2CF5A

Crystal structures of the arabidopsis cinnamyl alcohol dehydrogenases, atcad5
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
352
structure length
352
Chain Sequence
AERKTTGWAARDPSGILSPYTYTLRETGPEDVNIRIICCGICHTDLHQTKNDLGMSNYPMVPGHEVVGEVVEVGSDVSKFTVGDIVGVGCLVGCCGGCSPCERDLEQYCPKKIWSYNDVYINGQPTQGGFAKATVVHQKFVVKIPEGMAVEQAAPLLCAGVTVYSPLSHFGLKQPGLRGGILGLGGVGHMGVKIAKAMGHHVTVISSSNKKREEALQDLGADDYVIGSDQAKMSELADSLDYVIDTVPVHHALEPYLSLLKLDGKLILMGVINNPLQFLTPLLMLGRKVITGSFIGSMKETEEMLEFCKEKGLSSIIEVVKMDYVNTAFERLEKNDVRYRFVVDVEGSNLDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CINNAMYL ALCOHOL DEHYDROGENASE
publication title Crystal Structures and Catalytic Mechanisms of the Arabidopsis Cinnamyl Alcohol Dehydrogenases Atcad5 and Atcad4
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Oxidoreductase
total genus 90
structure length 352
sequence length 352
ec nomenclature ec 1.1.1.195: Cinnamyl-alcohol dehydrogenase.
pdb deposition date 2006-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2cf5A02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2cf5A01
1BXKA 2Z95A 3ZGYA 4BO3A 4UUMA 4E5PA 1DEHA 4B7UA 4IJWA 1N1EA 1C1XB 4ITUA 2FSSA 4D3SA 3ZI0A 4AFNA 2JKVA 5A5FA 1P0FA 4PZCA 3PHIA 5CFZA 2IDZA 3PGJA 3C1TA 1UJMA 3OA2A 1MG0A 2DBZA 2AE2A 4R9SA 2PGJA 1ENPA 4YJHA 4CR8A 1N92A 4CMEA 2IYOA 3AY6A 2V6MA 4G2NA 1IPEA 4QTZA 3T4EA 4HUJA 1VI2A 1ISHA 2RIRA 4EUHA 2X5KO 3OQBA 4WUVA 4BHTA 4XIJA 4JX8A 2JAHA 2QRLA 3VOSA 3K2EA 4J9UE 2AA3A 3K30A 4XJTA 3RC9A 4J2HA 2EF1A 3WMWA 3KO8A 5TIIA 1GV1A 4DQVA 3FI9A 4TKMA 4YQZA 2YV2A 4XD2A 1WAMA 2B4QA 1N7HA 1PZHA 2OMEA 4EDFA 4IDAA 4R3NA 1HZJA 1N5DA 2J8ZA 5L4SA 4OKIA 1LC0A 2VYND 4MP3A 1A9YA 1O0SA 4GBJA 1R15A 3STHA 4RQTA 5T57A 4RQUA 4XR9A 4CMKA 2DBVO 4HP8A 4I9HA 3JQ9C 4OQYA 1NBOA 2QRJA 1NPDA 4I5FA 4BKRA 1DLIA 3UVEA 5BNTA 3BMOA 4YA6A 3V8BA 1X14A 1LSSA 3VKUA 4O59O 1NHGA 5DBGA 1OFGA 3H9QA 1E3SA 1V9LA 1WW8A 4L74A 4NIMA 4RORA 1NPYA 4JNKA 4KOAA 1I3LA 2C5EA 3GY0A 3LLVA 4QX6A 1E77A 3P2YA 4R9RA 4AJJA 3ZW8A 1E7QA 2X5JO 2O3TA 3AUUA 4IJKA 3B1FA 3RFXA 1SCUA 4HX5A 2GRAA 1P31A 2J3IA 4ZQEA 4B7XA 3DBLA 3PYLA 2EW2A 1B8UA 1D7OA 1NXQA 3QHAA 2P5UA 4RO0A 2GF2A 3WOHA 1YQGA 1F8GA 4E5MA 4UVIA 1Q7CA 1I3MA 4N18A 4IMPA 4A0SA 4CLRB 2R2GA 3RUDA 1EFKA 3W6UA 2HDHA 3ZV6A 5CG1A 3WICA 1K6JA 2IXAA 1Y5RA 4CPDA 4LMPA 5JCXA 5L7YA 2GPTA 2D2IA 3KSZO 1X7DA 4IM7A 3WMXA 2IZZA 3I4FA 3ZV4A 3ADOA 1P77A 5T64A 1GUFA 3I23A 5DCUA 4TRNA 1SB9A 5ITWA 5JDCA 3HN7A 2W4QA 2ZQYA 4OYRA 1VM6A 4I5DA 2WSBA 3MJTA 3Q0EA 4P22A 4CV2A 3F1KA 3ETEA 2X0JA 3LLSA 3FTPA 3OP4A 1QG6A 2RAFA 3RFVA 3UN1A 5CG2A 4RLHA 1DFGA 2PNFA 4M87A 3U62A 5G4LA 1UXKA 1DRWA 1WDKA 5KJCA 1LX6A 4RVDA 1Z6ZA 2X4GA 4ALIA 4K26A 2EJWA 3GR6A 3WX0A 3GDFA 1MGOA 1P1FA 3ETDA 3DEYX 1NR7A 4BNLA 4Z3DA 1HE4A 4K6FA 4XR4A 1E7SA 4WCFC 2RHRA 4ND2A 5TT1A 3VPXA 1I3NA 5ILOA 2GASA 1GFSA 4MKXA 3WJ7A 3AUSA 3GOHA 3D4NA 2VRCA 4YAGA 1PJLA 4AJNA 3AI1A 3HDYA 4FC6A 3AM5A 4YWJA 5COBA 2D5CA 3DMTC 4O6VA 4CV3A 1E5QA 2RH8A 3JYNA 3C7CB 5H82A 4DLBA 4EUEA 4GGOA 1EK5A 3HUDA 2W98A 4DA9A 1WPQA 5U1PA 4OQZA 4LISA 4BGEA 3MJSA 2PGLA 4L0QA 2YFQA 4BNXA 1YO6A 1YOVA 4BO8A 1R4MB 3UHAA 4D41A 4C7KA 4Z6KA 5F3RA 3KYDA 3S2IA 1UZMA 1Y6JA 3I6IA 1N9GA 4CM9A 2PZJA 3NTQA 4IDCA 1AHIA 5KJFA 4CMCA 3PQFA 1TEHA 3HDJA 3KV3O 1Q1NA 2ZCVA 5IG2A 1BXGA 3JQFC 4R5MA 4ZD6A 1BTOA 3ZU5A 3NJ4A 3UFXA 1ENYA 3A28A 2X7HA 4Q3AA 3RASA 1T2EA 3GNTA 1P1JA 1LQTA 3NAQA 1XSEA 2WD7B 2Y99A 1HSZA 1XU9A 3VKVA 2W8ZA 3SVTA 1PR9A 2LDBA 4D0RA 3EVTA 5C3MA 1VL0A 2NVUB 5G0UA 2EGGA 3DO5A 3D7LA 4MVJA 3O8QA 4BO5A 3U5TA 2SCUA 3CH6A 5T8KC 4D45A 4RF5A 3GRKA 1CEQA 3EC7A 4Q3BA 2V6FA 4BB6A 1UXIA 2NU8A 3ENNA 2ZB3A 1TT5B 1P1IA 5FI3A 1LEHA 3D4PA 1SAYA 1E3EA 1LU9A 1A4UA 4GKBA 2OO5A 2EWMA 3G1UA 3BHMA 3PIIA 3VH3A 3VZRA 5I7EA 2HAEA 4AICA 2EG9A 4CQMA 4GWKA 5JXWA 4FJ0A 5U4QA 1QKIA 3VPHA 3BTUA 1NVGA 3GG2A 4U6SA 2DU8A 3PP8A 3GVCA 4YEDA 2BRUA 1LLQA 3QP9A 4RPGA 1SPXA 3GC6A 1ISGA 4DIBA 2B0JA 3OMLA 1P44A 3FPCA 1LDGA 3ZN2A 2XF8A 4R1SA 4CQLB 4DMLA 2I99A 4BS9A 4RJTA 1T2AA 4N7RA 5JAIA 2ZYAA 3D4OA 2NADA 4LSWA 5THKA 5JMWA 3QWIA 4BNNA 1I36A 5T5QA 3IUSA 3CE6A 1Q0HA 3KOUA 3FNFA 4H3VA 4ALJA 1JAXA 4GH5A 3EW7A 4XYBA 3V1TC 1KVSA 1E0DA 3IKTA 4HNGA 2EP7A 1E1LA 2JL1A 2O50A 2YYYA 3QW2A 4CM5A 4URFA 1LQUA 5KVSA 5THQA 2DPGA 3FRJA 2PD4A 3IAHA 5JDIC 3I9LA 1MG5A 2O3RA 1OMOA 1Y8RA 1Z7EA 2XPCA 4EW6A 2GLXA 1Z82A 4U5QA 3TZHA 2GSDA 2VNAA 4CLHA 4HBGA 4I8XA 3E03A 3V5NA 3LQFA 3WGGA 1EUDA 2IZ0A 3PQDA 3CMMA 4CMAA 1FDSA 4R01A 1Y7TA 4WOJA 5TGDA 3WWYA 1A7KA 5JMPA 1E6EA 1HTBA 2I5PO 3GEMA 3TL2A 4Z9YA 1WDMA 5F1OA 5EINA 1ZZEA 1UP4A 1WXDA 2I6TA 2OXIA 1TVEA 4OHUA 1XR3A 1MFZA 2WD8A 2FWMX 1D1SA 3JYPA 3DBHA 4DL9A 4ZICA 4D43A 4A27A 4BNZA 4UUOA 4E30A 4KWIA 1H2BA 1GQYA 1LSJA 5LDGA 3KEQA 4OOFA 4IMRA 1SC6A 4OKNA 4ALMA 4PLHA 3TN7A 2IEBA 1YS4A 5H81A 4WK6A 5DOVA 3UAGA 2ZTVA 3FR8A 1B15A 4HFJA 2EW8A 4E3ZA 4GL4A 4NJMB 1SEVA 1D3AA 4FFPA 3TZKA 2WE8A 3TZQA 4D3FA 1TT7A 4YBZA 1ORRA 1EVZA 4ESOA 4MINA 1U3UA 1U3WA 3MEQA 3W6ZA 5A5EA 1EVJA 1RKXA 5B4VA 5ES3A 3V2HA 4LGVA 1W73A 1LDYA 2A35A 5DF1A 3VH1A 4CM8B 4L76A 3H3FA 2VHZA 2X23A 1Y8QA 3PXXA 3F9IA 2B5WA 5G4KB 1FDVA 4YQYA 2X9VA 7MDHA 1JVSA 4PG8A 4CM4A 4WLVA 3DOJA 3U4IA 4TVBA 1M67A 4ZJUA 4W4TA 1LDMA 1DHRA 3JYQA 2OOSA 5ICSA 1U5CA 2JAPA 4WLOA 4XZ3A 3U49A 1W0CA 5CPFA 2EV9A 3PJFA 3IS3A 3ITKA 1FDUA 4XB1A 5I9MA 5IN4A 1ZEJA 2GZ3A 3DXFA 3IDSA 1T26A 2O3SA 2PWZA 1LJ8A 1PR3A 1DJNA 4NBWA 5DN9A 4YCAA 5H83A 3FWNA 5KKCA 5GZ3A 3JQEA 4PCVA 4EBFA 5JBIA 1QYDA 1CF2O 1GDHA 3VZSA 3I1JA 4D7AA 3WG9A 1P33A 2XXBA 2Y1FA 3P19A 1D1TA 2BMAA 4H15A 5HS4A 4DIFA 1VL6A 5KCZA 3AI3A 3JYOA 2QIOA 1J49A 1Y81A 3MWDB 4UAGA 2RCYA 3RUHA 4NBVA 3BAZA 2P9EA 3C3XA 3VVCA 4BO6A 3SBOA 3TRIA 3PRJA 3FWZA 1XA0A 2UVDA 1EVIA 4E2WA 1UR5A 4WE3A 4ZRNA 3U4CA 1DC3A 3EMKA 4UEJA 1JVBA 2I65A 3OICA 1XEAA 2D3TA 3JQ9A 4YAKA 1HETA 5L95A 2Q4EA 4FD3A 4J91A 4J9VA 3FR7A 4JGBA 4BO4A 2XOXA 4YXFA 5JC8A 1HRDA 3TL3A 3IJRA 3ZCXA 3MWEB 3RROA 1FJHA 1SB8A 5IZCC 3S1LA 1ZK4A 1U1IA 3PHLA 4IY1A 2H1SA 4PLTA 3H5NA 3R0IA 1P1KA 5CP8A 1DDOA 2P91A 2G82A 4XDZA 1JLLA 4E31A 5JAMA 4J90A 2IRWA 2X9NA 2UAGA 4BO7A 4YTEA 4PG6A 1UUFA 3VHRA 4QSMA 5JSFA 2F00A 4BL5A 3CUKA 4NG5A 1V0JA 1BWSA 4YDRA 5ILGA 4BO9A 2JD0A 3WGTA 2GERA 4KTTE 1YKFA 4EYEA 4WEOA 1PL7A 1PS0A 5ICMA 1UDAA 4YAEA 3NDJA 4RCVA 4BNTA 4N5LA 3PFFA 3P7MA 2Q4BA 2I67A 4INAA 3ZU2A 4CL8A 4YRBA 4FFMA 1EEHA 5IFLA 2J5KA 1HDGO 3PQEA 1PWZA 1J0XO 3W4KA 3RAJA 2TMGA 4AJ2A 5ER6A 2HMTA 3JQGA 2A9FA 3LT4A 3SC4A 2P4QA 5TLSA 4J3FA 4BB5A 4D0SA 4CUJA 1R4NA 1UAYA 5JCJA 2CNBA 4CR7A 4KDFA 4PGFA 3KSDO 2WM3A 3VZPA 3KB6A 1X0VA 4NI5A 1XLTA 3U09A 1IE3A 4MVJI 4CMIB 4JLWA 3ZHBA 3IKVA 4XKJA 3AUTA 5KWEA 4OJNA 3H2SA 5CEFA 4Y6PA 4WJZA 3UF0A 3DAPA 1KBZA 4MJLA 1ZH8A 5JYEA 5EERA 3N74A 3WBBA 3RQSA 4GVXA 4LK3A 5CDSA 4RLSA 3TF5A 1BGVA 4XQ9A 3D0OA 5DZSA 1JTVA 5TJHA 4PLFA 1C0IA 1PJBA 3BMQA 3ETGA 3TWOA 4WCFA 4R1NA 9LDBA 2DFDA 3MJCA 1WLYA 1X15A 1J6UA 2P4HX 2BGKA 2EXXA 2QQ5A 2VT3A 3RIHA 1ZXBA 3ONDA 3WGYA 4CM7A 3IMFA 2BGMA 3QA9A 3KBOA 4RPKA 2C5AA 1PQUA 2PZLA 5KIAA 1NTOA 1AN9A 3DMTA 3EUWA 1ZIDA 4W6ZA 2Q1WA 4IS2A 4ND4A 3PJGA 1IY8A 4FS3A 4FFOA 4Q39A 4GWGA 5I7SA 3AOGA 4R51A 1F12A 4GKVA 3W8EA 1YWGO 2HU2A 4X54A 3DOOA 2OUIA 2GN6A 1DIBA 1EUZA 1GQQA 4Z0PA 5IF3A 5TF4A 2C07A 4R16A 3OEYA 3I9KA 5CDGA 3AUAA 4MDHA 5BT9A 3ZU3A 1D4FA 4CLXA 3FTNA 2YJZA 4L8VA 1SNYA 3NT4A 1LLUA 2P9CA 3JQFA 4BOYA 5HBRA 4YACA 1E3WA 3GAFA 2EKPA 1M2WA 3VH2A 3GT0A 1XWFA 2C2XA 1HE5A 2W2LD 5CPBA 2O7SA 4K1LA 3CIFA 3JQ8B 4QUKA 2VHYA 3Q2IA 1EFLA 4O1MA 1X7GA 4IQ8A 3D3EA 3H5AA 5AYVA 1U8XX 4MPDA 1PJTA 4RPHA 3ZHZA 4B4UA 2WDZA 5T8KA 3INRA 3JQAD 4WLEA 4NR0A 1H93A 4A7PA 1MV8A 1RM5A 1NP3A 1FDWA 4M49A 1NVTA 3INTA 3ANMA 5DNAA 2P68A 1DC6A 4NH4A 3FCOA 5JAQA 3ZHYA 1G0OA 4YPOA 3E1KA 4FBGA 4LCJA 5BR7A 4XWYA 2FZEA 1AHHA 2PD6A 1YVEI 2OZPA 3IC5A 2AQ8A 2DC1A 1A71A 2IODA 1SO8A 2O2SA 3M6IA 1EQ2A 2DM6A 1CERA 3LC1O 3M2PA 4FGWA 4BO0A 4MIYA 5LDHA 1HL3A 1XQ1A 2VUUA 3KETA 2OBNA 3L6OO 1MLDA 1C14A 5IDYA 3JTMA 4EEZA 2YQ4A 3HZZA 1MX3A 3ANLA 3K2BA 2HSDA 2A92A 1PJCA 5ENDA 4LRTB 2GD1O 2BI8A 2X0NA 3GDOA 3H9JA 3Q2KA 1HF3A 1R0SA 4ZA2A 3I3OA 5CEEA 5L4LA 3OBBA 3AY7A 5EJ2A 1U7TA 1CIVA 3I6QA 2ZB4A 2A4KA 3I52A 5A9SB 1Z7BA 5A3JA 2CDAA 1E3IA 4BNMA 1KVTA 1O94A 2BFOA 3D3WA 3PIDA 1F14A 5CDYA 5IJZA 3V1YA 4GX2A 3QLJA 1UZNA 4OSPA 1K6XA 4XCVA 2VHXA 4CR6A 4ROSA 3IJPA 1N1GA 2BLLA 2VWHA 2ZB7A 2PKQP 1A27A 1SZJG 2EGHA 5JDIA 3JD2A 1U3VA 4ZRMA 1KYQA 2OP1A 4YT4A 3NT2A 1ML3A 4J1SA 5T6BA 3U4DA 3UOGA 5FYDA 1KIFA 3UICA 1B16A 1Y9AA 2YY7A 2DPHA 4YT8A 3S55A 1ADCA 4OO3A 2CVZA 3G17A 4LN1A 1A4IA 2QHXA 1HDZA 4KUGA 5BSEA 4XGIA 1LDNA 3QY9A 4TRMA 3LF1A 1ZEMA 4ALNA 3IP1A 2B35A 2NLOA 3DTYA 4ZGWA 1OBFO 1A5ZA 2G5CA 3SLKA 5C7LO 2FMUA 4DPMA 2X5OA 5KTKA 4FR5A 2VYVA 4ID9A 1EQUA 2HRZA 1U3TA 5I8WA 4PN3A 1RYDA 3B20A 2HUNA 2PTGA 5DBFA 5KVVA 5JAZA 5HA5A 1M66A 1TI7A 3JSAA 2EHDA 3M1LA 4ND3A 1GYRA 3WJAA 4EI2A 5HS6A 1E92A 1H0KA 1ZJYA 4XGKA 2D8AA 4OH1A 1NHWA 3RD5A 4HFRA 4DPLA 1BVRA 3D5QA 4N54A 3TPCA 1DAOA 1R12A 1X7HA 2DFVA 2OBYA 4XEHA 1GD1O 1TB4A 2IYPA 3ZWXA 4K28A 1R66A 4NJOA 4IDFA 2JHGA 4JXKA 4NMHA 4MVJE 3VPGA 1F06A 4DPKA 4K9DA 3NKLA 1PS8A 5DCYA 3AWDA 4GI2A 1Q0QA 3K31A 5JLAA 1N7GA 4AJHA 1H6BA 3O38A 1PSDA 1YONA 2PZMA 3WQSB 4BMNA 1P3DA 3GHYA 2NACA 3V2UA 2W2KA 1O9BA 3P5SA 2FY8A 4M1QA 4EJ0A 2HCTA 5JFOA 1E1NA 3CSDA 5I9NA 3U3XA 3O4RA 2WMDA 4UVEA 2VYVD 2V65A 1N8KA 4CODB 4EUFA 3QVTA 2OORA 1L7DA 1I10A 4RV9A 3WDSA 2DAPA 5KKAA 4G81A 2E49A 3AU8A 4WECA 2JFHA 4CM6A 1GL3A 1PGQA 4CMJA 1LA2A 3A1NA 4XB2A 1DC4A 3O9ZA 4I08A 3S2EA 1LSUA 3ZW9A 2UV8A 4E6PA 4FB5A 1B26A 4UEKA 3BMCB 4J4HA 3U0BA 3FNGA 1LSOA 3VH4A 4QFDA 3R3JA 1HKUA 4OM8A 5G0TA 4ZQHA 2VZ0A 2HMUA 1VC2A 2PV7A 3GMDA 4XDYA 3WGQA 2NTNA 5JY6A 2VWQA 1C1XA 1HYGA 4MIOA 1KEPA 4DBVO 5IDXA 4J7CA 4UREA 1XQ6A 3G0OA 2DTXA 3K92A 4OMUA 4B8WA 3AM3A 4KDEA 2ZTUA 2JCYA 4KZPA 4TZTA 4NBUA 4RZHA 2D0IA 5IXSA 3KYCB 3Q11A 4OSOA 3DBRB 2W90A 3L4SO 4CLOB 3OJFA 5BQFA 4YJGB 3HDHA 4HXYA 2ZTMA 4YJFB 2IZ1A 4WNIA 5EMHA 3FBGA 3CTMA 1FDTA 1PGOA 4Y8VA 3SJ7A 1FMCA 4LVUA 3GGPA 1CJCA 3RU7A 5IZCA 4YT2A 3AY3A 1NQTA 2JFGA 4FSHA 3RC2A 4UULA 4CM3A 1ONNA 2NTVA 1NAHA 4GX1A 1ZO8A 2J3HA 2D5AA 3FD8A 3E9QA 5ADHA 4CJXA 1SOWA 1DLJA 5FFFA 1HDXA 1P45A 3TFOA 3ZWAA 1QYWA 1B3RA 2GZ1A 1HE2A 2NU7A 4MP8A 4RDHA 1EDZA 3JD1A 2Q3EA 1QXSA 4PLVA 2FN7A 1R0KA 2VRCD 1NWCA 3OJLA 3FF4A 3JD3A 4QFCA 3W4IA 3MOIA 3M1AA 5KVCA 1T1SA 2I76A 1PL8A 4HFMA 4AVYA 1IHXA 1KVQA 3RJ5A 1UXHA 4NK4A 3SJUA 3E18A 3UKOA 1Q0LA 3G3EA 5K6AA 3BTSA 2BFMA 4E2YA 4OXNA 3VDRA 4YYZA 4FC7A 2Y0CA 2O3JA 5HM8A 3ADPA 5C7IO 3GZNB 3F47A 5BSFA 3H7AA 2PLAA 3ENKA 4W7IA 3GQVA 2DTDA 4CM9D 2IXBA 1BXZA 3WGHA 2AHRA 3UGKA 2BHLA 5JS6A 1DIRA 2I3AA 3O03A 3KLMX 2NVBA 3TOZA 4L73A 1AGNA 2B4TO 2VWGA 5J23A 5EESA 3SXPA 1EUCA 4CL3A 3WGZA 1DO8A 4Y6RA 3B6ZA 1PU2A 5COQA 3T7CA 4DMMA 4FDAA 1LLDA 2VHWA 3Q6IA 1MFPA 4TWRA 4CLRA 1C0KA 3BIOA 4J16A 5GZ1A 2EP5A 3DHYA 3QWAA 2VNSA 1IZ0A 1E6UA 1NX6A 4MVJM 4XA8A 5A3VA 4AJIA 3JQDA 3MJ4A 4MVJD 2X58A 3ROPA 3DZGA 3KUXA 2JFFA 1ZKMA 4UVDA 4HNHA 1NFRA 3EK2A 2X6TA 2CMDA 4Y98A 2EJVA 4IZHA 4Q3DA 4QXMA 3AM4A 4GPD1 4JBIA 4E13A 1KETA 4W99A 3L6EA 3BTOA 4MVJH 1U2GA 3R1IA 3UCEA 1I2BA 1MXHA 4D44A 3PHJA 1R6DA 4BVAA 3T7EA 5DT9A 2BD0A 5GMOA 3F1LA 4H7PA 4I1IA 1J5PA 1KEWA 3C1OA 3ICCA 3WNQA 3DZIA 4NNJA 1YGYA 2CY0A 4DYVA 4B8ZA 3BA1A 3MCVA 4E21A 3DC2A 4CQMD 2EEZA 4GLOA 4R1TA 4UUNA 3A14A 4F3YA 1G1AA 2Y1EA 4XIYA 4XRGA 4DQUA 3DZFA 3AK4A 1P0CA 3DONA 3HE3A 1W8DA 3DMYA 3JQ6A 4J0EA 4AJEA 4E33A 4TKLA 3VPFA 1E3JA 4PRKA 3HWRA 1HYEA 1I24A 2HK7A 3ABIA 1NQ5A 1U5AA 1TLTA 2YV3A 2Y68A 3RUCA 1QLHA 3HADA 5MGBA 2NWQA 3HN2A 2YW9A 3JQ7B 4IBOA 3FBTA 2YDXA 4GMGA 2GGSA 3JV7A 4RPLA 4ZHSA 3ZZNA 3GEDA 4WCDA 4Y9DA 3E5RA 1WVGA 1HSOA 4U6QA 3ASUA 4BO1A 2ZKLA 3QVXA 5T67A 2O3QA 1DHTA 4J1TA 3KSUA 4BV9A 1U9JA 1R37A 3ZWPA 5AQ1A 3SEFA 4R69A 3T4XA 1SEPA 1R4MA 3L77A 3OIFA 1FK8A 1SOVA 4DC0A 2WJPA 4EJ6A 1JAYA 3ZWMA 2CDBA 4P4LA 1PQWA 5JW6A 3MTJA 4RF2A 4UUPA 1GEEA 4WKGA 1NNUA 1XU7A 2Z5LA 2Y05A 1BW9B 2E6UX 2C7VA 3NDIA 5JPIA 1GZ3A 2VT2A 4BUCA 3EHEA 5ENVA 2YZ7A 2WD7A 2HK8A 3VTZA 1WZEA 2NU6A 3HB4X 1XGKA 2XXJA 3ZNNA 5HRUA 2NVUA 2ZQZA 1KC3A 5G0SA 1XHLA 5DOZA 3BMNB 3TNLA 1MUUA 3S2FA 4R3WA 1IL0A 4YVFA 4DVJA 1B8VA 4A26A 1O6ZA 4P4NA 5GZ6A 1HDCA 4E0BA 1GYPA 3OJEA 1MC4A 4QO8A 1TA4A 1TT5A 3BHIA 1IULA 1DB3A 5L45A 3LZ6A 4RF3A 4RL6A 1ISIA 3PZRA 3K8ZA 3COSA 2YFHA 2NTJA 2ZYDA 4IDGA 1OOEA 4LCEA 4B4VA 1ULSA 4BNUA 4WLNA 2B5VA 4AJ4A 3F4BA 5F5LA 4M54A 2ET6A 1TXGA 3JQAB 1MC5A 4CV1A 2CF5A 3GGOA 4BKPA 4M55A 8LDHA 1QV7A 2PZKA 3A9WA 4XRRA 3GVXA 3VC7A 1H6CA 2NNLD 3WIDA 2BELA 3NTOA 1C1DB 3I83A 1E7RA 1P1HA 2C54A 2VTEA 3NT5A 4HADA 4TZKA 4BGVA 3OA0A 4TRJA 3WYEA 5MDHA 1KERA 4HY3A 4UVHA 1K0UA 2YHIB 3MZ0A 1OI7A 3INGA 1I01A 2QRKA 1ONPA 4RF4A 1CRWG 2J5RA 1BG6A 1DFIA 2DUWA 4GAEA 4WLUA 1MA0A 1GAEO 5TRTA 1N2SA 2Q1TA 1QYCA 3AFMA 3GRPA 3WLEA 1U4SA 2X0RA 3PDUA 4LRSB 1M6WA 2X0IA 4YRAA 1YRLA 1C0PA 1YBAA 3CZRA 4U8GA 1YJ8A 4IINA 2H6EA 1KY4A 3RC7A 2AMFA 3WFIA 1U7HA 1ZCJA 4IUYA 3LF2A 1Q7GA 3TZ6A 2FZWA 4U0KA 5AXBA 3BXXA 1ZSVA 2DT5A 4IDBA 1E7MA 3PK0A 3ITDA 4IJVA 4Z0HO 1GUYA 3ZV3A 3ZWYA 4LMRA 4EEXA 1LRKA 1LUAA 3CPSA 4XJSA 4FOSA 1ID1A 3AW9A 3KRTA 2VUTA 4GVLA 4DXHA 4FJ2A 3IIEA 2I9PA 4Z9XA 1JKIA 1NQOA 4MIEA 4M89A 3G1TA 4FPXA 4R68A 3E48A 1PEDA 4IXTA 4CV0A 3NDRA 1OAAA 2ILTA 1Q2XA 4QEDA 1YB4A 3GEGA 2Y66A 5K6AC 4BIIA 3NV9A 3KEOA 1MP0A 3P2OA 4ONEA 4PVDA 3D1LA 1PJ3A 3V2GA 4ZQFA 1PZEA 3RU9A 1GADO 1ZMOA 2J6IA 4LW8A 1ZXLA 1ISFA 3AU9A 1I8TA 2XAAA 3GF4A 3GK3A 1T2DA 2C0CA 3WXBA 3AI2A 4YJHB 4PG7A 3LT0A 4I5EA 1G0NA 5AOVA 1VPDA 3PHGA 3ONEA 3ZWVA 3KM0A 2R00C 4P38A 4IGEA 4MOWA 2C29D 2NU9A 4W9NC 2YDYA 1PS9A 3ANNA 2CVQA 4G65A 4IIUA 1LRLA 1ISJA 1QSGA 2Q46A 2FHSA 2VWPA 3DZJA 3OJ0A 2QX7A 4RVHA 4CM8A 1LDEA 2P5YA 4YJDA 3DFZA 1ZK1A 4JQCA 4L75A 1E7YA 4MVJP 1UH5A 4M8SA 1BDMA 4WGGA 3RUFA 3RC1A 4J49A 5ER9A 1PTJA 3DFUA 2VCYA 5G4KA 1NPTO 3ST7A 2BH9A 2VOJA 3E9MA 5AXAA 4XGNA 3ZNPA 5CEJA 1T1RA 3VDQA 2NSDA 3UCFA 1U28A 3DZHA 4IQ0A 2AQIA 3GLQA 4KQXA 1PZFA 4QQRA 1UAGA 1NWHA 2QW8A 5A02A 2BI7A 5JCJD 5G2OA 3C85A 2QZ9A 1GCOA 3GN1A 2C59A 2V7PA 5EL0A 4L4SA 2GZ2A 4W82A 4JJFA 1UXJA 1FXSA 3BMOB 4L4XA 2CDCA 2NQ8A 3B1JA 4KUEA 3EVNA 4Z9FA 1V35A 2FSVA 2AW5A 4O63O 3RFTA 2B4RO 4F6CA 2PY6A 3RBVA 1EBFA 1WMBA 1A72A 3TOXA 4AJPA 3I9OA 4E4YA 2Y1OA 1QRRA 5EQFA 4W7HA 2AEJA 1NM5A 1J4AA 4Q3NA 2WE7A 3GN2A 2Q49A 3PFWO 2OFPA 5U9CA 4CUKA 2NQTA 3ROMA 1UDBA 3C8MA 2Q2VA 1OZAA 2D1YA 1B7GO 3DBLB 3VTFA 1GR0A 2NVWA 1WDLA 1H94A 1PX0A 4AJLA 1ENOA 3C1AA 3QVOA 3ZWOA 1YQXA 2VHVA 2HJRA 4WPGA 2DBRA 1RJWA 3WWZA 3NUGA 4Z3KA 3NGXA 4EGFA 2B83A 2EIHA 1IZ9A 4LVCA 1NR1A 1PJQA 5B4UA 3OJOA 4ZU3A 4IZIA 5FEUA 3QWHA 5COAA 1VJ0A 2C7GA 5K1SA 3S2GA 4A03A 3OIDA 1JW9B 3LK7A 3TDKA 2PGDA 4J2OA 1HYHA 1LXCA 2HMWA 4HV4A 4BKUA 5F21A 4GSLA 1ZMTA 3PWKA 1ZSYA 4PG4A 3PDJA 3OETA 3QSGA 3F3SA 4JP3A 3VZQA 3EGOA 3GGGA 3O26A 4U0JA 2ZATA 1IUKA 1FF9A 4XQEA 4B3HA 3ROKA 1SMKA 1RM4A 1Y9EA 5EPOA 1UZLA 1VKNA 2ZCUA 4GQAA 1GCUA 2AEMA 3GAZA 3NRCA 1B3BA 4MVJG 4R41A 1W4ZA 3PLRA 3LDHA 1PQPA 4K6CA 2GN4A 4YB8A 1NFFA 5BSGA 1DAPA 1V8BA 2IEDA 5KNLA 1EBUA 4DWVA 2CFCA 3OH8A 3GG9A 2BF7A 3F5QA 2Y93A 2VYNA 1XIVA 4J43A 3HQ4O 2C20A 1H6AA 2Y67A 4C7JA 3BZUA 4RGBA 2AXQA 4PVCA 3H8VA 3NGLA 3TQHA 3UH1A 1Z75A 5A1TA 2ZK7A 4O5OA 4ND5A 5KJEA 2X9GA 4D79A 3FNHA 4E12A 2GNAA 1H6DA 5A05A 4YAJA 1R0LA 1K5HA 3PI7A 1K6IA 1ZJZA 2BGLA 3CEAA 4QO7A 5FI5A 1KOLA 4CMIA 5JYDA 1YOVB 5CDUA 5K0ZA 1PJ2A 2RHCA 5A4DA 2Q50A 2WYWA 3K9QO 3KYDB 2GR9A 4AG3A 2VUSA 1N9GB 2YQ5A 3NTRA 4IGFA 1M6HA 4AJKA 1XDWA 4B3IA 1BXGB 4JCOA 3CMCO 4R1UA 1YBMA 5FF9A 1GU7A 4II3A 4WOKA 4ZN6A 3OQ6A 4D46A 4P8RA 1CDOA 1WNTA 2Y0EA 4PZEA 4EITA 1VJ1A 1EE2A 4BV8A 2FPGA 3PGXA 2GN8A 3WNVA 3H4VA 4BNWA 2OHXA 1XYGA 3O8QB 4KUHA 4BNJA 2FRDA 3GVIA 2D4AA 2CVOA 4PLYA 1E7WA 4XYGA 4GMFA 4TVOA 2JCXA 4NHEA 4J6FA 2TMDA 4JIGA 1NASA 3C7DB 4BNIA 8ADHA 2PFGA 2YV1A 4ILKA 4CUZA 3RBXA 3DR3A 4PFJA 2BKAA 1VE9A 2UUOA 2EERA 3IQDB 4PZDA 2FPIA 1ZFNA 4NZ9A 9LDTA 1DOHA 3F46A 1ZBQA 3Q1LA 2WEKA 3QWBA 4J7XA 4CQMB 3ZNOA 5AXDA 1H9AA 5JO0A 3PJDA 4BMSA 2J3JA 1F17A 5KJ6A 4I9UA 2IE0A 2PH5A 4MO2A 5AXCA 1QMGA 5JE8A 2G0TA 1EE9A 1EVYA 1NVMB 1YJQA 3DHEA 3JQ8A 4I5GA 4LSMA 1LI4A 4NU5A 4XYMA 2JCVA 4TROA 4FFNA 4FQ8A 3K96A 2X86A 1ADBA 1I2ZA 3KTDA 1V6AA 1GV0A 3GPIA 3ICPA 3G49A 3H3JA 3PJEA 3PTZA 1EZ4A 4KWHA 4E5KA 1X1EA 1E6WA 4JROA 1WZIA 2RBEA 3AFNA 1D8AA 1M76A 3MJEA 3NX4A 1YBVA 1ISMA 4IJUA 3FHLA 4J7UA 4DREA 4HWKA 1YQDA 1RWBA 2Z1NA 7ADHA 4R4JA 1KS9A 1JU9A 1ZSNA 2UYYA 1ZK3A 3MTGA 3ONFA 1Y8RB 2AQKA 2H9IA 3QE3A 4UEOA 2CF6A 1BRMA 2NUAA 2PKRA 2CD9A 3HG7A 3DL2A 3JD0A 3ZDFA 2FPPA 1NQAO 4IQGA 1X1TA 2O4UX 1T25A 5KOIA 3QIVA 4RVSA 5A9TA 3H9UA 2GUGA 4MKRA 4WLFA 2POQX 4ALLA 3ULKA 3VAZA 4RVUA 1BDBA 3IUPA 3PWZA 1B0AA 3UUWA 4WEQA 3HFSA 5LCXA 2CSUA 4FCCA 2WYUA 5A9SA 1VL8A 4N5MA 4OAQA 3D5TA 3JQBC 1GEGA 4S1VA 4J1QA 4BKOA 4DBZA 3IP3A 3PEFA 3QVSA 3QJ5A 4HKTA 2BFAA 2EKLA 1M75A 3DHNA 3F4LA 3DBHB 3L6DA 4JK3A 3U4HA 4CMBA 2FOIA 2ZTLA 1ULUA 1PJ4A 3OECA 4WNCA 3FN4A 4FFLA 2ZYGA 2DVMA 3E6AA 1U8FO 2O3UA 3TFQA 5FWNA 2O4CA 1YDEA 1T24A 1GZ6A 3RUAA 3WB9A 1BVUA 3HB5X 1EK6A 4BMVA 1E1KA 3GDGA 2FR0A 3AOEA 1BMDA 2DTEA 3GUCA 4DLLA 1G6KA 5F5NA 5LC1A 4XQGA 3LSYA 1T4DA 1ONOA 1W6UA 1JKJA 1RYEA 2YUTA 3OQ1A 5BNFA 4EZBA 1L7EA 3QV1A 4DUPA 5EN4A 2AQHA 1GQ2A 1PZGA 3I4CA 1JWAB 2B36A 3PYXA 3RWBA 4NBRA 4TQGA 1Y8QB 4E2XA 5JNLA 4XYLA 2X22A 3L4BC 1KVRA 1CYDA 3KYBA 1DRVA 5I8ZA 3K73O 2CUKA 3BYZA 4DTIA 3C24A 2V6BA 2PKQO 5AVOA 2Q1UA 5DCWA 4A10A 2BFPA 4NQZA 4O0LA 2PD3A 1GPDG 5G0WA 4B4WA 4CM4B 2Q2WA 4JBHA 4TRRA 1JWBB 2VN8A 4F45A 3OEWA 4BGIA 4RPJA 2E82A 1I5RA 1YB5A 1O8CA 3WGIA 3QRWA 1UDCA 2R00A 1ZNQO 3GZ4A 4RVFA 4IPTA 4KP7A 3WLFA 4W9NA 4BNFA 4JP2A 1F0YA 2GYYA 3HSKA 4XX0A 1HXHA 3MJVA 3DWFA 3QQPA 1DBVO 3M2TA 4KQWA 2Q45A 3WSVA 2R6JA 2ZJ0A 2O23A 2PK3A 3NYWA 3I5MA 2D59A 1H9BA 4KMSA 3E5MA 3WQQA 3EY4A 2DUUA 3FSRA 3GFGA 3SX2A 2Q99A 2O7QA 3L9XA 3R3SA 4FJ1A 3GFBA 3PZBA 1QV6A 1I0ZA 1VKOA 3ROQA 3RUEA 1KVUA 2HK9A 3X2EA 4OXYA 3L9WA 5HTOA 2CZCA 3HFGA 1K3TA 5TJ9A 3GNQA 5EQDA 1GUZA 1B8PA 4G5HA 3RSHA 4ND1A 1ZK2A 3W8DA 3A06A 3I9NA 4PLWA 4OGWA 2VQ3A 1I2CA 2RH4A 1AXGA 3GA0A 4CMEC 3FPLA 1I3KA 3W4JA 2FP4A 3PLNA 1HDOA 4QECA 5TNXA 3Q9UA 1LLCA 3BMCA 3E8XA 3WTCA 2J3KA 1HDYA 2E48A 4J1NA 2Y1CA 2JJYA 1HDRA 3DAGA 1QP8A 1MB4A 5F1KA 3LT1A 5L40A 4DIOA 4YT5A 5TX7A 4AJ1A 1WWKA 2HJSA 4AL4A 2Y1DA 1MXFA 5IDWA 2AEFA 3TSCA 3ZWBA 3KVOA 5TSDA 3SLGA 5B4TA 4BQPA 1S7CA 4NDNE 4D42A 3G79A 3I9JA 1F8FA 1DSSG 1Y5MA 2PR2A 4RDIA 4E5NA 2I3GA 1DRUA 4MKZA 1OC2A 3CKYA 3KYCA 1DPGA 3MOGA 3VVBA 3DBRA 1JQBA 1GY8A 2X8LA 3DTTA 2AE1A 2Q1SA 4A2CA 4CLOA 2AG5A 4YJGA 1ZW1A 4GSKA 4RZIA 4YJFA 5IXYA 2VTDA 4JJGA 3HNPA 5TQVA 2X1HA 3DZBA 3EDMA 1YDWA 3QVWA 2OP0A 3OIGA 1YB1A 1BHSA 2UDPA 3W8FA 3H6KA 4XQCA 3B1KA 4OL9A 6ADHA 2ZB8A 3JQGB 1PGPA 4IS3A 4L9RA 4PLCA 1IYZA 1R4NB 1T2FA 1V3UA 2H63A 1DJQA 1H2HA 3Q9NA 1ZVMA 4TSKA 1GPJA 3ASVA 3WTBA 3H9EO 4Y6SA 3K6JA 4S3MA 4BNKA 1XG5A 5KJ1A 3PHHA 2Q2QA 1O89A 1V3TA 3JQCA 5B37A 1ENZA 5F1PA 2I66A 3ZWCA 5IN5A 4J0FA 3WYCA 3H2ZA 3PWSA 1PJSA 5BNIA 4GX0A 3KXDA 5I9LA 4A5OA 2GO1A 4FN4A 4FFRA 3LYLA 4TMFA 3K5PA 5GY7A 1JN0A 1LC3A 2NV6A 4IDDA 3BMQB 2FR8A 2DBQA 4WCFB 4DC1A 1DIAA 3DAFA 4GLLA 4OXKA 1E5LA 3EAGA 5IDQA 3DB2A 4MVJF 1A9ZA 3PVZA 2O2YA 1YE3A 1ZK0A 3F5SA 2E4AA 3RCBA 3GZNA 5K9ZA 1IPFA 5JDCC 1IOLA 1VLLA 3H65A 3GVPA 1LRJA 1VSUA 2EKQA 4FW8A 2QYSA 3ON5A 3GNSA 3CXRA 3SC6A 1DC5A 4NFHA 2JD2A 1ADFA 4B4OA 2V6GA 1CQIA 3UXYA 3RI3A 3RKUA 2WWRA 1T2CA 3H9GA 4Y67A 3LVFO 5IZ4A 3BHJA 1ADGA 4Q9NA 3WR5A 3X2FA 4C4OA 4CQLA 3WSWA 1K89A 4OIMA 1E1MA 1L1FA 2ZIZA 4BNHA 4CMGA 4DLAA 3C7AA 4ALKA 4FOOA 2HO5A 3N58A 1JDJA 1X0XA 1PGNA 1AXEA 1E3WB 1VRWA 5CHEA 1RM0A 3DBVO 4A73A 1XKQA 2HMVA 4DGSA 4R5HA 3LC2O 4KTVE 3JYLA 4BNVA 5L4NA 2JHFA 4H16A 3B70A 4F46A 1YL5A 1T4BA 2B69A 3WIEA 3DZKA 4IXWA 1Z73A 1R16A 1A7AA 3EZLA 1CQJA 3DQPA 4FGSA 3KZVA 2PH3A 4IIVA 1UXGA 2B37A 1KEUA 3GH3A 2G76A 4EJMA 3PPIA 3UW3A 4Z0TA 3AOEC 4PLGA 1CETA 1BSVA 2Y1GA 4QT0A 1JA9A 4YR9A 5L3ZA 2UUPA 1NYTA 1AUPA 3WFJA 1HEUA 2ZJ1A 5DDIP 5JC1A 3RVDA 4YRDA 5L9AA 3W1VA 4PRLA 2NM0A 4OOEA 2FR1A 1KY5A 2Y0DA 1QYXA 1YL7A 4CLEA 1GZ4A 4P4GA 1WMAA 1B2LA 5DBIA 3ZNQA 1ZUD1 3L07A 3ZH2A 1B14A 4Q3CA 3ZU4A 3WBFA 4F6LA 1YXMA 4M86A 3JQ7A 3U9LA 2VZ9A 1HE3A 3Q3CA 3TJRA 5L53A 1O5IA 4B79A 3OF2A 5C37A 4BO2A 5EIOA 5TT0A 2DLDA 5ITVA 1HZZA 2H5LA 2P9GA 1GTMA 5JY1A 1DXYA 1IB6A 1QLJA 2J5QA 1I30A 4WASA 3DDNA 4E32A 2AG8A 2QG4A 1PL6A 4ZQBA 4GX5A 3ZWNA 4NJMA 1DIGA 4JBGA 3GMSA 3EYWA 3UCXA 2GN9A 1H5QA 2O48X 3OM9A 4CLDA 5A04A 6LDHA 5BSHA 5TC4A 1Z74A 2DKNA 1PIWA 3D3WB 1I33A 5A03A 5B1YA 1C3VA 3ZWWA 4D3DA 1LBEA 2C2YA 3EZYA 1KEVA 4PLPA 2JD1A 1QYVA 3WS7A 1UP7A 5TS3A 3HHPA 4DRYA 1BW9A 3GVHA 3LT2A 3E82A 2PA3A 3ORFA 5B12A 3RUIA 2HKIA 4NFSA 1YH3A 4B3JA 5I7VA 3DOCA 3QWFA 1VJTA 3FNEA 1ARZA 4UVGA 3WGOA 5DP2A 5A9RA 2HQ1A 1QR6A 5G0VA 1I32A 3WYBA 3IOYA 5DP1A 1EMDA 2VRBA 2GCGA 3NEPX 3HJAA 3GHHA 2P2SA 3ZV5A 1O95A 1PWXA 2HMSA 4RVGA 3L0DA 3RBZA 4BQRA 3BMNA 4BNGA 1OC4A 1NFQA 3GUYA 4GGPA 4B7CA 3GPDG 5CAEA 1LTHR 3JD4A 1DIHA 2QYTA 3I9MA 3LC7O 3IL2A 1HWYA 1LDBA 2W2LA 4ZVVA 4DQXA 1HLDA 1EDOA 1DFHA 1P74A 2E37A 4CM1A 5A06A 5CDTA 1U2DA 4PIVA 3JQBA 4R54A 4NFYA 5HWSA 1WP4A 2OGUA 3NJ8A 3CZMA 4ZQGA 4CMHA 2G1UA 3E9NA 3RKRA 3S8MA 1AE1A 3JQAA 2GDZA 4N5NA 5IAAA 2C82A 3KHUA 1Z45A 3R6DA 5JO9A 1NAIA 1HT0A 3D64A 1P9LA 3WQRA 2DQ4A 4U7WA 1C1DA 1GYQA 1P1RA 2YHUA 2WYVA 1X13A 3N7UA 4JN6B 1XELA 2VOEA 2Z1MA 4NPCA 4BNYA 1JKFA 2A94A 2YHIA 3VPSA 1E3LA 1UP6A 4E2ZA 4J4TA 1CWUA 3OFSA 2F1KA 2WTBA 4JJIA 2W2KB 4XYEA 3OSUA 4NBTA 4Q3EA 1VSVA 4II2A 3F6YA 5DULA 4AJOA 1SBYA 5L51A 1C0LA 3BTVA 3L4BA 4J4BA 5C7OO 1Q7BA 2LDXA 3TZCA 1LNQA 1U4OA 1XCBA 4FIZA 3V1UA 5L7TA 4PLZA 4NU6A 4MP6A 4I9NA 4DYDA 1RPNA 1QORA 3OHSX 2QZZA 4YAIA 1V3VA 1S6YA 3RJ9A 1PGJA 3H5RA 3AJRA 4BKQA 4NK5A 2HRBA 5C5IA 3A4VA 2VZ8A 5KVQA 1YL6A 3KLPX 1HLPA 4BGUA 4PG5A 1IHYA 1K2WA 3HDQA 2OL4A 1Y1PA 1KC1A 2G17A 2HLPA 3JCZA 4L4RA 5L7WA 5I7FA 1RM3A 3ZHXA 3CINA 4HFNA 4IDEA 3LU1A 4E5YA 3PYMA
chains in the Genus database with same CATH superfamily
1UOOA 3D3KA 3GBPA 3NOXA 4G9BA 3FUWA 4BO3A 1DEHA 2QTLA 1U2TA 1KDPA 4IJWA 2XZLA 2H92A 4UHJA 2YMLA 1N1EA 4FR2A 3R3YA 3WRXC 2V7WA 1XZLA 2QD3A 1WRBA 3B6IA 2ZR7A 1RLOA 2HRDA 2WF9A 3AG5A 5J3JA 2G9NA 4A92A 2DUNA 2ZIWB 4OUDA 4IFBA 3RS7A 1P19A 4PZCA 3WQBA 3PGJA 2MINA 4OV6B 4JT4A 4MWCA 1UJMA 4OP2A 3ZDEA 1XJCA 3CLUD 4UZEA 1MG0A 1HLFA 3DBOB 3L6RA 2VEOA 4RSRA 2OQRA 2RC6A 1CB7A 1S5PA 2PGJA 3GBSA 5CNJA 1DXHA 4NOLA 2WJGA 3AHFA 3O1HB 4YDSA 4CMEA 1CY2A 3AY6A 2ZAMA 4DNQA 3KKQA 5K0GA 3PA6A 4G2NA 4RK6A 3K6RA 2EEPA 3LC0A 2WWGA 4IIFA 3Q88A 4H2DA 2NZ8A 1OSNA 2QVCA 3KR1A 2RIRA 4ZCPA 3KK0A 5BVGA 3SVZA 1TQDA 1PCXA 2ETXA 2PUWA 3CBGA 4M21A 2CHUA 4FVTA 4MULA 1PJAA 4TOIA 1PN3A 4M7WA 3IIIA 4TLBA 2LKDA 3ZDAA 2FNAA 2QZSA 3B9RA 4MQMA 2P3OA 1X2BA 3OE5A 4R8KA 1BS1A 1PJZA 2RHBA 1JSLA 1NOKA 2GFQA 1OYVA 3CEPB 5BNWA 5CX4A 1Q11A 5TIIA 1GV1A 3O7MA 4O4LB 1ZU5A 2ZE5A 3FI9A 3IEUA 4QQNA 2PEYA 4E51A 1ST2A 1ZI9A 3NTXA 4XD2A 5JISA 1WAMA 1ZOIA 2B4QA 5DTIA 5LFAA 4AURA 1WOYA 3IA2A 4BP3A 4DUGA 4PANA 1HZJA 1MQSA 2ENUA 2ETVA 4EPYA 1N5DA 3CF4G 2PSSA 3IP8A 4ZVLA 1LC0A 2ALJA 2WJHA 1AKEA 3RTAA 1YVPA 1PVDA 1D03A 1KJIA 1Z4LA 3CRNA 3R77A 1GHTA 4II7A 2DMRA 1YIOA 4HNRA 1TYCA 2A5FA 3PNBA 3P9PA 4PCUA 4C0QC 2Z6UA 1E2NA 2LNDA 1L5NA 4I9HA 2A30A 4M0LA 1D2RA 1T4MA 2HNAA 2PMFA 3JQ9C 1NBOA 2QRJA 2AJLI 3ZZ0A 3MINA 2ZI4A 4BKRA 2EDAA 3ZK9A 4B46A 5TE9A 1YA4A 5LKRA 1DLIA 3UVEA 1GITA 4KQGA 3W6PA 4FE4A 3BMOA 4YA6A 3UOAB 3WNZA 4KIFA 1YKSA 2PWBA 3O8RA 2G0AA 5C32A 3DE2X 4WD3A 4O59O 3AEQA 3ZYZA 1YMQA 5LIPA 1E79A 4NIMA 4RORA 4WX2B 1PSZA 2QL7A 2AXEA 4H7FA 2JIQA 4JJAA 4JNKA 4DLWA 4Z7JA 3AKZA 1SPBS 1TYAE 3EXG1 1CUAA 1G8YA 3L7LA 1Q1EA 1AQIA 1FS4A 4KVFA 4YHBA 2IS6A 2C5EA 1YR6A 1ZQ1A 3GY0A 1E77A 3FCCA 1H23A 4QX6A 4B4DA 1DEXA 3ZW8A 4IJKA 3OF5A 2MYNA 4G3XA 1KFEB 1EUCB 3AEUA 2J3IA 4HX5A 4B6FA 5AIAA 1TEVA 4MR8A 2Y6UA 3QLVC 4O2BA 3VVMA 1B8UA 4O8ZA 3QHAA 4RO0A 3LP6A 4B3RB 3DPUA 4E5MA 1Q7CA 4N18A 4A0SA 3AIMA 3GFOA 2IT1A 3RUDA 1JJFA 2BEUB 1EFKA 3SK0A 1DO2A 1FIUA 4LXXA 5JAUA 1FDOA 4P5EA 2ZSIA 1K6JA 3BXPA 1GAWA 2QAIA 5DIZA 2N75A 1DKPA 1H4TA 2PGOA 1ZIOA 3G5AA 2D2IA 3KSZO 1X7DA 4L15A 4DY4A 5E6UA 4UXHA 2YWDA 2HCFA 3RJTA 4EO4A 1SUDA 2W6ID 3KZ1E 5ETJA 1QOZA 3MXTA 3TDNA 3IUNA 5DCUA 3V6MA 5EWLA 1JEEA 4UOEA 5JDCA 1GLVA 4DNFA 1H1LA 3HN7A 4K8RB 1U8AA 2IOYA 4OYRA 1UK6A 3MJTA 2PV0A 3FTPA 2YRXA 3E4DA 1E64A 5IPFA 1T8SA 3TE7A 1DFGA 1XCGB 3ZJVA 1FPMA 4M0UA 4C6TB 3U62A 3UXHA 5CVJA 2OXRA 3NC0C 1TQ2A 2OSVA 3CLHA 5LSAA 2Q2OA 3GLVA 4D4KA 4UOZA 3BSYA 5AO9A 1E61A 2SKCA 1X7WA 1IN8A 3GZJA 1CY0A 4G8CA 5GM2A 3RJMA 1TPZA 4D9FA 2VJMB 3L0BA 5CGQB 3WB0A 1JLRA 1I0LA 3MCWA 1CEXA 1COWD 2DF8A 3M7IA 2IX9A 4DR1B 2B82A 2UYOA 2RH9B 2FSUA 3N2IA 2C2OA 1HE4A 4LYYA 3DOIA 3EB9A 2RJ3A 2EFDB 3HBLA 5F4BA 1E7SA 1FTGA 3FVTA 4GOKA 4WCFC 4ND2A 3UXEA 3VPXA 4V3CA 3VOBA 9GPBA 3S1SA 3GEHA 1GFSA 4MKXA 4MV1A 1PT8A 1KU0A 2YCLA 3BXEA 1GKIA 1PR6A 2P9HA 2JZCA 2XODA 1T2VA 4TSFD 4MV9A 5DT2A 1MB3A 4AJNA 2BM9A 1EM8B 3AI1A 3H19A 3H4IA 2XQIA 1KRHA 3DMTC 3HDYA 4FC6A 4GRIA 4UNNA 1PNQA 2RH8A 1ISSA 3E3OA 3JYNA 2KMLA 3AR6A 5FHQA 1G8KA 3R75A 2NUPA 3C7CB 3D2CA 3KFXA 1T2UA 2IYAA 4N8DA 4RK4A 5DM0A 4GGOA 3HUDA 3WRVA 5JIBA 2W98A 3U44A 4HQOA 2IIVA 3A1UA 4OQZA 3T5MA 5BXYA 3UPTA 3MJSA 4L0QA 1SXIA 2CLKB 3BWVA 2VT7A 2YFQA 3Q7TA 1ZVQA 5JT1A 4OX9Y 1PV2A 2RBGA 4BO8A 1R4MB 5KYYA 2A57A 2QD2A 3D6MA 2VTBA 1Z33A 3MWFA 2XXAA 5HDBB 1W94A 5LPNA 3EPJA 1MX9A 3IV6A 1J1ZA 1MJGA 3OTGA 5F3RA 5AW8A 1IUOA 4RGYA 1KAHA 3WLNA 1IOVA 3KYIB 1X70A 2Z3WA 3OFVA 3K1YA 3A6DA 5HIIA 4E4TA 4K5QA 4BJ1A 4ZZIA 5LU9A 4EOGA 1OE0A 1RRVA 1BX1A 3PQFA 3NYRA 3A1DA 3PFIA 4P0TA 2CB0A 2J3MA 1C3OB 1T0JB 5GWXA 3HWSA 4K6MA 5ALNA 3FRHA 4LGMA 1UBKS 1U98A 3V55A 3EXFA 2C4TA 3C98A 4WZBE 4ZD6A 5AHOA 3QYAA 3ZU5A 3G2IA 4ALNA 3NJ4A 3N87A 1ENYA 5BV8A 4IP0A 2YMPA 2C2KA 1RT9A 4V2UA 5A7HA 3ECCA 1P1JA 1LQTA 1Z2PX 3FHJA 5LD2C 4XLZA 2BVNA 2X2PA 1EPUA 1FCJA 3FZQA 1JTEA 2ACVA 3OD1A 3Q3VA 4M1OA 5K4GA 3SVTA 4OHBA 1BQEA 1OA1A 2J9FB 2O57A 3EVTA 4M9SA 2X0EA 5G0UA 3TJMA 4L57A 2QX8A 3EZGA 4BX8A 2MSLA 3ZDQA 3D7LA 4FR0A 3O8QA 4QGGA 4BO5A 4LG1A 4LHYA 1CE8B 5EXDA 4PQGA 1Y48E 4D4IA 3CH6A 4JYMA 4K6KA 3EC7A 1S3GA 3KOOA 1UADA 1FFAA 3GCWA 4A2PA 1YS2X 1T4GA 2ZB3A 4U7DA 1FSGA 4L07A 4XIGS 3RRYA 1P2VA 1P81A 1SAYA 3D4PA 2BKEA 1SC3A 3N2GA 1SIWA 2OO5A 3EIHA 3G1UA 3P9YA 3WGVA 3OIVA 4HZIA 3PKZA 2PL3A 4WDQA 3RTEA 5BORA 1XFAA 2W8BB 3QFCA 5BN5B 4AICA 1TIPA 1Y8AA 1IG3A 1BU8A 2EL7A 4KAAA 4G0PA 2FEAA 4F92B 2BP7A 3CKKA 3VPHA 2VI5A 3FOCA 4MGKR 3SVLA 1E9AA 4PZPA 1JHUA 2W6JA 3GVCA 3E7DA 4JV5B 5AW1A 3QP9A 1U7ZA 1M34E 4LNUB 4RPGA 4TQ9A 1ISGA 4WY5A 2B0JA 2DLCX 5A6SA 2JF0A 4GM0A 1LDGA 1ZL0A 3OO1A 4FFBB 3ZN2A 2DULA 4BQSA 4DAOA 3VDMA 4BS9A 4WXYB 5GV8A 3WIUA 3H1FA 5F3WB 1Z6GA 2ZYAA 4I55A 2YXLA 3DEJA 5K01A 1R0RE 5JMWA 2OAP1 1QH9A 2OO3A 5KX5A 3GOQA 3QWIA 4DDUA 3O1JC 4BNNA 4PO8A 2IHJA 3M81A 1UFQA 4TLMB 1O94C 3KOUA 1E4EB 4RTNA 1JAXA 2O1WA 4XYBA 3NRJA 4XWTA 1V1RB 4LJ6A 3IKTA 5F73A 1I4WA 4CM5A 1NUSA 1RXEA 1WU7A 4S1PA 5THQA 1A69A 4TYYA 3TMAA 5JDIC 2A3RA 3I9LA 1EP9A 5D3MA 4GPTA 1W7AA 4ZU6X 3GJ5A 3K32A 2FOLA 4U5QA 2L19A 2V7EA 3JALA 2DPLA 3HBMA 5IH7A 2I6XA 5FXMA 2GSDA 2VNAA 2KW5A 1RAIA 3UC9A 4AX4A 1NF8A 3E03A 5HOEA 1O03A 3HBAA 3LQFA 3WGGA 4CG0A 3P9QA 4E7PA 2NP7A 3JWGA 4R01A 2HEGA 1RHQA 1UMBB 4WZAB 1IN6A 2ZGVA 4X6XA 2I5PO 1N2HA 3A2LA 3LQ1A 2VT6A 1X92A 2YIMA 3UYLA 1SXJE 3L4EA 5G1NA 4F4IA 1M2KA 4X3CA 1WABA 4GP7A 2HV8A 4IIJB 1K68A 5F52A 1SQ0A 3DUFB 2I6TA 1YQTA 3FUVA 1RPJA 2RB4A 1RC8A 1CQXA 1JT9A 1FYXA 2BFCB 4IWNA 5BW5A 1VDZA 3V46A 1XR3A 2WD8A 4D0LB 2FWMX 1IK4A 3AF4A 4EKIA 1ORTA 3PE4A 5FWDA 4DL9A 4ZICA 1FZTA 4A27A 2W2MA 4TV9F 1JU3A 1R9NA 3L46A 3NASA 4OFZA 1Y1SA 3IESA 1E8NA 4E30A 5K5EA 1OH6A 1H2BA 3DS8A 2GEUA 1Z35A 2WK1A 2ACWA 4WNAA 1GFWA 5LDGA 2HPZA 4HJRA 4D81A 3MJDA 4PLHA 1TK9A 4WK6A 1ABBA 2NNWB 1JDTA 1VDMA 1P3Y1 4MPJA 4DMKA 4HFJA 3SWWA 3W3AD 1GDDA 4NJMB 5G02A 1SEVA 1PDOA 4GQBA 5EJMA 5J2UF 2IS1A 3UAWA 2WE8A 5FTJA 3O3CA 4D3FA 3EIWA 3LW8A 4FOTA 3Q5EA 2YJ6A 1WM1A 4IVNA 5FNVA 1G8JA 1NN3A 4MINA 5C34B 3ZDZB 4LZZA 3MEQA 4DR6B 1EVJA 1C30A 4HX2A 3UHPA 1BCSA 2QGFA 4KKVA 2WIBA 5DF1A 4RIGA 4QDKA 2MR6A 3S1AA 3VH1A 4CM8B 3X0DA 5BYAA 5C81A 2H0AA 4MZDA 2H4XA 5KYXA 1UBUS 3CE9A 1KOFA 1ZG3A 4GD3Q 2P62A 3H2HA 1Z06A 4YRZA 1ICEA 2FQ1A 2XUOA 3RAFC 4FQ7A 3VSEA 2GPBA 1L4EA 1VCOA 5JH7B 3AR2A 1II8B 1E98A 3UA4A 2E21A 1XDGA 2WOJA 2I1LA 2X9VA 4Y9UA 5HIAA 4QSHA 1P6XA 4PYKA 1LBTA 4WLVA 4JB3A 1UBNA 1M67A 2FPUA 2IEGA 4ZJUA 3L0CA 1DHRA 3O4GA 4MQLA 4QEZA 2C1XA 2OOSA 4XDHA 4MR9B 1U5CA 3LY5A 1ZN8A 4RENA 3UV6A 4JQZA 1W0CA 1UBGA 3TYXA 1QFZA 3ID6C 3ITKA 3MCZA 3NBXX 4XB1A 1B42A 1QGED 1II0A 4I1SA 3OZSA 5IN4A 4JLBA 1ZEJA 3LP5A 2GZ3A 4Z5XA 4Z1MA 1PFVA 2IPAB 2O3SA 2PWZA 3BXFA 3OUUA 3Q3IA 2Y76A 2H2AA 2IGBA 2Q4RA 5I3CA 4LEIA 2G06A 3FWNA 3HZRA 4FU0A 4OHOA 3I53A 5JBIA 1KY3A 4FW9A 1Q5PA 4P1ZA 1CF2O 1ZAKA 3GLFB 3UT5A 5TQ0B 1P33A 3EGEA 2E2WA 3P19A 5T4BA 4LXQA 5L8VA 5F9MA 4ZI7F 1D4AA 2XUZA 3PKIA 4PNPA 1VL6A 5KCZA 3AI3A 3M6XA 2QIOA 3B5EA 1D5WA 4UAGA 3RB8A 4KITB 4KR7A 1KHHA 1L5YA 2UZ0A 2BM0A 3BWYA 3PD7A 4NBVA 3VVCA 3A2NA 4KYIB 3PRJA 3RC8A 1Z5WA 4B82A 1XPRA 1G98A 3OPVA 1NLZA 1Q3HA 3WNBA 2A0UA 4E70A 1ESNA 4WE3A 3SYTA 4JXXA 4OL0A 1I5EA 1XV5A 5E4FA 2RHGB 2IP4A 3OICA 5G3ZA 1XEAA 4BFTA 4AKSA 4YAKA 5FAKA 3NNSA 4HWTA 3E0QA 3GFVA 4HNSA 4J9VA 1JB1A 4JGBA 4MKFA 5AHXA 5EZYA 5IK2A 4KRYA 2BKUA 3TL3A 2OVBA 3ZCXA 5JECA 3RROA 5KWVA 5JARA 3TRDA 1FJHA 1CIJA 2D06A 4Z54A 1UF9A 4Q47A 2QRHA 1ZISA 2H1SA 1Z83A 2QD1A 1AO0A 3LA8A 1QUEA 3OWHA 3FWKA 4K1XA 5CP8A 1Q15A 3ZEIA 3D8BA 3GEPA 1JFFB 2YBDA 3AHGA 4G25A 4OFWA 4S24A 3RSQA 3ZR4B 2IH2A 1W44A 5FPYA 3K2IA 4CW7A 3W5IA 1N7JA 2ZVPX 1WCWA 1JIXA 5HF9A 5CT8A 4EMUA 4NENB 4BO7A 2UAGA 4PG6A 5D01A 3VHRA 3T54A 5JSFA 3SR4A 3GT3A 1TYBE 3H83A 1BWSA 2B2NA 4OXQA 4Y2SA 3AUFA 5ILGA 4AXXA 2B7CA 1WHSB 4NVRA 2FUNB 3ZE8A 4BO9A 2GERA 3D4LA 4KLRA 4LGYA 1I1QB 1GCGA 1T9ZA 1KNXA 1C80A 1E1CB 4ND6A 3T7JA 1QJCA 3H1EA 1YC5A 1N7IA 1A95A 1J0EA 3O3NB 5AVVA 5LJIA 4GI7A 2BFFA 4KMRA 5AW6A 4F4CA 3NDJA 2JJQA 4IJ6A 4RCVA 4KNWA 1UJBA 2F9FA 1D2MA 3A9SA 3ZZUA 4CL8A 1E2KA 4F11A 3EPKA 1Q0ZA 4GE3A 4S1NA 2JZOA 3IGFA 3IT1A 2BJHA 2QT1A 4DSOA 1HDGO 1G9XA 4AZ3A 1J0XO 2FPWA 2ONKA 3RAJA 1T5DX 5FFMA 4MUGA 1PFUA 2OG2A 5FX2A 5KQLA 4GR5A 5B1HA 4EMTA 1POXA 4BB5A 1ZGJA 1R4NA 2BFEA 1UAYA 2FRVA 1T9AA 1KS2A 4RMIA 2QMZA 4PGFA 1Y1LA 4CR7A 2P11A 3MJFA 1SCBA 3KB6A 5J4KA 3GLGE 5K4AA 3M5CA 2XOKA 3V2IA 4RCYA 3CX8A 4OQDA 4KXMA 1NI5A 2PAFA 1NA5A 4M36A 2R96A 4AMGA 1GG9A 2WQ7A 1N4DA 3AUTA 1XZMA 2QLLA 1KI4A 3SFZA 3VYSB 1SUBA 2A78A 4EHDA 2XUFA 5CEFA 3E7WA 2ZKIA 4UBNA 3W9SA 3N05A 5EMLA 1KBZA 4LF9B 4FLEA 3C5VA 3USES 2AVDA 4GVXA 5HIJA 4LK3A 2QUJA 3BGWA 4RLSA 2I29A 1GT91 1BGVA 3HKBB 4FFVA 3QM1A 4FT2A 1JTVA 1O9GA 2OBMA 1A9QA 1D2HA 3DVAB 3OZ7A 1EP2B 3MJCA 3DTNA 3EXHC 3TD2A 2A59A 2P4HX 5ESRA 4OHYA 3NP7A 3VKWA 1JVNA 1DWUA 4B74A 1NV9A 1NW4A 3NPAA 3CJQA 4ENTA 4K6GA 4OJKA 3IMFA 5GOTA 3T38A 2MIIA 1AJEA 4ODIA 5AQEA 3DE0X 2FPGB 2C5AA 3TFWA 2AMJA 2R4QA 4P3PA 5C46F 5I51A 1AN9A 1A3CA 2B6HA 1ZIDA 1SUCA 4K6HA 4YS6A 2EFEB 4W6ZA 4JI1B 5BVHB 4IS2A 5J43A 3O31A 3QFSA 5ITZB 1IY8A 4FS3A 1CF4A 4XCQA 2WHQA 2C7OA 4F9TA 4PC2A 3AOGA 4R51A 3HC7A 4XPZA 3ZE0B 4I1PA 5IARA 1FUUA 2FWRA 4MUEA 1Y5NA 2LR0A 3H11A 1BAPA 3VNBA 1QH1B 1SVNA 2OY0A 5KNBA 2I54A 1JT2A 2IA5A 4IR7A 4MI9A 4WINA 2YTZA 4R16A 1VRCA 4ROTA 4EPWA 2DR0A 3BC1A 1C4XA 4MDHA 3ZU3A 1D4FA 2JJ1A 4B2IA 2E85A 4N0PA 1WD5A 1V1MA 2JFUA 1XTIA 2V0CA 4PTYA 4U7GA 1TA9A 1E0AA 3JQFA 3V4FA 2W7TA 1E3WA 3FG9A 3GAFA 3VOTA 5AIBA 2BMDA 2ZRDA 5CFLA 1RHJA 3KJEA 4MIKA 2O2ZA 1JDBB 3GT0A 4AKGA 1XWFA 3LL7A 5AI6A 5FA5A 5AUPB 5CPBA 1QTQA 2O7SA 1YAJA 4K1LA 4OATA 3VVLA 2DRIA 1HBJA 2VHYA 4QUKA 3Q2IA 3TRJA 1THGA 4C5BA 4DDHA 5BWMA 1UMKA 2QG9A 3D0RA 3H5AA 3KQYA 5F3DA 5AYVA 2QQGA 3IHTA 1QYRA 4RXTA 3BK2A 1VHQA 1JIUA 4NS1A 4YCDA 4J1TC 4RPHA 5LLDA 2G09A 4FD2A 1WQ4A 2AYXA 4BE4A 2Z4RA 3EAQA 3QBTA 1TKBA 4MS4A 1R8JA 2PX6A 2W48A 2WICA 3K15A 1AF7A 3NC4A 2Q5QA 1U0SY 3KB2A 1EIZA 3O91A 1C9MA 3ZX5A 1IAQA 5LZ5A 2AZDA 3E84A 3ANMA 3PENA 5I9IA 1FRNA 2P68A 3DMDA 1NW5A 1D0VA 1LF5A 5CXSA 3N28A 5LNK1 3RV4A 4KGZA 4DW8A 4UMDA 5DI3A 4OYYA 2XAUA 3H5LA 3JZDA 4IIBA 3IBSA 5IKPA 3ONVA 4GNKA 4MROA 3W9UA 3QX3A 5F1YA 1FJXA 3VSBA 2OZPA 6NULA 1KO1A 4KR9A 4AY3A 4C88A 1J99A 4JP5A 2O05A 2UUAB 1EWQA 3M6IA 1OREA 2R1TA 2DM6A 4BO0A 4DZRA 1K06A 2ECOA 3M2PA 2NUAB 2GK4A 2VUUA 3RQIA 4BRSA 1L8QA 1MLDA 1O97C 2IHBA 3EGXB 4Y18A 1DTWB 4UUAA 1MX3A 3ANLA 4WESB 2HSDA 4PAOA 1M74A 3GRVA 2VZLA 1PJCA 3RVJA 3ROXA 4LRTB 2JLQA 1OZGA 3ECSA 3Q2KA 3LO5A 4HDKB 1ZR4A 2HQSA 2A0XA 1TJ4A 4ZA2A 4RK7A 4TL9A 1KDVA 3OBBA 3CX6A 3BHNA 4OLJA 2OCBA 2V3WA 4QELA 5EJ4A 7REQA 5B6IA 4L3WA 4O5AA 4UBMA 3ROFA 3TOVA 2GAAA 1I14A 3FHOA 3KKLA 3PIDA 4WOBA 1OLUB 1KKUA 3QLJA 2IYYA 3IAFA 4X3OA 4C76A 4PPFA 1C9KA 3IQZA 3L18A 2VHXA 5ALKA 4AMYA 3IJPA 4CR6A 1MNQA 2XYHA 3SM9A 3TNJA 3F74A 1YV9A 2CUTA 2BBSA 2WWFA 3AJEA 1DG9A 1SULA 4MB6A 4BFZA 2PKQP 3JR7A 4X1IB 4ZQIA 1A27A 1SZJG 5IMBA 1V8ZA 4MWZA 1U3VA 3CSUA 4ZRMA 5T6BA 2VHQA 5JXIA 3KL2A 3UOGA 1C9YA 3KXPA 3IH5A 3QG1A 4GECA 4QVIA 3S55A 4QBIA 4PHCA 5HYVA 3GEIA 2CVZA 2WU4A 3G17A 4LN1A 3IQGX 1LVUA 1HDZA 4KUGA 3DO8A 3X1MA 1R0WA 3KOWA 1LTQA 3AR9A 4KDRA 3U81A 4D96A 3LF1A 1BGWA 3ZK8A 5K1ZA 4V39A 2QXYA 1PE0A 1W5EA 5IBPA 4ZDIA 3HU1A 2FMUA 3AHCA 2X5OA 1NY6A 3C6ZA 2OGTA 4JVLA 1U0LA 1EQUA 2HRZA 4U8HA 1U3TA 5AK4A 1RKVA 3LZDA 4LTMA 5B6JA 4M46A 3B20A 1T0BA 2HUNA 2Z9BA 3MTIA 4XCXA 2K5UA 4Y0VA 5CT5A 3WLKX 5HA5A 1M66A 1MHTA 2FMTA 4KPYA 3PEYA 4IOMA 2X3YA 5AK3A 1N2BA 1ZH0A 1E92A 4UTXA 4XGKA 4EKGA 5KNCH 1E8DA 1KE1A 3TRHA 2DWQA 2LZ0A 2OBYA 1R3UA 1GD1O 2J48A 1KO4A 3LH5A 2JGLA 2QLTA 3VPAA 2WLSA 1PD0A 1HH4A 2QQFA 4FX2A 1F1JA 2AEEA 4FMDB 4J0JA 4DCGA 3IMGA 4YMGA 4OI4A 3UMBA 4NMHA 1EHCA 3U3KA 1RZVA 5EFOA 4Q4CA 1F06A 4DPKA 4XX0B 4LXGA 5TQ2A 3TSAA 5LBTA 1HC7A 3HJNA 3K31A 4AQ7A 1G6Q1 2WTNA 3AV0B 4Q9KA 4X71A 1YQWA 2Q3BA 3F3MA 1QIKA 3C6YA 4C2TA 2WTMA 4CT0A 1PSDA 2QF7A 3V8NA 4LDJA 4OA8A 4C01A 4LS3A 3VR4H 3I09A 4Y6QA 5LNK6 3EPPA 3OZIA 3P5SA 4J76A 4U7PB 4RA9A 1HFKA 4EJ0A 3AF5A 5JFOA 1A9SA 1RMQA 3CSDA 4RNDB 1GPYA 3FMVA 3VZBA 3U3XA 3O4RA 3K1AB 2WMDA 4IKPA 4MLPA 2VYVD 1WMDA 4BLWA 4KWTA 4NL4H 4ZMRA 3QVTA 1DZ3A 3UGTA 4IIDA 3T1TA 2E5LB 4DBLC 4EVSA 5KKAA 4W5HA 1FVXA 1ESZA 4RIIA 4LWOA 3WGMA 1R0ZA 2QUAA 2DFNA 2X8BA 4WECA 4UNPA 3A9RA 4PS0A 1XLTC 1XQYA 4ASUD 3SQXA 1R0CA 1KKLA 3C3PA 5GONF 1DC4A 3ESZA 4EJ2A 1F3OA 1F4VA 1ZWKA 1HEIA 2OC4A 2QSUA 1M2EA 3R7WA 4UEKA 2QMHA 1L6IA 2OK8A 3JZIA 3MK31 4MPTA 3REGA 3IBFA 5HJEA 2PUGA 2EFGA 1KAEA 4G23A 1TEXA 2QD4A 3WWCA 1HKUA 4OM8A 5CIWA 4GMDA 1NW8A 1X9HA 1NRXA 3PC4A 1RNLA 2PV7A 5EKSA 1Z26A 1U9CA 3PEUA 4YLEA 4QDJA 1XRMA 3DOHA 3QOXA 3RHFA 2NTNA 1PTJC 3I0NA 2OB2A 3BWEA 1WUIS 3GJQA 5DTEA 5IDXA 2Z8ZA 1G19A 4J7CA 3QOFA 1NKSA 2Q7DA 3T95A 3U0VA 1KYYA 1XQ6A 3G0OA 5KTTA 2Q1YA 5KYUA 1EGMB 1TADA 4ZIRA 4OMUA 3USCS 3UJHA 3W9BA 4DG9A 2JCYA 1C7JA 1I1HA 1U28C 2GHTA 4IO0A 2D0IA 1IEVA 1L8AA 3Q11A 3HL0A 4HNAB 4QD3A 4UCFA 3TS1A 3V80A 3IR5A 3DBRB 1PV4A 1WX1A 3L4SO 5SZIA 2AF4C 4CLOB 3OU7A 1D2CA 3HDHA 4HXYA 4TV9A 4A8JC 1AA9A 1PDWA 4A6XA 1UPTA 4UAJA 3FBGA 4EUSA 1YZYA 2W4MA 1VECA 3P52A 4M99A 3KAJA 1VI6A 4JBNA 4PSCA 4PYLA 4C0JA 5CCBA 1NRIA 2X2OA 3AONB 1X39A 2RKOA 3B3JA 2P30A 3F5DA 3JAKB 4WW0A 3W5VA 4YT2A 3V34A 5J2UA 4JMLA 3GLKA 3G02A 3SX0A 4FSHA 1FDRA 1NRJB 4UULA 2KBEA 3CLRD 4Z99A 3RC2A 1YZKA 2GH1A 2D3WA 1ONNA 2NTVA 3C7TA 1OROA 4I4NA 4U00A 1QBKC 1ZVKA 5EUQB 1ZO8A 2FLWA 3PT9A 4X97A 4IEIA 3R9XA 5DN6D 4F3NA 2CV2A 3VTAA 5B7PA 4EJSC 1L1QA 3E9QA 5DLDA 5BT8A 1G8GA 1ZN9A 3UWPA 1DLJA 3GB9A 1P45A 2OXEA 4I8DA 1H2YA 3WHPA 2WFMA 1QYWA 2VK4A 1B3RA 1I4TD 1HE2A 3KYJB 4J6EA 4OLFA 4RDHA 4UM8B 1H8HA 2WJ3A 1SC9A 3FCUB 4LSGA 1XKTA 4QPDA 5EMNA 2Q3EA 4AB1A 1JIVA 3VO9A 2GVDC 4L9AA 1N78A 1NWCA 2BGUA 1K8ZB 4NCNA 2H16A 4BCCA 5KVCA 3ANXA 1PL8A 3QXCA 4GYWA 1RXCA 4DLYA 5J5VA 2CBZA 4JD5A 1UFKA 4NK4A 1R6VA 3KXIA 1U2PA 3JZFA 2P0YA 4M53A 3TQTA 5C8YB 3EVZA 4D8UA 3KXKA 4ENSA 5FA8A 4FINA 4F38A 2QQ0A 3QE2A 1WETA 3PUXA 3UMCA 1FVOA 2J3LA 3ZGVA 3ZY3A 5HM8A 5G3YA 1JA1A 1GFIA 1MQAA 3QLUC 521PA 3QSYA 3GZNB 4FMCF 2PLAA 1E3TA 2WHYA 4NCIA 1UANA 4CM9D 2IXBA 4P6VF 3V8RA 3WMFA 2AHRA 4H3KB 2BHLA 5JS6A 2QKYA 2X76A 4KIUA 2QD5A 3KLMX 1T9DA 1UJ6A 1Y9DA 2NVBA 2YWCA 3DKRA 3DVLA 4K40A 3HKEB 3NVAA 3R0QA 4L73A 4P92A 1CQIB 2VWGA 1VRVA 2CLHB 2QRVB 3M3PA 3WGZA 4NG4A 1LD3A 1J8VA 5EXXA 1S9HA 3QITA 4NTZA 1XZ8A 3SNHA 4DMMA 2ZJ4A 4ZI7A 3HLKA 4KVZA 1TCAA 2PYDA 3Q6IA 1ECGA 1GNPA 4J16A 3RFFA 4MVJM 3U7FB 3LPCA 4JLAA 3TLXA 3THXA 5IJWA 3MJ4A 4MVJD 4ECEA 1U0JA 3R5XA 4EBBA 2PWPA 5HKKD 2YMQA 2VNIA 2Q5FA 3QMMA 2WJYA 2X6TA 2P4UA 2Y71A 3JAWA 1CFZA 5BQ5A 3AM4A 1KORA 1KETA 3JQRA 2E4XA 3L6EA 5IAGA 2IYNA 1Z0KA 3EFEA 3DHWC 2JLRA 3UCEA 3WIVA 1UDRA 3CF4A 2BKXA 5JOQA 3FJ1A 3ZJYA 4DV7B 4ZEWA 4BVAA 2REOA 2P5TB 4KE8A 2VSXA 3M33A 2ATIA 3LHKA 3C6KA 4H7PA 1WG8A 3FMOB 4BMYA 4XI9A 1QIEA 4N41A 1YT5A 1MEEA 3AZQA 4D5GA 3PUJA 1EWKA 1ZITA 1W8IA 3BA1A 5AM5A 3OG9A 4S0ZA 4W5WA 1FDIA 3BL6A 2I33A 1ZU4A 1DQZA 4UUNA 1G1AA 1W4AA 4QBFA 1ZKDA 1JR3A 4URWR 3OTIA 4P98A 2GK7A 3HU5A 1ODKA 4NSNA 5CNIA 5IUKC 5H5JA 4DQUA 2VXBA 1P0CA 3SIWA 4C1NA 2HDNB 1NNSA 1VL1A 3GLRA 4M8KA 1WHTB 2P67A 4AJEA 4AN4A 4K0KB 2PQ2A 3OX4A 3U17A 3LDFA 1AV7A 2JJ8A 3SQMA 3NWJA 4R71A 3CG0A 2QP3A 2BI4A 3HWRA 2HK7A 1J5EB 4L6IA 3R41A 3GEEA 4ER0A 4ATNA 2OGZA 4DFDA 2GHIA 2YV3A 3OLCX 1QLHA 1KK1A 5L3RA 2VJKA 2ZIAA 4JB0A 5KTRA 1HL7A 4N5DA 4Y0AA 1OIWA 1SU6A 1M7BA 1Y7PA 2YW9A 3BB3A 4OHWA 3FBTA 1P72A 2JH3A 5E1MA 4B3MB 1MN6A 2EZ4A 1FRZA 3M83A 4C5CA 2G77B 1QF6A 5TY0A 3TX2A 2PU5A 3KAQA 4U6QA 4UNSA 2XEXA 2ZKLA 5KOJB 2FRDC 2VDOB 3SYRA 2H1FA 1RIIA 4REMA 4HD8A 2CN1A 1X6VA 4K86A 4G01B 1R37A 4RS3A 4H7JA 4WKOA 1JLKA 4R69A 3L77A 1ZRNA 2WUVA 3GMIA 2XGMA 2HF9A 3TSZA 4B5LA 2JAOA 3KVRA 4OY3A 1O3YA 3D6AA 4P4LA 1NKVA 3DYBA 2A2ZA 1CK4A 2BR5A 4UUPA 1RXVA 1MTOA 2ZYSA 3DC7A 4MQUA 1PR4A 3QMWA 3AR5A 2F8LA 2HCRA 3QF4B 3FETA 3QMVA 4LBZA 2WT4A 1EVEA 4BUCA 3TNDA 2ZSAA 1M6EX 1JBEA 1W76A 2XQGA 4MKGA 4EEXA 2HK8A 5AKKA 1A9XA 2QTAA 2V9ZA 3KR9A 1QHEA 4YO7A 4YUXA 4ZT4A 1ZNYA 3IRVA 1NZDA 3HB4X 1M9NA 1QYIA 4YQEA 1XGKA 1NULA 4EUKA 3LY9A 1F2VA 1BWRA 1CEEA 3LUFA 1YA8A 3SZRA 1KEEB 3OCJA 3PD1A 1JSZA 3TW8B 3HA5A 5FOUA 5G0SA 3MS2A 4C6HA 3ZCPA 3TNLA 2JKZA 3UGJA 4FILA 4LHWA 5KO2A 1B8VA 5AVWA 1CXZA 1O6ZA 4A26A 1QE3A 2JFVA 2O0LA 4E0BA 3VA7A 1GYPA 4WRRA 1TT5A 4JFAA 1DB3A 3LLMA 4OMDA 5C8VA 4RXUA 4RL6A 5EIHA 3P2IA 1X1AA 5INTA 1ZGCA 4EH1A 3WWPA 3CVYA 3K8ZA 3COSA 2YFHA 2NTJA 3UBMA 5TMDA 4YPFA 5B1YA 2XCRB 4UQLA 1EWRA 1OOEA 3RR2A 5JADA 3OKAA 4BNUA 1QVRA 2QVYX 4WLNA 3CVJA 2V6IA 3FLMA 3ZQ4A 5B3LA 5JS1A 3JQAB 2N0SA 5JD4A 4X93A 1TM1E 2QS9A 3FROA 4BKPA 1T3HA 1MMFB 4ICIA 1BGXT 2GZAA 3VC7A 1PBNA 2NNLD 2OA0A 3NTOA 3O4HA 1JR4A 1C1DB 3NHPA 1P1HA 4V0NA 5BNZA 4YRFA 1JEYB 1PK8A 5E2IA 4MWGA 4BGVA 2Y8EA 4G5GA 4BE7B 2QGNA 3WYEA 4ARIA 2QU8A 5JWOA 1Z5ZA 2OG1A 4IHQA 3MZ0A 1WBJB 4RF4A 3UANA 4OQMA 3JVVA 1CRWG 2KM1A 4WLUA 5BYJA 4N49A 3QU9A 1OXKB 4L8LA 5TRTA 3N8HA 2Q1TA 2C5BA 4K9MA 4EL5A 1ZI6A 3WMRA 3I61A 1CVIA 1U4SA 3PDUA 2FW7A 4K2AA 4PAMA 4EYGA 4KZKA 4OJTA 4Q15A 1M6WA 4YY3B 2HJVA 1K88A 4AZTA 1T5OA 2VHTA 2J87A 5LD2B 2X0KA 2Z2JA 5EHQA 3M1YA 5JCOC 2AMFA 5LA6B 3TR6A 1BOOA 3RRMA 4DLVA 1Q7GA 5FUQA 1AY0A 1U7PA 3TZ6A 3Q1KA 2DUJA 3A3PA 1O7JA 4XFKA 5IC6A 4IDBA 4IJVA 3HYRA 3ITDA 1YHZA 4Z0HO 4D9HA 1YBFA 1EA7A 1USVA 5IT0A 2R8BA 3ZWYA 1VE3A 1WP9A 1LUAA 2R7KA 5FWAA 1EAMA 4QA9A 3ET5A 3UUGA 2WJVA 4FOSA 2CT8A 1XD9A 1L5WA 1VHTA 3FGOA 2ANBA 3QVMA 2IHYA 2VUTA 1GPH1 3G8AA 2OB1A 3DKPA 4GVLA 4JLVA 4ZOLB 3RG2A 4DXHA 5C5CA 2G1JA 3IDQA 3CUEF 1EJBA 3IRUA 3QQ5A 221PA 1NQOA 2DHDA 4MIEA 4M89A 4KPEC 3QVLA 5HG0A 2HBQA 5LLSA 3SXJA 3OX2A 5KSWB 2CFSA 4R68A 3E48A 3H1PA 1KBQA 3C3BA 4HRYA 4LDNA 3G5UA 1G3IA 2G5PA 1Z4NA 2Y4NA 3LWNA 1O6CA 3DA8A 2RAUA 2WAOA 4R8MA 3NV9A 5G41A 4C08A 1VL5A 2PUVA 3A6FA 3RUPA 2BMJA 4C0WA 3V2GA 3EWAA 2H7XA 4ZQFA 5HQTA 3DT9A 4QYXA 3FLEA 4H7KA 4HZUB 2IHZA 4FYHA 3Q98A 4LW8A 3RIYA 3UPUA 4IJ5A 1ISFA 1DINA 1TAHA 1ZGBA 1BQ4A 2FDXA 2C0CA 1MJ5A 3AI2A 1J8DA 3L7BA 3QX7A 4QDOA 1NVEA 2YIDA 4PG7A 3EULA 3PHBE 4I5EA 1Z0DA 4EJ6A 3H5WA 2QE7A 3PHGA 4FWBA 2X2EA 3KM0A 3TLAA 3ZWVA 4IGEA 4MOWA 2NU9A 4NRDA 1YACA 4B40A 1P4AA 4LQ4A 3HJGA 1RFLA 1V11B 3G2MA 4DA8A 3E53A 2FHSA 1JEOA 2HHHB 2F8TA 2XEDA 3T1QA 1FOEB 1UZAA 2VDWB 2D1SA 1V71A 3VSCA 3JRNA 3SYLA 3R8FA 3IALA 1F6BA 2VTKA 3WDLA 4Z2YA 3LIIA 1PHRA 1ZK1A 4JQCA 1E7YA 1NUPA 4DIKA 4G37A 2APJA 4M8SA 5BN4B 4C7VA 2B30A 4L0CA 1M73E 1SU8A 5FP0A 4FFWA 4J49A 4EG5A 1XEWX 1V6CA 1TA0A 1SCNE 3VR3A 1GXSA 3OEEA 4BASA 1O5TA 4D9IA 2LUOA 5F7ZA 3BFXA 4DCSA 3WAJA 1CHNA 2BH9A 3EQ8A 4IGKA 1JXOA 4V24A 3FLBA 1CS4C 1VFPA 2XIJA 3VGJA 3CN7A 2WG2A 1T1RA 3H8WA 4DCMA 2YXBA 2IFTA 3QKIA 4MGHA 3DT6A 3C8DA 1FLVA 3TMKA 1PYGA 2AQIA 5IKOA 4KQXA 4LY0A 1J56A 3BSSA 4QQRA 5JCJD 1SBHA 3C85A 5IAEA 3EMDA 2XBUA 3DOEA 4L4SA 4MDEA 4CKWA 4W82A 1ULZA 2BISA 3C5EA 1Y9JA 1GLNA 3QPBA 3FSGD 4L4XA 2NQ8A 4FYKA 5FBVB 1QS0B 1OI2A 3H42B 3FOEC 3GJ7A 4M1YA 5DNCA 2R1UA 4Z9FA 1V35A 1GN8A 2SECE 2AW5A 4RUKA 4X20A 3YASA 2PX8A 4O63O 4YPVA 4G1CA 5LQUA 3HM9A 2B4RO 2VSYA 4G1EB 4F6CA 1EBFA 1SKQA 1A72A 2D1RA 4E4YA 3I9OA 2Y1OA 3B60A 3TI9A 2H4YA 1CY6A 1DBIA 5IJXA 1VP3A 3OO0A 2H29A 2AEJA 3F6SA 3UJDA 2ODBA 1N6IA 3G9TA 3GN2A 2FN9A 3LP8A 4BCDA 4C0AC 2ZIXA