4J6FA

Crystal structure of putative alcohol dehydrogenase from sinorhizobium meliloti 1021, nysgrc-target 012230
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
362
structure length
362
Chain Sequence
QSMMRMMHSVPKTMTAVLLTGHGGLEKLVYSRDVPVPAPAAGEVLIKVTACGMNNTDVWVREGAYGTEDDPSAVSTWRRHGNTLTFPRIQGTDTVGHIVAVGEGVDRARIGERVMVDFSIYNRDDDSLADIDYMGHGRDGGYAEYMALPAENAHVVATDLTDIELATFCCAYLTGERMLERARLAAGETVLVTGASGGVGSAIIQLARARGAVPIAVAGPGKEAAMLDIGAQAVVTRGQGDLAEAVEAASGGRPIDVVADLVGGPLFNDLLKILRPEGRYTTAGAIAGPVVQLDLRTMYLKQLELHGSSQGSRADFRRLVRYIEEKKIRPLVGGVYPLSEFHRAQTDFMAKNFVGKLVVVPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Putative alcohol dehydrogenase
publication title Crystal structure of putative alcohol dehydrogenase from Sinorhizobium meliloti 1021, NYSGRC-Target 012230
rcsb
source organism Sinorhizobium meliloti
total genus 107
structure length 362
sequence length 362
chains with identical sequence B
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2013-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4j6fA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4j6fA01
4NFSA 5TJHA 4NBTA 2DLDA 1I3MA 3PVZA 8LDHA 2JAPA 4WEOA 1FDUA 3FNHA 3QE3A 3BMOB 5ES3A 4MO2A 3T4EA 4CODB 3KETA 1MA0A 3ZWOA 3L6OO 4J1TA 3JYPA 4IDGA 2J3KA 5TSDA 3CINA 3AW9A 2A9FA 3ROPA 3ZNQA 4F46A 3GMSA 3QSGA 4F6LA 1UAGA 3M1AA 4YAJA 3U0BA 2NADA 1ZXLA 1ZMOA 1GYRA 2D0IA 2ZYGA 3EZYA 3PWZA 3PYMA 4J2OA 4DLBA 2B36A 3WGYA 2O3RA 3FTNA 1E5LA 1MP0A 5KNLA 5CDSA 1K6JA 1VKOA 2LDXA 5IN4A 4GSLA 1VPDA 2W2KB 5F1OA 3SLGA 3AY3A 4CR6A 4J43A 3E9MA 4OIMA 1BRMA 3D4NA 4BGEA 1XSEA 1V35A 3KEQA 3IKTA 5HWSA 1VE9A 2B0JA 3EY4A 5TIIA 2DM6A 1DC6A 4B4WA 2Y99A 4RO0A 5L7TA 1SOWA 3UHAA 5JYDA 3OH8A 4TRJA 3ZU2A 5IZCA 3GN1A 3PHIA 1TVEA 4U5QA 1VRWA 1T2AA 3ZI0A 4B7CA 4BMSA 4RZIA 1DJQA 3CXRA 2JCYA 4Q3CA 1B0AA 1Y8QA 2GF2A 4IGFA 4WLOA 2W8ZA 1BXZA 5G0SA 2NWQA 1E3IA 1F0YA 4OXNA 2VT3A 2CUKA 4YT4A 3RIHA 5CPFA 1ZIDA 4BNNA 4BNGA 4YXFA 3ZCXA 5JLAA 4GBJA 1G0OA 3H9GA 3R6DA 2X23A 3PDUA 2VUTA 3JV7A 1BG6A 2DQ4A 4L9RA 3HB5X 3WLEA 1WAMA 3BTSA 5COAA 3RU7A 2TMDA 2Y0CA 1OOEA 1IUKA 2X5KO 2Y93A 3EW7A 4EITA 4FGWA 1MUUA 2X58A 2AEMA 3LF1A 1HE3A 3NKLA 1R16A 1P1RA 2FHSA 2DBZA 4YAEA 5IAAA 3HDHA 2DC1A 1I5RA 1YBVA 3ZHBA 3G1UA 4MOWA 5LCXA 1EUDA 1FDVA 3NT4A 4FC7A 4RVUA 1V3VA 3BHIA 1RKXA 2VZ0A 4TWRA 3TPCA 3G79A 4XYBA 5A5FA 3V2HA 2YQ4A 3WQRA 3WG9A 1B8VA 2VHYA 2JFGA 4NFHA 1PSDA 1X0VA 2G76A 1I01A 3F9IA 3RKRA 4E5PA 5JNLA 1E7QA 5A5EA 5CHEA 5F3RA 1GV0A 4D44A 1N7GA 3HZZA 3SLKA 3GFBA 4CM4A 2UYYA 1ZK0A 5ADHA 3AUUA 1WLYA 4WGGA 5IN5A 1FDSA 3VTFA 4AJOA 2P91A 5JDIA 1PJQA 1Q2XA 4XQGA 5HTOA 1T1SA 3H65A 1R6DA 2NM0A 2Y0DA 3FWZA 3QWFA 1C3VA 2CVOA 2A94A 2BLLA 1Y81A 5G2OA 5EN4A 2A35A 1LNQA 5KJEA 5DF1A 4LISA 4HFJA 1BSVA 1X7HA 2EKPA 2WD7B 1H6AA 1NPTO 1WXDA 4TRMA 4LCJA 5A9RA 4K6CA 4PLWA 3WGHA 2HU2A 3JYQA 3KSDO 4YJFA 4CMEA 4IMRA 2O3QA 3L4BA 4O1MA 1JAXA 1JVBA 1SNYA 3NJ4A 3ZWBA 2DTDA 1Z82A 2NSDA 1H6DA 2V6MA 5T8KA 4DIOA 4NJMA 1PL8A 1PJ2A 3I52A 3U5TA 2YV1A 4LMRA 1EE2A 4J0EA 4YAGA 1LSSA 3U09A 1K6IA 5A06A 4MKZA 4HV4A 1EVYA 1GADO 2YFHA 3KO8A 5IDWA 3QWBA 3RBXA 3DR3A 4R9SA 3RU9A 2Z95A 4BO3A 3TFOA 1YBAA 3DHYA 3VPFA 4DIFA 3VH2A 3OECA 2GPTA 2ZTVA 1B7GO 4J49A 2EF1A 1R4NA 3ONEA 1GQ2A 1EUCA 2WWRA 2EP5A 5B12A 1Z45A 4E21A 5CPBA 3SBOA 4E13A 4EW6A 1H6CA 3GVCA 2B4RO 3MEQA 4IDDA 3EVTA 5KJ1A 1F8FA 2CVZA 4CM1A 4EEXA 5KJCA 4BNUA 5FF9A 1XHLA 2NU7A 3OP4A 2Z5LA 3K96A 1UDCA 4IPTA 1YB4A 3KOUA 3D0OA 5JDCC 4J1QA 4CJXA 1LLCA 2DPHA 3KXDA 1NQ5A 2I67A 3UICA 4NFYA 4E31A 2D59A 1PU2A 4J1NA 3IUSA 2W2LA 1WDKA 1YXMA 4YWJA 2Q4EA 1H0KA 2O2YA 4LVCA 5THQA 1KY4A 2P2SA 2PGLA 3EK2A 3DFZA 1FDTA 5IG2A 3Q3CA 1LC0A 2X0JA 2FWMX 3WGZA 3JQFA 2NV6A 3C3XA 3I1JA 4LW8A 4MP6A 4D0RA 2ZJ1A 1UXHA 2EKLA 4I5GA 5JSFA 2E4AA 5KKCA 3F1LA 3CH6A 3KYCA 2BF7A 2JD1A 4P4NA 3A06A 3Q0EA 2B37A 3RSHA 2CD9A 4I5DA 3ZV6A 5CAEA 3PDJA 1GUFA 3DEYX 1E3LA 1UZLA 4BV9A 4EYEA 1Y8QB 3UGKA 4XQEA 1H2BA 5A3JA 2GDZA 1MFPA 5ER6A 3WB9A 2EKQA 1M76A 3JQ7A 1R12A 4H16A 4NZ9A 3D4OA 3I6IA 3ZWNA 4D7AA 4DQXA 3IL2A 3PGJA 4Z3DA 4OSPA 1NFRA 4DPLA 4E2XA 1JWBB 2ZTUA 4ALLA 5I8WA 5L45A 5GZ6A 1KEVA 4L4SA 2IZ1A 4XA8A 4J4BA 3HDQA 4P38A 1HSOA 1S6YA 1ISMA 3PK0A 4HFNA 4DTIA 3DZHA 4MVJE 4UUPA 4IXWA 4LN1A 3ZN2A 5HM8A 1NWCA 5GZ1A 1EVIA 3Q11A 4J9UE 4IMPA 3NT5A 4WK6A 1M67A 3S2EA 2YFQA 1DPGA 1YB5A 2NTNA 5BSGA 2R00C 2XXBA 1YL6A 2E82A 1YOVA 3DB2A 3GNSA 4LSMA 1VC2A 3JD1A 2R6JA 2VYVA 1ADBA 4BNYA 1NASA 3PTZA 3GNTA 1LDEA 4CM5A 2Y1DA 1W73A 4AFNA 4JXKA 4D0SA 3HADA 4W7HA 3WSWA 1RPNA 4XJTA 2C5EA 2G82A 2RHRA 2PZKA 1OMOA 3ICCA 5CG1A 3V1UA 1LEHA 3FPLA 4CMBA 1KVQA 3IUPA 3OA2A 4Q9NA 4FB5A 1G1AA 1JU9A 4CM3A 2YHUA 1GD1O 4FD3A 4O63O 3MJ4A 4CM4B 1QRRA 5JAZA 1DIBA 5LDGA 1PX0A 1GYPA 4RPKA 3RUFA 4BKOA 3JQGA 1PJ3A 1Y9EA 3OQ6A 4B8WA 5C37A 4CL3A 4HX5A 2I3GA 2ILTA 1SMKA 2IEDA 3DAFA 3MZ0A 1ML3A 1RWBA 3TWOA 5EQDA 3E9NA 3ADPA 1AN9A 3GN2A 2VHZA 2B83A 1DDOA 1ENOA 3DONA 5KCZA 2VTEA 3AM5A 3FBGA 4IIUA 4CMIA 1L7DA 3DZKA 4E5KA 2QG4A 4A5OA 4FBGA 4GQAA 4NBRA 1K6XA 4LMPA 4IQGA 1UXJA 2HMTA 4YJFB 4GPD1 5AXBA 5IXSA 4AJ2A 4P4LA 4QEDA 3E03A 3A9WA 3GVPA 5BNIA 4IZIA 4NJMB 3H7AA 3TDKA 2UUPA 3AUSA 1ZJYA 3E6AA 1EE9A 4IM7A 3BMNA 1IE3A 4LGVA 3IP3A 4M55A 2BFPA 2Q49A 2OP1A 4ZQGA 4E3ZA 3MCVA 4A27A 1CJCA 3RBZA 4JJIA 4RVHA 1ISJA 3D3WA 2OL4A 2IRWA 4HBGA 1CQJA 3H5NA 5FYDA 4FJ1A 1B2LA 1T4BA 1X7GA 3KVOA 3U4HA 5JW6A 1IYZA 1R4NB 3EZLA 5G0WA 3PHHA 1D1TA 4AG3A 3VKVA 2H1SA 1LA2A 1R0KA 2DPGA 4OKIA 1GPDG 1J49A 5JPIA 3B1JA 3TFQA 1UAYA 4PRLA 4BMNA 2F00A 4GKBA 3PJFA 1OZAA 4RF4A 4CLOA 1NM5A 4XD2A 2O3JA 4UREA 3MJEA 2UVDA 4A0SA 4ND2A 4BNZA 3DOOA 1UZMA 4BS9A 2EEZA 3A14A 5L40A 5JO9A 1QYDA 3I9NA 2Y67A 4QO8A 1YRLA 2VHVA 3OQ1A 1U2GA 4BO2A 7ADHA 2YY7A 4YCAA 3S8MA 3WXBA 3B20A 4PZEA 3VAZA 3MOIA 4EUEA 1UDBA 2VOJA 4R4JA 3DBRA 4W9NC 1U8XX 4GWKA 4UVIA 1PEDA 2PH5A 2Y68A 2C29D 1RJWA 1DB3A 1U2DA 1HZJA 4DWVA 5A02A 4KMSA 2NTVA 3H9UA 3HFGA 3RUDA 3LK7A 1IOLA 3RKUA 2X9VA 5ENVA 4YR9A 1ZEJA 1VJ1A 3LZ6A 3DMYA 1PJBA 3ETGA 1HSZA 2BFAA 3KYCB 3QWHA 3ULKA 1BVRA 1D8AA 2QIOA 1NVTA 1EK5A 4PVCA 3GLQA 2FSSA 1E6WA 3BTOA 3W4IA 3QP9A 3E8XA 1E5QA 2CMDA 3O38A 1BHSA 4DBZA 4E2ZA 2BRUA 1LQUA 1F12A 1MC4A 4YRDA 4AJLA 3OSUA 4HADA 2VNSA 3WQSB 4BNKA 4E32A 4XKJA 3QVTA 1FF9A 3NEPX 5AQ1A 1FJHA 1Q0HA 1T24A 1I3LA 2FY8A 4E2YA 4YTEA 1WPQA 3FHLA 4FQ8A 1NR1A 3NDIA 4BO5A 1MGOA 4K9DA 3NX4A 4A7PA 5JBIA 2P9EA 2GR9A 1EVZA 3WSVA 2X22A 3P5SA 1GZ4A 4RDHA 2JJYA 3WMXA 6LDHA 3IIEA 3TNLA 4XYEA 3M2PA 3O03A 4UVEA 2P4QA 1E6UA 1KVRA 4M86A 3ZWYA 4CR8A 3TL3A 3L9XA 4FJ0A 1C1XA 4UEOA 3NDJA 3DAPA 1YOVB 1I2ZA 3KYBA 4U6SA 4DLAA 3JD2A 3E5MA 3Q2IA 3AOGA 2YDYA 4K6FA 3TRIA 1E1LA 4XWYA 3GVIA 3RFTA 3JQ6A 1WMBA 5L7YA 3IQDB 1P0FA 1DFHA 1VI2A 5FEUA 2NTJA 2AQKA 1Y5MA 1SBYA 3RJ5A 4BKRA 1ZSNA 2NLOA 2FR0A 3GGGA 3H5RA 3IP1A 4PLHA 3AY7A 1HWYA 3F5QA 4ZHSA 2I99A 3F4BA 3JQGB 1IB6A 4RPHA 1JKJA 3U49A 4DYDA 5JAMA 3RASA 1H2HA 1BWSA 1U1IA 4DVJA 3GUCA 1HLPA 5AOVA 2AEJA 2JL1A 2BGLA 5DZSA 3GDFA 5EJ2A 1I33A 3QLJA 4C7KA 4CMIB 4QFDA 4Q3DA 3OFSA 4HFMA 3RC7A 2V6BA 4CUZA 3EYWA 5DP2A 2JCVA 1UP7A 3DBLA 4J91A 3SXPA 1PQWA 1V6AA 2JAHA 5JDCA 4JJGA 2EW8A 1X0XA 3LC7O 4WECA 1TA4A 1BDBA 4RLHA 4WCFC 4E5YA 4TVBA 3KBOA 3ZV5A 2ZCUA 1YE3A 5EESA 5JAQA 4DQUA 1SB8A 2B4TO 3HQ4O 2JKVA 3BMNB 2X5JO 2QX7A 4O6VA 1MC5A 2PGJA 2VCYA 1DSSG 4EJMA 1DBVO 2CF5A 2DFVA 1CRWG 3FCOA 3ZWPA 4BNJA 1DIAA 1KVSA 1A27A 4J90A 4WLNA 3A1NA 2VRCA 3D3WB 3BMCB 1A7KA 3QWIA 4IQ8A 1VJTA 4RPJA 4GH5A 1U4SA 3BHMA 4YPOA 5DNAA 1NNUA 3VOSA 2VRCD 1M6HA 3ZWCA 5JCJA 1RYDA 1GYQA 1HDGO 1PS8A 3DO5A 3V2UA 2HLPA 1Z7BA 1JDJA 3H9QA 4GL4A 4FJ2A 4UUMA 4DMMA 4BB5A 3LT2A 4JP2A 5JCJD 4I9HA 1CEQA 3ZV3A 4AJEA 1DXYA 4R3WA 4ZGWA 5JY6A 4ZQEA 2RHCA 1TT5A 4LRTB 2C5AA 2DFDA 5A05A 4FFRA 5CP8A 1SAYA 1Q0LA 1I3KA 1P74A 1GPJA 3JQAA 1N1EA 3I6QA 3C7DB 3QVWA 3S2GA 3VZRA 4UVGA 2F1KA 3LLVA 4JQCA 1SB9A 4DPKA 3OJOA 3NYWA 1NX6A 5DBFA 3ORFA 3SEFA 3IAHA 5HRUA 1GUZA 5HS4A 4M54A 2O7SA 1HT0A 2I66A 2OBNA 1V8BA 5A04A 2R00A 1JVSA 4YEDA 5DT9A 5F21A 3JD0A 3LVFO 5IDQA 3H4VA 1E92A 2WE7A 1P31A 4P8RA 3K8ZA 5DDIP 3KYDA 5G0UA 4DMLA 1PZHA 4QT0A 4BO4A 2GD1O 3TZCA 2YJZA 1NXQA 2ZIZA 3JSAA 3VPSA 4R54A 1PS0A 3ASUA 3N58A 1E3EA 3E48A 3OA0A 2VRBA 2PA3A 1JTVA 1A9YA 3PHGA 3QY9A 4URFA 3F1KA 4KUGA 3NDRA 2YW9A 3IDSA 1XA0A 1GCUA 2V6GA 3CEAA 3PFFA 3R1IA 2G1UA 1SC6A 2JHGA 1G6KA 2Y05A 5ICSA 1Y6JA 1A7AA 2NVWA 1IZ0A 3JQBC 4MINA 3UOGA 2QQ5A 4CMCA 4MVJG 3AU8A 3RUAA 1R66A 1KYQA 1MB4A 4K28A 2VN8A 3M6IA 2NU6A 4YA6A 3B6ZA 4IIVA 3HWRA 3PLNA 5B37A 3WYEA 2A92A 1XIVA 4NPCA 2HK9A 5T5QA 1C1XB 1F17A 2DU8A 3O9ZA 5K1SA 3LC1O 2X9NA 3X2EA 1XYGA 2EJWA 2AEFA 3RI3A 4DPMA 1QYXA 3TN7A 3KLMX 4C7JA 1GFSA 4AJKA 3WBBA 1YH3A 5KIAA 2Q1SA 5DBGA 1DAOA 2I5PO 1EUZA 2X4GA 3WFJA 4YRAA 3M2TA 2IDZA 4H3VA 4WNCA 5C7OO 2BKAA 1EBFA 4ZA2A 3AM3A 2GZ1A 2O7QA 3KSZO 3OETA 2I76A 3ZU5A 2H6EA 3W4KA 3GH3A 3Q9NA 2FPIA 5C7LO 1ZVMA 3K73O 4BUCA 1RM0A 1TLTA 4NU6A 1IPEA 5TF4A 4HFRA 1VL6A 1MV8A 3L07A 1T26A 5EERA 1VKNA 1C0PA 4PLZA 4ZQFA 4O0LA 3RVDA 4CMHA 2DBRA 3K5PA 1HL3A 1F14A 1ARZA 1AXEA 4L8VA 1H9BA 1NFQA 4PLVA 4BNFA 2J5QA 4JK3A 4GGOA 4B4OA 1YVEI 2D1YA 1ISHA 4N5MA 4N54A 3B1KA 3ANLA 4I08A 1HKUA 1LXCA 3TSCA 3ZU4A 2DBQA 2X8LA 3UCXA 1KEWA 4W99A 1E1MA 3DBLB 3L9WA 4DC1A 3DBVO 4NHEA 3GEGA 3DMTC 4UULA 2X7HA 1FDWA 4Z9FA 2QW8A 4WLFA 1DLJA 4EBFA 1B16A 4CV0A 2WJPA 1R37A 4XEHA 3ZWVA 3PI7A 2YUTA 2AE2A 1HZZA 2IODA 4MVJH 5L95A 4FOSA 2D3TA 4W9NA 4AVYA 4CL8A 3BTUA 3A28A 4DC0A 3HHPA 2C0CA 3GT0A 1ID1A 3G3EA 2C7GA 2HUNA 1T1RA 4Q3AA 1BTOA 2DT5A 4FIZA 4S1VA 4XQCA 3JYOA 3WDSA 1AXGA 5KVSA 1XGKA 2H9IA 5F1PA 3SVTA 1PJ4A 1U3UA 4BNXA 2PKRA 1DC4A 2XXJA 2ZKLA 3NTOA 1BXGA 2GN6A 2GNAA 1UR5A 4D46A 1E3WB 4EJ6A 4WEQA 4BV8A 3RAJA 4CMGA 5JO0A 2C07A 1TT5B 2EXXA 1U4OA 3EAGA 4MDHA 3PWSA 3JQ8A 4ND3A 3MJVA 3VH3A 4NBUA 5C7IO 2AQIA 3KB6A 4R5MA 5G0VA 4TRNA 2YZ7A 2PZLA 2C54A 3JQAB 1QP8A 5I9LA 4NJOA 3AI3A 3OIGA 4J4TA 4ND1A 3PJDA 3VZSA 1ADCA 4BOYA 3H9EO 1ISIA 4AICA 3U4IA 1E6EA 1HTBA 2FRDA 3K2BA 3ZHZA 1EK6A 1YQDA 3ZZNA 3ENKA 2BH9A 4FFLA 2YV3A 4DQVA 1DLIA 4IUYA 4MP3A 3D5TA 1IZ9A 2Y66A 2QZZA 3UKOA 1P33A 1XKQA 2OFPA 3DZFA 1YL7A 1A4UA 4PLGA 1UP6A 4U0JA 5JMPA 3NTRA 1IULA 2IYPA 4AJJA 1NTOA 4JBGA 3UVEA 3KYDB 4NH4A 2OXIA 3ZWXA 4ALKA 1SCUA 1BW9A 1KERA 3KHUA 1Y7TA 3ANNA 3JYNA 3I5MA 1J6UA 1HYEA 4E6PA 1SOVA 4WLVA 2QYTA 2YDXA 4MPDA 3JYLA 2HMWA 3FPCA 4JBHA 2O50A 5AXAA 3CMMA 1KY5A 1NHGA 2O3TA 1K0UA 1W0CA 5EMHA 1AHIA 1D1SA 1O94A 2R2GA 1ZH8A 2JHFA 2Y1OA 2ZTMA 4WLEA 3O8QA 1ULUA 3WYCA 4OHUA 1JKIA 1KVUA 4FOOA 4Z0PA 3UN1A 4DIBA 1B3RA 1PJCA 3SJUA 3ANMA 3UCEA 2CNBA 1TT7A 2W2LD 4FW8A 4G2NA 5C5IA 4LCEA 2I3AA 2EP7A 3GHHA 3R0IA 2PTGA 3CTMA 3PQDA 4ND4A 4QTZA 4GLLA 4KUHA 4Z9XA 3WGTA 5JAIA 4ITUA 5L4LA 1FMCA 4UAGA 4P22A 5COQA 1E1NA 3LT1A 3TF5A 4A26A 2BFOA 2Y1FA 2PR2A 4WCFA 2B5VA 1OC4A 1TXGA 3ZNOA 2IE0A 4IDCA 4BNMA 4I9UA 3OIDA 3KLPX 4W7IA 5T6BA 3TZHA 2V7PA 4M1QA 3W6UA 4E0BA 1LI4A 1A71A 2C2YA 3GDOA 3BMQA 1IL0A 1IPFA 3PFWO 2HK7A 4GI2A 1CYDA 2C59A 2ZATA 4IY1A 3BA1A 9LDTA 5A03A 5DCWA 2XOXA 4H15A 4II3A 4E30A 1I36A 2P68A 1O8CA 4NR0A 3OMLA 3W8DA 1U8FO 4OYRA 1UXKA 4IGEA 1C0LA 4QX6A 1LSJA 3Q9UA 1P1JA 1GEGA 1UUFA 3G49A 2EWMA 4EJ0A 1F8GA 7MDHA 3GVHA 2X86A 2FZWA 3H2ZA 4Y67A 2NNLD 4BMVA 1ZW1A 3B70A 2WM3A 2GRAA 2WD8A 5JMWA 3EVNA 3PWKA 2E49A 1UP4A 3GHYA 4FGSA 3TL2A 2UUOA 1LRLA 3M1LA 4CM9A 1GDHA 1XCBA 1QKIA 2W98A 2H63A 1T2EA 3KTDA 4CM9D 4U8GA 1B8PA 3PIIA 4B3HA 3TOZA 4PZCA 2VYVD 2E6UX 1E0DA 2JD2A 3DQPA 3GZNB 1NQOA 5ENDA 4A10A 2NACA 4XRRA 1GUYA 1LDNA 2Q3EA 5I9MA 4R5HA 3STHA 4YDRA 3HUDA 5EL0A 3WX0A 2WSBA 2WDZA 1WP4A 5TRTA 5I7FA 1Q7BA 4WPGA 3ZH2A 1Y1PA 1EFKA 1BXGB 2ET6A 1EQUA 5TS3A 3ZNPA 4D3FA 3GZ4A 2EJVA 4OL9A 4PG8A 4BIIA 2Y1CA 5U1PA 3OJ0A 2FMUA 4R51A 5AXCA 4NK4A 2Z1NA 3FR8A 2AHRA 1PZGA 4LK3A 3EUWA 2P5YA 2XF8A 3JQ8B 3HE3A 4YJDA 3WGOA 2RH4A 2X9GA 4FR5A 4ID9A 4O59O 5IFLA 3IC5A 1GCOA 2PZMA 4KDEA 1O89A 1AE1A 1IHYA 5HS6A 4BB6A 3FNGA 4F45A 1E77A 3JQBA 1XU9A 4AJPA 1AHHA 5CEEA 1A4IA 1QYVA 3CZMA 1DJNA 4PLFA 3W8FA 1QV7A 4W82A 1QR6A 1HDZA 4TZTA 1TI7A 3WJ7A 3WLFA 1DFIA 3VKUA 4EZBA 5KKAA 4CV2A 1ZMTA 1Y5RA 1HDYA 1ZO8A 1P1HA 2AQ8A 5TLSA 3QQPA 3PRJA 4BO9A 3IKVA 2DUWA 5JC1A 3BMCA 5AVOA 1QG6A 2JD0A 5HA5A 3LDHA 1BW9B 2PKQO 1YQXA 2GN9A 5BSFA 1FXSA 3CIFA 4L76A 4PN3A 2J8ZA 3UF0A 3PJGA 3E5RA 2NVBA 3MTGA 4DREA 3WGGA 4YRBA 2NQ8A 5MDHA 2IZ0A 5IDYA 2O48X 2IXAA 5FWNA 1LRJA 4E33A 3N7UA 4PLCA 2GZ2A 2OP0A 2RBEA 3AFMA 3I23A 1WDLA 2HAEA 3BHJA 5T57A 3Q2KA 4BHTA 3ZW9A 3HN2A 1WVGA 4D3DA 1PWXA 2Q1WA 1Q1NA 2BGMA 5I7VA 3O26A 4TROA 4DXHA 3O8QB 2B35A 2O23A 1SEVA 3GOHA 1CDOA 3VVBA 2DTXA 4ILKA 4Y98A 5L51A 4OGWA 3H6KA 4CQLA 5ER9A 2GZ3A 2HDHA 4S3MA 3LT4A 1LC3A 4RF2A 4TZKA 4OXKA 3EMKA 1DFGA 1IHXA 1PIWA 3C85A 1YDEA 2OZPA 5TT0A 4XGIA 2LDBA 4UUNA 4ND5A 3DHEA 4KQWA 3S55A 4JBIA 3H2SA 1ENPA 2O4CA 3K92A 3FF4A 1MLDA 4WCFB 3DMTA 3GK3A 4Z0TA 1UDAA 1YO6A 2Q4BA 3QVXA 4MVJM 5JFOA 4B8ZA 1N5DA 2EW2A 4XX0A 2NUAA 3LLSA 4XYLA 1D7OA 3I4FA 3JD3A 4L4RA 4WJZA 1GQYA 4RPLA 3UW3A 5MGBA 3PHJA 3WQQA 2C2XA 3BMQB 1YQGA 1PJLA 2QRKA 2PGDA 2CY0A 3I9MA 3NJ8A 4IDAA 4TSKA 4M89A 4DYVA 4BNTA 1WW8A 3ROMA 1MFZA 3IOYA 4Y8VA 1P1FA 3JQDA 1J4AA 1K5HA 3ZWMA 3H3JA 3C7CB 1NPYA 1R15A 4QQRA 2GASA 2X0NA 4Q3EA 2X5OA 1ZK2A 1I0ZA 4GX5A 5JYEA 3ZWAA 4Y9DA 1EFLA 4CM8A 4GVLA 4D79A 2HMUA 2J3JA 2C82A 3PJEA 4BKQA 5H81A 2VYNA 4J7UA 1E3JA 2RH8A 2V6FA 1VL0A 3AUTA 5L9AA 2VYND 4JIGA 4M87A 1HLDA 3JQEA 3FNFA 3TZQA 4WLUA 4G5HA 4Z3KA 3RJ9A 1B26A 2HMSA 1JWAB 1EVJA 5JE8A 4YAKA 1LX6A 4OO3A 1CERA 3P19A 4W4TA 5FFFA 3AI2A 4AJ4A 3MJSA 1BVUA 5KVVA 4IJWA 1C1DA 4ZJUA 4GX1A 4KTVE 1MX3A 1DEHA 4R1SA 2POQX 4OSOA 4YBZA 2HQ1A 4Y6PA 3FI9A 1I30A 2C7VA 2HO5A 2J3HA 2VZ9A 4RQUA 3BTVA 5L4SA 5CEFA 4NI5A 5TQVA 1I8TA 2SCUA 3VDQA 2YYYA 3WWYA 2UAGA 3ICPA 3KV3O 3ONFA 3E1KA 5EINA 5HBRA 3QV1A 4CLRA 3SC4A 3QJ5A 3U3XA 4U7WA 2WYVA 1J0XO 2G5CA 3GUYA 4ZICA 3K30A 4QXMA 4NMHA 4CMAA 3VTZA 1KEUA 3B1FA 4H7PA 4R3NA 4B3JA 1X1EA 1LSUA 5DCUA 4FCCA 3COSA 4E5MA 4JNKA 5LC1A 4J1SA 4FS3A 4LRSB 1D3AA 2CFCA 4E4YA 2ZB3A 2HJSA 4IBOA 4JLWA 3OM9A 4NBVA 4D43A 4TMFA 1E1KA 1XU7A 1RM4A 1ONPA 2GERA 3RFXA 4KWHA 4K1LA 2ZTLA 4PG7A 5EQFA 2JFHA 2VUUA 2ZB4A 3ZHYA 3LQFA 1ZXBA 3NT2A 1T2DA 3HJAA 4ZVVA 2O2SA 2HRZA 3O4RA 1MG5A 2CF6A 1VLLA 5J23A 2O3UA 4GSKA 1YS4A 2CDCA 4BQRA 1GY8A 3TZKA 3JQ9C 1N1GA 4R16A 5FI3A 4D41A 1B14A 1VJ0A 4PCVA 1E3WA 4RF3A 5JS6A 4I8XA 4YYZA 1DC5A 1MG0A 3E82A 2FSVA 3PHLA 3QVOA 4RVGA 1R0LA 1ISFA 3ZNNA 5F1KA 2FPGA 1LDMA 3MJCA 3QWAA 1I24A 1B15A 4B4UA 4E12A 3SC6A 3DAGA 4J7CA 1PJSA 4NU5A 1N8KA 3H3FA 1NWHA 3K9QO 4I5FA 1ZBQA 2PKQP 4FFPA 1O0SA 1O5IA 4CQLB 1N92A 3JQAD 2GUGA 3RWBA 3AWDA 5A4DA 4CMKA 3AOEC 1QLJA 3OICA 4PLYA 2QHXA 1LTHR 1X13A 5BSHA 6ADHA 2IXBA 1GQQA 3T4XA 1SPXA 3I3OA 2D5AA 3ABIA 3RCBA 4TKLA 5L3ZA 1YONA 1DRUA 3GG9A 1QYCA 4PGFA 1ONOA 4EUFA 4RQTA 3AM4A 1PQPA 2ZK7A 3Q1LA 3WOHA 4GLOA 4ESOA 2XAAA 1NYTA 3OEWA 4KWIA 3GNQA 4QUKA 2FPPA 4ZQHA 3V8BA 2JFFA 3GRKA 4J3FA 1KVTA 2CDBA 2NQTA 3NRCA 5THKA 4BO1A 3BZUA 1H94A 5DCYA 3HNPA 3NAQA 3AU9A 3QW2A 4XYGA 3RQSA 1LDYA 4ALIA 3KSUA 4ROSA 4L4XA 4OXYA 4NBWA 3ASVA 3I83A 1ISGA 4NDNE 2OMEA 5CDTA 3INGA 4INAA 1WDMA 5G4LA 2I65A 3JTMA 3ZWWA 1LBEA 4FPXA 2CVQA 3BYZA 1Y8RA 1L1FA 2EG9A 1V3UA 3EC7A 4G81A 3PLRA 1S7CA 4WASA 5BT9A 2D8AA 4CM8B 4IS2A 1HRDA 4HNHA 2NU8A 1DIRA 5I8ZA 1XDWA 3RC9A 3QHAA 1PGQA 3INTA 1KC1A 1WZEA 4CUKA 4GGPA 1ULSA 4FDAA 3RUIA 3ONDA 3PEFA 2O3SA 4CMJA 1DHRA 4YJHA 3INRA 3VZQA 1VL8A 4A73A 3GAZA 1ADGA 3QIVA 1A72A 3DZIA 5TNXA 1K2WA 3FN4A 2EHDA 1GZ3A 2BI7A 4MVJA 3TQHA 3ZV4A 1DC3A 3CKYA 4ZD6A 3RROA 4JCOA 1T4DA 3FD8A 4MVJD 3KEOA 4EI2A 3PQFA 4EUHA 3W4JA 2FN7A 3UAGA 1P3DA 5CFZA 4ZN6A 2HKIA 3DZGA 1C1DB 4A03A 1YL5A 2D4AA 2W4QA 1GU7A 1OC2A 2IEBA 4IZHA 4BQPA 3PXXA 4IJUA 3FNEA 3RC2A 4R1UA 2BHLA 2I6TA 5F5NA 1LUAA 1ORRA 4IINA 4ALJA 1OAAA 4JJFA 4JGBA 4F6CA 3S2FA 4G65A 3VPHA 1RYEA 1A5ZA 4PLTA 1X14A 3WYBA 4B4VA 1ZK1A 2Y1GA 4CLRB 4HNGA 1IY8A 4L75A 2WE8A 2ZB7A 3D4PA 2OO5A 2G17A 3AJRA 1HEUA 4TKMA 3RFVA 2A4KA 3V1YA 4EEZA 4R69A 4NQZA 1VM6A 1ZNQO 1GR0A 2VWPA 3PGXA 3UUWA 3GGPA 3HN7A 3CSDA 1JN0A 4IQ0A 4R1TA 4BO0A 4CLDA 1JLLA 3PZRA 4WUVA 4YJGA 4ZQBA 4J4HA 3GY0A 2ZYDA 4C4OA 3PQEA 2AMFA 4LVUA 1V9LA 2IYOA 3L77A 1Y9AA 3A4VA 1Z75A 1NVMB 4GX0A 4UEKA 4QECA 1M75A 3U4DA 1YKFA 3GZNA 1LQTA 4XCVA 1YWGO 2X1HA 1DOHA 3CMCO 4E5NA 4ZRNA 1CWUA 2ZCVA 2ZQYA 4R1NA 3W8EA 3ITKA 3C24A 3OJEA 2PK3A 1X1TA 4JP3A 4EDFA 1HYGA 3OJLA 3R3SA 4YAIA 4OH1A 1EMDA 5B1YA 4HUJA 2EV9A 4J7XA 4N5LA 1XLTA 4DGSA 4NNJA 2WTBA 1PGOA 3ENNA 1EDOA 4AJ1A 3WTBA 1VSVA 5ITWA 1I3NA 5ILOA 4FFNA 2BELA 4L73A 3DOCA 3AY6A 1KETA 5K6AC 3WTCA 1PQUA 3HDYA 4XR4A 1E7MA 1ZZEA 3CPSA 3DWFA 2DKNA 2B69A 4W6ZA 4XYMA 2Q46A 4IJKA 4MVJI 4BNHA 4XB1A 3K2EA 5A9SA 1JQBA 4OAQA 3TZ6A 1NQAO 3WIDA 3EDMA 3BIOA 1W4ZA 4N5NA 3GPIA 2EERA 5TC4A 3VC7A 3DDNA 3EGOA 2J5KA 3H8VA 4XIYA 4YVFA 4YB8A 4A2CA 1HDXA 4CPDA 3K31A 3F3SA 3UFXA 2AW5A 3NV9A 5B4UA 5DOVA 5T67A 4XB2A 4BO7A 1BMDA 3PYLA 3Q6IA 1JKFA 5H83A 2OORA 3MWDB 1Z6ZA 5L53A 3WIEA 3U9LA 3GEMA 2X0IA 3VH1A 2AE1A 3ON5A 2CSUA 3GQVA 4WCDA 2QZ9A 1QLHA 3LU1A 3MJTA 2RAFA 1VSUA 2J6IA 4R01A 2NVUA 3PIDA 1E7SA 3FBTA 2I9PA 2H5LA 3CE6A 3DTTA 2DBVO 3P7MA 4AL4A 3GDGA 3DZJA 2XPCA 3VPGA 4HKTA 2YHIA 3NTQA 1Z7EA 4GKVA 1DO8A 1E3SA 4DUPA 1XQ6A 1ZK4A 3H5AA 2Q1UA 2VWHA 1PZEA 2C20A 3NUGA 5C3MA 5JY1A 3ETEA 3L6EA 4M8SA 4Z9YA 2BI8A 1BDMA 1Y8RB 2FP4A 4HXYA 5KVQA 3HDJA 3KZVA 1U28A 4B3IA 3U62A 1PZFA 3L0DA 4AJHA 1LLQA 1RM5A 4XGKA 3WNQA 1WWKA 1DRVA 4PLPA 1ZFNA 1GZ6A 1X7DA 1O9BA 1I2CA 1NAHA 3F6YA 1ZJZA 5GMOA 2ZYAA 1YBMA 5EIOA 3V5NA 1N2SA 1E7RA 2O4UX 4J16A 4DRYA 4KUEA 4OJNA 1KOLA 3L4SO 1AUPA 4XDYA 4YJHB 1YDWA 5TT1A 5KJ6A 3AK4A 5K9ZA 1C14A 1LSOA 3LT0A 4KP7A 1Q7CA 3OHSX 3S1LA 3E18A 3UH1A 3N74A 4BNWA 5CG2A 1LJ8A 2GO1A 1B3BA 4UVDA 2Q50A 4B7XA 1JA9A 3DHNA 3UCFA 1H93A 2GLXA 1WMAA 3LSYA 1OFGA 1U3VA 3U4CA 2WEKA 2GSDA 4ONEA 5U4QA 4KDFA 1YJ8A 1GV1A 1PGNA 2VWGA 3FSRA 3JQCA 4MKRA 3VVCA 1V0JA 1ZSVA 2ZJ0A 4E2WA 3DTYA 3DOJA 3D3EA 3OJFA 1EDZA 3VZPA 2WYUA 1UJMA 3QVSA 1PS9A 3OQBA 4J2HA 4CQMA 4HY3A 2WYWA 4RVDA 4XJSA 3GF4A 8ADHA 2TMGA 3RUCA 4GMFA 2Q99A 1T25A 4RJTA 1LLUA 1Q0QA 3JQ9A 2JCXA 2VTDA 4CQMD 3D5QA 2AQHA 4TQGA 2PFGA 2G0TA 2D2IA 5KVCA 3OF2A 2P5UA 3FRJA 3WNVA 3ZW8A 4XGNA 3RC1A 2AA3A 5CDGA 4CM7A 4MIYA 1U7HA 9LDBA 2HJRA 5A3VA 1HXHA 3E9QA 2OGUA 2Y0EA 4NK5A 4RL6A 2GCGA 1T2CA 1ENZA 4GAEA 4YJGB 2QRJA 1KBZA 1PL7A 3LF2A 3HB4X 3G17A 4DLLA 1I10A 2Q2WA 4J9VA 4UVHA 2GYYA 5H82A 1SEPA 1U3TA 3LC2O 1F06A 1YGYA 3BAZA 3DBHA 3HG7A 2BD0A 4U0KA 3AOEA 1ZKMA 1SO8A 1U5CA 1DRWA 3DZBA 1CF2O 1L7EA 4WOKA 3ZU3A 4DL9A 3DL2A 1NPDA 4MVJP 3SX2A 4FSHA 1H6BA 4RPGA 4RV9A 4Y6SA 4IJVA 4OMUA 4AJIA 1HETA 1P9LA 3H9JA 5TX7A 2QYSA 2WMDA 2DUUA 2Y1EA 1MXFA 2VNAA 3GRPA 1J5PA 1I2BA 4MIEA 3ITDA 2Q45A 4QO7A 2X0RA 1Z73A 3RUEA 1NR7A 4ZU3A 3D7LA 4PRKA 3WS7A 2OOSA 2QRLA 4Z0HO 4QSMA 2VWQA 4OOEA 4JN6B 2HK8A 4L0QA 1XWFA 4FN4A 3AUAA 4K26A 5A9SB 1NP3A 2VOEA 1LDBA 4BGIA 1XG5A 4JX8A 5JXWA 1P0CA 5G4KA 4IS3A 4FFOA 5DP1A 5GY7A 1NQTA 3PZBA 4GMGA 4U6QA 2BGKA 3V2GA 3DFUA 4XR9A 2VQ3A 1O6ZA 5IF3A 1UH5A 4OKNA 5DOZA 1NAIA 3I4CA 4PIVA 1YB1A 3KRTA 3ROKA 1FK8A 1G0NA 2Q2QA 4IDEA 2PWZA 1PL6A 4IDFA 1Z74A 2EGHA 5IZCC 1D4FA 2FZEA 3WBFA 4TRRA 3F47A 4MVJF 2EGGA 5BNTA 4I5EA 3GEDA 4CLXA 2NVUB 3PYXA 3OBBA 1LRKA 4YQZA 1WNTA 1T2FA 1EEHA 1PGPA 2P4HX 1HDOA 3VH4A 3GGOA 1CIVA 1QYWA 1W8DA 2UV8A 3MTJA 4R68A 1PTJA 2YHIB 2YV2A 5KJFA 5BR7A 4NIMA 5L4NA 1P44A 2FR8A 1OI7A 4HP8A 5BSEA 3I9OA 1GTMA 1U7TA 3GG2A 1SZJG 4MP8A 4CR7A 5B4VA 3NGLA 2GN4A 2OBYA 2VT2A 2OUIA 3T7CA 1UXIA 4BVAA 4DBVO 1ZCJA 3X2FA 2E48A 4B79A 2DVMA 5B4TA 1LDGA 3WJAA 5BQFA 1C0KA 3TJRA 3WR5A 1WZIA 1TB4A 2BFMA 3ZHXA 3F5SA 1ENYA 2HSDA 3QA9A 4LSWA 4PG4A 1KIFA 4X54A 4Z6KA 4BO8A 2EIHA 4BNLA 4Q39A 3JD4A 1CQIA 2NU9A 3ADOA 3C1TA 5DULA 4ZRMA 2E37A 1N9GA 1GAEO 1EZ4A 3GMDA 4YACA 4O5OA 3OEYA 5AXDA 1EQ2A 1M6WA 4I9NA 1PGJA 1PWZA 4KOAA 1ONNA 4KZPA 3R3JA 4Q3NA 3SJ7A 3AI1A 5IXYA 1R4MA 2GGSA 4CM6A 2FR1A 1U9JA 4PG5A 2PY6A 1UZNA 5CDUA 5FI5A 4BNIA 4BGUA 2YQ5A 1I32A 1K89A 1QV6A 4II2A 3RUHA 5JDIC 1QSGA 3GFGA 5IDXA 2CDAA 1P77A 1UXGA 4MIOA 1H9AA 3MWEB 2VUSA 2Q1TA 4FFMA 2FOIA 3IJRA 3KUXA 4CQMB 4WOJA 3WWZA 1P1IA 3FR7A 5CEJA 3BMOA 1ZK3A 1MXHA 1OBFO 5JC8A 5K0ZA 1PJTA 3DC2A 2HRBA 3JQ7B 3L6DA 4WNIA 5TJ9A 1PR3A 4BGVA 1PR9A 5GZ3A 4CMEC 5K6AA 1U3WA 1K3TA 1X15A 2W90A 1Q7GA 2B5WA 3L4BC 3T7EA 4RDIA 4D3SA 1O95A 4CV1A 3GR6A 3OIFA 3GVXA 4MJLA 3GC6A 5T8KC 4CV3A 1TEHA 2PD6A 4L74A 4OM8A 4RZHA 4UUOA 3I9JA 2Z1MA 2OHXA 3GA0A 1P45A 4Y6RA 1XQ1A 4IXTA 5DBIA 3ST7A 1YJQA 5ICMA 4HWKA 1P1KA 2W2KA 4GX2A 3NGXA 3DBHB 2GN8A 4CLEA 5BNFA 2RCYA 2DTEA 1B8UA 1BXKA 2ZB8A 3FTPA 3V1TC 4RVSA 3BXXA 1QMGA 4RLSA 4OQZA 3FWNA 5U9CA 1HDRA 2Q2VA 4ALNA 2CZCA 4PVDA 1ZEMA 3C1AA 5KOIA 5L7WA 1ADFA 5AYVA 3WICA 4D42A 1AGNA 5A1TA 2VHWA 4BKUA 3VHRA 4J0FA 1RM3A 1DIGA 3G1TA 4I1IA 4MKXA 1C0IA 3G0OA 1GL3A 1GEEA 3ZGYA 5KTKA 1KEPA 1QXSA 4YQYA 4RVFA 2PH3A 3VDRA 4OOFA 2B4QA 3I9KA 5I9NA 1DIHA 3S2IA 2PLAA 2ZQZA 5G4KB 3WGQA 2P9CA 5IZ4A 5A9TA 4XIJA 3JCZA 3WGIA 3IJPA 4FC6A 1N7HA 1KC3A 1KS9A 4CUJA 3HFSA 2V65A 4B7UA 2D5CA 3JQFC 4XZ3A 5COBA 1XELA 3EHEA 4AJNA 1M2WA 4D45A 1NFFA 2AG5A 1W6UA 3RBVA 1DAPA 2HMVA 4XRGA 5G0TA 5I7EA 2J3IA 1LLDA 3GPDG 4R41A 4Q3BA 4RORA 5LDHA 1HYHA 3W1VA 3D64A 3DXFA 5I7SA 1A9ZA 3LYLA 2PD4A 3ETDA 5ILGA 4KQXA 2DAPA 5TGDA 4OQYA 4PG6A 4BO6A 3AFNA 2PZJA 4BNVA 4N7RA 3WMWA 2AG8A 1NHWA 2X6TA 3IMFA 1V3TA 3ZDFA 5JCXA 1H5QA 1HDCA 2PV7A 4CLHA 5ITVA 5EPOA 1HE4A 4YT2A 4PFJA 1EBUA 1XEAA 1LU9A 4F3YA 2PD3A 4YT5A 3P2OA 3W6ZA 2VZ8A 3I9LA 4PZDA 4P4GA 4RGBA 4ALMA 1DHTA 4DA9A 1QORA 4XQ9A 1CETA 1BGVA 1HE2A 4YT8A 4RF5A 1E7WA 1HF3A 4RCVA 3CUKA 1E7YA 1M66A 1JW9B 2P9GA 4GVXA 2WD7A 3C8MA 4GWGA 3IS3A 4CLOB 5F5LA 4R9RA 3WFIA 4TVOA 4J6FA 3PPIA 2RIRA 4IDBA 3PP8A 3D1LA 4WE3A 4NG5A 3K6JA 1ZSYA 2AXQA 2PNFA 3KM0A 3P2YA 3MOGA 4QFCA 3F46A 1U5AA 1N9GB 3ROQA 2IZZA 1HE5A 2J5RA 1R0SA 4WKGA 4M49A 3VPXA 1NVGA 3DBRB 3QRWA 4EGFA 1NBOA 4JROA 3GAFA 4N18A 2BMAA 1R4MB 4UEJA 1ZUD1 3UXYA 4BKPA 3HSKA 2VHXA 5DN9A 3C7AA 5CDYA 2UDPA 3CZRA 4BL5A 4XDZA 2HCTA 5T64A 5KWEA 1JAYA 3C1OA 4KTTE 3F4LA 5IJZA 3RD5A 1XR3A 3TOXA
chains in the Genus database with same CATH superfamily
4HNTA 1Z5ZA 1R6BX 1H3FA 4MVXA 2DLDA 5D5QA 2AYXA 2BHNA 2ZRMA 3IIJA 3KUCA 3MHTA 2CEKA 1GNSA 4HCJA 4K6HA 1FDUA 1UINA 5K6TA 4FT4A 1XYYA 1XD2B 5CIWA 3KETA 2WVGA 1UJ4A 3ZE1B 2IHKA 1UJNA 2Q6IA 4LDPA 3JYPA 2ANCA 3IUEA 4PHFA 4R2JA 4JI0B 1X19A 3BRWA 1UT5A 3FSGA 3PE3A 4OI4A 2JS7A 1U6KA 1QP4A 1RKUA 2P2YA 2H5IA 2PS1A 4E14A 5KZMB 1GYRA 2GCNA 3FSGD 3PWZA 5CT8A 3OZAA 3W2FA 2VT6A 2JGNA 3DCYA 3LCMA 4J0QA 1E5LA 1F0NA 3ADBA 5KNLA 5CDSA 1ACMA 3UY4A 4TN1A 1A2BA 2BM8A 3SIXA 2D2FA 5DBOA 1R64A 1VPDA 2C2BA 1A98A 1C1YA 2PUHA 2ORED 2PGAA 3L0YA 3P9ZA 3QE4A 4JKOA 3EDOA 3GEBA 1Z12A 3D4NA 2E7ZA 2JLXA 5ABPA 2Y1KA 1J0AA 4BN5A 4ZOLB 5TIIA 2REXB 1WSBA 2H2FA 4D4JA 3LZDA 2VHQA 2Y99A 2CKDA 3UHAA 2ZI4A 4DNXA 3OH8A 4TRJA 3ZU2A 4JLSA 5BY2A 3PHIA 4HC4A 4B7CA 1VRWA 1T2AA 2X14A 3EDQA 3IAEA 2AR0A 3KDAA 3UW1A 1SKYB 2R6CA 1E58A 1L5RA 1B0AA 2GF2A 3QYPA 4IGFA 4WLOA 2ZT6A 2HU8A 2W8ZA 4Q15A 3I62A 1TZKA 5CXXA 2IYZA 2NWQA 4EY8A 1EK0A 1SKMA 1OYWA 2CUKA 3BSFA 5LA6B 3RIHA 4YT4A 1XUOA 4RAOA 2NZUG 2PS9A 2QAJA 4N3AA 4BNNA 4FP9A 4TTQA 3EFOA 4Y1RA 3MWLA 4YXFA 4EFDA 4LXIA 5JPDA 1QBGA 2A0WA 1G0OA 2PLNA 3B7WA 2AJTA 3JAWA 4KLZA 4LBYA 3JV7A 3SU8A 3DM9B 3HB5X 3LOPA 3PC8C 4TS3A 1EQAA 4GPZA 4DCSA 3CLUC 3BD7A 1MQ8B 2VTVA 4GBGA 4X41A 4F6CA 2Y0CA 4NXMB 1NIPA 2PX8A 3EW7A 4P92A 5DO9A 4FGWA 4EHJA 1B43A 2IEGA 1QBKC 5JMWA 1Z5VA 1R16A 5ADWA 1SXPA 1KJWA 1IWOA 4LRQA 4LV5B 1FQKA 4D80A 2YFYA 3HDHA 2DC1A 2P1ZA 4GRAA 4NU0A 4WFIA 2AYZA 4ES6A 1U2TA 1KQ3A 1YBVA 2HXSA 3ABSB 3K1AB 4MOWA 4RFSA 5HCIA 5LCXA 1FDVA 2FVYA 3O2NA 2HRDA 5FEMA 1RKXA 4TWRA 3HEMA 4HNSA 3TPCA 5MN6A 1ULTA 3IIKA 1LB1B 2A3NA 1GKKA 5A5FA 3I58A 3IVMA 2G4CA 3AGPA 2PUFA 5HP4A 5HE9A 1MKYA 4NFHA 2H2IA 3M5DA 1E7QA 2DUMA 1UMBA 1L4GA 2Y27A 4J0DA 3ZE6A 5F3RA 4HRVA 1N7GA 1A8HA 1KO7A 1DADA 4QPCA 3SLKA 1DVRA 1H9CA 1EI9A 2XUIA 4CM4A 1OBHA 1ZK0A 4K81B 1I7SB 4WGGA 4G37A 1ODTC 1QIMA 4AJOA 2BSQA 2CLMB 4I6EA 5HTOA 3S5JA 4JSRA 1R6DA 1J56A 3N86A 2QVCA 1C3VA 4DLPA 5CFQA 1THTA 1I5EA 2A35A 2I8AA 4G5RA 1SG0A 5DF1A 1BSVA 4Y9TA 4FFBA 4K9OA 2C4WA 2EKPA 1P0QA 2WD7B 5A9RA 1MT3A 4BFYA 3C48A 3LL7A 2RKBA 3KAJA 3LKBA 5BN4B 4LYAA 4DV7B 4UASA 3KSDO 4JT8A 4IMRA 1RZVA 3GGJA 4LRWA 5AKGA 4AF8A 1Y7PA 5CB8A 2QQFA 5DEOA 4ML3A 3P5BA 1SNYA 3VU9A 3OIVA 4BECA 1S3FA 1Z82A 1H6DA 3UXMA 4U2CA 4K86A 1EB8A 3KYIB 1KJNA 4DIOA 3CY6A 4R0MA 1PL8A 3LY9A 4I0WB 2C5GA 4Q03A 5CW2A 4YRSA 2W5UA 4LZLA 3U5TA 1BEUB 1BE8A 1L3IA 1GG5A 1UEIA 3TLKA 3A9RA 2XZDA 4HV4A 2HF2A 1TZJA 4B3TB 1HRKA 1GADO 3ILHA 4KGDA 1N32B 1QLWA 2VFAA 1FFEA 1SUPA 2VDRB 2IYTA 3CBQA 4EG5A 1HT2E 2JFBA 4WBSA 1M2HA 4DM7A 4PQRA 1WM1A 1EGVB 1H3EA 3VYSB 4A6EA 8MHTA 1JE0A 1XHFA 2GPTA 2OAQ1 1OFHA 2EF1A 2ZULA 1C29B 1TE2A 3AYZB 3HP1A 4A6XA 1UMCB 4S1NA 2R8EA 5LP6A 2Q3FA 4EFLA 5B12A 1U2EA 3LBYA 1CE8A 1Z45A 5J2TA 2PUGA 1Y7HA 1JU4A 3GAMA 4EW6A 2H08A 1E89A 4Q0MA 1UPBA 2B4RO 3MEQA 4OHBA 2DG2A 3NONA 4UCXA 5KJ1A 2CVZA 1W93A 1ODCA 2IKQA 3ORHA 4N8DA 4CM1A 5CGQB 4E4RA 3H2JA 8ATCA 1P1BA 1Z56C 2Z5LA 3K96A 2R8OA 3U19A 4BAGA 2ID7A 5DM2A 1QK3A 2G63A 2L17A 5EWMA 5IF9A 3H1PA 3KXDA 3UV3A 3UICA 4NFYA 2BKUA 2D59A 2HA7A 1S5PA 5J43A 5KYKA 4J1NA 4KBYA 4GNKA 1XAJA 4YJ3F 4RGYA 3EA5A 1H0KA 4LVCA 5THQA 1BE1A 1KSGA 1KYIA 5H3HA 1SUWA 5C9ZA 2QTGA 3CISA 4GOLD 3SYNA 1LBSA 3H04A 1X9GA 3LYHA 3Q3CA 1FFXB 2ODTX 4G4IA 2FWMX 3DBOB 3JQFA 3D7KA 3PUIA 1N6KA 2B92A 2J67A 3I1JA 4DR4B 1LK7A 5LKRA 2JB9A 2QD3A 2ECOA 2ZJ1A 1UXHA 2VSFA 2PSJA 2HV8A 4Q16A 3O8OA 3ZE0B 5IZ4A 5LZ9A 3F1LA 2EZUA 4RL4A 2NN3C 4U02A 4E5PA 4WZAA 1L7XA 2JD1A 1ESCA 1NE2A 4P4NA 3L2OB 3WJ2A 3RSHA 2GPWA 3PDJA 5H16A 4F38A 1E0JA 3D8TA 3K0HA 3PC3A 5HW0A 1Y8QB 1PVVA 2GDZA 3WB9A 3ISJA 2EKQA 1US8B 4WXMA 1R74A 3HKEA 3JQ7A 1R12A 4LXGA 1E4OA 4RMIA 5TR9A 4N47A 1RPZA 3PGJA 1ODIA 2WSSA 2ZJAA 1ZJJA 5AJZA 4UTRA 2P6OA 4DPLA 3P0JA 4H2DA 2WM2A 3PDIA 2VH1A 4IOKA 5I8WA 1JLMA 4I4LA 3B51X 4IHQA 3JR3A 3SBEA 2AN9A 3NYRA 4QYIB 4P38A 4P5EA 2IY8A 1ISMA 1QQAA 2PUCA 1A9XB 2ZIVB 4MVJE 2C7PA 3AHGA 4UUPA 1K8XB 4GU5A 2QTZA 2Z6VA 3HI6A 4LN1A 5FLKA 3SZMA 3ZN2A 5HM8A 1G19A 2BFEB 3WK9A 3CVJA 1M67A 5H68A 2WOOA 3EOBI 2IEAA 5AJUA 1QHHA 4TKVB 2WILA 1AC5A 4TV8B 1XPRA 1SD1A 3AUYA 1QIFA 4PSDA 3UIEA 1DCFA 2B7BA 3OLXA 4POAA 1YOVA 2C9MA 3DB2A 4EW3A 1EUDB 3GNSA 2WQ6A 4W5NA 5JCPA 4QOJA 2QV7A 5C1IA 3RH0A 4KR6A 2GILA 1NATA 1PQ4A 1X74A 1YIOA 3GAAA 1OI4A 1CHDA 4LXYA 3GNTA 1LDEA 4WDQA 3UWMA 1WCXA 4AU1A 4CM5A 2YUIA 2Z9BA 1W73A 4AFNA 4JXKA 3I73A 3IUYA 5DKFA 4D0SA 4W7HA 2PEZA 1RPNA 2CV2A 3MK31 1UPXA 2RHRA 4DLKA 4JLPA 1ECJA 1QJ4A 1P6QA 2J7KA 3BEOA 4QKQA 4IIGA 4NYIQ 1TL7C 3IUPA 2IS1A 1KO8A 2O8EB 5HFNA 3ND9A 1XL1A 3JWGA 1R88A 1ZC4A 1QRRA 2DPXA 2FDXA 3LDFA 4L0MA 4NAHA 4RABA 1PX0A 1Q21A 4RPKA 1GTRA 2JEOA 2C3PA 2RGDA 2ILTA 1XAHA 3Q0TA 3DE5X 4PBSA 2ETXA 5CFRA 2P2GA 2OHVA 1ML3A 2AFVA 2C31A 2QI9C 3ADPA 3BL8A 3GRAA 4OM7A 4QQKA 4U9IS 5BV0A 1WQ4A 1Q1AA 1B76A 2QKYA 4MZXA 2V0NA 1ZD1A 4BX2A 3AM5A 2Q3DA 4BIMA 1PF7E 2GN1A 3DZKA 1K6XA 1NYRA 5AVVA 3G2QA 5CVVA 2MDTA 3RV4A 1HA3A 3UMSA 3ID6C 3U7FB 1V47A 4ETWA 3DCJA 3O7MA 4GPD1 4HS4A 5AXBA 3C6YA 4BRWA 3QPBA 1X42A 2KLBA 4CT4B 4EYGA 2FN3A 1MA3A 1GZ7A 3P71T 4RS3A 2ID9A 3D3QA 1KJYA 2NGRA 1RYHA 4UBNA 5BNIA 1OBOA 3H7AA 3EQ6A 2ZYVX 4BFSA 1Q84A 2HZBA 3G8YA 5FO0A 1EE9A 2AH5A 1FTSA 3NKVA 4GEGA 3T6KA 1N77A 5M29A 1Z5NA 1E96A 2WB4A 1CZHA 4M55A 4UHFA 4ZQGA 3FLAA 3BSYA 2AC2A 4ZCLA 4DAOA 2VDUE 2E9SA 4KVZA 1ECBA 1V1RA 1KY3A 1QQ5A 1ZAYA 2KX7A 3BH0A 5LLDA 2PUBA 1ISJA 3D3WA 4I55F 4OREX 1CIPA 1SXHA 1V4BA 1USGA 4BBPA 5FYDA 4FYJA 5CLHA 1T4BA 2ZR9A 3AZQA 5H02A 2XNDA 4KZKA 4DNQA 4OHCA 3B38A 3VKVA 3ZYCA 1YTLA 4GD3Q 1R0KA 1J97A 1NT2A 2WYIA 1W52X 1N4DA 2HBQA 4S2EA 2TRSB 2XNDD 3OZIA 5H1YA 5JPIA 1QMPA 4RJJA 2C4KA 1UAYA 3EC2A 4LJRA 1D2MA 2VBGA 1MC1A 4X1IA 3EH1A 4KFTA 3VOBA 1V5EA 1J8MF 4ER6A 4TYNA 3PJFA 1OZAA 3KOXA 1NG1A 4ICIA 2NU7B 3TLEA 1FX1A 1PI3A 4UREA 4DV6B 2ZWAA 3MJEA 2UVDA 1TYZA 1OYOA 5MFPA 4ENWA 2ZS7A 3H1AA 3ZXSA 1COZA 1UDRA 3H1EA 1K98A 1VLJA 2NSHA 4MQFB 4UAUA 4HO1X 4UTOA 5L40A 4AIIA 1YRLA 1I1QB 2VHVA 3L8YA 4KQEA 4LJ4A 4KO3S 3I2GA 5CH8A 4M22A 1OROA 3KB2A 4M7OA 4PZEA 1A9RA 5CVJA 4MK4A 3VAZA 4R4JA 3DBRA 1U8XX 3QNWA 4QGFA 2Y68A 1O9HA 1YDGA 3Q9SA 3H5LA 3OCJA 2OGZA 4DCCA 3HM2A 2UYOA 2E1RA 1Z2CA 1DB3A 3BXEA 1U2DA 3A05A 3O91A 4DJTA 4L8YA 4JI7B 4KN6A 1CEYA 3CEJA 3KJIA 4BWFB 2O6LA 4QASA 3LX5A 4UMVA 5BXQC 6Q21A 3HFGA 4V2IA 3LK7A 5G40A 1IOLA 4UMEA 2X9VA 2BP7A 3P9KA 5ENVA 4YR9A 1J39A 1VJ1A 4BV2A 1BOOA 2VAWA 3NNDA 1PJBA 1OX5A 1Q12A 1HSZA 2EDCA 3D2BA 4LYEA 5JJBA 4F3CA 5I3ZA 3DUWA 2Q6VA 2FSSA 1CU1A 1L5OA 2XUOA 3BB4A 3GLQA 3TLGB 1UK8A 1IC6A 2GHQA 3R7NA 3EEBA 3EZ9A 5DWDA 4AZVA 4EPTA 5JSZB 4RTOA 4YI3A 1ZRNA 1BHSA 4QEKA 1KK1A 4BZPA 4E2ZA 3DLCA 2BRUA 1Z06A 2QE7A 3R9IA 1MC4A 2C04A 1KI7A 3ADKA 4F71A 5D51S 2VNSA 2GT1A 4F9GA 2O2CA 3N9IA 1MOZA 4CEIA 4XKJA 1NY6A 2QE7D 4ARZA 1KP2A 3T7TA 1M7GA 1FJHA 3LWBA 1I3LA 4RSMA 1DTWB 2O7VA 5EOVA 2HCRA 4YTEA 3B3QA 1WPQA 3FHLA 3T3DA 2WIGA 3N8HA 2ATCA 4WESB 2Q5IA 4F60A 4K7JA 1MGOA 4A7PA 2V7QA 2NOAA 3NM6B 2BKLA 4PTZA 4IVQA 5HIMA 5LD2B 1U9IA 4RDHA 2XTNA 2XQJA 3KQHA 1QFMA 3WMXA 2ZIFA 3G8DA 1RLJA 4CCWA 1YE8A 4UCQA 2JLBA 2IITA 5H0IA 5I7RA 4UVEA 3KG2A 3UO8B 3WMGA 4WVFA 4BMOB 1KRXA 1FFCA 4QUGA 4DIDA 4FZ3A 4PONA 4QFMA 2REQA 2I54A 3TUIC 1VP3A 3L9XA 4RD0A 1VRVA 2FW8A 1TF2A 3OCUA 2J4DA 1I2ZA 2RGEA 4KLAA 3P4UA 1JQJC 3Q2IA 5C0OE 2J0UB 4HATA 2QW1A 3HRHA 4MR9B 4OP2A 5J5VA 1N5JA 2CLEB 3Q98A 1VA5A 3DC7A 1V7CA 2UVPA 4JENA 1MHTA 1QE5A 1Q17A 3GVIA 3RFTA 1R8XA 2OECA 1NZDA 1B2RA 4M8NE 3SNKA 4IW3B 1XZGA 1RTTA 2RHOA 1V45E 221PA 3BJIC 1KYTA 1WMBA 6NULA 4IQ4A 1IONA 3CO0S 4MPPA 4KXNA 2A5GA 2YW2A 4X7RA 4JMPA 2VAVA 4TUYA 2IC5A 1JT2A 4D9BA 1WCYA 3RJ5A 3U17A 721PA 3Q7QA 1ZSNA 2NLOA 5EJIA 2VSNA 4KSYA 3IP1A 4PLHA 3WDLA 1U1CA 1EP1B 3WGJA 4V2UA 3KQTA 3RVSA 2I99A 1YRAA 2VHEA 1XJCA 3JQGB 4H59A 1G8YA 2CXTA 4L15A 2ZUTA 4D4LA 1R6TA 1UANA 4BGDA 1M1NA 1X6VA 4DVJA 1JHQA 1V9CA 2G7ZA 2J9FB 4KACA 4KBGA 1EZ1A 1QVWA 1RP1A 1RQLA 4JBLA 4KE6A 5ERGB 3VX3A 4C2AA 4EKDA 4KVFA 2JL1A 2ZYUX 4I3FA 1YZLA 1EDBA 3DVAA 5DZSA 1I33A 2ST1A 3QLJA 1OA0A 5EJ2A 3WE7A 4CMIB 1H2AS 5AD1A 2G6BA 4QFDA 1KYVA 1XZFA 2QRHA 1SCJA 4NCNA 4ENPA 1EFHA 5DP2A 2JCVA 3N07A 1RSZA 1GJRA 1UP7A 3C8ZA 1P0IA 1PQWA 4QSHA 5DIFA 5CT4A 1JIXA 1BDBA 4E5YA 4AKSA 3ESBA 1FA9A 2YVUA 2L18A 2Q5QA 3G0IA 4EQ6B 3L8ZA 3S1AB 4XPIA 5EXDA 3TK1A 2J3LA 4RZXA 1EXDA 1KPIA 1TQHA 2QX7A 1KYZA 1MC5A 2R85A 2IOFK 2VF2A 1FQWA 1JMVA 2I0FA 2XIJA 1SRRA 3KJEA 4OHKA 1I6KA 4W5WA 5FUYA 3VR6A 4EJMA 1UBSB 1BIFA 3UZUA 4BNJA 1PG5A 3A6DA 4LY9A 4D5GA 1SIBE 3VR6D 2VH5R 1CJKC 2Y4OA 4Q4AB 3PSHA 1TTPB 4N3BA 1H22A 3HO1A 1NW7A 4FD2A 2AXPA 2XODA 1ZQ1A 3NHAA 2X0KA 4IQ8A 4Q01A 5JZOA 1CQJB 2QLBA 4O4HB 5DNAA 1QTQA 5AW1A 4XM0A 2DLCX 2BZSA 2G4VA 1TCUA 2WAMA 5M5BA 2XB8A 2GB4A 4MA5A 2JJQA 2QMQA 3MTDA 4R7TA 1Z5WA 3H5IA 2YXNA 2ODEA 1HDGO 4EW1A 5FWAA 1B0UA 1K08A 5TB5A 1JDJA 2QTCA 2Z9DA 4EQZA 4RDCA 3G1WA 5DHRA 4I9HA 1SU8A 2Q6TA 3SJBA 1XMQB 1VLMA 1X80B 4R3WA 4ZGWA 4LRTB 2XA1A 4HJXA 2GM5A 3GLKA 4KX5A 1HPLA 3UT5A 3GPLA 1C3OB 1WRBA 2QAGA 3EWNA 3NRJA 3SEAA 2R0QC 1VMDA 6REQA 1SAYA 2FCAA 3TTUA 3TJZA 2NXWA 4FWTA 1P74A 3OF5A 3N8GA 1NUHA 2AX3A 3R6GA 4QD3A 4YXWA 2I4OA 1W96A 4KH0A 3T34A 2PUAA 3HJTA 1U1DA 3C7DB 4RV5A 3AEUB 4DMUB 1Z5OA 4NENB 5JZMA 1KRWA 3ZD9A 1FU4A 5FCDA 3BZWA 3PS9A 2NAPA 2WRZA 2JBAB 4Q37A 5J63A 4YXWD 1YF3A 3O4FA 5E6UB 3Q7RA 5HRUA 2O07A 3W2GA 2J3MA 3OEHD 3AF6A 4ZREA 4CTNA 2XITA 5CITA 1UBNA 2RC5A 5A3RA 4ZZ3A 2V4MA 4ZAGA 5DB4A 5A04A 2PT6A 2R00A 3ZDRA 5DT9A 2CJWB 2P35A 2XJ9A 3Q5GA 3ZEIA 3DQQA 3LVFO 5IDQA 2YZMA 4IRUB 5CB6A 3ADDA 3QXSA 3RHZA 2G5PA 3EPRA 1GGEA 2XTZA 1CZUA 1WKCA 3K8ZA 5DDIP 5TMEA 1E2HA 3TZBA 3WSTA 1V8OA 3JWIA 4P7KA 4XPZA 3L40A 3ZWDA 3VKGA 2RI1A 3BUSA 3COYA 4MPJA 1IUOA 1Y3DE 2VDKB 1PS0A 3N58A 1E3EA 2VPTA 1G20B 1OXUA 4ZI3A 1P5JA 2A5YB 3RFFA 4OV6B 1A9YA 4M3NA 5AM2A 2HLHA 3RT9A 3PHGA 4OLJA 4OI0A 1DS6A 1Z5UA 3PKIA 2A9OA 3K0AB 4JEHA 2YW9A 1P39A 3IDSA 2A9RA 4XUCA 4HAZA 1QOPB 3R3HA 1ND5A 3R1IA 2G1UA 3O7WA 3OURA 4EHAA 5BWMA 5AJHA 4OJYA 2R60A 3PNLA 4CCSA 1IZ0A 1SVWA 2Q9UA 2R7AA 3A4IA 1EJ0A 3CEMA 5T4BA 2QQ5A 3UOGA 5CLJA 1KY2A 2QXYA 4PPGA 2COEA 1KWKA 3RUAA 1QH0A 2XYQA 2VATA 3I2FA 3ICOA 2Z2JA 1QNFA 1MB4A 2AZ4A 1WXHA 4KQ9A 4X1OA 2OV2A 2Y1XA 4K28A 3FCAA 1RABA 2C92A 2CL7X 3DE7X 2BTQA 3B6ZA 5B37A 5IBPA 3WYEA 4YO8A 4DC9A 1MD9A 3QX3A 1I1HA 3NXKA 2HK9A 1C1XB 1WMDA 2DU8A 2IIVA 2JGJA 3MJDA 4B85A 3OY7A 3BBPA 5E1DA 3LC1O 4FOPA 1QFSA 2ZAYA 1PUIA 2EJWA 2WFLA 3Q7PA 3RI3A 1QYXA 3TN7A 1LPNA 4QBIA 3PXAA 4WGFA 2XUFA 3M81A 3D1VA 1P7VA 4RVCA 4AJKA 4DR2B 2FJUA 1T8TA 1VBNA 4QDOA 1ESMA 3FDFA 4HEQA 5DBGA 2X4GA 3S40A 3SZOA 3EGXA 3M2TA 3FOBA 3MCWA 2GZSA 2QGZA 3WWEA 4BVBA 2XHZA 4L8FA 1FLAA 3IAUA 3RDPA 1O8BA 2O8CB 5A7FA 2F1IA 1G2PA 2GZ1A 3OETA 3FFAA 1X7XB 2FEPA 2I76A 3I05A 3KPVA 3PDCA 1CVRA 3R0VA 4IVNA 1OR8A 4JZKA 4QDTA 3ZU5A 5KX5A 2JLQA 2VT7A 4MSUA 4JHLA 4B80A 3BZBA 4AZ3A 5FH9A 5JMOA 3AVYA 1Z4MA 1ZVMA 5EUCA 1RM0A 3WWPA 1Z2EA 2CMFA 1WSAA 1EX7A 2X41A 3FGNA 3OO0A 3M6XA 5TF4A 2IZ6A 1MV8A 5EERA 3ES9A 4YMHA 3EISA 3EF3A 4QYIA 2YMQA 3TDNA 2W11A 1GA1A 2I9KA 3TNFA 1ARZA 1AXEA 4E88A 2L2QA 3A1EA 3KFXA 4L8VA 4R81A 4DHEA 1H9BA 1CZLA 1Y34E 5LVAA 5FIUA 1AZWA 2J5QA 4JK3A 3KLOA 4GGOA 5GADl 3EPJA 3E61A 2Z43A 1ZA1A 3DVSX 5FA5A 2D1YA 3U7RA 5B3JC 2QRPA 1XMIA 4N5MA 5BOSA 4ZVKA 4I08A 5AUNB 5JYCA 2BGUA 4KAXA 3QUQA 4N6OA 5C52B 1PX2A 4P3PA 3KDSE 4N4AA 4UZSA 1E5TA 2B3TA 3HMKA 4GGMX 4KXQA 1E1MA 1N5KA 3DBLB 3IKLA 4DC1A 3KT0A 4HDAA 2NO7A 4CXMA 3H5VA 4Z5XA 4F0JA 1B0ZA 3GEGA 3BGWA 1XZDA 4UULA 1JMYA 5FBQB 1YB7A 2X7HA 3EOZA 3LX6A 1KAMA 2JIDA 2VI5A 4HD8A 2BISA 5LSAA 4DDMA 1ZOSA 2JANA 1SC1A 3IRVA 4CV0A 3I04A 2IKSA 1I51A 4XEHA 5SY4A 1H0RA 1WUJS 5B57C 4D9MA 1PN3A 2IODA 1SKYE 3PNBA 3QF7A 3LW8A 4MVJH 4E15A 2D3TA 4PC2A 4W9NA 3X1XA 2ICAA 4DCNA 5JCZA 4LG1A 1OF1A 3BCRA 2PL1A 4CL8A 1DBIA 3A28A 4EB0A 1H3NA 4EYOA 2C0CA 3I5YA 3ETHA 1DTSA 4GE3A 2PIDA 2E5LB 1EAYA 1T1RA 5CA1A 2RFLA 1GDDA 4YMWA 2J3EA 4V03A 3S8EA 1G98A 4FLMA 1E3MA 3JYOA 4QJBA 3WDSA 4K0RA 1XGKA 3BGDA 4RZSA 4W5JA 5F1PA 3A31A 3WLTA 3C5VA 4GLBA 1BXGA 3KAKA 3A1TA 4NNOA 1O96B 1WB4A 1UR5A 1UOQA 4KYTA 2FXVA 2O20A 2ZP1A 3ZLTA 4BV8A 3SHTA 3TQQA 2C07A 3BXOA 3PRHA 2ONCA 4MMZB 2EXXA 4ZJZA 5HGJA 3EAGA 1SUBA 4AY6A 2EBHX 3PQ7A 4ND3A 1ZIXA 3N39C 1XROA 3FAZA 4NBUA 3WLHA 1QYRA 2FI1A 1FZQA 1KZ7B 3QPCA 2PR7A 4ZI7F 4F4DA 1QP8A 3PPXA 4Q4CA 1UBTS 3O31A 2EJCA 1JNYA 1MIOA 2Y1LA 3QEJA 2J0VA 3KC2A 1JR2A 2F9MA 2Q07A 2ZRPA 4AICA 3U4IA 1E6EA 1AZTA 2C5BA 4C0AC 1IXZA 3GV0A 1BVHA 2I6XA 4BP9A 2YV3A 5EC8A 2YVQA 3D5TA 4MP3A 3VU0A 2Y66A 3HVUA 1PE0A 1YL7A 4U0JA 4OQ4A 3K6RA 2C0QA 3PHBE 3VHXB 3V7WA 3FX2A 1MZPA 4WL0A 3HU1A 3IUJA 3GFRA 1P3JA 5JXIA 2EKDA 1SCUA 2VJDA 2J59A 2XZLA 1QK4A 3FI0A 3KHUA 4Z7OB 1GZUA 1N4AA 2ZWMA 2JAXA 4WY5A 3ER9A 5IK2A 1HYEA 3RVQA 4YBRA 1KZ9A 2WWFA 4I1PA 2OXEA 4WLVA 3UBMA 2ZZNA 2WG0A 3BHNA 3HR4A 2VPZA 4TXMA 4Z7NB 1CUSA 3UEOA 5IK2D 1L1QA 3FPCA 4PQEA 1E2QA 3V4RA 1EPUA 1HFWA 1KY5A 3AFIA 5H70A 5SY9A 3CG4A 3EGDB 4M7WA 1OXKB 4GM4A 4RLQA 2HCBA 3BFPA 3ICVA 5EMHA 4X8MA 2JGAA 5FOUA 1AHIA 3MYYA 3OG9A 4CIWA 1EGQA 1JRLA 3KTAA 3NUQA 3UG7A 3FTEA 1NNEA 3WYCA 3D8NA 2K7FA 1U5BA 3TUZC 1U7DA 1PLLA 1VYUA 3A6EA 1KVUA 2JFOA 3LXMA 4FOOA 4IJ5A 4OHUA 1B3RA 5NULA 2QSUA 1M0TA 4FW8A 3W6OA 2PQ6A 3DDCA 4FTWA 5K8TA 2I3AA 2OZLB 3GHHA 4ZYXA 5IUNC 2VF8A 3AP3A 3TOSA 3RFCA 4QTZA 5B6JA 2VDMB 4F3TA 4UAGA 4P22A 2JLAA 4MQ5A 1USKA 1M2GA 2OEPA 2BFOA 2SBTA 2Y1FA 3JALA 3MOSA 2PR2A 4G0UA 1MJGA 1FXUA 3W7BA 1QE0A 4C0HA 1PDOA 1EXWA 2B5VA 2F43A 2XE7A 5AJWA 1YAHA 2D2XA 1NW5A 2IE0A 3BWBA 3DXZA 4TMZA 2YXBA 1L4YA 4FU0A 3TZHA 2NPOA 2XCLA 1J20A 3D6VA 4CNQA 4HQFA 4E0BA 3OT4A 4EG8A 2C2YA 4EJSA 3U4GA 3FOZA 5J1TB 3RVRA 1S9DA 5K3FB 3LX8A 5CD1A 2J41A 2PNJA 2HK7A 4GI2A 4I5IA 4JT2A 1E4EA 2OXRA 9LDTA 3ESDA 3FZEA 3WQBA 3TZEA 3RVKA 1AOXA 1DTWA 1RAFA 2WJHA 4EL0A 4II3A 1C80A 5CX1B 1I36A 4NR0A 3NI2A 4WESA 3W8DA 4OYRA 4D8UA 1TD1A 5LZ4A 1N2OA 3N53A 4MKHA 4YGYA 4QX6A 3FROA 1V39A 2XUQA 1ZESA 3B6EA 1P1JA 5B1DA 1Z6TA 2YRWA 1OX4A 5D8DA 2X86A 1N2XA 1PT6A 3LKDA 2UYGA 1P2TA 2O1EA 2WM3A 2WD8A 3R7WA 3RTEA 1DAKA 1YMVA 3OM8A 3PWKA 2DKOA 4N39A 4FX5A 5AT1A 4AWAA 4EKEA 4GFDA 4PWZA 1LRLA 3OQNA 4ZTUB 5AJYA 4CM9A 4B6QA 3W5SA 3MN1A 2OGTA 3E9ZA 1XCBA 4H7FA 2X0EA 1KI3A 3AIOA 2G1KA 4HZUB 2LPMA 4PFQA 2NT4A 4U8GA 4CM9D 4GPAA 3PIIA 2PRZA 5BSRA 2OBLA 2D6FA 3FE2A 2VYVD 4EGQA 4EX6A 5ENDA 3GZNB 4QIHA 3LVBA 4X6UA 4ANFA 3NWPA 5CJPA 5KS2A 4MKGA 2OR3A 4MW7A 4P7JA 3RYIA 2CVPA 5CD9A 4N41A 1R8QA 4PANA 2IIBA 3AKYA 3VPCA 3I1YA 2ZREA 1HFEL 1SU7A 1GUYA 3VJRA 1WB9A 5ALFA 1BJRE 1V1MB 2A5JA 1PWYE 3FWPA 4R5HA 2AEEA 1AA9A 4HLUA 1AT1A 1LWOA 4YDRA 4BFCA 2VP9A 2RK6A 3TR5A 4F2WA 1U9ZA 5HBGA 2AB0A 4EB3A 5E6RB 1Q2UA 1FRQA 1REQB 2W6MA 3EXFA 1H85A 1XC7A 4WXPA 1IK6A 2FFBA 5T7BA 3N76A 4LYYA 5KDLA 3NNSA 3T3MB 5FLXA 5IHXA 4O3MA 3AG5A 3SY8A 1ODSA 3IX7A 1Y1PA 2KYRA 4MRMB 5D7NA 3UK2A 1TFUA 3LIIA 4D3FA 1NLYA 1JL3A 4X1YB 2EJVA 4C78A 4DDVA 3OJ0A 2OFXA 4R51A 5IKXA 3ML1A 4TL9A 1JJ7A 2Z1NA 1X2BA 1T34A 3FJYA 4MV1A 1JEEA 1WZCA 1GUBA 4C29A 3USZA 4W7SA 2E4XA 2A0YA 1KP3A 2K6GA 2QTTA 1VBKA 4A0FA 1Y1RA 1FY2A 3FYTA 1O89A 1XJWA 3HCOA 5TVKA 4ZP1A 2YYAA 1AE1A 1IHYA 2GZAA 4X8OA 1XZKA 1L7OA 3EIOA 1TYBE 5FOWA 1E77A 4HEJA 4KX3A 1JG4A 4WVLA 1XU9A 4AJPA 5CEEA 4R8KA 2D0OB 1QYVA 3UT6A 1K9SA 3W8FA 4ZYTA 2ZRCA 3ESXA 2VS1A 1RMQA 1Z4IA 1H0HA 1TI7A 3QBVA 3VKUA 4YAUA 3AL2A 4REQB 3ZU6A 2EJTA 3EHDA 4NJEB 1KJ8A 2WJZB 3KR1A 2GBLC 4P0PB 3WYAA 1P1HA 4RMHA 1Z36A 4D25A 5TLSA 4G5FA 1M83A 3EXHA 2JAWA 3PRJA 2P90A 1J07A 2CJFA 5CX4A 4B09A 5JC1A 3ZR4B 5AVOA 4LWQA 1CUFA 1QG6A 2BUAA 1SKUA 2QUAA 1CBUA 2R1TB 3IXLA 4O4HA 3LDHA 3TVTA 4HLDA 2PKQO 5DHQA 3TLXA 2OOKA 4I14A 1RHJA 3SHWA 5BSFA 2PWAA 3L18A 1Q0UA 3GJTA 3PJGA 2L69A 3DM5A 2J85A 4C3VA 3MTGA 3K5HA 1RWMA 3OLWA 1WCV1 4MDEA 1DG1G 2IZ0A 4BVLA 2R7LA 2OQ2A 1PR1A 2OO5C 4YRFA 2B6NA 4EX7A 1UIMA 1X80A 1EA5A 2GZ2A 5AP9A 1E8NA 3RSQA 4MJ3A 3SZ3A 1DWPA 3INYA 2RBEA 4E22A 2AN4A 2HAEA 1R0CA 1QF6A 1GLGA 4EZEA 4OQXA 3MRXA 3ZW9A 1TJ4A 4I4TA 3O1LA 1PWXA 2Q1WA 5FB3A 5KTTA 1F0KA 5TQ0B 1ZMBA 3O26A 5LFAA 4TROA 2IW3A 3LT5A 4MW1A 5GJWC 4DXHA 1Z6YA 4BLWA 5CTJA 1YBFA 3QLUC 5GJBA 4NENA 3JARB 4OGWA 1PR0A 2GZ3A 2EDAA 2HDHA 2CYAA 5ER9A 4P86A 5H4HA 4WX2B 3ICQB 3KQSA 1JE1A 2H51A 1TOAA 4TZKA 2RHGB 2ZIAA 3TIXB 4A0GA 2I3BA 3F0TA 1VLQA 3E1GA 4NP6A 3HL4A 3SWWA 3JZMA 3AR2A 3JWJA 5C5DA 2WTNA 1YA8A 3B1ZA 2PJDA 4GZ5A 4QUDA 2VBIA 3C4QA 4OUKX 2AG1A 4UUNA 3SIPA 4DZZA 4ND5A 3PI6A 4KQWA 5EWJB 1I2MA 5ALDA 4PXAA 3OIUA 3TDMA 2PTHA 1MAWA 4TL6A 1DBPA 3GARA 3DMTA 1PFWA 2RH9B 2PKXA 3GK3A 4QJ5A 4R31A 2Q4BA 4RJ2A 4Z0TA 5JFOA 3PTLA 2C2OA 2JLWA 1YS7A 2SICE 2EW2A 2QK4A 1Y1QA 1FXWA 2X1VA 2QROA 1KE2A 1NI5A 4JJAA 1D7OA 4BLQA 3JD3A 4DG5A 2VQFB 3UW3A 2V0CA 1O77A 2Z5FA 4UCFA 3BMQB 4MQBA 1QIDA 2BCEA 3IHWA 2EX4A 3BDIA 3NJ8A 3IXQA 3NEJA 2NG1A 5FWYA 4DB2A 1NBIA 1MFZA 3IOYA 4JC4A 4XQ0A 1P1FA 1XJQA 2BCJQ 1G4HA 3CLTD 4INJA 1K5HA 2RJNA 3IE2A 3KBBA 3F78A 3LUHA 4QBTA 3X1WA 3RODA 1NBMA 4JEMA 3WWCA 3FHOA 3ZIAD 2X5OA 3VKWA 2CLCX 5CK4A 5HJ2A 2LKCA 3ZS9A 3K70C 1J1ZA 1E6LA 3AHJA 1NBMD 3GWGA 3ZWAA 4GVLA 4D79A 1KFCB 2HMUA 1C7JA 5DV9A 3UJ9A 2J3JA 1V5FA 2PGIA 3RTCA 1A9SA 1IY1A 3UJ7A 4X7MA 3UPTA 2A1IA 2ZJBA 3RU3A 3HJFA 3ZLUA 1PLJA 2H11A 4BKQA 3C98A 4CKYA 2DOKA 3QGMA 3S2ZA 2AFHA 1E3JA 3V32A 1ORVA 1XTRA 2VK2A 5G41A 2RH8A 1VL0A 4ZYUA 4CL2A 1ATZA 1YR9A 2FB9A 3H16A 2Z4SA 5ALLA 4UUQA 1T0HB 1HLDA 1VKJA 2P6MA 1XQ9A 4DWOA 3GLHB 5ALMA 3GFQA 4G5HA 2ZU6A 5EXTA 4KGZA 3RJ9A 1W1UA 2C0PA 3IUQA 1JWAB 5ER6A 5JE8A 4RYLA 1DKNA 3ANXA 1NVVQ 3LUJA 3NCHA 2FG5A 2BGIA 2QMHA 2RG1A 3I04M 1UOEA 5FFFA 4E2FA 3MB8A 5MN4A 4AJ4A 4KE8A 3BB1A 4MI1A 3REGA 2QY6A 4C0XA 5KVVA 5AKJA 3HZRA 4IJWA 3KL4A 1UPUA 3S0JA 5CA0B 4CDMA 3D8UA 4CMHA 4M1OA 2ECKA 1MX3A 4ZRDA 3E7WA 3IMEA 1CNFA 1CR6A 2PWPA 2Z3WA 1JG6A 2ZDHA 4OSOA 4C76A 3A4MA 4AS1A 3FDXA 3OU7A 3FI9A 4OXQA 2C7VA 2HO5A 1SZDA 1FSSA 2EEPA 1OJLA 1N8SA 1U28C 2J3HA 3B1VA 2VZ9A 3A70A 3TFWA 3ACDA 1E99A 2QR3A 4V0SA 5TQVA 6CHYA 1X1RA 3IQWA 5FOVA 3BKXA 4L8WB 4MXDA 2UAGA 4B3GA 3MS7A 2OXTA 3QV1A 2ORVA 1TZBA 3TSWA 1PWEA 1NUUA 4P5PA 2GAFA 3U3XA 4E5DA 4YCLA 1J0XO 3CCBA 1L7QA 3GEPA 1XRPA 4DMKA 2W00A 1MB2A 2ZETA 1DQRA 4OU4A 1FVXA 2QM0A 1AN0A 1X8KA 3OE7A 1P17A 1DKRA 4O02B 1JJAA 1BDHA 2PT7A 4RXUA 1I9GA 1R5NA 4NMHA 4P58A 5FFMA 3VTZA 3B1FA 4JOQA 3RREA 4YLYA 2FF7A 2NZ8A 4Q3OA 1JPJA 2ZRAA 1TMYA 1E4VA 4HMOA 1EX6A 1C3XA 4IG4A 1U90A 5DCUA 5BN5A 2VSXA 3COSA 4REOA 4YDSA 3OPYA 5E0OA 1AQNA 2V98A 1STOA 4JT4A 3VUEA 3QMMA 2C97A 1VG1A 1L4EA 2HJSA 4IBOA 3OM9A 3SHVA 3TNJA 3VR5H 4D43A 5K05A 1U0SY 4H6VA 2QRQA 4K9KA 2MU1A 4NYJQ 2GCEA 3B9PA 1RM4A 3RFXA 1SIUA 2H06A 4K1LA 3JATB 2ZB4A 1O58A 2PS0A 2TS1A 1D8TA 1SQ0A 1ZXBA 5KOHA 1IK4A 4QPJC 4A36A 1YTUA 1T2DA 3AHCA 4RGVA 4WN3A 4CGZA 2BDEA 4ZVVA 4MV7A 4C2TA 2O2SA 2NYUA 1SUEA 2QLMA 3O4RA 5AESA 5J23A 4C01A 4HDMB 3L1HA 2CDCA 2JG3A 2WPDD 4BQRA 1E9FA 3JQ9C 3DDHA 2XR1A 2Z3ZA 1E9RA 1GUAA 4ARBA 1B14A 1D6JA 1ZNXA 1EFDN 1O96A 2GYUA 3GRVA 5JS6A 2PUEA 5LBUA 3N2GA 1DC5A 2F1HA 5KSYA 2FPGA 2H7CA 3L02A 4BMCA 1Y8ZA 1B15A 2Y3IA 3DAGA 2P11A 3Q87B 3BFVA 3NW9A 4J7CA 1PJSA 1A5BB 1FS6A 3DP7A 3K9QO 4L0DA 2WZQA 1Y89A 2X2EA 2BEUB 1YR7A 4A6DA 1N0VC 1K7FB 1W29A 2B7CA 2R87A 3OZFA 1N92A 4LQ4A 4BX8A 4S05A 3ZW7A 2PJRA 4H17A 1X7ZB 2ZUBA 3GGDA 3D2AA 1QLJA 1MRNA 3OICA 4U9HS 2QHXA 4KCGA 1JIIA 4HS9A 1X13A 2GNOA 2V7XA