2C0CA

Structure of the mgc45594 gene product
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
353
structure length
353
Chain Sequence
GVDLGTENLYFQSMMQKLVVTRLSPNFREAVTLSRDCPVPLPGDGDLLVRNRFVGVNASDINYSAGRYDPSVKPPFDIGFEGIGEVVALGLSASARYTVGQAVAYMAPGSFAEYTVVPASIATPVPSVKPEYLTLLVSGTTAYISLKELGGLSEGKKVLVTAAAGGTGQFAMQLSKKAKCHVIGTCSSDEKSAFLKSLGCDRPINYKTEPVGTVLKQEYPEGVDVVYESVGGAMFDLAVDALATKGRLIVIGFISGYQTPTGLSPVKAGTLPAKLLKKSASVQGFFLNHYLSKYQAAMSHLLEMCVSGDLVCEVDLGDLSPEGRFTGLESIFRAVNYMYMGKNTGKIVVELPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords ZINC BINDING ALCOHOL DEHYDROGENASE, DOMAIN CONTAINING 2
publication title The Structure of Mgc45594 Gene Product
rcsb
source organism Homo sapiens
total genus 124
structure length 353
sequence length 353
chains with identical sequence B
ec nomenclature ec 1.3.1.48: 15-oxoprostaglandin 13-reductase.
pdb deposition date 2005-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2c0cA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2c0cA01
3NEPX 3Q0EA 2PZJA 4PG4A 4LK3A 4Q3EA 4CPDA 1A9YA 4O0LA 4RF5A 4L0QA 4UREA 4BS9A 3PZBA 4ESOA 3PFFA 5A5EA 1C1DA 2NVBA 3A1NA 5JLAA 1S7CA 3N58A 1HRDA 1GEEA 2PLAA 1VSVA 3ZN2A 1BG6A 1WAMA 1YOVB 4PG7A 3QWIA 2IRWA 1WDKA 2LDXA 2PH3A 3WYEA 1DPGA 2WMDA 3WNQA 2O2YA 4IDDA 1YKFA 2Z1MA 4J2HA 3WQQA 3OQ1A 5ENVA 4S1VA 1LEHA 4OQYA 3CXRA 4XYMA 1J4AA 1BTOA 3INGA 2JKVA 1R4MB 1ZK4A 3KLPX 4XQEA 3JYOA 3F6YA 1GUYA 4GI2A 1YS4A 1XQ1A 2ILTA 4PG8A 1ENOA 4UVGA 4W4TA 2O2SA 4RQUA 5DOVA 4PZCA 4XGNA 4GX1A 3BHIA 4N7RA 4WLUA 5G0TA 5A9RA 2ZYDA 4YXFA 4CMJA 2BMAA 3ASUA 4U0KA 2GF2A 5ER6A 2Z5LA 4NG5A 3M2TA 2ZCVA 4AJ1A 1JLLA 3HNPA 1NM5A 1H5QA 3FR8A 1JW9B 4NMHA 1FF9A 5F3RA 1NNUA 5KJ1A 3EAGA 3A9WA 3B20A 5DBFA 5L95A 3JQAD 2B35A 4RF3A 3VPSA 4B4UA 1BXZA 3KRTA 1P0CA 4J7UA 1K2WA 1DJQA 1XA0A 3MJSA 1FDUA 1XIVA 1X1TA 2PKQP 3HADA 2O4UX 2JHFA 3QWAA 1B26A 4PVCA 2FR1A 4INAA 4E5PA 1YL6A 2NQ8A 2CF6A 4CM9D 2DM6A 2IXAA 2IODA 1EUDA 1ONNA 2VWQA 5JCJD 3ETDA 1MP0A 4WNCA 2WDZA 2WD7B 4EGFA 4YJFB 3JD0A 3CTMA 4K6FA 4E6PA 4WLVA 1JA9A 5TT0A 2BLLA 3LZ6A 1WXDA 4ND5A 4CQMD 3WWYA 1U7TA 1MG5A 1JWBB 1UZLA 4MVJM 3WBBA 4R54A 3DFUA 3MOGA 3V5NA 4L76A 3K9QO 5FWNA 4KUEA 2R2GA 3RJ9A 5MDHA 5A03A 3U62A 3L0DA 1ZCJA 3DXFA 4LVCA 1Z7EA 4PZDA 5CHEA 4ZRMA 4KZPA 3ZV6A 1VL8A 3R6DA 2CF5A 3AI1A 4HFJA 1QV6A 4F46A 1YH3A 1VL6A 1ENZA 1EUCA 2X0JA 1YQXA 3O4RA 1RM4A 3EC7A 3R3SA 1WZEA 2O3RA 3WJ7A 4XB2A 1P1JA 4BKUA 2JAHA 4BGVA 3RFVA 4XDYA 4PRKA 5I9NA 5FF9A 4ZQEA 1BXGB 2BGKA 1YRLA 2D4AA 4UVEA 1V8BA 3Q2IA 4OHUA 2DPGA 3JQBC 5BNIA 5HA5A 5JYEA 3JYLA 1NFRA 3KYCA 1I2BA 4WK6A 1W6UA 4BGIA 3F5SA 5JO9A 2ZJ0A 3B6ZA 2BFAA 3GVXA 4IZHA 4NBWA 3IS3A 3BA1A 4NK4A 4IPTA 1X0XA 3ZU4A 2ZQZA 5IN5A 3L77A 1B0AA 1OZAA 1YGYA 3IUSA 4NIMA 2AQHA 1MC5A 1X0VA 1I3NA 4CMKA 3DBLB 1YJQA 3C24A 1WDMA 3K8ZA 1DFGA 3PDJA 2Y1FA 4CM5A 3WB9A 4M8SA 1ONOA 4CV1A 5KOIA 1BHSA 2BD0A 1XKQA 1ZSVA 1GEGA 4R69A 1R4MA 2CMDA 3LT0A 1E7QA 4D45A 3H3JA 4Z9YA 2YW9A 3WIEA 5I7SA 4AG3A 1H6DA 4R1UA 4HNHA 1M6WA 4R01A 4XQCA 2DFVA 2JCXA 1P1IA 1HEUA 3E03A 4IIVA 1C0PA 2PGLA 5THQA 1UAGA 4WCFC 4C7JA 4M49A 3EK2A 1RJWA 3VH3A 4J43A 3C7DB 2EV9A 2NACA 2NTVA 3OEYA 5B37A 2ZB3A 2Y66A 4QEDA 2Q1WA 5CPFA 2EWMA 5BNFA 3RC7A 4PGFA 4YA6A 3KYDA 4BO7A 1HT0A 4XWYA 4WLNA 2Q45A 3LU1A 4E4YA 4TQGA 3IL2A 3SVTA 5CFZA 2O3SA 4YCAA 3I4FA 3I9LA 5BSEA 1L7DA 5DZSA 3RFXA 2EKQA 1SCUA 4NDNE 5A3VA 1Q0HA 4YWJA 2PR2A 3LDHA 4NR0A 5H82A 3ROKA 4MINA 5JDIC 2NU8A 4RPJA 1P33A 4YAJA 3VTFA 5A4DA 5AXBA 2QZZA 1SNYA 2X8LA 1JDJA 2CDBA 4JK3A 4WKGA 4MPDA 5A5FA 3ZNOA 3FF4A 1PSDA 5TRTA 2J3JA 1KS9A 4DUPA 1Y6JA 4BNZA 1PGPA 3NDIA 2WD7A 3GHYA 4FSHA 2X22A 1VRWA 4XJSA 1DC3A 4Z3KA 4FIZA 4XCVA 1CWUA 3C8MA 5FI5A 4OGWA 1E77A 4KDFA 4XQ9A 3W8EA 1P0FA 4BB5A 5IF3A 3IMFA 3RVDA 1X13A 1ZNQO 5K6AA 2B83A 4MP6A 3PLRA 1JU9A 1PGNA 3TWOA 3NT5A 2HDHA 4M87A 2VUSA 1OC4A 1UZNA 5G4KB 1KEVA 5L40A 3DL2A 5IFLA 2XPCA 4BNGA 3QVTA 4YEDA 3GDGA 1YBMA 4WLFA 2I5PO 4N5MA 1M66A 2PFGA 3GVCA 4NZ9A 1JKJA 2FP4A 2DKNA 3IJPA 1U3TA 3QVXA 4RORA 4HUJA 1W4ZA 4WE3A 5G0WA 3NDRA 4RPLA 3HQ4O 4CQLB 4FFNA 4CM4B 4HFRA 7ADHA 5CAEA 4H3VA 1XSEA 1ZSYA 3W8FA 4LMRA 4XYEA 4EUHA 1RM5A 2Q4BA 2QYTA 4QTZA 3DZBA 4GMFA 1HSOA 5HRUA 1EE2A 3F4LA 3TF5A 3VHRA 4O5OA 4E30A 2GCGA 1DIRA 4W6ZA 2IE0A 1T2CA 4YT4A 3D3WB 1DXYA 4Z0TA 2I6TA 2H9IA 1GCOA 4AJ2A 1U3WA 3UFXA 1Y8RB 1PGQA 5DDIP 3CH6A 3V8BA 2R00A 5B4UA 1YO6A 3LC2O 1E7SA 1T1RA 1KVSA 1Z74A 3NV9A 3TZHA 5C7OO 4TWRA 1P3DA 3DEYX 3ZHZA 4JLWA 4WJZA 3KSDO 3TZQA 2NVUA 4RVGA 1DAPA 2B0JA 5ICMA 3ORFA 5L4LA 1HETA 2JHGA 3H2ZA 5DBGA 5ILGA 2XF8A 3JQBA 4B7UA 1I0ZA 1YB1A 2HRZA 3JQFC 1YVEI 4DWVA 5GZ1A 1N5DA 3LC7O 4OH1A 4BO0A 1PQUA 2RH4A 2EERA 4J1SA 1KOLA 1O94A 2JFHA 4LVUA 4ALKA 4F3YA 3OETA 2B5WA 1P44A 1H0KA 4BB6A 3F1KA 1ZKMA 3M6IA 2C29D 4LW8A 3WFIA 1PL8A 1XELA 4WLEA 3WYCA 2VQ3A 3KHUA 4Q3BA 2X0IA 5G4LA 4GWKA 1PZHA 1GD1O 2B36A 2V6GA 2OXIA 3GRKA 2O3TA 2GZ3A 3IDSA 1QG6A 4GX5A 5F21A 2Q2VA 4JNKA 1CQIA 2ZATA 2HMUA 2AA3A 1MFPA 3WMXA 1A5ZA 2G76A 1LLQA 4QUKA 1EEHA 2JFFA 5B1YA 1T2AA 3TRIA 4BNVA 8LDHA 2DUUA 3G1TA 4UUMA 2WEKA 1KERA 4CM1A 1H6AA 4Q9NA 1WNTA 4EBFA 3GZNB 4RO0A 4RVSA 3GMDA 1ZMOA 2NLOA 1TVEA 2Y1CA 3E6AA 1PWXA 3ZWCA 3STHA 5ES3A 1GPJA 3CZMA 3Q9NA 1D4FA 2EF1A 1E3LA 1ML3A 3T4EA 3HFGA 1ISFA 4GX2A 1SEVA 2ZKLA 5DOZA 4QO7A 5TQVA 5G4KA 4RVHA 4BV9A 3S2EA 1LC0A 3X2EA 4E32A 3VH1A 2PZLA 2QIOA 7MDHA 2PZKA 3DTTA 3QHAA 3AW9A 4PVDA 5BT9A 4TRNA 3W4KA 3PWSA 3GVHA 3JD1A 1LU9A 2W2KB 4UUPA 5DULA 5T64A 1BMDA 3K92A 2V7PA 4CR7A 3L4SO 3TZ6A 3AUSA 1C0LA 4NJOA 4CQLA 1ISJA 3JD3A 4DTIA 3Q11A 2IYPA 4CM4A 4CM9A 3D5TA 5JCXA 2Q4EA 2Q1TA 2XOXA 3DBVO 4OSPA 3CIFA 5L7YA 1WW8A 2VOEA 2VTEA 1KVUA 3Q3CA 3UW3A 4B4VA 4FFOA 3OHSX 1R4NA 1SO8A 1IY8A 3AY3A 2VZ9A 4YQYA 5CG2A 1MLDA 3KB6A 1B7GO 2V6FA 3AUTA 3PJGA 5JE8A 4PLHA 1AHHA 3GUCA 3L6DA 1LSOA 1Y8RA 3JQ9A 4DYDA 2WYVA 5KJEA 1NHGA 1YL5A 3FI9A 3WSVA 2VZ8A 2SCUA 1MC4A 2QX7A 2J5KA 3C1AA 4OM8A 1TT7A 3KSZO 1E7YA 2C54A 4IDFA 4LRSB 4E3ZA 4NQZA 1HE4A 3GN2A 4OO3A 3SLKA 1JAYA 5JAMA 3PYMA 4OXNA 4M89A 1Z7BA 1E92A 5CP8A 1OFGA 2UVDA 4BO8A 2G0TA 3CEAA 3G17A 1B3RA 1GZ3A 1LDEA 3HDHA 1BGVA 3ZZNA 4ROSA 2I65A 1SBYA 2YFHA 4DPKA 4A27A 4AJNA 5LCXA 5KVSA 4ND4A 3E9NA 3W6UA 3MTJA 3ROPA 1DBVO 4FD3A 3NGLA 1TLTA 1RM0A 1M76A 1J49A 2J5QA 2O7QA 2W4QA 2EJWA 4K28A 4R16A 4D3FA 3RBXA 3ANLA 4BKQA 4ZD6A 8ADHA 4JP3A 4HFNA 2H1SA 5EERA 5KVVA 1BWSA 3R0IA 3G49A 1HDXA 2OHXA 3AOEA 5KJ6A 4L73A 2A4KA 4OYRA 5IN4A 3P5SA 1U2GA 4GKVA 5DCYA 3PXXA 4O6VA 1A72A 3EHEA 1L1FA 1QLJA 2W90A 3BTVA 4W7IA 1ISGA 1JVSA 2CDCA 3KM0A 4WEOA 1UP4A 3E48A 1BXKA 4IMPA 1B3BA 5I7EA 1V9LA 1PJBA 2HJRA 2ZCUA 3DBRA 1DEHA 3GZNA 2WE7A 4FGSA 1E7WA 4B3JA 2DBRA 4KTVE 3DZKA 3EUWA 1DFHA 2O3UA 4GMGA 1LUAA 3IKTA 2GERA 3GGOA 4QX6A 2E48A 3EW7A 1EK5A 4J1QA 4BMSA 2ZIZA 3RIHA 4XDZA 3QV1A 4J0EA 2FR8A 3Q2KA 4X54A 1QXSA 3BMCB 4BNKA 1U5AA 1O8CA 4YJGA 4ZQHA 4IGEA 4H15A 5TLSA 2W2KA 1VPDA 2O23A 1UXIA 3DMTA 3ZNQA 2X7HA 1O6ZA 2E49A 2HO5A 3DB2A 1YE3A 2BF7A 4CODB 3OJFA 1T4DA 5KIAA 3UKOA 2GZ1A 3LC1O 1H2HA 4I9UA 4K9DA 1I2ZA 1K5HA 2P9CA 5HWSA 3ONEA 4S3MA 4L75A 1SC6A 4YRBA 5C37A 2EJVA 1KVTA 2ZB8A 2QG4A 4A7PA 1TI7A 3MZ0A 3FCOA 1UXGA 4K6CA 4HADA 3E9MA 3ZWXA 4ND1A 1A7AA 2JD2A 3FBGA 4GBJA 2NADA 4R1TA 1PGOA 3PHLA 3H7AA 1NX6A 4CM3A 5BNTA 1MG0A 1TXGA 4LCEA 1A4IA 2HAEA 4GH5A 1QYXA 2AQIA 2OMEA 4TKMA 1LC3A 5I7VA 3AY6A 3ANMA 4GWGA 3ZGYA 3DOOA 4M86A 1SOVA 2FHSA 4EYEA 1E7MA 3VZPA 5IZ4A 4J1TA 4PZEA 1NFQA 4N54A 1IHXA 2VUUA 3ON5A 4IM7A 3ZWVA 4BV8A 4WGGA 2JD1A 3RKUA 1I3LA 5F5NA 4R3NA 3DZIA 1YBAA 3CINA 2OBYA 5GY7A 4YRAA 3VVBA 2HSDA 3LVFO 4ONEA 1I2CA 2J3KA 1PJ3A 2GLXA 2OOSA 4Z0HO 1Y9AA 2QW8A 1AXEA 1C1XA 4IQGA 4AJLA 4DVJA 4E2ZA 4NNJA 3JQ8B 3RJ5A 2GPTA 5C3MA 1E3SA 4F45A 2D59A 3FNGA 1LLUA 4FFPA 1VM6A 2WYUA 4K26A 4CUKA 2WJPA 2RAFA 4A26A 1NWHA 2EEZA 4WPGA 2YQ4A 3MJ4A 1X14A 5TGDA 3U9LA 1ISHA 4OAQA 5BQFA 3MJEA 1XU9A 4J16A 1HLPA 1T26A 3DAPA 3M1AA 3U4CA 1IYZA 2I9PA 4AJEA 2CNBA 1AGNA 2YHIA 3QJ5A 4CMEA 3ZHYA 4NFYA 2FPPA 3ENKA 4NBRA 2RHRA 4W82A 4DLLA 4QFCA 3PJFA 4U7WA 2DAPA 1M67A 2J6IA 3PIIA 3UOGA 4E2YA 3JYQA 1U3VA 4JXKA 1BVRA 2G5CA 1VKOA 3VPHA 4BNYA 1GUZA 3ZWPA 3IQDB 3GY0A 3WQRA 1J0XO 3GDOA 1P1KA 3H2SA 3VDRA 4BHTA 2AE1A 5B4VA 1I3MA 3RBVA 3ADOA 3Q6IA 4ALLA 5JAIA 5B4TA 1R6DA 4NJMB 2P5UA 1Y9EA 2AE2A 4GQAA 2IDZA 4AJJA 4BNJA 2HMTA 3K30A 4L4SA 1QV7A 2JAPA 2A94A 1ARZA 1YB4A 1O89A 2CD9A 2B4QA 3RROA 4I9HA 5IJZA 4ZQFA 3SBOA 1VL0A 3FTNA 1ADGA 3MJVA 5T67A 2H6EA 4PLCA 4CL3A 2BGMA 1ONPA 3C3XA 2QQ5A 5EMHA 5EQFA 3P2OA 1ZH8A 2DTEA 3KTDA 5KVQA 1XGKA 3G0OA 2PD3A 3PWZA 3TL2A 5K6AC 5HS6A 4RGBA 5F5LA 1EBUA 2G82A 4IJUA 3DOCA 4IZIA 4Z9FA 2PD6A 1IULA 5AVOA 3RU9A 1ZFNA 2J5RA 4IBOA 2FSVA 3BTUA 4QSMA 1XYGA 1YQGA 3BMNB 5DBIA 4DRYA 5CG1A 3IIEA 4Y6PA 1PZGA 4MKRA 3DQPA 1F12A 1QORA 4DBVO 4N5LA 1U8XX 1NBOA 1EVIA 3FPLA 3GPIA 2IEDA 1P77A 4CM8A 5C7IO 4Z9XA 3NDJA 4KUGA 3ITDA 3ZI0A 2P2SA 2PZMA 3BMQA 3TNLA 4BO1A 3KZVA 2VWGA 3PLNA 3LLSA 1QYDA 4IS2A 5KKCA 2PGDA 2ZK7A 2VCYA 4BNLA 2QRJA 4I8XA 4XYBA 2FZEA 2Q1UA 2YHUA 3C85A 2W8ZA 3DZGA 5EINA 2RCYA 2B4RO 3IAHA 2C0CA 4E2WA 1F8FA 4YAKA 4TROA 3GGGA 4Y67A 4AJ4A 1YWGO 3TZKA 3PTZA 4MVJD 4ALIA 4JQCA 5G0SA 5IXSA 3DZJA 1LSSA 2R00C 1G0OA 4IDCA 4YB8A 3GDFA 1E3JA 1QRRA 4ZRNA 4Y98A 5G2OA 5AOVA 4MP3A 3UCEA 2X9GA 5EJ2A 3IP1A 1SZJG 5K0ZA 4YR9A 1KIFA 1LDYA 3WIDA 5HTOA 3AI3A 3GAFA 4XR9A 1A27A 2GYYA 4BKRA 1T4BA 1U4OA 2BFMA 4AVYA 4D79A 4YAGA 4RCVA 4CMGA 5L3ZA 5K1SA 1XEAA 2Y0CA 1LSUA 2UDPA 2HMWA 4KUHA 1ZSNA 4YJDA 1NAHA 1RM3A 4DQVA 5U4QA 4NFHA 3GF4A 3HDQA 3PPIA 2FZWA 3I23A 1PIWA 4B4OA 3NJ4A 1UXHA 1PS0A 1YOVA 2AW5A 2B69A 4YYZA 1B16A 1R37A 4CV2A 4ND3A 4E12A 4GVLA 4NJMA 4R68A 1E1KA 1Y5MA 4N18A 5EIOA 4NFSA 1X7DA 3FPCA 4BKOA 3UF0A 3HHPA 4LRTB 1T24A 3AU8A 2YDYA 4IGFA 3UUWA 5A3JA 4UVIA 4XZ3A 1EVJA 1FDSA 4P38A 1YJ8A 3OBBA 4DPMA 4OMUA 2JCYA 1VE9A 3QA9A 5KKAA 1LNQA 1GYQA 2EKLA 1LRLA 1H6BA 1Q0QA 4M54A 1R16A 3GH3A 4RLSA 3P19A 4N5NA 1QP8A 4IQ8A 5JSFA 3ZU2A 3NYWA 3HWRA 5DP2A 4BO5A 3JV7A 1PQWA 4EEXA 4JGBA 1WVGA 1RPNA 1WP4A 3LT4A 4TRMA 1Q7GA 2EKPA 3GZ4A 4OOFA 4M55A 2ZTVA 3E82A 2VNAA 4QXMA 1A71A 1BVUA 4BNFA 3D5QA 2Y99A 4D3SA 4BO4A 3GK3A 5A02A 3HN2A 4FOSA 5T5QA 4DXHA 3UGKA 1EDZA 3V1YA 5CEJA 3BMNA 2OZPA 4ALMA 4CR8A 2YV2A 4BNXA 3KXDA 2RIRA 1F14A 3EMKA 4KDEA 4JX8A 3LYLA 3UXYA 2BKAA 3WX0A 2D2IA 2C7GA 3FSRA 4R1SA 3I9KA 4U8GA 5CEEA 3RI3A 1H94A 3QRWA 4YJFA 1EMDA 3PGJA 1WMBA 3JYNA 2NUAA 4OSOA 3RQSA 4UULA 4BGEA 4BNNA 2CDAA 1CERA 3O03A 4CLHA 2WWRA 1IPFA 4J9VA 1I10A 1N92A 1PJQA 4WLOA 2C59A 4WCFB 2GN4A 3DHEA 4Q3DA 1FDWA 1M75A 2NTNA 4E13A 5JNLA 5HM8A 3H5AA 3JQ9C 3DZFA 1C14A 3K5PA 5C7LO 3UH1A 1PS8A 3I83A 1DIHA 1SOWA 2RHCA 3I5MA 5AXDA 3VPGA 2Q2WA 4L4RA 1GQYA 5ILOA 2A9FA 3RASA 3P2YA 2VHXA 3QE3A 4XJTA 5LDGA 2VZ0A 3S2FA 2UV8A 1NR7A 4KQWA 1BXGA 5U9CA 3GAZA 4MIOA 5IDYA 2DTXA 2O48X 4RVUA 1AXGA 1V35A 1ZXLA 3IUPA 1R12A 4BNWA 3L4BA 3OQBA 3VPXA 2TMGA 3WQSB 1VKNA 2G1UA 4IY1A 3TL3A 3VAZA 1QLHA 3RUEA 1LDGA 2FSSA 2LDBA 5EN4A 1ZK1A 2Y0EA 2OORA 4RDIA 1MX3A 2POQX 1I30A 1NQOA 1HDZA 4OQZA 3JQDA 4I08A 3DBLA 2VN8A 4Z6KA 2DC1A 3JQGB 4MKZA 4P4NA 5DCWA 1AE1A 2XXBA 2BFOA 5G0UA 2DVMA 4B3IA 1NFFA 3BXXA 4IJVA 3RC9A 3AOEC 3WGOA 1U5CA 4BMVA 5A06A 1KY5A 1FMCA 3AFMA 1AHIA 3N74A 4ZA2A 2BFPA 3WNVA 1IUKA 4A10A 1SEPA 4YACA 3UICA 3OJEA 3R1IA 5DNAA 1E3EA 2C5AA 1K89A 3DTYA 1UXKA 2E37A 3WGIA 2QHXA 1DIGA 1K3TA 5JW6A 1CJCA 2PY6A 5F1OA 2HMVA 1DLJA 4I9NA 4A5OA 3ZWNA 1LRJA 4QFDA 3AK4A 2CVOA 4TRJA 1QYWA 2PWZA 2B4TO 3IKVA 4PLVA 3MWEB 1NASA 1WMAA 3K96A 3ABIA 1EZ4A 3OFSA 4FFMA 5C5IA 2FRDA 4Z3DA 1X15A 5EPOA 4TKLA 4NHEA 4FPXA 5T57A 4GGOA 3PYLA 1QKIA 2TMDA 2O7SA 2NV6A 2P4HX 2VHVA 1HYGA 1E7RA 2O4CA 3GNQA 4H7PA 1LDNA 4XIJA 1HZZA 3DMTC 3OEWA 3I9JA 3K2BA 1I36A 4QT0A 2AEMA 3VZQA 2UYYA 2RBEA 4H16A 3GUYA 2X5JO 1NVTA 4ITUA 2P5YA 4U0JA 2C82A 3EVTA 2YYYA 3K2EA 2YQ5A 4BNHA 2X5OA 4CL8A 2CUKA 4YVFA 1F0YA 4BO6A 3KETA 2J3HA 4DLAA 3MJTA 2GO1A 4IMRA 4JJGA 3WXBA 4E0BA 4FBGA 4B7XA 5JDCA 1Y8QB 4ZVVA 5JC1A 3DBHB 1NPDA 3L07A 4WOKA 3JD2A 1UUFA 2GNAA 3QIVA 1KYQA 3NJ8A 2Z1NA 3PQDA 2I3AA 2Y1DA 4DREA 1A7KA 1B8VA 3DC2A 1NYTA 1PTJA 1YBVA 2VOJA 4KWHA 2X9VA 3QWHA 1E6WA 1QMGA 4CM6A 3PQEA 3OIDA 5JFOA 4XGIA 3H9UA 5ITVA 2XXJA 4BMNA 3PI7A 3SXPA 1KVRA 1HL3A 2UAGA 1F06A 1YL7A 3LF2A 1NQAO 5KWEA 1ORRA 1ADBA 2Q46A 3AUUA 4RPGA 4J9UE 1LLCA 2OP0A 3D1LA 3BTOA 4PRLA 1LJ8A 4UEJA 1EDOA 4EJMA 5IXYA 2YV3A 5ER9A 2EW8A 3CUKA 4R5HA 2Q49A 3D0OA 3TQHA 1FXSA 1GV1A 3D3WA 2JFGA 2PKRA 4CUZA 3UCXA 1GADO 2BGLA 4ZICA 4OXKA 3ZV4A 4A2CA 3RWBA 1Z6ZA 3U4IA 2DLDA 3F9IA 1P9LA 2DBVO 1AN9A 4MVJI 3HDJA 3EZLA 1MB4A 3KLMX 3PZRA 4MVJA 5JO0A 1KC3A 1UDAA 5L45A 3QY9A 3GFGA 3AFNA 1IZ9A 3GMSA 4LMPA 3ETGA 3ANNA 3H3FA 1SB9A 4F6CA 3N7UA 4R3WA 1PJLA 4CMEC 2NSDA 5I7FA 3WGTA 3D3EA 4GLLA 3COSA 1MV8A 4OKIA 3OQ6A 4CMCA 3DFZA 5ENDA 2FPIA 5HBRA 3A06A 1YDWA 3PWKA 1F8GA 2Y1OA 3FN4A 1NAIA 5A9SB 3AUAA 3BTSA 3ZU5A 2I66A 5ADHA 2HLPA 3A4VA 2UUOA 2ZTLA 1NVMB 5J23A 1LQTA 2V6MA 4MVJH 5L7WA 2EXXA 5GMOA 3H9JA 1GPDG 1OI7A 1RWBA 4IINA 4TSKA 2NU9A 3I9OA 4D3DA 2IZ1A 1DHRA 3H9GA 4OL9A 2IZ0A 3VKVA 1K6IA 1GZ6A 3TOXA 1R0LA 1OMOA 4II3A 1Z45A 2JJYA 5FI3A 3VDQA 9LDBA 5JMWA 3BHJA 3SJ7A 3WSWA 2VT3A 4DIFA 3B70A 4IUYA 3ADPA 3PP8A 3U5TA 5TC4A 3QQPA 4R9SA 3D4OA 1N2SA 4EITA 3ZCXA 2D3TA 2BI8A 4UAGA 4BNIA 2C07A 3LK7A 3NT4A 2P91A 3PIDA 4DBZA 3ZNPA 4RV9A 4CM7A 3NTRA 2ZYGA 2D0IA 4BNTA 2F1KA 3IOYA 3ZV3A 3PYXA 1Q7BA 1CEQA 2CSUA 3VC7A 1JKIA 1H6CA 1N9GB 1LDMA 4XKJA 3E5MA 1EBFA 1R66A 2OL4A 2D8AA 3G3EA 4BKPA 2ZTUA 3OM9A 2ZTMA 1TA4A 2FY8A 1D3AA 4XA8A 1NQTA 4HWKA 3A14A 5AYVA 1H9AA 1C1DB 2CZCA 4IDAA 1B2LA 3LT2A 1DC6A 3PVZA 4JBIA 1UXJA 3DAFA 4J1NA 4KP7A 1DC5A 1O5IA 5JS6A 3FD8A 1GTMA 1EVZA 2HJSA 1ZVMA 4E5YA 1ULUA 4IS3A 1ZMTA 1JAXA 3M2PA 5B12A 3PJDA 4NK5A 3E8XA 1HE2A 5BR7A 4AJIA 1K0UA 2PK3A 4FN4A 3IJRA 1B14A 4Q3CA 3HZZA 3WICA 1E1NA 4WCDA 1HF3A 4URFA 5JPIA 2EGHA 2CVQA 1HE5A 2DT5A 3FNHA 5CEFA 1UR5A 4GX0A 3GA0A 1IL0A 2HK8A 1DAOA 3DHNA 3BMOB 4HXYA 5TJHA 4Q3NA 1BDBA 2OFPA 3ZV5A 3NTQA 3VH2A 1UP7A 3WS7A 3WTCA 4I1IA 1JQBA 4BQPA 1U4SA 2E6UX 3CMCO 4MIYA 1TEHA 3E5RA 3D4NA 4MVJE 3KO8A 1MXHA 4RZHA 1EK6A 4PG6A 2VHZA 2CVZA 3ONFA 4PLPA 1GQQA 5JY6A 2E82A 3GHHA 2HK9A 4FCCA 1F17A 4DMMA 1I32A 4O59O 4W7HA 4RDHA 1GZ4A 1RKXA 3RFTA 4CLDA 2I99A 1PJSA 1V6AA 2Q2QA 2ZB4A 1DO8A 3SLGA 2FMUA 2NU6A 3LF1A 3P7MA 1SB8A 1DIAA 3FHLA 1KETA 4K1LA 4DA9A 4B8WA 2D1YA 4CLOB 2P68A 5A9SA 3V2UA 3H5NA 5CDGA 4FJ0A 3U4DA 2QRKA 1KVQA 1DSSG 3I6QA 4BO9A 4CR6A 4AJPA 4PLWA 1PX0A 4TZTA 2YV1A 4O1MA 1PJCA 3H8VA 1NWCA 4DL9A 4DC0A 3LT1A 1ENYA 4BVAA 3FR7A 3U0BA 4B3HA 2YUTA 1IE3A 4E5NA 3KSUA 4FOOA 4J6FA 3HDYA 2HUNA 1VJ0A 3CKYA 3H6KA 4Z0PA 3H9EO 2GASA 4E2XA 4UUOA 2VRCD 3OA2A 2OO5A 3JQCA 1XHLA 5F1PA 3MWDB 1ZEMA 4GAEA 4GGPA 4C4OA 3ZW8A 1CF2O 1KEUA 3I3OA 2IYOA 1I24A 3ST7A 1D1SA 4HFMA 4MKXA 3MJCA 2DUWA 1WDLA 5ITWA 5G0VA 2RH8A 1UJMA 2P4QA 3F5QA 1GFSA 3KOUA 4OOEA 2GZ2A 3QWFA 4CMIB 1MXFA 3AOGA 4JBHA 4EJ0A 4BO2A 2E4AA 1ZO8A 5MGBA 3WFJA 3G1UA 4QO8A 2D5CA 1ZK3A 4M1QA 4XEHA 1ZW1A 3BMCA 4E33A 1B15A 2I67A 4FW8A 1R15A 3DMYA 1LA2A 1RYEA 3H5RA 4QECA 1CIVA 5COAA 4EW6A 2H5LA 1CQJA 3KV3O 2VYNA 3UHAA 5THKA 3KYCB 4I5GA 1DHTA 1HWYA 4CLEA 1PJ2A 1L7EA 4YBZA 1HYEA 4B8ZA 3RUFA 2I76A 3WLEA 4AJOA 3INRA 2A92A 4YRDA 1ADCA 1H93A 2VYVA 4FGWA 5TF4A 1PWZA 2Y93A 1DRWA 3OIGA 5DCUA 5A05A 3T4XA 2QRLA 4L4XA 5LC1A 3PRJA 3B1KA 1GQ2A 3PHJA 4B4WA 3VTZA 3Q9UA 5FFFA 3L9WA 3DWFA 3GVIA 3TFQA 1WWKA 4GSLA 4ILKA 4EI2A 1CRWG 5EESA 3ZWBA 3BMOA 3SJUA 4J4BA 1T2EA 2GN9A 4RF2A 5FYDA 4E31A 4J4HA 5JBIA 4CV0A 5IDQA 6ADHA 3TSCA 4DGSA 1HXHA 1G0NA 3MCVA 4CLXA 1J6UA 2ZB7A 3RSHA 1H2BA 3EZYA 1EUZA 5IG2A 4YTEA 1N7HA 1W0CA 4GL4A 1W8DA 3RUIA 3E9QA 5IZCA 4RQTA 4E5KA 4C7KA 2PGJA 1T2DA 1ZZEA 3DR3A 1U7HA 4JP2A 3NGXA 1LXCA 3B1JA 3PHIA 3PGXA 4OIMA 5T8KA 3WGZA 4BNUA 3KYDB 3GNSA 1Q1NA 3EY4A 1TT5B 4P4LA 1I8TA 1GYRA 2YY7A 5TSDA 1NVGA 1V3VA 4PG5A 3AJRA 5KJFA 4MJLA 3S8MA 1LDBA 4JROA 4JN6B 4XB1A 3GG9A 3ETEA 3H9QA 3QSGA 4D44A 4NBTA 3WDSA 3JQ8A 4CLOA 3L4BC 3BAZA 2EW2A 2ET6A 4XYGA 5AXAA 1YQDA 1LBEA 3HG7A 1ULSA 1GYPA 1HDOA 2CFCA 3QVWA 1NPYA 1EFKA 4BIIA 3S2GA 4CMAA 4TRRA 1I5RA 4NU6A 3FTPA 1WPQA 1IZ0A 2J3IA 5K9ZA 3AWDA 3SC4A 3KEOA 1U3UA 3OF2A 4U5QA 1DRVA 3NKLA 3U09A 5CDUA 5KVCA 4JCOA 3ENNA 1YDEA 5BSHA 2ZQYA 1DLIA 5L7TA 4R1NA 1C3VA 3ZWAA 4YJHB 3WR5A 2VUTA 1NPTO 2JL1A 1DC4A 4MIEA 3DDNA 6LDHA 1IOLA 1O0SA 4RLHA 4KMSA 3O8QB 3TZCA 2NU7A 1U9JA 1ZXBA 2NQTA 1V3TA 3DOJA 4P22A 1ZEJA 4RF4A 1EVYA 2X86A 3SX2A 3DAGA 3OP4A 4CMIA 1ZUD1 3RU7A 3W4JA 3C1TA 2WTBA 4LISA 1EQUA 4J0FA 2AG5A 5AXCA 1GY8A 3HN7A 2AQ8A 5JXWA 2A35A 1X1EA 4B7CA 5KJCA 4GKBA 1GAEO 1R0SA 1DOHA 3JCZA 4TMFA 4RVFA 5DP1A 3ROQA 4KOAA 2V65A 3DO5A 1FDVA 3GQVA 1UAYA 2NM0A 4GVXA 4DIBA 3EYWA 2DBZA 4KTTE 4PIVA 3PJEA 3WGHA 3ZNNA 3TFOA 1ZK2A 2PA3A 3GG2A 2B37A 3F1LA 5I9MA 3K31A 4LSWA 5HS4A 2VWHA 2WM3A 4Y9DA 3NAQA 3KVOA 1B8UA 4B79A 2W2LD 2DTDA 3WTBA 1NP3A 2IEBA 2NVUB 2C20A 4JJFA 1EE9A 1PEDA 2BH9A 1SMKA 4PLYA 1HE3A 2VT2A 1XQ6A 1D7OA 4D0SA 2J8ZA 5JDCC 1LLDA 4XD2A 4CJXA 3HSKA 3QWBA 1X7HA 3VH4A 1DRUA 3GN1A 4HY3A 4L9RA 2GUGA 4OJNA 1Y1PA 3PEFA 5I9LA 4AICA 4CV3A 4XIYA 1P1RA 4GLOA 5KCZA 3V2HA 3GNTA 1BSVA 1YXMA 3OICA 2VRBA 5LDHA 3S2IA 3CSDA 1IHYA 3UN1A 4FFRA 4R9RA 4MOWA 4W99A 1R0KA 5CDYA 1XLTA 1AUPA 1T1SA 1ZBQA 2DBQA 4YT8A 2HK7A 1N1GA 5I8WA 2BRUA 2Y0DA 1N8KA 5T6BA 1TT5A 2VTDA 4MVJF 2G17A 1PJ4A 1V0JA 1XU7A 1YB5A 1M6HA 3BYZA 3PHHA 4ND2A 1WLYA 1PGJA 5H81A 2GR9A 2GD1O 3AU9A 4GSKA 3UVEA 3HB5X 4J3FA 4DLBA 1ZJZA 3BZUA 1M2WA 3MOIA 4J7CA 5COBA 1I3KA 3RC1A 4YDRA 3PQFA 1DIBA 4G65A 2PTGA 3OJLA 2AEFA 4MVJG 3ULKA 3B1FA 2V6BA 4J90A 3W6ZA 2X4GA 3PK0A 3G79A 3RBZA 1E1MA 1KEWA 4I5EA 1T25A 1O95A 1U1IA 3WJAA 2YZ7A 2PNFA 4PFJA 4P8RA 3E1KA 4HNGA 1C0KA 4WEQA 2NNLD 4RL6A 5F1KA 1JVBA 1HZJA 1BW9B 2YDXA 5H83A 5L4SA 2GN8A 4ZGWA 3D4PA 4DYVA 3GFBA 4YJHA 3WWZA 1GDHA 2EGGA 4WASA 1JKFA 1VJ1A 4WECA 1OOEA 3ZWWA 3ZWMA 3O8QA 4BQRA 1U2DA 3CE6A 2OBNA 3JQAB 1CETA 3KBOA 4MP8A 4IJWA 4G81A 4AJKA 1SPXA 1OBFO 5DN9A 4II2A 1QYCA 2D5AA 1O9BA 3RD5A 4BOYA 4CMHA 5JAQA 1DB3A 3ICPA 2FN7A 4YT5A 5JAZA 3I6IA 2P9EA 2O3JA 2PV7A 4YQZA 1ZIDA 3F46A 1NQ5A 1HLDA 3I9NA 2X9NA 1ID1A 2AQKA 4HKTA 3QLJA 1R4NB 3QW2A 4I5FA 1QYVA 1Z73A 1RYDA 2OUIA 1XR3A 4CQMB 4WOJA 4IXTA 4IIUA 1G6KA 2QYSA 3DHYA 1LX6A 1KC1A 3IP3A 3KUXA 3OH8A 4XQGA 3U49A 2NTJA 2VRCA 1PJTA 4U6QA 1KEPA 4JBGA 3HB4X 1GR0A 3AI2A 4P4GA 3GEMA 3WBFA 1U8FO 3AM4A 2QZ9A 4A03A 4BGUA 1MFZA 2WD8A 3GT0A 3OJOA 2B5VA 1X7GA 3L9XA 3RKRA 2GDZA 3GVPA 4FDAA 3V1TC 4NBVA 2EP7A 3NT2A 3GOHA 4PCVA 4D7AA 4DQUA 1CYDA 1GUFA 1G1AA 4ZHSA 2X1HA 1ENPA 2JD0A 3NUGA 4AFNA 2X6TA 3VOSA 3T7CA 2VYND 4ALNA 3F3SA 1Q0LA 4FJ2A 4PN3A 2PKQO 3R3JA 4D0RA 1U28A 3ZWYA 3HUDA 2IXBA 1V3UA 2CY0A 4ALJA 2GN6A 3GEDA 3AM5A 3F4BA 1Y7TA 1XWFA 2VYVD 1KBZA 1YONA 3I1JA 1VC2A 3LSYA 4G5HA 1TB4A 3WGQA 4BUCA 3LQFA 5TNXA 1XCBA 5JYDA 3RUDA 3EVNA 5TIIA 3IC5A 4UEKA 4EUFA 3TJRA 4FQ8A 4AL4A 2BELA 4J2OA 4RZIA 1KY4A 3BHMA 3KYBA 4PLTA 3RUCA 3T7EA 1E3WB 4Y6SA 9LDTA 4NH4A 3FWZA 4L74A 3GR6A 1E6UA 1MGOA 3QVSA 4FFLA 1PU2A 4NBUA 4W9NC 2HQ1A 3O26A 2NWQA 1BDMA 3GRPA 3RUHA 4WCFA 2AG8A 2WE8A 2EHDA 4FC7A 5ICSA 3TDKA 3I4CA 2H63A 3DBRB 4R5MA 4EZBA 5TX7A 5KTKA 2JCVA 2OP1A 4Q3AA 2O3QA 3ZW9A 1GL3A 1E6EA 2VWPA 3RCBA 1I33A 4DQXA 2FOIA 1BW9A 1D1TA 2W98A 4KQXA 4D43A 4YPOA 4ZQBA 2AMFA 3V2GA 4G2NA 1NR1A 2Y67A 5A9TA 4E5MA 1N1EA 4TVBA 4TZKA 3ZH2A 3U3XA 3QP9A 4EEZA 1ADFA 5TT1A 2WSBA 3JYPA 4YJGB 4XRRA 1UZMA 1UDBA 3EGOA 3JQAA 3NTOA 5JDIA 2BHLA 4IDGA 3WLFA 4ZJUA 3MTGA 1PL7A 3H65A 3ZU3A 2HCTA 3C7AA 4HBGA 4KWIA 3GLQA 1P1HA 5A04A 3CMMA 1PQPA 1Q7CA 1HDRA 5CPBA 3S55A 5BSFA 1Y81A 2C7VA 2FWMX 4O63O 1JN0A 3JQGA 4CLRB 2C2YA 1FK8A 3GPDG 1LTHR 5I8ZA 1FDTA 5JCJA 4A0SA 4DPLA 2DQ4A 3A28A 4J49A 4DC1A 2PD4A 2ZJ1A 1HTBA 3ROMA 2EP5A 1BRMA 4YAEA 4CQMA 4R51A 1NHWA 1LI4A 2Y68A 3GEGA 2HMSA 1S6YA 3TOZA 1HSZA 4LGVA 1DJNA 3WG9A 4FR5A 3VZSA 2C5EA 5JC8A 1K6JA 1A4UA 2GRAA 2Q3EA 1SAYA 4LSMA 4E21A 1LSJA 4MDHA 3O9ZA 3JQ6A 3JSAA 1GV0A 2GSDA 4PLGA 4Y6RA 5GZ6A 5TS3A 3BIOA 3GC6A 5JY1A 5CDTA 3W8DA 1ZJYA 3I52A 4MVJP 4PLZA 2I3GA 4A73A 3RAJA 3QVOA 3K6JA 4I5DA 3ZWOA 1WZIA 4FC6A 1A9ZA 5U1PA 1FJHA 1C0IA 2ZYAA 4IXWA 4MO2A 1XG5A 2Z95A 4R4JA 1C1XB 1OC2A 2Y05A 1HDYA 1B8PA 1VI2A 2NVWA 3LLVA 1GU7A 4ID9A 1K6XA 3PFWO 3DZHA 3ZDFA 3RC2A 4RPHA 4BO3A 3FWNA 1GCUA 4XRGA 2Q99A 3OMLA 3WGGA 3JQ7B 4LCJA 3W1VA 3CPSA 5DT9A 3VZRA 3F47A 1I01A 1UP6A 5A1TA 3KEQA 3JTMA 4AJHA 1QR6A 4XYLA 1E3WA 3JD4A 2FPGA 4IQ0A 2HU2A 3CZRA 1OAAA 3M1LA 2IZZA 2W2LA 4PLFA 1Y8QA 3L6OO 5TJ9A 4ZN6A 3H4VA 1NTOA 2Y1EA 2YHIB 3DBHA 3WYBA 3JQFA 5EQDA 3TN7A 3AM3A 3Q1LA 1E5QA 3C1OA 2X0RA 3RUAA 2AHRA 1NXQA 2C2XA 1ZK0A 2HKIA 1N7GA 3I9MA 2R6JA 5GZ3A 2HRBA 1VSUA 4IDEA 5IDWA 1W73A 4CUJA 4NPCA 4RPKA 3UAGA 5IZCC 2DPHA 2VHWA 4DIOA 1J5PA 5T8KC 1UH5A 3NRCA 4JIGA 1PR3A 4HV4A 1VLLA 3OSUA 2X23A 4IJKA 4BL5A 5BSGA 4F6LA 1PZEA 4UUNA 4D42A 1LQUA 2FR0A 3SEFA 5L9AA 4W9NA 2VHYA 3D7LA 2F00A 3V1UA 4Y8VA 3O38A 1MA0A 3S1LA 1PR9A 1H9BA 3INTA 3SC6A 3ICCA 2DU8A 3WMWA 4NI5A 1ISIA 1Y5RA 4CLRA 2X5KO 3VPFA 1PS9A 3HE3A 4UVHA 4NU5A 4QQRA 2PH5A 3VVCA 4EUEA 1P31A 1ISMA 1E3IA 2UUPA 3HFSA 4OXYA 4DMLA 3FRJA 1E5LA 1Q2XA 5KNLA 3ITKA 3OECA 5COQA 2Y1GA 3U4HA 4OKNA 3ZHXA 1E1LA 2VNSA 1EFLA 1HDGO 3EDMA 1CDOA 1HDCA 2GGSA 5L4NA 4EJ6A 2O50A 4YT2A 5IAAA 4J7XA 4LN1A 2X58A 1HYHA 4RVDA 5DF1A 3E18A 4J91A 4RJTA 5FEUA 4FS3A 1LRKA 3FBTA 1PZFA 1Z75A 2OGUA 2YJZA 2P9GA 4EDFA 5CDSA 3OA0A 4CM8B 4R41A 2Q1SA 4UEOA 4JJIA 2AXQA 1HKUA 3PHGA 1DDOA 4ZU3A 4D46A 5AQ1A 3JQEA 3BMQB 3TPCA 1IB6A 3UCFA 3HJAA 1JTVA 1DFIA 2EIHA 1EQ2A 1UDCA 3D64A 3K73O 4FB5A 3WGYA 1XDWA 1PL6A 4XR4A 3GGPA 3ONDA 3OIFA 5IDXA 3NX4A 2WYWA 2BI7A 3DONA 2Q50A 3ZHBA 1IPEA 3AY7A 3VKUA 1VJTA 2XAAA 4IDBA 3OJ0A 1MUUA 2AEJA 4D41A 1T2FA 5EL0A 3X2FA 5L53A 5JMPA 4WUVA 3C7CB 3JQ7A 4GPD1 4FJ1A 4XX0A 5L51A 1QSGA 4Q39A 3FNFA 4ZQGA 4HP8A 4J4TA 4BNMA 2X0NA 3MEQA 4L8VA 4UVDA 4U6SA 3PDUA 4WNIA 1D8AA 4HX5A 2DFDA 2YFQA 4TVOA 1Z82A 3ASVA 3W4IA 1P74A 1JWAB 1E0DA 4YAIA 3WOHA 2EG9A 1N9GA 4XGKA 1P1FA 3L6EA 1P45A 3FNEA 4CMBA
chains in the Genus database with same CATH superfamily
3NEPX 3HA5A 1U6KA 1GPBA 4QRHA 2JBAB 1P2DA 4O0LA 1L4HA 3TEFA 3B3JA 2GXQA 2XQKA 2O5RA 3PZBA 5A5EA 4J8PA 1C1DA 3EGEA 2V55B 5JLAA 3VNQA 1RQNA 4UDOA 1GEEA 1SUWA 2PLAA 4D74A 3SS9X 1JBQA 4WJLA 1RYMA 3I8OA 1FNMA 1WAMA 4EGJA 3C3PA 2X41A 3QWIA 1U94A 2PH3A 3UWPA 1CRZA 2WMDA 2HJGA 3GFQA 2VKQA 4MCJA 3HZOA 1J2YA 3FE2A 4FUTA 3J80A 1M6VB 1AKQA 1X9HA 4Z54A 5LQCA 3ZVKA 5ENVA 1WXQA 1LEHA 3CW2A 4OQYA 5HIKA 3BWXA 3CXRA 2XZOA 2RHOA 4M3NA 5CK4A 5I6DA 1EXVA 1GPNA 2JKVA 4H27A 3PRHA 1ZK4A 1JSCA 3QPVA 4TVKA 4DV6B 3CV3A 3GFTA 4LMAA 1EAYA 3KNZA 4I55B 3EZ9A 4EFMA 2ZZNA 1TUEA 1VZ2A 1YS4A 1ENOA 3V1NA 1JG6A 4MW4A 4W4TA 4R8RA 2PUFA 2WKPA 3ZE0B 4OHXA 2BFWA 3BHIA 3K0AB 4N7RA 4I8DA 4ZKEA 4KQCA 5A9RA 4YXFA 2BJWA 1Y7HA 2MT9A 4DNXA 4NG5A 3K70B 3DL0A 4LOIA 2P69A 1EX9A 1JLLA 2I29A 3EXFA 4J2TA 4TYPA 2BUAA 1P2TA 1C3JA 1KQNA 1CD5A 3HKCA 4I1SA 3NWOA 4F85A 1KNXA 1DWPA 4NMHA 2B7BA 4Y3UA 4X94A 3KUCA 2CBXA 3EVGA 1TECE 2PL1A 1BN6A 1T5IA 4L7QA 4YV2A 3A9WA 4LTNA 4PZYA 3EA5A 4L51A 2DGDA 4RF3A 5IW8A 3UAWA 3VPSA 4EY8A 4IJQA 5BW6B 2AUMA 1LVHA 1VG0B 1P0CA 2PM8A 1VCHA 3HABA 3A3OA 5DSTA 1BC5A 3MJSA 3TCXB 1FDUA 4J94A 1X1TA 2RJNA 2J7PD 3RK0A 2AFHE 5BSMA 3SZOA 4B2LA 3ZK8A 2O4UX 4OQQA 4H1HA 2RIPA 2FR1A 3DYIA 1V8DA 4INAA 3BOSA 4XD7D 2CF6A 1RLOA 1SWWA 2IXAA 4HOYA 1YI8A 5HFNA 1QH8A 1Q1QA 2VWQA 1RC1A 1MP0A 3ETDA 2ZJYA 4OA5A 4DTCA 4EGFA 1RQRA 4QTYA 3D8BA 2C83A 2AVDA 4DARA 4I46A 2MDTA 1B4DA 3CTMA 4ER3A 2YKGA 1VDMA 2DUJA 3I04A 1ZCAA 5TT0A 3LZ6A 3UGQA 4AO6A 1WXDA 2YWBA 3RIXA 3ANXA 3BHNA 3D8SA 3O8NA 4H1TA 3TD6A 3WBBA 1QZUA 3OJCA 3DFUA 4C04A 4BEVA 2PJUA 3V5NA 2W48A 1SR8A 3UJ3X 1ESMA 2PSEA 2E4UA 4GPZA 4WVLA 3AH8A 5CHEA 1CP3A 1E9RA 5C32A 3GJRA 4UPVA 4ZVNA 3ZV6A 2CLMB 3S29A 1TM3E 5TQ2B 2Z8YA 4DDVA 4MTCA 4RXTA 1W7AA 4JJAA 3CNHA 4YK7A 3L1IA 4A2PA 4U2KA 1GAWA 2FEPA 2Y2UA 4P54A 1YQXA 2OPHA 2VPYA 1EK1A 3I0NA 3A9CA 4I50A 4RQAA 3REQB 2FP4B 3M4YA 3BG5A 4NAUA 3SDSA 1Z4PX 3KJNA 1OGIA 4XWOA 4RD3A 4LY6A 2YWXA 3PC6A 4I1VA 4EKDA 1WZEA 5A6VA 4Z8YA 3WJ7A 4XB2A 4ZQCB 4XWAA 4BKUA 5KYYB 2VDWB 3WLKX 2JGFA 4BGVA 1D1PA 3T3PB 3THXA 5FTWA 4BFTA 4ZQEA 1BXGB 4AXBA 4GOKA 3QUQA 1WKVA 2D4AA 2OECA 1KMNA 2RHJA 4UVEA 1V8BA 4ZARA 4B43A 4D4GA 3RYCB 4RA6A 2QRPA 3W90A 4P1ZA 2VK8A 4V0KA 1U02A 5LXTF 3F6SA 3RSZA 1UKAA 4WK6A 4BGIA 5A6SB 3SF0A 2X9QA 2IFTA 2P5TB 2VSYA 1SUSA 2GVDC 1Z7GA 4G8BA 3GVXA 2JLVA 4JJZA 2WR8A 1GRCA 4JAVC 4RJJA 3ABRB 3Q8KA 1E2HA 4G86A 1ULTA 4EA7A 1J24A 1B0AA 1KY2A 1JV2B 3E9RA 1YGYA 4NIMA 3FCYA 4NV3A 1X0VA 4ETNA 4JLMA 4XLTA 3FKQA 4CMKA 4RY0A 1EX1A 1UC4B 1H1LA 1E62A 3DBLB 5AKLA 1Z5OA 1WMFA 1QFMA 3JX9A 4EHNA 4Q5IA 4E09A 3N8IA 4M8SA 2VP0A 4OQMA 3I64A 1ZSVA 3ILHA 4RD0A 1VP9A 4JVSB 4ZZ1A 3MTQA 4US0R 3B6EA 4HSEA 1I5OA 5LZ5A 1QO0A 1YB7A 4D45A 3H3JA 5I7SA 4AG3A 1T3TA 4R1UA 1WUHS 5ALIA 4QYTA 4NHOA 4R01A 2Z2YA 2A0UA 1P1IA 4DWWA 4DR6B 3W2EA 3AKYA 4M1EA 3PWTA 3VHXA 4HNRA 1C0PA 2HF2A 1FPMA 1NRXA 6REQA 2Z3VA 3MQ2A 3RSSA 3QX9A 2P2DA 2CLIB 1UAGA 2FPMA 4QXPA 4ZC1A 4AUEA 4RULA 4M49A 1ZJ5A 1KFJB 3C7DB 3MGKA 2HL6A 2CLSA 1T4CB 2K6GA 4HH0A 1XRRA 5D5HA 2BBTA 3KQNA 2Q1WA 5CPFA 1DUSA 1H4QA 5HEKA 2AXEA 4KI7A 4O2RA 4PGFA 4YA6A 4F3TA 4BO7A 3AHIA 4YJ3B 5EJ7A 1R8QA 2Q45A 3LU1A 4TQGA 1GFIA 2AT1A 5JFTA 3DUFA 3I4FA 3I9LA 1BEUB 4YCAA 5BSEA 5K3DA 3RFXA 5A4KA 2ZLBA 3MS2A 3AHFA 4YWJA 4RHYA 1NN0A 2PVSA 4Q93A 2NU8A 4RYDA 1P33A 2VK2A 1IB0A 5AXBA 1QC5B 2X8LA 4NV0A 2CDBA 1DV2A 2FZCA 1EP9A 1T5SA 5TRTA 1CZKA 4DSOA 2WD7A 3H18A 4FSHA 4JASB 3ODPA 5IBRA 1DC3A 4QTXA 1FE8A 1I9CA 3NXKA 4Y1RA 3C8MA 1A8PA 1PFYA 2QP9X 3VYRB 421PA 3RPEA 1K98A 3QMVA 1FX1A 3DMNA 3HKEB 4KDFA 5DMHA 3IOEA 4BB5A 2JH9A 5IF3A 4BUJA 4F38A 3KSMA 3SSOA 3HNOA 3IEMA 1JU9A 1N5MA 1PGNA 5K20A 4OX9Y 1T6YA 4AKHA 1XYYA 5K7SA 1DU4A 1K08A 2X76A 2JJQA 1NT4A 2P3LA 4MUIA 5G4KB 4DF3A 2PH1A 3DL2A 3F8SA 5FLKA 5DSXA 2NXJA 2XPCA 3CW9A 2R85A 4UD2A 3VOAA 3ZUGA 5BXQC 5C1BA 1WCIB 2YIVX 2JFBA 2PRYA 2ZBEA 5FTJA 1YBMA 2R62A 4B87A 1AO3A 1FPQA 2QE6A 3KOOA 2DPMA 3FZEA 3PC4A 3WA6A 1KJQA 3WWEA 4ZT2A 1CUYA 1IRXA 1M66A 1N8NA 1PK9A 4W1QA 3BH0A 1M9NA 4PBSA 5EWJA 5KO2A 5EQTA 3WK4A 4C5BA 1OKKD 1C30B 3IJPA 4KK4A 5JS2A 1U3TA 4RORA 1F7VA 1GT91 4HUJA 2Y4OA 2N1MA 5G0WA 4CKEB 3GT3A 4M1MA 521PA 3O3OB 1EX6A 3FGNA 3LLCA 5AJZA 4RZXA 2PUVA 1MX1A 5CAEA 1XSEA 4IGAA 1UAAA 5AKXA 4B9EA 2YWEA 3IV9A 5GONA 1RM5A 3DLCA 4QTZA 2C99A 3DZBA 2VTVA 4PSUA 2AJ8A 3F4LA 3LKZA 1Z0AA 1I94B 1GUAA 3WI7A 1QFXA 2B8WA 1YMUA 1TCUA 4NYJR 5GV7A 3T3EA 5B7PA 1G6HA 1DTWB 1DIRA 2BGUA 1VE5A 2GT1A 3Q85A 3OPMA 4L5IA 3KXPA 3V97A 4NICA 3D3KA 4YT4A 3PJRA 2Q29A 3I61A 1NIPA 1KYWA 3BJIC 3I5XA 3N70A 1G16A 5HZHA 3FPEA 4AJ2A 1FQWA 1FS4A 5ALEA 3VYTB 4YC7A 3T6KA 1J9GA 5B4UA 3CCFA 3ILSA 3LC2O 1T1RA 3C87A 3IEIA 4MUJA 2PRZA 2BCGY 4BYMA 3OEHA 3ESQA 2YHSA 1YDHA 1TNDA 2F4VB 4JLWA 1ZP6A 5IAOA 4NU0A 2W0SA 2Y71A 2Y0PA 3KSDO 4JIMA 1E5XA 4RUKA 2OR3A 4TMVA 2NV0A 1CUXA 2OLKA 2B0JA 3CU5A 3NUZA 1KMCA 2D54A 4XI9A 2PBLA 3WL5A 1H8EA 4DCVA 3ZGXA 3TAHA 1VIAA 2JHGA 4EVSA 2OQ2A 2XF8A 3K0SA 2H06A 3W2IA 1YVEI 4AU1A 1UOPA 2ZRMA 1N7IA 1QAMA 2JDIA 4MZDA 4J1SA 4ZYZA 1O94A 2JFHA 3JAKA 3BB3A 4KB5A 4XGRA 3L4JA 2WHYA 5FTKA 1WLSA 1OX6A 2A3NA 1I3OA 4RETA 1D0SA 1P44A 1QG4A 2MWMA 1X86B 1EB8A 3THOA 3DEIA 1E2QA 1ZKMA 2C29D 4JLDA 2A2ZA 2P9YA 1SVSA 3ZE1B 5J4YA 4WLEA 4IIGA 4WFJA 1QH1A 3T7JA 3UJ8A 4Q3BA 4TL6A 5EJFA 3QUBA 1QBKC 2XUOA 5G4LA 2R1VA 3LVRE 1QGDA 2ZI4A 4GWKA 1PWYE 4XJXA 2DPYA 2V6GA 4ER7A 2NU9B 2C94A 5F73A 4DR5B 4D4MA 3HJCA 1QG6A 2H3HA 3Q8WA 1WSDA 3C6QA 4FOLA 4JMPA 3B3GA 1KZ4A 5F21A 2WHQA 1L5KA 3UB4A 1CQIA 2EOAA 2EKDA 5L3QB 4PAWA 1S96A 5FUXA 1A5ZA 5BVGA 2G76A 3KKEA 5IJ9B 1LLQA 3M6LA 2O2JA 13PKA 1MC1A 3TRIA 4BNVA 4UCQA 1YB2A 5HM6A 3G2LA 3C39A 2GYVA 4KX5A 3QELA 5L6LB 1DX4A 2F1JA 1Y1LA 1CZNA 3HM2A 4EBFA 5EWLB 5HQTA 2PBFA 1KSJA 1YA4A 3GMDA 1ZMOA 2PLWA 4RD1A 5F77A 4IG4A 5AVJA 1E8NA 1S2OA 2NLOA 3C97A 4FHZA 2GAOA 4RK1A 1RJEA 3NZEA 2Y1CA 2ZUCA 3P9RA 4HJXA 4ICIA 2WV9A 1GPJA 1J2UA 3Q87B 5IJXA 1D4FA 2YFYA 3E9ZA 4FD2A 3CT6A 1E3LA 2B1JA 3GCGA 3BSWA 3IHKA 3HFGA 1M0WA 1ISFA 3AUFA 3WLSA 2ZKLA 4CI0B 4QO7A 2ON6A 1ICIA 4RMNA 1XAJA 3BICA 3RQIA 1JEDA 1QPBA 5BQPA 1JG2A 1AGXA 2XHEA 3IULA 2XVAA 4BJ6A 5AKHA 5JCOA 3VH1A 4I2NA 3TJZA 4BGDA 1TAUA 2DPLA 2PZKA 5IKEA 3DTTA 4XCQA 2VK4A 4AECA 1SQ6A 4TRNA 3GRFA 4KGDA 1RMYA 2ZRCA 5T64A 4CGYA 2NZ8A 1BMDA 3JXEA 1OSNA 2VI5A 1XVIA 2W7TA 4C7OA 1P29A 3LT5A 1JR3D 1KYIA 3JD3A 3TVYA 1GO2A 4J1TC 4LC1A 2IYPA 3D5TA 3MMZA 3O3MB 4QU8A 4QTUB 3DBVO 2VTBA 3CIFA 4IFEA 2WLSA 1WW8A 5LYJA 4C0SA 4B4VA 1MPTA 1R0CA 3NVDA 1CUEA 1XCOA 1BKSB 1IY8A 3ADKA 3B1YA 3FUVA 3LA6A 3KR0A 2VZ9A 2HJHA 4XCXA 5IUKC 1XTKA 1LTQA 4MR9B 3WLPA 2R6R1 3KB6A 4MLDA 3F49S 2O7RA 4A8JA 4B82A 4LOJA 1J23A 2X0EA 4NE7A 3NGMA 4RTNA 4Z4QA 2DQKA 2GM9A 1PRYA 1LSOA 1F8XA 3CRQA 2V7BA 3JQ9A 3KUDA 4JLSA 4LHVA 1JS1X 1U0TA 1TM7E 1RTKA 2I62A 5KQMA 2WYVA 4QGSA 3O8OA 4QYWA 2SCUA 2RARA 1ZL0A 2J5KA 4OM8A 3RJTA 4KITB 3P27A 4H4EA 2QX4A 3KSZO 1WA5A 5I7HA 1BOOA 3PGLA 2YYZA 4E3ZA 1HE4A 2POCA 3SLKA 1JAYA 5JAMA 2ZUBA 1PZMA 3NHFA 1KI6A 4KH0A 2XYGA 4OQDA 1E92A 5JZBA 3IDFA 5CP8A 4CETA 3GLIB 3AB8A 4MQFB 4BO8A 3N2YA 5I5EA 3U60B 1QTNA 3QKSB 3OZXA 1QVAA 1GZ3A 4JLJA 2Z30A 4M1YA 4QBIA 2RHBA 4GXQA 1XRNA 3KEMA 3CNBA 3MK31 2ID7A 4ROSA 1EFHA 1X8KA 2QKYA 2OZEA 4DR7B 1N77A 2C42A 3HYCA 4AJNA 5LCXA 3MT0A 3U4QB 6PFKA 3MTJA 4RLQA 2VTKA 3MPOA 3GLFE 3I2GA 5AKYA 1G8MA 5KWIA 4P3OA 4NL4H 2PQ2A 3PE3A 3HU5A 2OEPA 4RMHA 2EJWA 1FMJA 1F8UA 1XUOA 4R16A 3RS7A 1PF7E 2K7ZA 1QUFA 1JIJA 3PV0A 1U0HC 4JP3A 2XVXA 4Y6QA 3DCYA 1E4EB 4IYJA 1H42A 2IA5A 5EERA 5KVVA 1YIAA 1P1CA 3CO0S 3R0IA 5J2UB 3AOEA 1ZAYA 1N2CA 4L73A 3NC1C 3U3OA 2ENUA 2FX2A 3G89A 3QLTA 4GWLA 3QU7A 3O82A 1X7WB 1KOFA 3D4LA 4HXEB 5BNZA 2D00A 3IMCA 3UXEA 4JBXA 2Z2ZA 5EE5B 2CHGA 3Q3JB 2NXNA 4WEOA 5DNCA 1BXKA 4TT3D 4ARCA 1M1NA 2OV6A 3CISA 5KYGA 2OXRA 5I7EA 1V9LA 1ZQ9A 2FFRA 2HJRA 3A4NA 4MLCA 2VCEA 4QVKA 4Y0AA 5E3JA 3TR0A 3VUEA 3ZLBA 3QLUA 2PMKA 2WE7A 4Q21A 4L0CA 2QY6A 3KSBC 5BT8A 2WZQA 2DBRA 4KTVE 1EG2A 3DS8A 3K70D 4LDJA 4UEWA 3EMBA 1DFHA 3B5EA 3L06A 4H6WA 4DV5B 1QTQA 3IKTA 2GERA 1TA9A 4ZJYA 2J1LA 3QA3E 3RAPR 3JARB 5DH9A 3SE0A 3MHPA 5IWCA 2ZIZA 2AD5A 4ZJPA 1G60A 1Y1QA 3AYZB 4H1UA 3QV1A 2CXPA 4MVXA 3RIHA 1SCQA 3KSAC 5LD2C 4UQPA 3UMCA 4K05A 2H4HA 3E0XA 5BRJA 3IP9A 4HTFB 4O4LA 4Q9HA 4D5EA 5JNSA 2GKGA 2YWGA 5TVKA 4DCNA 5ALTA 2OFXA 1ST3A 2OK8A 3H05A 4GM4A 4IGEA 3RVBA 1H0HA 5HKAA 1YF3A 2AMYA 3ZQUA 1EFUA 1RTTA 1YJ5A 4F9FA 5JSZA 3S44A 2Z5FA 1U3FA 3T5PA 1XLVA 1YE3A 3DMPA 4CODB 3TDNA 3VO9A 4RM2A 5T3YA 2BW0A 1NU8A 1IMJA 1K06A 1H2HA 3ONWA 3OZFA 3D4IA 3SDBA 4AW9A 3AFOA 2HK6A 2P9CA 3GQBA 1VYVA 2PJDA 3A0RB 1IZZA 1SC6A 1SUPA 4I50F 1WMSA 3ACBA 4HQFA 2C4KA 3R0XA 1N4AA 4A7PA 3AVWA 5G40A 3F4KA 3T1QA 3C3BA 2JLYA 3B13B 1UXGA 2VF7A 5KTPA 1BE1A 1KI3A 4K6CA 3GJ7A 2WF7A 3L7KA 1CJSA 3O92A 2ECKA 4C1NA 2XXAA 2ALJA 3UA3A 4C06A 4MV9A 2W0MA 1A7AA 2V7GA 3FBGA 4XB6B 4DQKA 3ZGOA 1MRNA 3H7AA 3AF3A 5FYQA 4CM3A 1XRQA 5CXSA 4MARA 1Y7IA 4KQFA 3WXMA 2AOWA 1LC3A 2F8MA 5ECGC 4GR5A 4Z1MA 3HJFA 4K6HA 4GWGA 2K2WA 2JCGA 3DOOA 1W88A 2YTZA 3P9ZA 4TTTS 1CY2A 2OZLB 1ATIA 3GGSA 4JC0A 4NE2A 3LRXA 2IHZA 2QVXX 4EYEA 4N7BA 5KINB 1DTSA 3SICE 2WUWE 5IZ4A 4N1AA 1NFQA 2M32A 2VUUA 3ON5A 2PZFA 3CZ9A 3KHKA 4IM7A 4WGGA 3WP1B 2P2GA 2JD1A 3U31A 3C3MA 4QAQA 4EUKA 1XT6A 5A3RA 1DKQA 4WZAB 4ZU1X 5K0BA 2YUIA 1UBEA 1BX1A 1G5RA 2BR5A 1K0FA 2J3LA 1YR3A 2V74B 4R3NA 1ZD4A 4UD6A 2LVBA 1VCOA 3KZMA 4NTZA 2HSDA 2MSEB 2QIPA 4NZZA 3LVFO 4QBHA 4DOMA 1I2CA 4NESA 4URHA 2GLXA 2ZIAA 4Z0HO 1Y9AA 2R79A 5EEHA 2QW8A 1AXEA 1C1XA 4BZPA 3CEHA 5C2JB 4NNJA 4UUQA 3JQ8B 4IHJF 4XUCA 4Y6GB 4E88A 2D59A 1QAOA 3UHJA 1LLUA 4FFPA 4WDQA 2CYCA 1VM6A 3TSWA 2IX3A 5K6TA 5MN5A 3I2YX 121PA 1Y5IA 5F52A 1SWVA 4EIWA 1RRCA 3R3HA 2NMVA 3PXAA 2PQ6A 3L7CA 1TU0A 4J16A 4EFNA 4OFZA 4XFKA 4ARSA 4YCCA 1HLPA 2HWUA 4ZI7F 1ZN7A 5K03A 1JBKA 1IYZA 1U8TA 2CNBA 2RHHA 4GOJA 2C4TA 4A16A 1KTVA 1AGNA 2YHIA 1E1QA 4HQRA 1UWVA 4NJEA 2BP7A 3I3SR 4K9QA 3B53X 4EA6A 3ENKA 1USKA 4NBRA 4OBWA 1TKRA 2RHRA 2VQDA 4H59A 3K6KA 3ISJA 3UOGA 3DVQX 4FEEA 4JL5A 4M1SA 3OMWA 4KEAA 3WRXC 2G5CA 2CBZA 4KFTA 4YMIA 4LE1A 3ZKWA 1VMDA 3II6X 4Y2QA 1HUQA 9ABPA 3JWGA 4I8IA 3QPAA 3O4GA 3E5NA 4BBZA 1ORWA 3DGEC 2QLMA 5HZMA 3COVA 3K70C 3ZYZA 3KP1A 5DX1A 3BK7A 5AUQA 2IV7A 1KH3A 5AW3A 1FFCA 1ZH4A 1SHZA 3RHFA 2CLFB 1XTRA 5B4VA 3E8MA 2F3SA 2C3MA 3GRZA 1J33A 1F4PA 2BGJA 1FNBA 1SHTX 3SR3A 2WB4A 3CF4G 4L5AA 4CGZA 1MHTA 1RRKA 4WZZA 5E4FA 1B76A 1NI3A 1NUUA 2IDZA 3FPHA 3TW4A 2HMTA 3U7GA 1L8LA 4WAUA 5L6MB 4M22A 1RI3A 2OCYC 1J2RA 3FRIA 4FU0A 4HB0A 4JD5A 4KN9S 4L4SA 2QE7A 3JALB 2P67A 2QSYA 5ALQA 4ZCQA 3HPQA 4YFYA 1GR1A 5F33A 5LP1A 2B4QA 2ICAA 3F5FA 4ON9A 1KJ9A 3BE5A 2QM8A 4YRRA 3KPVA 2WZDA 4LX8A 1V96A 2W00A 4R2XA 4BEJA 1TIPA 5IJZA 1FJ2A 3U4MA 3N0RA 1DS6A 1SIUA 3OWHA 5T67A 2ZJAA 2ZR9A 4N5HX 3M6VA 5FPSA 1QTRA 2I34A 4CL3A 3HYSA 4GBGA 2E4WA 2QQ5A 3P2OA 1E8DA 3NQ41 1BWQA 4PGGA 1XGKA 5PGMA 1N2GA 1G7SA 3FNRA 3R7FA 1PSWA 3QE9Y 3PWZA 1QOQB 5FNVA 1ZICA 2BEVB 4R2IA 5E6RB 1IAVA 1T9GS 5K6AC 3MILA 5HS6A 2FOXA 2EJBA 4GL2A 5ICGA 3DOCA 2AR9A 1VHDA 3EZXA 1IULA 1IWBB 2HA6A 2Q3FA 4JU9A 5AVOA 5EXTA 4IIBA 3R3WA 2LV8A 4TXLA 5BRNA 1XBTA 3S28A 1OT5A 1YQGA 2YXBA 2CCGA 1EDBA 4BQQA 1O4WA 2B92A 5TY0A 4Y6PA 2B98A 1TFUA 3MWKA 1CG6A 2OFOA 2JGNA 2X42A 3CWQA 1HLFA 4KQ1A 4N5LA 3EIHA 3W1EA 1NBOA 2RGAA 3GPIA 1QE3A 3WWPA 1VOTA 3BSFA 4MS3A 4MGYR 2H31A 3V8RA 3THRA 1CY4A 3X2SA 4F9EA 5C7IO 4L6IA 3LDUA 1NLYA 1YKSA 2JRLA 2WMOB 3OFJA 3PDIB 4KUGA 4L5BA 1H4SA 4F6RA 3A1TA 3DQZA 3FYDA 2Y1KA 2ZUSA 1ONBA 2GAFA 3PR2B 4X3CA 5JRZA 4DVGA 3TS1A 4AX8A 2B82A 1SXJA 3BF7A 3H2JA 5KKCA 1GNSA 2EATA 3ES9A 1FFXB 4IYRA 2ZJ8A 2VCYA 2QRJA 4I8XA 3AIMA 4G5FA 3AM1A 1G5FA 2Q1UA 2W8ZA 3QEBZ 1XP5A 1I14A 3BWEA 2BJVA 1F8FA 4H4DA 1U04A 1HV8A 3GGGA 2E1PA 4Y67A 1T43A 2QDKA 3GCXA 3KEGA 4AJ4A 4JS0A 2R7AA 6AT1A 3LGAA 4ALIA 4FGZA 5G0SA 5BWMA 2VFAA 5DM2A 1HOXA 1LWNA 3GGDA 5J3JA 1J07A 4YB8A 1RU3A 4YUWA 3HO8A 4ZRNA 3GBSA 3HVIA 2IYQA 2JJ1D 2LZ0A 3HJRA 4MP3A 2LCIA 1UM9B 5AHOA 2CHVA 5DYGA 3ETLA 3UCEA 5HJ7A 1Z63A 4DSUA 3W7BA 1R9MA 1NBME 5T41A 3UT5B 1DAFA 2D0DA 5HTOA 5MFPA 3AFIA 3AI3A 4GZMA 3GAFA 3OU7A 2BTEA 2Q9AA 4D3ZA 2GYYA 4DBLC 1DG3A 3B6IA 3L8DA 5EJAA 3VSEA 1F2UA 1JT9A 1U4OA 3EULA 3VR4D 4D79A 4G26A 1B74A 2ZIXB 4P5PA 5L3ZA 4JJ6A 3FPBA 4UTOA 1R9GA 2Y0CA 3QVGB 3TLMA 3GJ4A 1V9SA 4MEBA 1MB2A 4BJHB 2W2OA 2CL0X 6YASA 4HDKB 3RS0A 1ZSNA 2OOKA 3R8CA 4L5YA 4JUCA 5CB4F 2AG0A 1NAHA 4C4PA 1PDWA 1NW8A 3OPNA 4IIJF 4C0XA 1I6MA 2ZT6A 1PFVA 4MWSA 3BIJA 2P7IA 4CCSA 3ROXA 1PIWA 4B4OA 1UXHA 4F7DA 1YOVA 3DWGA 2B69A 3GI1A 4J3JA 4YDSA 3IX7A 4HEA6 3S8EA 1B16A 2O1XA 3NB0A 5CM8B 4CVNA 4EW1A 1QGAA 4ND3A 2WTEA 3MMSA 5DYWA 4E12A 5BR8B 1UBFA 1AVTA 3NBFA 1QHHA 1H69A 1Q95A 4CIVA 2FOLA 4N18A 5AH0A 1LGYA 3VAYA 3VR6A 4QXRA 1COWD 3FM9A 3JSXA 4DLXA 1E0KA 5DEIA 6GPBA 4OQ4A 1U2RA 4G5YA 1FIUA 3DTVA 2NUTB 2R6GA 2YDYA 2XRMA 1JG4A 4XZ3A 2J41A 2E5FA 4FHGA 1E79D 1SQGA 1Q0PA 3R6GA 2J3DA 2JCYA 1VMIA 3HUTA 4L8LA 4M0KA 4P6VF 1GHTA 2L82A 4H77A 3AYXB 3BRSA 1Q0QA 4OHCA 1CEXA 1OTYA 3LUCA 4K7JA 1CXZA 1ABFA 3HWRA 3OFKA 4RHFA 3VQTA 4BO5A 1PQWA 3GWGA 4EEXA 4RD6A 1RPNA 5BQXA 1HC7A 4TRMA 1BJRE 3QU2A 2EKPA 1KOGA 1C4OA 1IZYA 1JIKA 1OYWA 3PNVA 3QKTA 4WK0B 4BNFA 4DCSA 4FI3C 4D3SA 1GG5A 4BO4A 3K9GA 3MT8A 1QIDA 5A02A 2J5XA 3HN2A 2YHAA 3SBXA 1R3DA 2ZUUA 1Z83A 3OO1A 2NT4A 3RB8A 1IM5A 5EZYF 4KOEC 3N0XA 2O06A 3B85A 3L01A 4DR2B 3BMNA 4R1OA 3EZ7A 4L4ZA 1KDPA 3GLUA 1I4WA 4BNXA 1NBEA 1KJWA 2RIRA 1F14A 4NE9A 4RNDB 3TQFA 2AZTA 4QOJA 4OBBA 4F4IA 2RK6A 5AVTA 1XL0A 3PQ3A 4Q4LA 3FSRA 3FSGD 3I9KA 4U8GA 3RI3A 5GIOE 2KW5A 2A1UB 2WAAA 3SC3A 1H94A 2WHPB 3KKZA 3KTFA 3VNRA 3CWCA 4N3BA 4YJFA 1J21A 4QULA 1G5HA 3ADCA 3G5TA 4IDOA 4OSOA 3RQSA 3KCNA 4BGEA 2IHVA 3IOMA 2FFBA 4X20B 2B9VA 1CERA 1AUXA 2OBMA 4PRZA 2H9YA 1P0PA 2WUDA 5K3FA 3WLNA 2JA2A 2WWRA 3Q8MA 1IPFA 4ZHQF 4B3BA 4ZOLB 2XA9A 4J9VA 4QFBA 5FR1A 5G02A 4ZOCA 4EABA 4ZMRA 3R7NA 5LXTB 4WLOA 1OWMA 3O8CA 3MJDA 1KMIY 4M9CA 5AD1A 1DBRA 3DHEA 2CB0A 4Q3DA 4ZODA 4C4XA 4MUXA 2HN9A 4PFQA 4UM9D 4NECA 2JGIA 1IQUA 2NYRA 4L16A 1EFCA 2BFCB 2IIQA 3E22A 3PUIA 4QKQA 4W7SA 1WD7A 1CRPA 1GQSA 1X3SA 1ZM9A 2M2IA 4UW9A 3A6GA 3QFTA 3K1JA 1GQYA 1K2VN 2VP9A 3OQVA 1JILA 5ILOA 3BSYA 5T4BA 2PGOA 3N0WA 1CBUA 2ZSDA 2VHXA 3OLCX 3QE3A 4XJTA 3WYNA 4AQDA 2JVIA 4S12A 1ZH6A 1C8BA 4CKWA 1CY7A 3TQTA 1UOQA 3GAZA 3IJEB 3W5VA 3KFXA 5IDYA 2ZRKA 2O48X 1WZ2A 3AF2A 1XI2A 2XOKA 3LHSA 3T1VA 5LR6A 3NBYC 3QJGA 4IOLA 2QT1A 3Q0IA 4BNWA 3ESYA 3B3AA 1NOJA 2TMGA 3AUYA 1Z6XA 4RH0A 4Y2SA 1RT9A 1VKNA 4HAZA 4IY1A 4IZOA 1QLHA 1QFSA 1LDGA 1N57A 2XYQA 4H17A 4LXIA 3RUEA 1ETUA 4BVKA 1ORHA 3AB3A 3AZPA 5DO9A 1ZK1A 2OORA 4W5HA 2POQX 2BFEA 1Q7TA 3MS7A 3TSOA 1QJ4A 1I7NA 2QGFA 4OQZA 2O5CA 2VF8A 1OXVA 3X3HA 2VN8A 1WEHA 4Z6KA 2DC1A 2ZYTX 4A4DA 5DCWA 1IG0A 2XXBA 5ALUA 2BFOA 2HRQA 1XP8A 3NOVA 1TOAA 3AG6A 1SD1A 4OB8A 1TO6A 2H2DA 4YMHA 3UC9A 5IDQA 3B89A 3WGOA 1WSWA 4BMVA 2ADOA 4RACA 1FMCA 4RFVA 3R2JA 1OI3A 3I37X 1U2GC 4ZA2A 2BFPA 3WNVA 4A10A 5BMOA 4LXXA 1Y98A 3IQGX 4S04A 3UICA 5J9FA 2HPHA 2XB4A 3R1IA 3IA2A 1E3EA 5DNAA 2C5AA 5EKDA 1DBWA 2ZDHA 3ER6A 1OJ7A 1UXKA 1WX1A 1XMJA 2E37A 2J46A 3MLAA 1YNSA 4IR7A 4UOQA 4D02A 3GW8A 2UUCB 1IBRA 1HT3A 1DIGA 3DVAB 1U7UA 3U39A 4ENPA 5ED0A 1UIRA 2BWJA 4NOMA 2LCQA 4PXAA 3GLGE 3OZVA 5SY9A 3ZWNA 1YVDA 3FG9A 2XCTB 1SA0A 2PWZA 2LR0A 5AVRA 1RAGA 4UPDA 2DBYA 4JUFA 2B4TO 1WXFA 2BFFA 3VZDA 3KJHA 4NY1A 3D0RA 4ZCPA 1RZ3A 2GJAA 5IBPA 3K96A 1MGPA 4FFMA 1X7YB 3KD2A 5AHKA 2UYQA 5F7OA 4AMVA 4DDHA 3PLAE 2CE2X 5FOVA 1H4VB 2IE8A 3PQ7A 3SIPA 5IRCD 2FUKA 5EPOA 1A2BA 3HY4A 3KQHA 1ZZGA 3FSJX 1WBDA 1FP1D 2J0SA 5AJUA 3C16C 5T57A 4GGOA 4HVCA 4JHLA 4NS1A 1DG9A 3U6BA 2TMDA 3R7BA 2ZRQA 2XR1A 2VBCA 4BLUA 2HSWA 3FF1A 2O4CA 2ERCA 3GNQA 4KVZA 2V1UA 4GKAA 1PG5A 3OEWA 4OM7A 3K2BA 1YDGA 4G85A 1I36A 4QT0A 2UYYA 3G5LA 2O0JA 3JVIA 3GUYA 4QE3A 4V0OA 1YIOA 1QIHA 5DK4A 2X5JO 4A15A 2JHPA 5AICA 3HCBA 3OY7A 3V4OA 2C82A 3REFA 2YYYA 4KQIA 2YQ5A 4BNHA 1GL6A 4IO1A 3S4YA 1CJTC 4XVRA 4YVFA 1F0YA 1SQ5A 4HAYA 4WACA 1W85A 2IY8A 3RIMA 1KQPA 2J3HA 4DLAA 4F5EA 4HNTA 4A3SA 3MJTA 1QVWA 4JJGA 3WXBA 3RUPA 1SQ0A 2LIPA 1MT3A 1Y8QB 1UKEA 5JDCA 3DBHB 4PSKA 4KXVA 5FR2A 1YJBA 2I4NA 4WOKA 5FOQA 5I3CA 5JADA 3GRVA 2H7YA 2HT6A 1K68A 3M6AA 3QIVA 4Y9RA 1KYQA 4TWBA 4BAZA 3KQPA 2FXIA 4EG0A 1V8FA 4HWRA 1TC2A 4G37A 4DREA 1JXQA 1O96A 3LPMA 2WK1A 1FFGA 1M10A 2YS6A 3HJTA 4IWXA 3TNYA 7REQB 2O0MA 3QWHA 2VUIB 4DDUA 2OCDA 4INOA 4CM6A 3Q8XB 4KSCA 1KI4A 5JFOA 1NBWB 1ZDMA 3ISVA 2XXJA 3ESBA 4BMNA 2XKBA 2UAGA 4ZYVA 1F06A 3ZY2A 3DEZA 4CL2A 1E9VA 5KWEA 1JH8A 1ADBA 3PTLA 1Z5WA 5AI6A 4RPGA 2B4YA 2QUHA 4NONA 3L0BA 3EGDA 3EG5A 3KB8A 1JJ7A 4J0GA 2J0UB 1KDRA 1N1MA 3WQBA 4EJMA 3CX8A 4JC4A 4UFNA 1EP3B 5DK6A 5ER9A 3QFSA 5EUQB 3CUKA 5A4FS 5BV1A 1DINA 1Z36A 3D0OA 4IFBA 4Y1FA 3SEAA 4PTZA 1GPLA 3ZDDA 2I2WA 1T2UA 1D09A 2C04A 1U0EA 4OXKA 3O1JC 1THMA 2IVFA 3AP3A 4LF5B 1Z6ZA 2B21A 2DLDA 2C8JA 2IP1A 3PGKA 1G21E 1U1GA 2D2FA 1CUWA 5AOBA 3S5JA 2XDQA 3LY8A 2WSIA 3HDJA 3PZRA 2DB3A 3KLMX 5JQGB 3WV5A 2XKAA 2E4YA 2XCSB 2BE9A 4ZDIA 3RJMA 3FDZA 1FYFA 1KL7A 4HWGA 4ZVOA 4OXQA 4C4ZA 1IWOA 1YA8A 3BFJA 3H3FA 4AYTA 3QUTA 1VKRA 5LLSA 1V7ZA 4H0FA 2NSDA 5I7FA 2XQVA 1ZLXA 1DAHA 1Z5VA 4GLLA 4LNUA 1MV8A 2WQ6A 3SJAA 1GZ7A 2DETA 3WY9A 4CMCA 4ZIRB 5ENDA 4Q02A 5EMNA 5IAJA 4Q4AB 1TM2A 2C5SA 4P5DA 1OIWA 2PA0A 3QPBA 2FJ0A 2E55A 2QL5A 1PEKE 4UUBA 1N6LA 4WW0A 1F20A 5JR3A 2HLPA 4X7RA 2QM3A 1G7CA 3B36A 2R8XA 3ESZA 3PFKA 5BN5A 2V6MA 3KR1A 1DRJA 3MSCA 3R0JA 1MW9X 2P4EA 3N2KB 5HE8A 1I2DA 1QIGA 3SYTA 5L7WA 4XASA 4ZYUA 3LMKA 3H87A 4TSKA 5EOVA 2XH8A 1WE2A 1QYIA 1W0KD 4RDCA 3CR3C 4XE5A 3K9FC 1R0LA 4RFLA 1FP7A 1G2IA 4I4NA 5IM5A 4CF5A 3VNSA 4AQYB 3KK0A 4MLPA 4O2AA 1QFJA 1Z8FA 4RNCA 2OWEA 4BXOA 1LW6E 2HWKA 2I80A 3SZ3A 1PR4A 2A30A 3PG5A 3WSWA 4DIFA 2DLNA 3ADPA 3DDHA 3PP8A 3VR4H 1BS9A 3QQPA 4H1WA 3AEXA 1L4FA 3NIFB 4CKCA 3HDTA 1OQAA 2BI8A 4XX0B 4M88A 3Q6NA 4X6LA 5J2TB 2XKKA 5EIBD 3NT4A 4DBZA 1V1MA 2ODBA 4CM7A 2NG1A 3NTRA 1EFVA 2YC4C 2ZUVA 1FZQA 2JZOA 2J32A 4LGMA 2UYCA 4ZCTA 3M1YA 2F1KA 3SK0A 4EATA 5AW5A 3R9WA 3CBGA 2OAEA 5G1NA 3SVZA 1IWPB 4JYBA 3E5MA 1N6NA 1QRAA 1Q7RA 2L42A 3BJMA 4Q4DA 5JH7A 1VBFA 4RTMA 2UXCB 3FTCA 3ZJYA 2FG7C 3G3EA 3O21A 3OKFA 4ZV7A 1KZHA 3OM9A 4HWSA 2D0PB 3S2YA 3QF7A 10MHA 1RIFA 1TA4A 1V2GA 2V6IA 2FY8A 2W22A 4XA8A 4DDMA 3OT1A 3A14A 2GA8A 1C1DB 2CZCA 2HQSA 3BCUA 1B2LA 2QM7A 4HGZA 1DARA 1O2DA 3PD0A 3LT2A 1E2NA 2WG0A 4HG2A 3ZWKA 5EE9A 2WNHA 4JBIA 3VC1A 1UXJA 2XNJA 2Z43A 3LZCA 1DC5A 1GOTA 4LZPA 1O5IA 4CFSA 3LKDA 1TW2A 4EF6A 1NC1A 3FD8A 3IXLA 2X77A 5JS6A 2HJSA 3NW9A 1WW2A 2IEIA 4FX2A 5REQB 1TKBA 2PLFA 3K1ZA 5CW2A 3IIKA 1Z26A 4NULA 1OLSB 2BM8A 1G63A 1FRVA 3LO8A 2PK3A 2P2YA 4Q3CA 1UKZA 3NYQA 4Y2PA 3HZZA 3T9FA 4GVPA 1E1NA 3WICA 4JI4B 4URFA 4UHKA 4EI7A 3TG8A 2BEKA 3RANA 4EA9A 1UR5A 4WY8A 4F4JA 1ZL2A 3Q98A 3G6KA 4JQSA 1IL0A 2HK8A 1DAOA 4BP3A 3NEYA 3AIIA 1N2HA 5TJHA 4X1KA 1BDBA 4D9NA 3ZV5A 5FTMA 3DCNA 1SCJA 2P1DA 3DE7X 3WB0A 5LSAA 1UP7A 3WS7A 3U81A 3WTCA 4IOJA 3NXSA 4RHEA 3NHZA 3ICQB 2I6GA 5CK5A 4YRTA 3EEYA 2C3YA 3E5RA 3QBJA 4RZHA 4FHDA 1JMVA 2QUZA 4PG6A 4L02A 4Z49A 4E5VA 2YBEA 3KKLA 2FZVA 3EXFB 2DWCA 3PBKA 4C78A 3SXUB 1ES9A 3TW8A 1L5YA 3H2BA 4CIWA 3HKCB 5FUMA 3QVKA 1ILWA 2WTXA 3ESXA 4RDHA 1GZ4A 5ALHA 2F8LA 3TD9A 3EIOA 1IONA 1PJSA 1HT2E 2OBBA 3OUZA 3OJXA 4OFWA 4R7TA 2QN1A 3IIIA 4ZVQA