2C0CA

Structure of the mgc45594 gene product
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
353
structure length
353
Chain Sequence
b'GVDLGTENLYFQSMMQKLVVTRLSPNFREAVTLSRDCPVPLPGDGDLLVRNRFVGVNASDINYSAGRYDPSVKPPFDIGFEGIGEVVALGLSASARYTVGQAVAYMAPGSFAEYTVVPASIATPVPSVKPEYLTLLVSGTTAYISLKELGGLSEGKKVLVTAAAGGTGQFAMQLSKKAKCHVIGTCSSDEKSAFLKSLGCDRPINYKTEPVGTVLKQEYPEGVDVVYESVGGAMFDLAVDALATKGRLIVIGFISGYQTPTGLSPVKAGTLPAKLLKKSASVQGFFLNHYLSKYQAAMSHLLEMCVSGDLVCEVDLGDLSPEGRFTGLESIFRAVNYMYMGKNTGKIVVELPH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ZINC BINDING ALCOHOL DEHYDROGENASE, DOMAIN CONTAINING 2
publication title The Structure of Mgc45594 Gene Product
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 124
structure length 353
sequence length 353
chains with identical sequence B
ec nomenclature ec 1.3.1.48: 15-oxoprostaglandin 13-reductase.
pdb deposition date 2005-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2c0cA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2c0cA01
1UXGA 3INGA 1HTBA 1E6WA 1IZ0A 4MP3A 5JAIA 2CVQA 3NDRA 4ONEA 4NR0A 1H2BA 4A10A 4BKRA 5JAMA 4XX0A 1EVJA 2JJYA 3JD2A 1R6DA 3DZJA 4JBGA 4NDNE 5ER9A 4CQMA 2J5RA 1DIBA 3ANMA 3JQ9A 5CDTA 1GL3A 3KZVA 4QUKA 3JQ8A 4AJLA 1DSSG 3B1KA 2OXIA 4BGUA 5JS6A 4MVJP 5IAAA 1QYXA 1KEUA 1Y6JA 5CG1A 1U7TA 2EKPA 1A27A 3ZHXA 2DT5A 1P74A 2YV2A 4IDDA 1GD1O 1NVTA 1E1MA 4GMGA 2UUOA 4KQWA 4J3FA 4P4GA 3WJAA 2CVZA 1DRVA 2AG5A 2YFQA 4YJGA 4ZRNA 4RORA 2JFHA 3QY9A 5EPOA 1DAOA 2PGJA 2ZTUA 5THKA 3OP4A 1H9BA 3I6QA 1R0SA 1NHGA 3U49A 3HN7A 4YT8A 2OHXA 1W8DA 3OQ1A 3O8QB 1ZBQA 4X54A 3I4CA 2HUNA 3N58A 1ENPA 1ZNQO 2C20A 3DO5A 3JQEA 4I08A 4BO3A 4DYDA 1HDOA 1KEPA 1KOLA 1IOLA 3ANNA 1BGVA 5L45A 1DLJA 4CMIB 3EVTA 4TRJA 3PVZA 2EERA 3PHLA 1V3UA 1NNUA 4M55A 1LDMA 4QTZA 2W90A 4RL6A 4ZHSA 3ZWCA 3AY7A 3GRPA 2BELA 5GZ6A 3WNVA 2VWPA 3GC6A 1C14A 1OOEA 4BNKA 4OQYA 5L7WA 1KBZA 1GZ4A 3KV3O 3I52A 4UVDA 5BT9A 1MUUA 3WLFA 4U5QA 5A4DA 1I33A 2C59A 2O2SA 3ZU2A 1PJLA 4ND1A 4LN1A 1JKJA 2VUTA 3CIFA 3P2YA 4CUJA 4YJDA 3TDKA 2ZCUA 4XCVA 4GBJA 3ZWNA 4RJTA 4YACA 3I4FA 4M8SA 3AFMA 4K9DA 2DC1A 1P1IA 3L4SO 5TRTA 3CINA 4K6CA 2NVUA 1XU9A 4PLCA 3QWFA 4FFLA 5AYVA 3WGTA 3ZU5A 2YJZA 4UVIA 3RVDA 4CPDA 1E1LA 3UGKA 1PQWA 4NJMB 1BRMA 1PIWA 1R15A 1DBVO 1LSOA 2Q45A 4YTEA 1QG6A 2G17A 1DIHA 3JQGA 4ESOA 2VTEA 5L53A 3UCEA 3JQBC 4GSKA 1AGNA 4XQEA 4LVUA 4PLVA 3LU1A 3CXRA 5T6BA 4E4YA 4W9NC 3F1LA 4YJHB 1MXHA 4AJOA 2AE1A 1I36A 4Q3AA 3WSWA 4S3MA 2B37A 3K31A 3OIDA 1E3LA 2VRCD 3GEDA 4IINA 1WLYA 5B12A 3WGYA 2EJVA 2O3QA 3KSDO 4LCJA 1I01A 1YL5A 2I3GA 3E9QA 5GY7A 3VH4A 3ZW9A 5A9TA 4IDCA 2Y68A 1QYWA 5FEUA 1BVUA 2D5AA 2O3SA 3D3EA 4Q3DA 4CM7A 3DBLA 4ZQEA 3DTYA 1RM4A 4IPTA 1I3NA 3PHJA 5TT0A 1MG0A 3RUFA 3E6AA 2Q1UA 4FS3A 3VHRA 2CDAA 4AJ1A 5L9AA 1L7DA 1S6YA 3R6DA 4QFCA 4BB5A 4DQUA 1E7WA 5DBIA 2PZJA 2OORA 4UEOA 1VLLA 1JQBA 4FC7A 2NTJA 3CMCO 2ZQZA 4NZ9A 1D4FA 2Z1MA 3RBXA 4WGGA 1GR0A 3I1JA 4EEZA 4R41A 4I9UA 3QJ5A 4MVJM 4CL3A 4MO2A 4AJIA 1Z45A 2AXQA 2DUWA 4PGFA 4E0BA 1BDMA 4DQVA 1EEHA 4GVXA 3FNGA 2JD2A 5EQFA 1I2BA 4Z3DA 1G0NA 4ALJA 1DEHA 4IQGA 1DIGA 2D59A 1LJ8A 2B4RO 1ZK4A 2FN7A 1HF3A 4MDHA 2C7VA 2CVOA 2W8ZA 1LDGA 4AJPA 5AQ1A 3RUCA 4CMBA 5CHEA 4L74A 1V3VA 3G49A 1QYCA 1B3BA 3GZNB 3JQ7A 4BS9A 4TZTA 3SC4A 2NM0A 2W2KB 1HE2A 3KHUA 3NTOA 3JCZA 1YDEA 1NM5A 1YOVB 3O8QA 3ICPA 4XA8A 3GT0A 4CLHA 1DPGA 3DBHB 3WG9A 4CLEA 2IYOA 5F3RA 1K0UA 4PN3A 4FJ2A 3KUXA 5JDIC 1B14A 1UH5A 3DR3A 2H9IA 2NTVA 1E6UA 4CR7A 3AUTA 4PLWA 5JY1A 3GPDG 4CMIA 1U7HA 4GKBA 4RPLA 2WTBA 3Q11A 4I9HA 3KSUA 2GN8A 4HFMA 5ER6A 1A9YA 2NWQA 3QIVA 4AJKA 2DBQA 3ZU3A 1LSSA 5AXBA 5DP2A 2UYYA 2E49A 7MDHA 1GAEO 1I30A 2AEFA 2VRCA 1Z75A 2Q4EA 3LLVA 2P5UA 4NHEA 3RKUA 2CZCA 1P44A 4LSMA 2P5YA 4D45A 2HJSA 4XYMA 1WDKA 1T4DA 2O7SA 4KZPA 4QEDA 3JYNA 3AUAA 3UHAA 4WNCA 3F4LA 1ZK3A 5L3ZA 2G76A 1VI2A 4BQPA 4ND3A 5F5LA 5L4SA 3X2FA 4CV2A 4ND2A 1N1EA 5GZ3A 3UXYA 2D5CA 4EITA 1LQTA 3VDRA 3ZH2A 1XCBA 2AEJA 4CM3A 3JV7A 2C29D 1N92A 1RKXA 4Y67A 6ADHA 4DQXA 2WD8A 4NJMA 4HFRA 2IZ0A 1X13A 4XQCA 4AICA 2C0CA 1XU7A 5K6AC 1YB5A 3LT2A 3NJ4A 3BHJA 4XZ3A 1HT0A 1ZK2A 1L1FA 5A04A 1NFFA 1XIVA 3U09A 1HSOA 4XWYA 4DA9A 5A9RA 5HWSA 2ZB7A 1WNTA 1PTJA 4WASA 3GNSA 2EW8A 4IXWA 1C1DA 1RYEA 3K30A 3NRCA 1O8CA 1Y9EA 2WE7A 4J6FA 3SLKA 1UP7A 1LSJA 2FR1A 4ZQBA 3UN1A 5ADHA 1NQ5A 3IUSA 3VVBA 4ND4A 4NBWA 4MVJF 4PLFA 1SOWA 1XDWA 5J23A 1CJCA 3KYDB 2CY0A 2ZB4A 5U1PA 4CMEA 1LDNA 1OC4A 3DZFA 1M2WA 3BHMA 3PEFA 3FBGA 5IFLA 2PKQO 1D1SA 4L76A 3AUSA 4DXHA 3S55A 4NBRA 1ISJA 1ULSA 2FZEA 3G79A 3MWEB 3DBVO 4M49A 4CM6A 4HP8A 1GFSA 1FF9A 4CV1A 3NDJA 4A2CA 1VKNA 1P1KA 1XG5A 2B0JA 1IB6A 2PK3A 4H15A 3WICA 3VKVA 1DFIA 1CWUA 4R5HA 1WP4A 4HNGA 3SBOA 1H5QA 2GZ2A 4QFDA 3WWYA 4F3YA 4O0LA 1O94A 2WWRA 1DJQA 5JCJD 2C2XA 4ZQHA 5ENVA 3QVTA 1T2CA 4JX8A 1NQTA 1ZMOA 1ORRA 3K8ZA 4WCDA 1EE9A 4D41A 5A1TA 3K5PA 4CQLB 3PI7A 3E18A 3IJRA 4EBFA 1QMGA 2DFDA 3C7CB 4ILKA 4BKUA 4L4RA 4ZRMA 3KBOA 4Q3EA 2B36A 2Y66A 1XKQA 2Q49A 1T4BA 4LGVA 4BO6A 5H82A 3V2HA 3C3XA 4GSLA 3MJEA 3OJFA 3GZNA 1PJCA 1LLDA 4WCFC 3ZHZA 1U1IA 2W2KA 4TSKA 4Y9DA 4YAEA 4BMSA 3NT4A 3TSCA 1SB9A 2GGSA 1Q0HA 3IP1A 1DLIA 3U4DA 1Z6ZA 3ZWYA 3DBHA 4BMNA 3HNPA 1IYZA 3PWZA 2BFOA 1N8KA 3PK0A 4OL9A 4BNMA 1ARZA 1XWFA 2HSDA 2NLOA 3AI1A 4J7CA 1LSUA 4YB8A 3M6IA 2OUIA 4XYGA 3O4RA 4ZGWA 2FMUA 3LC7O 1TT5A 3DHYA 5CPBA 3ZHBA 4YA6A 1PL8A 1CF2O 2A92A 1NFQA 5TS3A 1ZEJA 4LMRA 1B15A 2OZPA 2CFCA 2NTNA 1O6ZA 5IDXA 3RFTA 5A5FA 3GH3A 4OHUA 4XQGA 3R3JA 3E03A 3WGOA 1E3WB 1LA2A 3H3FA 4D79A 1O0SA 1T26A 1VJTA 4U6SA 4I5GA 3T7EA 2D0IA 3R3SA 5A3VA 3SC6A 2OMEA 3AFNA 2DBVO 2C07A 1KVSA 2OOSA 3K9QO 1NVMB 3PHHA 1H0KA 2QYSA 3BIOA 4BGEA 2WSBA 2NV6A 2ZATA 5THQA 4RZHA 3MWDB 4FIZA 3ULKA 2BI7A 1ADBA 2DBZA 3EK2A 4DBZA 3OETA 2PH3A 1P0CA 1QLJA 2QHXA 2ET6A 2IEBA 1A9ZA 4BOYA 1LEHA 1K6IA 5JAZA 1IZ9A 4A27A 1XYGA 2Q46A 5EJ2A 2EP5A 2NNLD 5JNLA 3WGGA 4NH4A 4KDFA 3VTFA 2POQX 4JGBA 5JO9A 1XR3A 3OECA 1J0XO 3LT1A 1PJTA 1JLLA 3GMSA 3BMOB 3BYZA 3OQ6A 3GDFA 3VAZA 3INRA 4AL4A 3L4BC 2BMAA 1EBFA 1ZO8A 5I8ZA 4R3NA 2GO1A 3OEYA 1F8FA 2QX7A 1ZEMA 2RHRA 3L07A 3MEQA 4YVFA 5TQVA 3E82A 1R0KA 4UAGA 2EJWA 3FHLA 4JP3A 3D0OA 4GKVA 3RU7A 1UP6A 1WW8A 3QVOA 1PR3A 1NPYA 4I5EA 4B3HA 2C54A 1YB1A 4BO2A 3P7MA 2Z95A 1VL0A 5JC1A 1PJ4A 3DFZA 2Q99A 1JAYA 1UAYA 3G1UA 4EYEA 2PZKA 1DB3A 4OOFA 2VYVD 2X5JO 4U0JA 4D3SA 1T1RA 2I6TA 3L0DA 5A03A 2D4AA 4R51A 2VHYA 4A5OA 4FFMA 3WB9A 1GYRA 1X0XA 1KIFA 2IE0A 1GQ2A 1F12A 1GUYA 4RQTA 1JWBB 5DOZA 1EK5A 3Q2IA 2HMWA 2Q1SA 2VQ3A 3OM9A 1GUZA 2FR8A 4BO4A 3CZMA 3GAZA 1SPXA 3DC2A 4B8ZA 1CYDA 4R1SA 1ISHA 3DAFA 4GLOA 4WPGA 1G1AA 1KERA 3NV9A 4DLBA 4N5LA 3C1AA 1BXZA 2XF8A 3NGXA 1X7DA 2X1HA 3WWZA 2FPIA 3Q9NA 4DYVA 3M2PA 2W2LD 4IJWA 4JXKA 4FOOA 3P19A 5KCZA 1M6HA 5A05A 4RPHA 4Z3KA 1O95A 2BLLA 3LT4A 4OO3A 1D3AA 1G6KA 1OC2A 1TXGA 2IRWA 4B7XA 4Q3CA 3G0OA 3ZNNA 2PR2A 2C5AA 4BNTA 1BXKA 4JNKA 3LK7A 1AN9A 5ENDA 3GOHA 2JD0A 1FDTA 5L4NA 3F46A 3IC5A 3NT2A 8LDHA 1IUKA 4KWIA 3DZHA 3ZCXA 4FW8A 4YT5A 4O59O 1PGJA 4HFJA 4JIGA 4YQZA 5LCXA 2HRZA 3V2GA 4TROA 2HDHA 1YJ8A 2RHCA 4IQ0A 4EEXA 1PSDA 4IUYA 5COAA 2FP4A 2O4CA 4XKJA 5HBRA 3TFOA 1CIVA 1DHTA 3GGPA 3ICCA 1P1RA 4NU6A 4IJUA 1HDZA 2G82A 2H5LA 4WLEA 5U4QA 5KOIA 1DO8A 4CMHA 4BMVA 1E3WA 4RPJA 1BXGA 1I3KA 1HYHA 4A0SA 5IDQA 1IY8A 1L7EA 1DDOA 3I9OA 4OJNA 3RFVA 3K6JA 3ZWXA 1X7HA 1LNQA 1EBUA 1Y9AA 2AMFA 3D4NA 5LC1A 3QE3A 3AUUA 4Z9YA 3JQFC 5L40A 1J49A 5DCWA 4DWVA 4DMMA 1E7MA 1QR6A 5DN9A 3FF4A 3ZGYA 4YT2A 4ZD6A 4CM1A 2O3RA 5BNFA 4TRMA 2GSDA 4GWGA 4WCFB 4J2HA 1MFPA 2PZLA 2JL1A 1GU7A 3DDNA 4FGSA 3S2EA 5JBIA 1Q0LA 1Y1PA 3MJCA 4RF4A 1LXCA 4OXKA 3PFFA 1EVIA 3O26A 2HRBA 4DBVO 1EDZA 2Y1FA 3AOEC 5IN5A 1KS9A 1V0JA 3FNFA 1TI7A 2W2LA 1SEPA 1XELA 1FXSA 1X1EA 1ZMTA 3ORFA 1YXMA 2EG9A 2V65A 4JQCA 1E7QA 4IIVA 1GADO 2X9VA 3RC9A 3ONFA 3RSHA 4J43A 4CMAA 2ZB3A 5CDUA 4W7HA 5F1KA 3ZWVA 4PG8A 1LQUA 1DRWA 2NU6A 3GHHA 3BTOA 2P9CA 2R6JA 3G1TA 2FPPA 1YVEI 2VNAA 3D1LA 5EMHA 1YBMA 4K28A 3GPIA 4WECA 3DOCA 1E3JA 4ZU3A 4CMJA 4AVYA 2JKVA 2Y0DA 4L75A 2WEKA 4B4VA 4CR6A 2BRUA 4FFRA 1P1JA 5DULA 1K6XA 3S2IA 3H9EO 2IZZA 2ZTLA 3UAGA 4DTIA 1DIRA 2FRDA 3K2BA 2FWMX 1TA4A 1U3VA 3IAHA 2G5CA 4EJ6A 1N5DA 4JJFA 1WPQA 3C7AA 1ZJZA 1Q0QA 3WDSA 2XAAA 5CG2A 4JROA 4Y6PA 1JDJA 4RCVA 2OBYA 3IQDB 1W4ZA 3JQAB 1E6EA 3WFIA 3G3EA 2DTEA 3QWIA 1U5AA 1O9BA 4ID9A 3U4CA 4P4LA 4J1NA 3WNQA 3IIEA 3MZ0A 4PLZA 3ZNPA 3SX2A 4N54A 3KETA 1HZZA 4JCOA 3WQSB 1A4UA 1R0LA 2HU2A 2H63A 4IMPA 4KQXA 2A94A 3Q0EA 1MGOA 1MLDA 3DMTC 5TIIA 1LRKA 2EWMA 3BA1A 2VUSA 2TMGA 4BKQA 2DPGA 3SJ7A 1ZIDA 4XGNA 3E8XA 1A72A 2O3JA 4HBGA 4O5OA 2HMVA 2ZTVA 1V6AA 4CM4B 1M66A 2VOJA 1N2SA 3BMNB 5JC8A 3OBBA 1VJ1A 3CKYA 4M86A 1JW9B 4ZQFA 4CUZA 3K96A 2OP0A 2CUKA 4W82A 1KY5A 1F0YA 3RU9A 1OBFO 1R12A 1YBAA 2Y1CA 5A5EA 4J7XA 2PNFA 2HK9A 1ISGA 5KWEA 2F1KA 1U4SA 2DVMA 3ITDA 1PJBA 1ZUD1 5KVQA 3S8MA 3OQBA 4RVHA 4TKMA 1DIAA 3U9LA 1DFHA 3T4XA 4BNGA 1RPNA 5JSFA 2X0NA 5T67A 1I24A 1EUCA 3ZV5A 4HUJA 1NYTA 3MJVA 2HAEA 4BO1A 1EVYA 2W4QA 3KYCB 3FCOA 1ZCJA 3H9JA 3R1IA 3VPSA 4L8VA 3GA0A 2AW5A 1R4NB 1QYDA 5T8KC 1R4MB 2PKRA 5A3JA 2HK8A 3BXXA 3B6ZA 1LX6A 2DBRA 4WCFA 1DHRA 1YS4A 2J5KA 4HNHA 5KVSA 4URFA 4H7PA 1F17A 1BHSA 1VM6A 4P38A 5DCUA 3WQRA 4XD2A 3GAFA 4PVDA 3K2EA 5JDCC 4AJ4A 4WOKA 3MTGA 5T57A 1VE9A 1A7AA 3KLMX 3TF5A 4MKZA 1NTOA 3JYQA 3OMLA 1P1FA 5AXDA 5I8WA 2RH8A 4BL5A 3P2OA 1KC1A 3I9LA 1JVSA 3DOOA 4J49A 5JE8A 3WXBA 2DKNA 3A28A 5KVCA 4NK4A 4AFNA 1ZJYA 3QVWA 1IHXA 1P3DA 3AJRA 1PJSA 3PGJA 4PLPA 2PD4A 4I5FA 1BW9B 1KVUA 1DRUA 1UR5A 4YAKA 3UCXA 3O03A 4DIBA 1YBVA 3B70A 4IJKA 1HZJA 3RBZA 5H81A 5BSGA 2C7GA 3I9JA 3I9MA 4XJSA 5G0SA 3RC7A 5F1PA 4B4OA 5C7LO 5L4LA 1DJNA 2VUUA 1YL6A 1NVGA 1QLHA 2X9GA 3PHIA 3PXXA 4F46A 1ZW1A 5COBA 4UUOA 1HYGA 1PGOA 1CETA 2J5QA 3D3WB 1JKIA 2JAPA 4MP8A 4DC1A 3RKRA 1K6JA 3VZRA 4E13A 3F9IA 3K73O 4YRAA 1NAIA 3OA2A 4QX6A 2NQTA 4BNFA 3FD8A 5AXAA 4E5MA 2HMTA 1H94A 4OM8A 2WE8A 1Q2XA 3ENNA 4E12A 2B69A 3RCBA 4DGSA 4FC6A 1WDLA 1QV6A 2WM3A 3M1LA 3PPIA 2AEMA 3IMFA 3WS7A 4EUEA 1A7KA 3BHIA 4DPMA 3I23A 1B8UA 2CF6A 1H9AA 1EK6A 3CSDA 4GX1A 4QXMA 1GCOA 5FF9A 2QZ9A 4BNLA 3H9GA 4PLYA 3L4BA 5L95A 1N7HA 2UDPA 3F47A 3LLSA 1PS0A 4QQRA 4DLLA 3RUIA 1WZEA 5L7TA 1UDAA 3HDQA 4PRLA 4HX5A 4FQ8A 5JYDA 2JFGA 3WX0A 2P9EA 4OGWA 2AHRA 2FSSA 4R1NA 4RVSA 1MG5A 3D64A 4I1IA 3VDQA 5IZ4A 4MKRA 1Y5MA 4CM4A 4BNZA 4D42A 3ADPA 1DC5A 5ES3A 3VKUA 3I9NA 4R16A 1OAAA 3HJAA 3MJ4A 1MFZA 3CUKA 2B83A 3DL2A 4D43A 1WMBA 3WMXA 5TSDA 3HZZA 1LC3A 1YDWA 4XR4A 4CJXA 2Z1NA 2OP1A 4FB5A 3LC2O 1SBYA 3U0BA 4EZBA 3JTMA 2R00A 3WOHA 2AQIA 3PWKA 2VNSA 4J4BA 2ZYGA 5DT9A 4BIIA 5G0WA 4OKNA 4EDFA 2O4UX 3EAGA 2DFVA 2PGLA 4K6FA 4CLRB 1Q7BA 4GMFA 1E7RA 4PLGA 4B3IA 4C7JA 1D7OA 2WD7B 3A06A 4YRBA 3KYCA 4UULA 5TLSA 4GH5A 3PDJA 2HCTA 3OJLA 2HO5A 4IS2A 2FR0A 3GFBA 1R4MA 1FDVA 1HYEA 3DZGA 2JCVA 4D44A 4Z6KA 4G81A 2VYND 5ILOA 2RCYA 2I99A 4MIYA 1LRJA 3OEWA 2PV7A 3ON5A 1EQUA 4YJHA 3FPCA 2Y1OA 3VVCA 4E5PA 1SNYA 5EL0A 3JQ9C 4CM8B 4FR5A 1F06A 4EUHA 4H16A 2NU8A 2GN4A 5ICMA 1QORA 4O63O 5CDSA 4II2A 4GPD1 1EMDA 4OMUA 4RPKA 4CUKA 3ZWWA 5HA5A 1H6DA 3O38A 1E5LA 2DQ4A 1Z74A 3WGZA 2HKIA 4JBHA 4DPLA 1OI7A 2V6MA 4WOJA 2I66A 3MOIA 1JWAB 2X0RA 3MTJA 3NJ8A 4WEQA 3OJ0A 1FMCA 1Z7EA 3ST7A 3WBFA 3PQDA 4U7WA 4CM5A 2GDZA 3H8VA 2GN9A 3DWFA 4IMRA 4PG4A 3VPFA 3TQHA 4GX2A 1KY4A 1VSUA 3L6DA 3Q2KA 4FPXA 3ZWMA 4RZIA 5HS6A 4LW8A 2EIHA 3ETGA 3WLEA 4U8GA 2YQ5A 3CE6A 1FJHA 3RUHA 2E48A 1KEWA 4XDYA 3W8FA 3D3WA 1SO8A 3QRWA 4ITUA 2V6FA 2GCGA 4GLLA 3A1NA 1HXHA 3Q9UA 4MVJH 5A9SB 3A9WA 2YHIB 1DAPA 4O6VA 5AOVA 5IXSA 1X15A 3X2EA 1H6CA 5FFFA 4N7RA 4OIMA 1HWYA 3H2SA 1HL3A 5I7FA 3QWBA 3PJFA 3F4BA 4RVGA 4DUPA 5I7SA 4GX0A 4IQ8A 2XPCA 3ADOA 1SEVA 1U3TA 2GLXA 4BNHA 1I10A 4OH1A 3HHPA 2X4GA 2YUTA 3BMCB 3AY3A 3ITKA 3ZN2A 1B2LA 3QQPA 5C5IA 3HDJA 4AJHA 2Y0EA 2IXAA 2YFHA 1E77A 2H6EA 3C85A 1NPDA 4PIVA 4BQRA 4NNJA 5KJFA 5TGDA 1YONA 3CPSA 5F21A 5JMWA 1YOVA 3AI3A 2G0TA 4RQUA 5BR7A 1ZH8A 2D8AA 5CDYA 2VYNA 1ZK1A 1Y8QB 4NMHA 2VHZA 3VTZA 2BHLA 4RV9A 1X1TA 3GGGA 3NEPX 1Q1NA 2O50A 3UF0A 2NU9A 2E82A 1E3EA 1A71A 4MVJE 4BNJA 4U0KA 2I5PO 4IBOA 4XB2A 5IN4A 1ADCA 5BQFA 1M67A 2F00A 3VZSA 5HRUA 2BKAA 1U3UA 2JHGA 3LVFO 3VH3A 1FK8A 1FDSA 5B4VA 4IXTA 1PGQA 3P5SA 4UUNA 2EP7A 4TVBA 4R5MA 1IPFA 4FGWA 4FCCA 3MJTA 1DC3A 1YKFA 4LMPA 5EN4A 3TZ6A 4RLHA 4M1QA 3GVHA 1T2AA 4R69A 4MPDA 3U5TA 5DOVA 1Y5RA 4K1LA 1SAYA 3C1TA 4P8RA 4WNIA 3C8MA 3Q1LA 1CRWG 3QA9A 1C0PA 4CLDA 3PZRA 4E5YA 2JCXA 3KEQA 2E4AA 4O1MA 3U4HA 2BFPA 4IDAA 3EYWA 4HADA 4CLRA 3TFQA 1YGYA 1SB8A 3PLRA 3SEFA 3FTPA 4UVGA 1DC4A 5CPFA 2EKLA 3ASVA 1YO6A 3W6ZA 1ISFA 3GDGA 3GVIA 4IDFA 5A06A 2ILTA 2HMSA 3EY4A 2HK7A 2WYUA 5JCJA 5K1SA 3SJUA 2I3AA 1D1TA 4AG3A 1CQIA 4NBVA 4JP2A 4LK3A 1JTVA 4D3DA 4J91A 4J1TA 1V9LA 4J2OA 4JBIA 1R37A 2X8LA 4HV4A 4LRTB 5G0TA 2AG8A 2B35A 4XR9A 3ZW8A 4E33A 4FDAA 1HDGO 4AJJA 3Q3CA 3GUYA 3UH1A 1VSVA 1PQPA 2PKQP 3PJDA 1I0ZA 3JD3A 1CDOA 4FFPA 2Y05A 3M1AA 4EW6A 4CV0A 3AK4A 2FY8A 2IODA 5A02A 3OHSX 1JA9A 3KYDA 3DBRB 3VZPA 4J0FA 1SOVA 4A03A 3KLPX 1ZSVA 4TKLA 3DAPA 4A26A 5FYDA 3FWZA 2Q2VA 1YQDA 7ADHA 3K92A 1GYQA 1HE3A 4EJ0A 2TMDA 3RQSA 1WWKA 2BFMA 1I3MA 5CEJA 4OQZA 3OF2A 3KSZO 1I3LA 1TT7A 2Q3EA 2CDBA 1BMDA 3V2UA 3NUGA 2GZ3A 4QO8A 5CP8A 3DQPA 3W1VA 2NVWA 3PGXA 1NQOA 4L73A 4CLXA 1B16A 1IULA 4BNNA 1KVRA 3TJRA 1BWSA 4BO5A 3PJEA 5HS4A 1NFRA 1WAMA 4RGBA 2P4QA 3ASUA 1T25A 4BO8A 4MIEA 2Q1WA 1BTOA 2GD1O 3TRIA 2J3KA 4TRRA 3VOSA 1I8TA 3TZKA 3HB5X 3PFWO 1K3TA 5DZSA 2VZ8A 1KVTA 1PX0A 4XIJA 4CQLA 2QRKA 3IP3A 3JQBA 3QVSA 2W98A 1GZ3A 1WXDA 1RJWA 4OKIA 2NADA 2UAGA 3BMCA 1BSVA 1CQJA 4W9NA 3RI3A 2GPTA 3DMYA 1PGNA 1ONOA 2NVBA 4CQMB 1ZXLA 3CMMA 3E9MA 4J1QA 3O9ZA 1YRLA 1E92A 3ZWBA 3GEGA 5F5NA 3DZKA 1U8FO 3BZUA 1P9LA 4OYRA 4Y6RA 1HE5A 2A4KA 4RVDA 1MC5A 4JLWA 5ITWA 1SCUA 1P31A 2R2GA 1XSEA 2QRLA 4B4UA 5I9NA 1X7GA 2O7QA 3F5QA 4WLNA 1JU9A 3RC2A 5HM8A 2I9PA 4RF3A 2EW2A 1M76A 4IGFA 3FI9A 1AXGA 3NT5A 4FN4A 4RVFA 4D0RA 1HLDA 3IKVA 3VPGA 5JPIA 2JFFA 3PP8A 4DPKA 3T4EA 1J4AA 1HDRA 5BNIA 3WBBA 4CV3A 5B37A 3TL2A 3WTBA 2BGKA 1BDBA 5ICSA 3JYPA 1U2DA 3HB4X 1GV1A 3QP9A 1VL8A 3KB6A 2Y1EA 1ENOA 3FR8A 3KVOA 1HE4A 2DTXA 3ZNOA 2O2YA 5LDHA 1H93A 1UXKA 2VN8A 3GZ4A 3Q6IA 3DAGA 4MVJI 4NPCA 3GEMA 4B8WA 1W73A 1B8PA 2QRJA 1E1KA 4FOSA 2O3UA 5T64A 1EQ2A 2ZIZA 1PS9A 2VRBA 4R9SA 1OMOA 3TZCA 2VYVA 4UVEA 2IEDA 2I76A 4UVHA 1PJ2A 3SXPA 4E3ZA 1IE3A 3I5MA 1HDXA 4CQMD 4GI2A 1OZAA 1T1SA 2Y1DA 3GNTA 4PZCA 1HETA 3RWBA 4UUMA 1YL7A 3RJ9A 1E7SA 4N18A 3VH2A 5C3MA 1KETA 2CSUA 3D5TA 5EQDA 1HKUA 1UZLA 3L9XA 3HE3A 2IZ1A 2GASA 3GMDA 2WYWA 3BMOA 1EUDA 1Z73A 4IM7A 1YB4A 4HXYA 3H4VA 4EJMA 4RO0A 5K9ZA 5JDIA 3V1UA 4M87A 3EW7A 3H2ZA 1P45A 1ULUA 4GVLA 4KUEA 4XIYA 3UOGA 1ZXBA 4OAQA 1V35A 3PZBA 4B7UA 4C7KA 4TMFA 2X22A 3AM4A 2EGHA 4AJ2A 2WJPA 3ABIA 3HDYA 2WMDA 2C2YA 3COSA 4TQGA 5BSFA 5JYEA 3KTDA 4QECA 1JKFA 1K2WA 2ZB8A 3H9QA 3OA0A 4L4SA 4ZJUA 1MX3A 4BV8A 1R66A 1MC4A 1NWCA 1TVEA 5K0ZA 4GGOA 4YYZA 1NWHA 3VPHA 1VPDA 3D4PA 3JQCA 3HFSA 1UDBA 2X23A 3U3XA 6LDHA 4ZQGA 2AQHA 5JLAA 4J16A 1EUZA 2Q1TA 5JO0A 2BI8A 3LYLA 3MOGA 4FSHA 4ZVVA 4F6CA 4YCAA 1E7YA 4MKXA 5C37A 1B8VA 2AQKA 2YW9A 3WR5A 1HLPA 3KEOA 4R4JA 3KXDA 2QG4A 2GNAA 5K6AA 3AY6A 1LUAA 4CM9D 4YAGA 5I7VA 3ZWOA 2QQ5A 3HG7A 4W99A 4GAEA 4Y8VA 5TX7A 3WIDA 4HWKA 2Y0CA 1IHYA 2PD6A 2B4QA 1XQ1A 2QIOA 1GPJA 5EERA 1H6AA 1PU2A 3UKOA 5CDGA 4R1UA 3RC1A 3LC1O 2H1SA 4Z9XA 1Q7CA 1SZJG 2PGDA 2SCUA 2X5KO 3F3SA 4L9RA 4E2WA 4KWHA 4HY3A 4E2YA 1LDBA 3FPLA 4Z0HO 3TOXA 1W0CA 2Y93A 1M75A 5G0VA 1H2HA 3A4VA 3BTVA 1LLCA 1UZNA 4U6QA 3JQ7B 4PLTA 4XGKA 1H6BA 2A35A 3MJSA 3TPCA 5AVOA 3H3JA 1GEEA 3GG9A 3EHEA 2BFAA 3TNLA 3GUCA 2EHDA 4G65A 4KDEA 1O89A 4XYBA 5KJEA 4ZN6A 1ZFNA 3H7AA 1PQUA 1E0DA 3GFGA 1B26A 1UAGA 3GR6A 3GF4A 1LI4A 1T2EA 3H6KA 1I32A 2XOXA 4NIMA 4PFJA 4K26A 1HSZA 4R01A 5IDYA 4DC0A 4LSWA 5HTOA 1XLTA 1KVQA 4EUFA 2EF1A 3E5MA 1ZZEA 3AI2A 4RPGA 1NQAO 2FHSA 2Y1GA 2JHFA 2CF5A 4DLAA 3JQAD 1PR9A 5CEEA 2Q50A 4I8XA 3ANLA 3F6YA 5KVVA 1C0LA 5G2OA 4BNXA 4UUPA 4E31A 4OXYA 4L4XA 1PWXA 2X7HA 4E32A 5EIOA 3AU8A 1HDYA 2V6GA 4MOWA 1YQXA 3PIIA 4GQAA 4YEDA 1BVRA 1IPEA 1HRDA 2RBEA 4LCEA 3JD1A 2NACA 1YQGA 4XGIA 2RH4A 4DREA 2E37A 3AM5A 3I9KA 4M54A 1GY8A 2VZ9A 2V6BA 2OO5A 4WLOA 1QXSA 2JD1A 3LDHA 1C0KA 2VHVA 4Q9NA 2LDBA 5KIAA 4II3A 5KKCA 1T24A 1TEHA 4ALLA 3NKLA 4IZHA 4CM9A 2D3TA 3FR7A 3INTA 1A4IA 3H9UA 4WLUA 2ZQYA 5KJ1A 2X6TA 3WIEA 4JJIA 4FD3A 4DVJA 4QSMA 2Q2QA 3RJ5A 5KNLA 1GPDG 4HKTA 4D0SA 1ADGA 4WEOA 3QV1A 4R9RA 4L0QA 4BO0A 1GDHA 3ZV4A 4BNIA 4OSPA 5IG2A 1EZ4A 2VOEA 1PZFA 5KKAA 4IS3A 5CEFA 2VTDA 1W6UA 4ALIA 5G0UA 2HMUA 1C1DB 5DBGA 4OSOA 3PYXA 1XQ6A 3NTQA 3S2GA 9LDTA 4NQZA 1B7GO 2HLPA 3RUDA 2EKQA 4NBTA 1YH3A 3RD5A 3DXFA 5L7YA 1UJMA 2D2IA 3HUDA 4FFNA 1CERA 3BTSA 4BNVA 2GN6A 3OIFA 3W6UA 4W4TA 2P2SA 3ZDFA 1GQYA 2P4HX 3WYBA 2B4TO 3LF2A 3AM3A 5IXYA 3ZZNA 2CDCA 1QP8A 4EGFA 1UP4A 5BNTA 2XXBA 4ZICA 3PIDA 4I5DA 2YHUA 4YXFA 2ZYAA 1DXYA 5H83A 4DMLA 3NX4A 1DC6A 2X9NA 2DLDA 4LRSB 2ZKLA 4J1SA 1Y8RB 3GY0A 4FFOA 2E6UX 2YY7A 3JQAA 1C1XB 1EVZA 2ZK7A 4G5HA 1AXEA 4NI5A 3WQQA 4PVCA 5I7EA 3NAQA 1U9JA 2PTGA 1U5CA 5B4TA 1U4OA 1XGKA 3L6OO 3JQDA 2UV8A 5TF4A 1PJ3A 3WGHA 4E2XA 4J4HA 1LDYA 4PCVA 1SMKA 1IL0A 5FI5A 2DAPA 5JY6A 2VT3A 2OL4A 3PTZA 3BTUA 1Z7BA 4PRKA 3ZWPA 2EXXA 5IZCC 4A7PA 1RM5A 5IDWA 2PA3A 2CNBA 2JAHA 4KP7A 1PEDA 3BMNA 4BO7A 4XJTA 1ZSYA 4G2NA 4XDZA 5DP1A 2VHXA 2RIRA 1PL7A 2WDZA 3RAJA 4TRNA 3DZIA 3TL3A 4ROSA 3FN4A 3QWHA 1DFGA 1V8BA 1YWGO 2GR9A 4BHTA 3FTNA 4NG5A 1AHHA 3QWAA 3IL2A 4CR8A 4NFYA 2GYYA 3WFJA 4Z0PA 4PG7A 3GNQA 4E6PA 3JD0A 3TZHA 1NP3A 4MP6A 3S1LA 4KTVE 2PFGA 1TT5B 2OFPA 3E1KA 4D3FA 3VZQA 1J5PA 5TT1A 1GUFA 4XRRA 2YDYA 5DBFA 1JN0A 1U28A 3JYLA 3ZWAA 3UUWA 3GGOA 4BKOA 1GCUA 2DM6A 1P33A 2LDXA 4BNUA 3GN1A 2X0JA 4IZIA 4Q3NA 4ALKA 1GTMA 1O5IA 1R4NA 1XA0A 4BNYA 4LVCA 5DF1A 2BF7A 3A14A 3HDHA 1JVBA 5I9LA 2YDXA 3PHGA 2DTDA 2YZ7A 3C1OA 2Z5LA 3DB2A 4TVOA 4CLOB 1I2ZA 3AU9A 3IDSA 4YJFB 5G4KB 4BB6A 4INAA 3NDIA 4RF5A 1WVGA 2YV1A 5TC4A 2VCYA 4BVAA 3C7DB 3ZV6A 1N1GA 1QSGA 4E5KA 3V5NA 4EI2A 3DFUA 4Q3BA 5JAQA 1B0AA 4I9NA 1NXQA 3EZYA 3D4OA 2VWGA 1ENZA 3WYCA 1VC2A 4YAJA 1PZHA 4Y98A 1FDUA 5GMOA 1VRWA 4W6ZA 3ZV3A 1NR1A 5T5QA 3N7UA 1BW9A 3UVEA 2YYYA 2UVDA 4BGVA 1HDCA 1KEVA 4R54A 1N9GB 2J3HA 1QKIA 3G17A 4ALNA 2QW8A 5B4UA 4FJ1A 1ISIA 1CEQA 3OH8A 4QT0A 4NJOA 3WGQA 3LSYA 1T2FA 1NASA 3JD4A 2EEZA 3ROQA 1B3RA 2IDZA 1D8AA 2G1UA 5I9MA 4B4WA 3IKTA 2I67A 3BMQB 2EV9A 1K5HA 1VJ0A 2P68A 1BG6A 2PWZA 4YRDA 3HWRA 1MA0A 3MCVA 1LLUA 4N5NA 4BNWA 1M6WA 3HN2A 4WE3A 1S7CA 1UXJA 1WZIA 3JQFA 3WSVA 4B79A 3E5RA 3SLGA 2BD0A 2GZ1A 4D46A 1UUFA 5ITVA 3V1YA 2ZCVA 3CTMA 4E21A 1SC6A 4KUGA 3EVNA 4RDIA 3FNEA 1GV0A 1NX6A 2NSDA 5KTKA 5L51A 5DCYA 2ZJ0A 1Y8RA 1P77A 4W7IA 1C1XA 2OBNA 4IDBA 1MV8A 4HFNA 3QHAA 1LTHR 3D5QA 1JAXA 2OGUA 1WMAA 2QZZA 3FRJA 3H5NA 4GX5A 1NAHA 1V3TA 4J4TA 2X86A 4DIOA 5C7OO 1EFKA 3ZI0A 3AOEA 3M2TA 1FDWA 3R0IA 3KO8A 4MVJG 4BGIA 3WJ7A 3UFXA 5TJ9A 4LISA 3UCFA 4CL8A 1P1HA 4IGEA 3D7LA 3QLJA 3STHA 1XEAA 5MDHA 1RYDA 2V7PA 3GN2A 3JSAA 4WJZA 2C82A 2X58A 1Y7TA 4CODB 1YJQA 5KJ6A 2A9FA 2DU8A 3RASA 1QV7A 3PLNA 4XB1A 3L9WA 3EMKA 5EINA 1ONNA 2C5EA 2AE2A 3GVXA 3KOUA 3OIGA 4CMGA 1ZK0A 4PZDA 1U2GA 3DEYX 1ADFA 4XYEA 4TWRA 4RVUA 1Z82A 4F45A 3QSGA 4P4NA 2FZWA 3FSRA 3RROA 1MB4A 2O23A 4OXNA 4NU5A 3PRJA 2D1YA 2O48X 3B1FA 4R1TA 4D7AA 3QVXA 3TWOA 4CMCA 3GDOA 1Y81A 4A73A 2NUAA 1U8XX 4YAIA 1U3WA 3AOGA 5COQA 1E3IA 4KUHA 1MXFA 2GUGA 4PLHA 2WD7A 5U9CA 3TOZA 1AE1A 4C4OA 2B5WA 4WUVA 5IF3A 4BUCA 1E5QA 3ONDA 9LDBA 3B20A 3L6EA 3NGLA 4RLSA 3DONA 3EUWA 3S2FA 1X14A 3ROPA 4XRGA 1BXGB 2ZYDA 3U4IA 1X0VA 1UXHA 4NBUA 3RUEA 1QRRA 3PQEA 3F5SA 3RUAA 4E30A 3DMTA 4KMSA 3I6IA 4CLOA 4WK6A 4YJFA 1TB4A 5G4KA 3W8DA 3F1KA 3ROKA 4CM8A 5ILGA 1F8GA 3LQFA 2IXBA 2BGMA 4XQ9A 3ONEA 4JN6B 1TLTA 5TJHA 5BSHA 1ML3A 3HQ4O 1ZKMA 3EGOA 3OJEA 3PYLA 4GWKA 5TNXA 1GEGA 4B3JA 3V8BA 3DZBA 4F6LA 3AW9A 2J3JA 3EZLA 1LDEA 1HEUA 1PZEA 1PWZA 1C3VA 1J6UA 3HSKA 4DRYA 1KYQA 3ENKA 3KM0A 3W4JA 1N9GA 1YE3A 5GZ1A 3C24A 3RBVA 5JFOA 3SVTA 4N5MA 2GERA 1GZ6A 4RF2A 2J6IA 3HFGA 3W4IA 5LDGA 3E48A 1EDOA 3ETDA 1VL6A 3FBTA 3IS3A 3GK3A 4KTTE 4WLFA 3UICA 4IJVA 3W8EA 1ONPA 3DTTA 3U62A 5FWNA 4R68A 5CFZA 1ISMA 2CD9A 4FJ0A 3BMQA 5BSEA 1EFLA 1VKOA 1I5RA 3H5AA 2AQ8A 3CEAA 4GL4A 4MVJD 4DIFA 2AA3A 2J8ZA 5A9SA 2YHIA 4JK3A 5AXCA 3ZHYA 4PG6A 1PJQA 2YQ4A 4NFHA 3W4KA 4R3WA 5T8KA 3EC7A 4DL9A 3LT0A 3VPXA 4Z9FA 1UZMA 3LZ6A 2HQ1A 5CAEA 5F1OA 3HADA 1NHWA 2R00C 1E1NA 3GRKA 1QYVA 3I3OA 4IDEA 4UEJA 1RM3A 1RM0A 2VWHA 2FOIA 2EGGA 5JDCA 4MIOA 2NU7A 4E2ZA 2DUUA 3JQ8B 2Q4BA 1A5ZA 2Y67A 3DHNA 5DDIP 1ENYA 2RAFA 4M89A 1AUPA 2GF2A 1NR7A 4Z0TA 2NQ8A 1GYPA 2VZ0A 3WGIA 3QW2A 1ZVMA 1Y8QA 3NTRA 3H5RA 5JCXA 4KOAA 2X0IA 3CH6A 3FWNA 3GG2A 3GQVA 3L77A 4YJGB 1LRLA 1Q7GA 3WYEA 1KC3A 1PL6A 2X5OA 4AJNA 4BKPA 3PQFA 3PDUA 5JMPA 2Q2WA 3V1TC 4BO9A 2VT2A 4PZEA 5DNAA 2VHWA 4IIUA 1K89A 3DOJA 3E9NA 3GHYA 4J7UA 4Q39A 3OJOA 4H3VA 1NBOA 4ND5A 2PZMA 1ID1A 1XHLA 2FSVA 5JW6A 4RDHA 3IOYA 1RWBA 3ZNQA 4WKGA 4WLVA 4XYLA 2B5VA 4XEHA 2I65A 2UUPA 4FBGA 1N7GA 1DOHA 4ALMA 4CMEC 4J9VA 4UREA 3GVCA 2HJRA 2ZJ1A 4PG5A 2WYVA 3IUPA 1E3SA 3H65A 3PYMA 4TZKA 1C0IA 5EESA 3WTCA 1ZSNA 3B1JA 2JCYA 3N74A 3RIHA 5JXWA 3PWSA 2PLAA 3IJPA 3JYOA 4MJLA 4GGPA 4MVJA 2DPHA 4YBZA 2YV3A 3VC7A 3TZQA 4YR9A 3ROMA 1NPTO 3GLQA 3WMWA 2IYPA 2BH9A 4JJGA 2NVUB 4J90A 1UXIA 4QO7A 4B7CA 3ZU4A 2P9GA 4YQYA 2O3TA 1T2DA 2QYTA 4P22A 1LBEA 4MINA 4UEKA 5C7IO 4YT4A 4BV9A 5B1YA 5IZCA 3JQGB 1P0FA 2ZTMA 3OFSA 1I2CA 2PH5A 2CMDA 4ZA2A 1LC0A 3OICA 4YWJA 3GVPA 1WDMA 3T7CA 3DBRA 1PZGA 1OFGA 2PY6A 3OSUA 3EDMA 3LF1A 3AWDA 1G0OA 2PD3A 3RFXA 5MGBA 8ADHA 3CZRA 1PGPA 2P91A 1LLQA 1UDCA 5G4LA 2J3IA 3NYWA 4Y6SA 3KRTA 3KYBA 3PJGA 3VH1A 1LU9A 2XXJA 4NFSA 1PS8A 5IJZA 3JQ6A 1AHIA 4E5NA 3BAZA 4YPOA 3DHEA 1F14A 3ETEA 2GRAA 5FI3A 3I83A 4S1VA 4J0EA 3DBLB 2Y99A 1MP0A 4J9UE 4AJEA 4IDGA 3FNHA 2FPGA 2BGLA 4IY1A 2VWQA 3UW3A 1EE2A 1R16A 1GQQA 5KJCA 3TN7A 4CMKA 4NK5A 4OOEA 4YDRA
chains in the Genus database with same CATH superfamily
1UXGA 1SZDA 1E32A 3FLMA 3FRHA 5HDBB 1HTBA 4ME6A 5BWMA 1GTZA 3ELYA 1VE6A 1Z6AA 3U7GA 1KOGA 3B9RA 5JZVA 5FO1A 1E18A 2WNIA 4DJAA 1WF6A 1AX9A 3KQYA 4K9OA 3HKCA 1FQWA 3ES9A 1EVJA 4ZARA 3JD2A 4QOGA 4BQNA 5SYNA 3SNHA 1T35A 2VBIA 3WLRA 3QXGA 3AERA 4NDNE 5EE9A 2J5RA 3ANMA 4FT2A 1FZQA 5KMGB 3NOQA 4LSZA 3CX8A 4QUKA 4QIHA 3B1KA 2OXIA 1RQLA 1RJFA 3MXOA 4B43A 2WPDD 5IAAA 5KB3A 1G21E 3CEPB 1CP3A 1YS6A 2QD5A 2VSQA 1BFUA 4AIRA 2DQKA 4G01B 4RV4A 2YV2A 4IDDA 1NBWB 4OL0A 1NVTA 1E1MA 1UMCB 3EGVA 4GMGA 4LJLA 4MWDA 4XSGA 1T8PA 1OXVA 3M81A 4P4GA 1C8LA 5CBPB 1OFVA 3ZJUA 4CEIB 1P7WA 4PYLA 1G7TA 1ZH2A 2AG5A 4KGDA 4YJGA 2IIQA 4H4EA 4ZRNA 3QY9A 4HYTA 5KUTA 1J70A 3OKAA 5KWSA 4RTOA 1QJ4A 2QZSA 2BEKA 1T5IA 3OO1A 4TV8F 3TM4A 4A6DA 2OHXA 3CY6A 3OQ1A 1ZBQA 2Z4TA 4X54A 1Z12A 5D3QA 1QIHA 1HOTA 3N58A 4OFZA 4AULA 4L7QA 4D57A 1IJEA 4I08A 1M0EA 2C2MA 2WD9A 1C9DB 1KEPA 1IOLA 1ZN2A 4RELA 5L45A 4ZQCB 1FXWA 2P9TA 1NN3A 1K66A 4BKMA 4CTMA 4Q7EA 4FZ3A 3C48A 4MROA 4TRJA 1EESA 2AFHB 4Q9HA 3H0CA 2IUUA 2AN5A 3W3AD 1PX2A 5C35A 4WBNA 2OHHA 4M55A 3EXHC 1OI3A 4FN5A 4QTZA 4G0XA 1TD9A 2RHBA 4ZOBA 3A6EA 1UFVA 2OCDA 5B6PA 1R18A 5IYZA 2COKA 2Z8YM 4ETIA 5DGTA 4M53A 4Y18A 3GC6A 4MRVA 1GWNA 5EUCA 1OOEA 5GPBA 1Z22A 3T15A 3BRWD 3VDNB 4LI0A 4RANA 1NW9B 1RXUA 5FAXA 1CUXA 2ODPA 5A4DA 1QIFA 1I33A 4PGMA 3NBFA 2O2SA 2XSZD 5DPMA 4KHPB 1RQ2A 3ZC3A 4BXOB 1N2GA 4CUJA 2JGMA 4K88A 4MWCA 3QF4A 1HMYA 3UG6A 1A04A 2SKEA 4GWLA 1TYBE 4YACA 1W4RA 4NF2A 3G9ZA 3RRXA 2V0GA 2X9LA 3OFVA 2F3RA 2QORA 3RADC 4YR7A 3IOCA 4JBYA 3T7DA 5AYVA 1UMDA 4PLCA 1E2PA 3WGTA 1WMSA 4DR3B 1DTWA 2YJZA 4UVIA 2Q0HA 1E1LA 3RVDA 4P08A 4NJMB 1B6GA 1BRMA 2VPIA 1DBVO 3H84A 2P41A 3MM4A 2ZB2A 4QGGA 4L15A 4LRQA 3PEUA 3TAUA 3FJOA 4LFCB 4TTPA 1M1NB 3NWJA 3EBPA 1XI2A 2RC6A 1HFKA 4GR4A 4IVRA 4NCNA 1YKSA 4NYJQ 5LQKA 2AFRA 5GAJA 2V7QA 1NI3A 2CXRA 1TEVA 2H1IA 4D97A 3LU1A 4D4IA 3CXRA 3WWPA 5LP6C 1RQ7A 1QVWA 3F1LA 4ZYYA 2QAGC 1H05A 1S96A 1ZJWA 2PXCA 2Q7XA 1GAXA 4M88A 1G291 5E4YA 1IC6A 2AE1A 4G5XA 3FZGA 2VRWA 1I36A 3HXQA 5E6SB 2C0PA 1B8OA 1YR6A 4JVNA 4EGCB 4QUDA 3AEXA 4S3MA 2B37A 1E3LA 4LAFA 4JYBA 2CFTA 1G3QA 1IM8A 4AMUA 2KYRA 5B12A 2ZRNA 3L5KA 1UINA 2EJVA 2HF8A 4XOIA 1I01A 3VR6H 4D45A 3BGSA 3PGA1 2II6A 3FPEA 3N8HA 3LPNA 1EB9A 4IDCA 5A9TA 2H54A 3IAUA 3UJ6A 4ASUA 1XMQB 2WJVA 1V4NA 3DTYA 3ELUA 4KFRA 1RM4A 3EWAA 3ZVNA 3JXEA 1C8KA 3Q7IA 5TT0A 4MHOA 1MG0A 3DM5A 1UBRS 2AUMA 1J25A 3HKEA 5I7UA 4MDFA 3CLRD 4BMDA 4L8LA 4FYWA 3ZGOA 3ELWA 2E4UA 4XDHA 5IXJA 1MTZA 1YC5A 3L46A 1G98A 4KQJA 3H1TA 1JQBA 2CLHB 4CFYA 5CD1A 2NTJA 5B7PA 1QP0A 5AW4A 3D4LA 2IYAA 3FZNA 1S3SA 3UT6A 3M6WA 4I9UA 4B31A 3LNTA 4OVKA 5AUOB 4JJZA 4PGFA 2AXQA 5GM2A 5EZ6B 4E5SA 1BDMA 2VJBA 4TSFA 2I3BA 3FG9A 2OB2A 1GGVA 4NKRA 4JSTA 5DLYA 4GW3A 1W94A 5EQFA 5KMGA 3B8EA 3WMGA 1I2BA 1Q74A 1OTYA 2L69A 4G1UC 2ZVDA 3BB1A 4WXRA 1L4FA 1TW2A 4RKWA 3T3PB 2DQSA 2GOYA 4LY0A 1UMCA 1NW4A 1Y63A 2X15A 4NOMA 2CVOA 3VSBA 2EL7A 5CBPA 4AJPA 5H02A 5GONF 1JSCA 5BN5B 1JIXA 1ML4A 3SN6A 3CW9A 5CHEA 4YDQA 1UBGA 4L74A 1V3VA 2BR3A 2ZVPX 3NZEA 3IEMA 4TZTA 2QTMA 2W2KB 1HE2A 4K9NA 1E8DA 3KHUA 3L0BA 2HR1A 4IVPA 1NM5A 5DXFA 1CY4A 2Z6AA 1S9DA 2HUPA 2Q5QA 1U0EA 3S2UA 2FUG1 5FR2A 1SHJA 2CVHA 4MGKR 4ZCQA 4M8KA 3WG9A 4D9MA 1K0UA 4PN3A 1KQGA 3NG1A 5EVJA 1B14A 2JKZA 3KX2A 4LWQA 3QFRA 2XTZA 4HSEA 5AT1A 3SF8B 3AUTA 1CR1A 1V95A 5JY1A 1TVCA 3BGOS 3Q11A 2AFHA 1SXIA 2VZLA 4ID3A 4X1OA 2P2CA 2GN8A 5ER6A 2NWQA 2OE2A 5EIHA 2DBQA 5I4CA 4YUVA 4LHVA 3SIPA 1ISSA 1SUEA 4U7PB 1NU8A 2V45A 1GAEO 3LLVA 2AEFA 4L3WA 4QNMA 3RM3A 2OZVA 1YQ9A 1H2FA 3NXKA 1UEJA 2H7CA 4HLUA 2IYQA 2QN1A 4Q37A 2JGDB 1LBSA 4HCJA 3CV3A 4CN8A 2I4IA 1R0XA 4P82A 1LBHA 4QEDA 3GLRA 5DHAA 2ZCJA 1YI0A 1SKBA 3UHAA 2W2TA 3UJAA 1VIYA 4M1YA 5L3ZA 2QRGA 1SGWA 1R88A 2R96A 4NV3A 1ULAA 4GOKA 4C4XA 1SCNE 3MHTA 1N1EA 2I1WA 3W90A 2ERCA 2O2JA 3AKCA 1LQ2A 2IIBA 1FFXA 3TQTA 8ABPA 4JLDA 1E2JA 3QHPA 2ZSKA 4OJQA 1IOWA 2IDJA 2WHXA 2YWJA 4Y67A 2WD8A 4NJMA 1JS1X 4TXNA 1P6QA 4AICA 1P9WA 4PC3A 1YB5A 2VCHA 2VJNA 3DO6A 3NJ4A 3BHJA 2Y3IA 4WWHA 2QPTA 1XTIA 1ZGGA 5EJGA 1CY8A 1UANA 3HEMA 5HKAA 2ATXA 2OFXA 4EUNA 1PTJA 1H2RS 3D5EA 2D0DA 2V7TA 2OLJA 1PFGA 1U81A 2DQZA 3ZI7A 1YMVA 1M1YB 2PS9A 1RYEA 3K30A 4IO1A 3NRCA 1WW2A 5E6SA 5K8LA 3S8EA 1J0EA 1LSJA 2GH1A 3JSXA 3JALB 3IUSA 3KAPA 1EVLA 4NBWA 3UJCA 4MVJF 1BNCA 1KHTA 1EAYA 4B6OA 1XDWA 5AKYA 3UMGA 3GCXA 4N82A 1CJCA 5J23A 2O2XA 4DMCA 3KYDB 2ZB4A 4FE7A 5AK4A 1JG4A 3DZFA 1XMIA 3A3OA 3QA3E 1JWLA 2X3UA 3FBGA 1SCBA 1MC8A 3PE6A 3AUSA 3I1IA 4L76A 4OGLA 2OVBA 5JPDA 2WFMA 3DBVO 4JJKA 1XU4A 2ZUCA 3WHPA 5BV0A 5G3ZA 2PK3A 3W5DA 4OPMA 3IBFA 1L5VA 1ZHHA 3TXXA 2PZAA 4JC8A 4R5HA 4X3PA 1QAOA 1LPOA 3A9CA 3MS4A 1H5QA 1USGA 4HVLA 3TUZC 1YDHA 3BSFA 2QXYA 4G4IA 1E89A 4YREA 3X1MA 4WCVA 3R7LA 4YV7A 4HYEA 2ZAGA 4X7MA 1HI9A 3D7NA 2BZGA 1Q77A 3EC2A 3HCEA 1GITA 1NI4B 1O94A 2C94A 3ESQA 2WB4A 4G41A 5DHRA 1IVYA 4ZQHA 2CZGA 4G5YA 3K6RA 3PNQA 5ENVA 4KIFA 1ORRA 2QRPA 4ZT5A 2DB3A 4WCDA 1BHO1 1BMQA 1Y9DA 4G4SP 2E5LB 3TMAA 3AM1A 1J2EA 3MTIA 4AT1A 3KB1A 4G0NA 4M9ZA 2Q5JA 3E18A 3IJRA 3K0FA 3BPSA 1M74A 1SCIA 3GMIA 4A0QA 4N8DA 3T5AA 1OWOA 5BN4B 5KYVA 4NNPA 4HQRA 4OQ4A 2GX6A 4ZWNA 1XKQA 2CB9A 1C50A 5LP6B 1XD8A 2CXHA 1L4YA 2QAGB 3FCXA 3V55A 5BN5A 4RTMA 1KBOA 1JQEA 5GOZA 2G4CA 1GPBA 2JIOA 3OJFA 2BMFA 1OHHD 3JWIA 2QU7A 2AV6A 1UOPA 3HCAA 2W2KA 4R2HA 2V9PA 2PUTA 2PPVA 3D8UA 4O3FA 1NRIA 1AK9A 1QTRA 2QWXA 3NT4A 2VI5A 1SCUB 4HB0A 4RK5A 5EZ5A 3ETNA 4P4UA 1E4YA 3IP9A 3DWIA 4ENTA 2FK7A 1NY5A 2JGIA 4QJ4A 4QYIA 4BAGA 5AKXA 3PWZA 4OL9A 1N8KA 2F3UA 1XRLA 3P26A 1OX4A 4HRVA 1JT9A 4YB8A 3RT9A 3SF8A 2O57A 2IYZA 3HDTA 4TS4A 5KOYA 3W5AA 5E7QA 2YVLA 3SDZA 3RODA 4P35A 3AO0B 4NVRA 3TQRA 1XZQA 1JB1A 2G63A 1M0TA 1KI4A 3O4RA 3SR0A 3FIUA 1Z63A 5BWOA 1I2MA 1VPTA 2WF6A 3AI7A 1A4RA 1IN4A 4RC9A 1CF2O 5FUQA 2C7OA 2NXNA 4D99A 1ZEJA 3AUYA 3OFKA 5LOVF 4TLCA 1B15A 4G97A 4K9QA 4OM7A 3EB9A 3O94A 2G9NA 2GJ9A 3LUBA 1O6ZA 2B6NA 1QHFA 5A5FA 5IDXA 1SCDA 3ZQ4A 3GH3A 1DC8A 4XQGA 1YR7A 4B2IA 2ZI6A 2JGDA 1JFTA 1UZUA 5BMVB 2ZOSA 2FUKA 1NYRA 1PR1A 2HXGA 1VJTA 2R5NA 2R8PA 4I5GA 4WA8A 2D0IA 1TIKA 4Q19A 3T7EA 5JLJA 2OMEA 3AFNA 3SICE 5NULA 2ORYA 9ATCA 2OOSA 4UXJA 1NVMB 4ARIA 4MV3A 3BIOA 1U8EA 3I4LA 3JWEA 4LGYA 2DRIA 2ZATA 5THQA 4BGEA 3H86A 3WA6A 3PFGA 3BL6A 3FVTA 1ADBA 3EK2A 3KXKA 4PXSA 2J87A 4FSDA 5I47A 3L1JA 1OIXA 4C4SA 2J9FA 4YIHA 1KU6A 4BOYA 1LEHA 3OTQA 1K6IA 3H13A 4KJXA 3U3MA 5IM4F 1PVVA 1XYGA 2Q46A 4GP9A 5HR5A 2NNLD 5JNLA 4YI5A 4AN0A 3FWHA 3IMGA 2UZIR 4FZRA 4LZPA 1ZIXA 4JGBA 4GM0A 2FDRA 2JDIA 3O4IA 3OECA 4WNAA 1H23A 1UKEA 4GI5A 5JCOA 1ECCA 3VNBA 4B9EA 1ZD2P 3OQ6A 5JXIA 3GDFA 4EJFA 1P3JA 1CF9A 3VAZA 1PT9A 3OTHA 1KDYA 1RP1A 3FHJA 2H59A 2MINA 2WJJA 4GD3Q 1Z29A 2C1EA 1ZO8A 1NUTA 5I8ZA 4R3NA 5IH3A 3OEYA 1JB9A 1F8FA 1F9EA 1M1YA 2QX7A 2VSNA 3RWMB 2ZS9A 3USES 1YQEA 3V80A 4YVFA 4XQ0A 4F5EA 1JDBC 4LBVA 2QTBA 4RL4A 4UAGA 4MQMA 2FFRA 4JP3A 2OVFA 2XB6A 2HPZA 1OAKA 1DTSA 3QUBA 1UP6A 1NV9A 4D4HA 5IVPA 3FOFC 2A9OA 4LDPA 4MMYB 2BH2A 3RVOA 3N2ZB 2EAUA 5KTYA 1TL7C 1YB1A 1AS3A 4NS1A 4QBFA 4JUBA 2X9QA 4GPZA 2IUTA 4PS1A 5ALYA 1XRSB 1JG1A 3DFZA 4AZ0B 3FVQA 2Q99A 1Z4LA 4B6SA 3T54A 1YDMA 3L18A 1DB3A 4OOFA 4DM4A 2W6NA 1QGZA 3JATA 1U2TA 1TCBA 2BSAA 1HRKA 3GUHA 4WZZA 4A36A 2GKSA 1Y1KE 1LW7A 2R1UA 3G9UA 4ZKDA 1ZJ6A 3OIWA 4A5OA 5A1JA 4IDQA 3TQFA 3VO9A 1GOTA 3NETA 1I6LA 2XT6A 4I46A 5EZQA 3TDMA 2UKDA 3FZYA 4R7GA 3E9YA 4NOLA 4DLYA 3TEMA 1IEWA 2ZWPA 1D6SA 2OV8A 4M0CA 1ESCA 4LVOA 4KXFB 1NI4A 3PQ6A 4AWXA 5A4FS 4B48A 4D9IA 4QZVA 2SKCA 1I4WA 3A9VA 5I7HA 5FEMA 4BO4A 1IU9A 5AM4A 3DC2A 5K4HA 1L4EA 4R1SA 3FB4A 1U28C 3UY4A 2C98A 2JLQA 1KYVA 5EIEA 3FKQA 1KERA 4C7MA 3NV9A 2Q5CA 2RHDA 3NFYA 4RGQA 2F3SA 2BFCB 3CKMA 4DLBA 5BN4A 3K0KA 4HTFB 4L4ZA 1GA1A 2QAGA 3GLVA 3JY6A 3WWZA 5JAPA 1AQUA 2GZSA 1N2ZA 2A78A 2M32A 2O1SA 4EPRA 2W2LD 4PXYA 2V8BA 3P19A 2R7MA 2WU1A 1XTJA 3NONA 2CNOA 4UM8B 5A05A 4Z3KA 1SQ5A 3ZLJA 2C5GA 4ZEOA 3LT4A 1IRXA 1T6YA 2F1JA 4UNQA 4WZ6A 3PE3A 4BN4A 4JBWA 4EF6A 1A5SB 2PR2A 1QR2A 3GRUA 5DNVA 3QSYA 3GEEA 4JL5A 2P0AA 2FSUA 2CXNA 4BNTA 1M73E 3LK7A 3LUPA 1AN9A 4IIXA 1MX9A 2JD0A 2EBWA 4OATA 3HLTA 1VHDA 5ENDA 1ORVA 4Q7QA 2O5CA 2A6PA 1EIZA 2QUJA 2RGUA 8LDHA 1R6BX 3VVMA 5EJFA 3COPA 5I4IA 1E94E 1V4VA 5FUYA 4AY2A 1Q7EA 3NYIA 1L8QA 1LTKA 1L6IA 1G63A 2EFDB 3LUCA 4JIGA 4Y2XA 1MB3A 2OSBA 5G53C 3R75A 4V1CI 2HRZA 2QYOA 4Q24A 3AYXB 2HDHA 2KHZA 4TROA 2AG0A 3OE7D 3KFLA 2CUNA 1M2OA 4MVXA 4CZ2A 4KI7A 3Q10A 3FHTA 2O4CA 4P0PB 2OHFA 1KXJA 3EFHA 4N12A 3ER8A 4NJEB 3NVMB 3JAMA 1PT6A 2QR3A 1C41A 1OJLA 1ZUIA 3ICCA 3ZCRA 4CNQA 3ZTTA 2CSXA 3EDYA 1U1EA 2G82A 3SQWA 1DO8A 4KGXA 2QV0A 3KXIA 1NG1A 2FN4A 5DYGA 3DE1X 5DTQA 4QJ3A 4RHCA 1PCXA 1I3KA 2VBFA 3KBBA 4IJMA 4JLKA 3H19A 4AKIA 5LR6A 1KPHA 2ACVA 2H7YA 2X8BA 1B4DA 3CT4A 3VSEA 1IY8A 1GR1A 2B5OA 3F3KA 1IOVA 4A8HA 3M4JA 3WKAA 4OJNA 2A0UA 3TBHA 3MN1A 3B6EA 3D4NA 1EBUA 1Y9AA 2AMFA 1KO8A 3FZEA 3UPTA 3KWMA 3QE3A 4YLGA 1QOPB 1UPCA 4L4UA 4D6PA 1F0PA 2PXHA 1U0JA 4OA5A 1HBJA 1NNSA 4RGVA 4L2IB 3R0VA 3UXEA 4DWVA 1Q3KA 1EXVA 1QR6A 1V43A 2CFSA 1SH7A 3FVWA 4QU5A 5JSYA 1A9PA 3AMVA 3ZGYA 4UU0A 1B0ZA 3CVWA 2ZETA 3H2KA 2R4TA 4WDRA 3L7LA 5E38A 3VNRA 1C7ZA 1BRTA 1OYOA 2H2IA 4D3YA 1C3OB 3OOSA 1TQ6A 3QJGA 4U7FA 5F2KA 5J4YA 4NTZA 1GU7A 3DDNA 5AKJA 2PFSA 5WRFA 3ROZA 1DU4A 3Q5DA 2WUFA 4RF4A 4EMBA 4DSTA 3ODGA 4RIHA 4AQDA 4DBVO 2PMCA 1XTBA 3DMHA 1ST2A 4AZ3B 4CIAA 1AGPA 3TZLA 1TI7A 4EG0A 2APJA 2XE8A 3QI2A 3TYXA 5C2JB 3K15A 1QVZA 4KXLA 3ZHOA 1X1EA 1UKBA 4LYAA 4AWAA 221PA 5I9IA 1ECFA 1NJFA 4FEGA 4QU9A 1KH1A 1Z8NA 2FQXA 1E7QA 2V65A 3CR7A 3EPRA 1E1QD 4GYJA 4IIVA 1GADO 2DY1A 5A4JA 5GP1A 2BKLA 2X9VA 4K1XA 3RC9A 4RDXA 4O2LA 2EFCB 3R9WA 2JI4A 4CMAA 2D0PB 5FX2A 5CDUA 4P3KA 4EKGA 3ZWVA 5CLQA 4UJ5A 4ZVMA 1LQUA 4AZ0A 4TLDA 1UWLA 4DLKA 4MKFA 3TCXB 2P9CA 2R6CA 3S6JA 3WWEA 3HPRA 1G2OA 1YBMA 3BKWA 3GPIA 2YN2A 2CN1A 1X2BA 4ZYTA 4C29A 4CMJA 5ALJA 4CIXA 1CC1S 2I7CA 1TZBA 3ACDA 5ANRB 3VKGA 2X13A 4FFRA 2OECA 1KJ8A 1MOQA 2XWPA 1DIOB 4IDPA 1F2DA 3ZY3A 1SVSA 3DMFA 1XDSA 2AJTA 2ZJ4A 1RE1A 3KJZA 2FRDA 5TVKA 4DTIA 4HUTA 3PXEA 1G5FA 3K2BA 3W2IA 3BXGA 3TNFA 2FWMX 3D8HA 2PT9A 2WU8A 4WQMA 4B0PA 1DARA 2MCFA 3B3GA 1BFDA 3CUYA 4BFLA 4D9EA 3Q88A 2HTEA 3FDJA 5TPWA 1OIVA 2IYVA 1PL0A 4JJFA 4OTZA 1Q0QA 1Q95A 1TO6A 2XAAA 3GOQA 5DIZA 4GDFA 2E6KA 2ACWA 5FLYA 2WFZA 2OBYA 3F7TA 1CRQA 3UJ3X 3CEMA 5A5GA 1WCWA 3FCYA 3WFIA 1ZM2A 1U98A 1U5AA 3QWIA 2BFCA 2VP5A 2PYZA 4HTFA 4MJ7A 3WNQA 1OI4A 3T3IA 1GDDA 3KETA 1K6EA 2VJOA 5HF5A 2PXXA 3SZUA 2PSHA 3P97A 3WQSB 2G1KA 5CIWA 4B09A 3NHMA 3UO8B 1MLDA 3F9RA 2WSYB 1JDBB 3G2LA 5TIIA 1LRKA 1OASA 1N5IA 4YN3A 2VUSA 5K09A 1BE1A 1EP9A 5A5VA 2X19A 4TT3D 1VSTA 4Y2UA 5AFSA 4YCNA 3WOVA 3ZYZA 3E8XA 3LFHA 1SCJA 4WL0A 3ZKWB 2HNBA 1PBTA 1V6AA 2XKAA 3MD0A 4F4HA 2BP7A 3OE5A 4KU4A 4QL3A 4AX4A 1N2SA 2Q6VA 3RFUA 5HJ5A 3MIZA 2ZIWB 2AX4A 4A2QA 1N0HA 3T1YB 2PANA 2QRUA 4ZQFA 5I9BA 2OP0A 3NBAA 1FNSA 1XAIA 4QUGA 1UDRA 3KJGA 2P30A 3DWEX 1DMRA 3P0EA 4W82A 4RD6A 3A11A 3WRVA 3D0QA 4ZEMA 3RU9A 4UTNA 1TU3A 4NJEA 1DAIA 1R12A 1YBAA 1ESMA 2I4LA 2Y1CA 2Y4NA 1KYWA 2VHTA 4MW5A 1YSCA 5LYYA 5CITA 1OXXK 2EBHX 1N2IA 3X1YA 4H7KA 3ITDA 1DE0A 1X1RA 3KJFA 1ZUD1 4TS3A 2IXDA 3I01M 4TXMA 2MTBA 5K4GA 1DIAA 4IHQA 3U9LA 2EFEB 3LBFA 1DFHA 2LWIA 3A6FA 3T4XA 3FMOB 3ZZUA 3OI7A 4U9HS 2YVKA 3GFSA 3GFOA 3BXZA 4D2IA 2JFUA 2KWIA 4N41A 1G8GA 2ISQA 3T95A 1G2IA 2EKDA 3VXKA 2JGFA 2Q1XA 4B3RB 3PUYA 4RIEA 4RZQA 3LX4A 3QE0A 2WYIA 5BVGB 5CK4A 4BO1A 2O1EA 3AF4A 1J5XA 1HNNA 3GGCA 4X97A 1K08A 1W30A 4AYXA 4PSDA 1ZCJA 3BOSA 3R1IA 4L2IA 1EA5A 1X80B 1QIJA 2XYHA 3ZDAA 3G5MA 1IDN1 1R4MB 1VMAA 3DTVB 3HLYA 5A3JA 3DGFC 3WK5A 3O4VA 4EX7A 3P9IA 2ONKA 4MJXA 5J2UB 1HO3A 2DBRA 4W8OA 4A4DA 4MEJA 4TS9A 1IAVA 1MT3A 2GESA 3MCTA 2F1OA 2PSFA 4H7PA 4LS3A 2OYCA 3IHKA 1GPLA 2AW3A 3WLKX 4E11A 1NNEA 5EXEA 5JDCC 2CL7X 4JB3A 5T57A 4ZT6A 2XT9A 3VJMA 1B1AA 1S2OA 1QMPA 1CUBA 5E3JA 4X8HA 1P1FA 2EW1A 5AXDA 3MRXA 4AZ3A 2WYHA 2DKNA 2IS1A 1ZNWA 3OCYA 2JI6A 2ZRHA 2XB4A 4W5WA 1P4JA 2YIVX 3PGJA 3AWIA 1TEXA 2XUQA 2BZ1A 2PD4A 2GZDA 1BW9B 2WJ3A 2YWDA 3GWZA 4YAKA 1VKJA 2DWCA 3LIIA 2QTCA 5JBNA 3O03A 5REQB 3U5ZB 3NOXA 2ZAYA 3BJEA 5KNDH 4G23A 1W25A 2HT6A 3HEBA 3L7DA 3RBZA 3TQQA 1OFIA 2C7GA 3I9JA 4TQAA 3U13A 3S2SA 1XHFA 4D9GA 3J81A 2VUUA 4WKPA 4X92A 2FPSA 1NVGA 2YXNA 3PHIA 4QDZA 4Q1BA 4M60A 3KD2A 5FAKA 3C6QA 5CA0F 3VI3B 2AS0A 2GRJA 4Q4HB 1F20A 3D3WB 4I8DA 3Q7SA 1T0BA 3IXLA 4MP8A 3CT6A 3RKRA 2BDEA 3F9IA 5FJIA 1Y3IA 4BBJA 1KFBB 4IHJF 4GC9A 4FB4A 4YRAA 1ODTC 1AV7A 4E15A 2NO5A 4BNFA 1AO0A 5AXAA 2NOAA 4E5MA 2BTEA 2QW1A 1IVSA 2UYGA 1LK5A 1FYXA 1TA0A 3VGJA 2C2ZA 1BJTA 1Q2XA 3ENNA 2WMYA 4DGSA 4BMOB 1EFRD 2H0RA 2WOOA 4HGRA 2VTKA 1QV6A 3LOQA 4MRNA 3KEMA 3M1LA 2C3MA 2YRFA 3IMFA 4NPAA 3WS7A 5E4JA 1Q3TA 3KOMA 1I4EB 4DWOA 1GCOA 1PTKA 3W9BA 5FF9A 1I1OA 4DV3B 2HLDD 1LPPA 3KWLA 4WFQA 1KO1A 3K70D 1ECGA 1N7HA 5D84A 5BVGA 3E3NA 3OIYA 4BZPA 1UJ2A 2XMGA 3P9ZA 2QTLA 3QOXA 1SUDA 4MK4A 3JZAA 3TNDA 2L0XA 3UJNA 3RUIA 1LJLA 3GLHB 3C6XA 1JDZA 5DT2A 1AK2A 1UDAA 1X7ZA 3MFYA 2XRYA 4RYDA 3QEBZ 4U2KA 3U3DA 3WX0A 2P9EA 3R3UA 1JJBA 4FD2A 3GELA 1DG1G 1JR3E 2P8JA 2BONA 3PPXA 2NU9B 3KVYA 5E7MA 3KSAC 3ZKWA 4NDZA 5AI8A 2GM3A 4D42A 5SYMA 3ADPA 2IW1A 3K0HA 2A14A 1LZKA 2Z3WA 5ES3A 4QBTA 5G40A 2Z6QA 1EH5A 1OAAA 3ONNA 3VSDA 1CE8A 2FKAA 2IE8A 3BUSA 2CW5A 1WD7A 2R1ZA 3P20A 1Y82A 4QPNA 4RTNA 2JGLA 3TCKA 4LF4B 4AJ9A 3RVSA 1EHIA 4D4GA 3WMXA 4E3WA 5AIBA 2W0MA 5KHLB 4XR4A 1LC3A 1OBOA 1YDWA 4YFYA 3R0XA 4CJXA 1JEQB 5F35A 4FB5A 3UA3A 4OQFA 3U0BA 3JTMA 1YOBA 1EDDA 2R00A 4WACA 3EZFA 2PV0A 3WOHA 3PWKA 5ALGA 4URUR 1VKHA 2VAPA 2WA1A 3GP5A 3DP9A 1TUEA 5G0WA 1OT5A 2FE1A 3V4ZA 2X8AA 4LDQA 2VEDA 4EDFA 5B55A 2O4UX 3R9XB 3AHIA 3D6NB 2PGLA 4G1VA 3TLJA 3AKYA 1N1DA 3OY7A 3UWKA 3PJRA 2QT1A 3KTAA 1C7EA 3DC7A 1W29A 1D7OA 1DWUA 2E5FA 4C7JA 2HT1A 4N8SA 4BNDB 4ND6A 4B74A 2B99A 3ROFA 1FTYA 5AP9A 5KTRA 1N3BA 1H1DA 4FE3A 5IAGA 5TLSA 1NMQA 2FUG6 4GH5A 4RTKA 2GN2A 1IQPA 5C8ZA 1DUSA 3OJLA 2FR0A 3GFBA 5J63A 1R4MA 3DTVA 4HB3A 2ZR9A 5EP4A 4ZVKA 3JVIA 5ILOA 3HRKA 2RCYA 3C1UA 2EX1A 2I99A 4LJKA 4M1WA 4QUJA 3OZFA 4N0PA 3G2HA 4LJAA 4E51A 1LGYA 1V5GA 4QXOA 2VEOA 2Y1OA 3FPCA 2H16A 3NAMA 5CXSA 2XV1A 1EGHA 1NLUA 2MDTA 2ZIGA 4U9IS 5HMLA 4EG3A 1FU4A 3TTWA 3KWFA 2OV6A 4H16A 4PSCA 4Y6GB 2G71A 4I55B 5D3ZA 4O63O 5EP3A 1YZFA 3K0AA 4O4HA 1AA6A 4F9EA 4N0MA 2RK4A 1V4BA 5TXGA 4ENSA 3KQHA 1H6DA 3O38A 1E5LA 5BSTA 1T29A 3VR6D 1S01A 1EP3B 1JQKA 2JJMA 2GFHA 4U7TB 3S40A 3WGZA 1AKUA 1G5TA 2OCKA 3T12A 1UBEA 4FCVA 3UJPA 4DPLA 3VC3A 1YCHA 2QRMA 1JWAB 2D2XA 2ZSDA 1EG7A 4MW9A 5EMKA 4H4DA 5ALLA 1FMCA 1Z7EA 2X8WA 4ZZ0A 4DR7B 5REQA 4OFXA 2XRFA 4H1HA 4PQYA 4U7WA 3U0VA 3AKZA 2REOA 2V74B 3S68A 5IX8A 4LDZA 2N46A 3GA5A 5DHQA 5F7JA 1Z2PX 4OHYA 1QHXA 1EE1A 1OX6A 4QBGB 2QLBA 3FUCA 1O6GA 1UC4B 1TK2A 2O8NA 1CZHA 1P39A 2YMQA 1ZA1A 3PEVA 4RZIA 2JLBA 5HS6A 4CKYA 3KHSA 2GFQA 4U8GA 5EP1A 521PA 4BLRA 2DMRA 3DNMA 3E2PA 4ZALA 1FJHA 1FSSA 1Y1QA 4XDYA 3CH7A 3RUHA 4DIUA 3D3WA 3CLUC 3G23A 1CUSA 2V6FA 4BX0A 4DR6B 3T3MB 3A1NA 3Q9UA 4MVJH 4TN1A 3FLAA 3PQCA 1XMJA 2PJRA 4O6VA 4QE3A 1GCIA 5IXSA 3FM9A 4ZI7B 5JEDA 3ORRA 4B4KA 2O52A 5FFFA 2QPOA 1ZNYA 3PBKA 3PEEA 1EG2A 3RYHB 1U9ZA 4MW0A 5I7FA 1M83A 3PJFA 4TUYB 1QFSA 4DUPA 3IRVA 1Q0ZA 2J9XB 3IX7A 1MO6A 1WDWB 4JT8A 1JHZA 4JYMA 3A7DA 3SYTA 4NY1A 3VO8A 4DWJA 2GLXA 3KJNA 3B1WA 4OH1A 3HHPA 4MUHA 5K3SA 1NKVA 4EJSC 3QXSA 4HDMA 3DMRA 3Q41A 3WE7A 1YULA 1B2LA 3QQPA 4N6OA 2Q2OA 3HDJA 4N9WA 5CBKA 2WWIA 2Y0EA 2IXAA 1KU0A 3HDVA 4DLWA 3K9WA 2H6EA 3BE5A 4BLOA 3C85A 5J3JA 1NPDA 4P33A 3EEIA 1Y98A 4NNJA 4BQRA 5BWNA 5KJFA 3ZGZA 1YONA 3LYUA 5CCEA 1YOVA 5LQAA 1G8PA 5IC4A 1Y6ZA 2YBEA 3NCHA 2IYWA 4RQUA 1BYUA 2VYNA 1Y8QB 4CETA 2VHZA 2Z9DA 2XIQA 3VTZA 1GRVA 2ZUVA 1X1TA 1N6IA 4DF3A 3NEPX 1UWCA 1Q1NA 4L6CA 2NU9A 2RAUA 3GJ6A 2R6AA 1VLZA 1GUAA 1D04A 4U0KA 4IBOA 4QUAA 4AC9A 1OKKA 1Y6FA 1ZJ4A 3HWSA 5IHPA 3GAAA 1M2NA 2A9PA 1RRVA 4DJ5X 2F00A 3U7EB 2JHGA 1FUKA 3VH3A 1UBUS 4DCJA 2XWJI 3BN3A 3AW8A 1NLZA 2XLCA 3KEGA 4FGWA 2R79A 4KQMA 3W2TA 3LKDA 1J1UA 1DC3A 1YKFA 3C4JA 3U1VA 1JEQA 4M1QA 1JIUA 1CVIA 4R69A 1GQFA 1TAGA 4UTVA 3VTAA 3RC8A 1UFOA 2R8XA 3U5TA 5DOVA 3WL7A 1Y5RA 4FGUA 1CUUA 1SAYA 1YZTA 3K9LA 4TYNA 3D81A 1F4LA 1WXHA 2LGJA 2VYQA 1ABFA 1CRWG 3T7AA 3NNSA 3P2MA 1RHRA 1XVUA 1FRVA 3N2YA 4S04A 2ZXFA 3ECCA 4KN8A 1G8KA 2VAMA 4XWGA 2I2FA 3NBXX 1K75A 4XLTA 3VKHA 4HADA 2G08A 3C3WA 1SVWA 2HRQA 4D6YA 3H1PA 5FXMA 3SEFA 3H5LA 2BMWA 3ASVA 5FBVB 1GRRA 1U8ZA 2XZPA 3H11B 2AN9A 2C97A 2W6QA 1WR8A 4BNDA 3I61A 4IDFA 5FR1A 5A06A 4KPEC 1L5HB 1VIVA 5CW2A 1NOJA 4O4IB 4OMDA 3K72B 5CMLA 2W48A 5DRTA 5EA2A 3TGWA 4CQJA 4ECAA 5C8DA 1B74A 3GW8A 4FGLA 2C3OA 4I4IA 4PSKA 5AW1A 2V4MA 1KZ6A 2BFEA 1YCGA 1M5UA 3EQ6A 3PFHA 4JP2A 4FU0A 3WYFA 2ZJ7A 5LPNA 5FULA 1XTKA 3EIQA 2XR1A 3C3DA 3KOYA 4J2OA 1R37A 2WHRA 3S27A 2JCBA 3FB1A 1E3QA 4DT1B 3HU5A 1NY6A 1WO8A 4P54A 2GAAA 3IQXA 1T1JA 4H9GA 4QXAA 5DTJA 4E33A 1HDGO 2O8FB 3BXPA 5HIAA 3SC2A 2F6RA 1VSVA 3SMQA 3CNQS 2EFHB 3PJDA 1TK3A 1I0ZA 1JSXA 1NP6A 1VA4A 3D8SA 3O9VA 3I6BA 1JTFA 1NBEA 4Q34A 3VR1A 2FY8A 2W9XA 3K1YA 4XVCA 2GARA 2HRRA 1MRZA 2BJVA 4GU5A 3UHPA 2WHEA 3EBLA 3ADCA 1IUPA 2FZCA 4J0FA 2J3EA 1ZSVA 3KEFA 3L7YA 1C3XA 3DDZX 3QTLA 4QYTA 3IXQA 2RHHA 4D0LB 1CR6A 4ZCSA 7ADHA 3K92A 2WQ7A 3TTVA 3OWXA 1QZTA 3RQSA 2JBAB 2XRZA 1B23P 5EWLB 2CGEA 4H0CA 4B47A 3QG5A 5CEJA 4EENA 3OF2A 3CPEA 1I3LA 3G9TA 1TT7A 2DH5A 2I0FA 4MS1A 4BRZA 1GPYA 2CHUA 1AKQA 4BYGA 1NULA 4KBGA 4RSRA 1JJ7A 3DQPA 3ONWA 1L7MA 4ZC1A 4ZJYA 1G5IA 3V8NA 5I48A 5IASA 2JAUA 1NVFA 1H3EA 3UJHA 1IULA 4LQLA 1UQUA 4TWZA 1KVRA 4WFIA 4BNNA 4ZO8A 4BO5A 1CEXA 1FYFA 1Z62A 2H29A 3BC1A 3LYAA 8MHTA 2FPGB 4ZVUA 2ZE7A 2ZPTX 3V1LA 4QVKA 2P90A 3G7NA 5AR1A 1L4HA 1SG0A 1N0UA 1T25A 4D9NA 2Q1WA 1Z4MA 2GD1O 3F6RA 3ICOA 3VOSA 1NUSA 3FROA 4BFXA 4KVFA 2FRVA 3K05A 4J3JA 4UKDA 2PL1A 3PFWO 3K1TA 1T5LA 5DZSA 4F9GA 3HA7A 4TUYA 1PX0A 4CQLA 2QRKA 3CRMA 4PSVA 2BBTA 1VMKA 2GLTA 3JQBA 2W98A 2YMPA 3F74A 2IA5A 4IF6A 2NADA 4EF4A 5D7BA 3U4MA 1CZOA 3IE2A 3Q2OA 4KE7A 4MA5A 3WAKA 4NU8X 1PGNA 4WVLA 3CX7A 3F71A 1IUOA 2OFWA 3E9MA 1NQWA 3IOMA 2C9CA 2CJYA 3O9ZA 1P73A 2YHBA 4I0WB 4UNNA 3OESA 4AG6A 2DKOA 1U8FO 3N8NA 4FHEA 3ND7A 4PX3A 2HLNA 1DXOA 2OM6A 3IHLA 5B1IA 2C4UA 1Y48E 1GL9B 4AURA 1P31A 4B4UA 1CF4A 1X7GA 1Z16A 4WLNA 4C2BA 4L8WB 5CLGA 2IJGX 1TADA 4P93A 4DCMA 3CLVA 4TL9A 3HBJA 2D1FA 5F7ZA 4IGFA 1K98A 1DVRA 3NT5A 4FN4A 4D0RA 1U7ZA 3BMXA 5EUBA 4RY0A 1Z08A 1CVLA 3VPGA 1OCEA 4GZMA 4PFQA 1I2DA 3D8BA 4GICA 4DPKA 1J4AA 1HDRA 2D06A 1RWXA 4KKXB 5BNIA 4HN9A 4G5SA 1NLYA 2BGKA 5TQ0A 1MR3F 3WTBA 5KYGA 4ZGBA 1U2DA 1TMGE 3ORQA 4Q5IA 3WGJA 3QP9A 2CK3D 3B38A 3Q7RA 3W0LB 1PFVA 1VPEA 3A05A 3DOEA 3LRTA 3P52A 4YRNA 2ZRJA 2O2YA 1J8FA 3GBPA 5LDHA 2HX1A 2VN8A 5H80A 3T1TA 1SCAA 2I4TA 3DAGA 1U94A 4OHXA 3GEMA 2P2YA 3HACA 2XZDA 4KACA 5C51B 1PEYA 3UMFA 3RRZA 1TQDA 1WU7A 2ZIZA 2IYNA 1S02A 1VZ3A 4R9SA 4RUKA 5CM8B 1CHDA 1OMOA 1Q16A 3TZCA 1MVOA 1U2QA 2ZE6A 1PNTA 1W5TA 2IEDA 4JU9A 4QGFA 1X7XB 4HL6A 1E3MA 2GCIA 5A6SA 3K5IA 1LBIA 4AF7A 2H2DA 1DAEA 5JSZB 1HDXA 4M22A 1VL2A 5EYPB 4GI2A 3PA6A 4BV3A 3LP8A 4EJSB 2A57A 3H11A 4PZCA 3PNYA 1FS6A 3RQIA 1L5HA 5HFNA 5HF9A 4O4IA 3M5CA 1E7SA 4N18A 5C31A 1E0SA 2ERYA 3VH2A 5EJ5A 3JVDA 3IO5A 4G4JA 2WMOB 3HE3A 1R6VA 4RA6B 1M2JA 1V9SA 2GASA 2GJ4A 2NSLA 2WYWA 2P9BA 1EUDA 4HDRB 1Z73A 2P1ZA 3IPRA 2VNJA