4J6FA

Crystal structure of putative alcohol dehydrogenase from sinorhizobium meliloti 1021, nysgrc-target 012230
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
362
structure length
362
Chain Sequence
b'QSMMRMMHSVPKTMTAVLLTGHGGLEKLVYSRDVPVPAPAAGEVLIKVTACGMNNTDVWVREGAYGTEDDPSAVSTWRRHGNTLTFPRIQGTDTVGHIVAVGEGVDRARIGERVMVDFSIYNRDDDSLADIDYMGHGRDGGYAEYMALPAENAHVVATDLTDIELATFCCAYLTGERMLERARLAAGETVLVTGASGGVGSAIIQLARARGAVPIAVAGPGKEAAMLDIGAQAVVTRGQGDLAEAVEAASGGRPIDVVADLVGGPLFNDLLKILRPEGRYTTAGAIAGPVVQLDLRTMYLKQLELHGSSQGSRADFRRLVRYIEEKKIRPLVGGVYPLSEFHRAQTDFMAKNFVGKLVVVPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative alcohol dehydrogenase
publication title Crystal structure of putative alcohol dehydrogenase from Sinorhizobium meliloti 1021, NYSGRC-Target 012230
rcsb
source organism Sinorhizobium meliloti
molecule tags Oxidoreductase
total genus 107
structure length 362
sequence length 362
chains with identical sequence B
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2013-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4j6fA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4j6fA01
3E9QA 2DLDA 4H3VA 4TROA 5EIOA 1N7GA 4AJPA 4BNTA 1P74A 5A5EA 2I3GA 1FJHA 1XWFA 3L0DA 3A14A 3WGGA 4J1SA 4XQCA 3JQFA 2H1SA 5A04A 4HFRA 4INAA 2JHGA 3PDJA 2FZWA 4RORA 1EVJA 4RZHA 1NQ5A 3FNHA 4AJEA 1F8FA 2Q4EA 3E8XA 4XCVA 3ZU4A 5HTOA 1BVRA 5CDUA 3AM5A 5DNAA 4XYLA 4CR7A 2D8AA 1AHIA 4FW8A 2UUOA 3DBLA 3DMYA 3OICA 4IY1A 4FN4A 3ZU2A 1BXGB 1QR6A 3OEYA 1VJ0A 4Q3BA 3MWEB 1R4NA 5JDCA 1OC2A 1B8PA 4DQUA 4U6SA 3RUEA 2X0RA 4FJ2A 2DUUA 4DWVA 1QLJA 5HM8A 1ML3A 2ZK7A 3I9KA 3JQGA 2ZCUA 3NUGA 2JD2A 2H9IA 1AE1A 3CSDA 4JP3A 4J9UE 2FOIA 4PN3A 2DKNA 2G17A 3F46A 4YAGA 3F9IA 3IKVA 1D1SA 2D1YA 1E7SA 4DMMA 3ZNPA 3VPHA 4A10A 1UP4A 4OIMA 1DBVO 3GOHA 4ND5A 3ANLA 3CMCO 4IIUA 4RLHA 3GAFA 2Y05A 1EUZA 2ZYGA 4JQCA 3V5NA 2NNLD 1DHRA 4D43A 4EITA 1PGNA 4M54A 3KVOA 1X1TA 1LC0A 3G17A 1F14A 1M75A 2HMUA 3WJ7A 1KERA 3FN4A 3WDSA 1C14A 2NQTA 4A7PA 4AG3A 1A71A 5JCXA 2I67A 3IC5A 3IUPA 2WDZA 4M86A 3MOIA 4J91A 1E1MA 4B7XA 4EJ0A 4Y98A 3H5RA 1E7MA 3R3SA 1YKFA 4RVGA 4EJMA 2TMDA 5DN9A 2IYOA 2IE0A 4D7AA 5JNLA 1E0DA 2RBEA 1SNYA 2Q1TA 3D4NA 4FQ8A 3RC2A 4BGVA 4GWKA 4IZHA 4PLWA 1P0CA 2J3IA 1DLIA 1I3LA 4Y9DA 3QWFA 2EW2A 2QZ9A 1BXGA 3CKYA 3FI9A 1WAMA 3M2PA 3HFGA 3AOEA 4KTVE 4RF2A 1KYQA 1W8DA 1ZIDA 4AL4A 3ZNNA 4ALKA 4MKXA 5L3ZA 4BQPA 1YO6A 1PJ3A 1ZUD1 2FHSA 3NJ4A 4MVJI 3WGTA 3WIDA 3HADA 1T24A 3LLVA 4ZU3A 3DXFA 1R37A 3DZGA 2XF8A 4K6CA 3VKVA 3OEWA 4D79A 3ZV4A 4BNZA 2AE2A 3ULKA 4BNUA 5T6BA 2NWQA 4IDGA 4NJMB 4BGIA 4YPOA 3K8ZA 5EL0A 1FXSA 1NFQA 4DQXA 3SJ7A 2EV9A 5DULA 1NAIA 4UVDA 5ENDA 5BNIA 5L95A 2VTEA 4FDAA 1GZ6A 4L74A 1Y5MA 5COQA 4B7CA 3P7MA 4GPD1 4CQMB 1NHGA 5FYDA 1JKFA 2PWZA 1I5RA 4E5PA 3LT2A 3TZKA 3H5NA 3RD5A 4CM7A 1X14A 2W98A 5IN4A 3JD2A 1Z73A 1C0KA 3VHRA 4CR8A 4ONEA 1K6XA 4NZ9A 1AXGA 4J7CA 1Y9AA 3E9NA 1ZZEA 3NT5A 4DC0A 3T7EA 1ZSVA 1WLYA 2YDXA 4B4UA 4DL9A 4IJWA 3SBOA 3KRTA 4DGSA 1GQ2A 2Y0CA 3A4VA 3F6YA 4DA9A 1HYHA 4E3ZA 1XU7A 1XLTA 4O6VA 5DBIA 4EEZA 5FF9A 4J49A 4UUMA 4JX8A 4ZHSA 2A4KA 3F5QA 3QSGA 4DUPA 1QKIA 2DBVO 2NTJA 3JTMA 3JQAD 5DCUA 2QRLA 3PWSA 3PFWO 3B6ZA 5HS4A 1RYDA 4OYRA 3Q3CA 2CD9A 2OMEA 2EKLA 2YUTA 2RAFA 3H9UA 3GK3A 1XG5A 5JPIA 3PTZA 4ZGWA 3ZI0A 1O6ZA 4YACA 3H4VA 4KWIA 4Z0HO 4MVJM 2X7HA 1TXGA 2EGHA 1SCUA 2D5AA 2C5AA 3B20A 2A94A 4NJMA 1VJTA 3PVZA 2HMWA 3AUAA 3DHEA 4JJFA 2ZATA 3GNTA 3K2BA 1IE3A 1XQ6A 3A1NA 4CQMA 5DP1A 5C3MA 2BGMA 1ADGA 2JCYA 3GEDA 3GAZA 5LC1A 3EDMA 5ER9A 3AUSA 2GZ1A 4TMFA 1WVGA 4GSKA 8LDHA 1I36A 2WSBA 2J8ZA 1YGYA 1E6EA 1X0XA 1N1GA 1MX3A 2BRUA 5A9SB 4K1LA 3TFOA 1OBFO 3CXRA 4N5LA 4GI2A 2AHRA 2Q99A 4LVUA 4CL3A 2PA3A 2OUIA 3NYWA 1HZJA 4E5YA 5DCYA 2Q45A 3GRKA 4WOKA 1AGNA 4GVXA 4CM1A 4FFNA 3VVCA 2Y1DA 4DPMA 3GHHA 3OJOA 1LJ8A 1HE3A 2O7SA 3ZV5A 1VPDA 2DPHA 1ZBQA 1FF9A 1WXDA 1EE2A 4L73A 2VCYA 1X7HA 3WWZA 4BNHA 1DEHA 1J6UA 1ZW1A 1ONNA 3RC9A 3UCFA 5IXYA 1MLDA 3BHMA 1NQTA 3Q9NA 4RPGA 4RQTA 5COAA 2Q2WA 5LCXA 1XKQA 4BGUA 2GYYA 3AI1A 6LDHA 2EP7A 4AJOA 4BNWA 4A0SA 2YZ7A 1YQDA 2V6FA 1LDEA 3FR8A 1KIFA 2WJPA 5EERA 4I9NA 1I24A 3FD8A 3K96A 2NQ8A 4E31A 1ZK0A 2XAAA 4IS3A 5JAMA 3D4OA 3DAPA 3UKOA 3BHJA 2VRCD 3GNQA 3JYQA 4I5EA 4YQYA 4HY3A 3INGA 2GD1O 1JVBA 4NMHA 2Q50A 3U49A 4E6PA 1C0LA 3AY6A 4BKOA 4QT0A 3T4XA 5BNFA 4TZTA 1QORA 3B1KA 3PZBA 4E5MA 3AU8A 4HBGA 2AQHA 4GMGA 4DPLA 4OOEA 1GUZA 4IDDA 4XKJA 4MVJH 4UUNA 4DIOA 4WKGA 2VYND 1HT0A 2J6IA 2B83A 2O2SA 1GV1A 4NU6A 4AJNA 3K2EA 4OXYA 5L53A 1HLPA 3BHIA 1PTJA 4J7XA 4RO0A 1JWBB 5GZ6A 3EMKA 4YAKA 5F1OA 5F5LA 2AQIA 3STHA 3WX0A 1NWHA 3CMMA 4LGVA 2VNSA 5A9SA 1HETA 3F5SA 2W2KB 1PEDA 4FFPA 1JAXA 1Q0LA 3HB4X 5F3RA 1OAAA 3WICA 1UXJA 3DC2A 4W7IA 1NTOA 3RC7A 2X9GA 1XHLA 1U7HA 5IZCA 3FWNA 1IULA 3T7CA 4RPKA 1LNQA 4NI5A 5C37A 4XGNA 4MVJA 2VHYA 3IL2A 4QTZA 3IAHA 3H7AA 1PGJA 3HDJA 3OJEA 4J4HA 4C7JA 1H93A 2OP1A 3A06A 1U2DA 4WCFB 1DIAA 3H3JA 1KBZA 2E6UX 2CVQA 4R3WA 4KWHA 4YT2A 1T26A 1GUFA 3GPIA 1MXHA 5DOZA 5JMPA 1Y8RB 2YV2A 4GX2A 3WXBA 5KKCA 2VT2A 4YT4A 1AXEA 2VHXA 1D7OA 2C29D 2V6GA 1MFPA 4XGKA 2EG9A 2X86A 3RUIA 2QIOA 4XJTA 3F1KA 5JDIA 2VT3A 4KDEA 5K9ZA 1YJ8A 1BWSA 2CVOA 2VYVD 1HF3A 4GGOA 1NHWA 4HXYA 5ITVA 5C7IO 3AY7A 4GQAA 2VHVA 2UAGA 2VWPA 5JAZA 3WGYA 2W2LD 1NYTA 1E1LA 2GN8A 2ZB7A 4IQ0A 4B3HA 4DYVA 4TRMA 3K5PA 2JFFA 3MJVA 4R1SA 2AMFA 2GO1A 1AN9A 2HKIA 4R1NA 4R69A 3WFJA 1YB1A 3QVWA 2X5JO 1SC6A 3HDQA 4ROSA 2PKRA 2O2YA 2X22A 2X1HA 4WLEA 3AWDA 2QHXA 1X0VA 3D0OA 2CY0A 4MIEA 4CMJA 1DB3A 2YY7A 3R0IA 4JJIA 2P4HX 3PZRA 1SMKA 4PLGA 4O0LA 3MJTA 3ROPA 3JQ6A 4W99A 2DPGA 4NBRA 2EGGA 3ROQA 4AJHA 4CR6A 4N5MA 3U4DA 4MO2A 1PGPA 2BI8A 1BHSA 1ZEMA 4DRYA 5TT1A 3ZN2A 4CJXA 5L7WA 3HN7A 3GVPA 1RJWA 5DZSA 1B26A 3JCZA 1PS9A 4RF5A 1NQAO 4WCFA 2AQKA 2YDYA 1CDOA 1M66A 1UH5A 5GZ3A 1LUAA 4R5MA 4E5NA 4J9VA 2AW5A 1E3IA 3NT4A 4G65A 2PH5A 3GEGA 1CYDA 4MIOA 5CPFA 3VOSA 1Y8RA 2D5CA 1NP3A 3ONFA 4UEKA 2JD0A 4RF4A 5J23A 1GDHA 3PHGA 3RIHA 1E3LA 3OFSA 3EZLA 5AXDA 3GNSA 3N58A 4QUKA 3RC1A 2YV1A 4CV3A 1PSDA 1HE4A 1AUPA 3WSWA 1SPXA 3F4BA 3WBBA 2AEMA 4PG5A 3M2TA 3ZW9A 1HYEA 3I9LA 1PS8A 3B1JA 1LRLA 4ZD6A 2O4UX 1T2AA 4IDFA 1IHYA 5IDYA 1UZLA 3PQEA 1PQUA 2VHZA 5THKA 1GYQA 2BLLA 4XQEA 2P2SA 1QG6A 3SEFA 3PWZA 3E48A 3TRIA 1R4MA 2ILTA 3RVDA 3OF2A 3JD4A 3H9GA 1A27A 1NR7A 2JHFA 3U3XA 4CV1A 3FTNA 2Q1SA 1YOVB 3VPSA 1ISFA 2GZ3A 3ETGA 4Q3NA 4MOWA 4FS3A 3P2OA 4YA6A 3LZ6A 4CM8B 4BV9A 1PJQA 1O8CA 3AI2A 4LMPA 5CP8A 1GL3A 3GZ4A 4KQXA 1QV7A 1LDYA 2P9CA 1JU9A 5B37A 1U3TA 5AVOA 5A05A 3W4JA 5ICMA 2ZTUA 2P9GA 1R0LA 5L7TA 2IYPA 4RVSA 4K9DA 3TF5A 1JW9B 4D41A 5CPBA 3OP4A 3BYZA 1I8TA 3PQDA 3V1YA 5JYDA 3BMNA 3CEAA 2NVBA 1X7GA 4HFNA 3JV7A 4UEOA 4CPDA 5CDTA 4H16A 4UULA 1CQJA 3QLJA 4JP2A 3MTJA 2Z1MA 1B3BA 4AJ4A 4B8ZA 4DC1A 3HFSA 4RZIA 2WEKA 3WQRA 2NVUA 3ADOA 3RWBA 4E12A 4E5KA 4J2OA 4XR9A 1XU9A 5G0TA 3BA1A 4FFRA 3A28A 4Q3CA 4PLYA 3JQ9A 3JQDA 3RUHA 3M1LA 3LDHA 3PP8A 3G1TA 3RUDA 1A9YA 2YQ5A 1GCOA 1MB4A 1KOLA 1T4DA 3VTFA 4DLBA 1BW9A 4QQRA 3NDIA 3DFZA 3SC6A 5I9MA 1RKXA 3NEPX 3TDKA 3OQ1A 1QV6A 5DOVA 4OOFA 4UREA 1WZEA 2R6JA 4GBJA 2Q3EA 3GVHA 1YQXA 1GD1O 4CUKA 4X54A 1EE9A 3DZHA 1LDBA 3IOYA 4CM3A 2BHLA 3V2HA 5AYVA 3UUWA 1LRKA 4QFDA 2B0JA 4WPGA 4LSMA 1M6HA 2VWQA 5F5NA 3WBFA 3GGGA 4ND3A 5CEEA 1K6IA 3PHHA 4L4XA 3S2IA 3Q6IA 3UGKA 1H0KA 3JQ7B 3RFXA 4CM8A 4FJ0A 1ISHA 1KETA 1CF2O 4D0SA 5CAEA 3H9EO 3ZHZA 1H94A 4YJHB 1T25A 2HQ1A 1NQOA 2UDPA 1QXSA 1U28A 2EKQA 3L6DA 1P9LA 2VHWA 2WE8A 4Q3DA 4PLFA 1GAEO 3JD1A 1ZJYA 2C2XA 4R1TA 5CEJA 4L0QA 1MXFA 3ANNA 3NTOA 5H81A 4DTIA 1U2GA 1VE9A 2Z1NA 3WLFA 4NFYA 5DCWA 4BMSA 5B12A 3JQAB 3DBVO 5IAAA 1UXHA 2WD7B 1ULUA 2NU9A 1GU7A 3H5AA 1F0YA 4OQYA 1I0ZA 5TX7A 2NACA 1HRDA 4UUPA 3ZU3A 5BQFA 2GGSA 4RVUA 5F21A 1ZXBA 4H7PA 3PGXA 5I8WA 5IJZA 1Q7GA 4ND2A 1EUDA 3D3EA 2NU7A 3JD3A 3NGLA 4E2YA 3CIFA 3MOGA 1C0PA 4ZVVA 4GL4A 4PZCA 3OIDA 4AJ2A 1LLUA 2Y93A 5F1KA 3RCBA 4FFOA 4WECA 3FHLA 4YEDA 5U1PA 5KNLA 4LVCA 2QG4A 3WYBA 4A2CA 3BTSA 2HDHA 1NM5A 5JS6A 5TQVA 2F1KA 2FR8A 3DZJA 4Y6RA 3UH1A 1MFZA 5JE8A 3UAGA 3WGOA 3GPDG 3HG7A 3GC6A 4D3SA 4OHUA 3RFTA 1NFFA 2B5VA 4MPDA 4UEJA 4L75A 1U5AA 4YWJA 5T5QA 3JQBC 5JCJD 3JQ7A 4PLVA 4XRRA 2XOXA 1C0IA 5CHEA 1ENZA 3D64A 1O5IA 1I10A 4JBHA 2OORA 4YJHA 2DFVA 4BKQA 3LT0A 4OL9A 4WJZA 2AE1A 3TZCA 4OQZA 2FN7A 4PLTA 1PJ4A 4NIMA 4PLCA 2Y68A 1PS0A 3EAGA 4IUYA 4OMUA 2QRKA 3GDOA 6ADHA 1ZEJA 1PJBA 2RH8A 3HN2A 4BNGA 2BGKA 3OA0A 3VH4A 1XSEA 3COSA 4R4JA 4RF3A 2LDXA 3DFUA 3JQAA 1B0AA 2WD7A 4S1VA 1I2ZA 1SOWA 4XIYA 1W0CA 2XPCA 3GF4A 4O1MA 4ZRMA 3AFNA 2OBYA 1DLJA 4YJDA 3WYEA 2G82A 4R3NA 1P77A 1GYPA 4B3IA 4BO0A 3VKUA 1DRVA 2GNAA 5K6AC 4WNCA 1TLTA 2O4CA 3GN2A 2GERA 2AEJA 4G2NA 1EUCA 3KLMX 4HKTA 2NVWA 4J4BA 2BELA 4CMHA 5G0WA 2FPIA 1UJMA 4HFJA 4PCVA 3SLKA 3DMTA 4PRLA 3SXPA 5GY7A 3TFQA 3MJCA 1DC6A 2I6TA 2X9NA 5I9LA 3LVFO 2Q49A 4R68A 2ZTMA 1QLHA 5T67A 4JXKA 3ASUA 5JLAA 3ICPA 4UUOA 5CG1A 3K73O 3RUFA 5EPOA 1OFGA 1LDGA 1KC1A 1EMDA 1PU2A 5DBFA 1OMOA 1ZK3A 3VZPA 2QRJA 1Y9EA 1NAHA 1DHTA 4O5OA 4PG7A 1XDWA 3UW3A 4RVDA 2J3KA 2CF5A 1R6DA 1VI2A 2W4QA 4XWYA 3VVBA 1UXKA 2WD8A 3SLGA 1Q0HA 2PFGA 2PNFA 4UAGA 2C7VA 2FPGA 3FPCA 1VL6A 1H9AA 3VPXA 3EHEA 4II3A 4R01A 4AICA 1UAYA 3C7AA 4TWRA 2Z95A 4CLDA 5FI3A 5KVVA 1O95A 3HB5X 1LSJA 4U6QA 4QXMA 4WE3A 4CMAA 1EK5A 1LI4A 3H9QA 1PR3A 4DLAA 4BVAA 3C8MA 4YDRA 2X0IA 4IINA 3Q0EA 4YR9A 4QO8A 1JWAB 3HE3A 2VN8A 1WP4A 5HA5A 4EYEA 2HK7A 2J3HA 3RUCA 1IPFA 3U09A 3L4BC 5DT9A 1CRWG 1VRWA 5EJ2A 1ID1A 3GDFA 3NV9A 4M49A 4YXFA 2VRCA 5EINA 1H2HA 4DPKA 5BSEA 1YDEA 4NBTA 2VOEA 2JAPA 4B7UA 3H65A 5T8KA 5BNTA 2ZYAA 4FCCA 3JYPA 3PJDA 3R3JA 3UOGA 3IJPA 2DTEA 2VYNA 2HMVA 3H3FA 4KDFA 4MIYA 4P38A 4DIBA 2C54A 4XB1A 4HV4A 1NPDA 2Y99A 1LSSA 4BB5A 4LRSB 4CMCA 3UFXA 2X0NA 4Y67A 3W8DA 3L4SO 3W1VA 1A7AA 1U4SA 3WOHA 1R0KA 3DB2A 3TNLA 3LYLA 1CERA 4BNMA 4XYMA 3V1TC 5GZ1A 1EQUA 1WPQA 4W82A 4AFNA 1DAPA 1YL7A 2BD0A 3IJRA 5ITWA 3UCEA 3D5TA 2RH4A 3MCVA 5AOVA 2HU2A 1MP0A 3ON5A 2GLXA 3GVCA 4TRNA 2NV6A 4K28A 4CL8A 3RKRA 2LDBA 4DVJA 3QVOA 3DAFA 4Y8VA 2GN9A 5IG2A 8ADHA 3H8VA 1Z74A 2BI7A 4FGSA 3WSVA 4Z6KA 1YE3A 1UDBA 3RASA 1ZJZA 1ONPA 3V8BA 4YAIA 3H2ZA 3EZYA 1GEEA 1PJCA 4FD3A 4MVJE 1DJNA 1SB8A 5BR7A 1ZK2A 4QO7A 3GMSA 4E21A 5H83A 1PWZA 1YDWA 1BMDA 5FFFA 1GPDG 4A27A 1BDBA 2ZQZA 4E33A 3PPIA 1YVEI 4RCVA 1DC5A 2Y1EA 3G3EA 1T4BA 1P1RA 3DOCA 4TSKA 5JXWA 4NR0A 4QX6A 1C3VA 3E6AA 2AA3A 4RPHA 2IRWA 5JFOA 3DQPA 2VYVA 1L7DA 4Z0PA 2R00C 4M8SA 5C7LO 3DZKA 3KLPX 4OH1A 2FP4A 3I9NA 4PVDA 4DLLA 2W2LA 3RJ9A 4BNJA 5MDHA 3OJFA 1LDNA 3OSUA 3RROA 3HQ4O 4MP6A 3JQ8B 3S2EA 2EJVA 5CDSA 3GR6A 2I3AA 1P33A 1ZNQO 1DSSG 3AI3A 3GQVA 4ALMA 1XA0A 2O3TA 2EKPA 4NQZA 3C1AA 4N7RA 4B4VA 2EEZA 1FDVA 3VZQA 1HYGA 1CETA 4IXWA 4J43A 3PGJA 2GSDA 2DM6A 1GV0A 4BNVA 1EVYA 1XEAA 4BNXA 1KVUA 3E03A 4CLRB 3GUYA 2O3JA 3UVEA 1BRMA 3ROMA 2JJYA 2XXJA 1D1TA 3KB6A 2VRBA 1V3UA 1EDOA 5TS3A 5G0VA 2DTDA 3FCOA 2PTGA 2DBRA 2B4TO 1ZH8A 4R54A 1YL6A 2OXIA 1IY8A 2X0JA 3ZCXA 1KY5A 1HEUA 4E2XA 1Q0QA 5DP2A 5KWEA 1P1JA 3QWBA 1KEPA 2I5PO 1V3TA 5ILGA 2BFPA 4AVYA 1GY8A 2GUGA 4NNJA 2RCYA 4WEOA 5H82A 1IUKA 4J4TA 2B69A 1TEHA 4E0BA 3DO5A 2DU8A 3GGPA 1Z75A 5JW6A 4XDYA 1EBFA 3ZWNA 2EXXA 1FDUA 4EUEA 4BNYA 4Q3EA 2X5OA 4CLHA 1N9GB 4NPCA 2BKAA 2YHIB 2NU6A 3E9MA 1DXYA 3L07A 1RYEA 4B4OA 1KY4A 1ONOA 1GTMA 1PJ2A 4B3JA 1QP8A 4CMKA 3JQ8A 1EFLA 1UP7A 4XRGA 2OGUA 3BTOA 5L4LA 2PZKA 4OJNA 1EVZA 2GPTA 2UVDA 4MINA 3SJUA 5JY1A 4R5HA 4YVFA 4IJVA 4DXHA 3DBHB 4LCJA 3TN7A 3ZWMA 3FSRA 3IP3A 4JROA 1ISGA 3DHNA 1B3RA 2E48A 2O3SA 4Q3AA 4CMEC 3ZHBA 1ISJA 2V65A 3OETA 4A5OA 1E3SA 3U4CA 1OOEA 4YQZA 1D4FA 1YBAA 4EBFA 3EVNA 3RSHA 1O89A 1DJQA 4XQGA 1P1IA 5AXBA 5CDYA 1KEWA 3B70A 3IUSA 4YCAA 5TLSA 5TGDA 5KJ6A 1JDJA 5KTKA 4HADA 4PGFA 4CLRA 3ZV6A 3KSZO 1X15A 5HBRA 4W9NC 2G76A 3GRPA 4IDEA 1FK8A 2RIRA 5JAIA 4BMVA 3HDYA 1ZKMA 2UV8A 3WIEA 2JD1A 3GA0A 3M6IA 1I30A 4GX0A 3IDSA 2X8LA 4ZN6A 3TSCA 5KJEA 1SO8A 1WMAA 3O9ZA 3KXDA 3UICA 2O3UA 3S1LA 3KOUA 2G1UA 5KVQA 1WDMA 4LN1A 2A92A 3GGOA 1BXKA 1DOHA 1JQBA 1PZEA 1HDYA 2BGLA 1A9ZA 2H5LA 2NM0A 1XYGA 3LC7O 3I4CA 3ZHXA 4WNIA 1JA9A 3OHSX 1P0FA 2BH9A 2DBZA 3PJGA 5K0ZA 1Z7BA 5FWNA 3U5TA 4OO3A 3GDGA 4BNIA 4BL5A 2EERA 4B4WA 2AXQA 1N9GA 4CQLB 2YHIA 2OOSA 1R4MB 1A5ZA 4P8RA 4WASA 3DL2A 4UVHA 3KYCB 1M76A 3RJ5A 1QYCA 2EW8A 5BT9A 1YS4A 3PJFA 1ZXLA 2H63A 1ORRA 4CLOB 5IDQA 3NDJA 3DBHA 1J0XO 2PK3A 3KV3O 5A9RA 4J90A 4B8WA 4F6LA 4UVGA 1HSZA 4K26A 4ALLA 3L9WA 3OM9A 3ZNQA 4JIGA 4CV2A 4BO1A 1T1RA 1EK6A 1LA2A 4IJUA 1YB5A 3OQ6A 2CNBA 2JCXA 4HUJA 4K6FA 4KQWA 3LSYA 3INRA 3BMNB 3GN1A 1GQQA 3DHYA 4N54A 2IEBA 4CMIB 3DEYX 2HSDA 2WTBA 1FMCA 5BSHA 3RFVA 5A5FA 1KVSA 3DONA 1QYDA 3I4FA 3KEOA 3MJEA 2NVUB 3MWDB 5KVCA 2IEDA 3PHJA 2YJZA 2QYTA 2OHXA 2CF6A 1KS9A 1WWKA 4XA8A 3ZWBA 1TT5A 2VQ3A 4IGFA 4RGBA 1MC4A 4XIJA 5C7OO 3WMXA 3AOGA 3JYNA 1LSOA 1BW9B 1O94A 1YBVA 4DQVA 2W90A 1BVUA 3WJAA 4WGGA 1QYVA 4BNFA 1I32A 3TL2A 1Z45A 3JQFC 4ALNA 4JBIA 2I99A 9LDTA 1VL8A 4W4TA 3L6OO 3CE6A 2FR0A 4OKIA 5FI5A 2EJWA 4CQLA 3U4IA 3VH1A 3JSAA 2CUKA 1UXGA 4GMFA 5G4LA 5I9NA 2C0CA 4D3DA 5A03A 3KYCA 4D45A 1SEPA 2B4RO 2WYWA 4QFCA 1R15A 3KHUA 2Q4BA 5ADHA 4CLOA 2IZ0A 1GADO 2OL4A 2J5KA 1IOLA 3K31A 2HK8A 3OJLA 4D3FA 5JCJA 1WDKA 5JDCC 1B8UA 3VAZA 1GQYA 3X2FA 4PG6A 3M1AA 4IMPA 1KEUA 3E5MA 5EQFA 1Q7CA 1OI7A 1NNUA 1T2FA 1T2CA 3WLEA 3RU7A 3RI3A 1PX0A 3EGOA 3Q11A 4DMLA 5G0SA 3I9OA 1EQ2A 1H6CA 3VDQA 2YFQA 2PV7A 1L7EA 3CPSA 5B4VA 1MV8A 3AUTA 4CMIA 3IIEA 1EEHA 1PIWA 2PZLA 4O63O 3LT4A 3P5SA 4MVJG 4GX5A 2HMSA 3VH3A 4OSOA 3RBVA 5AXCA 1YJQA 3KSUA 3DTTA 2PLAA 1U3UA 3CINA 3IMFA 4J1QA 3RU9A 3WS7A 4UVEA 4LCEA 4YRBA 5EQDA 3KETA 3O26A 1OC4A 4U7WA 2R2GA 3VTZA 4BQRA 1PL8A 1H2BA 4FOSA 1PZHA 5JBIA 4M87A 1JAYA 3KUXA 1UZNA 5L4NA 3UHAA 1W6UA 3OA2A 3PLNA 2D59A 3AY3A 2EWMA 3KO8A 3NJ8A 3TZ6A 2CDBA 4I5DA 2CDCA 4XGIA 4RLSA 4EZBA 5LDHA 2NSDA 3AU9A 3LF1A 3PIDA 3K9QO 4R9RA 3U62A 2ZJ0A 4FSHA 3TOXA 1PJTA 2GCGA 2YYYA 4W6ZA 2YFHA 4WK6A 1M67A 1HZZA 1N92A 3E5RA 3CH6A 3QV1A 2PD3A 3FR7A 4WOJA 2Q2VA 4LW8A 5TJ9A 4I08A 5LDGA 5EESA 1UXIA 1O9BA 2E82A 1V35A 3MEQA 1KVQA 3PYLA 4YAEA 1F17A 3L9XA 3SC4A 4NFSA 3AOEC 1H6DA 3TZHA 3HSKA 2VTDA 2P91A 1DIBA 3GLQA 3NKLA 1SZJG 2VOJA 3ABIA 4N18A 1NBOA 1LDMA 1CIVA 5IDXA 1TVEA 2HUNA 1LEHA 2P9EA 4WLFA 2ZJ1A 4BV8A 5TNXA 3GFGA 1PQPA 3C85A 1R16A 1GZ3A 3IKTA 4GKVA 1IL0A 4IBOA 4NG5A 1F8GA 2C2YA 4F45A 1A4UA 5U9CA 3QE3A 1E3EA 2J5RA 5DDIP 3ZWYA 3I23A 4D42A 1I2CA 1VSUA 2CSUA 1NVGA 1P1FA 3QJ5A 3I5MA 2RHRA 4I8XA 3O4RA 3D3WB 4MKRA 2VWHA 3NAQA 4GKBA 1P1HA 4P4LA 2Q1WA 5TSDA 3QVXA 1BTOA 3PJEA 4JLWA 1ZMTA 2Y66A 5KVSA 3ST7A 2D4AA 2WYUA 5KIAA 3O8QB 3RUAA 4LK3A 1LBEA 1ZFNA 2PGLA 3DBRB 3LC2O 4MDHA 4Q9NA 3UN1A 5L40A 4L4SA 4RDHA 3WGIA 1MA0A 1V9LA 1I2BA 4MKZA 1UDAA 4EUHA 4PZDA 4XJSA 3GT0A 4PIVA 3ZDFA 4ZQHA 3BZUA 1Q1NA 1QSGA 3N7UA 4C7KA 4J16A 5JC8A 3LK7A 3GVXA 4XR4A 1TT7A 1YH3A 5KKAA 2Y0EA 3K92A 2A9FA 1X7DA 3IQDB 2X23A 2C82A 2DUWA 2O50A 4Z9FA 2PGDA 3HZZA 1N1EA 4Z0TA 3HNPA 1CJCA 1EBUA 1VC2A 5I7SA 4TZKA 4NHEA 4TVOA 2G0TA 3W8FA 3N74A 3D4PA 3QVSA 4RL6A 3OBBA 4HX5A 1DPGA 3R6DA 1FDWA 1NVMB 3LU1A 1LXCA 4I5GA 4J1TA 1ZK4A 3VPGA 1VLLA 2BF7A 3WGZA 4XEHA 2P5YA 3KSDO 4MJLA 4AJ1A 4BO6A 5I7VA 4JJGA 3VDRA 3D3WA 7ADHA 1Z7EA 2EIHA 1LQTA 3PYXA 3S8MA 4NU5A 4Y6PA 1QYWA 3EY4A 4WLNA 3EYWA 5CDGA 2JFHA 5A3JA 3ZHYA 2ZKLA 4WCDA 3ROKA 1SB9A 5EN4A 1DIHA 3INTA 5ER6A 2DT5A 3A9WA 3O8QA 4F3YA 1I3KA 4PZEA 3JYLA 4WLOA 1EZ4A 4NBVA 2PD6A 5AXAA 3DOJA 3DBRA 4E4YA 4BS9A 9LDBA 3OIFA 2HRZA 2C7GA 3FWZA 2HK9A 2ZB8A 3G0OA 2Y67A 2OFPA 4ZQGA 2D3TA 4GAEA 3C1TA 4TRRA 3U4HA 3BMCB 3FRJA 3V2GA 1GYRA 1TB4A 1G0OA 4ALJA 1DDOA 4N5NA 4NFHA 5T64A 2V7PA 1XELA 1PL7A 2QW8A 4XX0A 4O59O 1Y5RA 2GZ2A 2ZB3A 1YBMA 4DYDA 1ULSA 2E49A 3BTVA 1D3AA 4XYGA 3CTMA 5I7FA 2B4QA 2I76A 1WZIA 1Y7TA 1VKOA 3LC1O 2CMDA 2FY8A 3QWHA 3QA9A 4ITUA 2GN4A 2HCTA 4OXNA 3GVIA 5KJ1A 4YRDA 3W8EA 2X9VA 4JBGA 1HDXA 1N7HA 1N8KA 1V0JA 3LT1A 3KEQA 1D8AA 2IZ1A 1U8XX 2EP5A 1LLDA 2PD4A 1W4ZA 1B2LA 1YWGO 2CZCA 2IXBA 2V6BA 4IS2A 1E77A 4WLUA 2F00A 1WW8A 3X2EA 3PIIA 2O3RA 1MGOA 1RM3A 4EGFA 5CEFA 1B14A 2PH3A 3KM0A 1YRLA 2VUSA 1PZFA 3VC7A 4E30A 4MVJF 3EVTA 4II2A 3ITDA 2I65A 1G0NA 1E7WA 2Y1CA 3E82A 4FOOA 4F6CA 1N5DA 1YB4A 3P19A 4IJKA 5JO0A 1PR9A 2Z5LA 3ZWVA 3AM4A 2E4AA 2YQ4A 3HWRA 3H9JA 1UR5A 1XIVA 3ADPA 4OKNA 3DZBA 4TKLA 1KVRA 5THQA 4ZJUA 2DTXA 3ZU5A 2FSSA 1KVTA 5JO9A 4AJJA 3Q9UA 3GG2A 4PRKA 2PGJA 1F12A 3AW9A 3C1OA 3KYDB 2ZIZA 1ADFA 2FPPA 4GSLA 1IPEA 2IDZA 3BMCA 1ZSNA 1K5HA 3QQPA 2PY6A 1EFKA 3PQFA 3OIGA 3RQSA 1IHXA 2C5EA 3MJ4A 4DBZA 2WE7A 4IGEA 5IZCC 4IIVA 2B5WA 2FWMX 2Y1OA 3FNFA 3OJ0A 2IZZA 1BG6A 1AHHA 3QRWA 1HL3A 2GRAA 4MP8A 4YAJA 4CLXA 1NASA 3H2SA 3GH3A 5EMHA 7MDHA 3QP9A 4RPJA 3WQQA 4AJLA 1B8VA 1M6WA 2Y1GA 5A02A 3OMLA 2HMTA 3VH2A 4HWKA 2B37A 3LQFA 2WM3A 4NH4A 2JL1A 1ZMOA 2DBQA 4L8VA 4OM8A 1F06A 3S55A 2VUUA 4G5HA 4A03A 4DBVO 2PKQP 1BXZA 1H6AA 4BGEA 3OQBA 4Q39A 1HWYA 3VZRA 3E18A 3Q1LA 2AG5A 4JNKA 4YRAA 5ES3A 3FNEA 3ANMA 5IFLA 1QRRA 5K1SA 4PVCA 1MG5A 4ND1A 4YJFB 4YT8A 3P2YA 1Y8QB 1LC3A 4HP8A 5JDIC 4FPXA 2GASA 4ND4A 5HRUA 2X5KO 4NK5A 2IODA 2ZTLA 3I6QA 2B35A 2P4QA 1C1XB 4Z3DA 5JAQA 4GLOA 5L7YA 1RM0A 1EVIA 3BXXA 3AFMA 1I3NA 1GEGA 4J3FA 4UVIA 3F3SA 1IYZA 3FF4A 4PG4A 3JQBA 5TJHA 2O7QA 2SCUA 3ETDA 5I8ZA 1E6UA 1LX6A 2JCVA 4BB6A 1PJLA 1Y81A 4I9UA 2BFOA 2YW9A 3ASVA 2Y0DA 3KYDA 3GFBA 2ZB4A 1DC4A 1SAYA 3EK2A 3NT2A 2CVZA 5KJFA 2BFMA 1NPTO 1NXQA 5ILOA 4BO3A 4AJKA 1GZ4A 1UDCA 1WMBA 2FR1A 4U0KA 1CQIA 4CM4B 3QVTA 3PXXA 4P4GA 2O23A 3NDRA 4L9RA 2Q2QA 1UAGA 1T1SA 4OXKA 1DRWA 2X6TA 1E7QA 3G49A 3HJAA 4IZIA 2EHDA 1HLDA 3FTPA 3WYCA 1JVSA 1U8FO 5IDWA 4WCFC 5A4DA 2NTNA 1BGVA 4E13A 4XD2A 3ZNOA 4JK3A 1T2DA 3I3OA 4H15A 2Q1UA 2DC1A 2X4GA 3DWFA 3RBZA 4Z9YA 3K6JA 5ENVA 2XXBA 4NJOA 5K6AA 5TIIA 1U1IA 1V6AA 3PLRA 4YB8A 3JD0A 1J49A 1B16A 1HDOA 3I52A 3T4EA 1T2EA 4YJFA 2HRBA 4LRTB 1Y8QA 4EJ6A 3LLSA 1NPYA 4IM7A 4KUEA 5U4QA 4PG8A 1PGOA 2NUAA 4KOAA 3G79A 5T57A 1NFRA 1ZO8A 1Z6ZA 3BIOA 3JQCA 1J4AA 2OBNA 4XYEA 1C1XA 1DRUA 3SX2A 5G0UA 5KOIA 1SOVA 3PYMA 4OSPA 2X58A 1BSVA 2HJRA 1EDZA 4NK4A 2UUPA 2GF2A 3HHPA 3PI7A 1HDCA 1A72A 3W6UA 4JN6B 4BO4A 3NTQA 5IN5A 1HE2A 2DFDA 4LISA 4Z9XA 3PWKA 5TT0A 4ZICA 4R1UA 3U9LA 3E1KA 3ICCA 1ENYA 4KP7A 3R1IA 1ZK1A 1LU9A 1R0SA 1Z82A 2C20A 4KZPA 2H6EA 4CLEA 4CM5A 1HE5A 3I9JA 1HTBA 1E3WB 1B7GO 4RPLA 4FJ1A 4WUVA 4E2ZA 4KTTE 5MGBA 4BIIA 3S2GA 3AUUA 5B4UA 2V6MA 1PZGA 4FGWA 3B1FA 4XZ3A 1J5PA 5KCZA 3GY0A 4BMNA 5DF1A 5B4TA 3PEFA 4CM4A 4J1NA 1K6JA 1LQUA 4BNKA 4RVHA 1P45A 3ZWWA 2HLPA 1DO8A 4FC6A 1CWUA 3ZV3A 4IQGA 4BHTA 4Y6SA 3ONEA 4I5FA 1PWXA 3F47A 4OGWA 1HDZA 5GMOA 1U3VA 5TRTA 2DVMA 3MJSA 2CFCA 3FPLA 1YL5A 1VJ1A 4F46A 3JYOA 4KUGA 4AJIA 2A35A 4U5QA 3L4BA 3CZMA 3DZIA 1C1DB 4B79A 5I7EA 2JAHA 2OP0A 3U0BA 1JTVA 2E37A 3WG9A 3I9MA 3JQ9C 4BO7A 3L6EA 3ZWOA 1DFGA 4L4RA 4ZA2A 2W8ZA 1I3MA 1IB6A 3TPCA 4ALIA 1O0SA 1QMGA 4FR5A 1H6BA 5IXSA 1K2WA 1H9BA 4J0FA 3FBGA 1E1NA 4J0EA 1ENPA 3GZNB 2AEFA 3DZFA 4CUZA 4EEXA 1RPNA 4CV0A 3TOZA 4P4NA 1RM5A 1HXHA 1TT5B 3TJRA 4CMGA 3DTYA 3ZW8A 1FDTA 5G2OA 1VSVA 3H6KA 2WWRA 2WYVA 3PK0A 1UUFA 4FFMA 1ADCA 3TQHA 4PLPA 2QZZA 4U8GA 1R12A 1TA4A 1XQ1A 4FIZA 2ZCVA 4KMSA 4R16A 3ZWAA 2J5QA 2JFGA 4IMRA 1JN0A 4WEQA 3DR3A 1ISIA 1E3WA 4IDBA 1Y6JA 3TZQA 5C5IA 4TKMA 4QEDA 1TI7A 2DAPA 1DIRA 2ZTVA 2I9PA 2OZPA 3JQEA 4FC7A 5L45A 3QWAA 1H5QA 3ITKA 4EUFA 5L4SA 1SEVA 1N2SA 4CQMD 5IF3A 4I1IA 3WQSB 1XR3A 2TMGA 1NWCA 2QYSA 4CODB 3BAZA 2NLOA 3CUKA 4BO8A 4J2HA 4ZQFA 4BNLA 3KBOA 1R66A 5CFZA 3PFFA 1B15A 1OZAA 3ENNA 3LF2A 1E92A 5AQ1A 4OAQA 2VWGA 3GG9A 2RHCA 2VUTA 4DREA 1C1DA 3NGXA 4M89A 5JYEA 4BKUA 3GHYA 2POQX 3QWIA 4BKRA 1GPJA 4LSWA 2AQ8A 1PGQA 2W2KA 2OO5A 4NBUA 3EUWA 3WB9A 1YQGA 3ENKA 1K89A 1I33A 4ID9A 3PDUA 2R00A 2ZQYA 1L1FA 3C24A 1ISMA 3GZNA 3I6IA 3PHLA 1YONA 3K30A 3WGQA 3VPFA 1GUYA 5CG2A 2ZYDA 3BMOB 1FDSA 4ILKA 4BOYA 3WWYA 1QYXA 4E32A 1LRJA 5A3VA 4EI2A 1GFSA 3WTCA 4EDFA 2EF1A 4RJTA 3QW2A 3G1UA 2ET6A 2IXAA 2D0IA 1X1EA 1MC5A 1E7RA 5G4KB 3TWOA 5IZ4A 4JGBA 4D44A 5BSFA 4BUCA 4R51A 4Z3KA 1ZSYA 5F1PA 3AM3A 4U0JA 4XYBA 3RAJA 3HUDA 3O03A 4WLVA 5TC4A 2WMDA 3F4LA 1RWBA 4XQ9A 3O38A 3WR5A 1WDLA 2I66A 3D5QA 1DFHA 2PR2A 4CMBA 1LTHR 1NX6A 3GUCA 4CM9A 3CZRA 1CEQA 2O48X 4YJGB 3WNQA 4BNNA 1Q7BA 4YYZA 4W7HA 3UCXA 3Q2KA 1E3JA 5L9AA 1UZMA 4FBGA 1MUUA 1VL0A 4GGPA 3ZWPA 4RVFA 1NR1A 5DBGA 2P5UA 3EC7A 4ZQBA 3FBTA 3D1LA 4D46A 1G1AA 4EW6A 2AG8A 2C07A 4IXTA 3WTBA 2NU8A 2BMAA 2FSVA 3ETEA 3DOOA 4QECA 3V1UA 3RBXA 1NVTA 1BDMA 1DAOA 1PJSA 4S3MA 5COBA 4IDAA 1JLLA 4GWGA 2NTVA 2PKQO 4C4OA 3GMDA 1ENOA 4GLLA 2CDAA 4ZRNA 1GCUA 4M55A 5A06A 3OH8A 4MVJD 3RKUA 1HDGO 1E5LA 4R41A 4TRJA 1A4IA 2YV3A 3MTGA 4GH5A 5KJCA 1UP6A 3DMTC 3HDHA 1G6KA 1XCBA 1XGKA 4RDIA 3Q2IA 3EW7A 1MG0A 2NADA 3BMOA 4M1QA 1E7YA 1YXMA 1U5CA 3NRCA 4IDCA 2GR9A 3AK4A 4RV9A 4TVBA 1P1KA 3SVTA 2VZ8A 4I9HA 4URFA 3W4KA 4CUJA 1K3TA 4TQGA 1I01A 3BTUA 4XB2A 4ZQEA 1ARZA 1E5QA 3BMQB 4IPTA 5G4KA 4GVLA 3QIVA 3UXYA 3WGHA 2D2IA 5TF4A 2VNAA 1KEVA 3FNGA 4YT5A 3W4IA 4CMEA 1Y1PA 1PL6A 3S2FA 4FB5A 1ADBA 4IQ8A 1DFIA 3VZSA 2JKVA 4BO2A 3I1JA 3C7CB 1M2WA 5L51A 2HAEA 3NTRA 3AJRA 4W9NA 3V2UA 4YJGA 4KUHA 1HSOA 4A73A 3C7DB 1P31A 2PZMA 4DIFA 4XDZA 4G81A 4YBZA 1HDRA 3ZWCA 3PRJA 3KTDA 3KZVA 3WFIA 5A9TA 2FZEA 3GEMA 2UYYA 4NBWA 4GX1A 4NDNE 5JMWA 1ZVMA 3WMWA 2HO5A 4RQUA 1YOVA 4J6FA 3TL3A 1LLCA 1U9JA 3D7LA 1IZ9A 4JCOA 2B36A 2GN6A 1P3DA 3ORFA 4MVJP 2GDZA 4BO5A 5B1YA 1K0UA 2FRDA 3W6ZA 1V8BA 4QSMA 5A1TA 4PLHA 3UF0A 4FFLA 2Q46A 4R9SA 2HJSA 3OECA 2J3JA 3IP1A 1KC3A 3ONDA 1DC3A 1S6YA 3QY9A 3KYBA 2PZJA 1U4OA 4YTEA 5JC1A 1U7TA 3QHAA 1E1KA 4HNHA 2P68A 5T8KC 3DBLB 1WNTA 1X13A 3DAGA 4L76A 1LSUA 2DQ4A 5FEUA 3ZH2A 3BMQA 1HKUA 3PHIA 3NX4A 4P22A 1P44A 1Q2XA 2C59A 4MP3A 1R4NB 4BKPA 2BFAA 1RM4A 3C3XA 3ZGYA 1GR0A 1SBYA 4CM6A 4BO9A 1E6WA 3MZ0A 3JQGB 3WNVA 5BSGA 1V3VA 1W73A 4CM9D 3ZWXA 2O3QA 1LLQA 3ZZNA 1VM6A 4HFMA 5JSFA 4A26A 1VKNA 1U3WA 4ESOA 5JY6A 1A7KA 1JKJA 2VZ9A 4PLZA 2QQ5A 2QX7A 5ICSA 5HWSA 1IZ0A 1ZCJA 1PQWA 2YHUA 3DDNA 3I83A 3F1LA 2G5CA 5HS6A 1JKIA 3L77A 4J7UA 1S7CA 3IS3A 4HNGA 2Y1FA 4E2WA 4D0RA 4LMRA 1DIGA 4PFJA 2FMUA 2VZ0A
chains in the Genus database with same CATH superfamily
3EBPA 2DLDA 2NVOA 1VGRA 4H3VA 4UHJA 1WZCA 4XGQA 2W2MA 5TPWA 4BNTA 10MHA 1P74A 2QMHA 3NFRA 1FFEA 4HYQA 4LMAA 5A5EA 3BSYA 4F4UA 4J1SA 4A2PA 4TTJA 1QFJA 2P6RA 1OFUX 1RHRA 4JP8A 2CLHB 1CUVA 1VA4A 4MW1A 2B25A 1KR2A 1LS6A 2HBYA 3PDJA 3U3RA 2FZWA 1F51E 1KDRA 2YZGA 5FPSA 5HKBA 4ZVMA 2IIPA 3C6BA 1I3CA 3FZYA 3L05A 2XB4A 1FNMA 1TO6A 2B1GA 3AF2A 2VPXA 2Q4EA 3E8XA 3QLVA 5GONB 3ZU4A 5JBQA 2CV0A 4EHIA 2QN3A 2CXUA 2JATA 2SNIE 2IH5A 2HO4A 2A1TS 1TA9A 3BCUA 3DMYA 2OBLA 3OICA 4BFUA 4ZK6A 4FN4A 4HXFB 3ZS9A 1DKPA 5CDFA 3HLTA 2W71A 2P3LA 1JQDA 3BGWA 4PINA 2GNPA 4D5EA 1R4NA 1GPLA 1A4RA 1QE5A 1EX1A 2OO3A 4U6SA 5G41A 4KQHA 4UATA 4P3KA 1BE6A 1I5EA 2DUUA 2HRCA 1U9IC 1ML3A 2WVHA 3I9KA 3L7OA 3JQGA 2AOVA 1WUJS 1I6MA 1N6RA 4XLTA 2C4KA 2H9IA 3VU9A 3KQLA 1AE1A 3PT9A 1TEXA 4ZYLA 1FFAA 2PT5A 1HA3A 1L4HA 2G17A 2EIXA 4JBYA 4L8FA 4LJRA 3IKVA 4M76B 1D1SA 4HDQB 3DL7A 2JBAA 4CVNA 1BU8A 1E7SA 3SQNA 2D6FA 1YUBA 2YWEA 2UZ0A 2H11A 1S9DA 1NA5A 2QP9X 1QWOA 1E3TA 1OU4A 1S2IA 3GOHA 3MINA 4ND5A 3OX1A 4FI3F 2ZJAA 2Y05A 1KKUA 3KYJB 3ETNA 2CJWB 2ZYGA 3L49A 4P58A 4TMYA 4CIWA 3AJAA 4E51A 4DDUA 4TX1A 1PGNA 4LG1A 4LNAA 1FBNA 4UU0A 5FR2A 2AMLA 2AYZA 1UBNA 3A4IA 1IK4A 1YSCA 2X2PA 3LP8A 3MWLA 4QG3A 2ZT5A 4I1UA 1F14A 2IYFA 3OU6A 3FN4A 3THWB 1NVEA 4LZOA 4LXIA 3ZD6A 3AILA 4LOAA 4TYNA 1N6LA 2YW2A 3PVSA 2C5LA 6Q21A 1Z5GA 1B6SA 2Q5HA 4OHKA 3UAYA 5KOIA 5AW1A 4G0QA 5LU9A 2VATA 3D4BA 4M86A 3MOIA 1E61A 4EJ0A 4B7XA 3FMVA 4Q82A 4Y98A 4BIMA 2ZJZA 5HQ3A 1E7MA 2OV3A 3AYXB 1M6VA 1YKFA 2GCEA 4RVGA 2ECFA 2VSOA 1XRJA 4WNYA 3J7TA 3M82A 2TMDA 1A82A 3OZRA 4REQA 3UXMA 4YP0A 2G77B 1U7WA 1E5TA 2FFAA 5JJLA 2QTZA 4I14A 3CLTC 2ECPA 5JCPA 4GWKA 3EQ9A 3ZDQA 4FYJA 2H00A 2JI7A 5EJ8A 2NO9A 1V8ZA 2E5FA 2QQFA 4LGCA 2ZPAA 5FADA 3RABA 1P5HA 3UV3A 2LBPA 3C2QA 3QMVA 4Y9DA 5KYXA 2QZ9A 1BXGA 3BGOS 5E6SA 3CKYA 1WAMA 4DDKA 2W48A 2M6RA 3HFGA 5H16A 1K4MA 1P9NA 1Q0RA 1Q7TA 4CL2A 2W43A 1IM5A 3OUUA 1WQ3A 1R8YA 1FA9A 5CB4B 5DGHA 1X8JA 2J3LA 3NJ4A 1M54A 2P9HA 3WIDA 3FOCA 5DSXA 1JXOA 1KU6A 5KU7A 4LIPD 4CWAA 1I1QB 3R9XA 1KSHA 1VQ1A 3DXFA 3DZGA 3HSYA 3V55A 3NBKA 4M9SA 2W0SA 1XXLA 3MPUA 4NE2A 3U3OA 4D79A 3COJA 3WL5A 1PR5A 2REBA 2YC4C 3R6LA 3I2KA 1WB9A 2ZE5A 2GF0A 3K8ZA 1NKTA 5D3KA 1KOJA 4DQXA 1YR6A 4X7MA 4MGEA 3SJ7A 5DULA 1NAIA 4UVDA 5L95A 7AT1A 2G1PA 5JHGB 1OLUB 4FDAA 4L74A 1Y5MA 5COQA 1TUIA 3FVRA 3TLGA 4CQMB 1JKFA 4H08A 1XI2A 5HR5A 4C2UA 5ECWA 4DN6A 1DDIA 1U9YA 3B12A 3H5NA 1X14A 2HMAA 3AEYA 4IRXA 4EB3A 4WADA 1VSTA 1X9HA 2IDKA 3HXPA 3Q40A 3JD2A 5AOBA 2F55A 1Z73A 2ODWA 5CXUA 1K6XA 1O9HA 2PUWA 1OAKA 3BOSA 3D8UA 1ZZEA 3H1FA 4J7CA 1I7SB 2IT1A 5A7FA 1RBZA 1WLYA 1C8LA 2YDXA 4B4UA 4YXWD 4XCQA 2VHCA 5L3VA 3DCIA 3KRTA 3KKZA 3T7RA 1G7SA 1FFCA 1GQ2A 1HYHA 1FFBA 1JR3D 3DEHA 3KBBA 4O6VA 5DBIA 4CCYB 1GPH1 4GMKA 1J9GA 1CE8A 2WTMA 4I4TB 4RESA 4J49A 1NQWA 3TB6A 4DBLC 2JFPA 3VUFA 5J4VA 1Q57A 3F5QA 2FE4A 3DP7A 4KGXA 1WSAA 1Y7IA 1W4LA 2A14A 4Q7LA 3NYIA 3JQAD 5FTWA 1XE3A 3I3SR 2FQXA 1B1CA 1TMOA 3PWSA 5ULLA 2X15A 2IYTA 4QNMA 4LNUB 1A97A 1CUFA 1K8QA 2ZITA 3B6ZA 5DSZA 4ZT2A 2CEKA 3RVOA 3WISA 4CKEB 5H8WA 4AZTA 5EOVA 1GCGA 1X1BA 2VDOB 2XKAA 5DK4A 3OE7D 3Q3CA 4CW7A 4DCMA 5B7GA 2JVKA 4WW0A 1RI4A 5FV7A 4CKBA 4YV1A 4H4CA 1C7RA 3H9UA 1XG5A 2J07A 2NXCA 2F3UA 4HQKA 3O5AA 4MV3A 1GZUA 4MVJM 1DARA 3H2KA 1TXGA 1SCUA 1DL5A 2D5AA 4HEA1 5D01A 1OJLA 3B20A 1U3GA 2A94A 4UXHA 4KPUA 5CB6A 5JSKA 4A15A 1VJTA 5B1HA 1U2TA 3B13B 4E4TA 3MA0A 5JRJA 1FZQA 1U9ZA 2Y4OA 1IZ7A 3AUAA 3DHEA 3GOQA 1VMDA 2CNOA 2EKBA 2ZYTX 4R3UC 4OA5A 5SYNA 2ZATA 3GNTA 4DQDA 1IE3A 3STYA 4NDZA 2Q0HA 1NNI1 3FCCA 2BFDB 3PQ5A 5KSPA 3CLUD 2JCYA 1K63A 2XY4A 3KKKA 1JE1A 1U0HC 3GEDA 4KWCA 3GAZA 5TVGA 3WHIA 1EXWA 1JZSA 3AIKA 2I2XB 3PGKA 4LS3A 1WVGA 2YIDA 3PUVA 3CNEA 2WSBA 4ENPA 2J8ZA 3MGAA 3ND5A 2FVYA 1V9SA 1E6EA 1O9GA 3C98A 1X0XA 1N1GA 5E9WA 3ZEAA 1JPUA 4D4HA 1MX3A 2BRUA 2XIJA 1Q91A 2DWOA 4K1LA 1CJUC 2MYNA 3B9RA 3CXRA 3FUCA 2FJ0A 1LV7A 1UJNA 2AHRA 4WHMA 5BUQA 1J70A 2Z83A 3SFVA 4TKVA 4K6GA 5DU2A 2OUIA 3NYWA 1HZJA 3ILHA 2BDTA 5DCYA 2Q45A 3GRKA 3K0HA 2O0KA 1QH1A 1S2LA 1KJIA 1AGNA 2MSDB 2O52A 4YCBA 3EQ7A 1Y4ZA 3VVCA 4CM1A 1JFFA 1S9HA 5IJXA 1KMMA 3GHHA 3MERA 3PXAA 2VR1A 1ZMXA 2EBWA 2LW7A 4J0IA 5KHLB 5BW4A 1R6TA 4X1YB 3GGJA 2O7SA 2XE6A 4H31A 3RAPR 5B1SA 3K0AA 1L7MA 3ZV5A 3IO3A 1ZBQA 4KAAA 3JVDA 1M73E 2J87A 2QV7A 3WO0A 4UARA 2VCYA 3ESAA 4B3RB 1X7HA 2BLNA 3WWZA 3TQQA 4F1JA 1DX9A 1MLDA 2O20A 3BHMA 3DOUA 4FHEA 4XDHA 2Q2WA 2DFPA 2PO5A 5U4XA 5IBQA 3RHTA 1SK9A 1NSFA 3AI1A 2W6OA 2YN2A 4Z1MA 4AJOA 2SECE 4L6IA 2W8BA 4HVAA 3HBFA 4KW7A 3QFRA 3EBOA 5E1DA 5BR1A 2H06A 5EERA 3FD8A 4YCJA 2NQ8A 2JKYA 4DA8A 3U44B 4FKBA 4IS3A 1EU1A 4INOA 4CI9A 3G6WA 1B23P 3BHJA 4OHFA 1OKKA 4X71A 1CXZA 3U13A 3HB1A 4DFDA 4NV3A 4RIIA 4RMIA 3INGA 1BKYA 1R9NA 2GD1O 4W5JA 2GLUA 3CV3A 3FY4A 3U49A 2FOLA 3CUWA 3JASA 1C0LA 2ARKA 3PC7A 4E6PA 4OHYA 2VP9A 3AY6A 1NI5A 3E22A 4P53A 4BKOA 4C4PA 2WK1A 2XUJA 4QT0A 3MQFA 2ONCA 4Y1FA 1UT8A 3BULA 3FOFC 2PX4A 2PX0A 3AU8A 4HBGA 1JB1A 5TE9A 4B0OA 4DPLA 4PCUA 2O1XA 1GUZA 4BQOA 4KRYA 1D7AA 2IP4A 4JS0A 3V7WA 4DIOA 1T3TA 1OLXA 2DFNA 2VYND 2I33A 3CB4A 4KK4A 1GV1A 1L5SA 4FGZA 5BW6B 2C7QA 3NXKA 1SXJD 1H23A 2C94A 1D09A 1Z29A 4P4TA 2FWBA 3EMKA 4C89A 3ENWA 4YAKA 3NWBA 5F1OA 2QTNA 5UKDA 1E2LA 4F4JA 1ST3A 5KOJB 4WZZA 5LQRA 2ZG6A 3HKBA 2HH9A 5A9SA 4LGVA 2VNSA 4DXAA 3H05A 2V59A 3HXQA 3RS4A 2QTBA 1F0NA 3HGMA 5EHIA 5KOHA 1YQUA 3FTCA 1KSGA 3WICA 3PDWA 4C6RA 3FCYA 1KQPA 1PV1A 1VBFA 3IQZA 1IB0A 3MMNA 3OI7A 2OZKA 4W7IA 4U9HS 1XHLA 4FLFA 1NRJB 3QVLA 3FOEC 2JI4A 4PC1A 5IZCA 4ARCA 2VHUA 4ZIRA 2YXDA 5LZ5A 1JU4A 4BVJA 4QTZA 2X1MA 3RS9A 4BJHB 3IAHA 2QJRA 4AKEA 4JKIA 4QGGA 2AFIB 2OP1A 3M4XA 3K1ZA 3F97A 3O8DA 3RF6A 3KKEA 5DASA 3O4JA 1XVUA 4KWHA 2VNKA 1T26A 1XNQB 1OPRA 2QL7A 4CYMA 1SVIA 1GUFA 4DTCA 3EFOB 2RSLA 3CB2A 3H18A 2FSIA 5DOZA 4B2YA 1FYXA 4RY2A 1UC9A 2IQ5A 4BRUA 2GO7A 2IS6A 1HMYA 1AX9A 1ZNWA 1AGPA 3A4MA 1AT1A 1UODA 1UPAA 2MHCA 4MB0A 3EXIA 4GL2A 3TZBA 3EXFB 3HCPA 2HY7A 4N8DA 2G9NA 3EZGA 5K4HA 5F9HA 4X66B 4RIGA 2C29D 2V6GA 3I34X 3P0JA 4AG5A 4ZTZB 3JAWA 2EG9A 2X86A 3LFUA 3M5PA 2QIOA 4RX1A 2XDQA 4UFNA 4BYGA 1AQIA 4FS8A 1ZJ5A 1Z68A 2CD7A 2N46A 4RSHA 4U2KA 1YJ8A 1BWSA 2CVOA 2O1WA 1W93A 1EGAA 2BR5A 3HR7A 1VDZA 2JIZA 1NHWA 3A0UA 4M8KA 1SRQA 3AY7A 5ALJA 5JAZA 3JZIA 1G8JA 5KNDH 2C3MA 5DXAA 5I9TA 3VUEA 3ZLJA 2AMFA 4YWHA 5F7XA 2Y2VA 5CCEA 5HVNA 1XQWA 1XRPA 2X5JO 1SC6A 1JG2A 4NF2A 3VA7A 1E2NA 4RSMA 4LFCB 3GUZA 1K97A 4JSTA 3QKSB 3AWDA 521PA 4DRXB 1UJ5A 2P4UA 1ZIOA 1A9RA 1R8JA 1XMSA 2Q5OA 1G8YA 3C87A 1MQ9A 1DB3A 4CMJA 3KVYA 4U7DA 4MEBA 3SP1A 2ZI9A 4PLGA 3G2OA 1NLZA 3ROPA 1UMDB 2XVAA 3UHJA 3IXMA 3MWKA 2VNIA 3JQ6A 3ZGLA 4NULA 3V8NA 1Z16A 4CR6A 1HI9A 5AKZA 5KWSA 4EY3A 1AKTA 1KOFA 4OLFA 1HNNA 5TT1A 1T6BY 3HN7A 5DZSA 3SJBA 4R0MA 5AP9A 1NKVA 5B6JA 1H5UA 3CT6A 3ZQUA 3ONWA 1ZQ1A 2AQKA 2CB0A 2R6ZA 2YDYA 3DOIA 1CQJB 1M66A 1UH5A 1YDFA 3MILA 4KQGA 3R5TA 1LUAA 4DMRA 2EQ5A 5PGMA 4RXUA 4R5MA 1W0KA 5DH9A 5JUWA 2AW5A 1E3IA 3MTBA 4G65A 2BZ0A 2PH5A 2HSGA 3P45A 1V16B 3VU3A 4Q12A 1NVKA 3O8OA 4MIOA 5CPFA 1T0UA 1Y8RA 2MINA 4UEKA 1EFRA 3ONFA 4V2IA 2JD0A 1FFDA 3PCTA 1SJ9A 1U0TA 4IDPA 4TMZA 4WKNA 1GDHA 2XUAA 4GLJA 3QE4A 1P7YA 3HV2A 4EA6A 3R8CA 4KH0A 1NU8A 5K2OA 1T9GR 3OKAA 2BFBB 3JWHA 5GGXA 1YRWA 2XOKD 3LNCA 4JJZA 5IT5A 2HREA 2NTYC 1SPXA 2QGNA 2AEMA 4B33A 3M2TA 3OC0A 3ICEA 1HYEA 1XHEA 4TT8A 1GKUB 1W88B 2X4LA 5CR9A 1L7QA 4C0KA 1OH8A 1T2AA 4MUJA 3V4LA 3SDBA 2ZEJA 3DWGA 4R84A 5IDYA 5DTEA 3PQEA 5FBVB 3MCAA 4XQEA 1T5BA 5H5JA 1K4YA 2ZVQX 4MCHA 4PIPA 4ZJZA 1B0PA 3LY9A 4C22A 3U3ZA 1P80A 1R4MA 1DQPA 3C3JA 3ZC3A 3OF2A 4E08A 3CUYA 3IP9A 2R6DA 1NR7A 2JHFA 1CG6A 5A2QA 4Q9DA 3EGXA 3U3XA 4CV1A 4EHLA 1D6JA 1ISFA 4CBVA 1G20B 3JRXA 5K6TA 1XAHA 3NOVA 3QIAA 1N0HA 1KJZA 4UQPA 3TG8A 1Q0TA 1Q15A 4Y0AA 1GKYA 3BJMA 3FCXA 3IJEB 2FWAA 4CM8B 3K0CA 4NMWA 4U2BA 3W78A 4ZHQF 5GAJA 4LMPA 5CP8A 1E9AA 4N7MA 5HILA 1V6SA 1G2PA 3JZMA 1KMCA 1VLJA 4KVAA 1LDYA 2ESRA 2P9CA 3VU0A 2IZOA 3JVUA 3RS0A 1TZKA 3SMVA 4AWBA 1U3TA 3IQWA 3P52A 4RJLA 4AKSA 5ICMA 1SBZA 4LE1A 4RVSA 1O8BA 1JW9B 2VXYA 3FCEA 2YWBA 2G08A 2CKMA 4OP1A 1N5IA 1U98A 1KKLA 3E9ZA 3E3LA 3JR3A 2NVBA 8ABPA 1ZX1A 4G5GA 4GS5A 4FZJA 4MTCA 3NH6A 2FSHA 5KQLA 4O4JB 3WLJA 4FKMA 1Y3FE 2X19A 3LL4A 4JP2A 3HCOA 1WP9A 4JYMA 4ZPXA 4Q4JB 2LUOA 2C9YA 4DC1A 5FX2A 2NZ8A 2WFZA 3FKQA 1AUOA 4QFMA 2NVUA 3RWBA 4E12A 1E4OA 1W9HA 2CLIB 1DZ3A 1VRVA 1XJCA 3OTGA 4J2OA 3WL8A 3E7DA 5IF9A 4US1R 1JR3E 4ZOQI 3HHEA 2MYTA 3BRWA 4BX8A 3M81A 4Q3CA 5FJJA 1P6XA 1QGOA 4JL5A 1XKXA 3JQ9A 3RAGA 5KTYA 3G1TA 3VR4A 4LYDA 4QVGA 4KR0A 2OYRA 3Q10A 1KOLA 4JSRA 1PR2A 3KU1A 1PBTA 3WKDA 3HJFA 1EUDB 2L19A 3IOEA 3NDIA 3I09A 3SC6A 5I9MA 1DG9A 3OCXA 1WCYA 3FFWA 1BXRA 3QU4A 1W2GA 3IE0A 1U3DA 4G1EB 4AKGA 2B7BA 1W5FA 2XUGA 3DLPX 1UBGA 2FLVA 4MO9A 2R4UA 1V9CA 5BN5B 2W6PA 4CCAA 2CMHA 1E4EB 2ZRJA 1O96B 3I58A 3SX4A 2A2ZA 1EE9A 5D6OA 1XA3A 1YZVA 3IOYA 3GDHA 1GTL1 2BHLA 1U0EA 5AYVA 4AJNA 3ZHUA 4CM3A 1ZOIA 3A1TA 3UMMA 1SKAA 3LW7A 3FZQA 3SJAA 1MENA 3U3DA 1YQQA 3F96A 4HLQB 4ND3A 1XTBA 2A84A 2OVFA 5CEEA 1K6IA 1QGDA 3PHHA 2B4YA 1QG0A 4L4XA 3CVOA 4JQOA 1NYLA 5F78A 5HOEA 1MMFB 2PRSA 3S70A 4RMGA 2C77A 2WJWA 3ZHZA 1H94A 3FAKA 3PC2A 5MN6A 4YJHB 3EC2A 2X0DA 3LI2A 2JANA 3GA5A 3KCQA 9ABPA 3FIJA 3ZLBA 1Q6ZA 1UPBA 2GTHA 3FFBA 1M33A 1H85A 3FUWA 4YJ3B 4I7EA 4Q03A 4UTNA 1XFDA 2C2XA 1LD3A 2GILA 2G36A 3OPQA 2PANA 3IAS6 3SIWA 2C88A 4OB8A 1Q6YA 3P27A 5A0FA 1U2GA 1VE9A 3OQVA 2IUYA 3RQIA 4BTLA 1YVUA 2VUIB 4NFYA 5DCWA 7REQB 5DNDA 4MMZB 5B12A 3DBVO 4NCNA 3EF1A 3G13A 4INJA 1VJDA 2NU9A 4DLKA 2AXEA 5BXQC 2QM8A 1NY5A 4B34A 1QZXA 1O2DA 2ASVA 3OUZA 1YB7A 2H7CA 2QTHA 4GOLD 4QM7A 4JB8A 2CNDA 3HO1A 3KFLA 1S8AA 3AHDA 4OPMA 1CEEA 3IDZA 3A3PA 2GGSA 2H7YA 2RHMA 3GA7A 4GOND 1P2TA 1ZXBA 3NTUA 2PT9A 5CX1A 2OGWA 3ELYA 4BLTA 4ND2A 1CUJA 2CHGA 3EDOA 3S5UA 3RAEC 1DCMA 1USVA 3MOGA 5TQ2B 1H1LA 1KO5A 1UFKA 5BVHB 3OIDA 2CYCA 1HDIA 3E3AA 2Y93A 3I5UA 3KAJA 4DT1A 3SDZA 3IUYA 4FFOA 1GPWB 4F84A 1C9MA 2OBFA 5H3CA 2DRIA 3NORA 3K09C 1Z18A 1H66A 2PZGA 4LVCA 1Z3CA 5JI2E 5FNVA 2HDHA 1NM5A 2K7FA 4B6SA 1WA5A 1BRTA 1Z6GA 2G0NA 1QPZA 2F1KA 3DZJA 3K4QA 3DKRA 1MFZA 5JE8A 3UAGA 1H4SA 2XUQA 3GPDG 1OBHA 4F85A 3M4ZA 1XZHA 3EOZA 1DC7A 1NVFA 3RFTA 1F8UA 1NFFA 1Z47A 3A70A 3C5CA 1N36B 4EPRA 4L75A 4F9GA 1K75A 1C2YA 1ODSA 4V0ME 1OXSC 4OVKA 5T5QA 3WA7A 4WKPA 1JDNA 1LF5A 4PLVA 4YUZA 4XRRA 2JLUA 1EEXB 3VOAA 1C0IA 2VQDA 1C41A 1O5IA 3R74A 4C7BA 1AK9A 2O2HA 1P6QA 2QDXA 1V5GA 4ITRC 4OP3A 5T6MA 4DR4B 2IS1A 4WJZA 2AE1A 2PQ6A 2VYFA 2WU3A 3TZCA 3IBFA 4KSBA 4PLTA 2AR9A 5LU8A 5DYYA 2FPGB 3DT8A 1OGYA 1OGJA 4MPRA 4PQGA 4Q66C 2QRKA 3GDOA 1XEXA 2B8WA 3N8DA 1PJBA 3P9RA 1CF4A 1E0KA 3H04A 2CXHA 4BNGA 2ZRFA 3ZKAA 3OA0A 2A57A 5HYVA 3H5WA 3KQTA 2BM1A 4G8JA 1VBMA 1ZVJA 3MD0A 2JLXA 1YJCA 4QM6A 4ZVUA 2TRSB 2VH1A 3MAJA 4JGIA 1MX9A 4PM4A 4RF3A 3C3BA 5ESDA 2CLMB 1MB0A 3KJIA 1B0AA 1MC1A 1MJFA 4NL4H 1I2ZA 5KI6A 3HK2A 3U1TA 2CJPA 1W49A 4UAJA 1W0CA 4I1VA 4Y18A 5AW2A 5AVJA 5IULC 3FGPA 2B3TA 2HDNB 2XPCA 4O1MA 4ZRMA 4KEAA 3ICOA 3W90A 3ZX4A 2RHHA 3HU5A 4R3NA 2QV0A 3N07A 5HX7A 1JEYB 1Z4OA 4KV9A 1RP7A 3UAXA 1H9CA 1RJ9A 3GNLA 2GNAA 1FXWF 3F67A 4H3HB 3NIDB 2O4CA 4UDOA 5KNCA 1CDDA 3QXJA 1HFKA 1NF8A 4HKTA 3LX4A 1AGYA 5FWYA 1IDOA 2WRZA 2PWYA 5D1NA 4U2GA 5G0WA 1PJZA 4HFJA 2XWSA 4PCVA 3LUKA 2D2XA 2GD0A 3DMTA 3LQ2A 3PFNA 3Q7QA 3BD9A 4NEQA 4B0PA 3PQ8A 4BBPA 4NP6A 5DYIA 3MJCA 1Q19A 2GBGA 2ZSJA 4YRMA 2Z5GA 5I9LA 3LVFO 2Q49A 2RJOA 2O2GA 3NDPA 4Y2QA 2H29A 2I4NA 4JXKA 2RFLA 1X80B 3ICPA 1U81A 2C9CA 4GNKA 1IVNA 5JWOA 1SBIA 2RI0A 3IALA 5CA1B 3NHYA 1SOAA 3CKKA 2JJ8A 4L3VA 1FE8A 1DTWA 3GJXC 4R6WA 1VSQA 4IHJB 1XZFA 5AT1A 5C35A 3LPLA 2ZUWA 4DSZA 1OMOA 1G17A 1QOQB 3TTUA 3Q15C 4PSVA 3P9SA 3ZXYA 2PUAA 4O5OA 1ILWA 3BORA 5DM4A 1XC7A 3AB3A 2CF5A 3LQKA 4WOBA 5C4MA 5CFMA 1F2UB 3ZK8A 2ATIA 2O1EA 2I7VA 4WKCA 4ENVA 2H4YA 2PFGA 2ISSD 2JGRA 3ETCA 4ZKDA 2FWIA 3FPCA 2ZYHA 4HRYA 2A67A 3L7DA 5JJBA 5DM0A 2C4UA 2V5UA 3VPXA 2QRQA 1A8PA 4OM7A 2B94A 4R01A 1T1GA 1ODLA 4HRXA 1YCDA 3L02A 1X42A 4F12A 5B1IA 1W34A 3G9TA 1Z4IA 1MH9A 2HSWA 2G9ZA 2YBDA 1Z0JA 1V1MA 3HB5X 5BOVA 3UMFA 3SF8A 4IX9A 4KQMA 4CMAA 3H9QA 1JDBB 1QM5A 3DA8A 4ZU1X 4AF8A 2VA8A 3C8MA 5IJ0A 4XVQA 4DB2A 1AH2A 4AZ0B 1K5DA 4TS4A 4QO8A 3HE3A 1R27A 1UXOA 1E63A 1YJBA 3Q3IA 3KPVA 4MV0A 2HK7A 3E9CA 4KAXA 1TVMA 1IPFA 3OLXA 3WIOA 4BTVA 3MWGA 3KTAB 5C1OA 3U09A 2YRWA 1FFWA 1XZDA 4QDKA 1X77A 2ONYA 5DT9A 4ETMA 4B6OA 2FN9A 3W0LB 3GDFA 2ZI3A 1R6UA 2VRCA 3L3BA 3A1WA 2FX2A 5EINA 4Q9IA 4DOMA 1D4OA 3SGLA 3OEED 3DLHA 1WV1A 1JA0A 1FL9A 2FW7A 2JH3A 3LFTA 5AUPB 1DWUA 1DWPA 4JC4A 2WKWA 4WUTA 2FFBA 4B7UA 2XNSA 1DUIA 1N5MA 5BNTA 4NECA 2A3RA 2PUVA 3EVAA 1UBJS 4HGOA 5DM60 1N5OX 2Q2OA 5FTJA 3KSBC 2HFKA 3MXTA 2DF8A 1QH8B 4WVFA 1RKUA 4ML3A 4WWHA 1QGAA 2VJNA 4KDFA 5ES4B 1N2ZA 1CR4A 3BCSA 1VCOA 2J08A 3R23A 3JATA 4IF6A 1I7PA 2VTBA 4CMCA 1H2XA 4LAFA 3L4SO 4MQ6A 5HMMA 5J1TB 4AO7A 2QIPA 1AS2A 1U7OA 3UEOA 2EVWX 4XYMA 3WAKA 3SF0A 4K6KA 9MHTA 3DOEA 1L5FA 3D5TA 4A3SA 1IZZA 2RH4A 4GEKA 5L6MB 1EX9A 1JI0A 5AOVA 4JI8B 3LDFA 1NXVA 4C4AA 4PHHA 1OTHA 5ALOA 2NV6A 1PK9A 2IC5A 4MULA 4XSHA 2MMCA 3RR2A 1WETA 2FLKA 3K05A 1OFUA 2GN9A 4LDRA 3UJAA 4UPEA 2JBWA 1LPNA 3L40A 3H8VA 1CJBA 2PR7A 3TQSA 5ICSA 1MZPA 1XTIA 4LPSA 5FB3A 2YFYA 3RW9A 1XDGA 1YE3A 2H08A 1BHJA 1E18A 5CYPA 3RASA 1X74A 2ENUA 2XD4A 2RE8A 5LQKA 2YICA 4YAIA 3H2ZA 4JEUA 3EZYA 4PYKA 1GEEA 1WU7A 2B1RA 2H2AA 3HM9A 1P4SA 2P7HA 1PJCA 4QXQA 5HRCA 4FWTA 4MVJE 3AETA 4P7KA 3WP1B 1YZGA 5EXDA 4QO7A 1BOFA 3OTQA 1XHFA 1OH6A 1F9AA 4JT2A 1PWZA 5FFFA 1BMDA 2YRXA 1GPDG 1JXAA 4GXNA 1A7UA 3PPIA 8GPBA 5LOVA 1LPSA 1YVEI 4RCVA 4HNTA 2H4ZA 1YCFA 4U6NA 1T3SA 1IBCA 2QGFA 4MHOA 4LA4A 1JHUA 3QZUA 2WF5A 3PHBE 3SM9A 1P1RA 3DOCA 1MVNA 4NR0A 2NO0A 2WV7A 1C3VA 3PNQA 2Y1KA 3S8YA 4WBNB 1E2EA 1WS6A 5CUQA 1IATA 3HY3A 2FLWA 4DSNA 1ST2A 2YNMC 5EXEA 3DZKA 3BCRA 3L8FA 3AQIA 4PNHA 2J4FA 3RJ9A 2VSXA 4HZGA 1ULBA 3OJFA 1XZEA 3K94A 4KOEC 1CUIA 1Y7PA 3HPQA 3OSUA 4MP6A 4PHTA 3KLNA 8AT1A 4NX2A 2WFMA 3GR6A 3A7EA 3LP5A 2I3AA 5F1YA 1R5NA 4WXHA 4E15A 4F21A 2P62A 3I32A 3MGGA 2N9UA 3PEYA 2WF6A 2B5OA 3E23A 1XZMA 4ALMA 5F7JA 4H7FA 3VTKA 1O6FA 4AZ3A 1VG9B 2QT1A 4C3VA 3VR1A 5HKKD 4PO1A 3UYKA 2X6QA 2HWWA 1DT3A 2HQRA 2FWJA 2JJQA 1LK7A 3G82C 2JIRA 4RPCA 2EEZA 2GKSA 2AG1A 2H59A 2HJWA 2YV4A 3WQHA 4A8JB 5E2IA 3SK0A 2GD6A 3N7TA 5CVCA 1ZKDA 3LCCA 4IXWA 5CVEA 1A98A 2GSDA 2G8NA 4H60A 1EVYA 1XEAA 1YASA 3Q0IA 1JWLA 5AWFC 1KVUA 5K8LA 5D87A 2FGKA 3E03A 3GRVA 3GUYA 3K6SA 2AVDA 3GX1A 1BRMA 4XB6B 4J07A 2XXJA 1D1TA 4J3JA 2VRBA 1V3UA 5TS3A 2XTJA 3SFZA 3FPSA 2R1VB 2V0NA 3FCOA 1ZH8A 2DBYA 3IB3A 2X0JA 2QLBA 5KWEA 1KY5A 1HEUA 2R8YA 1SUCA 4FMCF 2XCTB 4RJ2A 1F38A 2LNDA 1RJEA 3PFKA 1N0VC 1T1EA 1VL5A 1YRYE 4OB7A 4DA6A 2IZ7A 3ZI4A 5IYZB 1JXQA 1V3TA 1KPIA 5BV1A 4UPDA 3KD3A 5ILGA 3WK5A 2H18A 4AVYA 1GY8A 1GU1A 1UOOA 3MJFA 1FU8A 5F98A 3ZVRA 3O83A 4M7RA 4PYRA 2W42A 5CD9A 1NULA 3IVXA 3R0QA 4NNJA 4B3GA 1IN4A 4WEOA 1CQPA 4L72A 3FNRA 4ER6A 1TEHA 3GFOA 5JSQA 2BTQB 2DU8A 2GKOA 4PRYA 3G6KA 2QYHA 1PT8A 3OWOA 4R98A 1PDOA 4XDYA 5D8DA 4MQ4A 4BUZA 5EJ4A 3H97A 4BLSA 2Z6AA 1FDUA 2F9MA 2QVLA 1Q14A 2YVUA 3A3YA 4AXBA 3G9XA 3MTDA 2X5OA 4L5CA 4CF6A 4ZYTA 1N9GB 4P08A 3O92A 1M1XB 5FBKA 2FUNB 3SEAA 4DV7B 1DXYA 2ACKA 3L07A 4YV0A 5AOCA 3VC1A 3BDAA 3GLVA 3M83A 3CPEA 3JQ8A 3ADCA 4O2LA 1E1RA 4WAUA 2OMKA 2C2HA 1EVZA 1FQOA 4G56A 4G97A 4M2LA 2BFWA 4MINA 4MQFA 1RW4A 4NMLA 4R5HA 4PPGA 5E8JA 2R44A 4AAYA 4DXHA 4OI0A 4WD3A 2F8LA 2OZEA 2OV1A 4WMLA 2JGNA 1JSXA 1B3RA 1ISPA 3F3MA 3H5TA 3ED5A 4Y3UA 1IEWA 2ORVA 2IXDA 1ISJA 1TFRA 3M6MD 5DTQA 4I55F 4RZXA 9ATCA 1OOEA 3QLTA 4MVYA 4EF6A 3I5AA 1D4FA 1TW3A 1UWLA 1G5FA 5LQMA 3RSHA 1O89A 3UTDA 5AXBA 3B70A 1ECBA 2IEYA 1B00A 1KARA 5TLSA 3HYRA 4X64B 3DUFB 1P1BA 4S1WA 3LA6A 5CURA 1YHZA 4PGFA 3QYJA 2ID9A 4R8LA 3KSZO 1X15A 4XIGS 1T8PA 4G8BA 4H1UA 4D98A 3L43A 1Z4JA 2FW0A 4JA0A 1LFDB 1FK8A 4B74A 5JAIA 2A9VA 5KSYA 3HDYA 4XTCS 2UV8A 1MEEA 4BCDA 3WIEA 3H83A 4HDNA 1TYAE 2JFUA 2X8LA 4YJ2B 5KJEA 1SO8A 1WMAA 1YKSA 5EIEA 4FFBA 3UICA 2O3UA 5LKAA 4IL5A 4NICA 1D04A 1DAKA 4RE6A 3RV3A 1WDMA 1LBQA 1KEKA 3UNXA 4B5LA 1KI9A 4LN1A 3KT6A 3D7RA 4XPIA 5L3QA 2ZUVA 2H5LA 1PZEA 2W93A 4G41A 1A9ZA 4EA7A 1XNRB 4MA5A 5EWJB 2D5IA 5CLLA 3ZHXA 3KQHA 4I8DA 1KYXA 4ZT3A 2H4XA 5BWLA 5FI0B 1WVMA 1WULS 5ERYA 4W5OA 4N4AA 3DKKA 5ALFA 1XTVA 1TAGA 4UEQA 3ZV7A 1KS2A 1Z7BA 3W04A 3NWEA 3W2HA 5ALMA 3KVVA 1T0JB 4N3NA 3TSOA 3GDGA 1A5SB 3V3TA 4BNIA 4DA4A 2ZWIA 2JFWA 4DS3A 4BL5A 1KIMA 4B4WA 4MR7B 2AXQA 3B6EA 4CQLB 3I01A 2YHIA 3LSTA 2OOSA 5AM5A 4JCOA 1A5ZA 4QXRA 3SBEA 1YVPA 3FTFA 1PFUA 1ETUA 3DL2A 1YZNA 3A6JA 4P36A 4TS3A 3KYCB 2O7NA 3NBUA 4UM5A 2W37A 2GPJA 1TF7A 4C78A 5J2TF 3PJFA 5AHOA 4KR7A 4L6AA 1ZXLA 2H63A 2HIAA 4F2PA 5ECDA 4KXQA 2AR7A 2I4LA 2AK3A 3NDJA 5A9RA 1TTTA 4ZV7A 2EZTA 4B8WA 4F6LA 4CTKA 2A9QA 2R48A 3PC6A 3USES 3NXSA 1HSZA 4ALLA 3L9WA 4TLAA 3ZNQA 1FBTA 4JIGA 4KFCA 4B3XA 1D07A 1J0DA 3KPWA 4IJUA 4KQWA 4PE5B 5FOXA 4PFSA 1JHZA 2R1ZA 1G20E 1U7PA 1GQQA 3DE3X 1QCZA 1DG3A 3IUEA 3O4IA 5LP6B 3B85A 3L0PA 2GEBA 3GJ5A 3Q85A 3O91A 2IEBA 1QC5A 2YJ6A 3NVAA 1IBKB 2D0OB 5KCMA 3D8NA 5BSHA 4PPQA 5JATA 2PUHA 3RS2A 4DCUA 3RFVA 1I9GA 3DONA 1W5BA 3GLIA 4NBKA 1Q17A 2GZMA 1QU2A 2UZ4A 5HJ2A 2QBYB 2IEDA 3OCZA 2QYTA 1UJBA 3I73A 1KS9A 2RGNC 3ZWBA 1TT5A 2VHQA 1KQFA 4FONA 4IGFA 2HMYB 4TMKA 4RGBA 1IBSA 1MC4A 1N57A 4M0LA 4MRRA 3CURA 4F0JA 5C7OO 1T3LA 1Q50A 3A6FA 4DV4B 1YIOA 3AOGA 3JYNA 2IELA 4PSDA 3RSLA 1DV2A 1AQ6A 5ALRA 1YBHA 2ZRAA 1JFLA 2J45A 2VJDA 4BVBA 1I32A 1XZJA 1CS0A 4LX0A 5CW1A 4WQMA 2OGZA 2V45A 3B52X 3R20A 4JBIA 1M6YA 3R3XA 3UMRA 1VL8A 4DG5A 3ITNA 4POAA 2KBEA 4F56A 1M0WA 4AG6A 2OFWA 4OKIA 3OQOA 4Q1VA 5EIHA 2BFEB 3TDMA 4RZSA 3CJTA 1UXGA 4DWJA 1RHKA 2IKQA 1L8AA 2OC9A 1KAGA 1VE7A 3K0FA 1M2OB 4R2LA 4DUGA 3I8XA 2WMOB 3FCAA 3QFTA 3AGPA 3UYLA 4A6DA 1FFGA 1FYEA 1MTOA 2A1IA 4FEGA 1GVHA 3GCXA 1SULA 3WOVA 1GAJA 4CLOA 5ADHA 5C8ZA 1ECJA 1WOMA 2J5KA 4P4SB 4TTTS 5E3JA 4CEIA 1RAHA 3NI2A 1US8B 5JDCC 1B8UA 3X2FA 2EX0A 3BX1A 5CNIA 3BJZA 4PG6A 4IWYA 2E89A 4IMPA 2CFTA 3B6KA 3U19A 3BJEA 5EQFA 1Q7CA 2XKBA 4OQLA 4Q4LA 3U0VA 2YKGA 3H2IA 1T2FA 3QFFA 4J76A 3WLEA 2DB3A 3E61A 4NARA 1M1YA 1ZH4A 4I99A 2XE8A 1EQ2A 5JRZA 3VDQA 3HKDA 2PV7A 3N3AC 1CSEE 1AKQA 2PTHA 1L7RA 3STUA 1RQNA 4DR3B 3L8ZA 4G26A 4W5RA 2UZ3A 3PQ2A 4C6TB 1N33B 1NY6A 3P5SA 1JHRA 1E9DA 1RI5A 3EZ6A 4JB0A 3E1SA 1VIDA 3DMPA 1L5VA 4MQUA 4OSOA 5AXCA 3NM5A 3PRHA 3RBVA 5CFPA 1WCIA 1RRKA 3AFGA 1M5RA 2J9FA 1K88A 3GARA 3GXBA 4I0WB 4UE3S 5KTRA 4YRBA 2R5FA 3HJGA 1GUDA 4FNAA 4I2VA 1OC4A 4TM7A 3R3WA 4U7WA 4O1HA 4D9NA 5C46F 3VTZA 1QE0A 1H2YA 1NBME 1PL8A 3IQIX 3O4GA 5B3JA 1F0KA 4BNDB 4HC4A 4MGYR 1BA2A 2ZSAA 3LLUA 3ILYA 2J6HA 2P2NA 1JAYA 2VP3A 1V41E 3WP0A 3KUXA 3WLSA 4DSOA 4KHPB 3KT3A 1CDZA 3R0XA 3Q0TA 4D9MA 2DR0A 1XRMA 3OA2A 3PLNA 2OCAA 1Z36A 2D59A 2JH9A 3AY3A 3NJ8A 4L0CA 4NV1A 4EZBA 1R88A 4RLSA 1O1YA 4Y1EA 5TEVA 5LDHA 1G8KA 3BDIA 3BIXA 4X6LA 3KKNA 3K9QO 4ID3A 2WYOA 1CR0A 5LA6A 5CCBA 4YCDA 2CDRA 4YROA 2WUFA 3ZQ4A 1TUEA 3RT1A 1O0BA 4DR7B 2Y71A 2OPBA 3AHIA 2EX4A 3LHKA 1SXQA 1MAHA 2GPSA 2B21A 2XODA 3TIIA 3I28A 2WAAA 1H2EA 3KB8A 1JYSA 1TW2A 4LW8A 5IH3A 1TL7C 1UXIA 2GZDA 4G01B 1SBTA 2IYSA 3UHOA 4AZSA 2E82A 3ZCQA 1ZM7A 2G40A 3O8CA 1GLGA 1ZG3A 1NJ2A 2A9RA 1G8GA 2C1ZA 2C8JA 2ZDQA 4PNPA 1LTKA 5EUCA 1YA4A 4LK2A