3TQHA

Structure of the quinone oxidoreductase from coxiella burnetii
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
317
structure length
317
Chain Sequence
KEMKAIQFDQFGPPKVLKLVDTPTPEYRKNQMLIKVHAASLNPIDYKTRNGSGFVAKKLKNNLPSGLGYDFSGEVIELGSDVNNVNIGDKVMGIAGFPDHPCCYAEYVCASPDTIIQKLEKLSFLQAASLPTAGLTALQALNQAEVKQGDVVLIHAGAGGVGHLAIQLAKQKGTTVITTASKRNHAFLKALGAEQCINYHEEDFLLAISTPVDAVIDLVGGDVGIQSIDCLKETGCIVSVPTITAGRVIEVAKQKHRRAFGLLKQFNIEELHYLGKLVSEDKLRIEISRIFQLSEAVTAHELLETGHVRGKLVFKVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Quinone oxidoreductase
publication title Structural genomics for drug design against the pathogen Coxiella burnetii.
pubmed doi rcsb
source organism Coxiella burnetii
molecule tags Oxidoreductase
total genus 96
structure length 317
sequence length 317
ec nomenclature ec 1.6.5.5: NADPH:quinone reductase.
pdb deposition date 2011-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
A PF13602 ADH_zinc_N_2 Zinc-binding dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3tqhA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3tqhA01
1P1KA 1HDCA 5IZCA 4E30A 4MO2A 3KEOA 1XKQA 4R5HA 5ICMA 4L9RA 3S2EA 3ZNPA 4RZHA 4MKRA 3LT0A 4CM6A 3DHNA 4E3ZA 1W4ZA 2X0NA 1HYHA 1ISMA 2R00A 3C3XA 3VH2A 5C3MA 3VZSA 4WASA 2O48X 5A05A 3VTZA 4D0RA 4CUZA 4KDEA 3E9MA 1K3TA 1P74A 5BSGA 4ND3A 3ST7A 3WJ7A 4CM5A 2B35A 2VN8A 1YB4A 3QP9A 4TZTA 1E7QA 4NBTA 1ZEMA 5G0WA 1NPTO 2DVMA 4XYLA 4CLDA 1U1IA 1X7HA 2XOXA 4RPJA 4WLFA 3RWBA 1U5CA 5BNTA 4ONEA 3F5QA 1U3UA 3E5RA 3ZW8A 1C0KA 4NR0A 2HCTA 4XQEA 4BNXA 4H15A 5G0TA 4TRMA 3KLMX 4GGOA 1LTHR 2Y68A 3EY4A 2Q2QA 3NV9A 4Q3DA 4FJ0A 3T4EA 5BSEA 3L07A 3JQEA 4J4TA 1PS0A 1AHHA 1QXSA 4A03A 3ZV3A 2O2SA 3GG9A 5G0VA 4DC1A 2C0CA 3OHSX 1ZIDA 4CMIA 2PLAA 5EMHA 1EZ4A 4YYZA 3RFXA 3W8EA 4MVJG 1AUPA 3NT4A 2Y1CA 1JU9A 2NVWA 5K6AC 4L8VA 2NTNA 4YBZA 2ZYAA 1VKOA 4AJKA 4ALLA 3ABIA 4WKGA 3RCBA 1LLDA 1B3RA 1PSDA 3U4DA 5FYDA 2B36A 4B79A 4D42A 1TI7A 1YBVA 1YL5A 3GY0A 4HBGA 1GAEO 1NVGA 5CEJA 3PXXA 2ZB7A 1WW8A 5BQFA 2H1SA 3OH8A 1QMGA 2DKNA 1OMOA 2A9FA 3KLPX 3V2UA 3FSRA 5B37A 2RCYA 3H5AA 4XB1A 2D2IA 3JD1A 1E5QA 1NPDA 1I32A 3RC1A 4UEOA 1RM4A 2YV2A 4B7CA 1X1TA 2D5CA 3NJ8A 3QHAA 3TJRA 3WBFA 4DREA 4Z9FA 3HG7A 2WJPA 5I7SA 3NRCA 4WNCA 2YQ4A 2ZK7A 5DF1A 3HADA 3CMMA 1PQUA 1WP4A 2ZATA 4YQYA 3SEFA 4JJGA 2SCUA 3LSYA 4QFCA 4B4VA 4D0SA 1GUFA 1U2DA 1GEEA 1GR0A 4F6LA 4OOEA 5B4TA 1CETA 1R16A 2CD9A 5T8KC 1WXDA 4JCOA 3SJUA 2NLOA 3IIEA 1B0AA 5B4UA 3FI9A 5I9NA 1LBEA 1VLLA 3N58A 3ZWBA 4RF2A 2Y1EA 2EJWA 2Q46A 4AICA 4JN6B 4OL9A 4GVLA 1DBVO 3DHYA 1R4MA 2GD1O 4DLLA 1LQUA 1GQYA 3PDJA 1T2FA 1DC4A 4PLTA 3HQ4O 2PH5A 1NQAO 2I76A 2XXJA 3GVCA 4HY3A 4RORA 1PZEA 2OXIA 1MFZA 4CM1A 3WG9A 4RDIA 1B14A 3OJ0A 3OQ1A 2JFHA 2UVDA 2BFMA 1W0CA 2PGJA 4BMSA 3AY7A 4RVDA 2AEFA 3KO8A 3SXPA 1B8VA 1A9YA 5JMPA 3GAZA 3WGZA 4R51A 4JP2A 4TKLA 3FCOA 1WWKA 2BHLA 3TZQA 5L4SA 3U4CA 4LN1A 4OAQA 4PG6A 7MDHA 4DUPA 2I3AA 1LDGA 4J4HA 3M2TA 4RPLA 2ZCUA 1I3NA 1P1RA 3NGXA 3IAHA 4GBJA 3DZHA 2HQ1A 4U6SA 4RLSA 1G6KA 1P33A 4GMGA 2C82A 2P4QA 3DFUA 4CMAA 2AQHA 3SBOA 2FMUA 2UYYA 1HSZA 2HMSA 3QWIA 4GH5A 1PU2A 1QLJA 4L76A 1PL8A 4NBWA 4R68A 1DPGA 1SZJG 3VDQA 4CODB 3LLSA 1HEUA 2PD3A 2YFHA 3ZGYA 4ZQBA 3VOSA 1X0VA 1PWXA 5TF4A 1OFGA 4YCAA 1Q1NA 3H9UA 3DTTA 3IJRA 3ENKA 4I9UA 4LVCA 1IY8A 1AE1A 4RLHA 1M66A 1EUZA 1P0CA 2X5KO 4CM3A 3O9ZA 2X0IA 1ULUA 1YH3A 2BMAA 5I7FA 1CQIA 3D4NA 4IMRA 1K89A 1DLIA 3WXBA 4NG5A 2C20A 3ZWVA 1R37A 1IB6A 1GCOA 4ZA2A 2W2KB 3I83A 1EUDA 4NMHA 2UDPA 4ALIA 3D0OA 2IEBA 3EUWA 4BNYA 1J5PA 2CVOA 1AXEA 4M87A 2QZZA 5IZCC 3Q9NA 5ITWA 3CPSA 3T7EA 3W8FA 3RJ9A 3DZBA 1KBZA 2O23A 2OOSA 3C7DB 3M1AA 2GPTA 1DIBA 3DBRA 3WIEA 1YQGA 2IZZA 2R00C 5JXWA 1GYPA 1GV0A 4D3FA 4J1QA 4DPKA 3OQ6A 4HP8A 3AI2A 2G5CA 2HUNA 3R6DA 3RBZA 3E18A 4YRBA 4CV2A 2OMEA 3DEYX 2NUAA 3OM9A 3GVXA 5F1PA 1KVSA 3C1AA 2H6EA 1Q7BA 2J3HA 3FNHA 3ONFA 4H16A 3TL2A 3V1UA 3I1JA 5B4VA 4YJGA 3L6EA 3FR8A 2FWMX 3F1LA 3BYZA 3M1LA 4YJHB 1ZK2A 2ZTMA 4YJFA 1B2LA 4E4YA 1WMAA 2O7SA 2YV3A 3ANMA 1TT5B 3WFJA 3RASA 5BSHA 4J3FA 1OBFO 4GX2A 1Z82A 2FRDA 5GY7A 3PHHA 5A9TA 1NAHA 2GUGA 5I8ZA 5BSFA 3PJDA 4A5OA 3KYCB 1H9BA 4FSHA 4PG4A 4E5YA 3B70A 3WYCA 1I30A 4MIYA 1DHRA 1N9GB 1IZ9A 2Y0CA 5TS3A 4BNWA 3VPXA 4PGFA 4IZHA 3ZU3A 1PJBA 3ON5A 3TQHA 3V2HA 1I2ZA 3HFSA 1KYQA 1XIVA 1PR9A 3QVSA 2YDXA 1YKFA 4ZQFA 3PTZA 2C54A 2G17A 1SOVA 1NVMB 4PZEA 1UZNA 2HK9A 5KNLA 2Q2VA 2PR2A 2HKIA 1LEHA 1EQUA 2Q1SA 1BWSA 3DFZA 3IUSA 1ID1A 4O63O 3UGKA 4AJJA 3V1YA 2NVBA 2VRBA 5EQFA 2EV9A 2LDBA 3GUYA 3PHGA 2EF1A 3IOYA 4PVDA 3CEAA 4XRGA 3GNSA 3JQ8A 4D45A 5I7EA 2PGDA 1E3SA 3Q11A 4G65A 1GY8A 4L0QA 1UH5A 2J6IA 4J6FA 4MKZA 4DLBA 5TRTA 3JV7A 4U0KA 1OOEA 2O3JA 1GEGA 1ZCJA 3D4OA 3GRKA 2AG5A 4FGSA 1NQ5A 3H8VA 4W6ZA 4MOWA 3VH3A 1TVEA 3OA0A 2OZPA 3H2ZA 4PG5A 1XR3A 4YR9A 4S1VA 3RQSA 3A1NA 2YUTA 2VRCD 1GQQA 3WGYA 4XQGA 3OIFA 1GUZA 3RROA 3GGOA 4BNTA 1V3UA 1DIAA 2ZQYA 4CM7A 4O59O 4J16A 4IDDA 3WNQA 3DR3A 3H9EO 3TDKA 1ZK4A 1GDHA 2YHIA 3JQCA 4CM8B 3IKTA 1PQPA 1LSUA 2DBZA 2VWGA 5G0UA 4J4BA 4Q3NA 1CIVA 1UXHA 3PQEA 3PLNA 5CG2A 4Z3KA 2IZ1A 4XGKA 4BNKA 1D7OA 1F17A 3MTJA 3JQ9A 2QIOA 4EBFA 3B6ZA 1WPQA 4BO1A 4CQMD 1P44A 5JPIA 5COQA 1V0JA 4N54A 3JQAD 3E1KA 3JYQA 2DFVA 1PJSA 4CLHA 3STHA 4UEJA 4CUJA 3JQ7B 4N5LA 1A4UA 2GZ3A 1F8FA 1R4NB 3H7AA 4JP3A 3DTYA 3ICPA 3PHLA 1MB4A 2C5AA 1GPJA 4BGEA 4KMSA 1FJHA 4KTTE 5A9SB 3ZWMA 3NDIA 2YZ7A 4ZGWA 4PRKA 5ENVA 5IDYA 4M1QA 1V3TA 4O6VA 1Z74A 3GDOA 3KSZO 3L9WA 4J1NA 4BO4A 3WYBA 3KRTA 2NWQA 4WOJA 1QYWA 3JD2A 3FTPA 4Z6KA 1Y9EA 4PLZA 1T2CA 3H2SA 1Q0HA 5JFOA 1W8DA 1YOVA 4JJFA 4GWGA 1GCUA 2IRWA 5LDGA 2R2GA 4FOSA 4I8XA 4ZRMA 7ADHA 5JO0A 5JAZA 3IDSA 1L1FA 3EK2A 4Y9DA 2WEKA 4BUCA 2Y1FA 3ZCXA 1MFPA 2FR8A 2QZ9A 1P1HA 1S7CA 3JQAB 1JKFA 2EW2A 2X0JA 3ETGA 1IULA 3DOOA 4K1LA 4ROSA 3D3WA 4WNIA 4J49A 1NQOA 4H7PA 4BKOA 3JYOA 1N7HA 4D7AA 4BNVA 1Z45A 1T4DA 4LW8A 1NVTA 4MVJI 1SB9A 3DBLB 1QSGA 1ZSVA 3IJPA 1ONPA 1RM0A 4JJIA 1LLQA 1E7YA 1VSVA 1X14A 1Y1PA 3G49A 3U0BA 4I5GA 1UAGA 1U7TA 3PYXA 2J5QA 3U5TA 1FF9A 3ASUA 2Q45A 4MVJM 3DWFA 1KIFA 3F4BA 3QWFA 1ZFNA 4BKPA 1PGOA 2JFGA 3V1TC 1A7AA 4XYMA 1X13A 1MV8A 3TL3A 1HYGA 3BA1A 3PVZA 1E7WA 3FNGA 3JQGB 2IDZA 3KBOA 3W4JA 3GC6A 3FNFA 3WGTA 1C0LA 3IP3A 2HJRA 5CDUA 2G82A 5DT9A 3WGGA 1A71A 2CZCA 1GQ2A 4IDBA 2C2YA 4NJMA 1NYTA 3EVTA 4P4GA 4YJDA 2I65A 1EK5A 4EGFA 1A5ZA 1EVJA 2A35A 4FFMA 3KHUA 3RUEA 1Y7TA 5AXDA 1JW9B 4EZBA 3KOUA 4QQRA 4XDZA 2EGGA 3RUFA 2VRCA 4C4OA 4QUKA 1ZKMA 2OUIA 4KOAA 2NQTA 4LCJA 3UW3A 1ISGA 1ZK3A 2Q3EA 4ZQGA 3BMOA 3ZWXA 5K9ZA 1O5IA 1T2EA 1MG0A 4XYBA 3VPHA 3D3EA 2RHRA 1O9BA 4AJOA 1V9LA 5HRUA 1B8PA 2RIRA 2VUUA 3GPDG 4QX6A 3RD5A 3C7CB 1JVBA 4WLNA 2HMWA 4YRDA 4KWHA 2F1KA 2AQ8A 4K26A 4CQMA 4GSLA 5L7TA 2CMDA 3GZ4A 1VKNA 4A7PA 1U4SA 3FPLA 3WGOA 2FHSA 3ITKA 3DAPA 4Y6SA 2Q4BA 3X2FA 3OEYA 1MP0A 4B7UA 1YJ8A 4II2A 2ZTLA 5EL0A 3VKVA 3ZV6A 1OAAA 1A72A 5HBRA 2WMDA 4R1NA 5JO9A 4EUHA 1B16A 4AJ1A 4UVHA 2QHXA 1RYEA 1T2AA 1CEQA 2BLLA 3KZVA 1E3WA 1G0OA 3AUUA 3K2BA 4CV3A 4E12A 1BHSA 1UP7A 3EZLA 3PZBA 3ROKA 2J5RA 4U5QA 3FD8A 4RQUA 4YVFA 4G5HA 3DONA 5C7IO 4U7WA 3MJVA 1NFRA 3TN7A 4XDYA 1P77A 1BG6A 1U7HA 1UR5A 4UUPA 3N74A 2V7PA 4DC0A 2Q1TA 3PHIA 3VVBA 3OJLA 3B20A 1SNYA 4P8RA 2ZB8A 1BXGA 2G1UA 4CQLA 5CG1A 1T4BA 4XYEA 5C7LO 5ADHA 3PRJA 4CV1A 1CF2O 5AXBA 3JQFA 4CMIB 2QQ5A 3DOCA 1JAXA 2PZJA 1VI2A 3RUDA 5TJ9A 3P2OA 2HO5A 3OIGA 3K6JA 1NXQA 1HE4A 3U49A 4NK4A 1E0DA 1PJ3A 3LLVA 3KETA 1PJ4A 4B4UA 1EDZA 5T5QA 2FN7A 1R0KA 3JQDA 5KCZA 2PY6A 3OIDA 1HRDA 4R1SA 4RPKA 5JYEA 4YDRA 2O3RA 2VNAA 1ONNA 3CZRA 4JXKA 2B4TO 3WWZA 8LDHA 1TB4A 1YL6A 2V6GA 5G4LA 1WLYA 5CAEA 1K6XA 1D4FA 4FR5A 4URFA 4N18A 3I9NA 1ENOA 4PLVA 1CJCA 2Y1OA 3C1OA 2Y99A 1DRUA 4I9HA 1GL3A 4RF3A 5A03A 2A92A 3WYEA 1GD1O 4INAA 3S2GA 3UH1A 4U6QA 3WSVA 1HLDA 3OF2A 2NU6A 2NU9A 4B3JA 5EESA 3NKLA 3RSHA 4L4XA 5THKA 4RVSA 1PR3A 3AOEA 5G2OA 1LRJA 2O2YA 3AJRA 2DPHA 1BXKA 3EMKA 2J3JA 5ICSA 5KWEA 5B1YA 3U62A 2B4QA 4H3VA 3I52A 1P3DA 3PP8A 2H9IA 5KOIA 1IPEA 2O3TA 4OGWA 1VL6A 3GDGA 4Q9NA 4W99A 1VSUA 3HJAA 1Q0LA 5GMOA 1E6WA 4NFSA 1I3KA 3H9JA 4LVUA 3DMYA 2X6TA 3CTMA 1I2BA 4LMRA 1K2WA 4HNGA 3JQ9C 1KC1A 1D1TA 3PJFA 1BDBA 4DPLA 2W2LD 1FDTA 2CY0A 1K6JA 1XYGA 3Q0EA 1P45A 4FIZA 3HHPA 1PEDA 2DM6A 3A14A 3WB9A 5BR7A 2HMTA 1XHLA 1LDMA 5DCYA 4N5MA 3G17A 1KOLA 2D8AA 1ZO8A 4J1TA 4Y67A 5A5EA 4AJEA 3RKUA 4EJ0A 3AUAA 5EERA 2QRKA 2VQ3A 3LF1A 4AJIA 2BFPA 1ZH8A 5ER9A 4O5OA 4BNZA 4WCFA 3I9JA 4JBHA 1R4MB 4I5EA 2GF2A 1R66A 1ENPA 3NTQA 4DBVO 4J2HA 4IIVA 4ID9A 5I7VA 4IJWA 2GR9A 1J0XO 1H6DA 1H6AA 4YT5A 2ZYGA 5JS6A 1QYVA 3P7MA 3CINA 1K0UA 1MA0A 4CR7A 3EAGA 1E77A 1C14A 4EJ6A 4NHEA 2PA3A 4YT8A 4XWYA 4ZRNA 1VRWA 2D4AA 4E31A 3K8ZA 3CIFA 3HN2A 3LT1A 4OIMA 1XDWA 4M49A 1VE9A 2V6FA 3PYLA 1N8KA 2GN8A 1NR7A 2ZCVA 2EHDA 3TSCA 1ISIA 1HWYA 1BTOA 1F14A 1BGVA 2BELA 1KVQA 4BNMA 1HTBA 3WOHA 4CJXA 1LX6A 3HZZA 4TRJA 5JDCA 3UAGA 4NDNE 4DIBA 4ALNA 4QO7A 4IQGA 1ZSYA 4IDCA 2CDAA 1N1GA 4ZQEA 1PJQA 3BMNA 1LJ8A 2PGLA 3GMDA 1I33A 2JJYA 3NX4A 1ENYA 3E03A 5T6BA 5A9RA 1HKUA 3RIHA 3ROMA 5IN4A 1W6UA 2CVQA 3QWHA 5AXAA 3Q9UA 3QIVA 1H6BA 1QV7A 2RH4A 3P5SA 3KV3O 4LRSB 5TC4A 1FMCA 4HFRA 4PLGA 4IDAA 2PV7A 2Q2WA 3DBVO 4DXHA 5L4LA 3QLJA 3DZJA 3VPFA 2Q1UA 3E9QA 3WGHA 2IXAA 1Z6ZA 1U9JA 1GYQA 4J1SA 5EINA 5T57A 4CL3A 3DBHA 3ZH2A 3I3OA 4P22A 1RM5A 4CLXA 1YB1A 3HE3A 2G76A 2XPCA 2ZKLA 2EKPA 3PI7A 4IXWA 4RV9A 2X0RA 1U28A 1GV1A 1HDXA 4BGUA 2GERA 4WLEA 2CF6A 5KJCA 3ENNA 4CLEA 1DXYA 5TLSA 1HZJA 4QSMA 5IDXA 3UICA 4FC7A 1IHXA 1YJQA 4TROA 1XEAA 3ZHBA 1SO8A 3S2IA 4OH1A 3I6QA 3VC7A 3OSUA 2VCYA 1UDAA 2NSDA 2J5KA 2X5OA 3EHEA 1XLTA 1E3EA 3UKOA 5JCXA 3LC1O 4UREA 3NJ4A 1FK8A 2W2LA 2QYTA 3BHJA 5L4NA 5JE8A 2DFDA 1NR1A 3MJ4A 1CWUA 1ZUD1 1UAYA 2OHXA 3HNPA 4A0SA 3G3EA 4L4SA 3DBRB 3L4BA 2I99A 4FGWA 4YEDA 4UUNA 4EJMA 1LSOA 1ZMTA 3GG2A 1JN0A 3TZHA 3AM4A 3NT2A 5HM8A 2QRJA 5L40A 1GZ6A 4WGGA 1K5HA 5TT0A 5A04A 3KSUA 4CMJA 4OSPA 1EUCA 3BHIA 3AI3A 4AJHA 3ADOA 1U8XX 1V35A 2O50A 5A3VA 5AXCA 2D3TA 5KVSA 1TT7A 2IEDA 1LNQA 1QYDA 4PLWA 4YJGB 5ES3A 2AE2A 3SLGA 4YAIA 1O6ZA 4R41A 5A5FA 4OMUA 1PL6A 3FPCA 4YJFB 1XA0A 4Q3BA 5MDHA 3PLRA 3PDUA 4GL4A 2NACA 2OFPA 3NYWA 1KY5A 3M2PA 3WR5A 3DC2A 4IDGA 1U3WA 3A4VA 1E1MA 3KM0A 1JVSA 3GVIA 4ZQHA 1PIWA 4LK3A 1T24A 4NQZA 4KDFA 3COSA 3JQFC 2AA3A 1T26A 2ET6A 2D0IA 3HDYA 4B7XA 4BNIA 1SB8A 4B4OA 3AU8A 4E2ZA 1DIHA 3D1LA 3GNTA 2NQ8A 4UVIA 1J6UA 2NU8A 1I01A 1DFGA 4R9RA 1B8UA 1XQ6A 1X0XA 1YONA 4NBVA 4CLOA 3ASVA 1X15A 3I4FA 2BRUA 4NU5A 4HWKA 3QVWA 2B4RO 2OP0A 1O8CA 1NBOA 1UUFA 1U3VA 3OFSA 1C1DB 4JBIA 3U3XA 5IZ4A 4XYGA 4TSKA 4BGIA 2RHCA 4IJVA 1LRKA 2VNSA 3JQ8B 4DGSA 1E1NA 4TZKA 4DA9A 2XXBA 3HDQA 3OJFA 4RO0A 4XGNA 4J0EA 1NWHA 4JK3A 5KVQA 2B83A 5G4KA 3WBBA 3FNEA 3RUIA 3S2FA 3AOEC 3INRA 3PWZA 2EKLA 4IDEA 3JYLA 3OMLA 1A7KA 4I5DA 3W6ZA 2VTEA 1ZNQO 5IFLA 1ZVMA 4LRTB 3QSGA 3KVOA 3FR7A 4C7JA 3PPIA 4EI2A 3N7UA 1F06A 1ZJZA 3CSDA 1VJTA 2YYYA 4E2YA 4J2OA 2QW8A 4KTVE 4HV4A 1O89A 5IN5A 1YS4A 4ITUA 3G0OA 3ZWWA 2YHIB 3KUXA 5DP2A 5F5NA 4ZHSA 2IYOA 1I8TA 3HDJA 4MVJF 1UDBA 4XR4A 4KQWA 4BB6A 4QTZA 4WEQA 2O4UX 2EP5A 5DBFA 1VL0A 3E5MA 4A10A 1CERA 5JSFA 3B1KA 5FF9A 4ND5A 1DC6A 2IXBA 2C7VA 4Q3AA 2YJZA 4D46A 1NFFA 4BV9A 2WYUA 4WCFC 1XSEA 3RKRA 4XJSA 4CUKA 2EKQA 3FBTA 4UULA 4LSMA 1HL3A 2Z5LA 3K5PA 1ORRA 2ZJ1A 1LUAA 3WNVA 1X7GA 1IHYA 2JAPA 3AFNA 3PGXA 4DQVA 2PKQO 4PG7A 1C1DA 1P1JA 2C07A 2PD4A 2Q99A 3OQBA 1HSOA 3RC7A 4N5NA 1LDNA 1SBYA 4BNLA 4D44A 1VJ1A 3VTFA 2VWHA 3CZMA 4IINA 4UEKA 3K2EA 3AUTA 4YPOA 1YOVB 1CYDA 4HKTA 3UCFA 5JC8A 5L95A 4ALMA 3PIDA 4BO7A 3C7AA 1MXHA 1KS9A 4D3SA 5IG2A 2Q50A 2C7GA 1T2DA 2GSDA 4BKUA 5JDCC 1HXHA 4TVBA 3JCZA 4R1TA 2GN4A 3WFIA 3I9MA 3IC5A 4Z9XA 3D3WB 4NZ9A 1DFHA 1E92A 2F00A 4XB2A 3WIDA 2JL1A 3ITDA 3SLKA 3GHHA 3DO5A 3GLQA 4TQGA 5JLAA 5U9CA 3WLFA 1AHIA 1WAMA 3ZWNA 4PZDA 4DMLA 3FTNA 1C1XB 4FN4A 3GPIA 3GH3A 3CXRA 1PX0A 3DXFA 3LK7A 3QW2A 4WCDA 4M55A 5C37A 3U09A 3AOGA 3S55A 3I5MA 4K6CA 4BVAA 4Z3DA 5DNAA 2B37A 2B69A 1PJ2A 3INTA 3JYPA 3RUAA 4DIOA 4NJOA 2CF5A 1TA4A 5JYDA 2GLXA 4E2WA 3DMTA 1BVUA 3DZFA 2H63A 3QVTA 5CEFA 4R1UA 1T25A 4FPXA 1SEVA 2V6BA 3K96A 4IY1A 2P5UA 3QY9A 2RBEA 4GLOA 3RC9A 4OQZA 2BGLA 3RFVA 2HRZA 3RU7A 4NJMB 3NTOA 1LC3A 2P68A 1K6IA 3ETDA 2X5JO 4NNJA 1ZXBA 4R4JA 5JW6A 1PGQA 4TKMA 4GVXA 2Z95A 4XCVA 4NK5A 5AOVA 3O38A 3OJEA 5IXSA 1UXGA 3QA9A 2AQKA 2Y1GA 3K73O 4S3MA 5TX7A 1WMBA 4BO9A 1NAIA 3OP4A 4NPCA 4ZU3A 3BMOB 1ENZA 3OEWA 3QWAA 4R69A 1HF3A 3JTMA 3IUPA 2W4QA 4QO8A 4TWRA 4R16A 1PZHA 2POQX 4FD3A 4ND2A 4B3HA 5I9MA 1FDVA 3EVNA 4J0FA 2JCYA 4KUHA 4M54A 4BB5A 3DAFA 2JCXA 1LLCA 3EW7A 4UVEA 1QG6A 5G0SA 3L4BC 4CQMB 1JKIA 2UAGA 2Y66A 2HLPA 1HLPA 3GFGA 3F6YA 4YAGA 2VHWA 3NGLA 5DBIA 1YB5A 1O0SA 2NM0A 4OYRA 8ADHA 4BMVA 2X7HA 3FWZA 5KTKA 1PWZA 1B15A 5TIIA 1BMDA 1N7GA 3VH4A 4PZCA 2FR0A 1MXFA 5HWSA 4DBZA 1TLTA 2BI8A 2YQ5A 1XWFA 2CNBA 2ZB4A 3UCXA 1DEHA 1LDEA 2H5LA 1C1XA 1E3WB 4JNKA 1DIGA 3ZZNA 5GZ3A 2WSBA 3ZWPA 5BT9A 1NNUA 3VH1A 2FSVA 1XCBA 3AK4A 4NFHA 4ZJUA 4JGBA 5U4QA 2X22A 3PFFA 2C59A 5H81A 1QV6A 1BW9B 5CHEA 1DAPA 3UF0A 1GFSA 3R1IA 4WPGA 3MCVA 1M75A 2AEJA 4IZIA 1Q0QA 3OBBA 4MPDA 1H93A 1BXGB 4CQLB 2HMVA 4LISA 5AQ1A 4M89A 3VZPA 5JCJD 4EW6A 5KJ1A 3SVTA 2FR1A 4FQ8A 3RUHA 3GOHA 4PRLA 2HRBA 1WNTA 2J3IA 3GA0A 3JD4A 3NTRA 2OORA 1GTMA 5TSDA 3ZWYA 3Q3CA 4W82A 2CUKA 1ZW1A 3GZNA 1I0ZA 3KXDA 3MWEB 2HAEA 3GVPA 1ADCA 5C7OO 4BO8A 1PS8A 3ZHYA 3GR6A 1EVZA 3L0DA 1H2BA 3ZU5A 1CRWG 1MUUA 2NVUA 3BMQA 2CDCA 3ONEA 4B8WA 2WWRA 2HU2A 1ZBQA 1Y8QA 3BTOA 1DHTA 3D7LA 4MDHA 4U0JA 4RF5A 5LCXA 4MVJE 3L6DA 4A73A 4DPMA 2D5AA 3KB6A 3ZU2A 1BXZA 2ZYDA 3H3FA 2FPPA 2BFAA 4PLYA 2QX7A 2P2SA 3ZW9A 4YT2A 3IL2A 4L4RA 3GGGA 1Q7GA 3RC2A 1HDRA 3RFTA 4CMHA 1U2GA 4DYVA 1PZFA 3BIOA 3L9XA 1BRMA 4WLVA 4BO6A 2GN6A 1H9AA 4FDAA 4Y8VA 1SC6A 5HA5A 3WGQA 4Z9YA 3O8QA 4CL8A 3NT5A 5F21A 3QJ5A 3KYDA 2Q1WA 3GMSA 3LDHA 3H9QA 3U4IA 2TMGA 3I4CA 2JFFA 5U1PA 2PKRA 3GDFA 1BW9A 4BNHA 3PHJA 4MJLA 2BI7A 2Q4EA 1UZLA 4A26A 1LDBA 2Z1NA 2FY8A 2UUPA 3DL2A 9LDTA 1R12A 1EK6A 4GKBA 4GAEA 4IIUA 1E3LA 3KEQA 3PIIA 4GSKA 4MINA 1EBUA 1E7RA 1NPYA 2BGMA 3EZYA 2BF7A 3QWBA 4GKVA 3TNLA 5CDSA 4AJNA 3ONDA 1NHWA 3GFBA 4CR6A 1I5RA 4WECA 2A4KA 1PJTA 4J7CA 2WDZA 4WCFB 2BH9A 4LCEA 3SJ7A 2Y05A 4IGFA 4OHUA 1UXIA 4CLRB 2PZMA 3NAQA 2YY7A 4IDFA 4FJ1A 2Y0EA 3IS3A 4NIMA 1PGJA 4DRYA 3RUCA 1ADFA 2QG4A 3I9LA 4CM4A 2Y1DA 1NTOA 4R54A 3GGPA 2B5WA 1LSSA 1A9ZA 2FZWA 2FOIA 4KUGA 4YXFA 1HE3A 3W1VA 3CH6A 4GX0A 3UCEA 1XELA 3H5RA 1ZK1A 2VHXA 1T1RA 4JBGA 4G2NA 2B0JA 5COAA 2GGSA 4IXTA 1EVYA 1I3LA 5FFFA 1RWBA 1D8AA 3A28A 4HADA 4FFPA 4NH4A 5DBGA 2VHYA 1LLUA 1A27A 4NBUA 3GEGA 1N5DA 1P9LA 5TNXA 5DZSA 3E9NA 5JCJA 5CPBA 1YDWA 5DDIP 4Z0HO 3VPSA 1HYEA 3BMNB 4KUEA 1KVTA 3Q1LA 1Q2XA 3LC7O 4X54A 2VOEA 3E82A 2V65A 3E6AA 3WWYA 5IF3A 2EGHA 4BGVA 4QEDA 2QRLA 3INGA 5GZ6A 4YAJA 3H3JA 4KQXA 1H94A 1SEPA 3FBGA 3ZU4A 2JAHA 4GLLA 5KJEA 4AJLA 5KJ6A 4XQCA 3UHAA 1RPNA 4RJTA 3RI3A 1NQTA 4ALJA 3HDHA 3DMTC 4A2CA 5IJZA 2Y93A 3ETEA 2GZ1A 3DBHB 2W90A 2UUOA 4HFNA 1GYRA 3ULKA 3KTDA 5C5IA 4RL6A 4Z0PA 3F4LA 3A9WA 2RH8A 3V2GA 2YDYA 1SAYA 2W8ZA 3DZGA 4WLOA 4CLRA 5HS4A 4YT4A 4HX5A 1Z75A 5ILGA 5TJHA 3WQQA 5FI3A 2DTXA 4RPGA 2I67A 2WD7A 2VWQA 1PTJA 2TMDA 1Z7EA 2AW5A 2VZ9A 5DCWA 4LSWA 1IZ0A 4K28A 4N7RA 4I1IA 4OM8A 1LXCA 2BFOA 2AHRA 3ICCA 2VUSA 5AYVA 2I9PA 1M76A 1N2SA 4BOYA 4L73A 3PJGA 4CMKA 1ISHA 1G0NA 3PGJA 4MVJH 2X4GA 2CFCA 4J9UE 4ND4A 1Y5RA 3WQSB 3MJTA 4DMMA 2P9CA 3SX2A 3UFXA 4TMFA 1Q7CA 2WYWA 4UAGA 5GZ1A 2X9GA 1AN9A 1DO8A 1VM6A 4XIYA 1R0LA 5K1SA 2AEMA 2WYVA 3ZI0A 4IBOA 1Z7BA 3F47A 1H5QA 4C7KA 4W7IA 2I6TA 3FHLA 4R3NA 5F1KA 5EQDA 2VWPA 3GK3A 1HDOA 2YHUA 4FBGA 3LT4A 1I24A 1O95A 4OXNA 1P1IA 2ZTVA 3K30A 2WD8A 3CKYA 5CEEA 4MVJD 3WMWA 1DRVA 1GZ3A 1XQ1A 3G79A 4QXMA 4YACA 4PN3A 2NU7A 3JYNA 3D5QA 3QQPA 3GHYA 4BIIA 3ZV4A 3TFOA 5ILOA 3LU1A 3BAZA 3GRPA 2ZIZA 3H5NA 3QE3A 5CDGA 1F12A 2DU8A 5A1TA 3RVDA 1DIRA 3ORFA 3RJ5A 5T64A 1NFQA 1SOWA 1YWGO 2E48A 2PH3A 1M2WA 2GN9A 2GASA 3VDRA 5KKCA 2FSSA 3WSWA 3FRJA 2GYYA 3W4IA 1FDWA 1DSSG 4MP6A 2I66A 1LA2A 4EEXA 4XR9A 4ZN6A 3ZNNA 3R3JA 3IQDB 4WE3A 4YA6A 5EIOA 4BNNA 5H83A 4ZD6A 1HZZA 3W6UA 3I9OA 4CMEA 3GUCA 4P4NA 5ENDA 3V5NA 5L7WA 2O4CA 3UOGA 3BTUA 4XGIA 3U4HA 4OJNA 2NNLD 5DOZA 3GT0A 3TRIA 1ADGA 2OP1A 3QRWA 1AGNA 4PVCA 4O1MA 3PQDA 2EW8A 3C85A 5L7YA 1ISJA 3ROQA 3WMXA 4BNGA 3HB4X 1I10A 4FS3A 4CLOB 2D59A 5KVVA 3ZNOA 4BMNA 4IS3A 1UXJA 4FJ2A 4GQAA 4E33A 1WDLA 1ZZEA 3EC7A 1LDYA 3ANNA 6ADHA 3AW9A 5JDIA 2AE1A 3DHEA 1UP4A 3JSAA 1EEHA 5B12A 1EMDA 5HTOA 4DL9A 1L7EA 1TEHA 3H9GA 1PGNA 3F5SA 1DOHA 4FFNA 2LDXA 1KEVA 4EEZA 5BNIA 4QT0A 1YL7A 2WM3A 1X1EA 1S6YA 4II3A 5A02A 3V8BA 5G4KB 3JQBA 5H82A 1KY4A 2CDBA 2ZTUA 2J8ZA 2WTBA 3U9LA 5JAIA 4R5MA 3MJSA 4A27A 2DT5A 1GADO 4F3YA 2OL4A 4AJ4A 2EXXA 1YE3A 2IYPA 4EDFA 2V6MA 3CUKA 5I8WA 4GMFA 2B5VA 2NV6A 1P1FA 2D1YA 2GNAA 3DAGA 1PS9A 2GO1A 3EYWA 4M8SA 1E7MA 2BGKA 3DZKA 5AVOA 1YVEI 2DBQA 4W9NA 4Q39A 3UUWA 1H6CA 3SC6A 4BS9A 3G1TA 3BHMA 3PWSA 3T4XA 2IZ0A 4CR8A 1FXSA 5FEUA 1B26A 9LDBA 4PIVA 4BNFA 2X9NA 2YW9A 4WLUA 2JHGA 4UUOA 3PWKA 4J7XA 4BKRA 3GAFA 2G0TA 2PTGA 4GPD1 3Q2KA 3WX0A 4WOKA 2EG9A 3BTVA 3K31A 2YFQA 4RF4A 4NI5A 3FN4A 1JLLA 1M6WA 3GNQA 4I08A 2I3GA 3KYBA 4RZIA 1ULSA 5L45A 1RJWA 4I5FA 2PWZA 3HN7A 4KZPA 1MC4A 2GRAA 1JWBB 3PFWO 1QKIA 4XQ9A 1PJCA 1SPXA 1H2HA 4MVJA 5TT1A 3R0IA 4QFDA 1IUKA 3JD3A 4J90A 5IDWA 4B4WA 3O03A 5JY6A 1H0KA 1UP6A 1QLHA 1WZEA 4YTEA 4BV8A 4YB8A 1PQWA 1R0SA 5A06A 1KERA 3CMCO 3HUDA 2XAAA 1V6AA 4HNHA 1U8FO 1KVUA 1VJ0A 4PLHA 4R01A 1RM3A 1IPFA 4W4TA 1YDEA 2JKVA 3MJEA 4CMGA 1ZEJA 3UXYA 5JBIA 3Q2IA 2EEZA 3R3SA 2GZ2A 2VZ0A 3B1JA 3W4KA 3L4SO 2BD0A 2ZJ0A 4LMPA 4B8ZA 1YBAA 4GX1A 4UVGA 2DTEA 3WJAA 3WTCA 3AWDA 2NTVA 2P9EA 5ER6A 1ZJYA 3BMCB 4IM7A 3WS7A 3RU9A 1QYCA 1NASA 1F8GA 2AG8A 3AM3A 5TGDA 4E6PA 3D5TA 2HJSA 2ILTA 2YV1A 4DVJA 5JNLA 1GUYA 2JCVA 1DC5A 3PQFA 4DIFA 1LQTA 1EFKA 1E6EA 5JY1A 2RAFA 3GN1A 3OJOA 4XIJA 1ZMOA 2E49A 3LYLA 5DULA 1EBFA 2VHZA 3C1TA 4XJTA 5KJFA 1ARZA 1WDKA 1NM5A 1XU7A 2NTJA 4JLWA 2GDZA 5FI5A 4MIEA 5ITVA 1X7DA 1DJQA 4IGEA 4YQZA 1QR6A 3NDRA 2VT2A 2OBYA 4AL4A 4EITA 1QRRA 4E13A 1TXGA 4FOOA 4IMPA 4TRRA 4AVYA 4E5PA 3BXXA 3DDNA 4IPTA 1WZIA 5FWNA 3MZ0A 3L77A 4TVOA 3AUSA 4FB5A 4DLAA 4MKXA 5KVCA 4XZ3A 1PJLA 1NX6A 4MVJP 3KSDO 1BVRA 4J7UA 5CPFA 3AI1A 5IAAA 1OZAA 2DPGA 3LT2A 4XRRA 5DP1A 1C0IA 2HMUA 1KETA 4FFRA 4KWIA 2O7QA 3BTSA 4Y6PA 5F1OA 5I9LA 4ILKA 4R9SA 1EE2A 3X2EA 1UDCA 2PD6A 3RAJA 4BO5A 1IYZA 1A4IA 3AM5A 2OGUA 3ZWCA 2DBVO 2IODA 2W2KA 2I5PO 4BO2A 4YRAA 1B3BA 1XG5A 3ZV5A 4K9DA 4GX5A 1EVIA 1DRWA 1UJMA 3G1UA 3VVCA 4E32A 1Y81A 1DDOA 5CDTA 2PZLA 1U4OA 4FC6A 1HDZA 3OECA 4PCVA 3TPCA 2VT3A 2BKAA 4DQXA 3TZCA 2VYND 2DLDA 3QV1A 2OO5A 3BMCA 3P19A 2PZKA 4TRNA 3TF5A 4OKNA 1CQJA 1Y6JA 3DOJA 5LDHA 1MGOA 4PLCA 3DQPA 4BQPA 5K0ZA 1O94A 3GEDA 1F0YA 3TZKA 2P91A 2W98A 5THQA 1XGKA 3RBVA 1MC5A 2DUWA 2Y0DA 4J91A 1WVGA 2PKQP 3F46A 4GWKA 2PK3A 1JA9A 2E6UX 2ZB3A 2EIHA 1J49A 2VHVA 3HWRA 3AY6A 3C24A 4OO3A 4U8GA 5DOVA 4EYEA 2GCGA 3VZQA 4YJHA 4JIGA 1Y5MA 1EE9A 1JKJA 2X58A 3BZUA 4J9VA 4OKIA 4CM9D 3O26A 4XEHA 1I2CA 2ZQZA 4AJPA 1TT5A 4BNJA 1HE2A 4CMEC 3A06A 4CV0A 4D79A 4RCVA 3MTGA 1LSJA 3IMFA 5T67A 5JMWA 3ZWAA 5HS6A 4CMCA 4NU6A 5J23A 4DYDA 3QVXA 2CSUA 3KYCA 3E48A 3D64A 1MG5A 5EJ2A 2AQIA 3VPGA 2DTDA 4FW8A 1Y9AA 3PJEA 3W8DA 1N9GA 1FDUA 4F46A 3ZN2A 1YQDA 2QYSA 1ML3A 5CFZA 2IE0A 1ZXLA 4J43A 3ADPA 2E4AA 4RDHA 3AU9A 4Y6RA 4XD2A 3ROPA 3GZNB 3AFMA 4O0LA 4DWVA 1P0FA 1UZMA 4RGBA 4WEOA 4F45A 3MWDB 2CVZA 5BNFA 3VAZA 2O3SA 5JDIC 3NDJA 3MJCA 5K6AA 2J3KA 2EERA 1FDSA 3O4RA 2HK7A 2NVUB 3BMQB 1PL7A 1VL8A 2E37A 3LF2A 3F3SA 4MIOA 4W7HA 1JDJA 3T7CA 1Y8QB 3OA2A 5F5LA 5JC1A 3TZ6A 3I23A 1BDMA 4NFYA 5JAQA 1EFLA 4IQ0A 2X1HA 3ANLA 3GF4A 1RKXA 2VYVD 1M67A 1Z73A 3JQBC 3NUGA 3ZHZA 4BHTA 1JTVA 2P5YA 3D4PA 3WGIA 3F1KA 3CE6A 3HB5X 1VC2A 1KEPA 2VZ8A 4XA8A 3WLEA 2NADA 2O3QA 1GPDG 3UVEA 4BO3A 1OI7A 1DFIA 1AXGA 4BKQA 4GGPA 1E7SA 4IJUA 1LU9A 3VKUA 1ZSNA 3H4VA 1KVRA 4WJZA 3LVFO 4RQTA 1IOLA 1CDOA 2AMFA 2C5EA 1KEUA 4K6FA 4M86A 2WE7A 2DBRA 3O8QB 1YBMA 1VPDA 4RVHA 4W9NC 4WK6A 3KYDB 4OQYA 1GU7A 1ONOA 6LDHA 4AG3A 3LC2O 2C29D 3OETA 4E5NA 1JWAB 4E21A 1E3IA 1MLDA 3DZIA 3WQRA 1ZK0A 5JAMA 3Q6IA 4L74A 4CM8A 1YXMA 4D41A 3MOGA 1QP8A 4KP7A 4FFOA 2DUUA 1R6DA 1YO6A 4CMBA 3IKVA 3WTBA 4CPDA 2Y67A 5DN9A 5L53A 4P38A 5L3ZA 2PNFA 1OC4A 4PLFA 4FFLA 1E1KA 2Z1MA 4XKJA 2VOJA 1Y8RB 3F9IA 4Y98A 5T8KA 2X23A 3IP1A 2DQ4A 1BSVA 3DB2A 4QECA 3UN1A 5CDYA 2FPGA 2O3UA 4Z0TA 1XU9A 1OC2A 3QVOA 4BO0A 2VYNA 3LZ6A 1M6HA 3JQ6A 3JQ7A 1V3VA 4G81A 2XF8A 4DTIA 1N92A 1P31A 2X86A 3FWNA 4PLPA 4BNUA 2Q49A 2DC1A 5F3RA 2E82A 5A3JA 1R4NA 1W73A 1UXKA 2EWMA 3HFGA 1HETA 1JQBA 1QORA 3HSKA 3P2YA 4BQRA 1I3MA 5A9SA 4CM4B 2OBNA 3EGOA 4RVFA 1HDGO 1LC0A 4ZICA 4E0BA 1IE3A 1NHGA 2X8LA 4RVGA 5EPOA 4F6CA 1DAOA 3K92A 1E6UA 1RYDA 2JHFA 3S8MA 3I6IA 3PYMA 4IS2A 4IUYA 3I9KA 1EQ2A 2WE8A 2X9VA 4CM9A 1QYXA 5EN4A 4YWJA 4E5KA 4UUMA 4E2XA 1IL0A 1PZGA 3FF4A 4I9NA 4OOFA 1E3JA 1LI4A 4Q3EA 1YGYA 3E8XA 3C8MA 3PK0A 3ZNQA 1N1EA 4ESOA 4FCCA 1E1LA 2HDHA 5TQVA 3TFQA 2R6JA 4ND1A 2FP4A 1T1SA 4OXYA 1GZ4A 4GI2A 3TOZA 4AJ2A 1DB3A 4B3IA 1G1AA 3ZWOA 5L9AA 3JQAA 1R15A 2HSDA 1DC3A 3H65A 1U5AA 1YRLA 1YQXA 3PEFA 5A4DA 4E5MA 4MP8A 2C2XA 2HK8A 3B1FA 3M6IA 2FPIA 2PFGA 3ZHXA 1HT0A 1KC3A 2P9GA 4IQ8A 4UVDA 3RBXA 3K9QO 1ADBA 1HE5A 1LRLA 1J4AA 3DBLA 4HUJA 4L75A 2VUTA 4HFMA 4YAEA 1B7GO 5LC1A 1SCUA 1KEWA 4PFJA 3EDMA 3PZRA 4ALKA 4D43A 4ZVVA 4IJKA 2JD0A 1MX3A 5DCUA 5KKAA 3VZRA 3VHRA 3TWOA 4JX8A 1C3VA 3WICA 4DQUA 5IXYA 3AY3A 1ISFA 5KIAA 4WUVA 1Y8RA 5IDQA 1L7DA 3JD0A 4EUEA 1U3TA 4OSOA 2VYVA 4P4LA 2DAPA 3JQGA 1JAYA 1PGPA 4OXKA 3OICA 1DLJA 3GQVA 1D3AA 2EP7A 5L51A 3GN2A 3TOXA 4EUFA 4R3WA 4PG8A 4NBRA 4YAKA 3S1LA 1E5LA 1I36A 2WD7B 4RVUA 3GEMA 4LGVA 4RPHA 1DJNA 2UV8A 3ZDFA 2VTDA 3LQFA 1WDMA 1NWCA 4D3DA 5MGBA 2EJVA 2FZEA 5CP8A 4XX0A 3WDSA 2AXQA 5COBA 1D1SA 4JQCA 3H6KA 1V8BA 4AFNA 1EDOA 2P4HX 3MOIA 2JD1A 4Q3CA 4BL5A 3L6OO 1SMKA 1NP3A 4HFJA 1HDYA 1C0PA 2A94A 3GVHA 4HXYA 4MP3A 3MEQA 3SC4A 4JROA 2JD2A 3NEPX
chains in the Genus database with same CATH superfamily
3HNRA 2OO5C 3LY8A 5GIOE 4H77A 2BEWB 4S1PA 4C6HA 3JWHA 4D98A 3BEOA 5C8ZA 3BDVA 1T0HB 4Q1CA 1BDJA 1EHYA 1MNQA 2AD1A 3LT0A 2YINC 1O94C 1W4ZA 2X0NA 5ICGA 1P5JA 5CIWA 1TCAA 2H1VA 3SSAA 3NOQA 3VH2A 4DCGA 1RE0A 2E4WA 2CNKA 2O48X 2AXNA 4BQIA 3VTZA 1MC1A 2PBFA 1MH1A 2Q6KA 3SHTA 4NZZA 3HYRA 2MOKA 1KMHA 3E9MA 3IA2A 4IQFA 5A62A 2HWWA 4ND3A 3A26A 3ST7A 3WJ7A 4YX9A 1A8QA 2ZUBA 1IDN1 2B35A 3O82A 3U7QA 2AFHA 2VN8A 1YB4A 4P7BA 4B9EA 3ZW7A 4TZTA 3UXHA 3FKSA 4NBTA 4DLRA 1H5UA 1NPTO 2FU5C 2R6CA 4M9RA 5CURA 4F4UA 5C7YA 3OU2A 5LFAA 4U7TB 4MK4A 1FSZA 1KZHA 1U1IA 3FX2A 2BFEB 3GJ7A 5EJMA 3RWBA 4HGZA 1DI0A 3A3OA 3OZVA 2FW7A 2PUEA 4H2DA 1Z4IA 4HO1X 3E7WA 4NR0A 3T9CA 4H15A 1AKYA 3L7IA 3QVVA 1LW6E 3AF0A 2PRIA 2Y68A 3UB3A 4AURA 4XFJA 1BX1A 2PRSA 4FJ0A 5BYBA 3JQEA 2QSUA 1PS0A 3GCGA 3RVKA 2WTMA 3J80A 1AHHA 1HOXA 4AY6A 2C4NA 1YCHA 4ZYYA 3NOOA 3AF1A 5G0VA 4DC1A 2HFJA 1ZIDA 4IZOA 3WHLA 3HCDA 4MVJG 1XZLA 1AUPA 1OVMA 1HGXA 1UPUA 3FPHA 2CLCX 5EJ8A 1NC3A 2Y1CA 4C7XA 5DSTA 5JUWA 2KWIA 5BSMA 2EATA 4V1CA 1T6YA 1SGWA 2ZYAA 1K7YA 1VKOA 4ALLA 4Y2TA 3EH1A 4QGSA 3U60B 4RULA 2ID8A 5AVRA 1FTWA 2H92A 4HX2A 3L6CA 1N5RA 4EELA 1LLDA 1QE0A 5I51A 2Y2UA 4HB4A 1N5LA 2IIQA 1HT1E 1Z15A 4RIHA 5LQCA 3K71B 4R40A 2YICA 3PQ2A 4PR3A 4B79A 1MJGM 1YL5A 5FLXA 4HBGA 1E96A 3ZTYA 1P2TA 3UBTA 5AESA 2HHAA 4I1VA 3IEIA 2PGXA 4K8RB 3RAPR 4QU8A 3SX0A 3I30X 3WP0A 4DGQA 2BAGA 1L5HB 3E5NA 4JC0A 2FGJA 1DG9A 1Z5WA 3FSRA 3VMFA 5LP6A 2J3LA 1EK2A 1XYYA 2GCNA 3I1FA 4I66A 4JR2A 4RKYA 5SYAA 1X7WA 3LDAA 4EVRA 2XOKD 1W19A 4N47A 1GR1A 2FN3A 2XWQA 5HKOA 1GZHB 2QAGA 1BVHA 4XB1A 3ZBUA 1Z37A 1E5QA 2ZR7A 5KSYA 4HPJB 4ARSA 1N6LA 3L8FA 3ETNA 3RC1A 3TKAA 2X0FA 2YV2A 2OGSA 5IK2A 4KXWA 2CSXA 4B9AA 1ZLXA 3AJDA 4EHHA 2ZJ2A 4L3WA 1XMPA 1ZLYA 1NUUA 2AI2A 2JJ1D 3HADA 4L6AA 4QJIA 5FXMA 1WP4A 1XL1A 4I8DA 3RR2A 3A7EA 4HLQB 3MBIA 4LYHA 3IKLA 3PPXA 5CVVA 3SEFA 4B4VA 1NBMA 1YZQA 4JC5A 1FFGA 3N87A 4KXFB 5HF5A 1G3IA 4F6LA 4OOEA 2OHGA 4KXMA 4U2DA 1L1QA 1XZCA 4OMDA 1RJGA 1SRRA 3FFWA 4MRMB 2ZIGA 2OV8A 3RYCA 2VAXA 1QOQB 3CLUD 5D5QA 1C2YA 2PSJA 3RGWS 5KSOA 2JGDA 2YNMA 3SJUA 1DKUA 2NLOA 4PXSA 4LI3X 1P7CA 3DW3X 4UMEA 1IOVA 3HJNA 5I9NA 2ZSJA 3A11A 3ZIAD 1CNEA 2VP6A 3W9UA 2ILVA 3O84A 5IT9A 4M99A 4JN6B 1KS2A 4KAFA 5JIBA 4V38A 2OYCA 1T5HX 4WFQA 4G3XA 3ZS9A 4UHCA 2OD7A 1YJCA 5I7RA 4QPZA 4PPFA 2OMKA 1FU7A 1TFRA 1EI9A 4J0GA 5EGSA 2YWEA 1GQYA 3FFTA 2AGVA 3PRHA 3R9KA 4D97A 3ADCA 2NYRA 2FMFA 5KTYA 3EEIA 4HN9A 3GVCA 3GUHA 5AW0A 2AUNA 3OPVA 1UBJS 2RHLA 3IIIA 5CCBA 3ET4A 5G3ZA 1KXJA 1CVIA 5E7QA 3H8JA 2UVDA 1W0CA 2PGJA 3B6KA 4RVDA 2CXNA 2I4MA 2IYLD 2H4FA 3P9ZA 2AEFA 3RVMA 2ZPTX 4Z4HA 3SXPA 4B3TB 3Q8MA 4KN9S 4E4TA 3RAGA 1UJ2A 3OQNA 2YMMA 2GZMA 1JEQB 3WGZA 3LQQA 3OZGA 1NY6A 1UPBA 3FUXA 3LBNA 1PSZA 4GLFA 5ENZA 3ORYA 3ESZA 1BWRA 1JDBC 1WWKA 2BHLA 3U4CA 1ACJA 1Z2DA 4OAQA 4PG6A 2L17A 2UZ4A 2I3AA 3KPUA 1EX9A 2AR9A 1LDGA 3G1WA 4J4HA 4X60A 3RG2A 3L01A 1TYZA 3HCNA 3RV3A 3QXXA 5B55A 1ECJA 4HJXA 2WHEA 3EFHA 1XRPA 1MO6A 3UUFA 4HRXA 4RLSA 3JX9A 1DJOA 2NN3C 3DFUA 2P4QA 2ZJOA 1NN5A 3N6VA 4K81B 4RNDB 4N40A 2Q5LA 2UYYA 1HSZA 2W2NA 3QWIA 1CUDA 1VL5A 3DKPA 3NANA 4CKXA 2R11A 4P0QB 3PD1A 1UBFA 3GLGE 4I1OA 1PL8A 3TW8A 3BQMB 2JBAB 2BCJQ 2ECPA 1QCZA 1ZYUA 4FX5A 4P0TA 2J0EA 4US0R 3TH5A 5K7SA 3AGPA 4MCAA 1FS5A 3UFBA 1T15A 5FL7A 4OQQA 1XTPA 2HM7A 3LLSA 3E1SA 2PD3A 3UM9A 4DZZA 1N25A 2YFHA 2WFMA 5DYNA 1L4UA 1QVWA 2PT5A 4HDMB 1RJEA 5DNDA 3CIOA 3I76A 4HQFA 4O2RA 5KHAA 1J97A 4UC0A 4XVCA 2QL5A 3JZFA 2I34A 4NYJR 5TF4A 1ZITA 3ZV7A 1Q1NA 1TUBB 1F4VA 1GTSA 2ZUSA 3L7JA 4ACBA 3DTTA 4K9SA 3ENKA 1NF8A 1Q3HA 5EE1A 2JI7A 2H54A 2HC9A 1J42A 3DFIA 4LVCA 1AE1A 2F9MA 2VYQA 3OO1A 3NH9A 4HC4A 4HL6A 4EUSA 1EUZA 1GZVA 1OWOA 3QPUA 5F51A 4KFCA 3O9ZA 1ULUA 2X1VA 4GQIA 4MVYA 4NV0A 4M7PA 5I7FA 3K9HA 3FDZB 4MWTA 4RA6B 5LR6A 1HQCA 1DLIA 5GPBA 4NG5A 4OUDB 4A6PA 1IWBB 3ZJYA 4BNDB 1IB6A 1JDZA 2W2KB 3THOA 1G20A 2UDPA 3RYIB 3D0OA 1GPKA 1JEQA 4WACA 4DSNA 4GOKA 1U2ZA 2CVOA 3UOAB 1AXEA 3Q88A 2VAMA 2QZZA 3PUJA 1BOOA 3SXUB 5IWCA 1OI3A 1GKYA 2G5PA 2M32A 4YJKA 2W8BA 3Q9NA 4XDHA 3CPSA 2QZJA 2W6ZA 4B80A 2FDCA 2H0AA 2O23A 2FRVA 3WL8A 3CZ9A 3DBRA 3RHZA 1DTWB 1YQGA 1O4VA 2IUEA 2W00A 2J1LA 2WU1A 3C6KA 1GV0A 2QLNA 4DLUA 4GRDA 3G5LA 4ITRC 1YUNA 4YRLA 1NLUA 1Q0SA 3DKRA 4UHHA 1CZKA 1KARA 2RAUA 2WKWA 3ZE2B 4POOA 3OQ6A 3KAKA 4HP8A 2FV8A 3AI2A 4U2KA 4WKPA 1J2UA 3MQFA 4CV2A 2IHUA 4YRBA 5KTNA 4PIMA 2GM4A 1OXSC 1E2EA 3H1BA 1KVSA 3C1AA 3H11B 4MZDA 3ONFA 1K5DA 1W0KD 2IZ7A 4XOUA 4A5OA 3I1JA 4K86A 3U4MA 2DEUA 3TUJC 2KMLA 3L6EA 2JVIA 3F1LA 3M1LA 1KYYA 4W1RA 3KKNA 5JD3A 2ZTMA 4YJFA 1GFWA 2ZSAA 2H1CA 2WKRA 1WMAA 3DVAB 3NHBA 4IHKA 3ANMA 4MI9A 1TT5B 3WFJA 3ZPXA 4CHGA 5BUZA 2MCFA 2F62A 4X1IA 4A3SA 4HDMA 1WY7A 1Z82A 2C4TA 2WKPA 3DR5A 3ZHCA 3GFTA 1CR6A 1T6ZA 1NW3A 4FGUA 4YAWA 5CXXA 4G5QA 4TLBA 1GILA 2PUWA 5DXJA 2FEAA 5L8VA 1GITA 2OB1A 3MINB 1H9BA 4PG4A 1V26A 2J9FB 4E5YA 3W8NA 3I6BA 4MW5A 4G1FA 4Y2YA 1DHRA 3AWIA 2F1HA 2HYDA 1B8OA 1YR3A 2Y0CA 1PZMA 5E9JA 4BMXA 4BNWA 1Q6YA 3N8NA 1EAYA 2ZRFA 3AESB 5FYQA 3RKSA 4CNQA 4RA6A 4ZQFA 2YDXA 4WQMA 1UFOA 2V58A 3OQIA 3CLTD 2G17A 3LCCA 5FORA 2XGMA 4H0NA 1U0LA 4OUDA 1L4FA 1RBZA 1UZNA 5AKJA 2Q7DA 4B7ZA 3UZUA 4F2HA 3TXAA 2IHVA 3IUSA 1OQAA 1ID1A 2JLQA 3TOSA 4O2LA 1J00A 4O63O 3ICEA 3QBTA 1G6Q1 4L5YA 4PQRA 1JHOA 4HYEA 4BATA 5CA1A 3ITEA 3GUYA 4LXTA 2VQDA 2A67A 3I64A 1W5SA 1MO4A 3IOYA 5EUMA 5D3KA 5DISB 3IELA 1QDUA 2HIHA 121PA 2EQ5A 4WXMA 3REGA 1IN7A 2LV8A 2WIAA 3ZCPA 2PGDA 2C2HA 5LP6C 2HD4A 4M1TA 5J9FA 3UKJA 1UH5A 1Z28A 4QYTA 2HIAA 1XZFA 3GCXA 5TRTA 1FS6A 1WM1A 2QAGC 1FYEA 1OOEA 2XHZA 3JV7A 4U0KA 4XLZA 4Y1RA 4Z8XA 1GEGA 2YRWA 3LPDA 3JU3A 3EXFB 3GRKA 2AG5A 2AOUA 4G4JA 2D6FA 1OBVA 4OFZA 2IYZA 3H8VA 1QDEA 1TJNA 4KQIA 1CF9A 3RK1A 1FNDA 1TVEA 1F2UB 4NYIR 4PG5A 2ZZNA 3TLGB 3RRNA 4WA8A 4S1VA 4LBYA 3ZZ1A 4KXXA 2VRCD 5I4IA 2J9YB 3VO1A 3CY6A 1WW2A 1GUZA 1XF9A 3VR6D 5I7HA 1ZN2A 3GGOA 3HXMA 1U0BB 1V3UA 1ZRNA 2Z83A 4RPIA 4KBFA 4CM7A 4G0ZA 1C9MA 1FLNA 1YACA 5IT4A 5JXIA 2PX4A 1IEVA 3H9EO 1GDHA 1QKJA 2YHIA 3IKTA 3OZDA 2G06A 5G0UA 1CFJA 2YIMA 1CIVA 1UXHA 3PQEA 5CG2A 1JHMA 3BC1A 3NUQA 4YMIA 3CF4A 1PFKA 2ZLBA 1RWNA 5B1IA 4D2IA 1SELA 1G38A 2YNMC 5CM9C 5EUQB 1XJ5A 2J5XA 2QIOA 4Q82A 2GFIA 3PCTA 4EBFA 4FSXA 4MUHA 1I2DA 2X7XA 3VR4H 2ZP1A 1L7PA 2GVNA 2BJVA 4PEVA 1VJ5A 1UPTA 3JQAD 4GR9A 5KCMA 1OZ0A 4HNTA 1XHEA 1VCOA 2ZBEA 1S8AA 1L4EA 4H7FA 4U63A 4G0XA 4CUJA 4RDXA 5GVRA 2P5SA 3H3XA 4MLPA 4S05A 3VJMA 3A1SA 2GZ3A 4NKRA 4LVOA 2OM6A 3UOWA 2PWBA 5EI5A 4YECA 3UT6A 1QVZA 3FDJA 1OIVA 2ZGVA 1BCRA 1U0TA 4KMSA 4W5RA 2HHCA 4KTTE 1CIPA 3IBGA 4MPTA 3CUUA 4QBHA 1P3JA 2QQGA 4PRKA 5CVEA 5IDYA 4ZGWA 2ACWA 2MR6A 2F90A 4M1QA 1O5TA 3ETCA 4MWGA 2ZRDA 4ZK6A 5J5CA 3ABZA 4IX9A 4KXLA 3L9WA 3Q3HA 1C9JA 2VPWA 4JLPA 3PFBA 3SHWA 2EU8A 2VR1A 2VF5X 3KRTA 1VE7A 4IDHA 1IWPB 1QYWA 3JD2A 3FTPA 3Q7QA 1L8XA 1UFQA 1SUCA 3BN3A 2JCSA 3H2SA 4NARA 5GJWC 3PXGA 2QUAA 2FFHA 4UE2A 3V4VB 5HM6A 5JFOA 5H80A 5FWYB 3LRTA 5EE5B 3V6MA 1CQWA 2R2GA 4ZRMA 3E9YA 4QJBA 2BZ0A 3IDSA 3HJHA 2WEKA 2HT1A 2ADFA 1YHNA 2QRVB 4IEEA 4BUCA 3PITA 4DDKA 3T9BA 5IVKA 1SBIA 1F2UA 1DMSA 4N03A 1MFPA 1G7SA 2FR8A 1PK7A 2QZ9A 2R5FA 3NAMA 4UZFA 4LDNA 2JFOA 5BR1A 1SXJB 1FTNA 4EFKA 5HXAA 2V5UA 2PL1A 2X0JA 2FZVA 1MVLA 3P9PA 1CY2A 3DOOA 4A0GA 2PGIA 4DA8A 4EUKA 5KTTA 2UUCB 3G02A 4H7PA 2NXNA 3H6HA 3IDAA 2IP2A 1MOQA 4BNVA 3G8DA 1ZJJA 1Y4ZA 5C5EA 5KTOA 1V37A 1GNPA 2ZRIA 1LK0A 2FSPA 4MVJI 1SB9A 4JJIA 5KNCH 1X14A 1VSVA 1DZIA 1Y1PA 3G49A 3ZYZA 4C2AA 2B2XA 1E3QA 1U7TA 3E9RA 2J5QA 3FCEA 3OEEA 2WA2A 3PYXA 4NS1A 4REMA 5AP9A 3U5TA 1Y6QA 2Q45A 3Q40A 5FO1A 1C7IA 1KSFX 3DWFA 2CNOA 3RIGA 1VRCA 1KIFA 1U8ZA 2UYGA 3NBUA 1IB0A 4WN9B 2QR2A 5IJ9A 4D26A 2QT1A 3WK9A 5F4BA 3SZRA 1HX7A 1PEKE 5JRJA 1T9ZA 2W2MA 4W5HA 3LC0A 1HYGA 1QTNA 2Q4OA 2H1FA 2W48A 3DD5A 5BYKA 2AZXA 3JQGB 3K9WA 4AZSA 3W4JA 3MIZA 4RMIA 1GPLA 3FNFA 1HYQA 1JSXA 1G8HA 4EOGA 4U8HA 2PMEA 4M1OA 2PS9A 3WGGA 2ZT5A 1A71A 1AUVA 4IDBA 2C2YA 2XB9A 3U3JA 3GZTB 2X8JA 1ACMA 3KZNA 3LOQA 3QKSB 3VKHA 1QH0A 1E9AA 1EK5A 1EVJA 1WPGA 4EGFA 3SOPA 1FPQA 1Y7TA 3RUEA 1CJTC 3F7NA 4EZBA 4AIRA 1VA5A 4HS9A 4W1SA 2VDMB 4C4OA 1G5IA 2BM1A 4Q02A 4KOAA 4S1NA 4C78A 4DR1B 3UW3A 1FFEA 2GJ9A 2JIQA 1GNVA 1O5IA 2P9BA 4NYMR 5FOSA 4BLQA 3AKZA 2NTEA 1QGUA 2O5VA 1YQEA 4N5DA 3TCXB 4AJOA 5HRUA 3A4IA 3N07A 4IIBA 4Z2YA 3RD5A 1J5EB 1T34A 2GH1A 3C7CB 3EISA 3E2IA 5FRDA 2IY7A 1JVBA 1YMUA 1HYBA 1ZA1A 1EPUA 2HMWA 2NYVA 4YRDA 3ZE7A 3PB3A 4KWHA 3K0BA 3C5HA 3GAMA 1IZ8A 4GSLA 1UMKA 3EQ2A 4QLAA 4A7PA 5HUJA 4MS1B 2G6TA 2PBRA 1KWGA 1GGVA 1Z25A 3DAPA 3NFRA 4CFSA 3BCHA 2OO3A 4L5IA 3X2FA 3TTXA 4P4TA 2IX3A 2R96A 1G2QA 1WKVA 2ZTLA 2FH5B 2I62A 3CNQS 3MERA 5EL0A 1G7RA 3VKVA 5T3UA 3FMFA 2YH2A 1GJRA 1RQPA 4ND6A 2P4EA 4ZYZA 1A72A 1OY1A 1VZ3A 4GC5A 2HQSA 4KWEA 5HBRA 5E4YA 2ON6A 1I80A 4KU4A 4EUHA 2CDNA 3V3TA 4QBFA 2SECE 1GGMA 2OM2A 1G0OA 3K2BA 1JILA 3YASA 1UFVA 3ROKA 3FWYA 2QXYA 4XD7A 3D6MA 4O1IA 1JMVA 3FD8A 2WFLA 4I50A 3DONA 3ZUPA 1OYYA 2PL9A 4U7WA 3GA5A 2ACEA 1QAQA 1BFKA 1NFRA 2O0LA 3Q3EA 4FW9A 4I2VA 4KXQA 3ESCA 4A2QA 4DCSA 1SKUA 2D8MA 4Q00A 3OQHA 4HUTA 1M74A 1PJAA 4OP1A 3E58A 2I1LA 4WBSA 4YCSA 3BSYA 2Q1TA 2Y6UA 1CLEA 3BGWA 2DPXA 2ISQA 4QE3A 3P97A 3PNLA 4JJAA 4P8RA 2ZB8A 4OK3A 5FCDA 3NYIA 3IAM1 3PXUA 4AG5A 1CDEA 2VTKA 4XYEA 1E5DA 4P82A 3BG5A 4RY8A 4PO3X 4U2GA 3TQIA 5L3QB 2OHIA 2TYSB 3HEAA 1WCV1 3O0TA 2CHFA 5U4XA 3O8CA 1KZ1A 2PZJA 2PDAA 1NT4A 4FONA 4E5SA 3RUDA 3HP4A 1ZD2P 2VUHB 5K8UA 3L8ZA 3V2IA 4F3NA 3GMIA 3KUKA 1YVDA 1K98A 5DKFA 4F1JA 2R8ZA 3DNFA 3EZ2A 3PGA1 2ZE6A 5KYXA 3FMIA 3RLIA 5C8YF 1N9KA 1YE5A 3JQDA 4C2BA 1QAMA 1RRVA 3VKFA 3RTBA 3FUCA 3QVUA 4FDMA 1VBKA 5CJ2A 3TQTA 4EKNB 1TB4A 2V6GA 1JA0A 3KPVA 4LHZA 2JAOA 4V0OA 5E7MA 5G4LA 3Q8WA 3QTTA 1COWD 1K6XA 4O4JB 4PC3A 1JTEA 4EO9A 3D31A 4URFA 3EMDA 4N18A 1W88A 4UAJA 2FYTA 1CJCA 5ECGC 2FGKA 4TS4A 1V4VA 3WAGA 3KZKA 1DRUA 1JV2B 4KE9A 4KWCA 4ND8B 3O90A 4OL0A 1MRZA 1L8OA 2QRGA 2MR5A 2I4OA 3CEHA 3ECCA 4LXUA 4HMQA 4M2LA 1GD1O 4LRYA 3WYEA 4INAA 1PAUA 1L5KA 3UH1A 3X1XA 3A4NA 4MV4A 2JGNA 5IM4A 4ZCLA 1BE0A 5AM4A 4C0BA 4LBWA 5THKA 5K0CA 1RQLA 3OAAD 3GD5A 4TV8F 3OUZA 4KQMA 5K3CA 5KWEA 4D6YA 1R9JA 5TMEA 1CRPA 2B4QA 4Z53A 1UAAA 1YRHA 3DM9B 9ATCA 1OHHD 3PP8A 4CIDA 2QJRA 3NIFB 4PQFA 2O3TA 4QG3A 5E1BA 1JR3D 2UZAA 1EVEA 1VL6A 4Q9NA 2SCUB 3OCYA 1BWPA 1TAQA 1VSUA 1AKQA 2GMWA 3HJAA 3KJHA 1Q0LA 1CY6A 4PAWA 3MWLA 2HHJA 1CQZA 2WT9A 3DMYA 5FEMA 3CTMA 3K16A 1XNQB 4LMRA 4N0MA 1KC1A 1D1TA 2VO1A 1K75A 2RGYA 2W2LD 3NP9A 3R0ZA 2AN4A 3REOA 1K6JA 3ZKWA 5A0TA 1CB0A 5D00A 1J39A 1P45A 1SQFA 2BGUA 1LPOA 2D54A 3RDPA 1L7QA 1SBZA 3ENVA 4IVNA 2DM6A 3A14A 3WLKX 1A0OA 1PEYA 1XHLA 1LDMA 3PNYA 4Q1VA 4HDKA 2D8AA 1ZO8A 5L3QA 3FYDA 4J1TA 1Y6GA 1LF0A 2WW8A 2CVHA 5CJPA 3AUAA 3RKUA 1VPLA 4HB3A 1EESA 5TPZD 1NVVQ 3ZKAA 2H08A 1Z6GA 2BFPA 4O5OA 3UUEA 3ZK8A 4UQPA 1CDDA 4BJ1A 3P2JA 4DAOA 1R4MB 5BN5B 4I5IA 4I5EA 4IMIB 4DEVA 3R44A 3R9XA 2GF0A 2G4LA 3NTQA 4DUGA 2C7QA 4J2HA 2I3BA 2PU5A 1AUQA 4MW0A 3PEVA 5I7VA 1ST3A 1S01A 1ZM4A 3PCRB 5JS6A 1H6AA 2GN1A 4P7GA 3BXFA 3P7MA 3VDMA 4O5AA 1MA0A 5KDLA 4D5EA 3VU8A 2HZ7A 4NHEA 5IBQA 1WW3A 4YO8A 5BV8A 3FNBA 2ZSIA 5AHRA 3SYTA 2YXLA 2ZI7A 3FB1A 1YIAA 1UKCA 3K8ZA 1P81A 4K6HA 4YS6A 3LT1A 3R7WB 2CXRA 1PBTA 4BX3A 1XDWA 1XZQA 4HDNB 5ALHA 5K4GA 3I61A 3PYLA 2HV8A 1NR7A 1B0PA 1D5WA 2ZRPA 4WKBA 1ISIA 1E4EA 4M8KA 4ZT6A 5D1NA 3HA7A 1Y1SA 2BELA 3FUWA 4GW3A 3CB2A 3SEAA 2FR8C 3A6FA 4N4AA 5CVDA 1ZQ1A 4C7OB 4F92B 4US2R 4YJ3A 3X1WA 5LQJA 4NDNE 1M34E 3G2QA 1ZSYA 1P0PA 5JWHA 2CDAA 1I1HA 2GYVA 4M6WB 1PJQA 2IEYA 1LJ8A 4Y1GA 2WVGA 5M5BA 2QTZA 4BCCA 2H1RA 3NX4A 1V6CA 1ENYA 5G41A 5T6BA 4B6SA 2JCBA 2PGAA 1F9EA 1QHEA 3PXCX 1W6UA 2R7KA 2JI6A 1IIRA 3UW1A 4U1RA 1W4LA 4AWXA 1DOZA 2AOWA 1T4CB 4IKPA 2Q4TA 4UFOA 4NECA 1II9A 2ADOA 4PW0A 2BFCB 3ZUGA 1UT6A 1C7JA 1E2IA 4DV7B 1IATA 3QKRA 4LZZA 3QEMB 3JZAA 5JZBA 3MRVA 1LV8A 4BFCA 1FMCA 1U7DA 3EVAA 4LXXA 4MR8A 3DBVO 3ZC3A 3DD1A 2W37A 1CY8A 2Z2ZA 3E9QA 2ZIAA 3G8YA 4US1R 5CM2Z 1U9JA 4J1SA 5EIEA 1KQFA 1ZW6A 2QVCA 4QEKA 1V8PA 3C3DA 3EXHA 4B85A 4WDRA 3W5UA 3S29A 1YB1A 3CUWA 3HE3A 1ND5A 4FWTA 2HEIA 3LNCA 1I3CA 3PHBE 2O7NA 3CH7A 3TJZA 2K87A 4JXZA 3IUJA 3NNDA 4ZGGA 1BWQA 1JE0A 2Z0MA 1RXYA 2GK6A 5FV7A 1T0PA 2JFWA 5C0OE 2YHAA 1HDXA 1JZSA 1NNSA 3K7EA 4N9WA 4YRSA 4WLEA 2WSSA 3IBSA 3T7IA 2CF6A 5EJ9A 3SOZA 4CLEA 1XTSA 4QSMA 3UJAA 1G4HA 1CQIB 3UICA 4A4DA 4OHXA 1AZLA 2P75A 3ABOB 2V7QD 2R85A 4NY1A 4OX9B 2GARA 5PNTA 4E1VA 4TS1A 1Q44A 1XEAA 1V11B 3LA6A 3N2LA 2HRQA 1EUDB 3G6KA 3I6QA 4G1MB 1ZN7A 4OH1A 3OSUA 3VC7A 1NJ5A 4FIDA 1UDAA 2X5OA 2J5KA 3F6SA 1XLTA 2HWYA 4QGBA 2ZW9A 5ADUS 3THWB 3TQFA 3CTPA 3ORRA 3NJ4A 4UREA 1EB9A 4CE6A 1OF1A 3BHJA 3KEMA 4LY0A 5JE8A 4YIHA 5EIBC 3BWYA 3SIRA 1NONA 3UK7A 4MS4B 1SPBS 3BEDA 3BL6A 2GPYA 4L2IB 1ZUD1 2RGCA 4S35A 3DH0A 1FSFA 3G3EA 1RLJA 2VF7A 5DGIA 2B6NA 2BMEA 2QTWB 1T3GA 1ZMTA 1WEKA 4QULA 1P17A 3TZHA 2O0MA 1ZGJA 2W6IA 5HM8A 3EDYA 3N6RA 1A98A 4JLUA 3K3PA 3SPXA 4QPPA 4B32A 2Z2YA 3GD7A 2PS3A 4PGAA 1Q95A 4YI3A 2JVKA 1NXVA 1SVUA 3PIRA 2I55A 4CMJA 3MGAA 5JI2E 1US8A 4B17A 3WHPA 1CBUA 1VJCA 3AI3A 3VHLB 4CCSA 3RARA 2C7PA 3G8CA 1U8XX 1CJKC 1V35A 1YI1A 2QZPA 1RKQA 4MGZR 5AXCA 2C5LA 5A3VA 3VXKA 1XQXA 1TTQB 1N5KA 2OYSA 1Q14A 2OCGA 2VFAA 1J33A 2FUG6 4BGDA 1YZVA 1DG1G 4AUMA 1PL6A 3FPCA 4YRPA 3T12A 3DLPX 4KVZA 2ZOSA 5JYBA 3RS9A 1SUPA 3AQIA 3N2KA 3NKFA 3VO8A 1KH2A 3CF4G 4LYYA 2XNDA 2OFPA 3NYWA 1LBSA 4X7RA 4F3TA 2H8KA 3WR5A 4DA4A 3N0RA 5JH7B 3OT1B 4IDGA 1L5SA 3BHNA 5K0FA 5K01A 3MMZA 5J1SB 4ZV9A 2GCOB 2OBXA 2XITA 1KBQA 1KRHA 1NBEA 1L5OA 3ENZA 3PVSA 1AK2A 1H66A 4NQZA 3BL5A 4KDFA 3Q41A 3K2QA 4Q19A 4EHFA 2K2WA 4LGMA 4QREA 3COSA 2ARKA 2ZETA 3S7TA 1GNLA 2HNKA 1PT7A 2QNBA 2D0IA 3HDYA 5E1OA 2IZOA 3BCUA 1XPOA 3HZOA 1AQUA 4B4OA 4E2ZA 3FMGA 2LCQA 1IHUA 1Z5GA 1I01A 2CK3A 2GEBA 2NZ2A 3VTKA 2WOJA 4KR0A 5ADWA 2ZIWB 1U0FA 3TR5A 3B2EA 4S04A 2HCJB 3I4FA 2BRUA 4NU5A 2DPMA 4HWKA 4L57A 5I4KA 3QVWA 1FP2A 3D8RA 4DT1A 5ITSA 1NVKA 2NG1A 1HC7A 1BGWA 3G5AA 5C5DA 1UUFA 2NQ2C 1C1DB 3U3XA 1ODSA 2GTPA 1FEZA 1XMIA 4TSKA 4F11A 3JR3A 3OUUA 2C5SA 4Q7QA 3OQPA 1UBHS 3M0EA 1LRKA 1FP1D 2QX4A 2VH1A 3CEMA 1BDHA 3JQ8B 3L0OA 4D3ZA 4I6EA 1CV2A 4NS4A 1XZPA 1YV9A 5B6IA 1AH2A 4R7TA 5HILA 4XGNA 1NWHA 3WBBA 3FNEA 3RC3A 3D8UA 4RJIA 3SKYA 3RUIA 5EXDA 4YCJA 2Z8ZA 3PWZA 3E8SA 2O8DB 3AETB 2EP8A 4L3OA 3A1VA 3JYLA 1A7KA 3O9MA 1L5WA 3W6ZA 1ZNQO 4QGHA 5IFLA 4EYSA 2YV4A 3FGZA 3P4YA 2P9YA 2PLFA 4FTWA 3OKAA 3BSSA 1P9WA 2ZS7A 1YS1X 2JGIA 1QIMA 1QTRA 1TKCA 3FR7A 4AN0A 4C7JA 5BVGB 4O33A 1YR8A 1ZJZA 2XEDA 4HV4A 3NAGA 1V8OA 3EZ9A 4J2OA 4KTVE 1OFUX 4ITUA 1T5IA 2J3MA 4M1KA 1QZXA 3TTVA 1P2GA 1ZINA 2FG6C 2IYUA 3KUXA 4J07A 5DYWA 2X5NA 3VPBA 4ZHSA 3HVRA 3WL4A 3SYRA 4PGHA 1KU6A 2FDXA 1NUAA 2EDCA 3FYUB 5JH7A 5KC9A 5FADA 3UMSA 4KQWA 4CF3A 4YK7A 5BPFA 5JQGB 2O2DA 1WVMA 3CLSC 4QTZA 2P41A 3V80A 2R8RA 3G2PA 3FROA 3OKPA 5JWOA 1AQ6A 2Y9PB 4G4GA 3KJXA 4J1TC 5A5GA 5JSFA 1NNLA 5SZHB 1ELOA 1VYTA 3NHUA 4Q3AA 3SF8A 1D2MA 1F3LA 1F5SA 3NC4A 1N2IA 2IKSA 4GO1A 5FD8A 1NFFA 2WYUA 4WFJA 2CCJA 2AFHE 4UPVA 1XSEA 2DE0X 2Q3DA 4XJSA 5B6PA 2EKQA 3FBTA 4ERXA 4TXMA 4KRFA 4DM4A 2Z5LA 5E6RB 1O5OA 5JMOA 4ITVA 3RLFA 4C4RA 1X7GA 2FKNA 1DWUA 3BB4A 3QKUA 1IHYA 4RVOA 2AMYA 1J8YF 1JP7A 4B6EA 1QOPB 1BEUB 2V5AA 4Q0MA 3SZUA 1NQWA 4PG7A 4DQVA 5HJEA 1ID8A 1ANKA 1C1DA 1OYOA 2C07A 1OYVA 1PLJA 3NHKA 3OQBA 5JVDB 3RNLA 3BD8A 3LWBA 2BL4A 4BNLA 4TMTA 4XUCA 4IEIA 3NU1A 1VJ1A 4QEZA 4QUDA 3VTFA 3PQ4A 5C8DA 4IINA 4DMUB 1D4OA 2NV2B 4NCJA 3DAOA 1UK7A 1FPMA 3AUTA 2RJNA 4HKTA 3UCFA 3VR3A 5JC8A 3ER6A 2OOKA 1DG3A 1T5BA 4HRAA 4IIJA 1GCAA 2VRNA 1NVUQ 1RWQA 2YQZA 3A58B 1CNMA 2Q50A 1D6SA 5DM0A 5EP2A 1T2DA 1QS0A 4RIFA 2JAUA 4LG1A 4UBMA 4BKUA 4P0PB 4B75A 3N8GA 1Z39A 4TVBA 3JCZA 4R1TA 4KW7A 5ALGA 2IUFA 1GRNA 4DXDA 4YRZA 2CJFA 2JCGA 3Q7RA 4U39A 2LVBA 3HP1A 2AG1A 3WFIA 3PNOA 5BVGA 1CUIA 4WZAB 4KE7A 1DFHA 1E92A 4M0FA 2XB6A 4XB2A 5TE9A 2JA2A 3WIDA 4F6RA 3SLKA 4C88A 4WBNA 1KQOA 3QFRA 3IT0A 3EC2A 1DU4A 4IFIA 4MRRA 4PNZA 1Z08A 3GLQA 5JLAA 3VYUB 5U9CA 3WLFA 3ZWNA 4Y18A 4PZDA 1XRJA 4Q34A 4QQKA 4HBZA 4DAEA 1C1XB 3LBAA 5JQGA 5KYTA 3GPIA 1CUGA 1YBHA 3GH3A 3LK7A 2GUWA 2X0EA 1QHNA 4H1UA 5C37A 1F2DA 1LBQA 2LZ0A 2Y1WA 2QT0A 4F4IA 5HIJA 3EH2A 4UCQA 4M53A 3WNBA 1Q57A 3QFCA 4YDQA 1K7EB 3IP5A 4X3CA 1E1CB 5EEGA 2XDAA 1OWMA 1E98A 3EXHC 4NJOA 4OLHA 3T0FA 1ZUHA 2ODAA 4HB2A 5IJWA 1FFWA 3DMTA 3FLAA 4L07A 1R00A 2O52A 5BN3A 3K0CA 1NW9B 1U2QA 2J59A 1MIHA 3KDAA 3QVTA 4WMLA 3K1ZA 4ZAGA 5MFPA 4JUBA 1LJUA 1Q1QA 1B73A 1JTFA 5HHTA 1QO7A 3O92A 2RBEA 2IZ6A 2FWPA 4DSTA 2JI8A 2BGLA 3RFVA 5A4KA 1F6DA 2HRZA 4NJMB 2A30A 5BMVB 4O4LB 1K6IA 1NBME 1SWVA 4Q4LA 5DASA 4D81A 1NU8A 3MVEA 4C4PA 3QEAZ 3OJEA 2ST1A 4JSYA 5DFAA 3QA9A 3K73O 2CXTA 2WYOA 3EARA 4H4EA 1V4BA 4JHXA 4BO9A 5IYZB 4DUZB 1NAIA 3OP4A 2XKJE 3BMOB 3HL4A 3I9V6 2ATXA 3QXJA 1RXUA 4LJ8A 2WNSA 1P4JA 3LCRA 4WK4B 4EG5A 5FBLB 3W2EA 1XLTC 5B6JA 5AW3A 4ND2A 1BU5A 1C1HA 3ZCSA 4BFLA 3DZCA 2JK1A 1CZUA 3B7GA 4B3HA 3LVRE 5I9MA 1A5AB 1UWCA 2J31A 2QRUA 1QBKC 4J0FA 4KUHA 4BB5A 3KKKA 1LLCA 1QG6A 1G66A 2AFVA 4LI0A 3NHFA 4OPMA 4R8VA 1JEDA 2BUAA 4FINA 3BRWA 1JKIA 4CQMB 1TYDE 5F52A 2Y66A 1M0TA 3MHPA 3DVRX 2J09A 4MRAA 4TTQA 3WFZA 5JADA 2REQA 2O0HA 4I7EA 3LUCA 1L2TA 5E2IA 4BFTA 1TMKA 5AI0A 1O0SA 1UBOS 3HR8A 3AZPA 4OYRA 1Z8FA 2PZ8A 5F76A 4EKIA 3OZ7A 4JVNA 3W05A 2X7HA 2QUZA 3QX3A 3ICVA 3S40A 4MNTA 4QPDA 3CR7A 4LOHA 5TIIA 2ATEA 1BMDA 5J2TF 3V1LA 3O31A 2XDWA 4A1OA 3FZEA 2ODEA 2A5LA 4BAGA 1MXFA 5HWSA 5LMNB 2XUOA 3MWKA 5BURA 1SUFA 5CFLA 4XVHA 4L0DA 1SCDA 1QYRA 1C1XA 1LFAA 3DF9A 3K09A 5DTQA 4JNKA 5DM1A 5KNDH 4ID3A 5TMBA 1CEXA 3EWSA 5DGTA 1KZ9A 2VZEA 1X3LA 5HIMA 5GZ3A 2ZJAA 5F98A 1F9AA 4KI7A 3I62A 3VH1A 3AK4A 1RMTA 4C4XA 2VQEB 1Z6AA 2BZ1A 3OOWA 2X22A 5U4QA 3I05A 2N1MA 1QV6A 1BW9B 4ZI5A 1J70A 3HY3A 2P2ZA 5GGXA 5LBUA 2C4KA 1OX4B 2IDJA 1GFSA 2ZJZA 1IEWA 3GLHA 3HKDB 1U1GA 3PWTA 5DMXA 1T8UA 5H3HA 4IZIA 5AUNB 5JHGB 3WKBA 1MIOB 1ZAYA 2O5EA 3DGFC 3A9CA 4UHFA 3KVNA 2QN1A 4JB0A 4OHCA 1KEEB 5FIUA 2QT9A 3WLNA 4CQLB 1AU9A 1F6BA 4WXEA 1AKMA 2HMVA 3W3AH 2X9QA 5CRIA 1A9QA 3TLJA 1IN1A 5TQ2A 5KJ1A 1U2RA 2EQBA 5BSRA 3SVTA 1W36D 4FFDA 4IX1A 3AEKB 1L5FA 5TQ0B 1K63A 2RAVA 3UAOA 1PYGA 2OAP1 2WIJA 3BFVA 4TS3A 1USGA 3GRAA 2IXTA 3TVTA 1WNTA 2ZB2A 3KNZA 1ZG3A 3R23A 1TKRA 4PM4A 3WWCA 1OCEA 4DR2B 2BRUC 1KMMA 5BOSB 1Z33A 1ZW1A 3C43A 1WXWA 2DY0A 3HU2A 3JWGA 1IEXA 4HOYA 3IMGA 5JR3A 3GEIA 3MUFA 2HQBA 1H2BA 1BAPA 1F8UA 2HDWA 2MSCB 3F2IA 1TO6A 3VV3A 4DR5B 4BUJA 2CDCA 2QUBA 3ONEA 1IXZA 1Q1GA 2WWRA 1YDGA 2QN3A 4AS1A 2PE5A 4MDHA 1GAJA 2QQEA 2QQFA 1H0SA 4DCTA 4K5QA 4A73A 2X40A 3T4UA 4DRXA 2F8LA 2WMOB 2CGEA 1BXZA 2GXSA 2ZYDA 3H3FA 3WNDA 2QX7A 1U7PA 3KR2A 4BYGA 5KWSA 4C3OB 2SKDA 1U0OC 4RH3A 1I4EB 1RNLA 3H5WA 1E1DA 2EFEB 2VKQA 4FYJA 4RA9B 4IIXA 3DE1X 2Z9CA 5ALJA 1KE2A 3VR1A 4CKBB 2ZPAA 2X4DA 1EA7A 4QOFA 1EWQA 4CMHA 2NU9B 1CZHA 1QZTA 2V3WA 2J08A 4GM1A 5AJVB 3DVLA 3MMSA 4X1KB 5E95A 1MX5A 2FEXA 4DYVA 3BIOA 1X7YB 2GN6A 5DI3B 1W76A 4BX0A 1SC6A 3EVGA 3A7DA 4KE8A 1KDYA 1ZONA 4ZU1X 4Z9YA 2ZAOA 3O8QA 3JS5A 2QLBA 1SQ0A 3KYDA 4KNYA 5B1HA 3H7IA 3FZQA 4BVLA 1FW8A 1IMOA 3H9QA 3P9IA 3U4IA 2TMGA 3I4CA 4FMDB 4RD2A 2XCUA 3EWIA 1BW9A 4J0HA 4MUAA 1L5NA 4BNHA 2RKWA 4MJLA 2QL6A 5IUNC 2IGBA 2FCRA 4JODA 1UMBB 5D85A 3PF9A 4IXNA 1R8XA 1U81A 2RC6A 3TECE 2VHQA 4D4KA 1C9DB 4E1AA 1SVNA 1PHRA