3TQHA

Structure of the quinone oxidoreductase from coxiella burnetii
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
317
structure length
317
Chain Sequence
KEMKAIQFDQFGPPKVLKLVDTPTPEYRKNQMLIKVHAASLNPIDYKTRNGSGFVAKKLKNNLPSGLGYDFSGEVIELGSDVNNVNIGDKVMGIAGFPDHPCCYAEYVCASPDTIIQKLEKLSFLQAASLPTAGLTALQALNQAEVKQGDVVLIHAGAGGVGHLAIQLAKQKGTTVITTASKRNHAFLKALGAEQCINYHEEDFLLAISTPVDAVIDLVGGDVGIQSIDCLKETGCIVSVPTITAGRVIEVAKQKHRRAFGLLKQFNIEELHYLGKLVSEDKLRIEISRIFQLSEAVTAHELLETGHVRGKLVFKVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Quinone oxidoreductase
publication title Structural genomics for drug design against the pathogen Coxiella burnetii.
pubmed doi rcsb
source organism Coxiella burnetii
total genus 96
structure length 317
sequence length 317
ec nomenclature ec 1.6.5.5: NADPH:quinone reductase.
pdb deposition date 2011-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
A PF13602 ADH_zinc_N_2 Zinc-binding dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3tqhA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3tqhA01
3DC2A 2IZ0A 4CMAA 1ONOA 3KETA 3NYWA 4B3JA 1E7RA 4J16A 4XYMA 1C1XA 2HDHA 4DQXA 2GR9A 3JQAB 3K92A 5KCZA 4ZRNA 1PJ4A 3UCXA 4GBJA 3EZLA 1B2LA 4UUMA 1FDVA 4YRAA 4HY3A 2G17A 1ISFA 2DFVA 3JQ8A 1GCOA 4OH1A 1U5CA 1QLHA 1DIHA 1VKOA 3UVEA 3ZU2A 4YT4A 1QXSA 1N7GA 5I8ZA 4L75A 1RWBA 4NQZA 5C7IO 5JDIA 4CQMD 1ENPA 1SAYA 3DMTA 4R4JA 3UCFA 2DM6A 4OSPA 3WTBA 1X1TA 1XG5A 4DMLA 4DC0A 3EHEA 1FMCA 3M2TA 5TLSA 2FOIA 3KM0A 2WSBA 3R3SA 2VYND 2AG8A 4J6FA 4LISA 1XCBA 2DBVO 1D8AA 1DC6A 2R00A 3H4VA 2IDZA 4YJFB 3HQ4O 5G0TA 1I24A 4WCDA 3PJDA 4YB8A 2YZ7A 1SB8A 3LYLA 4R1UA 5EESA 3EYWA 4WLVA 1LEHA 9LDTA 2XF8A 4CL3A 4H3VA 4OM8A 3RC2A 5JY6A 2WDZA 1WDKA 4MJLA 3LF2A 3K73O 4YDRA 4B7XA 4H16A 5F3RA 3C85A 3MJTA 4E2WA 1KC1A 1YBMA 4ZVVA 4BIIA 3A1NA 2GLXA 3GNSA 3K2BA 1HDRA 4RVFA 2QYTA 4NH4A 3RC9A 4TMFA 1JDJA 1A4IA 1W8DA 1WZEA 3SJ7A 1NAIA 3QVWA 3F47A 3PHGA 1HDGO 3OIGA 2QZ9A 3TZQA 3HUDA 1Z74A 2VTDA 3D5TA 4NIMA 2VT3A 4BNTA 3S8MA 4L73A 1AXGA 1W6UA 5IFLA 3QVSA 4O6VA 4IJUA 2GF2A 2P9GA 4CLEA 4YXFA 3L77A 3NTRA 4J90A 3DO5A 1H2HA 1P1RA 2EKLA 3AUSA 3MJEA 4RF2A 4RVSA 1QLJA 2EXXA 2PWZA 3BXXA 3HDJA 4RVDA 4PZDA 3EMKA 4BHTA 1NYTA 1LSSA 1H2BA 2XAAA 3KZVA 4HP8A 4IQ8A 3DBRA 1YOVA 5HRUA 2RH4A 3LC7O 1E3WB 3DFZA 3NTQA 4YQZA 3U5TA 4BV9A 5GMOA 4JP3A 3I4FA 4J7UA 5MGBA 3AI2A 4KOAA 5H83A 2ZYGA 3PGXA 5DT9A 4AJJA 4CLOA 3FTNA 3S2FA 4D0RA 2FR0A 4CQLB 3DEYX 2P91A 3HN7A 3C1TA 3OF2A 4ZA2A 4WLEA 4GWGA 1Q0HA 1PS0A 2GPTA 3PDJA 4EBFA 4KUHA 2RIRA 4MVJP 1U3UA 3WQRA 2NTNA 2ZJ0A 4A7PA 3L6DA 2IZ1A 3RUHA 3UOGA 1NVTA 1GQQA 1OMOA 1ZW1A 1XGKA 5B1YA 4DQUA 2ZTLA 3F4LA 3QIVA 3BTVA 1YB1A 2VHVA 4ND5A 3WIDA 2VHZA 2GN4A 1DC4A 1BXKA 1JA9A 2GSDA 3DZKA 1RM4A 3ETGA 4RF3A 5KVQA 1K0UA 4ZRMA 5FEUA 3QWBA 2FPGA 1R12A 3GZNB 4FFPA 4PLCA 4DA9A 4DIBA 4TROA 2BGKA 4MVJH 1I30A 1Y9AA 4QXMA 4I8XA 4BQRA 1U9JA 3ZV5A 1WLYA 3D4PA 4WPGA 4K6CA 2VWQA 4RF4A 4G65A 4XYLA 4CQMA 3OQBA 1YJQA 2PH5A 5A04A 1IB6A 5JDIC 3K30A 2G1UA 3PQFA 4IDFA 4YBZA 2B69A 1A4UA 2O23A 3IJRA 4E13A 4II2A 1CDOA 4P4LA 3GH3A 4B8ZA 6LDHA 1MP0A 4CR7A 2VYNA 2W8ZA 2GN6A 1WWKA 1N1EA 4TRRA 2EW8A 5ES3A 3GHYA 4OXYA 3JD2A 4YAKA 1U7HA 1ZK0A 3RBZA 2HKIA 2AQIA 3AI1A 3I5MA 4AVYA 4NFSA 4DRYA 2C2YA 3JYPA 2EF1A 2HUNA 5G4KB 1V9LA 5C7OO 5TX7A 5IZ4A 1DIBA 1CETA 1Y8QA 4EGFA 1QV7A 3ETDA 1SB9A 3I6IA 3WMXA 4BO2A 5ICSA 4J7XA 1P1FA 2X23A 3VPGA 2CDAA 1IULA 3NKLA 1IOLA 4EITA 1EDOA 2NTJA 4BKOA 2VUUA 2XXJA 3JQAD 3OHSX 4UVDA 1Q1NA 2AA3A 2O48X 2D2IA 3H5RA 4WOJA 5F5NA 5A5EA 4GX5A 1LXCA 4J43A 2OXIA 4DBVO 1UAGA 4OOFA 4MIOA 1E3SA 2H5LA 1O95A 1SCUA 1NPDA 4FR5A 4YTEA 4FOSA 1GZ6A 3WLEA 3U9LA 4ID9A 4Q39A 3UUWA 2WM3A 4MP3A 4UREA 3VTFA 3GPDG 3O8QB 2VT2A 1HDXA 1KY5A 2AG5A 3L6OO 3TZCA 3UICA 3ZWOA 3ZZNA 1ZUD1 1VJ1A 1DRUA 1IY8A 4KTTE 3KRTA 3PWKA 4NG5A 4K1LA 1YJ8A 4CM7A 2JHGA 4NU6A 3V2GA 3VKUA 1Y7TA 3JQFC 5IDYA 1SEVA 1ONNA 3BYZA 4QECA 3MTJA 4R1NA 4PLWA 4Z0PA 1M75A 2O50A 5G0UA 4EZBA 3QWHA 5HBRA 1Q7GA 3PQEA 4BGEA 2I76A 2P5YA 2YHUA 3D7LA 4DUPA 3B1FA 3AOEC 5KVCA 2BFAA 5AYVA 5ICMA 1ZXLA 4KWIA 3JSAA 4CMHA 2H6EA 1GQ2A 4YRBA 5CPBA 3NDJA 5LDHA 4BB6A 2JD0A 1IPEA 1N9GA 2YFQA 2ZQYA 3V5NA 1DB3A 5L7TA 4W7IA 3UXYA 3WXBA 2GERA 4C4OA 1V3TA 3H7AA 5IDWA 1EK6A 2PZLA 2V6GA 4FC7A 3WSWA 3OA0A 3ROMA 1C3VA 1HLDA 3F9IA 3L4SO 4YT8A 3RUCA 4ZQBA 2AQHA 2WD7B 2O3TA 3WBFA 3H9JA 4IIUA 2WMDA 3U4DA 1ZSNA 1OAAA 3DTYA 3PK0A 3QA9A 3GPIA 5DULA 1J0XO 1UP7A 2YW9A 2YQ4A 5DBGA 3ZV6A 3FBGA 4RJTA 2JJYA 4BO9A 3PXXA 3PI7A 2BI8A 3H5AA 3S2GA 3ZH2A 3BZUA 1Y9EA 2WE7A 5C5IA 3K8ZA 1LTHR 1PJBA 2ZK7A 5BNFA 1R4MB 4CM8B 2B5WA 4FIZA 4NI5A 5THKA 5A5FA 1YQDA 1GY8A 3IMFA 4NR0A 1K3TA 1E7MA 1YBVA 2Z95A 4UULA 3RBXA 2Z1MA 3WDSA 4CL8A 4XR4A 3RJ9A 4PRLA 4K26A 1D3AA 1I2BA 2Q45A 3EK2A 2J3KA 3ITDA 3S2IA 3WGZA 4BNLA 4DYDA 2PD3A 4DIFA 4NK4A 4R1SA 4B3IA 2VWPA 1V3UA 1OI7A 4ND3A 4LCEA 4YJHA 5JDCA 4FS3A 5G0VA 2PZMA 2ZQZA 4QUKA 3VOSA 4E5MA 1YGYA 2YV2A 2SCUA 3DBLA 4RDHA 4CR8A 3PYMA 1HKUA 4Y6RA 3HHPA 3GMSA 3RUIA 5DN9A 2FR8A 3KSUA 4HWKA 5JC1A 1LDEA 3H6KA 1NPYA 1E6UA 4IGEA 1ZK3A 3Q6IA 2P9EA 4J91A 4QFDA 3JQAA 4D3FA 4CLRB 1KVTA 1Z7EA 2OMEA 1NQ5A 3HZZA 1Z45A 4BQPA 1Z82A 3M6IA 5TS3A 1M76A 5KVSA 4YRDA 5U9CA 3SC6A 4L4XA 4HXYA 2WEKA 4A2CA 3TN7A 5CEEA 2BI7A 1J6UA 3KO8A 3OEYA 4BO1A 2O7QA 4XEHA 4AJ1A 2ZYDA 1U3WA 3H9GA 1K6JA 4KQXA 4XRRA 1PJQA 4CMCA 1U4SA 1NR1A 4EJ0A 1PJ2A 2FY8A 4PLZA 3I9KA 4LMRA 4QEDA 1FDWA 3IDSA 3PLRA 1GYRA 4GPD1 1MC4A 4GAEA 3JD4A 1EVIA 4AJNA 3ANMA 2HO5A 4U8GA 1M6HA 1WMBA 2GZ3A 2EHDA 4RO0A 3ZDFA 1OC4A 3Q2KA 2LDXA 1AGNA 1NTOA 1ZCJA 3QVTA 1DIGA 1HXHA 4R3NA 4Y8VA 1YB5A 4TSKA 2FSVA 5DOZA 5U1PA 3BAZA 1ZKMA 1YB4A 2GYYA 3F5QA 4DBZA 2PGDA 4OQYA 4Q3BA 1LNQA 4Y98A 4E0BA 4BL5A 4M55A 2NACA 3DOOA 4K6FA 2C0CA 2NQ8A 1F0YA 5JY1A 1EUCA 1HYEA 3D3WA 4AJIA 4EYEA 3I9MA 3GFGA 3ZNQA 1LRJA 2CF5A 2Q2VA 1VSUA 1K6XA 3BHJA 4RDIA 5KNLA 1YQXA 4G5HA 3TF5A 1GUFA 4JK3A 4GKVA 4IY1A 3HE3A 3ZHYA 3QJ5A 3INRA 1QG6A 3IKTA 1P44A 1C0PA 5B4TA 2QZZA 3VH1A 2QQ5A 5DZSA 2PR2A 5C37A 1YRLA 2AE1A 2JD1A 5HS4A 4E2XA 5JCXA 3GOHA 4D44A 5JS6A 4P4GA 2EIHA 1T24A 2AW5A 1F06A 4PLTA 5DP1A 3ST7A 3O03A 3TL2A 4RF5A 2HCTA 1T4BA 3IOYA 1I32A 3JQ7B 3NX4A 2Y05A 3IC5A 3AY7A 3TRIA 3A14A 1M6WA 5K1SA 1LX6A 4E4YA 5A1TA 4BKRA 1E3WA 5AQ1A 2AEMA 1WZIA 1D1SA 1ZSYA 1KEWA 3ZWBA 1V35A 4L8VA 3ANNA 4B4VA 3I3OA 3CINA 3K6JA 4FFMA 3IL2A 2D5AA 1XQ6A 3S2EA 2Y68A 3H9UA 4L4RA 1AUPA 3GFBA 4D3SA 5TF4A 1KC3A 4BV8A 1YDWA 4HV4A 3PPIA 1U4OA 3PVZA 4I5GA 2OP1A 3D3EA 2X58A 1QSGA 3WIEA 1ZK4A 4IXWA 1PGQA 4AJLA 3PFFA 4RVGA 1D4FA 3DQPA 5IZCA 4J4HA 1HDZA 1PL6A 3ENKA 2NQTA 4CUJA 3EUWA 3DOCA 9LDBA 2X1HA 2CF6A 1YONA 3C7DB 2AQKA 3I52A 1ZBQA 4A73A 1UXIA 3NDRA 2VOEA 4JXKA 2FRDA 5KWEA 4PFJA 2BH9A 4GX2A 1C1DB 1UP6A 4OAQA 4NHEA 3WB9A 3PJEA 3ONDA 1EE9A 5HTOA 1VI2A 1A71A 5TT1A 2X7HA 1TT5B 4JBGA 1V8BA 3B1KA 3U49A 4IXTA 2WE8A 4Y6PA 2WYWA 1VE9A 4R68A 2BLLA 5CHEA 2C82A 2RCYA 1N5DA 4LSWA 3ZN2A 4CMIA 4RPGA 1ZEMA 4B4OA 3I9LA 4FB5A 1HDCA 1DLJA 4H15A 1ADGA 3RU9A 3HB5X 2NVWA 1DLIA 3WGQA 1O9BA 1P1IA 1PWZA 4TVBA 1MX3A 2VRBA 2W2LD 2NU8A 2F1KA 4CM1A 1E1LA 1P0CA 3TZ6A 3GG2A 3KYDB 3Q2IA 2O4CA 3HWRA 4NBRA 1UZMA 3D5QA 3P7MA 5ER9A 2IEDA 4EJ6A 1IZ0A 1GEGA 2DPGA 2X9NA 1UUFA 3KB6A 4XYEA 3V1YA 3VDQA 3AFMA 3IUPA 5JSFA 3Q3CA 3ZWMA 3PYLA 4DLLA 3DONA 2GDZA 2PKRA 3L0DA 4U6SA 3H2ZA 4IPTA 3KV3O 3JQ9C 5T67A 2GNAA 4WLFA 2ZIZA 1DEHA 1PZGA 1ZSVA 2IODA 1A5ZA 1YS4A 3HG7A 2OFPA 1HT0A 3FRJA 3IQDB 2EV9A 1OC2A 4W7HA 4MKZA 3I6QA 3H5NA 3UAGA 3RVDA 1LLDA 1SOVA 2EJVA 2VRCD 2XXBA 3F4BA 3ZGYA 4GI2A 3VZRA 4B3HA 4QX6A 1ISJA 3E5RA 3SEFA 4IIVA 5JAMA 4W4TA 2I6TA 2G5CA 1S6YA 4BO4A 2YV1A 5KJFA 3EAGA 1WAMA 3ZHBA 3I9NA 1AHIA 1R0LA 3WQSB 4BMVA 4WE3A 4XDZA 4I1IA 2I3AA 1MV8A 2NM0A 3HADA 4N5NA 3R0IA 1T2EA 5DBIA 4GQAA 3RIHA 2QRKA 2UDPA 5KIAA 4IS3A 4QO7A 4Z9YA 4GH5A 4M8SA 3NAQA 1JKFA 2BGMA 3H9EO 3UFXA 2PTGA 4DIOA 2ILTA 1O8CA 2HK7A 5A9SB 4QFCA 4DWVA 4OXKA 1PJSA 4ND2A 4UAGA 4AJKA 4MDHA 3W6UA 1Y5RA 4ILKA 1UXKA 1UP4A 1U8FO 3STHA 2P4QA 3TJRA 3WS7A 4AJ4A 4CPDA 5F21A 3GMDA 1Z75A 3E1KA 4NJOA 1B3BA 2ZCUA 3WGHA 4DVJA 4A0SA 4BNZA 4RVUA 1H9BA 3ORFA 4GX0A 4DQVA 4BO0A 4CV3A 3H3FA 3WSVA 3WFJA 3KYCA 1LLUA 3ZW9A 1PTJA 1YO6A 4PVCA 3FPCA 4MKRA 5CPFA 1R4MA 5C3MA 3W8FA 3ZWVA 4CMEA 3OJFA 1HSZA 1PGNA 3DDNA 3BMQB 2Z5LA 3PP8A 3VVCA 2CVZA 1CIVA 3RKUA 5CDSA 2Y1GA 3NJ4A 3JQEA 4N7RA 1PL8A 2UAGA 4BB5A 4U0JA 1VPDA 4BS9A 5EJ2A 1LDNA 3G0OA 1LDBA 2X0JA 2VUSA 3INGA 3B1JA 4IZHA 4NDNE 1SOWA 3WX0A 2C7VA 4E2ZA 3SJUA 1ZIDA 1W73A 2ZJ1A 4ZQHA 3GNTA 1BXGA 4P38A 3KUXA 1FK8A 4F46A 1ZJYA 3L6EA 4JBHA 3ZV4A 4I9NA 5FYDA 3KXDA 4PGFA 4YACA 5A9TA 5BR7A 2G82A 2W2LA 3MJVA 3RFTA 4GLOA 1QYWA 2EP5A 4EEXA 3KYBA 3GVHA 1H0KA 3IS3A 3B70A 5DCUA 3COSA 1DAPA 1K89A 1XEAA 2JCVA 1CWUA 4O63O 5HS6A 3E9NA 2B5VA 2HJSA 4MVJD 3M2PA 3G1TA 2DUWA 3DXFA 3N58A 5EERA 1O94A 4BNYA 3DHEA 1ZNQO 5JAZA 1D7OA 3OIFA 3H9QA 4HFRA 3N74A 4XGIA 3GUYA 4FW8A 4YT5A 3RU7A 1PGOA 1S7CA 1KOLA 4D41A 3GGPA 1ID1A 4WLUA 3WGIA 1SC6A 4RPKA 3JYNA 3I9OA 4XYGA 4ZJUA 4N18A 3SLGA 4XWYA 3GEGA 1DRWA 1EDZA 1T2AA 1KYQA 4XZ3A 4YA6A 1UDBA 4P22A 2B4RO 4BUCA 1MUUA 4CV1A 2PZKA 3KLMX 3GRKA 4LK3A 2GASA 4IDGA 1KERA 3DAGA 6ADHA 3DZIA 1LLQA 2VRCA 4JNKA 5DOVA 1K5HA 3ROKA 1B15A 2ET6A 4WNCA 2OZPA 1DFGA 4Y9DA 1M67A 2X5OA 3HFGA 4LW8A 2ZTMA 4AICA 4AFNA 3GGGA 4BNXA 2PLAA 4QQRA 4I9HA 1HRDA 4BNNA 3ZWNA 4WLOA 1YBAA 3JQ6A 1TVEA 3D4OA 1ENZA 5L4LA 3HDYA 3W1VA 2DLDA 3RCBA 1NWHA 3QW2A 1BTOA 4WASA 5ILOA 3LZ6A 2HU2A 4WCFB 4O59O 3BMOB 4CV0A 1G6KA 3EVTA 1BVRA 3MTGA 4CLDA 3JQFA 3MEQA 1LSOA 3NDIA 2Q1SA 1Q0QA 5A3VA 1DJNA 1E3LA 5A4DA 1BW9A 1KEUA 3GK3A 3TSCA 5KKCA 3U09A 4RV9A 1MG5A 4G81A 4N5LA 3AOEA 4TRJA 1U1IA 1DIRA 2UUPA 2A9FA 1QP8A 2R2GA 1ISMA 1X1EA 5BNTA 1GR0A 2OBNA 4X54A 4UEJA 4B8WA 3LT1A 5L95A 4PZEA 4EUFA 2CZCA 4OSOA 2Y66A 1IZ9A 5L40A 3L9XA 4Z3DA 1FXSA 2I5PO 3AM4A 5EN4A 4OJNA 3VZQA 3BMNA 1CRWG 2NNLD 2A94A 2X6TA 4J9UE 1Q7CA 1U8XX 3I4CA 2OGUA 1E5QA 3PTZA 4F6LA 4CMEC 5LC1A 4TRMA 4ZQEA 3KEQA 4XJSA 2QW8A 2PD4A 5A05A 2BRUA 2CNBA 4YAGA 3FN4A 2B83A 4BNIA 3BTOA 2DBZA 3CUKA 4CM4B 4ND4A 4HNHA 4EUEA 4LCJA 4A26A 1GL3A 1Y81A 2C07A 3DBVO 4OKNA 3HDHA 3GY0A 4EUHA 5CAEA 3QE3A 2BFPA 3CE6A 1WXDA 2P9CA 3F46A 5EPOA 1LA2A 5TC4A 1OZAA 4WOKA 1C0IA 3RUFA 3FCOA 4L74A 1MFZA 1RYDA 3NJ8A 2HMVA 4YAEA 4KDEA 1L7DA 4MOWA 4JJIA 3QV1A 5CEJA 4R01A 2X5JO 2VYVD 1ULUA 1PGPA 3F3SA 3NUGA 4MVJA 3A06A 2P5UA 5JE8A 5LCXA 1GAEO 3CMCO 1HYGA 4HFMA 4P8RA 4ESOA 1PQPA 2FMUA 2VZ8A 1HETA 1DFIA 4CV2A 3AOGA 2FN7A 1T2DA 2PK3A 4JQCA 3JQGB 1E1NA 2AEFA 1E3EA 1BGVA 3LU1A 3ADPA 2X0RA 2DBRA 4L4SA 4NBTA 2W90A 4KMSA 5KVVA 4S1VA 4BNMA 1DIAA 2AQ8A 4WGGA 1E6EA 1CYDA 2CVOA 2G76A 1JTVA 1Y1PA 1EUDA 5CG2A 3LF1A 4O5OA 4XIJA 4XA8A 4DC1A 2OOSA 2B36A 2QYSA 2G0TA 4RQUA 1YXMA 8ADHA 3WFIA 1GD1O 1TT5A 1ULSA 1NFFA 1R4NB 4BKQA 2DT5A 1P1JA 1ZJZA 4DMMA 3JD1A 1P74A 4HKTA 4WUVA 4YJGB 1A7KA 3JD3A 3ROQA 3PEFA 1EZ4A 3SXPA 4R9RA 3MCVA 1RKXA 1RPNA 2WYVA 2HRBA 1E1KA 1X0XA 5T5QA 1HSOA 5L53A 1EQUA 2Y1EA 3B20A 3DHYA 2YY7A 4DPLA 1LQTA 1GCUA 1XA0A 3OETA 1EVZA 1NAHA 4IQGA 4B7CA 4S3MA 2NTVA 4FFNA 2UYYA 3I1JA 3F6YA 2NSDA 3I23A 1GEEA 1LDGA 3MJCA 3VTZA 5FWNA 1IPFA 2H63A 4XGKA 3UW3A 3PRJA 2VHYA 4R16A 1DC3A 2VZ0A 4E5PA 2V6FA 1ZXBA 3V1TC 4JROA 4EI2A 4OL9A 5TJ9A 3H65A 4HUJA 5AVOA 3EW7A 4FGWA 4XQGA 2X22A 4E33A 3CMMA 3WJAA 3ZU4A 2O2YA 4BO3A 2GD1O 3T4XA 2UVDA 4PRKA 3DAPA 4NJMA 3WJ7A 5F1KA 4E30A 1PR9A 5BT9A 1ZZEA 3MJ4A 2RBEA 3WGGA 3WYBA 4M86A 4BMNA 1TB4A 4H7PA 4TVOA 1ZMTA 1Y6JA 4XCVA 5CDYA 1FDUA 3MJSA 1Y8RB 2NVUA 4IGFA 2A92A 4IDAA 2GUGA 4BO8A 2ZB4A 4ZQFA 4XYBA 3G17A 1EFLA 2ZYAA 3QVXA 4AJHA 3GA0A 1H94A 3DBHA 3W8EA 3O9ZA 1N92A 2FP4A 2C59A 3CKYA 2D3TA 3BMCB 3PYXA 1U2DA 3OIDA 3GLQA 1HEUA 4XQCA 5I7FA 4LSMA 4Z9XA 1EQ2A 4FSHA 3LK7A 1AHHA 3PHHA 1B8UA 4QT0A 1E6WA 4ALJA 4FJ2A 2PFGA 4O0LA 4C7JA 4DPMA 3PHLA 1PU2A 4AL4A 2OHXA 2QIOA 1C1XB 4YR9A 1LQUA 1GFSA 1LJ8A 3K9QO 3PHIA 4JN6B 4TZKA 4HFNA 3EDMA 5JFOA 2FZWA 3ZWPA 2NU9A 5L51A 5JW6A 2DFDA 5JAIA 5JMWA 3ZNOA 2A35A 3HDQA 3G3EA 4NFHA 3GT0A 3NTOA 1KS9A 3VC7A 1C0KA 1I3NA 2JFGA 4XQEA 3CXRA 1D1TA 1CQIA 5DP2A 1EK5A 1UJMA 3NT5A 4NBUA 1TI7A 4BO5A 4HNGA 2I9PA 3H3JA 5BQFA 4NZ9A 1N1GA 5ENDA 3GUCA 3UN1A 1EBUA 2OBYA 1T26A 1QRRA 3TL3A 4M1QA 4IMPA 1E92A 4ITUA 3K2EA 2IE0A 1E77A 3ZW8A 3C3XA 4E5KA 3C1AA 2JAPA 2Q4EA 3MWDB 3GAZA 2IYPA 1ADCA 1GDHA 4M54A 4GX1A 4OO3A 1ENYA 1JAXA 1JW9B 1Z7BA 1I2ZA 3QVOA 4YEDA 1XSEA 4L76A 1R0SA 2Z1NA 4D79A 3DL2A 3QSGA 4Q3CA 1HWYA 1E7QA 1NM5A 1PGJA 3RFVA 5COQA 4ALLA 3PJGA 1Q2XA 2HMSA 4F6CA 4YJFA 5KOIA 3ON5A 3LSYA 4BNUA 2Q2WA 4HBGA 2FWMX 2BFOA 3FD8A 3ZV3A 1T1RA 4YPOA 4C7KA 1ISHA 3E48A 3G1UA 4I9UA 4NMHA 4OYRA 2WYUA 3R1IA 4IZIA 4I5DA 5AOVA 4A10A 1DOHA 3GEDA 3PLNA 2I65A 4BKUA 1ONPA 1PJ3A 4KQWA 4A5OA 1A27A 2D1YA 2TMGA 1H6BA 3ASUA 3AY6A 4BNFA 2B4QA 3DZJA 3FNFA 3I83A 4RVHA 3GNQA 3E9QA 4DL9A 2DTDA 2GCGA 2UV8A 1U2GA 2JL1A 3VH3A 5GZ3A 1UAYA 4UEOA 3DBRB 2OUIA 4J3FA 5G0SA 2P68A 4ALKA 4BNVA 1JWAB 2Y99A 3AFNA 2JHFA 2DQ4A 2QG4A 3O38A 4ZD6A 4CMKA 1EBFA 1MA0A 3OA2A 3DMYA 3JQ9A 3RFXA 4PG8A 4A27A 4CLOB 3FBTA 1MG0A 4PVDA 3VPXA 2Q1UA 2Y0CA 2NU6A 3JQBC 3P2OA 2O4UX 4FC6A 2VNSA 3FR8A 1LC3A 3HN2A 3WNVA 2EERA 3D4NA 1PS9A 5BSFA 2NVBA 5HA5A 3SVTA 2CDBA 1V3VA 3E82A 5I9LA 1AXEA 3FI9A 5I7EA 3PIDA 5DCWA 4MINA 2EGGA 4FBGA 4CM9D 1XWFA 3ZHZA 5T6BA 1GTMA 3NT2A 1U7TA 3NRCA 4CUZA 3GQVA 2NADA 3GC6A 3JTMA 4RPLA 2H9IA 3KHUA 4XJTA 1ZO8A 4CQLA 2E82A 3R6DA 1R0KA 2Y0EA 4ALNA 2EKQA 1VSVA 2C7GA 4R3WA 1E7WA 3ZU3A 3P19A 1IUKA 3BIOA 3WOHA 3FWZA 4GSLA 4IBOA 4BNWA 2CSUA 5AXBA 1B16A 5T57A 3KSZO 3ULKA 4JGBA 4CQMB 8LDHA 2C5AA 2CVQA 2HRZA 4MVJM 1RYEA 5KJ1A 3OJLA 2Y93A 1G0NA 2NLOA 2HMUA 3VKVA 5I7VA 4MIEA 3GZNA 2YDXA 1F14A 3QP9A 3RI3A 5L7WA 3ADOA 1OOEA 4WEOA 2DTEA 2E49A 2J5KA 4CM4A 1O0SA 2QRLA 2OP0A 5TSDA 4F3YA 5L9AA 5JCJD 4LMPA 1VJTA 1KEPA 3CPSA 3WGYA 3V2UA 4NFYA 3ETEA 5A02A 1UH5A 4LN1A 4BNHA 1BWSA 3KOUA 2YHIB 1DC5A 4M87A 4HFJA 3QRWA 4GKBA 4KZPA 1L7EA 1SNYA 2BGLA 4GL4A 1GPDG 1WMAA 2IXBA 2A4KA 1TA4A 4E5YA 1P1HA 1BDMA 3VVBA 5ITWA 2YDYA 4M49A 5COBA 3GVPA 4OHUA 3WTCA 4RCVA 2DAPA 5EQFA 4WJZA 4Z9FA 4DGSA 4W9NC 4UUNA 2O3UA 4IUYA 3ICPA 5G4KA 1EVYA 1MXHA 1ZK1A 2D8AA 4E5NA 3LT2A 1T1SA 1UXHA 4FCCA 4LVUA 4MKXA 1UZNA 5F1OA 3E5MA 4RLHA 4UVEA 1PIWA 1PX0A 1BRMA 2FR1A 4J1QA 3GR6A 4AJEA 4CLHA 4MPDA 2HMTA 2PKQP 4UVIA 1W0CA 1I3LA 3PQDA 3Q11A 3ZWAA 3C8MA 4OMUA 1FDTA 3LLSA 3RBVA 2FSSA 3AU8A 2FZEA 5K6AA 1UXJA 5JNLA 2EGHA 1O5IA 2O3SA 4OQZA 1J49A 3W6ZA 4R9SA 7ADHA 1R4NA 3JCZA 1CJCA 1P45A 1GPJA 2CDCA 2ZCVA 1LRKA 5JMPA 1U28A 3OJ0A 1HE2A 2HJRA 1H6AA 3W4IA 3KEOA 3CTMA 3O8QA 1ML3A 1DHRA 4GLLA 3RD5A 4D0SA 1VRWA 2E37A 5ER6A 4BMSA 4D43A 4YJDA 3PWSA 5IJZA 4PG5A 2NUAA 2QRJA 4CM9A 4ND1A 4WCFC 1N9GB 4IQ0A 2XOXA 4TZTA 3AW9A 1BSVA 4U6QA 5KKAA 1F17A 3OBBA 2CD9A 4NBWA 4NPCA 3BTSA 4CM3A 5CG1A 3RSHA 4BO6A 1LC0A 1MGOA 4PIVA 3LT0A 7MDHA 1XU9A 5A06A 1T4DA 4U5QA 2X5KO 5GZ6A 1NQAO 4ZU3A 1TXGA 3HJAA 4CJXA 3KLPX 4BGIA 4ROSA 1TLTA 1KVRA 1N7HA 1I01A 1PJTA 5G2OA 1PZEA 1X13A 3FWNA 2VCYA 2WWRA 2HAEA 2I67A 3DZBA 4MVJF 3EGOA 5I9MA 3NGXA 4J7CA 4EEZA 5I9NA 3EZYA 1E0DA 2Q2QA 2AXQA 2I3GA 5CDUA 3CH6A 1ISIA 4DYVA 2RAFA 2WD7A 1I36A 3U4CA 4TKMA 1HE4A 1VL8A 1GV0A 4JX8A 4UEKA 5JCJA 4NU5A 3BHIA 3FNEA 5JC8A 4YJHB 4UVGA 3CSDA 3BMCA 1F8GA 2ZATA 4TWRA 4CM8A 1XHLA 4D42A 1AE1A 5JYDA 3GN1A 2GN8A 3DBLB 4OOEA 4Q9NA 3GGOA 2O2SA 2PH3A 1U3TA 1XDWA 1FDSA 1LSJA 3OFSA 1J5PA 5BNIA 3QLJA 4NBVA 3LT4A 3PGJA 3W4JA 1ADFA 1X0VA 2IRWA 1G1AA 3VAZA 4FN4A 1RM5A 4KUGA 1DAOA 3GZ4A 5HWSA 4WK6A 5DBFA 3UH1A 4NK5A 4YYZA 3TFOA 3OJOA 1KETA 1QYXA 3GDOA 3DTTA 1I3KA 4L0QA 3HSKA 2HSDA 4RGBA 4E21A 4Q3AA 2B0JA 3QY9A 1NBOA 1M66A 4GGOA 2OO5A 2P2SA 1XQ1A 3UKOA 4XB2A 5EQDA 3WGOA 4CLRA 3IJPA 5K6AC 1NX6A 1XKQA 3ZI0A 1HDYA 4ZN6A 3IKVA 1YL6A 4B7UA 1ZK2A 3A28A 4RL6A 3VPSA 3L4BC 5ITVA 2YV3A 1JLLA 4XRGA 2B35A 1RM0A 3TPCA 3QWAA 1GADO 1XU7A 4PG7A 1O89A 4J4TA 2XPCA 3VPFA 4JLWA 4YWJA 2PY6A 4CMBA 2GGSA 1ZH8A 4IDEA 1X7HA 4GVXA 4DXHA 1U5AA 4F45A 1N8KA 3Q0EA 4IJVA 4L9RA 3GHHA 5B12A 3D3WB 1NVMB 3O26A 1ZEJA 4KWHA 2BKAA 2V6BA 3BHMA 4GMGA 3VH2A 3ZNPA 1B8VA 1H9AA 1J4AA 3DZFA 1SBYA 3HNPA 2C20A 1SZJG 4A03A 2HMWA 1YL5A 1SEPA 5FFFA 1HF3A 1UDCA 2Y0DA 2HK9A 5IN5A 4Z0HO 5K0ZA 4TQGA 1CERA 3JYOA 5EINA 3GAFA 3S55A 1E7YA 1V0JA 1E1MA 2J3JA 2F00A 3GG9A 5MDHA 1VLLA 2VOJA 3I9JA 5DNAA 1WP4A 3TOZA 1GUZA 5IDQA 3GF4A 1XR3A 2BHLA 1DSSG 2QX7A 1X15A 4KDFA 1KVQA 1JKIA 1KVUA 1NQTA 2VWGA 5G4LA 3OEWA 5TJHA 5IXSA 5DCYA 3RQSA 5AXCA 3OH8A 1YDEA 2GRAA 5IN4A 3KVOA 3ZCXA 3BTUA 2W2KB 1H6CA 3AM3A 1Z73A 3GDGA 5T8KC 1NPTO 2ZB7A 4FFOA 4DREA 3OQ6A 3DAFA 2AEJA 1RM3A 5B4UA 4D3DA 1GQYA 4OXNA 3JQ7A 5FI3A 4RLSA 2D0IA 2Y1CA 4CM6A 2Y1DA 4XQ9A 1DDOA 3WR5A 3GRPA 3C24A 1P0FA 1GYQA 3C7AA 3D1LA 5F5LA 1I2CA 3JD0A 3INTA 5CP8A 3X2EA 2PV7A 1E5LA 3OP4A 5B4VA 5AXAA 1ISGA 1CQJA 1GZ4A 3UGKA 2Q99A 2IXAA 5IG2A 5FF9A 2P4HX 1LDMA 3TFQA 4PG4A 2Q4BA 2J5RA 4DPKA 3H8VA 3R3JA 3MZ0A 3IP3A 4ONEA 3PWZA 4K9DA 5JO9A 4IJWA 1EE2A 5TNXA 4EDFA 3L07A 5KJEA 1ORRA 3TZHA 3ICCA 2Q46A 5TRTA 3HFSA 4E32A 2AE2A 1I5RA 3WMWA 1VKNA 2X8LA 3N7UA 3OJEA 3DMTC 1Z6ZA 3ANLA 1C14A 5JXWA 4D7AA 4URFA 1F8FA 2E4AA 4R51A 4IJKA 4W6ZA 1QMGA 5L7YA 2C54A 1HZZA 2DBQA 2GN9A 5EL0A 4TKLA 5L4NA 2WD8A 4BGUA 1IHXA 2VNAA 1B0AA 4LRTB 3EVNA 1UDAA 2V65A 4CMGA 4DLBA 1PJCA 2R00C 2ZB3A 3WNQA 4CMIB 4PG6A 1PR3A 2O3RA 1QYDA 3NT4A 4XD2A 4R41A 4CUKA 2Y1OA 4U7WA 2IEBA 4PZCA 1QORA 1C1DA 1PZHA 3C7CB 1BMDA 3OM9A 5DDIP 3ZNNA 2RH8A 5A3JA 1UXGA 2UUOA 3KBOA 3FF4A 4IM7A 2EW2A 3PHJA 4M89A 1IYZA 2Y1FA 3WICA 2YHIA 2PD6A 3NGLA 2E48A 1NWCA 5K9ZA 3TWOA 4E2YA 2POQX 4YAIA 2X9VA 4LVCA 3FHLA 4LRSB 3MWEB 2VTEA 3M1LA 5IF3A 2RHCA 1P77A 1XELA 2PGJA 3GDFA 1C0LA 1E3IA 3QHAA 1VC2A 2EJWA 1PQWA 3GEMA 4BKPA 1BG6A 3IAHA 3RKRA 4FFLA 3W8DA 1KY4A 2BD0A 3M1AA 2PGLA 1NNUA 3KYDA 4CLXA 5ENVA 5KJ6A 5THQA 1WNTA 4Z3KA 1I10A 3UF0A 4W99A 3VHRA 3G79A 4CODB 3U0BA 2DKNA 1LBEA 3GVXA 5EMHA 3TZKA 3WLFA 1R6DA 2V7PA 2HQ1A 1VM6A 1YL7A 2JFHA 3JYLA 1QKIA 1XLTA 3ZWCA 4FDAA 2OL4A 2WJPA 3B6ZA 2DTXA 3PJFA 2HLPA 1JKJA 3IUSA 1JAYA 3KTDA 4IS2A 3U4HA 4ALMA 4DTIA 2EG9A 3E03A 3IP1A 3PDUA 5JPIA 3AUAA 1DXYA 3F1KA 3AJRA 4J1SA 2O7SA 1GV1A 1R37A 2TMDA 4BNJA 3G49A 4WKGA 5H81A 5CFZA 2Q1TA 4D46A 3ABIA 4BGVA 1XIVA 3KSDO 3D64A 3VZPA 1H6DA 1T2FA 3JQBA 2X9GA 4I5FA 3NEPX 1TEHA 2GZ2A 3E18A 4FPXA 1IE3A 3LVFO 5IXYA 1MLDA 1MC5A 4MIYA 3E6AA 3RJ5A 4CR6A 2LDBA 2EKPA 3DOJA 4Z6KA 5CEFA 4E6PA 1BXZA 5BSGA 1V6AA 1LUAA 2D59A 4ALIA 3FSRA 4J2OA 3AU9A 1PQUA 5GZ1A 1B26A 2IZZA 2OORA 4PLVA 3GVCA 2VYVA 5A9SA 1ZMOA 3KYCB 3K31A 4B4WA 4P4NA 4ZICA 1AN9A 4KP7A 2ZTUA 4IINA 5HM8A 2X0IA 3W4KA 1WDLA 5EIOA 3JQ8B 2CFCA 4KTVE 3DZHA 1IL0A 3VH4A 3T7CA 1A9ZA 2DPHA 3QWFA 1HE5A 4N5MA 1NASA 3ZHXA 1JN0A 1ENOA 1KEVA 1NP3A 2JAHA 3HB4X 4J0FA 4D45A 1QYVA 2ZB8A 1B3RA 4Y67A 5JAQA 1N2SA 1I3MA 3K96A 1BXGB 2FPPA 3TQHA 2B37A 2I66A 2RHRA 4FFRA 3ITKA 4PLGA 4XKJA 4JIGA 1GYPA 4ZGWA 3Q9UA 3TNLA 2DUUA 1HE3A 1WVGA 2Q49A 3X2FA 2FPIA 3PIIA 3BMQA 4Y6SA 4XX0A 1L1FA 3ROPA 3AY3A 4Q3NA 1VJ0A 2R6JA 4BVAA 1LI4A 1JWBB 3TDKA 1ARZA 2FHSA 3SC4A 5L4SA 1P1KA 3ZU5A 4BO7A 1OBFO 4OGWA 3ENNA 3AUTA 1F12A 5JLAA 3VPHA 4NNJA 4MVJE 4QTZA 5C7LO 4EJMA 1PZFA 4HX5A 4B79A 2JCXA 4RORA 5H82A 3CIFA 3AM5A 3WBBA 2J5QA 4WLNA 4FD3A 3U4IA 4RZHA 2AMFA 2AHRA 2PZJA 2ZTVA 4TRNA 1WPQA 3WQQA 3ZWYA 1MFPA 1I0ZA 3A9WA 4WNIA 4W9NA 1R15A 1EMDA 2GO1A 3MOIA 4I5EA 3RUAA 1KIFA 4GVLA 2C2XA 3CZRA 2VHXA 1A9YA 4JCOA 2HK8A 1W4ZA 3L9WA 1YQGA 1YH3A 5ADHA 3WWYA 4YAJA 3RUDA 2YFHA 5BSHA 4QO8A 4DLAA 3UCEA 5CDTA 3V1UA 1X14A 5BSEA 4AJOA 5I8WA 4FGSA 3ONEA 4RPJA 1YOVB 4Z0TA 1M2WA 1UZLA 4XDYA 2BMAA 3FNGA 2CUKA 3JV7A 2CMDA 3IIEA 5GY7A 3PZRA 4J1NA 3C1OA 2O3JA 2W4QA 3AK4A 3QQPA 4WEQA 1CEQA 1G0OA 4JBIA 4INAA 4UVHA 3DWFA 1BW9B 4R1TA 4PN3A 4J49A 3S1LA 2QHXA 3RASA 3JYQA 5COAA 1JQBA 1EEHA 1EUZA 3NV9A 4PCVA 4IDCA 4CM5A 1OFGA 5FI5A 1P9LA 4MO2A 2GZ1A 3U3XA 2H1SA 4AJ2A 1MXFA 4WCFA 1GUYA 2JD2A 1DBVO 5A9RA 3FPLA 1QYCA 1QV6A 3BMOA 1B7GO 4GGPA 3DHNA 3FR7A 3LC1O 2BELA 3LQFA 4MVJI 1HTBA 4PLYA 5A03A 3BMNB 4R54A 1NFRA 1A72A 1YKFA 2VQ3A 3K5PA 2YQ5A 4J1TA 1BVUA 4YQYA 4WECA 1LSUA 1P3DA 1PL7A 3RC1A 1HYHA 2C29D 3OMLA 5AXDA 4FJ1A 4MP6A 3WGTA 1DPGA 5KJCA 4J9VA 1P31A 3RUEA 1SMKA 1FJHA 1PS8A 1HLPA 3CEAA 1QR6A 2DU8A 2W2KA 2PKQO 1RJWA 1UR5A 3RWBA 2YUTA 4RZIA 3RROA 1FF9A 5F1PA 1NFQA 2JKVA 4J0EA 5JDCC 2NU7A 4CMJA 2DC1A 1JU9A 3O4RA 2JFFA 3AWDA 1LDYA 3OECA 3DR3A 3SBOA 1P33A 1WDMA 1MB4A 1ZFNA 3ZWWA 1T2CA 1H5QA 1VL0A 3WYEA 4AJPA 1H93A 3LLVA 3V8BA 4XB1A 1Y5MA 1ADBA 2D4AA 3FNHA 5T64A 3T7EA 3VZSA 1KVSA 1DFHA 1Y8QB 4O1MA 1NVGA 1Q7BA 4J2HA 4XIYA 1I8TA 1YE3A 2Y67A 3MOGA 3EC7A 1YWGO 3DZGA 2VWHA 4G2NA 4EW6A 2C5EA 1PJLA 3V2HA 4BNKA 5IAAA 4PLPA 1R66A 4N54A 3FTPA 5CDGA 4XGNA 4YVFA 1T25A 4RPHA 3BA1A 4MVJG 5DF1A 4XR9A 4GMFA 4R5HA 4RQTA 3WYCA 2Q3EA 2X0NA 3T4EA 5I7SA 5J23A 3CZMA 3JQGA 2B4TO 3PZBA 1HL3A 3P5SA 1GZ3A 3UHAA 1E7SA 2E6UX 4AG3A 4QSMA 3DB2A 1NXQA 4W82A 5TQVA 4IDBA 4YT2A 4FQ8A 3A4VA 2DVMA 3OICA 4J4BA 1TT7A 2EWMA 2VZ9A 2NWQA 3H2SA 4FJ0A 4MP8A 5L45A 2JCYA 3Q1LA 4Q3DA 1IHYA 1U3VA 5JBIA 2I99A 1SPXA 1K6IA 4PLHA 4U0KA 2VUTA 3QWIA 2BFMA 1GU7A 4GSKA 1Q0LA 2O3QA 3L4BA 2CY0A 1WW8A 2PNFA 4II3A 4YJGA 1NR7A 4JJFA 5TIIA 4GWKA 1JVSA 1VL6A 1YVEI 1E3JA 2ZKLA 1K2WA 1X7GA 2J8ZA 3PFWO 5JYEA 1CF2O 2Q1WA 3D0OA 3JQDA 4OKIA 1EVJA 1A7AA 4OIMA 3ONFA 4HADA 4IDDA 5L3ZA 4BNGA 2IYOA 5KTKA 3OQ1A 1EFKA 3OSUA 1JVBA 1B14A 1LLCA 2WTBA 3RC7A 5JO0A 3GVIA 4BOYA 4JJGA 3DFUA 3LC2O 3E9MA 4NJMB 3GN2A 1R16A 4FOOA 1X7DA 2VN8A 4ZQGA 4YCAA 2YYYA 1BDBA 1LRLA 3WG9A 2YJZA 2VHWA 1DRVA 3JQCA 2NVUB 3RAJA 3LDHA 2Q50A 1HZJA 3E8XA 4KUEA 5ILGA 1KBZA 1XYGA 2W98A 4E3ZA 3F5SA 3P2YA 5U4QA 3VDRA 4E31A 5B37A 1DJQA 3AUUA 3DBHB 2J3IA 4JP2A 1DO8A 2NV6A 2EP7A 4I08A 4IMRA 4PLFA 4K28A 4UUOA 1PWXA 2EEZA 3Q9NA 4ZHSA 1NHGA 2J6IA 3TOXA 5IDXA 1I33A 1O6ZA 3U62A 1DHTA 3SLKA 1Y8RA 4R69A 1SO8A 3SX2A 3F1LA 4B4UA 1BHSA 4Q3EA 1NHWA 2PA3A 4UUPA 5T8KA 1PSDA 3WWZA 4E12A 2J3HA 2V6MA 5TT0A 4R5MA 1PEDA 2X86A 3EY4A 5IZCC 1ZVMA 4LGVA 1HDOA 1B8PA 5TGDA 2D5CA 1LU9A 5LDGA 2BF7A 2X4GA 3AI3A 1NQOA 5G0WA 3ZWXA 3ASVA
chains in the Genus database with same CATH superfamily
1XI2A 2X4IA 1S2IA 2PT7A 3ONNA 1IWOA 4D9BA 3UJNA 2FWIA 4BVLA 5FOQA 2NYAA 3NYWA 4G3XA 4J16A 3CVJA 2OQVA 1C1XA 1QX4A 1RBMA 4HB0A 1Q77A 2Z98A 3AXSA 4OQ4A 4Q1DA 3ZC3A 4UUBA 4M22A 5EGNA 2BGJA 3JQAB 5FRDA 3G2IA 3OUUA 5KCZA 2Q5IA 1GGVA 1PJ4A 3KD3A 3UCXA 4HNUA 2JF0A 1CUGA 3TNDA 2XNKA 3FPBA 3HZOA 4OHWA 1SR8A 3I9FA 4QPNA 2WJJA 3PQ3A 2G17A 2HLDA 5THXA 3RIEA 3B2EA 3UJ3X 5CK5A 3K94A 1J21A 4QG3A 5K0LA 3PHCA 3R20A 5HIKA 4LXYA 2FWJA 4X6LA 3R9IA 5HHTA 3GXBA 1CT9A 1DIHA 1VKOA 1QWOA 4WRRA 4Z1MA 3ZU2A 1OASA 3ZXXA 1N7GA 2XWQA 3NTUA 1UMDB 3H1TA 4O29A 3EA0A 2HIMA 3STYA 5JDIA 1OIXA 2IYSA 3QLUC 4Q21A 2HR1A 1ENPA 1SAYA 1U0OC 3DMTA 4RUKA 1CLEA 3NBYC 1O7JA 1Y5IA 3X1YA 2DM6A 1OQAA 2WRZA 3V8QA 1VFNA 1ZQ9A 4DC0A 1SHKA 3WGMA 4RS3A 1T9DA 3E3LA 4BMOB 5DLDA 4JAVC 4QM6A 2AG8A 1RBYA 3CT6A 4J6FA 1DTSA 2ERYA 1SKBA 4NF2A 4DNPA 1XCBA 4EHIA 4F06A 2HDWA 3EVBA 5G0TA 4YLYA 5EP2A 1I24A 4WCDA 2EJUA 4DR7B 5L7WA 2YZ7A 2ZAYA 4R1UA 3DE6X 3BD8A 3EYWA 4OHVA 5F3DA 2HA7A 1LEHA 2ZAOA 4MTCA 4D0GA 2ON6A 3CLTD 5A6VA 1AB6A 3TW4A 9LDTA 4YDQA 4O4HF 1EIWA 1A9SA 2Q3MA 3RC2A 4M7OA 5E6RA 5DLEA 4P80A 3UAXA 4AYWA 4Q4HB 1PV2A 4MJLA 2EFYA 3LF2A 1AGRA 1ZNZA 4ANFA 1MW9X 4O4JA 1FVXA 2FTKE 2MHCA 3DYBA 4H16A 3C85A 4MV6A 4ZAXA 3M3DA 3VYUB 1X77A 1NJ2A 2QVYX 3GRRA 4BMYA 3F90A 1ODKA 3A1NA 4KQ6A 2FZVA 3GNSA 5KBYA 2QYTA 2RARA 2V1UA 4TMFA 1A4IA 1CK4A 1WZEA 3VC1A 2FZLA 3VU9B 2G63A 3F47A 3Q5DA 2FFRA 3G82C 4L2IB 2PNJA 1FOEB 1U3FA 1WP9A 4I8DA 3DHVA 3G13A 2AN5A 2VTDA 4AY3A 1JJBA 4U7TB 3D5TA 4NIMA 2HTFA 1YZYA 1EFVA 1U0RA 2VT3A 3MUNA 1AMNA 4H3SA 4P36A 2AR0A 3ISVA 1GUAA 2IGBA 5FL3A 2GB4A 3S8MA 1KNQA 4EVSA 4C2TA 1T13A 1WTCA 2WIGA 5IFLA 3PDWA 2X3FA 4G4JA 3IO3A 5ECYA 5CMLA 2BEWB 2ZR9A 4YRZA 4J90A 3DO5A 1P1RA 5AIAA 2FW0A 3SSNA 1JG6A 4I55F 4BHTA 1KI3A 2OMKA 3JVUA 1LSSA 1H2BA 4K6KA 3A37A 5CYOA 3S7ZA 3DBRA 4HI0E 1U8CB 1MAWA 4YQZA 2C83A 4ZVMA 5GMOA 4JP3A 5CA0F 2IYQA 1G20E 2ZWVA 5A4KA 2Y1KA 1USWA 4TV9A 5IC6A 3V4OA 4F56A 3H18A 3N2IA 3VZCA 4C4SA 9MHTA 1IQUA 4CLOA 1L5YA 2IK8A 2ZYIA 3K9BA 4WESA 1SHJA 5EJ5A 3LX5A 3OZDA 1L5WA 1REQB 2ENUA 2PGAA 2PJUA 3DEYX 2VO1A 5DEIA 3C1TA 2LR0A 4TXMA 1TF7A 1FRQA 1FYFA 2I55A 4Q3KA 4TVSA 4BASA 1Q0HA 2GPTA 4EBFA 3VU1A 1B23P 2OV6A 2RIRA 1TD9A 2HFJA 2WIAA 3GJSA 2VL7A 4NWIA 1JEQA 2FZ4A 4OXIA 3LL4A 3Q0TA 4A7PA 3FMOB 1IBMB 1DBQA 4EY8A 1Z2DA 1HO3A 2GN0A 4B6EA 1UZAA 1ZGZA 2OAP1 1XGKA 3HCBA 4G5QA 3IT1A 1AZWA 3F4LA 5I6DA 1UODA 3ZG6A 4G24A 3CLSD 3KZ1E 3RSFA 3DZKA 2WMNB 2GSDA 4WXPA 1RM4A 4RF3A 5C1IA 5BN4A 5JQGB 2R6ZA 4E03A 1PTJC 1VP9A 3E9YA 4QU8A 5KYVA 2FPGA 1DO2A 3ZQ6A 4BFZA 1KDPA 3QYPA 3VYSB 4F4CA 1A77A 2BUAA 1OLXA 1PR6A 2BJVA 4BDSA 2AYYA 2BGKA 1Y9AA 2A5JA 4I8XA 2AOVA 3G8AA 3ZGXA 9ABPA 5T3YA 1BQ4A 3D8HA 2OHGA 2GO7A 3G9XA 4MEJA 3WC4A 1YJQA 3BL5A 3L5KA 3PCTA 2ATVA 3GW8A 5DSTA 4I7EA 2G1UA 1E63A 3ZDXB 2QAGB 4YBZA 1ZKDA 2B69A 3MINB 3ZQUA 3UMYA 1K8QA 1KK0A 1U9ZA 4KIGA 3U3MA 3U0VA 6LDHA 4HUQA 5KNDD 1N1MA 4H60A 4OHRA 2OYCA 1KO7A 1MU0A 2X2EA 1TM1E 1ESZA 3COYA 2CDNA 4KI7A 1E98A 3THOA 5TPWB 3TB4A 3RYCB 1XCPA 1L5VA 3FCSB 4UFNA 2BMJA 5F4ZA 3UQYS 5E1BA 2Q5LA 1P0MA 1U7HA 2DJIA 3RHZA 4RKFA 3KWJA 3WRWA 1PKXA 2YINC 3ZYCA 3B3AA 1YQEA 4M9CA 4JOQA 1ZLYA 2XGGA 1FS4A 3D3JA 2O8BB 2Z8XA 4NFSA 2WTAA 1SA0B 2Q0SA 1JF8A 3BULA 1RLIA 2XUOA 4AKEA 4BCDA 3K32A 3TEFA 3A9RA 4QDJA 2EF1A 3KPJA 2A4MA 4RD1A 5ITSA 3CEMA 2B34A 5IZ4A 3OCWA 1WXWA 3NS7A 3OCCA 4FSXA 1MO5A 1UIMA 2AFRA 4L5JA 1M2GA 5CHYA 1DWQA 1FRZA 4J7XA 4HPJB 3WMXA 1UEJA 2XD4A 2XW6A 3F6BX 3KKZA 4OGGA 1PR2A 3BM5A 4W5QA 4ZU6X 4DLPA 1P1FA 3U3KA 3AF4A 3QF7A 1IULA 2Q4TA 3NKLA 1IOLA 3G5LA 4MLDA 5FLYA 1EDOA 1XKXA 5EXTA 2XXJA 4BKOA 2AOUA 3OHSX 2XRYA 4DIEA 2A5FA 4UU0A 1UAAA 2QZPA 4V0MA 3C5VA 4LYFA 2D2IA 1W36D 5F5NA 5A5EA 6REQA 4LV8B 4S2EA 5FTNA 4UHKA 2DUJA 4DBVO 4EL5A 1CLUA 1UAGA 4B2LA 4PSDA 2H5LA 4R8KA 2AK2A 2ETXA 2QGZA 2ID4A 3IAS1 3OPMA 4FOSA 3CRMA 1S3IA 5LMCA 1GRQA 1E8MA 3ONWA 4A6PA 2WM3A 4LJ8A 4MYSA 1PWEA 3T5DA 3UMRA 1I6WA 1AHNA 2JAUA 4YBRA 3G88A 5ADVA 5TARA 3HV2A 4ML3A 4C6TA 1V4BA 3B53X 3FGPA 3TZCA 1NE7A 4DOMA 3QEMA 3UICA 1YJAA 4LWOA 2OC9A 3HWWA 2NUAB 4KQEA 421PA 3ZWOA 1VJ1A 1DRUA 1P5JA 8MHTA 1VJDA 4D9CA 2Z08A 4WNAA 1YJ8A 4RKWA 3UPDA 2BKXA 3V2GA 4OI2A 1BX1A 3JQFC 4BQQA 5JZBA 1ONNA 3BYZA 4MGZR 2ZXFA 5IAGA 2O50A 5FWXB 3K6RA 1OTYA 4QUJA 3QWHA 5HBRA 4JI0B 5BR4A 1AN0A 2Q6IA 1T8WA 1Q7GA 3UT5A 4OQDA 3DOUA 5LOVF 1GHTA 1Z0DA 1X9HA 1YKSA 2X0DA 2Q3CA 4MNTA 3KCNA 2J48A 1QF6A 2BFAA 5ICMA 2JI4A 4ARBA 3MIZA 3HO8A 4REQB 1O5TA 5JRJA 1X7YB 5LZ7A 4QGHA 3QXCA 2VK2A 3DE2X 1Q1QA 4J7AA 3NDJA 4A8TA 4BB6A 1S89A 1N9GA 2YN2A 3O93A 4YCCA 3ADDA 1JFFA 1OKKD 1DB3A 4W7IA 2ODAA 2ZS8A 5ULLA 3WP1B 1II0A 3UXYA 3WXBA 2HADA 4DABA 2FI1A 4D74A 2PZLA 2V6GA 4ZYZA 1I3CA 3K8YA 2F8TA 1C8VB 5F76A 3QNWA 2EBUA 4KE6A 3OA0A 1KPGA 4YT8A 5FH9A 1EE1A 4HQ0A 1PFYA 2ZTHA 2WD7B 3WBFA 2WB4A 3GT7A 4IIUA 3U4DA 3K53A 1NN5A 3O8LA 1OAAA 4J0HA 5AI4A 3QA9A 1Z37A 2A1IA 2H3HA 4FWBA 3SXJA 1N33B 1UP7A 3FHCB 2YQ4A 4I50B 3L84A 4M8IA 3ZV6A 1U4NA 2C5HA 4K3UA 1FZQA 3AESA 3IIIA 1QZZA 2BI8A 3V1KA 1HLFA 2XEXA 5FPQA 1YQTA 5IAEA 1ZJ6A 3M70A 3T34A 4DDVA 3N2LA 3ZH2A 1Y9EA 2WE7A 5HEKA 2RGAA 1I6MA 2BGIA 1TRHA 1TM3E 3OE7D 3WGVA 4QGBA 1NXOA 2VH5R 4C88A 3S81A 4FIZA 3BD6A 4NI5A 4Z4CA 3IMFA 4NR0A 1K3TA 1E7MA 5KNDA 3M5DA 3NFRA 5CGZA 4LNUB 2Z1MA 1E18A 1UPTA 1EX6A 2XDAA 4XR4A 3RBXA 1FFEA 2X9LA 4K26A 3GP3A 3MTIA 1D3AA 4G1EB 2Q45A 4KL8S 1DBRA 3EK2A 3ITDA 3R23A 1E5DA 1ECCA 4YUYA 2PD3A 2R8YA 3OFND 4RZXA 1Z22A 2EX0A 4ZQIA 5KCMA 3WLHA 3NORA 2DSNA 2IY9A 3L5OA 1YRBA 2BMWA 2QRQA 3KT3A 3RTGA 1OXXK 3ACDA 4B3IA 1NI4A 5CCEA 1OT5A 4YJHA 4P93A 4KNWA 3AHGA 2PZMA 2QN9A 2GCOB 3IH5A 5BOSA 1YE5A 1E9AA 1PFKA 2SNIE 3EXEB 3I45A 3UAWA 5A4FS 2A5YB 3MJDA 1XZQA 3BWCA 4KB5A 5TGTA 1YGYA 4G9GA 2YV2A 3DBLA 4PFSA 2G0AA 5K0TA 2WSLA 3FW1A 4Y6RA 3BGSA 4IKPA 1MEOA 2YX1A 3S2YA 3KL4A 2JCGA 3UXHA 2FPSA 1DAIA 1YT5A 3C97A 1IAVA 3OCJA 2FR8A 4DLXA 1Q16A 2VSXA 1P4AA 3L40A 2VXOA 3Q6IA 3T7JA 4C4AA 2G4VA 3PPXA 5GQSA 4C5AA 3LHDA 2GHIA 4OJKA 1KVTA 1XTPA 3FSJX 3KLOA 2VAVA 2LRHA 3A1FA 3HK2A 2PJRA 1M76A 1PUIA 3RAFC 2H4XA 1D2NA 1FSFA 4RE5A 2F9MA 2WEKA 3JATB 2Q7DA 5EMJA 1MT3A 4DCSA 1GZUA 1TTPB 1XP8A 2HA3A 3NPMA 2ZYDA 4XEHA 3UWPA 5JBNA 1AKQA 1JLLB 2PU7A 2VJCA 2IY7A 1P0IA 3U13A 2XUKA 1U0EA 3SEQA 2HMAA 2C94A 2QXUA 1GNVA 2V9PA 1DV1A 3FUWA 4FMPA 1U4SA 4US0R 4CMCA 2Z4RA 1NR1A 3VGPA 1QTQA 1G4HA 2AYZA 1AK2A 3CNQS 2I80A 2V3WA 3D8SA 3L8HA 4JUIA 4OJTA 4PLZA 5LA6F 3REFA 3ZBUA 1J8QA 2PL9A 3PLRA 2QD5A 5TF0A 2C77A 2QQEA 3TZBA 2FG5A 4MXDA 5REQA 4IUDS 1Y3IA 4F8EA 4IW3B 1FLVA 2GRJA 4ZYXA 4HN9A 1JEJA 1WXXA 1JDTA 5C4GB 2GOYA 2O5CA 1TC1A 2HA2A 3JWPA 3KYIB 1M6HA 1WMBA 2GZ3A 5CTJA 5MFZA 3Q2KA 2LDXA 2ZDQA 1NTOA 2EBHX 2Q21A 4HB4A 2XCSB 1XZEA 4MQFA 1JIJA 3I2FA 4TSKA 3BE5A 2FSVA 4Y8VA 4NX2A 1KOFA 1ZKMA 4DMHA 4HAUA 5CFQA 2XYHA 4PY2A 4YI3A 1F51E 2C2ZA 2J7KA 3D8TA 3LW7A 4S1TA 2Z6VA 5C8XA 1RRCA 1GPAA 1AK9A 1NRXA 2GVNA 3HKDA 1OKKA 1E0SA 4N7JA 1VGRA 2YVUA 2C0CA 5JY1A 1YHZA 4KXXA 1HYEA 1PNTA 4ZV4A 3ACBA 5EKDA 3GFGA 2O7VA 4IMIB 3T7SA 2CF5A 2G77B 3DL0A 1K6XA 3PEUA 1ZH4A 5KNLA 1FJGB 1GUFA 2VA9A 4JK3A 2ZJFA 4IY1A 2PX6A 2RGXA 2WSSD 3TSYA 3INRA 1QG6A 3CLVA 3ANSA 3ESAA 1U1FA 4L9WA 4U02A 4D56A 2QZZA 3E2MA 4E08A 4ZK6A 5LP6B 3L1KA 5DZSA 4U7JA 4K46A 2XVYA 5C37A 2LWIA 3R75A 2YR0A 2PWAA 4ZEMA 3GOHA 1EG7A 2M6LA 1WXQA 4B3FX 4P4GA 4XWAA 1R10A 2EIHA 3ETLA 4AS2A 1AD2A 1T24A 4ZI3A 4AN4A 3I61A 3DWEX 1F06A 1TCCA 3OE7A 1U7OA 4WTOA 5DP1A 4D4IA 3V46A 1F1BA 2KM1A 2WF5A 2HCTA 4MRPA 3IVGA 4RF5A 5J63A 3RS0A 1N8TA 3OHPA 1K08A 4GPBA 3GLRA 2V96A 1E6CA 2Y05A 3A1EA 3OC0A 5HQ3A 4PGGA 3PE3A 4LX8A 5ALOA 3U3JA 4G1CA 1CD5A 4RHCA 2IU0A 4MUXA 3RRNA 4DV4B 1YF3A 3HZRA 4PWYA 5D3KA 4X84A 1IY1A 4YO8A 3OFNA 4D4MA 4L8VA 1QH8A 1J00A 1CY6A 3IOEA 3TLEA 3I3OA 1W93A 4B4VA 2F2TA 1RHQA 1ZC4A 3QBVA 4FFMA 2ZWAA 2RB4A 1YR7A 1IEVA 2QS9A 4OHMA 3UAVA 3ZTWA 3BF8A 4GW3A 2Y68A 4RDCA 3S2EA 4AD8A 3GFBA 4B40A 5TF4A 1KC3A 1RJFA 2O19A 1HURA 2OB2A 1TMGE 1V8FA 4A91A 4D8VA 1M1ZA 1BN7A 1U4OA 2PSFA 2OP1A 1T6XA 1ZD5A 2JVJA 3D3EA 1E2JA 4X6YA 3SP1A 3KKOA 2WPNA 1E4EA 1VYHA 3H5WA 1UINA 1YB7A 2FEXA 4KXFB 1NZJA 2CEKA 4IXWA 4JT9A 3SIPA 3EDQA 4E14A 1L8QA 3K0BA 4WVLA 3QSYA 1H4VB 4F3KA 3UKDA 4QE3A 4M7WA 5I48A 3I01A 1JTEA 4BVHA 4M0DA 4DJDC 3QKIA 3KFXA 3P9CA 4MAMA 1U0FA 2EX4A 1Y7PA 5AKEA 5EWJB 3VC3A 4HMOA 2WHEA 2X1HA 4EFKA 4OFBA 2OYRA 1TKAA 2AQKA 4MCAA 4ZGBA 1XPRA 3X1JA 1LWNA 4P92A 3BIXA 1QU3A 1F2DA 3B3FA 5D5PA 2VYFA 4AZ0A 3FIUA 3ROTA 2I2AA 1JSCA 2FRDA 3HVIA 4M2LA 4NCKA 4PFJA 4RAQA 4BV3A 3PTAA 6CHYA 4L28A 4NENA 5BR8B 1NOKA 4YPVA 4C0HA 5HTOA 3S3TA 4XQ0A 5TT1A 3IO5A 3SEAA 5CCBA 1Z47A 3MGGA 5DTJA 1V37A 1NG9A 1LPOA 3BILA 2WE8A 1QCDA 2PPLA 4MWBA 2XUHA 4CKCA 5KOIA 3KXKA 4GICA 5AHOA 1JI3A 1VE9A 2K7ZA 3GUVA 2WY2D 3TR6A 4GOMD 3EXG1 4FXOA 4WBNB 5JARA 2C82A 5AHRA 4EKEA 3IDOA 3NP9A 5HF9A 3ZN2A 4LSWA 4DV1B 1ZEMA 3QLUA 4IRMA 4B4OA 1HDCA 3H17A 4C22A 4FKZA 1DLJA 5BW8A 2PSJA 1YRQA 2IXTA 4B32A 3RJMA 4ENPA 1FSPA 1YS1X 1R6XA 2ZT7A 1ODTC 2XQJA 1O9BA 3DFKA 4IX1A 4JASB 4LHZA 1A9XA 4UBLA 1PWZA 4LJ5A 1K7YA 4TVBA 5EE0A 2NU8A 4AF8A 1JPVA 5K2OA 1EINA 1P0CA 3IRUA 1UDWA 1RABA 1X80B 3MGCA 2O4CA 4X8MA 2J08A 1UZMA 5IBCA 2NO7A 1U8EA 1PRYA 1KEEB 3GWZA 3KQKA 4QHYA 2PGIA 4QBFA 2DPGA 2R85A 4XYEA 4TTJA 4OJQA 3R7BA 3C5HA 2JIDA 5JSFA 2WSSA 5KOYA 1P4HA 5BVHA 1XZFA 3ZWMA 4PC3A 4ID3A 2QENA 2QLMA 3GQBB 2GDZA 2PKRA 3L0DA 1VPVA 5HP4A 3O3NB 1Q1ZA 3N8HA 3W2FA 2GNAA 2HHCA 4JSYA 4KGVA 5D87A 3I1YA 5DT2A 1PG2A 1XQWA 3CUEF 3NHKA 1JKJB 1NJGA 1C2YA 1PZGA 2FWNA 2YZKA 2NTEA 4QYIB 4ZZ2A 5WRFA 1YS4A 4HF7A 2OFPA 3C39A 3EAFA 3FRJA 4LG1A 1BX3A 3IVXA 3R0QA 3GCWA 1OC2A 3FPGA 2UYGA 1Z26A 3I3SR 4MKZA 3UAGA 3VR3A 4IUCS 5F98A 3JALA 1RYFA 1M2JA 5JIBA 5H4HA 2XXBA 3CC8A 5KDDA 5FYQA 4AG6A 4QX6A 1ISJA 2O8FA 1M83A 4W4TA 1G38A 2VJYA 3PNKA 2MYUA 2JBAA 4BO4A 1I7QB 3D7MA 3EAGA 3LYAA 5AOCA 5FBZA 5A3SA 3ZCRA 1ESMA 1AHIA 5E6UB 4G0MA 2OY0A 4DR1B 2GCPA 4QOGA 3AQIA 1XDSA 3O83A 1RLMA 4W8GA 2I3AA 2NM0A 3HKEA 3OX2A 4WE3A 5D3MA 5PNTA 1Q17A 4AP6A 4BB9A 3R0IA 1MR3F 3NVMB 4RIEA 3QTTA 3RIHA 3RJTA 3ZLUA 1OV6A 3ENWA 3OTGA 3LQ2A 5CLIA 2P6RA 3WL8A 1Z25A 4L8FA 1ZS9A 1TF5A 3CZ4A 4Y2TA 5FX2A 4M8SA 5CW1A 1JKFA 1OV4A 3UFXA 5NULA 2PTGA 1KSGA 5BP7A 4H77A 1W88A 1SELA 2HK7A 2XE7A 4YJ3F 5A9SB 2QD1A 4LDPA 4QFCA 2XY4A 2I2WA 4OUDB 4DTCA 4ND2A 3E1SA 3HR4A 3GLGA 1J90A 2JEZA 2WSYB 5B53A 4CIYA 3WRVA 1IY2A 2JRLA 4JWKA 4B47A 1U8FO 2P4QA 3DCYA 4YUWA 3NAZA 4TKZA 5FBHA 2O0HA 3BFKA 4IJMA 4NJOA 1B3BA 1V5FA 2YASA 2HH9A 1OSNA 5AICA 2PYDA 3TQRA 1M5TA 4BNZA 1FFYA 4RH3A 4RVUA 2CSXA 4BZPA 4MUGA 4QDTA 4GX0A 3TD9A 4EX6A 4DQVA 4CV3A 1CE8A 3BJMA 2MMCA 3I58A 3IPAA 4KXNA 4B2YA 3ND6A 4ZDJA 1FFXB 1USGA 1PTJA 4KRFA 4HDSA 4MKRA 4X00A 3K71B 1KMIY 4RK0A 1ISPA 3U1TA 3P32A 1CY1A 3DDNA 3THYA 3QXGA 2HF8A 2C5GA 1ANKA 2ONKA 2CVZA 3N2YA 3NC0C 4MV5A 4XX0B 5CDSA 7YASA 1F1JA 4N7RA 1PW7A 1PL8A 2V7WA 1FP6A 3NKFA 1SGWA 1QP4A 1XXHE 2X0JA 4ZMRA 1C29B 4FWTA 3F7OA 1SOWA 1YB2A 2QD2A 3LUHA 1T91A 3WYGA 2GK7A 2JKZA 1ZIDA 1BNCA 1U80A 1W73A 1X42A 2ZJ1A 2XQFA 1PF7E 4HXFB 4RLQA 4X6UA 5ALIA 1Z7WA 4NPAA 4ZT3A 4A5SA 4Z7QB 1WSAA 1FNSA 3M3PA 1MHPA 1II8A 4DEYA 3QX3A 2BEVB 4OU4A 1Z0KA 2N42A 3EXIB 5TB5A 4FHCA 4NZMA 1E6LA 4PGFA 2HYIC 1E4OA 3EEIA 2CBXA 5A9TA 2G82A 2BL4A 2PUWA 3IEUA 2DEUA 3MJVA 2FQWA 3RFTA 1VMIA 5DJ5A 1L5ZA 4BMPB 1QYWA 3I0NA 4DMFA 5JROA 1QVZA 3EPKA 1NMZA 5DCUA 1Z5WA 1K7XB 5CA1A 1N0WA 4DIMA 4PYIA 1XEAA 3DL4A 3LCRA 1KF0A 5HS6A 5EKSA 4XUEA 3TINA 3H75A 2CXPA 3NHAA 4F2WA 4DJAA 2HJSA 5B1DA 5EERA 4XVUA 1XL0A 1B1AA 3N58A 2WU0A 4BNYA 3GLHA 3H9QA 3N74A 3QNUA 4ZVTA 4FW8A 4YT5A 5AHXA 1KOLA 1S7CA 4D3ZA 3GGPA 3PR2B 4X1OA 3QKRB 1SC6A 2OZLA 1Z29A 2VDUE 3JYNA 3WISA 1USKA 2EAUA 3SLGA 3K15A 3L0CA 4EHHA 4H1TA 3MMNA 2BBTA 1IBRA 1KYQA 3H1EA 2BFBB 3FA2A 4P33A 4HG2A 4P22A 5EJIA 3K1AA 4CV1A 1JEEA 4D9KA 1EFPA 1Q21A 1URPA 2GLUA 2GASA 3F67A 1SUBA 2J67A 2PJZA 3N59A 2V0CA 2WAOA 1W25A 4JNKA 5DOVA 5JWHA 3ROKA 1X8KA 1EKXA 2ET6A 4HHEA 4MGHA 4R3UC 1M67A 1E2EA 3HFGA 2W22A 1Q22A 3HJBA 4UQLA 3R5FA 3SY8A 3VHLB 1HRDA 1OWMA 1WUKS 5D51S 4BNNA 2ST1A 3GGDA 1OBHA 3D8NA 4RJLA 2RI6A 1JHUA 3MRVA 4LWQA 1ENZA 2ZI3A 1GQRA 4FHEA 1C9EA 3RCBA 5JJLA 3PXCX 1NWHA 5EZYA 3NWBA 3QW2A 1GZDA 3DLPX 1MJFA 4WASA 2H29A 3DDUA 4AY4A 2FQQA 4WCFB 4F11A 3DLTA 3PXEA 3D6FA 1OU0A 2VQDA 2VF8A 2JEOA 1BVRA 3KQTA 3MTGA 3Q7EA 3IKMB 3JQFA 5AKXA 4CLDA 2A67A 3FOAA 3NDIA 4M1EA 5K8CA 3FUVA 2E1PA 1HT3A 3NDBB 1E3LA 2ZYUX 3GK3A 1KEUA 5HKLA 2H2IA 1UBUS 2M1XA 2XMGA 4Y2UA 5LBIA 4J3NA 1PP4A 3A10A 4RV9A 4BUJA 1MG5A 2ZIUB 2CLEB 1F6WA 3KWFA 4MTLA 5B7GA 4WXRA 1QVRA 1QP8A 4G5XA 4ZMSA 1CUHA 3QG1A 4BBJA 1S8NA 5DW3A 5TMBA 1BEZA 5AT1A 3U7JA 1GR0A 2OBNA 1UKVY 1NKTA 3LT1A 4B81A 1I7NA 5DVZA 3OQOA 2RHJA 4NESA 4EUFA 1Q3KA 4WA7A 3H1GA 4GPIB 5C8YA 2R7LA 2VPWA 1UM9A 3EGVA 3L9XA 3NTXA 1JPUA 4UZEA 3WLIA 4LHEA 4RSHA 1EXMA 4OJNA 3VZQA 2C9DA 2Q0XA 4Y6QA 2A94A 3W5CA 4N40A 2IYRA 3R77A 1GSHA 2HY7A 2NU7B 1XD9A 4FYYA 2OGUA 1E5QA 3IBYA 4RABA 5FV7A 2B25A 1IZZA 1SC9A 2FUEA 2X0KA 4CMEC 2JVKA 2Z8YA 1NY5A 3JAKA 4YAGA 2CNBA 1SQ6A 1W5EA 5DWVA 2J6HA 3T3MB 2DFTA 1YDFA 3CUKA 2DBZA 2HBYA 2B8WA 1A82A 4HNHA 4EUEA 2VEOA 1EVKA 1ZITA 1GKIA 2ZSJA 2BFNA 1T2VA 2C07A 1TLFA 2VP5A 3EZNA 4TQAA 3Q8MA 3HDHA 2P8JA 1T29A 4HX2A 2WAYA 3NU1A 4EG5A 4LZJA 4ER5A 2DH5A 3F46A 2P9CA 2G08A 5ALRA 4YY3B 1LA2A 3R5JA 3K5HA 5TC4A 2JASA 4WZBB 2KJQA 4B48A 2BSQA 1VHLA 1IXZA 3PKJA 4DBLE 3FCOA 4L74A 1MFZA 1RYDA 3OX3A 3CA8A 4YAEA 3OPYI 4KDEA 5GONA 5GGXA 1IATA 2OXCA 1K7CA 3QV1A 2FPMA 4ER3A 5CEJA 2X5JO 3EZ2A 3SI7A 5FPTA 2V4UA 1NONA 3RODA 1NXTA 3H6HA 3F3SA 2GZHA 2HDNB 2P5UA 2YZMA 3A06A 5AW8A 3OT5A 1N36B 4H3HB 4P8RA 3KZKA 4C4XA 2VZ8A 3KVYA 3TBKA 4OGKA 2FWBA 2REOA 3HACA 4LWZA 4PXAA 3AOGA 4CV2A 3QPAA 5EP4A 1G21B 2E4WA 2NO0A 3HR8A 1DU4A 3LU1A 4P7FA 3ADPA 2AK3A 2HCFA 3DC7A 3WL6A 2XKAA 5AUQA 2IPMA 1DIAA 5IJ9B 1XXLA 5DTRA 4N39A 3VR6D 2V59A 4AU1A 4B1FA 1YFZA 3LWBA 1CYDA 2CVOA 4LPSA 1QS0A 1TQDA 3NFYA 4H2DA 4FMDF 2RFLA 3JR3A 4XIJA 4XA8A 4NS1A 2OOSA 5PGMA 2VG8A 1BFUA 2B7BA 4LQDA 1CQWA 1SXIA 3WFIA 4GPZA 1W5TA 1MQ9A 2LZ0A 2P4EA 4BKQA 1P1JA 4DMMA 3FSGA 3JD1A 1P74A 4DLZA 2CXTA 4M9SA 1R5OA 5J2TB 1A7KA 3JD3A 1YDHA 3EBPA 4R9RA 3VPAA 4E88A 4QIHA 3MM4A 2ZJ7A 1RKXA 2WYVA 4I6EA 4P4UA 1QIFA 4P7GA 1J2EA 4PXSA 2H4ZA 3RFCA 1SQSA 4QG7A 2C0PA 3TQFA 5L53A 2A8YA 2B7LA 4OI0A 1Q57A 5A5VA 4M38A 2DETA 4IO0A 4QWWA 4MSUA 3AHEA 4JJ4A 3HBJA 1N6KA 3L1UA 4Z4IA 1Y98A 4DPLA 4AMYA 2QYOA 3ABQB 2V5VA 1NN0A 4PSCA 3BDIA 1EXDA 1EVZA 4UFPA 4Y9SA 2DPMA 1XA4A 2IU6A 3QBTA 3UWDA 3I1JA 4RWEA 4MIKA 1GRCA 2NSDA 1GEEA 5B55A 3MJCA 3GCDA 1XLVA 2H63A 5FWNA 5KTNA 5M34A 1GNPA 3SYRA 3PRJA 4R16A 1S9DA 4LZWA 3KR9A 3P0FA 2V03A 5LUBA 3V7WA 2VP4A 1ZXBA 2J9RA 4P82A 1YU6A 4FGWA 1P8AA 4XQGA 5AH0A 1R00A 3REQB 1U5BB 2IUFA 3PCXA 5LP6C 1JYEA 1Q0ZA 1TCAA 4CKEA 4N3GA 2UVDA 2BFEB 3U80A 3LLCA 2XMSA 5JG7A 3WJ7A 4D8WA 2FUKA 3N8DA 3INNA 5DMHA 1PKEA 1PR9A 4BPBA 3MJ4A 3PXBA 4L51A 1SUEA 1RBQA 1RRKA 4DLSA 5GOTA 3WGGA 4JL8A 1ZGGA 3JAWA 1SXGA 2RGYA 1UBKS 1TB4A 3BL6A 3GPCA 4XW2A 3BIJA 2V7TA 4BMNA 4E1AA 5LDDC 2R8PA 2ZVDA 3IHLA 4GOKA 4XCVA 5CDYA 3OLYA 1FDUA 3G2JA 4FIDA 4IGFA 4O5AA 5LU8A 2BCJQ 4D25A 5FTLA 3QU5A 3VNAA 4GWLA 2BRUC 5EMKA 3G17A 2JFOA 1VFPA 3LBNA 2FLWA 4A0FA 4K0KB 1QVAA 4ZJZA 1XMPA 4WX2B 1K97A 3LP8A 3OQMA 3OD1A 4QQ8A 2C59A 2D3TA 3BMCB 1J2TA 2H54A 3GLQA 1HEUA 2QLLA 1EGMB 3NP7A 1RYHA 3EXFA 4ZPJA 4RADA 4FSHA 2G5TA 4W8OA 2BTQA 4DMCA 4WJLA 1B8UA 1KU6A 3OEED 1Q20A 1WL8A 4QT0A 3USCS 4ALJA 1UJ5A 1XRNA 4FJ2A 4L6IA 4P5DA 4C7JA 1D8TA 4DPMA 5CB4B 3SIXA 1DX9A 1MOQA 1T8RA 1V4VA 2CDRA 1YZKA 2OHXA 2Q5QA 2QIOA 2R6HA 4HAIA 4J94A 1H85A 4UASA 3T0FA 3ZLVA 4F6RA 5AIBA 1LQUA 3BWMA 1P5FA 1QF9A 4JN6B 4A3SA 5JFOA 1BCSA 2FZWA 3QOYA 3ZWPA 1P1CA 1VMEA 3G9ZA 4Z53A 1EVEA 2QRVA 2VF5X 4IQFA 4ITVA 5C7YA 4JLPA 4MX8A 2G9RA 3HDQA 3PITA 5D00A 3WA6A 3NTOA 3WB1A 2OILA 3LD9A 5DX8A 5BWMA 2JFGA 2XAUA 1WULS 2ODTX 1PR0A 1D1TA 2QVLA 1RRFA 3PF9A 4HB2A 5FR2A 1EK5A 2SKCA 1HZZC 4NBUA 4BO5A 1SUPA 4MV0A 4HNGA 1UFOA 2OG1A 2V5AA 3ZJ5A 1MH9A 2I9PA 1XFAA 3ZS8A 1L4MA 4NZ9A 3VR6A 1NT2A 2NUPB 5ENDA 2NN3C 1Z0IA 1U31A 1UKBA 3UN1A 1JDPA 1VIYA 4YV0A 1T26A 2GK3A 3GGCA 1RFLA 3JU3A 4LF4B 1Y6ZA 4QNRA 4UHCA 1H4QA 1XB2A 5FB3A 3T94A 1W87A 4LJ9A 2J0VA 1OY1A 4QUBA 3C1AA 2Q4EA 1FUYB 4S1OA 2JKYA 3JSXA 3O8DA 1MH1A 2WW8A 3PSHA 5D6OA 1GDHA 3A32A 4U2GA 3MWKA 4F3CA 1SCAA 1UMDA 4EB0A 3G9QA 4URHA 2IITA 3DKKA 2FE1A 4ZO9A 4BYMA 4YEDA 1OWPA 3JASB 4ODIA 2OK7A 2WT4A 4XSVA 5DYYA 4L76A 1R0SA 3KE9A 3P1JA 4OGFA 3C6KA 5CJPA 1CNFA 5F4BA 3UATA 3VTAA 2BPOA 3BWBA 2IBMA 1PWYE 2EC5A 3DL2A 3FLMA 4L3OA 4PFKA 1Y3DE 4DG5A 4YCLA 3RFVA 2LPMA 2ZREA 5EIFA 4TS4A 3PJGA 1HTTA 2P7IA 1DT5A 3ON5A 4BNUA 3RT7A 1WCIB 2ZRQA 3I0ZA 4HBGA 1U11A 1ZICA 2F3UA 2F48A 3C0KA 4N3AA 3V34A 3DDHA 4YPOA 4F92B 2WYUA 1C9NA 1Y1TA 1NQWA 3KC2A 3LYHA 3I0MA 3R1IA 1UT5A 4LGMA 4MA5A 4YH1A 3A1SA 3GEDA 1TZCA 2EKDA 2GYWA 2P8SA 4Q4HA 2I65A 4BKUA 3OZTA 4WHMA 3C7KA 1A27A 2F55A 2D1YA 3ASUA 5IMSA 2FA9A 3AY6A 4BNFA 3Q8LA 1TTTA 4NMWA 2B4QA 2JFYA 2R25B 1FMLA 3O5AA 4JV5B 4YRFA 3DZJA 3FNFA 2WTEA 1PQYA 1IAQA 3E9QA 1KMHB 3RSQA 1WMEA 2QV0A 5C52B 1QDLB 4DL9A 2UV8A 3VU9A 1NUAA 4L2IA 4Z4FA 3QI7A 3KKMA 5K0FA 4NYIR 4UEOA 2X76A 4AW9A 1H1TA 1HYBA 3HP4A 1B6TA 3QE2A 4ALKA 5JBQA 2WTUA 4IVQA 3MQFA 2OZKA 1GKYA 1H42A 4U2EA 4ZD6A 3ZVKA 1EVLA 1MA0A 4G36A 5ALJA 4A27A 4PG8A 3LX6A 5KQPA 3FBTA 1MG0A 4PVDA 3A6KA 3GFTA 1GRRA 1RYBA 2XMCA 2GPWA 3JWEA 4TTVA 5C5EA 2ZM6B 2Y0CA 2D1FA 4G01B 1F6BA 5K8JB 3SZLA 3C45A 3QXHA 4MRMB 3L8YA 2ALJA 2FG6C 3HN2A 3WNVA 4NQRA 1SRQA 1Z2OX 3W77A 5IAOA 1A95A 2G06A 2NVBA 3MCUA 3K0EA 4LX0A 3OEEA 5C8VA 3B8EA 3LUPA 3OPNA 5EZQA 4DQDA 1A5BB 5CLFA 1E2KA 2Z8YM 3K0FA 5I7EA 1YA4A 4P31A 4MINA 1E96A 5FNVB 4LFAB 4FBGA 2X2FA 3WL3A 4CM9D 2QTBA 4FOPA 1GTMA 2FN9A 3NT2A 4RHTA 4CUZA 3GQVA 1TM2A 2WJVA 2FSGA 2WJ4A 3GC6A 2H9IA 3JTMA 1JE0A 2CW5A 4IDHA 2CFOA 1REQA 2E82A 2FQ1A 3NM5A 4C7MA 1R0KA 2EKQA 1LPAB 3NHMA 4RULA 2C7GA 5SV2A 1FNNA 3A6GA 1IUKA 3P19A 1VLZA 5AJUA 2AW3A 2G9NA 2IUEA 3A0RB 3F7MA 4LJ7A 1Y3CE 5FHRA 3VHQA 4GDFA 3RC3A 2R86A 1J25A 2X14A 2H51A 2HN9A 2OBFA 5AXBA 1B16A 4EPWA 5K2MA 4C7XA 3T3OA 3AL0C 2WM8A 3QJYA 1CY7A 1Z6AA 3QITA 4TPKA 4BFUA 1VKZA 4FI3F 4GZLA 2XXAB 3AILA 3KYJB 4O4JF 1OFUX 4DLYA 3O1IC 1RYEA 1JDBB 5DGDA 4MVWA 1B0ZA 4RIIA 2O1EA 1JAIA 2PRJA 3RGGA 1H0SA 5JQGA 5LLTA 4XM2A 5DHAA 3ZNOA 3V7NA 3CXUA 5ESXA 1F14A 3RI3A 3P96A 2IF0A 3Q9SA 4BECA 1OOEA 3GEBA 3QVJA 1LH0A 3KQSA 4JI5B 4EF6A 4R71A 3C74A 4Z49A 1HM5A 1W47A 4J0GA 2JIOA 3A3PA 4CM4A 4F3YA 4K03A 4R2LA 2PIAA 3FBWA 5AI0A 1SRRA 4G67A 1VJTA 2QN6A 2FU5C 3VHXA 3WGYA 5AUNB 2XDWA 4HN4B 5BNWA 2QAGA 5JWRA 1KI6B 2XUGA 1KJNA 3MINA 1FYEA 3QW4B 3UNXA 4M8NE 1T8SA 3OLWA 1L1EA 3CRW1 1RWOA 1NVVR 2OCPA 1DUVG 3IQWA 1DC5A 2J4FA 1OHHD 3M4ZA 2LCQA 4EMSA 2FCAA 3DDCA 4EYOA 4KZPA 2HA0A 2HIHA 3HU3A 5TPWA 3VQTA 3L7YA 4LQCA 4DLVA 5IVHA 1GPDG 5FUMA 4H7HA 1XJ0A 1CZUA 3OOHA 1TA4A 1RXEA 3VVBA 3ZHTA 3WK4A 2O8BA 3WTCA 1SA0A 3OIUA 2UVPB 4I81A 3COWA 4DGSA 4TV9F 4Z54A 3TH5A 3U9SA 2W4IA 4IUYA 1DBPA 4OBBA 4LHYA 4FYIA 3LT2A 1NDHA 1SCUB 3C3MA 1S5PA 1Z4IA 4MKXA 4REMA 1TYAE 4J1QA 5D5QA 5FTWA 2V8OA 3SYLA 4CLHA 8ABPA 5EIXA 1Q11A 2HEIA 1H3EA 1ZOLA 4D57A 1W0CA 4O2AF 2V9CA 4Q1AA 3Q11A 3ZWAA 3C8MA 4OMUA 1PT9A 4YQFA 1JEYB 3LLSA 3RBVA 1TW3A 4XUGB 2FZEA 4ARSA 4KXVA 5K6AA 1NA5A 5JNLA 1Z7YA 4MJ7A 5B3LA 1FTSA 2O3SA 1XRSB 4P84A 4P54A