 3WDSA 1T8SA 1VBKA 1EFAA 1HSZA 1FYVA 2ODQA 4PX5A 2I9KA 3L3BA 4EH1A 4FSDA 4MTCA 2X22A 3MT0A 1N6LA 3AUSA 1GEGA 4E6PA 3VHRA 5LQRA 2IXGA 4JJGA 1XI2A 3J7TA 3SC4A 5GTDA 4KSBA 5JASA 2GBIA 2GTIA 3FMIA 1Z4MA 4DBLC 3A2NA 1B74A 2TMYA 1IIRA 1T6YA 3FUTA 1RHMA 3KFXA 4OF4A 3HO8A 3FX2A 1ORWA 5CW1A 3T5MA 3GNTA 4KEAA 3C7DB 4A15A 4ZCTA 2E87A 2WWWA 4JLSA 1E8DA 1R9GA 4OSOA 1E2JA 1L7XA 3B2NA 4E14A 4LHZA 3C6KA 1S9HA 5F5XA 3QK7A 4BGUA 1SWVA 2OQRA 1E3MA 5JDIA 1F8GA 2SECE 2ZI5A 3K8YA 3LT2A 3LUAA 4JX8A 4ND2A 2CXXA 4OLJA 1I9CA 1RLMA 4IINA 2VDVE 1IPFA 3AC0A 4KWHA 2ZTHA 3ND7A 4WKCA 4B6SA 3O21A 4OYYA 2YBDA 3OC6A 2QUHA 2P2GA 2VHYA 2XTMA 3EGVA 4LQLA 1UFKA 3Q3GE 4LWZA 3ZVRA 3CB4A 2WZDA 4DVJA 4YJHA 1UDCA 4OXYA 3HFGA 1IE3A 4PZCA 4EPTA 5JALA 2A9JA 1ML3A 2NU6A 3VPBA 3T41A 1QQ6A 2C2OA 3DOJA 2D6FA 3PL5A 2YOFA 2PL3A 1ETUA 1XZAA 4LJRA 3G0GA 2EJCA 4UU7A 2VUIB 3IAM1 1ORTA 4LXYA 4OL9A 3SC3A 1F2TA 3IQHX 3OAAA 3SKXA 2VSQA 3MCUA 1CVIA 2YY7A 2CD7A 2F64A 5IKXA 4HLQB 2X58A 3D7MA 3KOOA 4QIHA 3WTCA 1N3YA 3ZE6A 1GIAA 2PRJA 3TTSA 5GADl 3WNBA 2VLBA 4B4UA 4ES6A 1ML4A 3GUUA 4DKJA 3KZ1E 5T57A 2AG8A 3N8IA 4MYDA 1JIJA 2CZCA 4EUNA 4LSWA 3LXUX 2DM6A 2DFKB 5E1DA 2B2XA 3HRKA 4FE3A 2QQEA 3B12A 4M1ZA 3MJHA 4TROA 4FEYA 4ARCA 4IMPA 1GRRA 4OYHA 3KLOA 1EYZA 1SXJA 2O2JA 3DKRA 1ZNQO 3PQEA 4YIKA 1MABA 1JIUA 3AX6A 3WZLA 1MB9A 2BEVB 4MVJI 1OR8A 3Q11A 2X7XA 1KS9A 2IIVA 3EXHC 3F6SA 1JSLA 3LUPA 3K1JA 4Q9LA 4G0WA 4B76A 2QN2A 2RHGB 2NM0A 2OZPA 2C4HA 5HE8A 4ND6A 3TCKA 2NZVG 5F52A 3GMSA 1X13A 3NJRA 3HCOA 2LGJA 2VF8A 3HYRA 2DFPA 3OQMA 1YAJA 5FDFA 3R75A 3BB4A 3PQ8A 1Q77A 1U99A 4G5QA 4LSGA 3DZJA 3WIBA 3M82A 4NK4A 2GLXA 3WRXA 4QAJA 2CT8A 1WY7A 1QRTA 3GMDA 4R6XA 1T36B 2G04A 1RRMA 2J48A 4KK4A 4Y2SA 2IHVA 2I76A 2BIFA 2P30A 3FSRA 2XUQA 1FC0A 4FWIB 2YXEA 2EX1A 4QYWA 4AZ3B 1DAFA 2P4QA 3WYNA 2OUIA 4DPKA 1J2YA 1DIRA 3A0RB 5AM2A 2KBEA 4N9WA 1AUQA 3T5BA 3U5ZB 2YW9A 1LQ2A 4X6XA 3M81A 3RIHA 3WGZA 4DW8A 2F9MA 2YY6A 2QLFA 3PU6A 4B2PA 4EI8A 1A2KC 2I66A 3O73A 3KUDA 3VTFA 1PLJA 4E88A 1MF7A 4BKOA 4BNIA 3EXFA 3S1AB 4D8XA 4F4UA 4YCSA 2WWXA 3B9PA 4RABA 5IT0A 3FVVA 5HK9A 5IM4A 1G98A 1I6KA 1V3UA 4GM1A 4KMSA 3R9XB 1L8XA 2A5YB 4D46A 2QRUA 2QY6A 1IG0A 3F6BX 3GCXA 1L7AA 1XE3A 4RD4A 4PPQA 4JUIA 5DTRA 2EG5A 4IEFB 2WG1A 5KOIA 3U13A 4BB5A 1ECCA 1YDHA 3UAOA 3ADBA 2BSQA 3ZX4A 4MWBA 3CUKA 5J4LA 1O4WA 1KMCA 1VMKA 1XYVA 2D2FA 1A76A 2M6SA 5AJZA 3H4IA 4BN5A 4G5HA 2XDQB 5LN1A 1VC2A 3B6IA 3PPXA 5LQNA 1IHDA 5FUVA 5FTWA 1XP8A 2F9FA 1QRSA 4QX6A 1V43A 3ZHZA 4JI7B 4YQZA 2ZW9A 5AVXA 2ERXA 1LPOA 3INNA 4QJ5A 2OHVA 1U9IC 3H11B 3P2IA 4O29A 1FQJA 3X1JA 4ZHQA 5BUCA 3HU5A 5L3SB 4C05A 2GTHA 4B2YA 1EVQA 4MWGA 2MJLA 4IW3B 1XRSB 1X74A 3HCRA 4HUTA 4MKHA 3Q0IA 1U1DA 4YJ3A 3EGIA 1QE0A 3ZHUA 3U7IA 5AVWA 1OJ7A 2Z2ZA 3ABSB 1OASA 1RPNA 1XMIA 2EDCA 2JCYA 1CZOA 3FBGA 4PLPA 1JLLA 1ZR4A 1Q0TA 2QUKA 1NNLA 3TKAA 1AQIA 1DFIA 3I39X 1JHYA 1XKLA 1VKNA 1HMYA 2VHVA 1KAMA 2AUMA 4GKKB 1D2CA 1N1DA 2B1IA 1TM2A 1SEPA 3O8QB 2FB9A 1Z2CA 1E3DA 3KBBA 4ZAFA 4B3JA 4M8LA 2VJKA 4XR9A 4CR8A 5C5IA 2FVXA 3HJTA 3JAKB 1IEWA 4I4TA 4JQSA 4RVCA 1SC9A 1P1BA 5CVDA 1QXSA 4WBNA 4RVFA 2HZBA 2QD1A 1B0UA 2ZBRA 2NSYA 4MV0A 4WEOA 1Y42X 3I9NA 2DFDA 1JB1A 2DQ4A 5EZ5A 3RC9A 4DJAA 4UHDA 2QE6A 1RYZA 2H85A 4N5HX 1HWYA 5TEVA 5I7OA 4PO9A 4QGGA 3QE9Y 1YS9A 2O1SA 4WBNB 5UKDA 4N6NA 3SQLA 3V8EA 4HVCA 1WCV1 4Y30A 3MAJA 2JGIA 3TDKA 2GYWA 3NC4A 1MR3F 1IQ0A 1PWZA 2W2KB 5C8XA 3AP1A 4LKRA 4NZOA 2NYVA 3RI3A 2R00C 4JI1B 1OGYA 4W63A 5IXYA 3KQMA 1XXHA 3FWZA 1G2PA 1PG2A 3AIOA 1JPUA 5BW6B 4J29A 5LQCA 5F9FA 2QE7D 2I22A 1NMYA 4PINA 3A6LA 4Y9UA 2ZIVB 3DT8A 2RC5A 5LCXA 2JLWA 5KUTA 2GF0A 2PX2A 4DXHA 3GD5A 2AW5A 4EELA 3SZRA 5AW7A 4B3RB 3H65A 1ZVJA 3U4DA 5FRDA 5CW2A 1N36B 1ZOSA 1X1RA 4L50A 1Z0DA 5FBLB 1G5FA 1H8EA 4JV5B 2VDKB 4JBGA 3I5YA 1DX6A 3OPNA 3GJRA 4BP3A 4CG0A 1GKKA 5AVYA 2F43A 5HGXA 3FFTA 3A3KA 1UDBA 1D2RA 2I33A 3INYA 3MS7A 1ZZGA 3E6AA 4HMQA 5LB2A 5H4GA 3QX3A 2NWQA 5KTPA 2NIPA 2WTEA 4MV1A 1NAHA 1LKZA 2MT9A 2XY4A 3FI9A 3QU4A 4IM7A 3FM9A 4MQBA 1GLVA 4WPGA 4GZ5A 3ZU6A 4PYRA 1GTRA 4UU0A 4G01B 3LK7A 3IL2A 4YMWA 4C0XA 3QFRA 4DLRA 2ATVA 1OX6A 2Q2QA 1U7ZA 2RKOA 3HNPA 5A62A 4BJ5A 4DT1A 2HAEA 1XWIA 1YT5A 4YRKA 4MIYA 1JSZA 2JKYA 4M21A 4OLHA 3O38A 5K4AA 1NP7A 2DKOA 4AYXA 4H4EA 4NZMA 1M75A 2IIQA 4X00A 3P0EA 4IVNA 1W36C 1Z5PA 2WLSA 4DNXA 1B8NA 1TEHA 4P33A 4TXLA 2CDBA 3TTXA 1KFBB 1N5LA 3GGGA 1QYXA 1ABFA 2HT1A 2EBFX 2VJLA 3L0IB 1Z47A 5GZ1A 4OSPA 1XTUA 1NWCA 4JEIA 1KEEA 1L5HA 2DHQA 5CG1A 3QBTA 4QGHA 1UOOA 1JNXX 3DW1X 3WQQA 1ODFA 1YKGA 1VIMA 3CW9A 2BVNA 4DSUA 3LPAA 4RA9A 1E79A 3NHWA 3R3JA 3GPLA