2CF5A

Crystal structures of the arabidopsis cinnamyl alcohol dehydrogenases, atcad5
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
352
structure length
352
Chain Sequence
b'AERKTTGWAARDPSGILSPYTYTLRETGPEDVNIRIICCGICHTDLHQTKNDLGMSNYPMVPGHEVVGEVVEVGSDVSKFTVGDIVGVGCLVGCCGGCSPCERDLEQYCPKKIWSYNDVYINGQPTQGGFAKATVVHQKFVVKIPEGMAVEQAAPLLCAGVTVYSPLSHFGLKQPGLRGGILGLGGVGHMGVKIAKAMGHHVTVISSSNKKREEALQDLGADDYVIGSDQAKMSELADSLDYVIDTVPVHHALEPYLSLLKLDGKLILMGVINNPLQFLTPLLMLGRKVITGSFIGSMKETEEMLEFCKEKGLSSIIEVVKMDYVNTAFERLEKNDVRYRFVVDVEGSNLDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CINNAMYL ALCOHOL DEHYDROGENASE
molecule tags Oxidoreductase
source organism Arabidopsis thaliana
publication title Crystal Structures and Catalytic Mechanisms of the Arabidopsis Cinnamyl Alcohol Dehydrogenases Atcad5 and Atcad4
pubmed doi rcsb
total genus 90
structure length 352
sequence length 352
ec nomenclature ec 1.1.1.195: Cinnamyl-alcohol dehydrogenase.
pdb deposition date 2006-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2cf5A02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2cf5A01
5B12A 2O48X 4R3NA 3C3XA 3PEFA 2OO5A 1DO8A 3PJGA 2P2SA 4W4TA 1LQTA 4AJ1A 2YQ4A 2A35A 2C82A 4RORA 3JQDA 1R4MA 1N5DA 3SJUA 1TA4A 3GA0A 1MG0A 4DBVO 2DC1A 1IULA 1J4AA 3WJ7A 4BV9A 4KUEA 3WWZA 1Y5RA 1WMAA 4BGVA 4CV2A 2POQX 3DEYX 1Y8QB 1OI7A 3G0OA 3PPIA 1N1EA 2B4TO 2ZB7A 4ZICA 4XIYA 4HP8A 1PQUA 3QWIA 3RUDA 5A06A 1YDEA 3ZH2A 2FMUA 2YDYA 3DTTA 4OSPA 3WGTA 1PJLA 3GPDG 2FPGA 1XLTA 2GN9A 2Q99A 1JWAB 3DBLB 4FC7A 4FFPA 4J0FA 4PLTA 1V8BA 3FNHA 1W73A 2Z1NA 5COBA 5MDHA 2UAGA 1PZGA 4FQ8A 1LC0A 2IE0A 3CKYA 4FGWA 2BI7A 3JD3A 1K0UA 3RC1A 4AFNA 2J6IA 4D3FA 5TJ9A 2Y1GA 2C2XA 4I9UA 3K31A 4BGEA 1ISMA 3GFGA 4H3VA 4AJEA 4X54A 4A27A 5CDYA 3D7LA 3W8EA 1WMBA 4G2NA 1UXJA 3L6DA 3KEQA 1NBOA 4RGBA 4RPLA 3Q6IA 3VC7A 4RF5A 4TVOA 1U2GA 2DBQA 4CJXA 2J3HA 2IYPA 3JV7A 4L4SA 2WEKA 5L4SA 1EK5A 4XZ3A 5AXDA 3HE3A 1TB4A 1ZZEA 2IODA 1XGKA 2HRZA 4FS3A 2RH4A 1R37A 2JAHA 5HTOA 3TPCA 4I1IA 4NBTA 4IIVA 2IXBA 4OO3A 4ZQHA 2VRCA 3P2YA 3UCEA 1DIBA 4H7PA 4CUJA 1R0LA 4MKRA 1E3WB 1M75A 2XF8A 3IS3A 2NVWA 1GAEO 5K6AC 4W82A 1QYDA 3O9ZA 1X0VA 2LDXA 1HE2A 1U4OA 1VL8A 3GHYA 5JPIA 4CM9D 5DBIA 4NBUA 1JWBB 4BO9A 2V65A 3PWZA 1PGJA 1H6DA 1LDGA 3E1KA 4YXFA 1BMDA 2CVOA 2D4AA 2YV3A 3IKVA 4PG5A 5JYEA 3KYCA 3PLNA 4XB2A 4P8RA 3TZHA 2ZB4A 5AVOA 1KBZA 1MB4A 3KUXA 2A94A 5F1PA 5I7EA 1B7GO 4ONEA 3WGGA 1WW8A 3I52A 3PK0A 5KWEA 1Z7EA 3WGHA 2HDHA 4BB6A 1EUDA 4OQYA 4RJTA 2PZLA 2Q1WA 3HB5X 2B5VA 3O03A 4YCAA 4Z9YA 3GDOA 5T8KC 3ZWXA 5JBIA 2J3KA 2YV1A 1VJ1A 1UZMA 4FC6A 3EC7A 3ZWYA 4DQUA 3TDKA 2VWHA 2O4CA 2GN8A 1I2BA 2Y68A 1I2CA 1ISFA 1ID1A 3EDMA 1V9LA 4J43A 2I99A 3GEGA 2V6BA 2PGJA 1LRJA 1A71A 4GSLA 1QXSA 3DHYA 4BNYA 4O59O 1JA9A 5EIOA 3MJ4A 5C7IO 2VOJA 3GEMA 4GMGA 3VOSA 3LT4A 1DRVA 3P19A 4YA6A 3FHLA 4KOAA 4IDFA 3L9WA 1C3VA 1QYWA 3WLFA 2CDCA 3KRTA 4CMHA 1NVGA 3HG7A 1VJTA 3KZVA 3L4BA 4E5MA 1MFPA 2PD6A 4CMBA 1YO6A 5TF4A 3S55A 3H4VA 4JROA 1QORA 4QXMA 3ZWWA 2ILTA 3LYLA 1PS9A 3W6ZA 4QT0A 5TIIA 1I24A 1GY8A 1SPXA 3C8MA 4OSOA 1A4UA 1B14A 4TZKA 4GWGA 4IIUA 3UW3A 1R12A 4JJFA 4YAKA 2EKLA 3FWZA 3NGXA 4YJHB 1U5CA 1DC5A 1ZEMA 4J3FA 4BKQA 3AI1A 3SLKA 4PG7A 3GRPA 2YHIA 1VKNA 4Q9NA 2OP1A 1Z6ZA 3A1NA 3QQPA 3VPGA 5JDCA 4DYVA 3HFGA 1D4FA 5ITWA 1U1IA 3PQDA 5DULA 2JL1A 3AW9A 3OJFA 3PIIA 3O8QA 1I0ZA 4R68A 4GGPA 4GLLA 3FF4A 3COSA 1XR3A 1C1XA 5GZ1A 1C0LA 1L7DA 2Y05A 5FI5A 3OHSX 2YZ7A 2JFFA 1CWUA 5JXWA 4YJDA 1ZH8A 4RPKA 2I6TA 3ZU5A 4A7PA 3L6EA 1O8CA 4BNLA 4O5OA 2PNFA 3FNFA 3DL2A 3H2ZA 3ZWOA 4XYGA 3GN1A 3BHMA 1F12A 3D3EA 4YACA 1FMCA 4WLUA 3LC7O 3DHEA 4GLOA 4DMMA 3RBVA 4XYLA 1G0NA 3I9NA 3RFVA 5IZCC 1N92A 2I67A 4BO8A 4PLGA 4YT8A 2EIHA 2O3QA 4WKGA 3GNTA 1E3SA 4TVBA 2X58A 1Y8RB 1M2WA 5A04A 1ZNQO 2PWZA 3R3JA 2EF1A 4NZ9A 3DFUA 4DYDA 1MP0A 5T67A 4FOSA 4ESOA 1I01A 2VN8A 3WTCA 4CM5A 5IZ4A 4JX8A 3GNSA 4U7WA 4CM7A 3KV3O 3DZKA 3C7CB 2PKRA 4B4UA 5A9SA 2AQ8A 2Q1SA 4BOYA 3RUHA 2JD2A 2Q2WA 4C4OA 2V7PA 3K6JA 4YB8A 1NFQA 4E31A 1NHGA 2CMDA 2X6TA 1SB8A 4K28A 4FFMA 4NHEA 1HSZA 5CDGA 4J4TA 1K3TA 3PYMA 3EY4A 2PTGA 4R9RA 4PG6A 4ZHSA 4UVEA 1KVQA 1ZK3A 4CL3A 3H9EO 3PGXA 5DF1A 2GN4A 4E0BA 3GGPA 2X86A 1WAMA 4TWRA 4XB1A 3N7UA 3IOYA 2GCGA 2O3RA 3DBLA 4PIVA 3ZGYA 4I5DA 1VE9A 4OGWA 4B3JA 1ZUD1 2ZYGA 4UEOA 1BSVA 3STHA 3ADOA 4HXYA 5K0ZA 4WEQA 4W7HA 4HFNA 5I7VA 1P31A 5H82A 1QV7A 4CMEA 2FPPA 3UKOA 3C1OA 1BDMA 1YJ8A 2QG4A 1B3BA 3IQDB 3LZ6A 3UOGA 1GZ4A 1Q0HA 2VQ3A 4D45A 4EEXA 1M67A 4BMSA 4D43A 3GDFA 3KETA 3EUWA 1SZJG 3WYBA 2X0JA 2AMFA 2CD9A 3JQFC 4IS3A 1FDTA 3ETEA 2IDZA 1RJWA 2HMVA 2QYTA 5A05A 3DXFA 2J5KA 1NFRA 3AWDA 3JQ6A 1XG5A 3GHHA 3WXBA 1SO8A 4E2WA 2JKVA 3DOCA 2JFGA 2PLAA 4L4RA 3LT0A 5TJHA 3ICPA 3VH2A 3I9JA 1XA0A 4WCFB 2BF7A 2CDAA 1A5ZA 1QYCA 1UZNA 1VM6A 3I9MA 1P0CA 4EDFA 4XR4A 1EBUA 3CXRA 3PDJA 4LCEA 3L4SO 2RIRA 3CTMA 3LT2A 3AUUA 1O89A 4U6SA 3K30A 1K5HA 3E03A 1Y7TA 1T2CA 4OOFA 1ISGA 1WDLA 4RF2A 2NQ8A 4NU5A 4TRJA 1U9JA 3PHJA 3EHEA 5KJFA 2VNSA 3ZWPA 2UDPA 5DCUA 3B70A 1WZEA 2QIOA 1MC4A 2X23A 1HDYA 1D8AA 1Y9EA 3WG9A 3MWDB 1E1NA 3PWSA 1NM5A 2VUUA 4DTIA 5G0VA 3G49A 5DOZA 3QWFA 3VH4A 5TRTA 3W8DA 1DOHA 1E0DA 1Z73A 2IYOA 1GZ3A 5EESA 1WWKA 2YW9A 3GK3A 5A9TA 1YKFA 4IDCA 3DBVO 3DZBA 3JQ9A 4F46A 2X0IA 4M54A 2EGHA 3F5SA 3HDJA 5F5LA 1AXEA 2WMDA 2JHGA 1NFFA 1B2LA 2RHCA 3FI9A 1DLJA 1U3TA 1BXZA 2WWRA 1P9LA 2ET6A 1L1FA 2OP0A 1Y6JA 2PZKA 3VZPA 4BNWA 5CAEA 4WLOA 3AY7A 1EUCA 3G17A 2I66A 3JD0A 1MXHA 3CH6A 1HDCA 2VZ0A 1EDZA 1V35A 3FTPA 2EKQA 3H9GA 3QE3A 5FI3A 1DSSG 4A5OA 1R16A 3JQ8A 4Z3KA 4Y6PA 2NNLD 4BNKA 2CUKA 4J91A 3DBRB 3DZHA 1X7DA 4DRYA 3FRJA 2DM6A 1S6YA 4R4JA 5JFOA 3F1LA 3UAGA 4B79A 1YB5A 4J0EA 5CFZA 1F14A 3ST7A 2Q2VA 1GUZA 3OEYA 1G0OA 3INTA 1TT7A 3TZ6A 1FK8A 4CLOB 4UREA 1BVUA 5IJZA 4PVCA 5CPBA 2DLDA 4QFCA 1E92A 5TX7A 2Y1EA 4MVJI 2RBEA 5T6BA 3SC4A 4BV8A 1B8UA 1PR9A 4J1SA 5B37A 1CERA 3HN2A 3DR3A 1PZHA 4IDGA 3WNQA 2X9VA 3AUSA 3U9LA 4FOOA 2O23A 4YJHA 4CPDA 1ULUA 3EW7A 1EDOA 2ZCVA 4R54A 1ENOA 2D0IA 2VT3A 4J6FA 4RL6A 1GYQA 4EUFA 1O9BA 2SCUA 1LSUA 4NBVA 5G0WA 4DA9A 1C0IA 4QUKA 2EP7A 1LI4A 4NNJA 1QLJA 3UCXA 4WCDA 3RBXA 3HDYA 4E13A 1MUUA 3SXPA 4Q3NA 5EN4A 1HDRA 2VYVA 3O8QB 4NQZA 3UF0A 1XU7A 1ZSVA 2I3AA 1DJQA 2X1HA 3FR8A 2CZCA 3QVOA 1EFLA 3JSAA 1HZJA 1P1JA 3KYCB 3JYNA 4URFA 3EMKA 3PVZA 3KLPX 1Q7GA 1ZKMA 4BO5A 4JIGA 4L75A 2X8LA 1UAGA 1JKFA 3IP3A 3DZJA 5TNXA 3QLJA 3VH3A 2Q1TA 2HMTA 4CMGA 1OC4A 5H83A 3DFZA 3OIGA 4Z9FA 3GZ4A 1E3IA 4EITA 4WECA 4YRDA 5LCXA 1JLLA 2JCVA 1DAPA 5JDIA 2EW2A 4P4LA 3FPCA 1U8FO 4GVLA 1NVMB 1C0KA 1ZVMA 2VNAA 1AUPA 3TOXA 3ZV5A 4NH4A 3GGGA 2NVUA 2NWQA 1UAYA 1U5AA 4MOWA 1LQUA 5A1TA 3R1IA 3K9QO 3PJFA 4Z9XA 5I8ZA 5EINA 1HF3A 1U4SA 5THKA 4RDHA 1GU7A 1PJBA 1JDJA 1X14A 2WYWA 4HUJA 4K26A 5DZSA 5DT9A 4CMAA 5JO0A 4FD3A 3GUCA 4J9UE 5C37A 1ZW1A 2VHVA 1Z7BA 2D5CA 3ZU4A 3AM4A 5DP2A 2X9NA 1JKJA 1KS9A 3V2HA 3VTZA 2OOSA 4CQLA 4OKIA 3LT1A 5JCXA 3TL3A 3E5MA 1LTHR 4XIJA 1XSEA 3ZW9A 2PD4A 2Z1MA 1GCOA 4WPGA 4FGSA 1KOLA 3ZWMA 4BB5A 3T4EA 3I1JA 4MVJH 4AJHA 4BO4A 1B15A 1KY5A 1Z82A 1GPDG 2NU6A 2PA3A 4LISA 4MKXA 5HM8A 2DPGA 4Q3DA 4Y8VA 4JP2A 4R5MA 4BS9A 2G5CA 5KJCA 1YBMA 3FCOA 2CSUA 4WOKA 1NYTA 2J5QA 2D2IA 1HDXA 1ENYA 3H5NA 4Z0PA 4IJWA 1A7KA 1E1MA 2YQ5A 3WX0A 4I8XA 1R4NB 1MFZA 2J8ZA 4WGGA 3B20A 3EVNA 2Q1UA 1QMGA 2OMEA 2NU9A 3MTJA 1IY8A 3M1AA 5JSFA 4OM8A 4J1TA 1T25A 2YV2A 3GFBA 2VTEA 2X5JO 3H3FA 3KYBA 3O26A 4IUYA 4Z0HO 3V1YA 2D59A 2DBRA 3W4JA 2R6JA 1OZAA 5IN5A 4TSKA 1N9GB 4W99A 1EUZA 1LC3A 3FNEA 3H5AA 2WSBA 5I9LA 4PLHA 1P1IA 3PRJA 4XQEA 4B7UA 1UP4A 3VH1A 1I5RA 1PQPA 2FSVA 4XJSA 1KYQA 4PFJA 1XKQA 3DMTA 3GRKA 3NUGA 4XGKA 2VUSA 3MJCA 4LW8A 1N8KA 1U3VA 5FFFA 2C7GA 5AXAA 4NMHA 4MP6A 1H2BA 1PQWA 3QSGA 1FDWA 6LDHA 4MIEA 4QSMA 5BNIA 2EJWA 2P5UA 1L7EA 4XYEA 1O6ZA 5EQDA 4CLXA 2EERA 1ADCA 4DUPA 4HBGA 2GDZA 5HWSA 3BTVA 1MC5A 3W6UA 2JD0A 4BKUA 2O7SA 2WE8A 4MVJF 4RF3A 4ZU3A 2W2KA 3NTQA 3HSKA 4PG4A 3DTYA 2BELA 3KHUA 4ZQEA 3KEOA 1R66A 1EVIA 1O95A 4E33A 1KIFA 2HJSA 4ND1A 4W9NA 3LVFO 1YL7A 3RROA 4UUPA 1CRWG 3OMLA 2Y1FA 2IZ1A 1IZ0A 4UAGA 1N7HA 1PZEA 2OFPA 2WD7B 4RVSA 1BTOA 3UFXA 4KDFA 3PXXA 1NQOA 3DBHA 2JJYA 1SEVA 4DIFA 2YUTA 1I36A 1M66A 3BIOA 4NPCA 4BKOA 3TOZA 4D42A 4EBFA 2NQTA 3VZRA 3BMCA 5IN4A 1UXIA 2AXQA 3WLEA 1J5PA 3OEWA 3IL2A 5IDYA 1EQ2A 3ZU2A 2H5LA 3RFXA 1E3EA 2FZWA 4CQLB 1U7HA 1LBEA 1QP8A 3KVOA 1H6AA 3LLVA 1PWXA 4CQMA 3BA1A 4YT5A 5MGBA 2HK9A 4CV0A 3L6OO 3CZRA 2AE1A 3VHRA 3I5MA 3E9QA 3WGQA 5J23A 4Q3CA 3ICCA 4JLWA 1GUYA 2DUUA 1QRRA 3BMQA 3RQSA 2R00A 4LCJA 4XQCA 3JQGB 1HZZA 3LC1O 2Q3EA 1ZSNA 3QP9A 4WE3A 3C85A 4KQXA 4DC0A 4GKBA 1VLLA 2X0NA 4M55A 3JTMA 5JYDA 3ZV4A 1QG6A 5EQFA 3ROQA 3LK7A 4B4VA 4NI5A 1EEHA 3G1UA 2AHRA 4JBHA 4LK3A 5HA5A 4ALIA 4BGUA 1EMDA 1N1GA 2P68A 4BNJA 4C7JA 3P5SA 3QA9A 2FN7A 3QJ5A 4R9SA 1ZJYA 1LLQA 3Q0EA 5HS6A 1LLUA 1P44A 1GTMA 4GQAA 4CMIA 1CETA 1XDWA 3F9IA 5T57A 4MO2A 3NX4A 4PLCA 1GDHA 3DAGA 3F47A 1C0PA 4HY3A 3E6AA 1E3LA 4KQWA 4BO2A 3AY6A 3OJ0A 2W2LD 5T8KA 2A4KA 3ZV6A 2NLOA 1YOVA 2OXIA 1TT5A 1RM0A 1TLTA 4ND4A 4C7KA 4LRSB 1EVYA 4CQMD 1HYEA 3BHIA 2ZB8A 1TXGA 3PWKA 3EVTA 4OXKA 2PKQP 4BNTA 4YAEA 4IDAA 3UCFA 3PHHA 2E6UX 2GASA 3H2SA 5KTKA 4JP3A 3FTNA 4L4XA 4PLVA 4UUNA 3ZNQA 5ICSA 4CLRA 3KLMX 3DB2A 3KYDB 3FWNA 4BL5A 2Y1DA 3PHGA 4UUOA 4KDEA 3WGZA 1OBFO 3RU9A 1QYXA 4PZCA 4IDEA 4BNVA 4DLBA 3ZWCA 2D1YA 5IF3A 2B36A 4IJKA 2R2GA 3LF1A 4MKZA 3JQ8B 4Y67A 4BNFA 1KC3A 5EERA 2ZCUA 3L07A 1I32A 4BHTA 2VRBA 5A5EA 4PLZA 1P33A 4YAJA 1UXGA 1H0KA 4DQXA 1HYGA 2O50A 5I7FA 2H1SA 3UN1A 4FB5A 1HE4A 5FEUA 3I9KA 4YRAA 1NX6A 2C7VA 4RQUA 3QVTA 3JCZA 2Y67A 4YYZA 1VSVA 3ABIA 2JD1A 5ADHA 3IJRA 8ADHA 5F1OA 1LDNA 1JU9A 3GMDA 4Z0TA 3ZI0A 3WYCA 1HDOA 2FZEA 2DFVA 3MOIA 1DRWA 4IPTA 1ZJZA 4N7RA 3PHLA 2EXXA 4E32A 4LMPA 3RC9A 8LDHA 4PRKA 1QV6A 3GH3A 2CDBA 1J0XO 3JQCA 3PIDA 5U1PA 4DL9A 2DUWA 1AGNA 4LVUA 1HE5A 3TJRA 4FFRA 4I5EA 2O2YA 4L74A 2G82A 1HYHA 4UULA 1DDOA 2C5EA 3I23A 3MJEA 2E82A 2QX7A 1A72A 1DC3A 3MEQA 1NR7A 1LNQA 3R6DA 4ALMA 3LC2O 3RWBA 2C0CA 4L0QA 3CPSA 3L0DA 4ALJA 2QRKA 3ZW8A 4EUHA 1F06A 1R15A 1JKIA 1LUAA 4I08A 4CM8A 1VRWA 2CFCA 1PJQA 3AOGA 4W7IA 2I9PA 4TRNA 4ALKA 3VKUA 3JQ9C 3INGA 1XELA 1K6XA 2EWMA 2H9IA 4J9VA 1LXCA 4MPDA 4YWJA 4BNMA 4HNGA 5COQA 1VI2A 3HQ4O 3IDSA 3QWAA 4MVJP 4B7CA 4YRBA 4CL8A 5IXSA 1D3AA 1ZXLA 4L9RA 4FSHA 4I5FA 4IXWA 3WICA 3GG2A 2JCXA 2XOXA 3DC2A 2NVUB 4RQTA 1NTOA 4D0SA 3HWRA 4HFMA 3K8ZA 3UGKA 1LEHA 1T26A 3K73O 3DZIA 4TRRA 3U4DA 4PLPA 4E5YA 3AOEC 3RD5A 2QYSA 2X4GA 3I9LA 4ZRNA 4I9HA 1TI7A 5KJ6A 1W0CA 4NJMA 1V0JA 5C3MA 4I5GA 1PJ3A 4IZHA 1LRKA 1T1SA 3H9JA 5CPFA 4NBWA 2HJRA 4XGNA 4YTEA 3JD4A 5G4KA 1DPGA 4KUHA 5KVCA 4L76A 4PG8A 4IBOA 4E4YA 1ML3A 2DU8A 2QRLA 3TFQA 1C1DA 3WSWA 3WS7A 1LLDA 2WD7A 3JQFA 4GSKA 4RLHA 1D7OA 2Z5LA 4MVJD 2FOIA 3OA0A 4JBGA 2G17A 3WR5A 3I9OA 4A10A 1BDBA 3KSDO 2EKPA 2B37A 4WUVA 5CHEA 1H6CA 1JN0A 3OICA 4K6FA 4L73A 3GDGA 3KO8A 3SC6A 2WM3A 3MJVA 3WQQA 3OH8A 4J4HA 4DVJA 2WTBA 4MDHA 5DNAA 3S2IA 3O4RA 3JQ7A 3WFIA 1SB9A 3I6IA 1U3UA 4TMFA 3BMOB 3QY9A 3DWFA 4AJOA 1HETA 3V1UA 1YBVA 4PVDA 3Q2KA 3FD8A 4YT4A 4CLEA 5F21A 2ZQYA 4J7XA 2O7QA 3T4XA 4DPKA 4EJ6A 3FBGA 4IDDA 2VTDA 5JO9A 3ON5A 1PGOA 3LQFA 2J5RA 1UR5A 5KNLA 1XIVA 1DXYA 3DOJA 5FWNA 2O3JA 3ZNOA 3NDRA 1GYRA 4MJLA 4XDZA 3ROPA 3K5PA 5JMPA 3U09A 3IUSA 2I76A 4R3WA 4CV1A 1P1RA 3GG9A 2ZTUA 5BSGA 4II2A 1PIWA 3INRA 1MV8A 3OJEA 2BKAA 3GR6A 4FR5A 3S8MA 1E7YA 1RM5A 5I9MA 4QQRA 4R16A 2E37A 2QHXA 1YOVB 1LJ8A 4TRMA 4BNNA 2EJVA 1KVUA 2VOEA 3L77A 1NQ5A 4IJUA 4W6ZA 2Y1CA 2ZIZA 3RI3A 3QHAA 2YY7A 2Y99A 4GI2A 1WZIA 3AU8A 3OM9A 5CG2A 4EJMA 3SLGA 4FIZA 5JMWA 2DBZA 5THQA 4AJNA 3PZBA 4BQRA 2OHXA 1RM3A 2X0RA 3F46A 1MX3A 3IUPA 5A5FA 5A9SB 2GRAA 4JCOA 4GGOA 5L51A 2VT2A 1RKXA 3RSHA 1IHXA 3B1FA 1XU9A 3BMCB 5IAAA 1ORRA 5DN9A 1XHLA 4HFJA 4E2YA 4BUCA 1ADFA 3ZN2A 3V2GA 1GR0A 1X7HA 5JE8A 2HMWA 4IS2A 1GQQA 1GV1A 2C29D 2X22A 3GC6A 4M89A 1UP7A 3H3JA 2X5OA 3D5QA 5ER9A 5I8WA 3M6IA 1T2EA 4CQMB 3PQFA 1UDCA 1RPNA 4BNXA 1HLDA 5I9NA 4Y6RA 4YR9A 2O3UA 1HWYA 2RHRA 2ZKLA 5HBRA 1I10A 4YAGA 2NV6A 3WGIA 3AK4A 1M76A 1U7TA 1YS4A 2X7HA 3FNGA 4M86A 4E6PA 4P4NA 3AU9A 3JYQA 4FDAA 2FR1A 4ND5A 4XWYA 3R3SA 3RUFA 4OIMA 3AUTA 3ZNPA 1TVEA 4JQCA 1T4DA 4U6QA 5L4LA 2WYUA 3GY0A 5JDCC 2GLXA 1DFIA 3OQBA 2DT5A 3MWEB 5KVQA 5CDSA 2IEDA 2P9CA 1T4BA 4U0JA 3KB6A 3ZWAA 2VHWA 4RVGA 1Z75A 3E8XA 1NWHA 1EE2A 2VYVD 3VPFA 4CMIB 4RVHA 4GX0A 4Z6KA 3VPHA 3OQ6A 4XJTA 5JW6A 3VDQA 2DTEA 1HKUA 1X15A 2GYYA 5ES3A 2PGDA 1GPJA 2B69A 4XDYA 5FF9A 1E6UA 4H15A 3ETGA 1XWFA 3CEAA 2IEBA 4QX6A 1YDWA 5L9AA 1PGQA 4BNIA 3VDRA 2CVQA 2EG9A 2NADA 1HT0A 2HK8A 2AQKA 4RZHA 2EW8A 2G76A 2RAFA 4CM3A 2JHFA 1PJCA 2Q46A 4PZEA 5HS4A 4F45A 1E7MA 3GT0A 5CEEA 1DC6A 4OYRA 2NUAA 2Y0CA 4CLRB 2BFAA 3AFNA 2XXBA 2Y93A 3OJOA 4J7UA 1IUKA 2WJPA 3ZV3A 5IG2A 1KEPA 5CDUA 4H16A 3PLRA 4R51A 4EEZA 5ITVA 5KJEA 4CR8A 3ITKA 5ICMA 4B7XA 2FRDA 3OJLA 4GBJA 1DB3A 4MINA 3VKVA 3ZU3A 4BO7A 2A9FA 3SBOA 1PX0A 1ZIDA 1RYEA 4GAEA 2BD0A 4B3IA 1JTVA 1HE3A 1Y81A 4Y98A 5H81A 5L45A 4I9NA 3LU1A 1YQDA 2FHSA 2FSSA 4B8ZA 3ASUA 3RUIA 3D3WB 6ADHA 1A9YA 3RC2A 3L9XA 3NKLA 3ZCXA 4F3YA 1Y1PA 2PR2A 4Q3BA 4QEDA 5JS6A 4AL4A 4M1QA 3WWYA 1DIAA 3CE6A 4OJNA 2GZ2A 5JAIA 3F3SA 4S3MA 2Q2QA 2RH8A 3TNLA 3DBRA 5K1SA 4D0RA 3E9NA 4BO0A 1QKIA 3N58A 2ZYDA 2HMUA 4ND3A 5A3JA 1KEUA 2G0TA 1LX6A 1ZK1A 1BW9A 1O94A 3H65A 3GVIA 3NAQA 2DBVO 4R01A 2DKNA 4E12A 4NK4A 3TZKA 4OL9A 4HV4A 1CYDA 3CZMA 1B16A 4DC1A 1I3KA 2VZ9A 4ZJUA 2EP5A 1KVSA 3GZNB 1SOVA 1ZO8A 3GMSA 1TEHA 2AEFA 3KSUA 5GMOA 3ANNA 4CM8B 3QWHA 4CR7A 3ASVA 1QYVA 1YQXA 4GWKA 1WVGA 4LSMA 1NQAO 5F1KA 4E2ZA 3K2EA 5JC1A 3ENKA 3RCBA 3P7MA 4PGFA 1P1FA 4PLFA 1IPFA 1JAYA 2GO1A 3JQEA 4WASA 1E77A 2EHDA 3VZSA 4IMPA 4AJPA 7ADHA 5TT0A 1E7SA 4E5NA 5JY1A 3IP1A 1P74A 5KVVA 1R0SA 2GF2A 2NU7A 3GQVA 1R4NA 4NR0A 1K6IA 1U2DA 2PV7A 2OUIA 1LA2A 2UV8A 5EJ2A 2B0JA 1ZK0A 3TF5A 4IQ8A 1GL3A 5JLAA 4KWHA 4II3A 4AJKA 1P45A 3JD2A 3CUKA 2AE2A 2C2YA 2BLLA 4XEHA 4KWIA 3K92A 1NXQA 4O0LA 4ZQGA 2FR8A 4BMVA 1I2ZA 1NHWA 4JXKA 2DTXA 4NJMB 3F6YA 3ZHXA 1ZMTA 4L8VA 4NBRA 3WTBA 4CMJA 4K9DA 1VJ0A 3OIDA 4XGIA 3U49A 3O38A 3GPIA 1O5IA 3JQAD 1VL6A 1PS8A 1DC4A 2HMSA 4NFYA 1H9AA 3U3XA 3DAPA 1UXHA 3F5QA 1LLCA 2NU8A 2E49A 4J90A 4R5HA 2O3TA 1MG5A 2OL4A 5KOIA 3WNVA 2LDBA 5ILGA 4LSWA 3H9UA 1SC6A 2I5PO 2V6MA 3AI2A 3OQ1A 4PCVA 5T64A 3AJRA 5AYVA 5U4QA 2I65A 3AM3A 4K1LA 4AJJA 4OQZA 1N7GA 4FW8A 2Q4EA 3UVEA 1ZXBA 1Y8QA 1X0XA 1ZEJA 3GN2A 2YJZA 4DIBA 5IZCA 1WPQA 4N18A 5L95A 2BMAA 2B4RO 2NTJA 1KY4A 2I3GA 1I8TA 5U9CA 2AG8A 4WJZA 4FBGA 4M87A 5CEFA 1W6UA 3CIFA 4K6CA 5CP8A 3QV1A 4ALLA 2UUPA 3NJ8A 1E1LA 1T2DA 4P4GA 2VUTA 3FPLA 2IZ0A 3JQAA 2J3JA 3OECA 5JCJD 2P9EA 4NFSA 3DOOA 1ADBA 3BTOA 4QECA 2C5AA 1KEWA 3BMNB 4GX2A 1EK6A 3SEFA 4INAA 2NACA 5ENDA 3VZQA 3L4BC 1E7QA 1J49A 4R69A 1YL5A 1NR1A 4MIYA 1GD1O 1DIHA 1P1HA 1HDGO 5COAA 1FDUA 1BWSA 2NM0A 3T7CA 5JDIC 1VSUA 2R00C 3KXDA 4JNKA 4KZPA 5GZ3A 4D3SA 1YRLA 3GLQA 1UXKA 2GR9A 2IRWA 3SJ7A 4PN3A 4LRTB 1DEHA 4A26A 4NG5A 2B4QA 4BVAA 4A73A 3NT5A 1GQYA 2VYND 2DVMA 4UVIA 2Y66A 3RJ5A 4GH5A 3TZQA 4ALNA 3EAGA 1QR6A 5BR7A 3V2UA 5KKCA 3E9MA 4J7CA 4QFDA 3WJAA 1R4MB 4IGEA 5LDGA 1PJSA 3G79A 1PS0A 2ZJ1A 2P4QA 5HRUA 1I3NA 1HXHA 5EL0A 4MIOA 2QQ5A 1ZCJA 4U0KA 5LDHA 3ANLA 4A03A 5AOVA 4JJIA 4TZTA 1H6BA 1KETA 1TT5B 3GVPA 3GOHA 4IGFA 1GADO 2CY0A 2VHXA 3D4PA 1BRMA 1UP6A 1T2AA 3Q1LA 4CUZA 4ZGWA 2V6GA 3M2TA 2W4QA 3W4IA 3ENNA 4XX0A 3NT2A 2Q50A 1GV0A 1R0KA 1ISHA 4IINA 1LSSA 3DBHB 5AXCA 5L53A 3D64A 1UUFA 4RO0A 9LDTA 5C7OO 2O4UX 1AE1A 3JQBA 1B3RA 4UEJA 4BNZA 5KVSA 1BGVA 1HTBA 3GVCA 5DCWA 4XYMA 2EEZA 2ZTVA 4BO1A 3OETA 1GZ6A 1MXFA 3ZZNA 2P91A 4WCFC 7MDHA 1U8XX 1HSOA 3VVBA 4PZDA 2EV9A 3MJTA 4AJLA 1CF2O 4AVYA 5G0SA 2AQHA 3F1KA 4N5MA 3E82A 1DLIA 4KUGA 4RCVA 5DCYA 3R0IA 4G65A 1SBYA 3BYZA 2PKQO 4BO6A 5JAMA 4NIMA 2HKIA 4BNHA 3PJEA 1KVTA 4RZIA 4WK6A 4WLVA 5G4LA 3VPSA 4BQPA 1ONNA 4NFHA 1Y5MA 5T5QA 1X1TA 2GUGA 3QVWA 3DONA 3RKRA 3BMQB 5IDXA 3IC5A 1HL3A 4UVHA 5DBFA 3JQGA 3WBBA 3DMYA 4OHUA 5KKAA 4RLSA 2BFMA 3VTFA 1ENPA 1O0SA 4XKJA 1AHHA 5FYDA 3I83A 1V3VA 4RDIA 2AA3A 2Y1OA 4PRLA 4YQZA 1H93A 4DWVA 4M49A 3PYXA 4GX5A 4LGVA 1T24A 3F4BA 5TSDA 1DHTA 1H2HA 3EZYA 4EUEA 5JAZA 1KC1A 1CIVA 3DMTC 3I3OA 4EYEA 3PI7A 3U4CA 4DREA 4D46A 3B6ZA 1VPDA 2BGKA 3RFTA 4OXNA 1DJNA 2DTDA 4BO3A 3MJSA 5B4VA 4XD2A 2QRJA 4TKLA 1XQ1A 3U4HA 4AJ4A 1GCUA 3EZLA 3CMMA 2H6EA 1IPEA 1JVBA 1YE3A 2C20A 4O63O 1PEDA 4PLYA 4GX1A 1PTJA 4JBIA 4R1UA 2DPHA 4NJOA 5A03A 5A4DA 2AG5A 3ULKA 4RVDA 3NGLA 1NPYA 2G1UA 2YFQA 4HX5A 2X9GA 3QW2A 1JW9B 4EGFA 1X1EA 2GNAA 2TMDA 2QW8A 5L7WA 3TRIA 2P5YA 2GGSA 1H94A 3A06A 4ZQFA 4RF4A 3PHIA 2B35A 1NP3A 3FN4A 1I33A 2CNBA 3ROKA 2OGUA 1PJ4A 2VWGA 3KYDA 1ONPA 4WLEA 3JYOA 3PFFA 4Q39A 2GD1O 5JCJA 1EFKA 3H6KA 2IZZA 4CM4B 1J6UA 1GQ2A 4DLLA 4J2OA 2ZATA 2BGMA 4KTVE 1B0AA 1G1AA 4FN4A 1Y8RA 1B26A 1M6WA 3JYPA 3TN7A 3QIVA 3D4NA 4FJ1A 4R1NA 1E5LA 1GEGA 4IM7A 4YEDA 3DZGA 2ZYAA 2RCYA 4ITUA 3DAFA 3H9QA 3E48A 3RASA 2VWPA 4CM9A 3A14A 1CJCA 1UDAA 3PP8A 2JCYA 1WXDA 1F0YA 5K6AA 1A9ZA 2GZ3A 5TC4A 1DBVO 4OKNA 1LSOA 1SNYA 1VKOA 2F00A 5BSHA 1U3WA 1PJ2A 1EZ4A 4MP3A 1W4ZA 4NU6A 5GZ6A 4B4OA 3WOHA 2VRCD 1VC2A 3B1JA 3NV9A 3RUAA 4CMEC 2XPCA 5BSFA 1Q1NA 3GGOA 1HDZA 3GZNA 5G4KB 3D5TA 3GAFA 5BT9A 2JAPA 2OBYA 3D0OA 4ZRMA 4QO7A 1IE3A 4ZA2A 4A0SA 2ZQZA 4ZN6A 4R1SA 1N2SA 4F6LA 1CDOA 2PD3A 2YFHA 3NT4A 3HB4X 5A3VA 2D8AA 3MOGA 3T7EA 4KP7A 4IY1A 2W98A 1CEQA 3I4CA 5ENVA 3Q3CA 3BZUA 3A4VA 1QLHA 3HDQA 2Q4BA 4D41A 3FSRA 3JQAB 4BKRA 3RUEA 3RIHA 3ITDA 1NASA 2IXAA 1C1XB 3NJ4A 4UVGA 1E5QA 1KEVA 3Q2IA 1RM4A 4OH1A 4BGIA 3DZFA 1LDMA 3KSZO 5TGDA 1WDKA 3HDHA 1A7AA 2BRUA 2P4HX 1SCUA 5KJ1A 4WNCA 4CM6A 1PL7A 1B8VA 5L3ZA 2UUOA 3AI3A 3V1TC 1B8PA 1P1KA 3GVXA 4IDBA 5L7YA 3EGOA 1NAHA 5IXYA 3PYLA 4Z3DA 1PWZA 1ZK4A 2Y0DA 1XYGA 1BXGB 4YVFA 3FR7A 3N74A 3TFOA 1K89A 3I4FA 2FP4A 4IMRA 3QWBA 1FF9A 3LLSA 5DBGA 3LF2A 3ONDA 2PZMA 4ZVVA 1IOLA 2PH3A 1Q0QA 3BTUA 1YWGO 1YQGA 3HJAA 3ZWVA 3W8FA 3NDIA 5B1YA 5IDWA 1Z74A 2HQ1A 4YJFA 4IXTA 2BFPA 4WLNA 4Y6SA 5B4UA 2D5AA 3OBBA 4MVJE 1ADGA 2QZZA 3TSCA 2E48A 1IL0A 3RUCA 2DAPA 1XQ6A 1V3UA 4O6VA 2W2LA 1K2WA 5BQFA 1F8GA 1H9BA 4LN1A 5BNTA 3HNPA 5A9RA 1YB1A 4WOJA 1WDMA 1YXMA 1C1DB 2C54A 1E3JA 3KTDA 1E1KA 3MZ0A 4YJGB 2V6FA 4J2HA 1F17A 4U5QA 3AOEA 1WP4A 3K96A 3TQHA 3WIDA 3D1LA 4NK5A 3ORFA 2HUNA 3S2FA 1PL8A 3NTOA 1ZK2A 4EW6A 3B1KA 3NTRA 4ROSA 3ZWNA 3UH1A 4DPMA 1ZMOA 2PY6A 3ROMA 2DFDA 4MVJG 4CV3A 4XQGA 1RYDA 3OP4A 3PQEA 2HO5A 3BTSA 1D1TA 1AXGA 1IB6A 1S7CA 5CG1A 5I7SA 3E5RA 3NEPX 3RAJA 1CQJA 1JQBA 1T1RA 2VYNA 4J1QA 4R41A 3BMNA 2ZB3A 1OFGA 3JQBC 3VPXA 1MLDA 4EZBA 2QZ9A 3JQ7B 2YYYA 3WMXA 1NVTA 1VL0A 3JD1A 3BMOA 3G3EA 4QTZA 2PFGA 1DFHA 4B3HA 3HUDA 4G81A 4RPHA 4N54A 1Q0LA 4G5HA 4HADA 4BMNA 1ENZA 4U8GA 1PGPA 5EPOA 4D3DA 3TL2A 3BHJA 3ONFA 3PZRA 2UYYA 4ZQBA 1FDSA 1NNUA 3OF2A 2WDZA 3DO5A 3S2EA 1PU2A 3S1LA 4J4BA 3RVDA 3X2FA 2GERA 3V8BA 1LDYA 5AQ1A 1PR3A 3D4OA 4PLWA 2Q49A 1OC2A 4CLHA 1LRLA 4B4WA 4GKVA 1XEAA 4RV9A 4UUMA 1U28A 1ZFNA 4BNUA 1YJQA 4ID9A 1PGNA 4XCVA 3WBFA 4CM1A 4Y9DA 2OORA 3KOUA 2HRBA 4EJ0A 1Y9AA 4LVCA 2PH5A 1LU9A 3WIEA 1HEUA 4DBZA 2VWQA 3H8VA 5JAQA 3CINA 1SMKA 1BXKA 2VHYA 4P38A 4E30A 1NWCA 2XXJA 3C24A 4DLAA 4IZIA 4LMRA 4TKMA 4AG3A 5A02A 4DXHA 3M1LA 2HLPA 4OMUA 1A27A 3LSYA 1OOEA 3OIFA 4J16A 2OZPA 1UH5A 4BIIA 1GYPA 1EQUA 1DRUA 5BSEA 3IMFA 4E5KA 5LC1A 1PJTA 1E3WA 5TT1A 3ETDA 1FDVA 2AEJA 3V5NA 5TLSA 4NDNE 1KERA 1P77A 1YONA 1PZFA 3VVCA 1LDEA 4XQ9A 2E4AA 3K2BA 5F5NA 4CM4A 1MGOA 2B5WA 3ZHYA 1ONOA 3JYLA 4HKTA 3RBZA 2B83A 5GY7A 3PJDA 3RKUA 1EBFA 2Y0EA 4E2XA 1HLPA 1YH3A 3ZHBA 4DIOA 1OMOA 1SOWA 4CLDA 4FJ2A 2ZJ0A 4JN6B 3W4KA 1Q7CA 3OFSA 3M2PA 3CMCO 3GVHA 1DIGA 2BFOA 2H63A 3C1TA 3ADPA 2WE7A 2UVDA 2GZ1A 3PFWO 5F3RA 5AXBA 2Z95A 4DPLA 1ZBQA 5ILOA 2AEMA 4A2CA 4EI2A 1K6JA 3OSUA 2YDXA 3DDNA 3WSVA 4CLOA 5CEJA 1G6KA 2W90A 3D3WA 3RU7A 2VZ8A 4E5PA 1YB4A 1PL6A 1W8DA 5L4NA 3E18A 4FPXA 4F6CA 3GNQA 2FWMX 2WD8A 3PDUA 1GEEA 2CF6A 4B8WA 1JVSA 1F8FA 4OOEA 3GEDA 3W1VA 5IDQA 4HWKA 3ZDFA 4XYBA 4RVUA 5K9ZA 1YBAA 4AJIA 5B4TA 1SEPA 1IYZA 3HN7A 3UXYA 4IQ0A 1BW9B 3UUWA 4AICA 3GUYA 1IHYA 1ISIA 4CUKA 4MVJA 4DMLA 3KM0A 5KCZA 4CR6A 4XRRA 2Q45A 3TZCA 2HU2A 2OBNA 4DQVA 4OAQA 4WLFA 1E7WA 4CMKA 2ZTLA 3BAZA 9LDBA 1BG6A 3DHNA 4R1TA 2ZK7A 4MVJM 1GUFA 2CF5A 4O1MA 3WB9A 1EE9A 4ZD6A 2ZTMA 5DDIP 3H5RA 4FCCA 1LDBA 5DP1A 3WMWA 4KTTE 4E3ZA 4YBZA 5C5IA 4FFOA 2BI8A 2YHIB 2P9GA 2J3IA 2GN6A 3ZNNA 1I30A 1N9GA 4E21A 2FPIA 4D7AA 1YVEI 3AFMA 3GF4A 4FFNA 3S2GA 4IJVA 3LDHA 4TROA 4BNGA 1T2FA 2PK3A 3PGJA 1I3MA 1BXGA 1DHRA 3NDJA 1IZ9A 1CQIA 1NPTO 3HADA 4YQYA 4GPD1 2W8ZA 4CODB 4HFRA 2PZJA 4Q3AA 3H7AA 2NVBA 3NYWA 4KMSA 4WNIA 2XAAA 3HZZA 3SX2A 2HCTA 2WYVA 3IJPA 3C1AA 1ULSA 4FJ0A 3VAZA 5TS3A 4YJFB 2W2KB 4XA8A 3WQRA 1DFGA 1WNTA 4N5NA 3WDSA 1Z45A 4GL4A 5KIAA 5G0UA 3DQPA 2X5KO 2CVZA 3WYEA 4RVFA 3WGOA 3WGYA 5JY6A 2VCYA 2HAEA 3UHAA 4QO8A 3ONEA 3RJ9A 1P3DA 3IKTA 2GSDA 5G2OA 3WFJA 1DIRA 4J1NA 4BKPA 2BH9A 2NTVA 4YJGA 1NPDA 4UEKA 2C59A 4MP8A 5EMHA 4UVDA 4RPJA 3TWOA 5IFLA 1FXSA 1EVZA 1C14A 1R6DA 4TQGA 2VHZA 2EGGA 3I6QA 4GMFA 3SVTA 4D79A 1X13A 4D44A 4OXYA 2HK7A 3AM5A 5L7TA 3BXXA 3GAZA 3NRCA 2BGLA 1FJHA 1Q2XA 4HNHA 4AJ2A 1M6HA 4XR9A 4RPGA 4FFLA 3RC7A 5BNFA 3Q11A 2NTNA 1ZSYA 1LSJA 1NQTA 3AY3A 2O3SA 3A28A 3Q9NA 5DOVA 1Q7BA 1MA0A 2FR0A 1HRDA 4P22A 5G0TA 1I3LA 1ARZA 1XCBA 3MTGA 3X2EA 2PGLA 1A4IA 4JK3A 4DGSA 1ISJA 4YAIA 3KBOA 1QSGA 2BHLA 4GVXA 1E6WA 3G1TA 3HFSA 3QVSA 1DAOA 1AN9A 3MCVA 1PSDA 1AHIA 4XRGA 3F4LA 2O2SA 5JC8A 4WEOA 5ER6A 3CSDA 1BHSA 1NAIA 3EYWA 1RWBA 1E7RA 2TMGA 1GFSA 4YPOA 3C7AA 3U4IA 2F1KA 3ANMA 1V3TA 2A92A 3ZWBA 1YL6A 1EVJA 3FBTA 3HHPA 3AUAA 1X7GA 3UICA 1JAXA 3U5TA 3C7DB 2C07A 4CMCA 1UDBA 4J49A 2D3TA 1OAAA 1H5QA 2AQIA 1V6AA 3Q9UA 2YHUA 4IQGA 5L40A 3U0BA 4ILKA 1KVRA 2JFHA 4N5LA 1SAYA 1UZLA 3ZHZA 3OA2A 4JGBA 1UJMA 3P2OA 4Q3EA 2AW5A 4JJGA 4M8SA 4W9NC 3A9WA 3PTZA 3U62A 4WCFA 5C7LO 1P0FA 2FY8A 2HSDA 4YDRA 5CDTA 3QRWA 4ND2A 3EK2A 1E6EA 3QVXA 5TQVA 3IAHA 3WQSB 4YT2A 5JNLA 1D1SA 3IIEA 4S1VA 1YGYA 1WLYA 2DQ4A 2GPTA 2NSDA 1BVRA
chains in the Genus database with same CATH superfamily
4DWOA 5BRAA 1RI5A 3B8HA 4Y2SA 1FUEA 5MFPA 1ZH6A 4W4TA 5JI3E 1LQTA 1ZQ9A 3S29A 3TRHA 4QDXA 3S99A 4IUCS 1NJSA 1N5DA 3K16A 1BJTA 3SJUA 4DCPA 4ETWA 4R8KA 2PS1A 4PF1A 4RIGA 4BV9A 1JZSA 1G55A 3F67A 2ZUWA 1N77A 3WWZA 1DQZA 3BKXA 5FPYA 1JHPA 3LDAA 1U9YA 2X42A 2BCEA 2EBHX 3AETA 1M1XB 1Y8QB 3ESAA 2ZT6A 4FHEA 1OI7A 4QGFA 3STUA 1Q0TA 4TTQA 2E1PA 2JFYA 1N1EA 3AQ4A 4K9OA 1CVRA 2ZIXA 4MI6A 1X70A 2R11A 3LY8A 3V4SA 4OHYA 1JR4A 1IZZA 2NN3C 1XMIA 1FU4A 4G0ZA 3X1YA 2PA0A 2R7NA 3HB0A 1M2VA 3HKEA 4OSPA 4ZU1X 2PPVA 3GPDG 4GMXA 5AJUA 1RS0A 1QO0D 1XLTA 5EKXA 2GN9A 1CB0A 2W5UA 3ODGA 4AKTA 3I62A 1JWAB 2ZWOA 1NN5A 3DBLB 4E1BA 5AM5A 4OUDA 1W73A 2B7LA 2Z1NA 3BUSA 4KNYA 1OW3B 2F3QA 1M2OA 1PZGA 2VSQA 4C03A 3OT1B 1NMZA 2FZ4A 2IE0A 3PNSA 5EZYA 4LYAA 1A1SA 2LXNA 3CKYA 1KI4A 2MOKA 3MELA 4FGWA 5C1OA 5KQPA 2BI7A 4L8GA 3UMVA 3NEJA 3RC1A 2OEPA 1XRSB 1L5MA 4YV7A 5ESWA 4MHSA 5KYWB 4D3FA 2VQFB 4FNAA 5FTNA 1FQJA 2HNAA 1PT6A 2E87A 3PTLA 5KOJB 2C2XA 2FDRA 4I9UA 4RVOA 2X3YA 1UPXA 1CJTC 1ZGCA 3K31A 3P9PA 5MF6A 5FADA 1ST2A 4GC5A 1ZH4A 3G8YA 3FVTA 3GFGA 3NW9A 1U11A 1XNHA 3M9XA 3UAOA 4CCAA 1Z6AA 2ZRKA 5LXTB 1M9NA 2F1OA 1Z34A 4Q12A 2MCFA 4D74A 3N9IA 5KKNB 3D7LA 3LQ2A 1EAMA 1O95D 4LXHA 4GPEA 1UXJA 4QTXA 3RABA 2UZ0A 4MS3B 4RGBA 3CU5A 2A5YB 3I5AA 2D1RA 3Q6IA 4QBIA 4QWWA 4ANFA 5D3QA 2DBQA 2O6HA 4DUYB 1NQXA 2J3HA 2ZSHA 3KAPA 4L4SA 1ISRA 4QGHA 2ZJAA 2WEKA 3L4JA 2XMZA 4AKHA 2QRVA 5C4IA 3R6WA 2A7QA 1ECGA 3HE3A 5FD8A 2AR9A 2HXGA 5EZYF 2Z3WA 1PN3A 1XGKA 2X4LA 4QXRA 3DYIA 4A8HA 2P2ZA 2Z43A 3T9BA 3A31A 3O9VA 4PO9A 5KMGA 1X86B 4FKBA 4HB0A 1BS9A 3TPCA 1OJLA 3PL1A 1S1CA 1XMVA 1RRVA 4JSYA 1VZ3A 4S1TA 4EY5A 4BC0A 4QPCA 2BBTA 2IXBA 4IIVA 4OO3A 3THOA 2QG6A 2QQFA 1PW7A 3WQBA 1SKQA 4RSHA 4MGHA 1K5PA 1VIYA 2I1WA 3IS3A 1CT9A 1QK3A 2VI5A 4TXJA 1JQDA 2NVWA 1GAEO 4BLUA 2HW8A 2FPIB 3HXQA 4LC0A 3P9IA 4W82A 3O9ZA 3SYKA 1NBME 1PJRA 2H0QA 1HE2A 1U4OA 1JHXA 3H11A 1P8JA 1NU8A 1S89A 3AI7A 3O3NB 3QLEA 5DBIA 2GILA 4IH4A 3DP7A 4TMWA 2B8EA 3NIFB 3PWZA 1W85B 3H1FA 1LDGA 3KQQA 2C4NA 1ZU4A 2D4AA 4OTZA 1QAMA 2RI6A 4PG5A 1RZVA 1B8NA 4IIJB 3RVMA 4PE5B 5F4BA 2QE7D 4HK4A 4KQ6A 1CFZA 4B7AA 3OAAD 1OFTA 1GZVA 2E9SA 2ZB4A 1E8NA 3PQ3A 5AVOA 3W1WA 5F1PA 1QUFA 4BCCA 2QL9A 3UATA 1YQUA 4JGIA 2XR1A 4AYXA 2V7EA 1KO7A 3P94A 3WGHA 1XA3A 3VPBA 4TV8A 4BB6A 1XTUA 4RJTA 1MX1A 1TCCA 5IVPA 1NNEA 2QGFA 2EJUA 3N0VA 2Q1WA 3O03A 4NDAA 4Q7JB 4Z9YA 3WMFA 4A0GA 2BKXA 4PZLA 1XF9A 4B45A 6ADHA 2YV1A 3FMOB 1AQNA 3COVA 4YDSA 3EC7A 1G5IA 1PBNA 3SSNA 4K46A 4L5AA 1NUHA 1QK5A 1RHQA 2PG3A 4R2JA 1L5OA 1CY6A 3TDKA 4KJZA 4KWCA 2Y68A 2H31A 3EDMA 1V9LA 2I99A 3V48A 5HUJA 1YNSA 1WM1A 2O0KA 3GEGA 1J70A 4Z86A 4A2QA 2PGJA 1R3UA 3KJNA 4ZPXA 1I3OA 5EIWA 4C2BA 5FYQA 1JA9A 2B1RA 4MJXA 1CE8B 3MJ4A 5C81A 1X7WB 5M7EA 1OQAA 4L2IA 4ZOCA 1SU8A 1JEJA 4GMGA 2COEA 1DRVA 3I8XA 3IBCA 4X64B 3OHPA 3IAEA 4XTRA 4HJXA 2QEQA 3KRTA 4W5OA 3EIQA 1F8XA 1E1CB 2PD6A 2X6RA 4MVXA 1B6RA 3VR4A 5KNCH 3BIXA 4CQLB 3H4VA 2YS7A 1BOOA 4JROA 3OCCA 4D98A 3LYLA 3W6ZA 4JC0A 4X3PA 1GY8A 2CVFA 2QE7A 3GJ6A 5EVJA 1A4UA 1B14A 3IVCA 4CNBA 3AHCA 2W0MA 4JJFA 2EKLA 2JGMA 2OHOA 4TMZA 1TF2A 4OP1A 1DC5A 2A0YA 4BKQA 1BCSA 1DKRA 3F49S 1SBQA 2YHIA 2JJ1A 4Q9NA 3EPKA 4MEAA 2PSEA 2X2FA 4QU0A 5J2UA 3A1NA 3HLKA 3QQPA 1YJBA 13PKA 3RLIA 1GNTA 1N2BA 1ZONA 2WPDA 3HFGA 4QBTA 1GZ5A 4UMEA 3TRKA 4F11A 821PA 4P5DA 5K8CA 2CGEA 3PQDA 4S35A 4EUKA 3IGFA 3OJFA 2Z4SA 3A7EA 3FJ1A 4EG0A 1I0ZA 4R68A 4GGPA 3CH5A 2C77A 4N0MA 1SQ0A 4GLLA 3FF4A 1V7QA 1XR3A 1C1XA 4NSNA 1C0LA 4OFBA 4UE3S 5LYJF 8MHTA 4DV4B 3MHTA 4KIWA 4HHEA 1XTPA 2VPXA 3BRQA 1CWUA 5DI3B 3D2LA 2P3LA 5EWMA 5JXWA 4YJDA 3HACA 4A7PA 5ALLA 2GM4A 1O8CA 3UH0A 4O5OA 2PNFA 3LE8A 2IE8A 1AK2A 1D2EA 3SI7A 1VKHA 1Z6QA 3P20A 3AVVA 1Z0SA 2R751 2MSWA 3ZWOA 4YHBA 5JCZA 3QSYA 1SG6A 1F12A 4YACA 4WLUA 4C78A 2ES4A 2M2IA 4Q9AA 4JR1A 4DV1B 4TV9F 1CIJA 2WUVA 1G0NA 3I9NA 1P75A 1V45E 3FDJA 3DFKA 2I67A 3DDZX 5BUCA 2VUHB 1G38A 3GFVA 1U3CA 1AA6A 3GNTA 5IC4A 5JQGB 2YIMA 2PRKA 6REQB 3UPDA 3M4XA 3R5XA 4BLOA 5FPTA 1ABBA 2DZDA 1JTFA 2GCNA 3KTAA 5FWAA 1XAGA 1L5QA 1P91A 2F1RA 3H1TA 1UMBA 3OO1A 4XJXA 4FOSA 5T67A 4KOEC 1U7PA 5AIBA 1TUGA 3EEBA 1Z7GA 3V4VB 4BJ5A 4JX8A 3GNSA 3UXMA 4EMBA 4WBXC 1JBEA 4M88A 3FKSD 4F3TA 4WCVA 1JA0A 3ZX4A 3RODA 2QP9X 2FN3A 2Q1SA 2YTZA 4HWSA 2JD2A 3KQYA 5E2BA 1ORWA 1RLIA 3KWLA 4C4OA 3KOMA 4YB8A 4PPGA 3NH6A 3DUWA 3LD9A 1JQAA 1HSZA 4KIUA 5CDGA 1GXSA 5A62A 2EZ9A 2PT5A 2HADA 5AO9A 3NWEA 4BBJA 5HJ7A 2QX8A 3L5OA 3SDSA 3EB9A 1BVYF 2PTGA 4G5XA 4PG6A 3RYHA 4BMPB 4DIFA 4ZHSA 1T1EA 4RL4A 2DXIA 4IW3B 1PWYE 3H9EO 4LOLA 4FE4A 2GTHA 3GGPA 2ZWPA 5DTJA 5FL3A 3UB4A 5D7BA 1YVUA 4XB1A 3R0QA 4DEVA 2ATEA 3EIOA 2QTTA 4XW2A 5H3LA 3MLBA 3ZGYA 3AINA 2BLNA 4I5DA 1M3SA 1VE9A 4LF4B 2QE6A 1EBBA 1M5UA 4UEOA 3T0IA 3ADOA 1PV1A 2K87A 2AWOA 1UEJA 5BV7A 4WEQA 2JIPA 2O5RA 3CUUA 3L49A 1OZFA 2GO7A 2VS1A 3B60A 4TSFA 4W7HA 1JJVA 1Z15A 1SXIA 3OPYB 2Q2OA 4PPFA 1L7NA 4AZTA 1Y33E 3ZQUA 2HV9A 1RR6A 1L1EA 4FNOA 3G68A 3LZ6A 1J0AA 1VZ2A 1Q0HA 3NONA 5GONF 1FP4A 3U7IA 3WGVA 5ALRA 4BMSA 5B7NA 4FLFA 1YRWA 3GDFA 1URPA 3EIWA 5CT8A 3ZZUA 5C8YB 2XYVA 5JU6A 4BQSA 1GLVA 5KVAA 3EXEB 5LIPA 1BMQA 4B75A 3QYAA 2WSYB 5IJXA 3HJNA 4RS4A 4JYMA 2XDWA 4CT4B 2ZU0C 1SO8A 4N01A 4AG6A 1IM8A 2PLAA 4F5EA 2J46A 3TSOA 1M7BA 1UXOA 3ICPA 4ZVMA 4DLWA 2XKJE 3I9JA 4TS9A 4KXNA 4N65A 3R8XA 1EUQA 4NARA 1PFYA 1QFXA 4IHJB 1KJ8A 3A05A 4A8PA 1GTSA 1AKRA 3HFRA 2VH1A 4WKCA 1T6BY 4D2IA 3L8GA 3THRA 5HIIA 4KQKA 2RIRA 4R2LA 1O89A 1XMSA 4NH0A 1U0BB 3LA6A 1K5HA 3L8CA 2GHQA 3ZCQA 3OZXA 1IUPA 3E03A 4V0OA 3CURA 3A11A 5FFNA 3KC2A 3UG7A 4MRAA 1ZOPA 2FGJA 4FBMA 2OXRA 4RTLA 1KDYA 1KYTA 1SVWA 2RGUA 2DSTA 3B70A 2QIOA 1WHTB 3T52A 4N82A 2J45A 2ZREA 4WKBA 3ZVLA 4RWEA 3MWDB 4ENUA 5JCOC 3JATA 4ZYWA 3DYVA 1QC5B 3UC9A 1FVHA 2JI4A 4AZ3A 1RWOA 3QBJA 3T7SA 1QTNA 3PNQA 1TCBA 1MAUA 4Z1MD 1E0DA 4A8JA 2YW9A 1J8DA 1A0OA 3PPYA 1U0FA 1YKFA 4DLYA 1TVKB 1PCXA 1JDUA 2PL9A 3LPCA 4DA6A 2NO0A 2A9OA 4DM4A 4O2AA 1M2NA 3F5SA 3U56A 1YZVA 2FX5A 2RB5A 3OLQA 3TO5A 2A0XA 4PCAA 3UMBA 1IBMB 1JFFA 2BFDA 2I4RA 1FFWA 4JBYA 3AQIA 4F9EA 5HKKA 1DLJA 1G21E 3TEMA 2WWRA 3OQMA 2ET6A 5LQSA 1L1FA 3AKZA 3NBKA 4K9NA 1T8SA 1Y6JA 5AI4A 1ZVVA 4BNWA 2XWQA 3LBIA 3BBLA 3U7QB 4ICIA 4JGGA 3UOAB 1WU8A 2IV3A 3AY7A 1EUCA 5C8YF 1R0ZA 2I66A 1RXWA 4LV8B 4F5YA 2A5GA 3CH6A 3GRVA 2A0WA 1HDCA 3FYCA 4KE8A 1V35A 2XNJA 1JBKA 3MTBA 4FGUA 1W96A 1KIMA 5FI3A 1WP9A 1R16A 5JNVA 4ETMA 2BFFA 4ZCQA 2A78A 2WD9A 2CYAA 4S2UA 1Z37A 2CUKA 2I2AA 1YQWA 2H1IA 3DZHA 3N0RA 5LBIA 4DRYA 2GPNA 3KKQA 2DM6A 1VOTA 3NCHA 4XWAA 1XVUA 5HIMA 3D4BA 4R1OA 3BK2A 4J0EA 4F1WA 4X3OA 1RIIA 1IEWA 2Q2VA 4UE2A 3C6ZA 1GUZA 1US8B 1G0OA 1TGYA 1ZUHA 3JVUA 5K0SA 1X87A 2AK3A 2O05A 3TZ6A 10MHA 3QYFA 3WL5A 3CB4A 4KMOA 2DCMA 2PEYA 2J0UA 2PYZA 1FBNA 4K8OA 4PVCA 2XDQA 1G3MA 3GU3A 1PR6A 2R44A 5AW1A 3EEOA 1WMFA 3EDCA 1JHQA 4GC9A 1N6HA 1WPXA 3C4QA 1PJ8A 3KQWA 4BV8A 1Z4MA 1P5JA 2H06A 4J1SA 4FHGA 4IP0A 1FYXA 3RS8A 5F3DA 4G1FA 1SXQA 4FOOA 3Q7PA 4NV0A 4YJHA 2HV8A 1ULUA 2WIBA 1FMLA 4NNPA 4XFKA 4DLSA 5CITA 2D0IA 2JJ8A 5I4BA 3ZCRA 4EYSA 2II6A 2ZI4A 4YJ3B 1X2EA 2SCUA 4RZQA 1WJGA 3NG1A 5G0WA 4KXQA 2IUEA 2ORVA 5FO1A 1K97A 3CY6A 1C9JA 5C8ZA 2WF5A 3LGXA 1EHCA 1UF9A 2OBLA 4UM7A 1X80B 4IGKA 1M1YB 3OHMA 3B6EA 3W2GA 5EHGA 2W58A 1ZSVA 2EBFX 2CZCA 5BV2P 3JASB 3L4EA 3K0BA 3S28A 4OHKA 3KYCB 4CEJA 1QF7A 2OCKA 3NIDB 1ZHFA 1K7CA 2PMDA 5L6LB 4Q1EA 2X8LA 1C7QA 4G0OA 3UJAA 4G89A 1U2SA 2Z8XA 4ED9A 2DJ5A 2ZTHA 2CCJA 5EMLA 4IJ6A 1S3IA 3VH3A 5CM9C 2XKAA 1PLKA 2WFMA 1H3FA 5AI5A 5H83A 2QTHA 4FE7A 1E3IA 3IP5A 4A9AA 5LCXA 3ISTA 3L82B 4QD3A 1L3IA 1JLLA 1PL0A 4EENA 2DEUA 1QCCA 1DAPA 4JT2A 1B2RA 3WNCA 2ZJBA 5AUOB 2EW2A 1XL1A 2QAIA 5DTEA 4NMLA 3FPCA 3N2EA 2KB0A 1U8FO 3CH4B 3HS3A 3RVKA 2XADA 2FN4A 3SHVA 1QIKA 2HUPA 1C0KA 1GOTA 1W9HA 1ZVMA 2J08A 3TMKA 4RULA 1XDSA 4QVGA 4K1XA 1AUPA 3ZY3A 1BAPA 1UM8A 4GMHA 2FX2A 1I94B 1PYDA 2ZGVA 3BZBA 2BGIA 4Q3LA 5TQJA 1VKRA 3DKKA 2OSVA 5EKSA 3GJXC 2I3BA 3R1IA 1YFLA 5AW8A 1KI2A 4V24A 4Q4LA 3UA3A 3PGMA 1L7OA 5ENZA 1GCGA 1X3SA 1F0KA 1I7PA 2MT9A 4FD3A 3TE6A 4X6UA 4ENQA 5HQ3A 5C37A 2RHWA 2OV4A 4CEHA 1SHTX 1YVDA 3HY4A 2D5CA 5HZHA 3A4LA 4MYTA 2OOSA 4Z7OB 2EX0A 3GJ7A 4PC2A 3EBLA 4DYDA 4WY5A 4OKIA 3P9SA 3M4YA 2JLUA 1LTHR 3DM9B 1W76A 1S0UA 2B8WA 2I78A 2JARA 1Z6YA 4FR2A 3SNHA 4KU4A 2RGBA 3ZW9A 4BECA 2BEVA 5KI6A 2XZTA 2R85A 5IWCA 3LRTA 1KOLA 2AD1A 4MGYR 1LBSA 3TZBA 4C3ZA 3T4EA 2Q5CA 1VJRA 2NU6A 1Z82A 2C4VA 3X1WA 3L1JA 1XWIA 2JBHA 1TF7A 1ODLA 3G2LA 3A4NA 5EE1A 1UPBA 4BS9A 1KMHB 1QHEA 1TTQB 3P9QA 3FCOA 4IR7A 2FFAA 4HVCA 1NYTA 1HDXA 2J32A 2QGNA 4GKKB 5F33A 1YASA 4Z0PA 3U44B 3P0HA 1XDGA 2FDXA 1IY9A 3B2QA 5CIYA 5K1ZA 1R4NB 2I8LA 2JIOA 1QDEA 3OY2A 2X15A 2O0LA 3AILA 4M8LA 2Q1UA 2AJTA 2Z2XA 3OUTA 2PXXA 1FYFA 4PTLA 1HI9A 1ECLA 1C2YA 4DNOA 1M5TA 2H8GA 3QF4A 2PRIA 2ZG6A 4JNCA 3D9QX 2JKZA 3GFBA 2X5JO 3B78A 3O26A 5GONB 4LF5B 1NQWA 1KU0A 1P1BA 4W99A 4GOJA 4BNDB 1EUZA 1FFEA 4XVCA 1XNGA 3FNEA 2OSBA 1X1CA 1PWHA 1TK2A 1G41A 3UJCA 1IN4A 3WZMA 1TO6A 3CNOA 4UTVA 4DA0A 1TQ2A 1C41A 1I5RA 1PQPA 4XJSA 4PFJA 3VZBA 3PUZA 1E9AA 3T1OA 4XGKA 1RP7A 1Y89A 3H8WA 3OKAA 1S9HA 3MJCA 2ZJ6A 3QY0A 2FWIA 3CJQA 1U3VA 1Y82A 4U2EA 1FU8A 2C8KA 5IYZF 1E4OA 3I37X 4CI9A 4PSVA 5A4FS 3L0OA 3AHJA 3RV3A 1G8AA 2PWPA 1FDWA 4ENRA 4QSMA 3QKRA 1NF9A 3FB4A 4U7TB 2P5UA 3JQQA 3KQPA 5IAGA 3TRJA 4XYEA 4I2NA 1O6ZA 1Y34E 1WKBA 3HU3A 3OCZA 4DUPA 1JQ5A 2OHIA 4PFSA 5ALTA 3BTVA 1MC5A 4BKUA 4DE5A 2WSIA 3DMRA 2WE8A 3AB3A 3I1FA 2ZR9A 3AP3A 1NDQA 1QAQA 4MVJF 1CR0A 3BWXA 2W2KA 4RF3A 4WK0B 1AV6A 1XZMA 1QO0A 2R6R1 2ZJ8A 3UANA 4C6TA 5FWXA 4HYEA 2UZ4A 3D8UA 4IEIA 4TV9B 4RW0A 4E33A 1UBMS 2JIZA 2QXUA 1AS3A 4ZOQI 4ND1A 1IMOA 1K7SN 4W9NA 3LVFO 4HDAA 4V0LA 2XSZA 1UMCA 3C6QA 3OMLA 4RPCA 2AC7A 3V4ZA 2IZ1A 2WINI 4NY1A 1RPZA 1RC1A 4MWZA 1JLKA 1TCAA 1IZ0A 2X9QA 4UAGA 3RYCB 2OZEA 4RZ3A 4QUHA 5JWRA 1BTOA 1Y9JA 1A5BB 3UFXA 4CCYA 3PXXA 3U6KA 1CUYA 2VATA 2GBLC 2IYWA 2GETA 2J3MA 3MNFA 4GW3A 1USGA 4PX3A 3EGXA 3HEAA 4W63A 3B9BA 3UO8B 2AWNA 3BIOA 4RZ2A 3UWSA 3SZMA 4IOLA 3GLHE 1T6ZA 3IE1A 4D42A 4V0ME 2NQTA 2FE4A 1NKVA 3MUEA 4WFIA 1OFUX 4W5RA 1NW6A 1AB6A 2GX6A 1YRAA 2XECA 3VO8A 3E0XA 1SFRA 3IL2A 2WJ4A 2E5WA 2UVPA 5IDYA 1G3RA 2H5LA 3GLGA 1P62B 1B41A 1K66A 4EL5A 2AN5A 3LCCA 4JI8B 1QP8A 1ZY2A 3KVOA 4OAOA 1V37A 4OJMX 1XD8A 3LL4A 4EP1A 5KDOA 3SICE 3UK7A 1PG5A 1AQLA 2PZFA 2VDLB 3BA1A 4OBWA 4YT5A 5K6AA 3L6OO 3CZRA 3VHRA 1K86A 3E9QA 2BM0A 3EDOA 3ICCA 421PA 4M7WA 2BFCB 2H0RA 2PLNA 4X1IA 2DQZA 4JLWA 1L4FA 2QBYB 3BE4A 4Q05A 4FWBA 1TCUA 3NBQA 1FZTA 4M21A 5GM2A 4JDUA 4RESA 1XZQA 1HZZA 3AGQA 3G0CA 1F51E 3FUTA 5LNK6 2G1KA 3BIFA 1C9NA 4GKBA 3T12A 1T0BA 2Q3CA 1LKZA 1G9TA 3FKQA 4DQKA 3DD1A 1BS1A 2HJHA 1CEXA 1M1UA 2PLFA 3JTMA 1IJBA 1E9BA 1RXEA 2DPYA 2XF2A 4UHFA 5EQFA 2OM2A 1PD0A 1EEHA 3L7KA 1CNMA 2IEZA 3NIBA 2QZPA 3A3NA 4NI5A 1GRNA 1N1GA 2GLUA 3JY6A 4C7JA 2QR5A 2FN7A 3L7OA 3T9AA 3H5TA 2GYUA 1U0EA 1P44A 3K1TA 4ZVPA 2CNLA 1RACA 2BGRA 4CMIA 1SKMA 3NO4A 1CETA 1XDWA 4I81A 4W8OA 1EWKA 1SKAA 2CVHA 2VJYA 3F9IA 5T57A 1Z5PA 4B1FA 4MO2A 2H1WA 3GLHB 4BRWA 3GT7A 4H3SA 1C4XA 4M0FA 2PV0A 1C0PA 3E6AA 4N76A 4OHRA 4H3KB 4BO2A 4ZO6A 1W29A 1KBQA 3E3AA 2CN1A 2W2LD 1VL5A 3C3EA 3DL7A 3AESB 3INYA 1T8YA 4P83A 1Q0UA 1XU4A 2YYSA 4Q18A 1SZPA 2EZ4A 3AL3A 3WIVA 4DJEC 1EI9A 4ZWNA 2RGXA 1A2KC 1XPJA 3IR6A 2PNJA 1JR6A 1BYUA 2X2PA 2FKNA 2FE1A 4RLQA 4AURA 1ORIA 2NP6A 2AYZA 5JRJA 2ZB8A 5IRCD 1E63A 1A7JA 2VAVA 3P2KA 5CDHA 2JK0A 1RWKA 4BBPA 4YO7A 4IDAA 4L9SA 1CUFA 4P58A 5FBVB 1B8OA 1FA9A 1NQUA 3TVDA 5P21A 4BN4A 3NETA 2AXNA 1G66A 2FPMA 2V8BA 3MWKA 4L4XA 4JC8A 2CV1A 4CLRA 5HR5A 3UUEA 1M6NA 5KSWB 5K01A 2JZNA 3PHGA 3V7FA 5FUQA 1L5HB 2DOKA 3U3JA 1OBFO 3RU9A 4IDEA 4DLBA 1FFDA 1KZ6A 3HSSA 2D1YA 1ETUA 4IJKA 1SKYE 1O58A 2J3DA 2XQKA 5LFAA 1Z26A 1KR2A 1R9GA 4ZOLF 4MKZA 2V1UA 3O2JA 2Q4TA 2XGGA 3WMRA 5EERA 4XUDA 3TE7A 4CHTA 3QITA 2XE8A 4DG5A 1P33A 3MQFA 1JB9A 4YAJA 3U1TA 4FZ3A 3LDUA 4ENPA 2OG1A 2WUFA 4DMCA 3O8RA 4Z4FA 2O50A 4G85A 3TKAA 5I7FA 1N33B 1QFYA 3UN1A 1AN0A 2PJRA 2QNRA 4OUDB 3I9KA 1TJYA 4NZNA 5LBUA 3C6MA 4RQUA 4YGYA 2TMYA 4ZJPA 4ZZ1A 5JNWA 3ABIA 2O57A 1RHMA 2FLKA 4TL9A 3IJRA 3QFTA 1QM5A 4IYRA 5F1OA 1CLEA 1CZNA 3NOOA 2XE6A 4Y2YA 1ZN7A 3CRRA 4IYJA 4K87A 3FKJA 1I7SB 3ZI0A 1E5VA 1WVIA 3FPHA 4OVKA 3GFRA 1QGUA 1V8PA 1V48A 3AKYA 3QUQA 4EAQA 4MW0A 4G09A 1DRWA 1V8FA 1ZJZA 5I6DA 3KNZA 3PHLA 5JNTA 4E32A 3N8KA 4W5WA 2PX6A 4PRKA 1QV6A 3FCAA 3W0LB 2GF9A 2AJCA 1EJBA 2IPLA 2V7VA 4GUAA 1JYFA 5J1TB 3AUXA 4R9UC 2VNKA 1OX4A 3KOOA 3MWJA 3PL5A 4L28A 2O2ZA 3B7GA 3TTWA 1V7CA 2VK1A 3ZTWA 3T5AA 1XXHB 9GPBA 5NLLA 2IUTA 3QUTA 2CB9A 2X76A 2W37A 3PNPA 1DDOA 4KNVA 1VA4A 2RFLA 4MRMA 1KSJA 1VP9A 4M0EA 5JQGF 3ZJUA 2BISA 2QX7A 5LDDC 2C4WA 5DN6A 3RH0A 1WOYA 1G6Q1 1LNQA 4ALMA 5JSUA 2O8FA 3RWBA 4XAQA 4L0QA 1X3LA 3B85A 3D4LA 3QEKA 4V0MA 4CKWB 4N41A 4H9GA 4LBVA 1JUDA 3Q7EA 1F06A 1R15A 1WCV1 4XASA 1JKIA 1YJAA 2R97A 4FXPA 5K8TA 1PJQA 3AF3A 3P0IA 1W1UA 2EBUA 3QELB 3MN1A 4KQ9A 4ALKA 4P4UA 1TQ6A 5CHYA 5BR8B 2R79A 3JZFA 3NYRA 1M2JA 5FNVA 5BT8A 3WJ1A 2H9IA 3T9FA 4J9VA 4F4JA 2QU7A 4YWJA 3VSCA 2ZANA 3A8TA 2OGZA 1UOPA 1IJEA 1E9EA 1N75A 4NEHB 4MV1A 2IKSA 4CL8A 4EY3A 1FNMA 4C4RA 3VKFA 1W85A 2NSLA 3K4HA 3MQ2A 4PV7A 4L9RA 2GK7A 4RSRA 5IABA 4XVUA 3WICA 5KTYA 2E4ZA 2JCXA 4OJYA 4M7RA 2X77A 3K3PA 1VPLA 3IEUA 1TM1E 5JS2A 4RSMA 5JH7F 2H92A 1RXUA 2AZMA 4EG7A 2W6NA 4HFMA 1ZINA 3UGKA 1Q22A 1LEHA 4REQB 3T15A 5JASA 2JS7A 2OCYC 3HWWA 4S1OA 3WGLA 1V7ZA 3NBZC 4Q4DA 2X4GA 3I9LA 2ZUTA 4LDNA 1E1QD 6REQA 5JWOA 3GFSA 2NYVA 5IVKA 2D54A 2JLRA 3D2BA 4PYNA 2ZDHA 5JT1A 2WUWE 3AO0B 1PJ3A 3ACBA 4MB6A 2XKKA 1LRKA 2G9RA 1L4NA 2Q5EA 4AY4A 4F56A 3UMSA 4MMYB 2Y92A 5AW7A 4XGNA 4YTEA 3PXDA 4S2EA 3U31A 3B3QA 5G4KA 4Z49A 5SZHB 1T0IA 4DY4A 3IH5A 2SECE 5MN4A 1DPGA 2LP4Y 4J6EA 3G9XA 5FR2A 4L76A 3UJ3X 4PG8A 5EJ6A 4BCBA 2Q3MA 1C1DA 4C5CA 4PAOA 4RCZA 2UZ1B 1B1CA 4B6EA 1X7WA 1R88A 2BKUA 4NZYA 1TAGA 2C7RA 4J2TA 3D81A 2KJQA 5FL7A 4R98A 4L0DA 1YZQA 3OA0A 1XN1A 3I2IA 2RHTA 3EVAA 3I9OA 1GU1A 4GEGA 3RANA 5BR1A 2ZR0A 5ALWA 1PNTA 2FJPA 4AN0A 3KSDO 1JDSA 1H5UA 1VG9B 2GA9A 4WUVA 2B37A 3O93A 4HEA6 1Z4KA 5IVHA 5EE5B 2H1LA 3UJDA 2XLBA 3C3BA 3PNBA 1JN0A 3JX9A 2WP0A 4K6KA 5K0NA 4P84A 2AJLI 2YKGA 4JJEA 5KNDA 3KO8A 1I6WA 4XGRA 1CW2B 1ECFA 4D92A 4KBFA 2I6UA 3OH8A 4EGCB 1OB2A 2RDMA 1UKBA 4DLPA 2IC5A 1YKSA 2DQYA 4B4KA 1SQSA 3JQ7A 3VR3D 1IPHA 1CVLA 2OFXA 3OZ7A 3WFIA 2WF6A 3I6IA 4PZYA 4TMFA 2FU5C 1KGSA 1X7ZB 3O4IA 5HYVA 4AJOA 1QRTA 1MORA 1NE7A 3PDWA 1Z18A 3UB3A 2G06A 1UJ4A 4G86A 2AFHB 4YCNA 1TIPA 2XQFA 3Q0IA 2CFIA 4X6LA 5F9MA 1P7PA 3UENA 1YA8A 4TL6A 4CLEA 1J42A 2ID8A 4Y6LA 3T4XA 4IDDA 1BN6A 1I4EB 4ZIRA 3G6KA 3QUBA 3EVBA 3VHXA 2GD0A 1PEAA 2FPRA 4X1YB 3SE0A 3SXUA 5KYUB 5FWNA 4MJLA 1YAHA 2NZWA 2F67A 4JKYA 3AVYA 3ZQJA 4O2AF 2VHCA 4CV1A 4RY8A 5B30A 1BMTA 3AZPA 1SWVA 1PR1A 2OB1A 3ABRB 3UEOA 1QQ7A 4AU1A 3INRA 5LQRA 5IKXA 3SNKA 5FTKA 5EZSA 4BXOA 2WA2A 1P61B 3ZY6A 2QUKA 1M5RA 3L7YA 4FR5A 2ZUDA 3AFGA 3K9HA 1DTSA 5I9MA 1QIIA 4R16A 1HL7A 4KLRA 2E37A 4P0TA 4D3XA 1CY2A 1QQBA 2ZRCA 4Q9IA 1E79D 2N3ZA 5I7RA 2Z6UA 3D0KA 4A92A 3HVRA 1D2HA 1RYNA 1CP3A 3CKMA 3QHAA 3QK7A 5ALPA 4GI2A 3E7PA 3PKIA 1VG1A 2HREA 3HDGA 1O6BA 2AYXA 4EJMA 5HRCA 3RU3A 4HDKA 1GWNA 1JECA 3PZBA 4FMDB 5BQ3A 2GH1A 3I12A 3VKHA 1QFSA 3V8PA 3IUPA 1TZKA 2M6SA 2ZP1A 1E2LA 1PTJC 2L82A 1I80A 3CX8A 3DZDA 4C4AA 2QD4A 4MGIR 5L51A 3GPLA 3EVDA 1PLJA 1YUBA 3O83A 3L8YA 2MYPA 2EDAA 4MARA 1GQRA 2YWDA 5B36A 1F9AA 1SBNE 2XEXA 1QHFA 1MAVA 1S9DA 3P9ZA 4GOKA 1GR0A 1X7HA 1Z4OA 3V2GA 4BMOB 3TLCA 4RIHA 2VDUE 2X22A 3GC6A 1XTIA 3O47A 4M89A 4DA7A 1I9CA 4U7HA 3H3JA 3Q72A 3OQIA 3ICVA 2X5OA 3RYHB 5I8WA 4Z2AA 1ZKDA 4HQRA 5CA0F 3FYDA 1VMEA 2PZGA 3AV0B 3WDKA 2PXCA 1RPNA 4YQEA 3AF1A 4CDNA 1VE1A 1GUBA 1A4RA 1HLDA 5I9NA 1GNRA 1MH1A 4YR9A 3NHPA 2ZBPA 2ZKLA 3OEHD 5FOSA 1YULA 2QUJA 4IH9A 1I10A 1FNDA 2C99A 4MWDA 1CF4A 4IOJA 1NF3A 1YS4A 1IN6A 3NRJA 3ILHA 4HEJA 1BS2A 4M86A 2CT8A 2E4YA 4E6PA 2J87A 3EQ6A 3LK6A 3JTEA 3RS4A 2ZI3A 3BH7A 5FI1B 5IJ9A 2H65A 1ZVJA 3WKBA 4DZRA 1HQDA 4ND5A 2O8VA 4UCWA 3PX7A 2OESA 2PAAA 1BJRE 2QMEA 2PH7A 2ZXEA 3E84A 3VYSB 5CA1B 5L4LA 3MC1A 3F5FA 1DJOA 2NW6A 3BVPA 4MZDA 2DT5A 4QSHA 4F5ZA 3MWEB 2OQVA 4D26A 5C8YA 3VDXA 4AD8A 5IK2A 1OWOA 2A3NA 1T4BA 5JJCA 2XEDA 1SELA 1W93A 2W2XA 5KB3A 1VKJA 1GTJ1 3VPHA 2EARA 1XTVA 1YZNA 4R81A 7AT1A 5LP6A 3OQ6A 4XJTA 2PFKA 3VDQA 4CFZA 3EC1A 3IYLW 1HKUA 5AK5A 2I71A 2ZSBA 3L7CA 4BZWA 1NOKA 2J48A 1KE1A 4ZJYA 1TQDA 4OFWA 3ZHOA 2B69A 4XDYA 5FF9A 2I33A 1E6UA 4H15A 4H59A 2K7FA 3CS3A 2ZYRA 2FK8A 4XTCS 3VU9B 5ABPA 3K1YA 1N25A 3OCJA 1YDWA 2F64A 1ZN8A 5EEHA 2ARKA 3OF3A 5TARA 3CNHA 2BFWA 2F3UA 1GGHA 2CVQA 3IVRA 3L7DA 4NYIR 4R0VA 4Y2QA 3P2MA 2RAFA 4KB5A 5DGHA 4JUFA 5J5CA 3ZHCA 4AROA 4CM3A 5BXYA 4QPDA 3MGAA 1ORDA 2HJ9A 5HS4A 2QOEA 5ESRA 2Z5VA 5CEEA 5LL6P 4UHHA 1DZ3A 1M2EA 1TZBA 3U81A 2BFAA 3AFNA 3WIBA 1XKTA 3KBBA 3OJOA 4S0XA 4QRDA 4M0KA 4BP8A 4TKVB 3ZHTA 4D4MA 4MWBA 3N86A 1X8XA 3THXA 2FZVA 4BVHA 5IG2A 4AZ3B 1RRGA 1WCWA 5FV4A 4I50F 3THYA 1KZ7B 4Z1OA 2RK6A 1C7JA 3NIGB 1Q95A 1SVOA 4MV9A 5KJEA 2NUBA 3KVVA 5EPUA 4AO6A 4QQKA 2OO3A 5LJLA 4QOGA 4B7XA 1HURA 1Y37A 2VFAA 3KK0A 3SR0A 4M0MA 1YT5A 1KJ9A 4Q1VA 2Y2UA 3H2BA 2ODTX 4MINA 1G20A 4KSBA 3FWPA 3TL6A 3VR6D 1JXMA 4BO7A 4KGXA 3K9FC 3CR7A 1Z0KA 5DIFA 2JG3A 5DTIA 5BW4A 4RS3A 3JRNA 3OE7D 1RYEA 2BD0A 2P79A 1JIUA 5BYJA 1HE3A 4EH1A 5C46F 1IEVA 1Y81A 5EXDA 5C8DA 1JKMA 5IUNC 3G2QA 5A0VA 4IEFB 3TDNA 4C4SA 4DG9A 2X13A 1C4WA 1XT6A 4BQEA 3H5WA 1CJSA 2MWMA 4WGFA 4OJKA 4XSVA 3MMZA 1G5QA 1HFKA 3NKLA 4D4IA 1P80A 4X8MA 3VDNB 1OGYA 1UKYA 4A8JC 1KBOA 1A97A 4DARA 2PR2A 4F3YA 5JV5A 2PVPA 4AL4A 3SK0A 1X7XB 1OIXA 1SXPA 2IHTA 2N47A 1GKIA 1PYOA 3CE6A 1K5GA 3WGMA 1NF8A 1A4XA 3F3SA 2VBIA 4U2FA 5JLJA 4PZAA 4ZOLB 1ZIXA 1CS0A 1UOOA 3H2GA 3E9NA 2P3QA 3HUUA 1QKIA 1ESNA 1Y98A 3N58A 1E58A 5TE9A 2HMUA 3T61A 2YOFA 1FNNA 1T0JB 1KEUA 2P6NA 5A3JA 1LX6A 2JLBA 3ZDDA 4ARBA 4TKZA 7REQA 1L8OA 3HUEA 3GVIA 3FPKA 3NAQA 5REQB 4R01A 4QFBA 3TD2A 1WV1A 1M8PA 2DKNA 3A1WA 4Q9KA 4E12A 3HJHA 3HR8A 3KHTA 3Q3HA 4FB4A 1Y3BE 1DKLA 2XTNA 4X7RA 1DAMA 4Z5XA 3HWX1 3OPYI 3LP5A 2OBBA 4ZT3A 5BORA 1F7UA 4LWPA 2VZ9A 4FWIB 1K5DA 3ER6A 3GIWA 2EP5A 4F4CA 1LS6A 3CUYA 3X1XA 2Q7DA 1JR2A 3RIEA 2FEWB 3D0QA 4B6JA 1ETHA 4HYTA 1ACJA 4G5YA 4JB3A 2AEFA 2PL1A 2GPAA 1E8MA 2Q3LA 4CR7A 3W77A 3LH5A 3EFOB 1QF6A 2O8DA 3AX6A 1WVGA 5JROA 2IIPA 2P2YA 1VB3A 1V96A 4YJ3A 4RD0A 1PR4A 3K2EA 2XCOA 5CGQB 5JC1A 4TN1A 3BK1A 3C4JA 5FOTA 3NBUA 1GR1A 5JJBA 1KTIA 4EHHA 1JALA 2JAWA 2RHDA 4YP5A 5B2FA 2J7KA 1NVVQ 1AY0A 3NV7A 4HH1A 1G2OA 4MA5A 5JY1A 1P74A 2QNIA 3BC1A 4AWXA 4DUGD 4NR0A 4RFSB 1K6IA 2IXTA 1Z4JA 3SBEA 4KITB 2D13A 2DR2A 4A6DA 3RGGA 4C05A 3QYJA 4MVYA 5BYAA 1RTKA 3TF5A 1JPVA 2QMQA 3K94A 5JLAA 3A6FA 2DF8A 3NH9A 4V39A 4AJKA 1C3OA 3JD2A 4HZGA 1AZTA 4QLOA 2AS0A 2BLLA 2WNSA 3GJ8A 3I72A 4R2IA 5K8IA 4TWBA 1APBA 3HTXA 1C7FA 1J8FA 4C0KA 2RKBA 1NHWA 1R0BA 3F6YA 1BX3A 1ZMTA 3O2QB 3F2IA 3OLZA 4OH7A 2FW6A 2ZBFA 4JB2A 3NBFA 3KT8A 4MA4A 4MYDA 3D2AA 4OXXA 1L8QA 3P9YA 4CKZA 3U49A 4HOYA 1TMYA 3O38A 3GPIA 1O5IA 2AVDA 1QH1A 2WYHA 4HZUA 4ZKEA 4B71A 2XXAA 5TQ0A 1CY7A 4RJJA 2JIQA 3UF0A 4EMUA 4LA4A 4LX0A 3ELUA 3W2EA 5ADUS 5IAKA 1KU6A 4JXJA 4DR4B 4ZYVA 2IHUA 3A1DA 5C51B 2NU8A 1QHYA 2GFHA 3KKNA 2JF0A 2G40A 2LDBA 5MN6A 3ICEA 3H9UA 3IHTA 2PE5A 3W5BA 4OHVA 4PCVA 4DM7A 5JXIA