2CF5A

Crystal structures of the arabidopsis cinnamyl alcohol dehydrogenases, atcad5
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
352
structure length
352
Chain Sequence
AERKTTGWAARDPSGILSPYTYTLRETGPEDVNIRIICCGICHTDLHQTKNDLGMSNYPMVPGHEVVGEVVEVGSDVSKFTVGDIVGVGCLVGCCGGCSPCERDLEQYCPKKIWSYNDVYINGQPTQGGFAKATVVHQKFVVKIPEGMAVEQAAPLLCAGVTVYSPLSHFGLKQPGLRGGILGLGGVGHMGVKIAKAMGHHVTVISSSNKKREEALQDLGADDYVIGSDQAKMSELADSLDYVIDTVPVHHALEPYLSLLKLDGKLILMGVINNPLQFLTPLLMLGRKVITGSFIGSMKETEEMLEFCKEKGLSSIIEVVKMDYVNTAFERLEKNDVRYRFVVDVEGSNLDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords CINNAMYL ALCOHOL DEHYDROGENASE
publication title Crystal Structures and Catalytic Mechanisms of the Arabidopsis Cinnamyl Alcohol Dehydrogenases Atcad5 and Atcad4
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 90
structure length 352
sequence length 352
ec nomenclature ec 1.1.1.195: Cinnamyl-alcohol dehydrogenase.
pdb deposition date 2006-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2cf5A02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2cf5A01
5T67A 2DAPA 3E8XA 3CH6A 1MLDA 3GUYA 1XG5A 1NR7A 1Y8RB 3A1NA 4BO7A 3I52A 2C29D 1C0IA 4UUPA 3VZPA 3KEQA 2JAHA 3L6OO 2EGGA 1PZGA 2EV9A 1ZVMA 2QQ5A 4PLZA 2DPGA 3ONFA 3FHLA 1PJ3A 2Y1EA 4HNGA 2CNBA 5JFOA 1YWGO 5I7EA 1V3VA 4KZPA 2NU8A 1QKIA 4FFPA 4DMMA 4J1QA 1NFQA 1DRUA 1YDWA 3PGJA 4J0FA 1I2ZA 3STHA 1D4FA 1M66A 4OXYA 5KWEA 5F21A 4CM8B 1T2DA 2IXBA 5C7LO 4OXNA 2D2IA 4XR4A 4Y98A 4BGVA 3JQEA 1YH3A 2WJPA 1Y81A 2JJYA 4J9UE 4XEHA 2X7HA 4XQEA 4BB6A 2C2YA 1LRJA 4UREA 1G1AA 4BNJA 3K31A 2LDXA 2PH3A 1T24A 3PJGA 4CMGA 4BNWA 2Q1UA 4L8VA 4TMFA 5ER9A 4BGUA 2C20A 1UJMA 3GHYA 5DF1A 3BMQB 1HYGA 1P45A 4EGFA 4D7AA 4FFLA 2I67A 1ZK3A 2HQ1A 4WKGA 4MP6A 5A05A 5DBFA 4O1MA 1H6BA 2OL4A 3ZHBA 4NMHA 1U2GA 5JNLA 4MKXA 4EUEA 4I5DA 3QHAA 5JC1A 1N1GA 4QT0A 3BA1A 5T8KA 3ZWMA 2TMGA 2VOEA 1F14A 3M6IA 1NASA 2I6TA 1LLCA 3PLNA 4NDNE 1N9GB 2CY0A 1RWBA 1I3MA 2OP1A 4BMVA 2POQX 1DOHA 1VRWA 2ZTLA 4BKPA 4CMEC 4J1SA 3DZBA 5HS4A 1E1LA 2D59A 1CJCA 2BHLA 2I66A 1X14A 4W7IA 3NGLA 4J16A 4MVJD 1JN0A 4ND5A 3KLMX 4ND2A 2VYNA 5G2OA 3AK4A 3PZRA 1TT5B 3JQFA 1MC5A 4GX1A 3SC6A 3SLKA 2O3TA 5DBGA 4Q39A 4WLEA 2C5EA 4DPLA 1RPNA 3K30A 1DEHA 5EIOA 2WD8A 3A28A 5A02A 1KEVA 1GADO 1HE5A 1HL3A 3ZWPA 1XQ1A 2IZ1A 2NNLD 1DIAA 3WFJA 2NQ8A 4PRKA 3WX0A 3DAFA 2E37A 3ETGA 4XX0A 2AEJA 4CLOB 4FIZA 1IE3A 4C7JA 3AM3A 3EW7A 4L74A 4FGSA 2VTEA 4XGNA 1MP0A 4CQMD 3WTCA 1JU9A 3E5RA 3QWAA 4LVCA 2BF7A 4NZ9A 1EVYA 3OP4A 1Z7EA 1R12A 4OJNA 4PIVA 1Q2XA 3WLFA 3WQRA 5B1YA 1Y5RA 2CVQA 2BFMA 1U4OA 1NAIA 5TJHA 3KYCB 1YB1A 4EBFA 1GPDG 2AMFA 3V1TC 3A9WA 4OSOA 5G0WA 1HDRA 2CUKA 4JP3A 5I7VA 5JAMA 3BHMA 1L1FA 4D3FA 4RVUA 2D8AA 4P8RA 5T8KC 2JAPA 1ZUD1 5JS6A 3HDYA 2EERA 3DZFA 5HM8A 3WYCA 1LRLA 2GD1O 2H63A 2JCYA 5TQVA 4BO5A 5TX7A 1GFSA 1H6DA 3WNVA 5TRTA 4HFMA 4PRLA 4XKJA 1ORRA 3PHJA 4IJUA 4R1TA 4TKMA 2DTEA 4J1NA 5DP1A 2C82A 4DL9A 4N54A 4L4RA 4IM7A 5FF9A 2V65A 3JQFC 2VUUA 1H2BA 2Y1DA 3KXDA 3MWDB 1EDOA 1N92A 3K5PA 3LC2O 3RCBA 5K6AA 2FY8A 3RUFA 1JKFA 2HRZA 2FWMX 4YT8A 4UUOA 4NJMA 3A06A 1NQOA 3DR3A 1T2CA 2HK9A 4WEQA 4A26A 3TF5A 1KETA 1E6EA 1FF9A 1NP3A 1E7YA 2EG9A 3WIDA 3GMDA 5KJ1A 2CVZA 3QY9A 4BO3A 2DM6A 1U8FO 4XJSA 4DIOA 3I9MA 4XA8A 2WD7B 5DCWA 2AE2A 3TDKA 3AOEA 1A9YA 2PTGA 4WNIA 2VHYA 4O63O 2O3JA 3JQ7B 5BSHA 1SMKA 5AYVA 2DPHA 4GAEA 1MA0A 3EMKA 3AFNA 2F1KA 3GDFA 4FFNA 1BSVA 4ITUA 1VJ1A 1GYPA 4I5FA 4MIYA 2ILTA 4A73A 1ZXBA 3C7AA 1LSSA 3JQGA 3HDHA 4FS3A 3FR7A 1GZ6A 1T4BA 4AJPA 3D5TA 1XQ6A 1HZJA 3MJ4A 4NIMA 1Y6JA 3GVPA 3OJEA 4Z9FA 3D5QA 3E9MA 3JQ6A 5DN9A 1HTBA 5A4DA 1D3AA 2PZKA 1VE9A 2EHDA 2DU8A 3D3WB 3GLQA 5ES3A 1ISJA 1JW9B 1PJBA 2P2SA 4BMNA 4MVJM 5BNIA 1CEQA 2YV3A 4WNCA 3GY0A 1ZFNA 1NPYA 4IDEA 3A14A 1QYWA 2IODA 5L4LA 1C0KA 1PJCA 3IOYA 1ISIA 1G6KA 1SEVA 1U3WA 1YL7A 4FOOA 2GSDA 3H9JA 4WCFB 5COQA 3S2FA 3CPSA 4MKRA 3ETDA 4MVJF 3RAJA 3F1LA 1W8DA 3TWOA 1NHGA 1Y7TA 1ZMTA 4EI2A 1B2LA 1V9LA 2ZB7A 4PLPA 3MOGA 3WJAA 3Q0EA 4FJ2A 1BXGB 4HV4A 2NTJA 3QVTA 2PH5A 1FDSA 5K6AC 1Q0HA 5JXWA 4RVFA 4FPXA 4ZRNA 3M1AA 2NVUB 1QYCA 1HETA 3OQ1A 5H82A 3F46A 1BXGA 3N7UA 1BW9A 4NI5A 3KTDA 3UCXA 1N5DA 3L4SO 3MEQA 1M75A 1RM0A 4XWYA 5EESA 2QYTA 3UHAA 7ADHA 1DC4A 3NTOA 2NADA 4A2CA 2PZMA 4HUJA 2XPCA 3AOEC 4RVSA 3L4BC 5BSEA 3U5TA 4P4GA 2GCGA 2YW9A 3GQVA 3ABIA 3I83A 3WR5A 4B3JA 3QVXA 2Q2VA 4I5GA 5L9AA 4DIBA 3PXXA 2J3KA 2DFVA 4J2OA 3ZN2A 1PGNA 1XELA 3B1KA 1RYEA 2EXXA 4MJLA 5HWSA 2B36A 3ZWWA 3CKYA 3RC1A 2Y1CA 4CM1A 1QV6A 3PLRA 1EUDA 1UP6A 5I9LA 2OMEA 3KV3O 2CVOA 4DYVA 1X13A 1C14A 1EK5A 2FPPA 4DWVA 5KVCA 1YOVB 3LU1A 4O5OA 5CEEA 2J6IA 4MDHA 1Z7BA 3VH1A 3RJ9A 1XDWA 5LDHA 1PQPA 1FK8A 5U9CA 4WOJA 4OQYA 1EZ4A 3DBHA 4GL4A 4G2NA 4I9UA 4QECA 1GDHA 4LVUA 2B35A 1PIWA 2ZYAA 1PR9A 4W82A 3OJFA 3HHPA 1MXHA 1E1NA 2Y0EA 3ITKA 1QMGA 4YTEA 1PZEA 1C3VA 1SB9A 2UDPA 3TNLA 2PZLA 1P31A 1C1DB 1UZMA 4WK6A 3VDRA 6LDHA 2JFGA 1T2FA 1Q1NA 5CDTA 1G0OA 2W2KB 4IDBA 3GOHA 3LC7O 4Y9DA 1PZFA 3CEAA 3WNQA 4B7CA 4RGBA 3WGTA 2Z1MA 2FRDA 1OAAA 1I32A 1ZZEA 1OI7A 1EEHA 2X9VA 4PLCA 4IPTA 4PG8A 5TLSA 2LDBA 4BNIA 3L0DA 4HKTA 4PG4A 5A06A 3ZWCA 5JCXA 3NDJA 4J0EA 4Z9YA 1QG6A 3EC7A 3GEDA 3GVCA 4GMGA 2P4QA 5JMWA 5CEFA 3V1UA 4TRNA 1ZK4A 3ICPA 3AJRA 3ZDFA 2BGKA 3ANMA 4FC7A 1YBAA 1J6UA 2A92A 2GLXA 1PJTA 3X2FA 3TRIA 4YJDA 4F46A 3GDGA 2VWPA 4K6FA 3D4NA 2I99A 3VDQA 5A3JA 3Q6IA 2RH8A 3MTJA 1O0SA 3F9IA 4IQ0A 4EJMA 5JO9A 3O8QB 1JQBA 3OECA 3AUUA 4CV3A 2WE8A 3FNFA 2BGLA 4ALMA 1OBFO 5AXDA 4IXTA 3JYPA 2PZJA 4YQZA 4J6FA 3RBZA 3A4VA 4MOWA 2D5CA 3TQHA 2EKPA 2PKRA 2A35A 2VRBA 1H6AA 3FD8A 4IDGA 3U9LA 4GLOA 1PX0A 3V1YA 3GRKA 4S1VA 2Y05A 3LF2A 4JLWA 3RFXA 2C59A 1QRRA 4KQXA 4Z3DA 3VTZA 1M6WA 2Y66A 1BDBA 3B20A 3GGGA 4Y6PA 4NG5A 3VH2A 5GMOA 4WLFA 4UULA 4XJTA 4OH1A 2AA3A 1V35A 2BKAA 1CYDA 2W98A 3BTSA 4MVJA 5FI3A 1PJSA 1ML3A 1KVTA 1E7RA 2VWHA 3SJ7A 1WPQA 4IBOA 4WLOA 4UVEA 3WDSA 4CR8A 5JY1A 3LF1A 1K89A 2Q1WA 4E5MA 2D0IA 1Z75A 5FI5A 4AL4A 3I4FA 3NJ4A 4N18A 1H5QA 4B7UA 5K9ZA 3G49A 4AJ1A 1JVSA 3TZCA 4DYDA 1GUZA 2W90A 3R1IA 3I9LA 2B4TO 4YQYA 1UXGA 2EEZA 4IINA 2OBYA 2EP7A 1RM4A 3Q1LA 2RHCA 3JSAA 4JK3A 3PTZA 2V6BA 3OM9A 5IDYA 3ZNNA 4CLDA 4KTVE 3H9UA 1A7KA 4U5QA 1E92A 3U0BA 2AG5A 5CAEA 3MWEB 4PCVA 2JFFA 4E5KA 2OP0A 3ULKA 1OC4A 3ZZNA 1H9BA 3K2EA 4QQRA 4WLNA 1M2WA 3DDNA 3IAHA 3UFXA 2B4QA 2Y93A 2HUNA 1X1TA 2J3HA 3DBRB 4NQZA 4RCVA 3GG9A 4FC6A 4WE3A 5TF4A 2I9PA 3LLSA 1A7AA 4NBVA 4FGWA 4WLVA 3RROA 1UP4A 4ZICA 3DBRA 2CDCA 3DEYX 4ZA2A 1MG0A 4KDFA 3VKVA 2NACA 3AY7A 4N5MA 5AXCA 3D3EA 3ENNA 5TJ9A 2H1SA 1PL7A 1I30A 1N7GA 2R00A 3ICCA 4P4LA 1KY4A 3WGGA 5IF3A 1HXHA 1PZHA 1ZCJA 5KJFA 1R4NB 2VZ8A 4MKZA 3WG9A 3S8MA 5IDXA 4I8XA 5IZCA 1QR6A 1K2WA 2BFPA 4WLUA 4FDAA 1BGVA 4DC0A 3JQ9A 2Q3EA 1UZNA 3C1OA 3NDRA 1U1IA 1R4NA 4IDFA 3LT0A 1DLJA 1Q7BA 5BR7A 2HSDA 2BFOA 5A9SA 1YKFA 3FBTA 3UXYA 4KWIA 4NBTA 1YQXA 2FP4A 5L40A 3M1LA 4XZ3A 3PK0A 1U7HA 2VNAA 2HK7A 4D42A 2BGMA 1ONNA 5H83A 1EE9A 1NFFA 2PKQO 3UICA 2CF5A 1I5RA 3LYLA 3TZHA 5IDWA 5KCZA 1MUUA 3AI2A 3ZU3A 2GRAA 1NYTA 3GZNA 1N8KA 2BD0A 4UVHA 2NLOA 3DZJA 4JJIA 3HUDA 4YYZA 2NWQA 4PVDA 5TSDA 5K0ZA 1UDBA 4PG5A 2I5PO 4KUEA 1DAOA 3EGOA 3V2HA 1GCOA 3R3SA 1BDMA 3WGOA 1ZEJA 3HADA 3B70A 2YYYA 3UGKA 3QA9A 4HNHA 4XGKA 4PLHA 2ZYDA 3ENKA 5HA5A 1PS0A 4LSWA 2OHXA 5ILGA 5KVQA 1N1EA 4JJGA 1JA9A 2O4CA 3KEOA 2X5OA 3V8BA 4MVJG 5JYDA 4BKRA 2VHXA 1ZMOA 4W99A 1B8PA 3DXFA 3W8DA 5G0UA 1ZSVA 4L76A 3OF2A 2VQ3A 4OGWA 2B83A 1Q7CA 2JCVA 3I4CA 1A72A 4II2A 4M1QA 4BQPA 3HZZA 3GF4A 3TZKA 4B79A 5GZ3A 2GZ3A 1TB4A 4CMHA 3DO5A 1SOVA 4INAA 5AOVA 2P5YA 5C5IA 1GPJA 5DOVA 3U49A 1ENOA 1C1XB 1HE2A 3BMCB 2X86A 3JQ9C 3NTRA 4CLXA 3WBBA 3RD5A 1LDBA 4HY3A 3R0IA 1HDGO 1MV8A 3H4VA 2PD6A 4YJHB 5CDYA 4DBVO 2ZCVA 3HB4X 4RZIA 5B12A 1KIFA 4YDRA 1D7OA 4DLBA 1Y8QA 4EZBA 4W7HA 1HWYA 1E6WA 1R4MA 3PYXA 5EL0A 3U4CA 5BQFA 4AJJA 2A4KA 1GZ4A 3IJPA 3Q2IA 3T7CA 4FJ1A 4B4OA 3RUDA 3OQBA 4R9RA 3AM4A 4L75A 5I9MA 3W8FA 3TPCA 5JYEA 1LQUA 3GG2A 4B8WA 1L7EA 5DNAA 4DTIA 4M55A 4UVGA 4GPD1 1LDGA 2DQ4A 3GPDG 3SC4A 3EYWA 1DIBA 4R3WA 3EHEA 3EZLA 1FJHA 3U4DA 3GN2A 4NPCA 3DONA 3DQPA 1I0ZA 3PVZA 1WDLA 4J90A 3SXPA 5ICSA 1KC3A 4E3ZA 5EQFA 1TVEA 3CZMA 1I2CA 3GGOA 3W1VA 2XF8A 3WYEA 2VYVD 3ZV5A 4F6CA 1BG6A 1ADCA 3W8EA 1DIHA 1ZK1A 5B4TA 4PLGA 1LUAA 4YXFA 1O6ZA 1U9JA 2QX7A 3ROPA 4DLLA 1ENPA 1P1FA 4M87A 4BB5A 3BAZA 4N5LA 1LSUA 4O59O 1ENYA 4U6SA 4YEDA 1SO8A 1GUFA 1EFLA 2G17A 4E5PA 1SOWA 1F06A 4R1UA 4IMRA 2PGLA 5IJZA 2NU9A 4H3VA 1IPFA 5GZ1A 3HDQA 2ZTVA 5EPOA 1Z74A 3RC7A 3DL2A 4ONEA 3I6QA 3QRWA 1M67A 4XYBA 2X0NA 4RZHA 5JPIA 4BQRA 5BNTA 4Z6KA 3RQSA 4K28A 1UZLA 2H9IA 3F5SA 4RVHA 4ZU3A 3U62A 5JLAA 2ZIZA 3JV7A 2R6JA 2Z5LA 2V6FA 2ZK7A 4ALLA 4CLEA 4UVDA 2GNAA 2ZTMA 3DBLA 5ITWA 5KVVA 3L6EA 4EUHA 1BVUA 2VZ0A 3M2PA 3RUEA 4MIEA 4P38A 1J49A 1UXHA 2RBEA 1IUKA 1B8UA 1O8CA 3ASVA 1PL8A 4IQ8A 4D0SA 5B37A 5A1TA 4F6LA 1CERA 2EW2A 2JHGA 3PWKA 1ADGA 1CETA 4C4OA 4CM9A 2YV1A 1DRWA 3RU9A 8ADHA 3IJRA 4EEZA 4Z0PA 1E7QA 3QVOA 5MDHA 3S2GA 3NYWA 2YZ7A 4IDAA 3UKOA 4KDEA 3H9EO 3JQDA 5G4LA 3JD0A 1DJNA 1KERA 1DFHA 2ET6A 4OOFA 9LDBA 2ZJ1A 2GR9A 3CIFA 3ONEA 3GHHA 5IXYA 2PD3A 3PRJA 4ZQFA 1Q7GA 4RVDA 1CRWG 1HSZA 3E82A 1X15A 5DZSA 3RKRA 2E6UX 4BO8A 3BTOA 5KJEA 2VRCD 5A04A 1I2BA 2X5JO 2O3SA 1N7HA 1EUZA 5I7FA 3BMNA 1LSOA 2WEKA 4I08A 4TKLA 1LNQA 5EINA 4FB5A 1NXQA 4LN1A 1PWXA 3I9JA 1PJLA 2WTBA 4M49A 3CTMA 3AOGA 3GAZA 1LI4A 1QLHA 5L4SA 1WVGA 2GN9A 1PGJA 2P9GA 5KVSA 3CXRA 3H3JA 3H7AA 1BRMA 2PR2A 2IDZA 3NAQA 2Z95A 3MCVA 1LDMA 4TROA 5KKAA 2PGJA 3BZUA 2RIRA 2BRUA 4YJFA 4BNMA 2O2SA 3RFVA 1BXKA 1DFIA 2DBVO 2G0TA 1IZ0A 2G82A 4WECA 3PPIA 2YFHA 1Y1PA 3RC2A 2CDBA 1U5AA 4QXMA 1YBMA 4Z0TA 4D43A 1GEEA 4XRRA 2D4AA 4AFNA 4KTTE 5A9TA 3Q2KA 3Q11A 3HN7A 3D1LA 4XGIA 4FD3A 4P4NA 2VNSA 3ZGYA 1D1SA 2I76A 2FSVA 2W4QA 1E7MA 1NVGA 1NWCA 5TS3A 3ADOA 1EUCA 2GYYA 4KUGA 5JBIA 3BXXA 1GY8A 5G0SA 5CG1A 2C54A 4NJMB 1GAEO 1LTHR 2P9CA 4RPJA 3PYMA 3WB9A 4R9SA 4AJEA 4E2ZA 2PLAA 1V6AA 4IQGA 5KIAA 4IIUA 3SVTA 2B37A 4FFMA 4U0KA 3E6AA 4OO3A 2PY6A 5U4QA 5IXSA 4MP3A 5TNXA 1DPGA 3IP3A 3CMMA 1B16A 2D3TA 1IY8A 5JW6A 1SCUA 5AXBA 1LU9A 4CM6A 1K3TA 1AHHA 1QLJA 4TQGA 4UEKA 4NBRA 1H2HA 3AWDA 4GBJA 3W4IA 1DHRA 1Q0LA 1B0AA 2NUAA 4CL3A 4E4YA 3L4BA 1HE3A 4KMSA 4R5MA 3SJUA 1KVSA 1AXEA 3JQGB 4NFYA 4BGIA 1MGOA 2AEFA 4II3A 3PHIA 3DHEA 4ALJA 1UXJA 1GZ3A 1BWSA 2I65A 2VHWA 3K96A 1E77A 3E9NA 2JL1A 2P9EA 5JSFA 4CMAA 1F8FA 4UEOA 5JCJA 1HRDA 3LZ6A 4GI2A 3E03A 1WMAA 3W6ZA 2DKNA 4JBHA 3JYQA 1DIRA 3PWZA 5JAIA 1ISHA 4J4TA 1YL5A 4PN3A 3ZW8A 1V8BA 4AJIA 3JQAD 3JD1A 2FR0A 1LC3A 1H9AA 3DMTA 4RF5A 4Y6SA 4HFNA 1MFPA 4DGSA 4WCDA 2WYUA 4U0JA 1HEUA 3AUTA 4RPKA 3JYLA 5CP8A 1KS9A 2YQ4A 4EUFA 3I6IA 4G5HA 4YCAA 4LSMA 2XAAA 3WICA 4D41A 1YS4A 5EERA 3CINA 2X6TA 3WGHA 2WMDA 4OM8A 1JTVA 2ZB3A 4XIYA 3AU9A 1UUFA 1O95A 3GFGA 3D0OA 4RORA 1BW9B 3ZV4A 2CD9A 1F8GA 3RUIA 4CM4A 5DDIP 3H8VA 2HMVA 4DREA 5FFFA 5C7IO 2X9GA 3VC7A 3K73O 5F1OA 1E3SA 4R5HA 3LSYA 3BIOA 1U28A 4HADA 2BLLA 2ZB4A 3DFUA 2PA3A 4XDYA 2WE7A 2CSUA 2HJSA 2Y68A 3GFBA 1E5QA 5G0VA 2V7PA 3I9OA 1B3RA 4YAJA 1LRKA 4ZRMA 3QW2A 1H0KA 2AQIA 1OFGA 4Q3NA 3RUAA 2RCYA 1VL8A 4JX8A 2QIOA 3V5NA 5IN4A 4RL6A 1Z6ZA 1P1HA 1EBUA 2PV7A 3DZHA 4GVLA 4TVBA 3INTA 2V6MA 1WW8A 3AY6A 4QSMA 5A3VA 1MG5A 5I9NA 1ZH8A 4OSPA 4YWJA 3WSWA 4R69A 1ISFA 4PLWA 1JVBA 2G76A 2IZZA 3LVFO 3VOSA 8LDHA 3FRJA 2UUOA 3WXBA 3ETEA 4RVGA 3L9WA 2AQ8A 3DAGA 5F1PA 1HT0A 2EF1A 3G79A 1OOEA 3KRTA 3ZW9A 1NQTA 3C8MA 2GDZA 3U4HA 5T6BA 4YR9A 1NAHA 1E3JA 1DO8A 2J5KA 1AE1A 3PWSA 3NT2A 3DBHB 4JN6B 3ZWVA 3GDOA 3DMTC 1B8VA 5IN5A 3PQDA 1PEDA 4RJTA 1PSDA 3FN4A 2CMDA 1HLPA 1R15A 1BHSA 2YFQA 1N2SA 2OUIA 3VVCA 3FBGA 3L6DA 3QJ5A 3H65A 3ZWAA 3V2GA 3WIEA 1LJ8A 4OL9A 2GASA 1ONPA 1QORA 1YXMA 3JD4A 4E2XA 2AE1A 2DLDA 2NU7A 3FPLA 3S55A 2GZ2A 4UEJA 4FFRA 3FPCA 2E4AA 1SZJG 3DB2A 1Y9AA 4LW8A 4XYMA 4PGFA 3ZCXA 3HB5X 3OIFA 1EMDA 1AHIA 5T5QA 4FCCA 4BUCA 2FSSA 2UAGA 4D45A 2AQKA 1JLLA 1SNYA 2R2GA 2YY7A 5L4NA 3GH3A 4BNHA 1IYZA 3H9GA 1XLTA 3HSKA 4BO9A 2VYVA 5ILOA 1NFRA 1VJTA 3OJLA 2VUTA 3LK7A 4Q3CA 5A03A 2HRBA 1QSGA 3VAZA 2CDAA 1FDWA 2C7GA 5F5NA 2X0RA 3I1JA 2UYYA 3LQFA 5DT9A 3EVNA 1QP8A 3JTMA 2Q4BA 4PLYA 4EW6A 2X58A 4N7RA 4OAQA 3FWZA 1IL0A 5KNLA 4J3FA 1AXGA 1GYRA 4HP8A 3PGXA 4F3YA 4AJKA 3KBOA 4MINA 4R68A 3ORFA 2EIHA 2X8LA 4XDZA 3RI3A 4B3HA 5HS6A 1LDEA 1EQUA 1JWBB 2O7SA 1ARZA 4IDCA 4IXWA 1I10A 4TWRA 5EMHA 1U7TA 4YRBA 4PG7A 3DWFA 4IMPA 1SEPA 2HMWA 2ZCUA 2EJVA 1QYDA 1I3KA 4J9VA 1WZEA 1MC4A 3EZYA 4AICA 5LC1A 5IFLA 1KEPA 2HMUA 3QQPA 4A03A 3QVSA 4IY1A 3EVTA 1UH5A 3NJ8A 4D46A 4XRGA 1PJ4A 1T2AA 4CLHA 1FMCA 3BMOA 4EJ0A 1A4UA 5L3ZA 1A4IA 1HYHA 2BELA 3TN7A 1ADFA 3TZQA 3QSGA 4CJXA 4XYLA 3DHYA 4OHUA 4Q9NA 3LLVA 1BVRA 4BNFA 1K6JA 1UXIA 1A27A 1JDJA 3IKTA 3H5RA 2PWZA 4WGGA 3W4JA 4TRJA 2PFGA 3QWHA 4L9RA 2E49A 4ZN6A 3PFWO 3PEFA 1TT7A 1GV0A 1YDEA 2G5CA 2WWRA 3I23A 3OH8A 4R01A 4QFCA 4XYGA 4BKOA 4DQVA 1UDCA 2PKQP 3WSVA 1GV1A 3G1TA 4XD2A 4BNZA 1A9ZA 3P19A 4AJ2A 4B4VA 2J3JA 4BV9A 2E82A 3DBVO 1XGKA 5JE8A 1KVRA 2I3AA 1J4AA 4CUJA 3IIEA 4EITA 4E12A 1CWUA 5CEJA 5JC8A 4UAGA 5DOZA 2D1YA 1U4SA 5BSFA 3INGA 3I9NA 5COBA 4XYEA 2DC1A 4DUPA 1T2EA 1WLYA 3PJDA 4CQMA 2UV8A 3UW3A 2QRJA 3IC5A 3QWFA 4RF3A 1XKQA 3HFGA 3HNPA 3V2UA 2CZCA 2FOIA 1K5HA 3F1KA 3D64A 4JP2A 1KYQA 1X0XA 4CMBA 2Q99A 5L51A 1PWZA 2EKQA 4QX6A 4GX5A 3UUWA 2ZKLA 2HDHA 5IAAA 1FDUA 1LC0A 4OQZA 1VSUA 4CPDA 3RU7A 1LSJA 4RV9A 1I8TA 2FR8A 2HKIA 1SPXA 4AJOA 4LK3A 1HYEA 3Q3CA 3KYDA 5FWNA 3ROKA 2WM3A 5TT0A 4ALNA 3CE6A 4DIFA 2OZPA 5JDCA 3HQ4O 3RKUA 3PJFA 2Y1GA 3GEMA 2O50A 3VTFA 1U3VA 3PDUA 1WWKA 2H6EA 3K8ZA 2F00A 4GKVA 3JQ8A 1B3BA 3TOZA 2X0IA 3GZ4A 2O3RA 3MJTA 5A9SB 4GWGA 1DLIA 4NH4A 4J7CA 1P1RA 4RPLA 4I5EA 2ZB8A 3HDJA 1DRVA 1XEAA 3DTTA 4GGPA 3WGYA 4B4UA 1YBVA 4ROSA 4GKBA 1RYDA 3VHRA 4ALKA 4MO2A 4O0LA 3KZVA 1YONA 3CMCO 3DTYA 3PHLA 2O3QA 4NJOA 4YRDA 3VPHA 3ZWOA 3FCOA 1ZNQO 4CQLA 2O7QA 4JGBA 1WAMA 3GZNB 3GA0A 2ZYGA 1SB8A 4AG3A 4NR0A 4CMIA 3C7DB 4U8GA 1YL6A 3WBFA 3P2OA 3EUWA 4A0SA 3PJEA 4CMJA 1E3WA 3WS7A 1X7HA 3D4OA 1ZKMA 3UH1A 1K6IA 3S2EA 2DUUA 3ASUA 5DBIA 2EJWA 3C24A 3LDHA 3FWNA 1U5CA 3QE3A 4H15A 4LRTB 2GO1A 3RVDA 4OMUA 4NK4A 2Y67A 4JBIA 3QWBA 1ZSNA 4FQ8A 5DCUA 5BSGA 4EEXA 3PZBA 1X0VA 3DMYA 3JQCA 1IHYA 4A10A 2CF6A 2PD4A 5MGBA 1TXGA 4GMFA 4KWHA 3GPIA 1T1RA 3EY4A 4YAGA 2GF2A 2OORA 1PQWA 3ZNQA 2PGDA 4ZGWA 5DULA 2O4UX 1XYGA 2B0JA 5JDCC 3E18A 4R1NA 4HFRA 3RBVA 2JD2A 4BOYA 1PGOA 1TA4A 1CQJA 4E21A 5CFZA 1YB5A 2G1UA 3H6KA 4J43A 4DVJA 3JQAA 5LCXA 4QTZA 1EVIA 4FJ0A 4BO6A 4GX0A 4H7PA 4ZD6A 1TEHA 1XR3A 2C7VA 1NTOA 1RJWA 4DQUA 4E5NA 4XCVA 4ZQBA 4PLTA 4JROA 4YB8A 4BV8A 1YJ8A 1S6YA 1C0LA 4B4WA 1Y8QB 2NV6A 3ZHZA 3JYNA 4LRSB 4E33A 4IS3A 3QLJA 1R4MB 1PR3A 2C5AA 4TRMA 1NNUA 2P5UA 4DPMA 5IDQA 4Z3KA 3HG7A 1P33A 2Q2WA 4GX2A 4R1SA 4BKUA 1K0UA 3UN1A 1KEUA 1E3IA 1EQ2A 1R0KA 2A94A 2NM0A 3PIIA 4CMCA 1HE4A 4YJGA 2XXJA 4TZTA 1JAXA 3IQDB 4DA9A 4JQCA 3UCEA 2EWMA 4CL8A 3VPSA 3H2SA 3ZWNA 1EFKA 1X1EA 3IKVA 3C1AA 3AUAA 1U8XX 1ID1A 5KKCA 3GVHA 3TOXA 3TFQA 3F47A 3JCZA 2J3IA 4WASA 3WQQA 4QO7A 2P68A 3COSA 3FF4A 3HN2A 3N58A 2BMAA 3AW9A 2C2XA 3OHSX 1P1IA 3VVBA 4IJKA 1GCUA 3K9QO 4IDDA 4IJVA 5HBRA 3X2EA 4CLRA 1VI2A 2HO5A 2UUPA 3F6YA 3EAGA 4MPDA 1XWFA 1KC1A 4YAKA 1HZZA 1HSOA 1X7DA 1DJQA 2B5WA 9LDTA 3PHGA 4RQUA 4XQGA 3ROQA 3U4IA 2ZQZA 1YQDA 1ZSYA 1IB6A 3NKLA 2PNFA 3FNHA 3HWRA 4CR6A 1Y8RA 6ADHA 1GD1O 4PLVA 1ZW1A 2DVMA 1P1JA 1DC5A 3PFFA 2QRLA 4RQTA 1M6HA 3DC2A 4JJFA 4JXKA 1MXFA 2Y99A 4J91A 3S1LA 2Q4EA 4ZVVA 2JCXA 3DBLB 1V3UA 3PI7A 1HLDA 4ND3A 4NFSA 1L7DA 1PTJA 4IZIA 2IYOA 1VJ0A 4CM8A 3OSUA 1ZO8A 1ZBQA 4O6VA 1E3EA 4PG6A 3KETA 2FR1A 1DC3A 4CV2A 3RUHA 1DAPA 3OETA 1SBYA 3OMLA 1VL6A 4W9NA 4BO2A 1JKIA 3BMQA 1YRLA 2P4HX 3I3OA 3FSRA 4R54A 5I8WA 3ZWYA 4I9HA 3SLGA 5TIIA 3JD3A 3ANLA 1DBVO 5COAA 1ZJZA 4E2WA 4KUHA 2WDZA 3ZWXA 3R3JA 5B4UA 1P0FA 1BTOA 1YQGA 1EE2A 3I5MA 3WGIA 5GY7A 3KO8A 1P1KA 4Q3BA 1Z73A 3D4PA 3EDMA 3OA0A 2DBZA 3G17A 3WWZA 3QVWA 3FI9A 3WQSB 4NBUA 2DBQA 1R37A 1W6UA 4MVJH 1E7SA 3OJOA 4PLFA 1N9GA 2FPIA 2Q50A 3BMNB 4BL5A 2Z1NA 4QFDA 3G0OA 3OFSA 3VKUA 2A9FA 3B1JA 3KHUA 3G3EA 3DOJA 1PS8A 3W6UA 3ZV6A 1G0NA 3AU8A 2C07A 1M76A 3GNQA 1TT5A 4MP8A 5GZ6A 1F17A 3VH4A 1W0CA 3WYBA 2DT5A 2BH9A 1P77A 1UR5A 3RWBA 3OICA 2GN4A 1ONOA 4YJFB 1F12A 4U7WA 5JAQA 3PP8A 1BXZA 4RDHA 1HDYA 3MJSA 3PDJA 1CIVA 2FHSA 3DAPA 4CODB 2IYPA 4CUZA 2GZ1A 2GPTA 4K9DA 3NRCA 5KJCA 2GN8A 4FW8A 4MVJI 4UUNA 3NTQA 3PQEA 4YPOA 1GUYA 2YJZA 3AFMA 3LC1O 4FR5A 1EVZA 4CLOA 3L07A 3Q9UA 1ZEMA 4BGEA 3GAFA 1PGQA 1ADBA 1WDKA 4LCEA 4J7XA 1YVEI 4Y6RA 4GQAA 4BO1A 1QV7A 3E5MA 5JO0A 1VKOA 1FXSA 1XA0A 4W9NC 3GR6A 1WNTA 4J7UA 2VWQA 3SX2A 4JIGA 3U3XA 3PQFA 4RPHA 2PK3A 3P2YA 3ADPA 1P44A 4FOSA 3S2IA 4M86A 3OQ6A 1RM3A 3MJEA 3KYCA 1E3LA 5ICMA 2X1HA 3WMXA 1ZIDA 3OJ0A 1UDAA 4HFJA 1RKXA 3W4KA 4XIJA 4YA6A 3WFIA 5L53A 1T26A 3GEGA 4XB1A 1LXCA 2QZ9A 1NVTA 1GR0A 3DOOA 3DZKA 4OKIA 4BIIA 4OOEA 1ZK0A 2NSDA 4ZQHA 5CPFA 4Y8VA 3QV1A 1OZAA 3GNSA 4KQWA 5BNFA 1PJQA 3F4BA 3N74A 2AEMA 5ENDA 4GLLA 3VZQA 4D3SA 4BNGA 4TZKA 1LX6A 2UVDA 3RBXA 3QP9A 3ZNPA 4HX5A 4M8SA 3O9ZA 4AJNA 4E0BA 4A7PA 4RF4A 3KSDO 3C1TA 3GNTA 4EYEA 2W2LD 3RC9A 4YAIA 2IZ0A 2SCUA 2WSBA 1SAYA 4BNTA 4MVJP 2E48A 4PZDA 1D8AA 2VZ9A 1R0LA 2DFDA 5G0TA 4N5NA 5L95A 5A9RA 1EK6A 4E30A 1J0XO 2OXIA 1GQQA 1IOLA 3LT2A 1YJQA 1AN9A 1EDZA 4RPGA 3ANNA 4S3MA 1OC2A 3K6JA 5DCYA 3WTBA 1Y5MA 5HRUA 1IULA 3NGXA 3NV9A 3ZHXA 1DB3A 1EBFA 4B8ZA 1LBEA 1WMBA 3GRPA 4A5OA 1I24A 1GQYA 1GU7A 1ULSA 3JQBA 4HXYA 4E31A 3JD2A 4L4SA 4L4XA 3KLPX 4CMKA 1PJ2A 2ZATA 2OOSA 1P0CA 2VN8A 2WD7A 2X23A 5JDIA 2X4GA 1LLUA 3VPFA 4M54A 4GSKA 4YT2A 1CDOA 2IRWA 3JQ7A 5THKA 1XSEA 1YE3A 5FYDA 3B6ZA 2IE0A 2J5QA 2BFAA 5G4KB 3GN1A 5ENVA 3MOIA 4CM4B 2DBRA 3KVOA 1JAYA 5K1SA 1P9LA 5CDSA 3P5SA 5TT1A 4CV0A 5G4KA 1DSSG 1R16A 2X5KO 3HFSA 1MB4A 2HAEA 4GVXA 1DFGA 2YQ5A 4Y67A 4DQXA 4EJ6A 5AQ1A 1XHLA 1SC6A 1UXKA 5FEUA 4R41A 3D3WA 3UOGA 2GERA 2HJRA 4TRRA 2GN6A 3UVEA 1X7GA 3KYBA 3GGPA 4D79A 2AXQA 1E5LA 4Q3AA 1NPTO 3ZH2A 3TFOA 1IPEA 4WCFA 5C37A 2QHXA 3AI3A 4WEOA 1IZ9A 4R3NA 1LDNA 2VT3A 3ST7A 4FBGA 2VHZA 2AG8A 1LEHA 3I9KA 1GTMA 4I1IA 5KTKA 4BNKA 1YB4A 4EDFA 1XIVA 4OKNA 4HWKA 5H81A 5LDGA 4DBZA 3K2BA 1KY5A 5THQA 2RH4A 2WYVA 5BT9A 4GSLA 4CM7A 2NVUA 3DZIA 2FMUA 4XB2A 1T1SA 4ND1A 1MFZA 3WGZA 3NDIA 3G1UA 3JQBC 3WJ7A 3O38A 1B14A 4XR9A 1XU7A 4XQCA 1KVQA 2QYSA 1GEGA 3ZU4A 2JD0A 4WUVA 2YV2A 1LQTA 1CQIA 3PYLA 4JBGA 1DIGA 4IIVA 3AUSA 4ESOA 2O3UA 3Q9NA 5JY6A 5JDIC 2ZQYA 2FZEA 4YACA 2D5AA 3FTPA 2YDXA 2O48X 5AVOA 1HF3A 3EK2A 3MZ0A 2Q1SA 4LCJA 1UP7A 5JAZA 1O94A 2Q2QA 2C0CA 4Q3DA 4FN4A 4PZCA 2AW5A 4IGFA 2B69A 4ND4A 3HJAA 2Q1TA 2QZZA 2HMTA 4Z0HO 4YRAA 3VZRA 4DC1A 1HDZA 3MTGA 4AVYA 3SEFA 3TJRA 4CR7A 4OYRA 2I3GA 5ER6A 4CUKA 5C7OO 4CV1A 1XCBA 1C0PA 2FZWA 3H2ZA 1R0SA 3AM5A 3F5QA 1MX3A 4E5YA 4J49A 5EQDA 4BVAA 4NFHA 4R51A 2HK8A 3WOHA 3D7LA 2NQTA 3L77A 4BKQA 1OMOA 1NM5A 3BYZA 3VZSA 1UAYA 3T4EA 3RASA 1ISMA 1YOVA 4Q3EA 1Z82A 4Z9XA 1WXDA 4YVFA 1NPDA 4J2HA 1PU2A 3B1FA 2HMSA 3E9QA 3ITDA 4G65A 3ON5A 2Y1OA 4LMRA 4QO8A 3ZWBA 4WCFC 3CZRA 2FPGA 3K92A 5T64A 4BNUA 1NHWA 2GGSA 1ZXLA 4CM3A 3AI1A 4BMSA 1E6UA 3MJCA 2B4RO 3UF0A 5KJ6A 4NBWA 3NX4A 4BHTA 2JFHA 1A71A 4URFA 1WDMA 3ZNOA 1VM6A 4CM9D 1BMDA 2BI8A 1C1DA 4LMPA 2VYND 1LDYA 4OXKA 2XOXA 2AHRA 4LISA 3ROMA 1NX6A 2W2KA 4BNYA 1A5ZA 5F5LA 4ALIA 3NUGA 3IS3A 1H93A 3SBOA 5HTOA 4A27A 4BS9A 3KSZO 1LLDA 5ADHA 3BMOB 2QRKA 2NVWA 5T57A 1WP4A 3QWIA 4UUMA 3T4XA 3E1KA 4XQ9A 3T7EA 3TZ6A 4GH5A 4KOAA 4B7XA 3UAGA 4IUYA 4AJ4A 3CUKA 5CG2A 2W8ZA 4F45A 3PHHA 4IS2A 1B7GO 3C85A 4M89A 2VTDA 1KOLA 4ID9A 4L73A 2YHIB 3MJVA 1U3TA 3TL2A 4H16A 3IUPA 3CSDA 4GGOA 4YT5A 2NTNA 3RUCA 3BHJA 4PFJA 1NVMB 3H9QA 3IUSA 4D3DA 3H5AA 3M2TA 3ZI0A 3KSUA 4HBGA 1W73A 3O8QA 1NQAO 2YHIA 4L0QA 2VHVA 2V6GA 3DHNA 4U6QA 1O5IA 2B5VA 1PS9A 3O26A 4IZHA 3IL2A 2J8ZA 1YGYA 1YO6A 3ONDA 2VUSA 5TGDA 1ENZA 2NTVA 3IP1A 4RLHA 3ZU5A 1NWHA 1T25A 3ZU2A 1KBZA 1GL3A 4DMLA 1FDVA 3NEPX 1B26A 1R6DA 4NNJA 3R6DA 4CQMB 1PGPA 3TSCA 3U09A 1H94A 1NQ5A 2VRCA 3VPGA 3GC6A 2J5RA 2YHUA 3GMSA 4P22A 2AQHA 3OIGA 4QUKA 3F3SA 1ZJYA 1JWAB 5CDUA 4R4JA 1DDOA 2DTXA 4W6ZA 2YUTA 4X54A 2Q45A 3OEYA 3BHIA 3P7MA 4IJWA 5L7WA 1I01A 5L45A 3KB6A 4BNVA 5ITVA 4RF2A 1LA2A 5I7SA 1WZIA 3GUCA 1JKJA 2X0JA 3FR8A 1IHXA 3ZHYA 2IEBA 1FDTA 4MIOA 1HKUA 2Q46A 1Z45A 2JD1A 3KYDB 4E6PA 1QXSA 4K1LA 3TL3A 2DTDA 2IEDA 2X9NA 1I36A 1P3DA 3C3XA 4G81A 4D0RA 1HDOA 4K6CA 2O2YA 2HLPA 4NU6A 5I8ZA 1O9BA 3ZV3A 1XU9A 4RLSA 2P91A 3LT1A 5IZ4A 1T4DA 4J4HA 1J5PA 3JQ8B 3C7CB 3OA2A 3H3FA 4W4TA 1DHTA 3O03A 1GYQA 1QYXA 1ULUA 3BTVA 4MVJE 4ILKA 1VC2A 1VKNA 3RSHA 1GQ2A 1VL0A 1W4ZA 4J4BA 1AGNA 1I3NA 4ZJUA 1D1TA 3WLEA 2HU2A 1R66A 4AJLA 4CM5A 4BNLA 1V3TA 4YT4A 5L7YA 1EVJA 3PIDA 2OFPA 4E32A 2EP5A 2VCYA 4DXHA 2EGHA 4CQLB 2GUGA 2IXAA 1KVUA 1U2DA 4KP7A 4ZQEA 3RFTA 1I33A 1B15A 2RAFA 1Q0QA 3JYOA 4CMIB 5IG2A 4LGVA 1E7WA 1S7CA 5EN4A 5F1KA 1E1MA 2XXBA 2Y0CA 1E3WB 3KM0A 2X22A 1PL6A 1VLLA 3DOCA 5JCJD 4ZQGA 1E1KA 1E0DA 5A5FA 1P74A 2EKLA 3NT4A 2EW8A 2FN7A 4DRYA 4BNXA 4E2YA 4QEDA 1ZK2A 5C3MA 1TI7A 2CFCA 2W2LA 1TLTA 5CDGA 1F0YA 2HCTA 2QW8A 1HDXA 3OIDA 4R16A 5CPBA 3UCFA 3FNGA 5J23A 3GT0A 3GVIA 2YDYA 4YAEA 3DZGA 2ZTUA 4BO0A 3WGQA 1U3UA 3OBBA 2DUWA 3RJ5A 4FFOA 4ZHSA 2JHFA 1O89A 3H5NA 3L9XA 1VPDA 4NK5A 1NBOA 3F4LA 5AXAA 2OGUA 3KUXA 1K6XA 2VOJA 5L7TA 3JQAB 4DLAA 3LT4A 4PVCA 4YBZA 1DC6A 2Y1FA 4BO4A 5B4VA 5U1PA 4TSKA 3O4RA 2OO5A 2Y0DA 1RM5A 3HE3A 1KEWA 1Y9EA 4NHEA 1ISGA 3AY3A 4I9NA 4C7KA 3VPXA 4NU5A 2JKVA 5DP2A 2H5LA 1VSVA 4AJHA 3RIHA 1HDCA 2O23A 3FTNA 4OIMA 4J1TA 4TVOA 2WYWA 3IDSA 2OBNA 2ZJ0A 1PQUA 4YJGB 2RHRA 3DFZA 4JCOA 4FSHA 4BNNA 3QIVA 3BTUA 4GWKA 2NVBA 4D44A 1H6CA 2R00C 4PZEA 2TMDA 2VT2A 1DXYA 4JNKA 5F3RA 5IZCC 3GVXA 3OEWA 3WWYA 3IMFA 1QYVA 5TC4A 3WMWA 5A5EA 4WOKA 1LLQA 7MDHA 1I3LA 4IGEA 4RDIA 5JMPA 1NR1A 3INRA 3FNEA 5CHEA 2Q49A 4E13A 4WPGA 3GK3A 3KOUA 1C1XA 3BMCA 1V0JA 4B3IA 5EJ2A 3E48A 2VWGA 3VH3A 4CLRB 4RO0A 4DPKA 1AUPA 2BI7A 5KOIA 2NU6A 4CMEA 4YJHA 4K26A 3NT5A 1CF2O 1UAGA 4UVIA 4WJZA 2QG4A
chains in the Genus database with same CATH superfamily
5T67A 2DAPA 3ZW7A 4CQNA 3CH6A 3THRA 3CURA 3GUYA 3UMFA 3RSOA 4B44A 2OWDA 5FPTA 2Q3CA 5KU1A 2JHCA 4JI8B 1H2AS 3ZE1B 2RBKA 1CNFA 3L6OO 1PZGA 1DC8A 3EARA 2XSZD 4O02B 3ONFA 1ACMA 4KIWA 1ORVA 2OXTA 4ZYXA 4LZPA 1TMYA 3CLKA 1XD2A 2XDYA 2FZ5A 5JFOA 2PPLA 2YXEA 2BZ0A 1HFJA 1QKIA 2NIPA 1L5GB 1MOQA 3ILVA 4RLQA 4J0FA 5DHQA 5E6SA 1M66A 5C2JB 5LWHA 4IRXA 4OXYA 1TGVA 2QX9A 2CXNA 2JGAA 2ZYSA 2B25A 5F21A 2VQ6A 4OXNA 4XR4A 4O2RA 3EG9B 4EL5A 3JQEA 1BH6A 5HFJA 2JJYA 1FNMA 4JYPA 4XEHA 2HPAA 4XQEA 1VBKA 3SE7A 4BNJA 2LDXA 4V2UA 4MUXA 2X77A 4FXOA 4JFAA 1S4MA 5H3LA 4TMFA 2X3YA 3Q7PA 4K88A 1L4LA 1UJMA 2VP2A 3GHYA 3PF9A 3RS4A 4H1WA 4OHYA 4PAQA 1ND5A 1RLOA 2EDCA 4PSUA 4NV3A 2O8EA 3A36A 3L0SA 2DWOA 2QAGC 4S1NA 1XTBA 3RE1A 4QOSA 4G25A 4MP6A 4H7JA 1ZVJA 2VLIA 2QW0X 1RNLA 3G0CA 5EWLB 1C80A 1VL2A 3S29A 3PJRA 3ML1A 4AM8A 3ZHBA 4NMHA 5JNLA 3G13A 3C7KA 4EUEA 1YZHA 5FT9A 4I5DA 2RKBA 3QHAA 4JJ4A 4OJTA 4BFCA 4NCHA 1YI1A 2QT1A 5DBEX 5DM4A 3TGWA 2UYOA 3UEOA 1OREA 3I2GA 2FYTA 3GLFA 1F14A 1IEVA 3SE0A 1NASA 4AF8A 5KQRA 4NDNE 3P2EA 4ND8A 1N9GB 2JGFA 1PR2A 2CY0A 3R3VA 4OB6A 4QARA 4X7BA 5FV7A 3EGVA 5ALPA 4AZVA 3ROXA 2QTFA 5I7UA 3NJRA 3X1JA 2H5IA 3AYXB 4RGVA 5K1ZA 4KXWA 2ZTLA 4GOLD 4DR4B 1WL8A 2YRFA 4X24A 3TIVA 3L6UA 2GHIA 2D59A 4QBGB 3KQLA 3RF7A 4KHPB 1X14A 4L8WB 2IDKA 2A7QA 1M1YE 3KLMX 4ND2A 4IHQA 1D6NA 1F9AA 4FWBA 5DHFA 1EFPB 2IOFA 1XAGA 1ZS9A 3P9XA 4FONA 1ZNZA 4IG4A 5JZ9A 4EJ2A 2ZJZA 1FMFA 1X87A 3EWAA 4DLYA 5FD8A 4HNAB 3V4ZA 4QUAA 5DYTA 4DIEA 4FYPA 4Q39A 2CBZA 4L5BA 4WADA 3FUVA 3SF0A 3K30A 4ZAWA 3L0PA 4MUYA 1QMPA 5CIQA 5JH7A 3SF8B 2OV4A 1CR2A 4IXMA 2X0EA 1HE5A 2BKXA 2BSQA 1HL3A 3PBKA 1PJRA 2Z3VA 5DK4A 3BZBA 2OESA 2E37A 1O6BA 3ETGA 3KQVA 1IN8A 4M8KA 1DBSA 4KQ6A 3SF8A 3UB2A 5CW2A 5HQ3A 1OLOA 5JXHA 3Q8LA 2LUOA 3ITNA 1EUQA 2W11A 3MAAC 4DY6A 2DR0A 4MRVA 4HG2A 3WTCA 1KBOA 4R71A 1UWVA 2WUVA 3B13B 3QWAA 3L7CA 4QQNA 3IEKA 4JL8A 4Y6OA 1ZP6A 3UGJA 2UXBB 3COWA 1MNAA 1R12A 2WKWA 5FUBA 2VA9A 3KUCA 2CVQA 3IXMA 1FTYA 1RLMA 1HT1E 1U4OA 2XJ9A 3FFBA 3H5TA 4GC5A 2VNIA 2FFBA 3ISTA 1UBEA 3ZDXB 4OSOA 4F4HA 5G0WA 3VO1A 2KYRA 4HDNB 1SC1A 4WGFA 4P5PA 5AKHA 3SX0A 4EG3A 4TT3D 1XTVA 1NXXA 2WT4A 1P2UA 3GQBA 3ZK9A 3IERA 5JAMA 3P71T 4RVUA 5BW5A 5EHIA 2D8AA 3FM9A 3EXG1 1JHAA 4LHZA 1ZM7A 4P8RA 4QEZA 4TYQA 4R2MA 4C43A 4G1EB 3W3AD 4HQKA 3OC0A 1E1CB 1AJEA 3NFYA 3FCEA 5FUVA 4X84A 4EG0A 2YJ3A 5DWDA 1JLHA 3DFIA 5HM8A 2HXGA 3QY0A 5TQVA 1ZH6A 4BO5A 4IEIA 1GFSA 2FZKA 4OQMA 1V7ZA 1KFJB 1YRWA 3RTEA 4HDSB 3F6SA 1ORRA 3PHJA 3GJ4A 2ROQA 2DTEA 4J1NA 3VGJA 5F5XA 2XQJA 4P58A 1H8EA 4JBYA 4KITB 4KRXA 4YR7A 3T7KA 2Q8QA 2GPJA 4O25A 4UHFA 4ABYA 1FTNA 1H2BA 1UPUA 2Y1DA 1E9CA 1T5LA 4EF4A 1HMYA 5FOQA 4HAVA 1TZMA 1E98A 1L4YA 1ANKA 1NKTA 3GRCA 3RCBA 5K6AA 3EBPA 5LZ9A 1OB5A 2BGWA 4E7PA 1PD0A 3HJCA 1SXGA 3L0IB 3TKYA 2DP4E 3MMPA 1D6MA 4BFZA 3DR3A 3WY9A 3C6XA 2AOTA 1ZRHA 4LKOA 4KXQA 4WEQA 3T1YB 3VNVA 3QFCA 1O54A 4QD3A 1Y89A 1BOFA 1E7YA 2FVYA 3PR3A 4GPBA 3UJPA 3ZS8A 5M04A 1WD7A 2C31A 2CVZA 5LMZA 1U8FO 2I1QA 1Q19A 1UPTA 4MZXA 5CFNA 2FEXA 3NNNA 4LC9A 1RLTA 2ZWMA 1CUJA 1ZGAA 3F8SA 2ZROA 4UDOA 1JIKA 2W2OA 3M3DA 3IT3A 3RTCA 4C7XA 2AE2A 3AOEA 5E7JA 4E4TA 1A9YA 5F78A 4O63O 1V1MA 2QD2A 3JQ7B 1N7JA 4M0EA 1SMKA 4QNRA 5CVEA 2DPHA 4BVBA 2FUG6 1AGRA 2IVZA 2W6NA 3AFNA 3H1EA 3NBMA 5IM5A 1D8TA 3HXKA 4CT5A 4RM2A 4AECA 3K5HA 2W22A 2ENWA 3TW8B 3JZAA 3PCRB 3NW9A 2BFFB 5BN3B 4CKZA 5BN5B 1XTPA 3REQB 3EFEA 3C7AA 2DG2A 3EB9A 3SNKA 5CNIA 3FR7A 1GZ6A 4EGAA 3UV6A 4GPTA 1XQ6A 3IBGA 3T7JA 4NIMA 1JHQA 2OCIA 1SN7A 4Q9KA 1OXMA 3JQ6A 1N5RA 5BWLA 3VI4B 3DHVA 2G28A 4EA6A 2R7AA 4NMLA 4GDFA 1RHKA 5EGNA 1FNDA 1AUOA 2PZKA 1VE9A 4BMNA 5ES3A 2GJ9A 3H2HA 5FEMA 4WZAB 2WWIA 4MVCA 4OKSA 1QHFA 1ZA1A 2YVQA 5K99A 3LXRA 2GAFA 1ZRSA 5DTIA 2XDWA 4HLCA 4DVGA 2YV4A 2GETA 1N3BA 2IODA 3EPPA 5L4LA 3C48A 1C0KA 1OJ7A 2VHCA 3SC3A 3IOYA 3SR4A 3VRHA 2A9OA 1U3WA 3BDIA 3G8YA 4FOOA 4TSRA 3PXGA 1CJVC 3TQOA 4E09A 4ECAA 1RC1A 3CPSA 2X5XA 2B7BA 3ETDA 1QKKA 4R9NA 3RAJA 3OZDA 3F1LA 4AIIA 1L0BA 3RM3A 3TWOA 4ZVSA 4NONA 1MHTA 2RI0A 1B2LA 3I1IA 1UT8A 1GTRA 3MOGA 3QFFA 2YWRA 3I9V6 2QZSA 3EEFA 1BXGB 1FL9A 1OF1A 4CETA 1AC5A 2NTJA 3B1YA 2O8FB 4KN5A 4V0OA 2PH5A 2ZYWX 4M0CA 4XWAA 1JPJA 5K6AC 2BM1A 4D74A 3RNOA 3EEQA 3AVUA 3TS1A 3TTSA 2HIGA 3V97A 3ZZTA 4Z51A 3KQSA 3WLMA 1EM8B 3MTBA 3T15A 3M89A 4DV6B 2ZBUA 4Q3LA 4ITVA 2HDNB 3F46A 1BXGA 1ZGHA 2VF8A 3HA2A 1IQ0A 3BGDA 3HKBA 3N7UA 2HU5A 1USKA 2ID9A 3U37A 4HPXB 3DMDA 4LNUB 4D8WA 4DSAA 1AGPA 1SBZA 2YZGA 3L4SO 5EESA 2QF7A 4EKGA 1E5TA 5JRZA 3OU7A 4D4GA 1FFDA 2QTAA 4LJRA 4BPBA 1VI6A 4LS3A 1IEXA 1UDWA 1M7HA 1ZM2A 2NADA 2PZMA 3HJRA 3RS8A 1MPXA 2O20A 4HUJA 1N77A 4IX1A 3AOEC 4WZBA 2FWRA 4LNHA 1Q11A 1DRJA 2ALJA 3B1XA 4P4GA 2GCGA 3T3PB 2HW8A 4I2VA 4Z1MD 1F4PA 4KRYA 3E3AA 4H1TA 3PNMA 2CCJA 3ABIA 1NVAA 1O2DA 1KQ3A 3DVAA 2VNKA 4ZT4A 2Q2VA 3M1IA 1OTYA 4I1YA 2VAMA 5L9AA 4UM9B 2V7QD 1KYZA 4YBRA 1MOPA 1NLYA 1XKXA 2OPHA 2A6PA 4C7OB 2G71A 2QKYA 2VDKB 3NUZA 4P0TA 1TADA 3R7NA 4D6XA 4CEJA 1U8TA 4LXUA 4TTIA 2B36A 1E1YA 3LUBA 3ZKWB 1E4VA 3ZWWA 4EHHA 3LY9A 4GBGA 4TV8B 2YVKA 4CM1A 4TWIA 3JAKB 1EXWA 3TFWA 4TUYF 4BY9E 1V9SA 3CF4A 4AIRA 5I3ZA 2IZ6A 4KGXA 3R3XA 4JLUA 2FPRA 1XEXA 1QPZA 4DYVA 1X13A 1O77A 5CLJA 3CNOA 2GHRA 1XVVA 4KSBA 4L9AA 4N5DA 2ASEA 1FNBA 1WCWA 1Z4PX 3QELA 4H0NA 5BV1A 3EUAA 2GBCA 3UNXA 3VH1A 4KQMA 5D1HA 1JKMA 3RJ9A 4DUGD 3MCAA 4EVIA 2GBPA 2QZJA 3ZZ1A 5K20A 2R62A 1FK8A 5IRCD 1R5JA 5FL7D 1L5FA 1Y7IA 3DBHA 4GL4A 3CZAA 1T0IA 2QTVB 4F3NA 4I9UA 3FFXA 3KKMA 4GT1A 2ZYAA 4P4UA 4W82A 1H0RA 3U13A 3WGKA 1N6PA 1G59A 1UBUS 5KYWA 2XB2A 4LJAA 3NPAA 2ORIA 3RHSA 3TLXA 1YNSA 2G5GX 1AF4A 1I9GA 1ZDMA 4LYDA 5CH3A 1MQ8B 1S8FA 4JWKA 3JALA 5HUJA 3A6KA 2WUEA 3CN7A 1CX9B 3VDRA 2PFSA 3FNQA 1R1DA 4LOIA 1NJ1A 1SOAA 2DGDA 3E22B 4BVHA 2FDRA 1GG8A 4OYYA 4QDTA 3EVBA 2Z09A 3ZR4B 1YTUA 4RKWA 2I4IA 1L4NA 3WNQA 4LTDA 3KKZA 4Q48A 1TO2E 2P4UA 3H7IA 1OI7A 1EEHA 2RFLA 3AHCA 5LKRA 4NULA 5EMLA 2CJXA 2J6HA 3PFKA 4PG4A 2EWWA 1ZMBA 2FQQA 2J4CA 3P9PA 3ZEAA 1D2AA 1RKUA 2WF5A 3DBIA 4PYLA 3ZWCA 2OENG 4DFDA 2OC9A 4FDMA 5HHTA 1XKLA 3GEDA 3O6VA 1J24A 1X8LA 2R7NA 1ZK4A 3ICEA 5EQTA 5CDFA 2I4OA 3EZ7A 2BGKA 2V7VA 3MGGA 4U2CA 2VRWA 3ANMA 3SHTA 1J6UA 2P3SA 1NIPA 4E2FA 4F46A 4YCMA 3D4NA 4R1OA 4EJMA 2WUWE 2AI3A 5JS2A 3NM4A 3A1TA 2XT9A 3DE0X 4DB4A 3QPBA 1N0IA 4BAZA 4LBZA 1JQBA 4WZZA 2V7BA 4CV3A 5JT1A 5AXDA 3R4VA 4YQZA 5ALTA 5F4BA 3VR3D 4ZALA 4DLTA 3A4VA 1NR5A 4G1CA 4N40A 4UOQA 2BMVA 1II0A 2JANA 3FD8A 1QQ7A 1T4MA 3CRW1 3R3HA 2J33A 3LQ4A 4JLWA 3RFXA 3AHIA 2C9DA 1V5EA 2C59A 4H7DA 5DX8A 2ATEA 2XQKA 1M6WA 3BJIC 1BDBA 1RIFA 1TEXA 1UCFA 1D6JA 1XALA 2QD5A 3O4JA 4YAWA 4YFVA 5DMHA 5GINE 4AI6A 3ADDA 4NG5A 1FNSA 5LA6B 4OH1A 1UBHS 2PLFA 1HQYE 1CYDA 4RMJA 5FI3A 1NN5A 3F3MA 1GCIA 1WUYA 1J97A 3NONA 2RGNA 1JFVA 3SJ7A 2R4UA 3MF4A 5T4BA 2IX3A 1GSAA 3CCCA 3ECCA 2ADFA 4MJXA 1GA4A 1I9CA 1MH9A 3WDSA 1Q15A 3LF1A 3IR7A 4RXTA 4CR8A 5IAOA 3RRFA 4OVKA 4EYSA 3I76A 1GZUA 2Q5QA 1HE1C 4PYRA 3ABOB 5EG5A 5FI5A 3THSA 4N18A 1XNRB 2E5WA 4QLAA 3K71B 5HIJA 2ZVDA 2EF0A 3FWYA 3KXPA 1PQ4A 4TM8A 2B4YA 2I3BA 4AJ1A 3SC2B 3R1IA 4M9RA 2ATCA 2OE2A 3UV3A 1U9ZA 4YQYA 1UXGA 1WW2A 4EKEA 1LNZA 2EEZA 2PO5A 4IINA 3UT5A 3D8HA 3AESB 2QB5A 1RM4A 3OOYA 4S1WA 1GPAA 3JSAA 2H0RA 5LQAA 4EW3A 1XZEA 4IV8A 4JLAA 5IDYA 4BAUA 2ZI9A 3AHFA 3RV4A 1OFIA 1TX4B 3N2KB 4CLDA 1BN7A 1EGHA 3EC1A 3FWHA 3KOMA 4GZ5A 4OUKX 4UARA 3TB4A 2YICA 3EDOA 4ZODA 3LWBA 1NRIA 3IBSA 2JFFA 3LO8A 2OP0A 2IU3A 2I03A 2YW2A 3R3YA 4IDHA 4AUEA 1RYBA 3KKEA 5J1SB 1GPNA 1VFPA 4TQAA 3PHBE 4RDXA 5F2NA 5AM0A 1CJMA 3DDNA 2VAWA 1D2HA 2OQIA 2CMKA 3IAHA 3PB3A 3K2QA 2PU5A 3QLUA 2J3HA 4NQZA 1R6TA 4C22A 3TH5A 4NESA 4MPJA 3CVYA 3B8EA 2ID7A 2I9PA 3SJAA 3L8MA 3EAFA 4TT3A 1A7AA 4FGWA 4M2LA 3QMWA 4YI3A 4O4IB 4E4RA 4Q4CA 1CP3A 1GR1A 3FGNA 4JLJA 1LLFA 1UKAA 2CDCA 4RZ3A 2HEGA 1L8QA 3E9RA 2EJBA 1MG0A 4KDFA 5BXYA 3D9QX 4ZCTA 2ZDHA 1SOUA 4NATA 1UKEA 1U7ZA 1PL7A 3O1LA 3R44A 1JR2A 2WZBA 4LMBA 2BEWA 3ICCA 5LB2A 5K8UA 3KWMA 5IF3A 4WK4B 1HXHA 1RYMA 5KJFA 3OOWA 2BDUA 1QIKA 2VZ8A 4HQOA 1D07A 4MKZA 1TPZA 4QOHA 3V7FA 5IZCA 3GBPA 1ZJ5A 4W1RA 5C7YA 4NAHA 3C7TA 5BWOA 2BFPA 1ZCAA 3PXDA 2Q3EA 3CFYA 4WDRA 2JEZA 3IB3A 1JILA 1M2OA 3NDRA 4EI9A 2RGNC 5B53A 3TVTA 1SKYB 2Q6IA 3LT0A 3OIWA 8OHMA 1L6IA 3UKJA 3ANSA 3HMQA 3G2HA 3SJCA 3AJ8A 3HGQA 2BFOA 4PTZA 1YKFA 1WXHA 1T0JB 1XDBA 4KWIA 4NBTA 2WWYA 1YQXA 1L7PA 2FP4A 4G9EA 1C7RA 2QY9A 4ZVPA 4QYIB 5KQMA 1QIGA 4XZ3A 3F6BX 2Q9AA 1U7HA 3HWWA 1QUFA 2HK7A 1VIVA 2P40A 2W37A 2XUFA 2NUPB 3OKAA 3TE7A 2ODWA 2ZZMA 3NANA 4FT4A 1EE9A 4RS3A 1AK9A 3GO4A 3W6PA 2WJ4A 3UICA 4MQ6A 3OZCA 3CF6R 3WK9A 5HUQA 1L2TA 4CIBA 2UYHA 3LYLA 1GGHA 2FZLA 3TZHA 3A26A 1VHTA 3PEWA 1YZNA 3NBZC 1IAQA 4PSKA 3ZU3A 3OY7A 1QO7A 1QU3A 3GZNA 5CIWA 5FYQA 4DJJA 5ALMA 1NYRA 5DASA 5EWJB 5CYPA 4QGBA 1CIPA 3EXEB 4PZLA 5IANA 3O1HB 4PX3A 4ACAA 1DGQA 4L1KA 4P7KA 4X64B 1T9ZA 4RESA 1NU6A 3CF2A 1A97A 2I2DA 3EGOA 1BA3A 1KZGB 1OSNA 4KXUA 1MQSA 3R3SA 1BDMA 3U4MA 1ZEJA 3HADA 3RKSA 3QLUC 2C7OA 1BEEA 4KR7A 3QA9A 1KXZA 2E4WA 3WL4A 4BQFA 5HA5A 4O08A 2HV9A 5ILGA 1K8QA 2Z2IA 2HGSA 1KH1A 1RBQA 4NFLA 4Q4JA 1G98A 1R10A 4CDNA 2O4CA 5AHKA 2X5OA 4K6GA 3ZWQA 5CFOA 3UK7A 3LCCA 3GJ8A 5JYDA 5KWJA 2J41A 1ZMOA 3WLHA 2HPVA 3AIKA 4H3HB 4C30A 4D80A 3EFOB 1ZINA 3ILXA 2R65A 5EUQB 4KN6A 4HEA6 4XM0A 4RDCA 2FPWA 1BCSB 3AL3A 2G6BA 3HJNA 4U7JA 2JCVA 4M1TA 4IIDA 3NIGB 4II2A 4ZO4A 1USWA 3OE1A 1UJCA 2H8GA 3LUKA 3PR2B 3RB8A 2BYTA 4B79A 2IOHA 2X7JA 1SUFA 2V96A 3K6KA 3OP1A 5BQ5A 4Q9DA 5GZ3A 4INAA 2B1QA 3NM6B 1K88A 2ZBRA 2J5BA 2YASA 3A9VA 3BD9A 4JLNA 2IHNA 3VPCA 3WK5A 1KMHB 4TLAA 5BUSA 4QBTA 3BMCB 3NTRA 4J76A 3RD5A 2EQBA 2AMYA 1LDBA 3FYSA 3D3NA 1X80B 2Z57A 1XB2A 3G8DA 4G9BA 1MV8A 4M8IA 1S01A 4HNRA 1BVHA 2ZCVA 5AVXA 2O8VA 4YDRA 2H06A 2JJ1D 2AZ4A 4XVHA 1D7OA 1QF9A 3GUZA 4WJKB 4UMVA 3TR0A 4G86A 2YHAA 1G20A 1Y8QA 1JIXA 4DLBA 2VP6A 1E6WA 3LW7A 2JI4A 1R4MA 4JLOA 4BBJA 3SEQA 1I80A 3TR5A 1GZ4A 3T9CA 4DV0B 2A0XA 3BQ9A 5C8XA 3SY8A 3RAEC 1NI3A 1U0HC 2XIJA 5JQGF 3LKDA 3TPCA 2HWKA 4D57A 1X8JA 3GG2A 1COWD 1L7EA 5A62A 5I48A 5KC9A 3O94A 1CEXA 4LI0A 3OZRA 4RV5A 2JVJA 3HDVA 3EHEA 4FFBB 1X42A 3B3GA 2HA7A 2XMPA 1Z39A 1Z8DA 3N6VA 4RABA 5EFZA 3U4DA 1EPUA 3JZFA 4RJJA 4V1CA 2A84A 1QFXA 3DONA 2V54A 3D4LA 3DQPA 2ZJBA 5CYOA 3WL7A 4B76A 5J5CA 2DH5A 2N47A 3WGNA 2ZSEA 4HLUA 3W1VA 1R0XA 3RVQA 2QN2A 2HBQA 1FFXB 2V7QA 4PFQA 4MICA 3AILA 5JFGA 2LPMA 4IG9A 2IS6A 2PS0A 2CGEA 4PLGA 5I7RA 1YK0A 1FSZA 1LUAA 4DLLA 1U9JA 3ROPA 4YXFA 3L8GA 3DH0A 5ELXA 2OGSA 3DE2X 4ZJZA 1VLVA 1D09A 5BVHA 3CUVA 1GUFA 1UWKA 1D04A 2G17A 4E5PA 1XAHA 1G8HA 3N2ZB 3BSYA 2SNIE 2PGLA 3HCDA 3HPRA 1L7NA 4NYIQ 4BX9A 3KPJA 1EDDA 3FZNA 2GQ0A 2WIDA 4YK7A 3EA5A 2XMSA 3L46A 1NRXA 1HYBA 3N0VA 2BKUA 3KDSE 2R1VA 4H35A 4HWGA 5EPOA 2ZIAA 3G8CA 2I4RA 3RC7A 4DUGA 3G0HA 3I6QA 2CNWD 3PQ5A 2O0MA 4XYBA 5JPIA 5JG7A 5FL7A 4ZQIA 4EG8A 3FZEA 4Z6KA 4ZV4A 4X62B 1O58A 1UZLA 4K28A 2G5PA 3F5SA 4JQSA 4PGAA 4RVHA 3V4OA 5JLAA 4YQFA 2BGUA 1GNTA 2FMHA 4C14A 1K27A 1F3LA 2UZ4A 3NEJA 2ZWVA 1ZYUA 3UTCA 3VJMA 1BVUA 3RUEA 5H3CA 1E2BA 4MDYA 5M7EA 1UKVY 1UXHA 5D3ZA 1TM5E 4EJSA 1JDTA 1OXKB 4BP1A 3H2BA 1O8CA 1PL8A 4IQ8A 5B37A 4L5IA 3TAHA 2O0KA 2V5VA 4BZPA 1YIDA 1WNFA 1CERA 2LIVA 4C4OA 1CETA 3IP8A 4TQ9A 4B6PA 5KTRA 2FPSA 4LYGA 3SZRA 4DR7B 1YV9A 3LQ2A 3EN0A 2GZHA 1TUGA 5FUMA 2ISQA 1KEEA 2QWXA 2ZBDA 3T3MB 1N25A 4HNUA 2CFOA 4PAWA 2I8CA 1WUJS 3DEFA 1JEQA 2I4TA 1DJNA 1DADA 1KERA 3OZ7A 3R4CA 4NICA 3CIFA 3W06A 2PUHA 3G8BA 4P83A 2BMEA 2O6HA 5B3LA 2PD3A 4NYMR 3P27A 3PRJA 4XX0B 2KW5A 1UC8A 4PAOA 3LLUA 1HKHA 2P2DA 5AW1A 3R74A 1CRWG 3LC0A 3PQ6A 4TWZA 3VV2A 5B5SA 3T9AA 4C7VA 3G2PA 5B2EA 4G09A 3RKRA 2Y1XA 4HVAA 1PVOA 1IBCA 1U5BA 2H2FA 3NBUA 2R47A 2FDCA 4TYWA 3OT1A 2XA9A 1ZESA 3UMBA 4ARIA 2X5JO 3CEPB 1QC5A 4ZAVA 1N7HA 3BXFA 3CUWA 2I2CA 5H68A 1ADYA 1ACLA 1XCLA 3K2IA 3UM9A 4Y6LA 1AA9A 3H6HA 3OM0A 4I08A 2ZM5A 3F9CA 1DTSA 1FFSA 1PWXA 2YFKA 3BQMB 3IP5A 4M49A 2BTQA 1W29A 1I4DD 1U0OC 3CTMA 4K9PA 4MQEB 4DV2B 3GAZA 1LI4A 2XCUA 1QLHA 1RXYA 1WVGA 4OGGA 2H4ZA 1PGJA 4N5IX 5DW3A 5KVSA 3H3JA 2BIFA 3HYNA 3KJZA 4L6AA 3KZMA 4EMSA 1BRMA 2AJCA 2PR2A 1N5KA 3Q41A 2R8OA 1Z0SA 2RBGA 2IDZA 4OREX 2QSZA 5EJ4A 4A92A 1FMTA 1IHUA 2ATIA 1VHQA 1LDMA 2H92A 2JLQA 2W6MA 2XNHA 3HB0A 4WCVA 5IAGA 1L4KA 5KKAA 4D8TA 5SY6A 1BXKA 1AV6A 2BOVA 4GYJA 2D5LA 3HVHA 2G82A 2IUFA 1CB0A 3IPYA 4DLZA 4WECA 1C9EA 2YFHA 3RC2A 2CDBA 1K06A 3L0BA 1Z8FA 4RS4A 1H0HA 1Q6ZA 3VR6H 3O91A 1YBMA 3TECE 4DT1A 4BXOB 2XCQA 1GWNA 1REQB 3KFXA 1CG6A 4EJSC 4OLHA 4AFNA 1U7PA 5A9TA 1IDOA 3Q2KA 1E2QA 1JFFB 3D1LA 1ZNYA 2J3QA 2Z30A 3BXEA 1YIAA 4JL5A 2KS6A 3PV0A 1D1SA 4OFBA 1L8OA 1MVNA 3H11B 4EY5A 3DGEC 2V74B 4I1VA 2EQ5A 4KUGA 3UPDA 4UDYX 3DMFA 5JQGA 3T7IA 1SKQA 2QUBA 2AOUB 2WUGA 4PR3A 4WXRA 3W0LB 2O19A 3CRVA 4LYAA 4NZNA 4MMYB 1MHPA 3FE2A 4IQGA 2ZSAA 2WBLC 4FCVA 5B6JA 4FFMA 4U0KA 2HHLA 3E6AA 4CKYA 1A2QA 2PY6A 3GLIA 3B78A 9MHTA 3TSAA 1IK4A 1O57A 4MP3A 3IP3A 2IZ7A 3ESAA 3TVYA 3CMMA 4E5DA 3R5XA 1YQWA 5AXBA 1RTTA 4JLSA 1ULTA 5D3MB 1PSZA 2R4QA 3VR4H 1QTRA 1B0PA 3U3ZA 3WOVA 5H59A 4EAAA 1WO8A 3W4IA 1GQRA 4QDOA 4FZRA 1KTIA 4DV7B 3L84A 3UMJA 4LWQA 4OUDA 2XUIA 2B0CA 3SKVA 2NUAA 3I34X 5HPYB 2J4FA 4CL3A 4QJBA 1U8EA 3P5BA 1JG4A 3L4BA 4EB6A 1KDZA 4R5MA 3K5WA 5DM70 1E0AA 3I0ZA 4Y2VA 3MHTA 1DTWB 1FUEA 1PO7A 2JK1A 2QX8A 1Y63A 2OK7A 3MC1A 4H6WA 4MGEA 4LZNA 4JELA 1GPH1 3UJAA 4DILA 7ADHA 2DSTA 4PQGA 3I30X 1VLMA 3BB4A 3KJXA 4XIIA 3DHEA 1G9XA 1SZDA 1Y98A 1ZOPA 3C6KA 3FA2A 3ONVA 5D3QA 4A8JC 3K53A 4DC9A 5H70A 2I65A 2VHWA 5D8DA 5FRDA 4NEQA 1XRLA 1P62B 1G8PA 1PZMA 2P7HA 2YN4A 3KC2A 3KSRA 2DHDA 2ZUDA 3TTTA 4C21A 2ZJYA 5J2UF 4BBPA 4E1VA 3HU5A 1KAEA 2ZT5A 1F8FA 3NKVA 1RYYA 3AQ4A 1JZTA 4I1RA 5FI0B 1BC5A 3I4LA 5TQ0B 4CEIA 2QD1A 4IDPA 1E2EA 2IJGX 3PWZA 5JAIA 2RE8A 1ISHA 1FMLA 2RJ3A 3KXIA 3Q12A 3ZW8A 4C4AA 1V8BA 4AJIA 2PWYA 1H42A 1H9AA 1T9AA 4RF5A 2DXIA 1MFPA 1UM9A 1UDRA 2WYUA 3C4QA 1CE8B 3D6JA 3MA0A 5GJBA 5EIHA 1X1BA 5B55A 1NONA 3ABZA 3JYLA 3PGKA 4LX0A 1C9MA 1TUIA 3E84A 4E94A 4X6YA 4LSMA 1AU9A 4D41A 2M32A 1OV4A 5FUQA 4JI1B 3L1KA 5CB8A 1PEKE 1TD9A 2W48A 4N9QA 1CE8A 3LZDA 4YHBA 3WGHA 5K3SA 2DBYA 2WILA 3FPGA 3KTFA 1UUFA 1YAJA 4Q34A 4RORA 4IIYA 4A0HA 3Q0IA 4XSGA 1XHEA 2OSVA 2CD9A 1F8GA 5AWFC 3RUIA 3T8YA 3IEXA 4FZJA 5C7IO 1OXSC 4Q12A 2CXRA 1DEXA 2PLRA 4KV7A 1TMGE 1UBOS 3IPXA 1U2TA 1SXJB 3LSYA 1U28A 1HOXA 1UQTA 2HO4A 3C3BA 3IAFA 4HADA 3G7SA 4M7RA 2BLLA 5C46F 2H3EA 2ZB4A 1Q92A 4WOBA 2JJ8A 1PCXA 4XDYA 2QJTA 2HJSA 4UKDA 3ZLBA 4J0CA 2NQ2C 4EKYA 5G0VA 5HE8A 5LBTA 2HHHB 1N4DA 2Z9CA 1J9EA 1B3RA 2ZRAA 4UXIA 3TM4A 4CTOA 2IY7A 1BQEA 2R1TB 4H31A 4L4ZA 1UEXC 2Z3WA 4J75A 3KS9A 2J9GA 2CDNA 1X86B 1XTTA 1ZD8A 2AIRA 1OFGA 3IUMA 4P3NA 1GTG1 1VE7A 1VL8A 4JX8A 3V5NA 2QIPA 5IN4A 3Q8MA 4RL6A 1Z6ZA 5PNTA 1P1HA 4TVBA 3AI7A 5KMGB 4PFSA 4B6RA 1LJLA 4QSMA 2YIVX 4LFCB 3KPYA 4ZOEA 3W5SA 4BC0A 3B6IA 2GB4A 2HI0A 5E4TA 4Z7JA 2I6XA 2QRHA 3IQZA 1P0MA 3KV1A 3LVRE 3NC0C 1F3OA 1ISFA 3O95A 2JEYA 1RMTA 1VKHA 4LC0A 3VPBA 5AI8A 1SVKA 2IITA 4QUJA 4G4SP 2FFHA 1W93A 5K6RA 2J0VA 3OPVA 2B5OA 1NRWA 5SYNA 5B64A 4RLFA 3VZCA 4KMMA 4PZ0A 3ZJUA 1T4CA 5E7MA 3C8HA 5F1PA 3G79A 4E5KA 1KI3A 1UBGA 2H00A 3KRTA 3ZW9A 5T6BA 3OTQA 4DNXA 2DERA 3O9MA 1NAHA 2J5KA 2CJFA 2PRJA 2JJ1A 1Z15A 3MQFA 4JN6B 4O3FA 3V4FA 3IVRA 1WY5A 4ASUA 3H4MA 4BE7B 3ACBA 1B8VA 4BLUA 1XL0A 5C8ZA 3PQDA 3CISA 3FCXA 4XPIA 1PEDA 2QJRA 4RTPA 1PSDA 3RPEA 5GTDA 2AG0A 1BHSA 2P90A 4S1TA 3FBGA 2LR0A 1KI6B 4MQUA 3QTLA 3KHTA 1GZ7A 1NF2A 2VT6A 4BRSA 3A0UA 2GASA 1ONPA 1IWOA 4YPFA 4DBLC 2AE1A 4HAIA 3RVNA 3H75A 3S55A 4MPRA 1KZ1A 4BAGA 1Q12A 3FPCA 4KE9A 1EBBA 4UM8B 3VPAA 3DB2A 1PN3A 2AHOA 3CG0A 4E22A 2WHPA 4PGFA 3N2IA 4O3MA 3HB5X 1AHIA 3LPCA 4HH1A 4HNQA 4AMBA 4EHBA 2JRCA 4CIAA 4D9IA 3UAYA 5L4NA 1U28C 4C4TA 1XQWA 1R8XA 1RRVA 3E4CA 4KB5A 4M9ZA 3ZUPA 4BO9A 2C92A 2QU7A 1UBNA 3DEIA 3OJLA 2WUDA 3P2IA 3F8WA 3I6BA 1ZGBA 2GF0A 1J21A 2OZEA 3LK7A 4FNMA 1T3HA 4RTSA 4OX9Y 1QSGA 1HH4A 2CDAA 1FDWA 2I54A 3BXPA 5FPYA 2GZMA 3H83A 3B6MA 3IRUA 2PRKA 2CE2X 3P8ZA 4XCXA 1HQDA 3LQFA 4I8IA 5EXTA 4EVRA 3U19A 1TZJA 4YJ3F 4I46A 4OK5A 1QO0A 2X58A 4N7RA 4X41A 4DCCA 2KHZA 1IL0A 5LZ2A 1N6KA 5KNLA 1RXWA 4TVKA 3GFSA 3QJGA 3NHZA 2WSIA 3SDBA 4BMXA 5KTNA 3ADBA 3H8WA 3PUYA 3KBOA 1A8SA 1P6UA 4LV8B 5LWQA 1WBBA 3MSCA 4MINA 2ZOSA 3ORFA 3BWYA 5HS6A 2FXIA 4IDCA 3LY8A 4TWRA 5AW7A 2CNWA 4EIWA 5HF5A 2HR1A 5J2UA 3CIOA 2CLDX 1NZDA 1BMFA 2ZCUA 3RNLA 5FH9A 1WV1A 1QYDA 1YCDA 2W83A 3KYJB 5DTQA 4Y1EA 2B6HA 2EOAA 1ID8A 4JUIA 3EZYA 3SKXA 4F9EA 1OYOA 1YIOA 2HMUA 3TQTA 2JG3A 2GPBA 1AS0A 1MW9X 3QVSA 5BVGB 1K97A 3EH1A 4KODA 3KL2A 2OZLA 3R75A 4CT0A 3ZCUA 3D4BA 5IAEA 3BMOA 3W5IA 1QB7A 5JPCA 1A4UA 3L3BA 3AR7A 1DJLA 4E7OA 2HCJB 2IQIA 1Y1TA 1LW7A 4F5EA 1S7GA 4OEHA 4HVLA 3QXHA 2IL1A 5DRTA 5BVGA 4QJ4A 3CZPA 3H1GA 4D0NA 1UXIA 4FDUA 1A27A 4H17A 1UDXA 1MZVA 3E61A 5CH5A 3QWHA 1WCIA 2HHAA 4MITA 5E6UB 3HNOA 3ZYCA 2E49A 2F55A 2BBTA 2IPAB 4LF4B 1V5FA 2ZUCA 3ZJ5A 2ZJ5A 3HCCA 2OXRA 1TT7A 3PEFA 1S2NA 4B80A 4QNMA 1GV0A 1L3CA 1YDEA 2PX4A 3I23A 3QENA 2ZSUA 4BKOA 2QL5A 3MQ4A 4DQVA 3GLHB 1GV1A 4X8LA 3EIFA 4IAOA 4ASUD 3P19A 2J3JA 2Z4TA 4ESHA 3GFPA 3ZBQA 1J20A 2JKYA 2Q4TA 3DBVO 4GZMA 5AM5A 2PL3A 1YOBA 3GI1A 1J4AA 5AJUA 4ZVRA 1WRBA 4E12A 2JI9A 5CEJA 2I71A 1KIAA 4X1KB 1UBSB 3K0FA 4UAGA 1I0LA 2D1YA 4N6GA 5DOZA 3FPHA 3CUYA 4I1UA 3T3EA 2WC1A 3INGA 2W4MA 3JY6A 1P18A 2J45A 1Y9ZA 2C84A 2PBRA 1QX4A 3KYIB 3UOAB 4EKNB 1ORWA 1UBKS 3W1WA 1KORA 4KQHA 4TWBA 1AQLA 3PJDA 2P1DA 5CK5A 5JLJA 2QRJA 3CTPA 5LSAA 2CWDA 1NW3A 4ECEA 2H8KA 5KNBA 1QRUA 1BU8A 1P17A 2J1LA 3DTVD 1USIA 3EDYA 4MWSA 2CZCA 5BYJA 2ODNA 4JS0A 4B73A 4BRZA 4JP2A 1J8VA 1KYQA 2GX6A 1XN1A 1PWZA 3P45A 5DEIA 5E0OA 1AGXA 4JI0B 2PVPA 2QPTA 4M37A 3KR1A 1NE7A 2DECA 4W8GA 4ZZ2A 1FDUA 2NZUG 4MV3A 1L5ZA 1TO1E 2XYQA 4YLYA 2ZAMA 1LK0A 2V4ZA 2RAUA 1HC7A 4P7GA 4B82A 4XWKA 3G2KA 3KJFA 2O8CA 3WISA 1NSYA 2YWHA 3ENVA 1NUSA 3VDXA 1Q0ZA 2NYAA 3B48A 3L6RA 2N1BA 3LX8A 3KYDA 2CT8A 2RGUA 4DOMA 3BWBA 1YT5A 2Q5OA 2XB9A 4NMMA 3GXOA 5C8YB 4N76A 3JWIA 3RKUA 4ARSA 4D9JA 3PJFA 5TGZA 1ST3A 2Y1GA 4Y2SA 1TAGA 2O50A 4C3UA 2PT7A 1W87A 2H6EA 1CY6A 1ESEA 2A1TS 4DAEA 1DX9A 2NXEA 3GLGA 2BMWA 4Z1OA 1UMBB 3ORQA 3JQ8A 5C8YA 4XI9A 2ETVA 1USUA 1QGUA 1YR1A 1ZY2A 3GZ4A 4ZAXA 5L3SB 2A1UA 2JBWA 2CV2A 3MJTA 3NG1A 3EW9A 3EIHA 1FDRA 4GWGA 4I4TF 3CRMA 3KQQA 3L7BA 3NHMA 4BC1A 4YP0A 5LQKA 4U2EA 4M0FA 1Y6GA 4MWGA 4RPLA 2BHNA 4I5EA 2ZT7A 3L7OA 4A23A 1DRVA 1XEAA 3WGYA 5BPHA 3THWB 1N6RA 2YMPA 4WK2B 2H2WA 4ROSA 3PC8A 3PUKA 4ALKA 4MS3A 4MV9A 3EPKA 1MO2A 2LE0A 3B1WA 3M5DA 4B6SA 4D3YA 1KH2A 2H2DA 4NJOA 1G21A 2O3QA 4Y2YA 1PZNA 3AW8A 3FCOA 4B3HA 1NNEA 4KNWA 4OHFA 2XVZA 1ZGZA 1J25A 1RKVA 1XO1A 4JGBA 3IVAA 4I50B 1BXRB 1SD2A 1QH8B 1ZOLA 2IYWA 2VTVA 3OFNA 4MW0A 5EZSA 2EKBA 2WHRA 4AS3A 3EPHA 3CR8A 2GVDC 3HBFA 2B8TA 4DLSA 3IIJA 1DEOA 1HR0B 2O7RA 1TJ5A 3C7DB 5HK8A 5LBUA 5BV2P 4C5CA 1IMOA 1LGYA 1YZYA 2RC6A 5LXTA 2R0QC 1Y1LA 4LBYA 1SH7A 4LZWA 3PJEA 4CMJA 2H7CA 1E3WA 4QREA 1HNNA 1YQTA 1X7HA 3D4OA 4HMOA 1NW7A 3UH1A 3T1HB 1K6IA 4OAPA 2WWXA 1T29A 3MWLA 4B9EA 1M34B 1MB9A 2C99A 4Y9SA 2CLHB 4LRUA 4WXMA 3LDHA 2EKZA 4LRTB 2GO1A 2NGRA 2Y67A 1JQLB 3BDVA 3E58A 3IVMA 1L1RA 1ZSNA 5BSGA 2PYIA 5CX4A 4DG9A 3QXJA 2JF0A 1R8JA 3PZBA 4EDHA 2OCAA 5CLQA 3U44B 5K2OA 5JNRA 5ABPA 2WQ6A 3JQCA 1PT7A 1E2GA 2Q0SA 3DVLA 1ATZA 2CF6A 1P4GA 2YMLA 2BJVA 2YJGA