3TQHA

Structure of the quinone oxidoreductase from coxiella burnetii
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
317
structure length
317
Chain Sequence
b'KEMKAIQFDQFGPPKVLKLVDTPTPEYRKNQMLIKVHAASLNPIDYKTRNGSGFVAKKLKNNLPSGLGYDFSGEVIELGSDVNNVNIGDKVMGIAGFPDHPCCYAEYVCASPDTIIQKLEKLSFLQAASLPTAGLTALQALNQAEVKQGDVVLIHAGAGGVGHLAIQLAKQKGTTVITTASKRNHAFLKALGAEQCINYHEEDFLLAISTPVDAVIDLVGGDVGIQSIDCLKETGCIVSVPTITAGRVIEVAKQKHRRAFGLLKQFNIEELHYLGKLVSEDKLRIEISRIFQLSEAVTAHELLETGHVRGKLVFKVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Quinone oxidoreductase
publication title Structural genomics for drug design against the pathogen Coxiella burnetii.
pubmed doi rcsb
source organism Coxiella burnetii
molecule tags Oxidoreductase
total genus 96
structure length 317
sequence length 317
ec nomenclature ec 1.6.5.5: NADPH:quinone reductase.
pdb deposition date 2011-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
A PF13602 ADH_zinc_N_2 Zinc-binding dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3tqhA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3tqhA01
3SLGA 4IS3A 1Y6JA 3UXYA 2HAEA 4RORA 1GCUA 1ZK4A 3HN2A 3SC6A 1LQUA 3UAGA 3O26A 3HWRA 1IZ9A 2I6TA 1Q2XA 2OL4A 1BDMA 4DLBA 1VLLA 4HADA 2HMVA 4UULA 5L9AA 1FXSA 1QP8A 1LLUA 3PLNA 4BNMA 3G49A 1LDEA 1M6WA 2FSSA 2X58A 4A73A 1E6EA 6LDHA 4AJJA 3ROPA 2VYVA 1X7GA 3E18A 1KVRA 4ZN6A 3L07A 2Z95A 4BIIA 3JD1A 4WLOA 3ZU4A 1ADCA 3H6KA 5HS4A 3BTOA 1YDWA 4LVCA 3F4BA 3H9GA 4R1SA 1ADBA 4XZ3A 4Y8VA 4R51A 4CV0A 4DYVA 1VKNA 4MKXA 1YBMA 3FSRA 1Y1PA 4GGOA 3MJEA 2QW8A 2HLPA 1U9JA 3NRCA 5T64A 1UZLA 1AE1A 3JYLA 4MVJM 4ALNA 4B7XA 3IQDB 1BWSA 3GOHA 3UICA 1GUZA 3W1VA 1NTOA 3PGXA 4R54A 1XR3A 3Q1LA 1M2WA 1AN9A 1H2BA 2HUNA 2JAHA 3EZYA 3PQFA 1DAPA 1QLJA 4Q3NA 1NFRA 1HE2A 4NK4A 4PG7A 3KLMX 1RWBA 4GSKA 4J7XA 1I0ZA 3I3OA 1GL3A 1PL6A 2HDHA 3KVOA 4YJHB 3N74A 4GX2A 2WEKA 4J16A 4A26A 1H5QA 1PZHA 1ISHA 1W73A 3H5RA 4A10A 4IQ8A 3N7UA 5DOZA 4Q3AA 4WEQA 2LDBA 1GR0A 1NVTA 2CNBA 2W2LD 2GZ2A 3A4VA 2Q1WA 3NTRA 1MV8A 1Y7TA 5IJZA 4YT5A 1BVUA 1LC0A 1MG5A 2OZPA 3DBHA 4E4YA 1H6DA 2GN4A 4UUMA 5IAAA 3UCEA 3WSWA 1DC5A 1TT5A 2QYSA 4RZIA 1WMAA 3A1NA 5EJ2A 3GGGA 4FC7A 3DBRA 1CETA 3ZNOA 4YT4A 3QVTA 3B20A 4J2HA 4CM3A 1J5PA 1U4SA 2BRUA 1N1EA 5KJEA 3RWBA 1XU7A 1GYQA 4PLWA 2DPHA 4MVJI 4YVFA 1EK6A 1BXGB 3D4NA 4WE3A 5ES3A 1HL3A 2C5AA 3O38A 4L74A 4LCEA 3LYLA 4RQUA 3OJFA 3I23A 5A9SB 4WLVA 1S6YA 4UUPA 3QV1A 3DBLA 5AVOA 3TZHA 5I7SA 3RKRA 1HZJA 1BGVA 1N2SA 4OKNA 4E31A 1G6KA 4M55A 4JK3A 4KTTE 4R41A 3BTVA 4TRJA 4DREA 4ND5A 3BHJA 1P1KA 4YA6A 3E6AA 3TPCA 1TEHA 2G17A 4CM8B 4BO7A 3KETA 1QSGA 4PVDA 4EEZA 1Z82A 4WCFC 3OBBA 3D7LA 1EE9A 4FFMA 1KY5A 1IYZA 4BKOA 2HU2A 4PLCA 2E37A 4IDFA 3AOGA 4NJMB 3TZ6A 1KS9A 3QP9A 4ZU3A 4CPDA 2Y67A 4R9SA 5TGDA 1MP0A 4RVHA 2A94A 4EUEA 4HKTA 4RF4A 2O7QA 4J3FA 5IFLA 1XELA 5G4KB 1DIBA 2HMSA 4RPGA 3ZWCA 3RUDA 2P9CA 4E0BA 3K73O 2FPPA 3NT2A 4ZGWA 4YAJA 4WECA 1VE9A 2AQHA 1VM6A 2W90A 4W99A 3JQGB 4W9NA 4C7JA 1ML3A 5U9CA 1HETA 1HZZA 3V1TC 1T24A 2YFQA 1N7HA 1I10A 2F00A 1D7OA 3WGZA 3PK0A 5ADHA 3LSYA 2V7PA 3ADOA 3VPXA 4I9HA 4XIJA 4UVHA 1SEPA 4QT0A 5AQ1A 1XGKA 3NDRA 4DGSA 2VWQA 4KOAA 4AFNA 2ZJ1A 4MP6A 3RC2A 4LW8A 3AUAA 4IIVA 5G0UA 4XX0A 1ENOA 1I3NA 3C3XA 5DF1A 2PGLA 3FTNA 3S55A 1Q0HA 2EIHA 1B8PA 4CR8A 1XQ6A 5ENVA 1U3WA 5G0SA 1H6CA 3OMLA 3TRIA 4QEDA 2X0RA 4E5YA 5I9MA 1M76A 3ZI0A 3R6DA 1T2AA 4E5MA 3BHIA 4MP3A 2ZK7A 3ZNQA 2OGUA 4LISA 3BMQA 4R4JA 2EHDA 2HCTA 1E7YA 3OJEA 4YRDA 3K92A 1DO8A 5TRTA 3ANLA 4NZ9A 3QE3A 4MIYA 1PJLA 4BNHA 4FPXA 2VHWA 2Y05A 2X1HA 4IJKA 5JPIA 3AI1A 4JIGA 1LSOA 4TZTA 5CDYA 1PL8A 1X1TA 3CXRA 3DR3A 1NQOA 4K6CA 2VYND 3RU9A 1DC4A 3VAZA 1A9YA 1S7CA 1RYDA 3C1AA 4MVJG 3U0BA 4GQAA 1VJ0A 2DPGA 1X0VA 4O6VA 1BXKA 2BHLA 2CSUA 4XYEA 4YJDA 4YT2A 3NTOA 1UXKA 1C1DA 4DVJA 3GHHA 2W4QA 4XB1A 5BNIA 4NH4A 1JTVA 4XEHA 2AW5A 4XDZA 1EQ2A 3VVCA 4YXFA 1C14A 1LDYA 3FNGA 4UVDA 3HQ4O 3PJEA 1YKFA 4E2ZA 4EITA 5KIAA 2J3HA 4CM9D 4IQ0A 1VJ1A 4YJGA 5JBIA 5CAEA 4B4UA 2P5YA 2ZTUA 4EW6A 1E1NA 3DMTC 2X4GA 1FDUA 2AXQA 3IS3A 3PJGA 4R5MA 3TZKA 1Y81A 2HMWA 4ALMA 3BHMA 4L4XA 3PZRA 1WDMA 2CDCA 3LK7A 2EWMA 3DFUA 2EGGA 4ZVVA 3W6ZA 3VTZA 2AG8A 1IY8A 2TMDA 1WDKA 1QXSA 4CUZA 3G79A 4GX5A 5FI3A 1IHYA 3HFGA 2DUWA 3U3XA 1Q7CA 5COBA 4CMAA 5IG2A 1GUYA 5U1PA 3UCXA 3AU8A 1PJQA 3OECA 5TJ9A 4OHUA 4UREA 3IAHA 3D5QA 2GERA 4XR4A 5JO0A 2OORA 4WGGA 5BT9A 4RCVA 3ZH2A 4IINA 1I5RA 2O2YA 1PIWA 1VL0A 3H7AA 1Z7EA 4CR7A 5FFFA 1KBZA 5CG2A 3ZU2A 3UHAA 3ZWWA 5KWEA 2PLAA 3OQ6A 3T4EA 1HXHA 2BFMA 2GYYA 4XRGA 2Y0DA 4BV8A 1KEVA 3KBOA 3JYQA 2V6MA 4FGSA 5JCJA 1EUCA 2CMDA 1P44A 3NJ4A 4TRRA 1I8TA 2VOJA 4BQPA 4XQGA 3ETDA 2OFPA 5JDCC 3GQVA 5L4SA 2YQ5A 1ULSA 1B15A 5L7YA 3WFJA 4LCJA 4KQWA 4L4SA 4AICA 1T26A 3WYCA 4TRMA 1XEAA 5KJCA 3GR6A 5ENDA 1CJCA 1DRWA 2HMUA 2JL1A 2NVBA 5EQDA 5A03A 1B14A 2Y0CA 2JHFA 3I9OA 4BO6A 4BNIA 5JC8A 4NDNE 1A4UA 4OAQA 1P1IA 4E5NA 2VWGA 4P38A 4Q3EA 3I9JA 3V1YA 3ENNA 5I9LA 4XYGA 1NPYA 4PLPA 3RASA 1E3WA 1EEHA 5L40A 4TMFA 4MVJE 5DCWA 3ONEA 1P9LA 3DBVO 4DC1A 4DXHA 5A06A 2FZEA 4R5HA 3RBZA 3BMCA 2CUKA 4PCVA 3WGQA 1DIGA 2YFHA 1PGJA 2B4QA 3VZPA 5G2OA 4EJ0A 3JQ7B 5DBIA 1UAYA 4IXWA 3I4CA 4ZRNA 2F1KA 3TOXA 3D1LA 1NFFA 3TN7A 1D3AA 2Q2WA 1L1FA 5EERA 1KEWA 1HT0A 5A1TA 1C1XA 4CMIA 4D45A 2JCXA 3IL2A 1ZO8A 3HE3A 4IGFA 1IULA 3JTMA 1ID1A 3L9XA 5BNTA 2QX7A 3D3WB 3MJCA 1YO6A 5THQA 1EVJA 4PGFA 1NPTO 4WLUA 5DNAA 1KVSA 3KUXA 1EDZA 1H93A 3U09A 3WGIA 4CMJA 4D3FA 5C7OO 4K9DA 4JP3A 1ONNA 3WDSA 1SZJG 4OQYA 3WGHA 4I9NA 4MVJF 1NXQA 1H9AA 2E4AA 4XQ9A 1ADFA 1FMCA 3VDQA 3ZNPA 2G1UA 2WWRA 1JKFA 4OSPA 2PZKA 2Q46A 3K8ZA 4FFPA 1XLTA 3S2FA 3TL2A 4DPLA 4YEDA 1ZMTA 4DBZA 1ULUA 1Q0LA 1YGYA 1DFGA 5IZ4A 5T8KC 3PQEA 1I2CA 3Q9NA 3CKYA 3MTGA 2Y99A 4AG3A 2DTEA 4BMVA 1WPQA 1NX6A 2D59A 1I36A 1LXCA 1DJNA 2IODA 1J49A 2JHGA 3S8MA 2QRJA 3OETA 2CY0A 3CE6A 4BGIA 3PHHA 2RHRA 1E3IA 2GCGA 1G0NA 2NM0A 3W8EA 2NV6A 4CL3A 2VQ3A 5F5LA 4GVXA 1WWKA 3TWOA 4EYEA 2H6EA 4W82A 4WCFA 3MWEB 4Q3DA 1HYGA 2EV9A 1I32A 1B26A 4CV2A 4FIZA 3RBVA 1UH5A 4E2WA 3JQCA 3WYBA 1QV6A 3MWDB 3GRPA 1QV7A 4O59O 1R4MB 1RM0A 2AHRA 3D5TA 3LF1A 1GU7A 3GK3A 3RROA 4KP7A 1VRWA 3K2BA 1M67A 1X14A 3K96A 1LDMA 4B79A 2ZCUA 1LLQA 4HFMA 4J0EA 1YVEI 4NBVA 4L9RA 4NR0A 3GN2A 3HB4X 3RFTA 4IZHA 4CL8A 1QYDA 1T2DA 2OBYA 2EW8A 1PWXA 3I83A 3JQAB 4DRYA 1QORA 3C24A 5CP8A 1O8CA 2XF8A 4GWGA 1LLDA 1U5CA 1EBUA 1JA9A 5HS6A 3RSHA 4NNJA 1N9GB 5F5NA 3L4BA 1FDWA 3ETEA 1E7QA 4LRSB 3QVWA 2OO5A 2UVDA 3OA2A 4ZHSA 3KEOA 4BVAA 2VHVA 3GA0A 1PGPA 3GVIA 4GAEA 4B3JA 5TS3A 3VC7A 5ITWA 1PS9A 4DIOA 4XDYA 4UUOA 4CM6A 1IOLA 4E21A 4J4HA 1LRLA 5A05A 4QXMA 4OOFA 3WIDA 4CV1A 3R1IA 1PJ4A 1HRDA 1SPXA 3CUKA 4GL4A 3UVEA 3VPGA 4KDFA 1N7GA 4ID9A 2ZB3A 3ZW9A 3AI3A 3QWFA 4JP2A 1V6AA 1YB5A 3GNQA 3OIDA 3RUAA 1YL7A 3CPSA 5AXCA 1O94A 4FFNA 3OQ1A 2PR2A 4YAEA 4TVOA 1ISGA 1U2GA 2NADA 2IDZA 2IXAA 3D4PA 4CMEC 4HFRA 3PYXA 1V3VA 4IJWA 3WWZA 1R6DA 3S2GA 1E92A 3ANMA 4CLRB 2O2SA 3GY0A 1MB4A 1E6WA 2Q45A 3ZHBA 3HDYA 3ZCXA 3PTZA 3ROQA 1DIRA 3PDUA 1P3DA 1QRRA 2O7SA 4E12A 1MX3A 1OZAA 4GH5A 2DBRA 3SEFA 4QO7A 4TKMA 1NQTA 3JYOA 5TJHA 1DFIA 3CSDA 5L4NA 1PZEA 3D4OA 3G1UA 3PPIA 1WP4A 5ITVA 4J1TA 4NFSA 5FYDA 1U3VA 3DMTA 1A5ZA 2DM6A 1PGQA 5KNLA 3H2ZA 2VYVD 2GR9A 2PD4A 1A9ZA 4URFA 4BKRA 2WMDA 3ZWOA 4JJGA 5G0WA 1YE3A 5DZSA 2ZYDA 1PR9A 2Y93A 1E1KA 4XQCA 2HRZA 1KEPA 1BMDA 2D5AA 1EVIA 3ITKA 4HNHA 2EKQA 3PRJA 1L7DA 3KTDA 4CQMB 4RV9A 3V1UA 5AXAA 1O9BA 3FI9A 3B70A 2EP7A 2OUIA 1W6UA 4FSHA 2J5QA 4GBJA 4RF3A 4R1UA 5TC4A 2ZQZA 3IUSA 4J7UA 4FJ1A 3RI3A 2DAPA 2FMUA 4FS3A 1ZK2A 4U6SA 1EUDA 4D79A 3LT1A 1I3MA 3H9QA 1SEVA 2B0JA 2X5JO 3W6UA 3ADPA 4XB2A 8ADHA 1NAIA 1PQPA 5B37A 2LDXA 1H6AA 3BA1A 1PTJA 2JFFA 4DMLA 5MDHA 1ZBQA 2NWQA 1EUZA 3PGJA 4YRBA 5KJ6A 2C59A 2ZKLA 2VT2A 1U7TA 3B1KA 5JDCA 4B3HA 1I33A 3KEQA 1W4ZA 1V8BA 2DTXA 1PJBA 3DZGA 1M66A 2YHIB 3VKVA 4ZQHA 1CQIA 2GO1A 2C2XA 2AG5A 1HKUA 4RDHA 4D7AA 1DRUA 2BKAA 3OJOA 4RVUA 4TVBA 4BNFA 4AJPA 1EFLA 1R66A 2ZTVA 3O8QB 4WLFA 1NQ5A 3JQEA 3ROKA 4FB5A 3A06A 4RLHA 5A04A 1XU9A 1GY8A 1K3TA 3WQQA 1WW8A 3JQFC 3BMOB 5BR7A 1UJMA 3DFZA 3I9LA 3KSZO 4XQEA 5DT9A 3WMXA 3ZN2A 2FY8A 4TRNA 1H94A 3JQ8B 2YDXA 1Y8RA 4FCCA 4HX5A 3GAFA 1YB4A 3UFXA 2JD0A 1R0LA 4BNKA 2JKVA 3FNEA 2PFGA 3JQ6A 4RVFA 3K30A 4OKIA 3AK4A 1DPGA 3KXDA 3E5MA 2IYPA 5EQFA 4GKBA 5JYEA 3MJVA 5B1YA 3OSUA 3HZZA 1QYWA 3IKTA 1HLPA 4B4OA 2J3IA 3TL3A 5JSFA 4KUHA 3CH6A 3JYPA 5IDQA 3RU7A 1V3UA 3FD8A 4J1NA 4MDHA 4PLTA 3WG9A 2X6TA 2B36A 4ONEA 3CEAA 3QWBA 1R4NB 5A3VA 4II2A 4FJ2A 1PGNA 2YQ4A 4KTVE 2FHSA 3GFBA 2GZ3A 2RIRA 4OSOA 5T57A 4D0RA 3G17A 4MIOA 3H9JA 4ZQEA 4CLOA 2HRBA 3WLEA 2DBVO 1GADO 5A5EA 4XGIA 1X7HA 1LBEA 1RYEA 3TDKA 1TB4A 4GWKA 2YJZA 5FWNA 4LSMA 5KVSA 5TIIA 2NSDA 1C3VA 3DC2A 4ZD6A 3W4IA 3ZDFA 1RKXA 5EMHA 1RM5A 2H1SA 4J90A 5T8KA 3NYWA 4FFRA 4BKPA 1NVMB 4J43A 2E48A 1BXGA 3LC7O 5AOVA 2J6IA 4C7KA 1O0SA 4PRLA 4HUJA 1H9BA 1HDCA 4YQYA 5A9SA 1ZUD1 3M1LA 3MJ4A 4EEXA 2AE1A 4IXTA 4MINA 1E1MA 4GX0A 3GMDA 3PYLA 3UOGA 1GFSA 1WLYA 4L75A 2VTDA 3BTUA 2ZIZA 1YB1A 2QRLA 1ZZEA 1U1IA 5DP2A 3PIDA 1MC5A 2DC1A 4PLZA 5L7TA 1YQDA 2B4RO 3H8VA 3AI2A 3IUPA 3QWAA 4PRKA 4DLAA 4CLXA 3TNLA 1LA2A 3RKUA 4AJ2A 1Z7BA 3LQFA 1YRLA 3E03A 4Z9XA 3FNHA 4BNNA 4CQLB 5TLSA 2X5KO 3HHPA 4NJMA 2AQKA 4HY3A 3DL2A 3FBGA 4JJIA 4CM5A 2I66A 4DYDA 4NG5A 3PHLA 1PJTA 3RUFA 3ZV5A 3ICPA 2O50A 3EY4A 2PKQO 5A02A 4NBTA 1VSVA 3DBHB 1BSVA 4BKUA 2XAAA 1DHTA 3AY3A 4WOKA 1RPNA 1NAHA 1TT5B 3U62A 5ER6A 1ONPA 2OHXA 5C7IO 2R2GA 5I8ZA 2FOIA 3AUSA 5MGBA 1LLCA 4OL9A 4MVJD 1DAOA 2TMGA 4L4RA 4IBOA 3TSCA 2G5CA 2B37A 4FQ8A 4BV9A 3SC4A 1PX0A 3IIEA 4BB6A 1SCUA 1RJWA 4GMGA 1ZJYA 1SC6A 4J7CA 1YJ8A 3DAPA 1D1TA 5CDTA 4GLLA 1OC2A 4J0FA 1DC6A 3BMNA 2P4QA 3CIFA 3I4FA 3JV7A 3NKLA 3U49A 2JFHA 1F0YA 3MTJA 2O4CA 3I1JA 1C0PA 2I99A 2R00C 4YJFB 3SXPA 1ENZA 4NPCA 4D3SA 3WQSB 1H6BA 3F47A 1EFKA 1HDRA 2DFDA 3PEFA 3RJ9A 1GQ2A 3SVTA 1ONOA 2BF7A 2ZQYA 3WJAA 2HMTA 5JNLA 3U5TA 4NFYA 5KVCA 1JKJA 2NVWA 2Y1GA 3JQBC 4JROA 3RFXA 4J91A 4BB5A 1GPJA 3FR8A 1I3LA 4CMEA 4WASA 1DXYA 1ZXLA 1TT7A 4R16A 3WWYA 5F1OA 4O1MA 2WDZA 1ZH8A 4FC6A 1GPDG 3E8XA 1ISFA 1UZNA 4BL5A 4ND1A 4GKVA 4S3MA 3GEGA 3PP8A 1LSUA 1P74A 1CDOA 2NU6A 4R68A 3HADA 1Z73A 3EK2A 1UXGA 3OIFA 3IMFA 5L7WA 4MKRA 2EXXA 4WUVA 5COAA 3EGOA 3WJ7A 4BOYA 4J9UE 4ALJA 3JD3A 5LDGA 3GDFA 2B5WA 4XRRA 1Q7BA 1MFZA 4L0QA 4WPGA 2PY6A 5JDIA 4Y9DA 1LJ8A 3P2YA 1E77A 2XXBA 3C7AA 1G1AA 4BO1A 3GVXA 5IN4A 1SO8A 4Q39A 2RBEA 2Y0EA 2X9VA 1E1LA 4Z3DA 1K6XA 3HDHA 4BNGA 5JCJD 1Z45A 3DHEA 2AQIA 3F1KA 3KHUA 1PZGA 2VT3A 2X7HA 4MVJA 4WLEA 1QYVA 5CPBA 4YR9A 5BNFA 3F3SA 1M6HA 1KVTA 5C37A 1ISMA 2YY7A 2EEZA 2Y1FA 3VH2A 1J0XO 4ITUA 4BO8A 3ICCA 4K1LA 4BGVA 4U8GA 3BAZA 4II3A 1V3TA 4BNWA 3FTPA 4CMHA 1DIAA 2HSDA 4ND2A 1LDBA 2DVMA 4YB8A 4CLEA 2CVOA 3QJ5A 1U2DA 2WSBA 4IDAA 5B4VA 1T2EA 4IPTA 1HSZA 1MFPA 1SOVA 1EZ4A 2C82A 2GNAA 1T4DA 2AQ8A 3WGTA 1YONA 3EMKA 5AYVA 3HUDA 2X0JA 3T7CA 4KQXA 4PLGA 5G4LA 4BKQA 4U5QA 3W8FA 3GEMA 2ZYGA 1ISIA 2Q4EA 3HN7A 3G0OA 1O89A 4GMFA 4CM1A 3MCVA 2JD1A 4FD3A 3JQ9A 1W0CA 1PJCA 3GEDA 2X23A 4G65A 3EVTA 1H0KA 4JLWA 3GVPA 3UH1A 4XYMA 2GASA 4E5KA 3OQBA 2IEBA 3NGXA 4YAIA 5TX7A 1E5QA 1NVGA 3GC6A 1JAXA 1GZ6A 5THKA 4H16A 2YDYA 4H3VA 2FSVA 1OI7A 4BNZA 4DLLA 4JXKA 3VZSA 1DSSG 1QKIA 5KVVA 1GV1A 4LSWA 5TT1A 3SLKA 2X22A 1C0IA 3PHIA 3HNPA 4TZKA 4FOSA 3I6IA 2PK3A 3JQFA 4PLHA 3Q2IA 2WTBA 3PLRA 3KYCA 3FHLA 1D4FA 2VRCA 3WICA 1K89A 4Y67A 2A4KA 4FN4A 5COQA 3DOOA 2Z1NA 4I8XA 4CUJA 3I5MA 1MXFA 4BO0A 1E7RA 4YACA 2JAPA 3P7MA 4X54A 3RVDA 2I3GA 3TZCA 1AGNA 3QVOA 1DJQA 1YOVB 4JCOA 2BFOA 5JO9A 4HFNA 3ZWMA 2QYTA 1U7HA 3JQ7A 2CF6A 2A9FA 4WLNA 3QVXA 7MDHA 9LDTA 4IDGA 4EBFA 2PD3A 4O63O 3JCZA 3PIIA 4I9UA 4B4VA 2JCYA 4DPKA 2EKPA 3FPLA 3VH1A 5TSDA 2IRWA 3IP1A 3RAJA 2D3TA 1ZW1A 3DZFA 4LRTB 4WK6A 5GZ1A 3E48A 3JD2A 4BHTA 3TJRA 2O3TA 1DBVO 3D3WA 1ZSNA 2P5UA 2Q4BA 2PKRA 1CRWG 2UV8A 2H5LA 4M89A 2E49A 3IC5A 4AL4A 1FF9A 2DFVA 3GVHA 5CEFA 4MIEA 1HDOA 2Y1DA 1T1RA 1GEEA 5JAQA 2P68A 4NQZA 3ORFA 3OEYA 5ILGA 4AJKA 2IE0A 4WJZA 1E3SA 1Y5MA 3NUGA 2NVUB 5IZCC 1T4BA 4L8VA 1AXEA 4G81A 3V8BA 3F6YA 4IDCA 1XWFA 3LLVA 4KDEA 1B3RA 4OGWA 4W7HA 1OMOA 4BGEA 1PSDA 1A71A 1YBVA 3QWIA 4S1VA 3NX4A 1A7AA 5EPOA 5HBRA 4A27A 4ZQFA 3UF0A 3AUUA 4J9VA 2SCUA 1EQUA 2V6BA 5JW6A 5DCUA 2EERA 3RD5A 3QRWA 4E2XA 1MLDA 3MEQA 5KOIA 1SB9A 3BMCB 4YYZA 4G5HA 2NTNA 2XXJA 3BZUA 2V6GA 4IMPA 3GG2A 1Q1NA 4PG5A 3AM5A 4E5PA 4DMMA 4BO5A 1F8FA 1NBOA 3OEWA 4CM7A 1NQAO 3C1OA 4J6FA 1GZ3A 3DONA 3U4DA 3KV3O 2ILTA 2RAFA 3F5SA 4PLYA 3VH4A 4R01A 5A4DA 3ZU3A 4BNUA 4H15A 3F4LA 1BRMA 4WNIA 4F46A 4PFJA 5CPFA 4RPLA 4D42A 5IXSA 4D0SA 1JW9B 1F17A 4R1TA 3UCFA 1TA4A 3W8DA 4EZBA 1B0AA 1I30A 4AVYA 1GYPA 1E6UA 3Q2KA 4Z0HO 4B7CA 3JQAA 1ZNQO 3GN1A 3L77A 3RBXA 1PQWA 4Z0PA 3NJ8A 2GUGA 2Q2QA 3H2SA 1N9GA 4XGKA 4ZRMA 2B4TO 2BFPA 2NQTA 4D43A 1PQUA 2O3UA 2UAGA 4NK5A 1IB6A 1VKOA 1PEDA 1NFQA 2NTVA 1XKQA 3ZWNA 1UP6A 5FI5A 5JS6A 3OIGA 2PZLA 1E5LA 1LX6A 3QA9A 3Q3CA 2Q1TA 1YBAA 4RPJA 2R00A 1LDGA 2JCVA 2Q1SA 1Z6ZA 3AU9A 3ONFA 3PHJA 4HFJA 3PWKA 4HWKA 5DBFA 3WYEA 1XQ1A 2FRDA 3GZNA 2D2IA 4F3YA 2YUTA 3GH3A 3LVFO 3NGLA 1CEQA 2YZ7A 5L95A 4WCFB 3JQBA 2HKIA 3B1FA 4UEOA 5HM8A 2CZCA 3UKOA 4DQUA 1EVZA 1JQBA 4ZA2A 4RVDA 2O3JA 3WR5A 4UEKA 5CDGA 4UVEA 3H3FA 4M49A 4JBHA 2BD0A 4BMSA 7ADHA 3L6OO 1MC4A 2FPIA 4HBGA 2H9IA 3M2PA 4XYLA 5CDSA 1OBFO 5I8WA 5ICSA 2BMAA 3VKUA 2V6FA 5KCZA 1P1RA 3FWNA 1I2BA 1BW9B 4FFOA 5TF4A 2WE8A 2ZB8A 3L6EA 2NU8A 4IZIA 1P1HA 5H82A 4E2YA 4D46A 2FN7A 3Q0EA 4OO3A 2NTJA 3PFWO 1YWGO 4DIFA 1TXGA 3QY9A 1E7MA 5IF3A 4BO4A 1XG5A 1NR1A 3ZV6A 2DBQA 1U28A 1XDWA 4TROA 5IDWA 3WGYA 3KRTA 5JMWA 1JKIA 4Y6RA 1F06A 5TT0A 3I9NA 3TFQA 4DTIA 3D3EA 5K1SA 3WGOA 3CZMA 2PGJA 3H4VA 2FR0A 1KEUA 2VTEA 3RC1A 3OHSX 3COSA 1J4AA 4PG8A 1DLIA 3IP3A 1GV0A 2GRAA 4ROSA 2DU8A 3WTCA 2D8AA 5KKAA 3E9QA 2O3QA 1JVBA 4CMGA 1XHLA 5H83A 4RPKA 1Y8QB 4O5OA 3OA0A 4CQMA 1CERA 2Q50A 3VOSA 4CODB 4I5GA 2Q2VA 2QZ9A 3MJTA 2IZ0A 1ZXBA 4LMRA 1T1SA 3E82A 3IDSA 5B4UA 1HE4A 5JCXA 5EESA 4CR6A 1LQTA 3RUIA 4RF5A 1XA0A 4J2OA 4MKZA 1UXJA 1RM4A 3GLQA 4HXYA 4R3NA 3ST7A 4QFDA 4FR5A 4BNYA 1R0KA 3DEYX 3P5SA 4QTZA 1N8KA 4ZICA 4PLVA 4YTEA 4CM4B 3X2FA 4EI2A 1CIVA 3EC7A 3KLPX 1C0KA 1W8DA 2DUUA 1GUFA 3PJFA 2O4UX 3AM3A 3KYDA 5GY7A 5T6BA 3S1LA 5BSGA 2E82A 2J8ZA 5CFZA 5JXWA 4RPHA 2ET6A 3WMWA 1QYXA 5DOVA 3EVNA 4DQVA 2AMFA 1KYQA 3JYNA 1ZFNA 3QIVA 3HDQA 2FWMX 4WEOA 5CHEA 4CMIB 1PZFA 1SAYA 1UXIA 2VWHA 2WYUA 2WD7B 3HFSA 1E3EA 3F46A 4R1NA 1LC3A 2QZZA 4QSMA 3WIEA 4Z3KA 1KERA 2XOXA 5CDUA 1MUUA 4I5DA 1EBFA 2B35A 2I5PO 3OP4A 3BMOA 2B69A 4QQRA 5EN4A 3GT0A 3OJLA 3GG9A 2G82A 3LZ6A 3JQ8A 3OJ0A 1IZ0A 5LCXA 3WFIA 3DDNA 4AJNA 1NYTA 2Z1MA 3GZ4A 4K6FA 1XYGA 2BGLA 1ZCJA 4Y98A 3EUWA 3F5QA 4RGBA 1HTBA 3DZKA 1UDAA 2Q49A 2PH3A 4BNLA 1PJ3A 5G0VA 5GZ6A 1PGOA 2W2KB 4Q3BA 4DBVO 1VI2A 1EK5A 4DC0A 1HDXA 4ILKA 4DPMA 3WS7A 1X7DA 3GAZA 3WSVA 2EP5A 4KWHA 5H81A 1LSSA 1X0XA 4K26A 1HLDA 1K2WA 1KOLA 4M8SA 5AXBA 4EDFA 4I1IA 4D41A 1ZMOA 4NBUA 5EINA 4B4WA 1R4NA 2YV2A 3I9MA 4J1QA 3WBBA 3CMMA 2GLXA 1ZVMA 1NASA 4J4TA 5FF9A 3DMYA 3KSDO 3D64A 3O9ZA 4IMRA 4RF2A 2VOEA 5JMPA 3WX0A 5B12A 3WTBA 4R3WA 5DDIP 1HE3A 2OP0A 1I01A 4YJHA 2CDAA 2JD2A 4B8WA 3BIOA 2WYVA 1IPEA 3ABIA 3DHYA 4O0LA 3RUHA 3GPDG 1HE5A 1Q7GA 2IEDA 1X15A 1ENPA 4OM8A 1U5AA 5IZCA 4NIMA 4RJTA 4QX6A 4QO8A 1J6UA 4WNCA 3NTQA 2VUSA 4LN1A 1HDZA 4Q3CA 1GD1O 4GI2A 3EHEA 2W8ZA 4N7RA 2PWZA 2VZ9A 1K6JA 1Z75A 3ZGYA 5LC1A 4Y6SA 3INGA 3PDJA 1NPDA 1VL8A 4CLHA 3DZJA 4MVJP 2AEMA 2BLLA 4KWIA 3HSKA 4UAGA 4ALIA 1KIFA 4HV4A 1Y8RB 1Y9EA 3SJUA 5DN9A 1SOWA 3AFNA 4AJEA 3MJSA 2VUUA 1GQYA 5LDHA 4QFCA 1OAAA 3PXXA 4IDEA 3GUYA 3GF4A 4YQZA 1HYHA 3RC9A 3UGKA 5I7EA 3FWZA 1CQJA 2D5CA 2HJRA 1A4IA 2CF5A 1DEHA 2QG4A 4UVGA 2ZYAA 2EW2A 1IPFA 1ARZA 1P0CA 3MOIA 2CVQA 2YYYA 1PR3A 3S2EA 4CQLA 1P45A 5B4TA 3A14A 3OFSA 4XJTA 3VHRA 4F45A 5CG1A 4U0KA 3QW2A 2EF1A 4D3DA 1V9LA 2ZTMA 3LT4A 1LU9A 3R3SA 2UDPA 3JSAA 1IUKA 3KB6A 1IL0A 3PI7A 3QLJA 5F1PA 5J23A 4CM8A 4U7WA 1EDOA 1MG0A 3MZ0A 3QSGA 4GLOA 1DOHA 2EKLA 5A9TA 4NMHA 3LC2O 3U4CA 3ROMA 5K9ZA 3PFFA 4CLOB 1FDVA 3U9LA 3WGGA 4YAGA 2WD8A 3ZWYA 3VPFA 2AE2A 2BFAA 3ULKA 1DHRA 4J1SA 4A2CA 3NEPX 2FR8A 2X5OA 3OF2A 1U8XX 2E6UX 4E3ZA 3F1LA 1DC3A 4R9RA 3ZU5A 5G4KA 4A0SA 3F9IA 5I7VA 1P33A 3OM9A 2G0TA 2W98A 1Q0QA 4KUGA 5BSFA 5GZ3A 5HRUA 3ASVA 4PLFA 4PZCA 2CVZA 4A7PA 6ADHA 2DQ4A 1JLLA 2YV3A 3L0DA 5AXDA 3QWHA 4AJIA 2CD9A 4G2NA 1NHWA 3GRKA 1EVYA 3JQGA 1ZEJA 3AWDA 3DBRB 3H9UA 5KKCA 1X1EA 1E3LA 2AEFA 2POQX 2ZTLA 4AJOA 2NACA 2RCYA 4Z9YA 4YJFA 3PHGA 1SBYA 8LDHA 2PGDA 3GGOA 4FFLA 5L53A 3KYBA 3A28A 4E33A 4IM7A 3IJPA 4MVJH 2IZZA 4ND4A 4P22A 3H5AA 1UUFA 2BGMA 3T7EA 2O3RA 3K6JA 1UR5A 5K0ZA 5K6AC 5HA5A 5F1KA 1DFHA 2Y1EA 3DBLB 1PS8A 3CINA 5ICMA 5JAMA 2PTGA 4MPDA 1N1GA 1NM5A 2GN6A 3EAGA 1B2LA 3L9WA 4RO0A 1I3KA 2Q99A 1F14A 3E9NA 3B6ZA 3QHAA 4OIMA 4AJHA 4HP8A 3WLFA 3ZWPA 1UP7A 3DTTA 1AXGA 2W2LA 2UUOA 4KZPA 2C54A 3GGPA 2X86A 4WOJA 1N92A 2DTDA 4OXNA 1VL6A 1BTOA 1YQGA 3KZVA 2OXIA 4BNJA 1DDOA 1CF2O 4H7PA 3PZBA 3TOZA 3M2TA 1UAGA 1E7WA 4YAKA 1YL6A 1Y5RA 3NDIA 3OH8A 2RHCA 4R69A 3R0IA 4N54A 3L4BC 4ND3A 3KO8A 1T25A 3S2IA 1YJQA 3VPSA 4GPD1 1U8FO 3DHNA 4E6PA 1KY4A 4JX8A 1AHIA 3ONDA 2XPCA 3BMNB 3KM0A 3ON5A 3T4XA 4OXYA 4PZDA 1LEHA 5DULA 1DRVA 4XGNA 4JNKA 2WJPA 2O23A 2X0IA 3EYWA 2I3AA 5DP1A 1O6ZA 4A03A 1P31A 5C7LO 1UZMA 2VRCD 2R6JA 3M1AA 4I5EA 3RUCA 4CV3A 3FBTA 1KC1A 1FDTA 5HTOA 4N5NA 3E1KA 3GMSA 3ETGA 3RIHA 5JLAA 3KSUA 5JAZA 5JC1A 2C7VA 3INTA 2OMEA 1ORRA 3DAFA 1L7EA 1U3TA 3WNQA 3HB5X 3GHYA 1GDHA 1YS4A 3PVZA 2Z5LA 4MOWA 5CEEA 1E0DA 2X9GA 3ZZNA 3BMQB 1K5HA 1RM3A 2HK8A 4YRAA 4TQGA 3PJDA 2GGSA 3AOEC 2IXBA 1BG6A 3LU1A 3OICA 2C2YA 3H5NA 2J5RA 5IDXA 1H2HA 4JQCA 1U3UA 3R3JA 2QRKA 4PG6A 3TQHA 2GZ1A 1HDGO 1AUPA 3IOYA 1WDLA 4W7IA 2PH5A 2B83A 4PG4A 1QG6A 4XWYA 3B1JA 3L6DA 4FOOA 3ZWBA 1LSJA 2O48X 2VN8A 3NT5A 2PD6A 1R0SA 1LTHR 2RH4A 4ZQGA 4QECA 5EIOA 1R12A 2FZWA 4Z0TA 1KVQA 4IGEA 1C1DB 3ANNA 1EE2A 1TI7A 4AJ4A 1CYDA 3GUCA 5A5FA 1KVUA 2PZJA 1UDCA 3H3JA 3N58A 2NU9A 1FK8A 2BI8A 2GD1O 2P91A 3WOHA 3I52A 4J49A 1NWHA 1YOVA 4YJGB 1NNUA 4OJNA 4YDRA 4NU5A 3JQDA 1WVGA 1OC4A 3DWFA 4B8ZA 4FGWA 4IJVA 2G76A 3AW9A 5HWSA 4MO2A 1MXHA 2GPTA 2EGHA 3ENKA 2WM3A 1ZEMA 2CDBA 2I76A 1GTMA 3DZBA 3PWZA 4INAA 3DO5A 4TKLA 5T67A 5KTKA 5C3MA 2P4HX 4CUKA 1O95A 2UYYA 4C4OA 4A5OA 4GGPA 3C85A 3DQPA 4Y6PA 5TQVA 3CTMA 1XIVA 1N5DA 4L73A 1E3JA 4CMKA 3LF2A 1VSUA 2FR1A 1OOEA 1ZSVA 4OOEA 4FJ0A 3VZRA 4M1QA 3V2GA 2C20A 3RCBA 1B8VA 2VCYA 2H63A 3STHA 4BS9A 2NUAA 2P9GA 1NP3A 4I08A 3FR7A 1A7KA 2VYNA 1QYCA 2CFCA 1FJHA 5IDYA 3CZRA 3ZHXA 1GCOA 1KC3A 2B5VA 3VDRA 3ZV3A 2HJSA 1TLTA 4ESOA 1VJTA 4GVLA 1CWUA 2NVUA 3FF4A 1GYRA 1YH3A 3FNFA 2P9EA 4N5LA 1BDBA 3BXXA 2D4AA 3JQAD 1HF3A 4DA9A 4NBRA 1HDYA 4DWVA 3KYCB 4CM9A 4P4LA 1UXHA 1WNTA 4OMUA 1JDJA 2V65A 1OFGA 2DKNA 3HG7A 3ZW8A 4EJMA 3SX2A 5G0TA 4IDDA 1LRKA 3INRA 5DBGA 1PWZA 4XKJA 5C5IA 2PA3A 4GSLA 3ZNNA 3AY7A 3UUWA 1PJ2A 4N18A 3K9QO 4TSKA 3KOUA 4Z9FA 4YCAA 4LMPA 3LT0A 1TVEA 2JFGA 4BUCA 3AY6A 3ITDA 2J3KA 2PKQP 4PVCA 5JY6A 4E30A 5ER9A 1VC2A 2GN9A 3RJ5A 1R15A 1B7GO 3GFGA 2X0NA 3SJ7A 1HWYA 2VRBA 4TWRA 1DIHA 2VHZA 2YHUA 3DAGA 2GN8A 3DXFA 4OXKA 3ZWXA 1E3WB 4BMNA 3CMCO 4IJUA 2J3JA 4EUFA 1FDSA 1P1JA 3H9EO 2HK9A 4M54A 4PZEA 5L3ZA 4WCDA 3VTFA 1YQXA 5BQFA 5L4LA 1JU9A 1YXMA 3EW7A 4DL9A 2ZB7A 3FN4A 1QLHA 1HSOA 2DT5A 4U0JA 2OOSA 4M86A 4Q9NA 2AA3A 1GQQA 3WQRA 2P2SA 4YBZA 1X13A 5ILOA 2NLOA 2UUPA 1C1XB 4AJLA 1ZK0A 3LLSA 3V2UA 1A27A 1LDNA 2PNFA 1R4MA 4XCVA 4OQZA 2IYOA 4OH1A 5DCYA 3GDOA 3E9MA 5F21A 3RQSA 5KJ1A 1LUAA 4BO9A 3BYZA 1MA0A 2Q3EA 1HEUA 2DBZA 3A9WA 1JWAB 1NWCA 3FPCA 3HJAA 4XJSA 4RZHA 4LGVA 4IS2A 4B7UA 2NNLD 5JYDA 5A3JA 5EL0A 3MOGA 1IE3A 4P8RA 4EUHA 1A72A 3ZWVA 2FPGA 3O4RA 3JD0A 3I6QA 4NU6A 2QHXA 2I65A 3TFOA 1HYEA 2NQ8A 3V2HA 1PU2A 3K2EA 9LDBA 3TF5A 5A9RA 3ZV4A 3GDGA 3DZIA 2PZMA 1WMBA 2JJYA 4IQGA 4U6QA 3G1TA 3RC7A 1PS0A 4HNGA 1U4OA 4M87A 4QUKA 5K6AA 2FP4A 3U4HA 4XA8A 3UW3A 5I7FA 1UDBA 1P1FA 4LK3A 4D44A 4FBGA 1ZK1A 4DUPA 3LDHA 3O03A 4RQTA 4DQXA 1WZIA 4F6CA 1BXZA 4P4GA 1SNYA 4CQMD 2HQ1A 1B16A 3PQDA 5TNXA 3C1TA 2VZ0A 3V5NA 5L51A 3WBFA 1BW9A 1IHXA 4NJOA 1GAEO 3FCOA 1T2CA 1ZSYA 3VPHA 1YDEA 1E7SA 3M6IA 5IN5A 3NAQA 4KMSA 3AUTA 5JY1A 1G0OA 3K31A 5KVQA 3QQPA 1F8GA 3LT2A 1AHHA 2QQ5A 1NHGA 3VVBA 1F12A 4N5MA 4NI5A 3RUEA 4JBGA 3PWSA 4MP8A 3WXBA 2EG9A 5JE8A 4LVUA 4W4TA 5FEUA 1M75A 2VNAA 3U4IA 3DZHA 2ZCVA 4DIBA 4EGFA 1I2ZA 3LC1O 2HO5A 1JVSA 3D0OA 3Q9UA 4CLDA 4CLRA 5JFOA 3IJRA 4FDAA 4W6ZA 4E13A 1BVRA 4IY1A 3RFVA 5I9NA 2BI7A 3BTSA 5CEJA 1B8UA 3PYMA 1ADGA 2Q1UA 4RDIA 2BGKA 4YWJA 5JAIA 4XYBA 1K0UA 1WAMA 4IUYA 1B3BA 3QVSA 4W9NC 2RH8A 4RLSA 1WZEA 4I5FA 2BH9A 2C7GA 1ISJA 2WE7A 4P4NA 1P0FA 1P77A 2GF2A 1Y8QA 3GZNB 4K28A 1D1SA 2EJWA 4PN3A 1KETA 4CJXA 2D1YA 1NR7A 4NHEA 4ZJUA 4IDBA 2Y1CA 2VWPA 4ALLA 1LNQA 1XCBA 4RVSA 4BGUA 5KJFA 3E5RA 2I67A 4XR9A 1JWBB 4UVIA 3EDMA 2WYWA 2HK7A 2C07A 2D0IA 4B3IA 3C7CB 4JGBA 3DTYA 1JAYA 3C7DB 3GVCA 3IKVA 4CM4A 1XSEA 2OBNA 3NV9A 1DB3A 1SB8A 3P2OA 4J4BA 4RL6A 1O5IA 4BNTA 4FW8A 3AOEA 3ZHYA 4F6LA 2X9NA 1LRJA 2I9PA 1DLJA 4WKGA 1T2FA 4MJLA 4JBIA 4IIUA 1QR6A 1ZK3A 3C8MA 1ZKMA 1D8AA 4BQRA 3G3EA 1K6IA 3GNSA 4Z6KA 4PIVA 3L4SO 2Y68A 4XIYA 4RVGA 3WB9A 2ZATA 3W4JA 5JDIC 3X2EA 1JN0A 4NFHA 3Q11A 2WD7A 1GZ4A 3K5PA 3VH3A 2GDZA 4CMCA 2A92A 2IZ1A 1V35A 2Y1OA 3AFMA 3DOJA 2C29D 4UUNA 1LI4A 2VNSA 1Y9AA 2NU7A 3FRJA 4AJ1A 2VUTA 1QMGA 4CMBA 3SBOA 3JD4A 3ZHZA 4BNXA 1BHSA 4ALKA 5T5QA 3NDJA 1WXDA 2YHIA 1ZJZA 3TZQA 4YPOA 5GMOA 4BNVA 1PJSA 5L45A 2X8LA 1Z74A 3GPIA 3VZQA 1YL5A 1R16A 1GEGA 5U4QA 1UP4A 2ZB4A 5IXYA 1SMKA 2W2KA 2BELA 2Y66A 3O8QA 2VZ8A 4UEJA 1I24A 1VPDA 3HDJA 4ZQBA 2C0CA 4EJ6A 4KUEA 2YW9A 3UN1A 4OYRA 2J5KA 4NBWA 2A35A 1C0LA 4YT8A 4JJFA 2DLDA 4L76A 4XD2A 3ASUA 4BO2A 3AJRA 3P19A 5BSHA 2YV1A 3AM4A 3DOCA 3GNTA 3WNVA 4E32A 3NT4A 2PV7A 2VHYA 4BO3A 2EJVA 2ZJ0A 2VHXA 2QIOA 3I9KA 5BSEA 3Q6IA 3EZLA 3KYDB 1V0JA 3JQ9C 4JN6B 5F3RA 3ZWAA 2AEJA 1PL7A 4GX1A 3H65A 1ENYA 1R37A 3W4KA 1EMDA 3DB2A 1ZIDA 2O3SA 2C5EA 2OP1A 2GSDA 1MGOA
chains in the Genus database with same CATH superfamily
3KUKA 3MLAA 3RH0A 1S9HA 2HAEA 4B3FX 3CWQA 2XHZA 3P2KA 4KW7A 3AHIA 5AVJA 3U13A 3G9ZA 3NG1A 5DGXA 1PW7A 5EJ7A 2IUYA 3HWRA 3B78A 4AKSA 3F98A 4K0KB 2OL4A 4BYGA 1BDMA 3KPUA 2HMVA 1LW6E 3V8VA 2FN3A 3GFOA 5GVSA 4XCXA 3ROFA 4YCLA 1QP8A 2FQ1A 4BNMA 1JR3D 4E15A 2Y1XA 621PA 2OV6A 1KYIA 1XNHA 2C7OA 3LG2A 2VYVA 1WQ1R 1X7GA 5AO9A 3I5XA 1JIJA 4UKDA 1Z88A 1N36B 1CQIB 3ZU4A 1NVXQ 5DM1A 4NY1A 3B1YA 3WMGA 5HS4A 3BTOA 4QUDA 3NUQA 5EAIA 3IKJA 4MKXA 5FHRA 3PUYA 5LYJB 3FSRA 1IHPA 1NXVA 2HY7A 1W88B 2HF8A 2OBBA 2UUCB 5T64A 1UZLA 1UPBA 2HR1A 4QODA 3T5AA 4ALNA 1P7PA 2BDUA 3L46A 3W1VA 3A36A 3SQNA 3NU1A 3L06A 4YXWD 2FKAA 3CX6A 3JARB 4R54A 1QGYA 1HDIA 1QQTA 1XR3A 2JGDA 2I03A 3D6VA 3BE6A 3K05A 4L7QA 4HTFB 4P3PA 1U9IA 2R6HA 4K9OA 1T1EA 4R2HA 1OPRA 4UXIA 3SBDA 4LHSA 1OX4A 2JAHA 2OCYC 2IYSA 3PUKA 4RFLA 2IYFA 4N41A 4UNRA 1JDUA 4JWTA 4DMUB 4MW0A 5LLTA 1J2RA 5FEMA 4J0GA 1UFKA 4ZT4A 4DMKA 1GL3A 4EARA 1PL6A 1KP9A 4XVQA 3MC1A 1TIKA 3UNXA 2NP7A 1PZHA 4A10A 3T1YB 3QEAZ 2J9FB 4YMWA 1QRDA 4FSDA 2VP6A 5JR3A 3GJZA 1PFVA 5ALPA 5DOZA 1AQJA 1G8HA 4CEHB 2WPDD 1LVHA 1T8SA 3FLMA 1OLXA 2Q1WA 4AM8A 2WFMA 3UYLA 1S2LA 1SKBA 4ZI7A 5GOZA 1BVUA 5LZ4A 2OZPA 4M36A 2VDJA 5K6TA 5E1OA 4F3RA 5CIYA 1H6DA 3AMVA 1SK8A 3OFND 1UM8A 1CY4A 2FG7C 3CHYA 1N2JA 3F3MA 4LZZA 3L8ZA 4HWRA 3WSWA 3ROGA 1M8KA 2Z83A 1QIJA 3D7RA 3SXJA 3K1YA 1PG5A 2CL5A 1WV1A 2DB3A 3GGGA 3KJIA 1WUIS 3T7AA 1CETA 1YRHA 3V8QA 1YR3A 3CRVA 3HA5A 2CEAA 2XE6A 1AH2A 3RJMA 5C1DA 1GGKA 1ECBA 1SIBE 3B20A 2WUWE 3M6FA 4J2HA 3OPYA 4MI1A 2H18A 3H5TA 4CM3A 2ETXA 3AZPA 5IKXA 1WA5A 2BRUA 4PYLA 1T8PA 4QWWA 4O4IF 4Q9DA 2OG1A 3SXUA 4YVFA 4JI0B 2DPHA 3HU2A 4MVJI 1EK6A 1BXGB 3SQLA 1OYOA 3EA4A 1DKPA 2C5AA 1LJUA 3O38A 4M9UA 2WZBA 4UOQA 1CBUA 1PW5A 2FRVA 5A9SB 2PWBA 4UUPA 2QQFA 3QV1A 3DBLA 3TZHA 3Q7QA 4RV5A 3GJSA 5LFAA 1BGVA 4D9CA 1G6KA 1EK0A 3L1JA 4M55A 1U1FA 1B2RA 1DBRA 1NW4A 3QYAA 5KYKA 3BTVA 4F9GA 4O4HA 1S9DA 3CQ9A 2C5BA 3HNOA 1Z0JA 1UMCB 3W5IA 2AWNA 1LBQA 2PCJA 1UMKA 2ATVA 5BV2P 4BO7A 1Z08A 2KX7A 4X61A 2A9PA 3ZPXA 2ZJ6A 1O4VA 3M33A 1TKAA 2GESA 4ODIA 4TV9B 4WCFC 2FGJA 5CM8B 5EZ6B 3JSXA 1KY5A 3KOMA 2Q2NA 3R8CA 3S7TA 4NJMB 3QP9A 4ZU3A 1Y8ZA 1QJ4A 3K0FA 2Y67A 4JA2A 4R9SA 2FOXA 2IITA 4QYMA 4RTMA 3I42A 2HNKA 4HKTA 3CF6R 2O7QA 4J3FA 4RF4A 3TQRA 3K0BA 4UDYX 2BM1A 2WVGA 4CG2A 1MIOA 3V7UA 1WSBA 3ZWCA 1XT6A 4TXMA 1XMSA 3M3DA 2FPPA 3IA7A 3NT2A 4ZMBA 5IYZF 1WCWA 2EFHB 3HP1A 4WECA 4YAJA 1FX1A 1VE9A 2Q5OA 1PO7A 2BI4A 2RAUA 3JQGB 4C7JA 4MDYA 4D02A 2XX3A 3V8EA 1X2BA 1YZUA 3MQFA 4NE2A 1ML3A 4CGYA 5DNCA 5IEJA 5K03A 3MPOA 1I7SB 3E05A 3FNIA 1X38A 1AF7A 4IICA 4N1AA 5KOHA 3PJRA 1N7HA 1I10A 1A9QA 1GGEA 1V71A 2LGJA 3FDFA 4ISBA 3FSGD 3LSYA 4DDKA 2JGAA 1RXEA 4U2FA 1SEPA 2AZDA 5JCPA 5AQ1A 3NDRA 3PRHA 3OFKA 1MORA 2VWQA 5HJEA 4KOAA 2XMGA 2DCUA 3FCCA 4MP6A 4LW8A 1ZCFA 3OIVA 3IESA 2WYOA 4XX0A 1T9KA 2WV7A 2JK0A 1ICEA 4FHDA 2VDOB 1ZOOA 2M32A 2QS9A 3FTNA 4Q4LA 3LHKA 3S55A 5GADl 3B8HA 4KE6A 4N0QA 4JI7B 3LKBA 1U3WA 1ZYUA 3GCGA 4E5YA 3CKMA 3FCUB 2OXRA 4KAAA 3ZI0A 5AH0A 1KO8A 1T2AA 4X8MA 4RTNA 2MMCA 3W79A 1A50B 5HRAA 4BE4A 4TTRA 5EC8A 2OAQ1 1UK9A 2G7MC 3UAWA 1Z8FA 2WQ6A 5DLPA 5EIBD 4EB6B 1O95D 2EHDA 4M9ZA 4YRDA 2HRCA 3K92A 3K0SA 3QVGB 3GRAA 4IKEA 4NZ9A 4YRCA 1TEVA 4P84A 3JPYA 4MIYA 4YONB 1PJLA 5KHOC 1WR8A 1A5BB 4BNHA 3DVLA 1K27A 3L8MA 4FPXA 4RKYA 2VHWA 2Y05A 4GD3Q 1R4AA 1S89A 1ACMA 2QNRA 2ZRBA 3M6VA 2H48A 3AI1A 4U2DA 2VSNA 3DZDA 2CDRA 4UM9D 4CF3A 3D59A 1BEUB 1X1TA 2NU6B 3KVNA 5KDDA 1UM9A 3RU9A 1I3OA 3DE6X 4N76A 2YVAA 1T4MA 1ZD9A 5EIEA 1WETA 2BZSA 4A4DA 3ZD6A 3O8NA 1M2OB 1N2OA 4ZOCA 5HQ3A 1VJ0A 1BJRE 2VBFA 4CDNA 4HDRB 4GICA 5CH5A 4Q01A 1XRMA 1UXKA 1C1DA 3HZRA 4Y2JA 4TKVA 2P40A 3GHHA 4MV6A 5KTKA 3IQGX 5DLEA 2AW5A 5C34B 1L4GA 4J0JA 1EQ2A 1RACA 4I4LA 4EECA 3Q7EA 3FNGA 4UVDA 3ZBPA 3THWA 3PJEA 1YHYA 1V47A 3H6GA 4F71A 2OKGA 2GEKA 4IQ0A 1VJ1A 4CM9D 5JBIA 1L5VA 4LOAA 1E8NA 3SQWA 2A1UA 4TTAA 2ZTUA 2VR1A 2VQFB 1G8KA 1X7XA 2F1HA 3AF1A 3QE0A 3QEKA 5F64A 1RRCA 2AXQA 3PJGA 5ALDA 3K70D 1QFJA 1D09A 4R5MA 4E03A 5INTA 4AWXA 5CA1F 3UPTA 4XWKA 4G0VA 3PZRA 4Z1MD 1XKXA 3I2JA 5BRJA 4TV9F 5KYYA 3PUXA 3D31A 4KQCA 3DFUA 1NURA 4R1OA 4BFLA 2GJSA 4ZVVA 3CLUC 5BWCA 5IASA 2CXPA 1FSZA 1IY8A 1TJ3A 2RI0A 2P6UA 3NHPA 3TNDA 4BASA 3EGWA 1GTZA 1ZOSA 3AHDA 3KQNA 4JH0A 1XX6A 2Z2IA 4G8JA 1E89A 4CUZA 3RTEA 4NESA 5CW2A 5AM2A 2Q0SA 3GLHB 3HFGA 3MPUA 3OVMA 2C7QA 5TQ2B 2M1ZA 3ZDYB 4CMAA 3IR6A 3H86A 5I4IA 2P6NA 4UBJA 5BQXA 3AU8A 1QPBA 1PJQA 3B5EA 3EXAA 1NUPA 3OECA 3ER8A 2QPTA 3OKAA 2WWHA 5DRYA 3CLTD 1Y5LA 3IAHA 4ENPA 5JZSA 1HNXB 2GERA 4XR4A 5IUKC 4A23A 2OUKA 1IJEA 2YWJA 5H9VA 3H4IA 4DNOA 5JO0A 3KJXA 5BT9A 3ZWKA 2NYAA 1K3FA 5MF6A 4KV9A 2F2TA 1Z7EA 1COWD 3D0RA 4LXXA 4AXBA 4CR7A 2CC2A 5CG2A 2IQ5A 3ESZA 1ZU4A 4QIHA 1II0A 1OVGA 3DVAA 4GL2A 4CKXA 1OIWA 2IHUA 4IRXA 3TIFA 2WPNA 2G9RA 3CZCA 4FEEA 1YE8A 2VDWA 1M2NA 2FX2A 1JIXA 1QK5A 2ZSHA 5I8PA 1N8SA 4WY5A 1CY1A 2PMCA 5DWDA 2MWMA 4G63A 4LF7B 1OXMA 4H1VA 4BQPA 2XRZA 3F9CA 4G9EA 2DY0A 7GPBA 1O58A 4M0CA 5JDCC 5JTTA 2AJBA 1N2ZA 2AK3A 2AW3A 3BIJA 1ULSA 1JEAA 4LCJA 3VPBA 1QHNA 2EKBA 4KQWA 4L4SA 3ZHVA 1SIWA 2A8YA 5JZ9A 1KJQA 3WYCA 4MR7A 3SIRA 2RFLA 5BQ5A 1BWRA 1CJCA 2JL1A 3F3KA 5B53A 1KYVA 2ISCA 3LBHA 3I04A 3I9OA 4HH4A 4UMEA 4BQNA 2QROA 1T43A 3BULA 3VPDA 4TTSA 1P1IA 1X19A 2ST1A 2VWGA 1UOEA 4S24A 4RABA 3V1YA 4MV1A 5I9LA 1NPYA 2TS1A 5F5XA 3HCRA 1Y1SA 3LGXA 2WHPB 4MKHA 4JR1A 3TZBA 3DKKA 3U40A 3C3EA 4ZCLA 4LXIA 4OU5A 1LPAB 4DXHA 4R5HA 1B8OA 5A06A 3IQEA 4WJLA 4PO1A 2CUKA 3KLBA 4HDMA 3WGQA 4IKOA 3PFIA 5HJ5A 1L8QA 3GMIA 1ZVQA 3IVMA 5G2OA 2XMQA 5I5EA 3AF4A 2C92A 4IXWA 1VBFA 1NOJA 3I4CA 1NC3A 4ZRNA 1TE2A 1VRCA 1ZVJA 2EWWA 4TTVA 4B81A 4KK3A 5NLLA 5KYXA 4G4IA 3AVXA 2O8FB 5EERA 2RSLA 4F2GA 1HT0A 5FL7D 1C1XA 1Z7WA 5T3YA 4CMIA 3IL2A 4WXRA 3SKYA 1NV9A 1VG0B 5FAKA 1QGUA 4JZKA 1XCLA 3LQQA 5AUPB 1VIAA 4MPRA 4X44A 5BNTA 1RSZA 3W1EA 4V0KA 1NY6A 4BWYA 4LDNA 1VPTA 4JB3A 2ZBRA 4B35A 1H93A 4OREX 4D3FA 1L7XA 2QMZA 1VCIA 4OLHA 4TZ0A 3TQCA 4AW9A 4K9DA 1VLJA 4JP3A 3PF9A 4N3NA 3WDSA 1XV5A 2HCBA 2JNWA 2ES4A 2O2JA 1BE6A 3P0HA 3K35A 1NQXA 4FMDF 5GWXA 2JIDA 4OQYA 4I9NA 4MVJF 3R23A 1NXQA 1H9AA 4QG7A 1T3TA 3NBYC 4CKWB 5EWLB 3CVWA 3MYRA 5A5DA 2H51A 2G1UA 2ZRDA 2J3LA 5F7OA 1Z18A 3TL2A 4FFPA 4KI0A 1XLTA 1YCGA 3S2FA 1Z5PA 2KB0A 3L8YA 5EVCA 3HH8A 3N8DA 1NP6A 2XWQA 2C3YA 2SBTA 1N2IA 4LQCA 4LUCA 2PCLA 1YGYA 5K8IA 4CHGA 5T8KC 1OGYA 3KX2A 2ZJ3A 4YYEA 1RWVA 3CKYA 2FLVA 2Q6LA 3EIWA 3FLAA 3Q9NA 2PZGA 2VLBA 2WWXA 2P7IA 4L5IA 4RXUA 1NZFA 2C99A 3TRHA 3GDHA 5EHNA 4PFKA 2FLWA 2QXUA 3VO8A 1LVUA 2YN0A 2DJ5A 2HA6A 5LL6P 1I14A 3CE6A 4TS3A 4BGIA 1DUIA 1ECCA 3EJ6A 2HJWA 1SBTA 4MS1A 4NULA 4N47A 4OB8A 1E3IA 4JUFA 3WLKX 4YBRA 2RARA 1NYQA 3D5EA 4HNSA 4HN4B 5CXXA 3W8EA 1WWKA 2VJNA 4W82A 1F1BA 3EISA 5K0JA 4Q3DA 2XDQB 1EYZA 1HYGA 3T7SA 1BN7A 5CLLA 2RD2A 4QJ5A 2HI0A 3UXHA 3FIUA 1B26A 4CV2A 4HL6A 4ZAXA 4DR2B 4FIZA 1FMTA 1NIJA 1OT3A 1U0GA 2VPYA 3E1GA 3NHWA 1Z28A 4HQLA 1UBOS 1UH5A 4PAOA 3JQCA 1T1JA 4YIHA 2X3YA 3A1TA 4YRMA 4WOBA 4F84A 1QV7A 5CJ2A 1TJ5A 3B12A 4FTWA 4WZ6A 3EGVA 4ZVQA 4O59O 1E2QA 4DG8A 1JR4A 2PX2A 3LF1A 4EPRA 1PFUA 3NFRA 5AW6A 5BVHA 1X14A 2RC6A 1JEJA 1LDMA 1YR9A 2BHNA 2E3JA 4J0EA 2HDOA 3IKLA 2Q9BA 4S1WA 2V58A 4NR0A 1T35A 3DEZA 3M34A 2UZIR 1O8BA 1QX4A 2RGNA 1S3SA 8ATCA 4FIDA 3UK7A 2V3CC 1UBFA 2XNSA 3D54D 4UZEA 1QYDA 1P80A 4WK2B 2OBYA 3GIWA 4OMFG 3VZDA 2VJAA 5H3LA 1KU0A 2ORED 1IEVA 3JQAB 1UFVA 3FUUA 3P9YA 3C5VA 1F20A 2ASEA 1TU3A 1BKSB 4QOHA 5CP8A 3BSSA 3C98A 1U5CA 1L5SA 2I71A 3D2BA 4L4UA 4HVAA 3RSHA 4QGFA 4C7OB 1FDWA 2QUHA 2M9MA 3EEYA 3O92A 3RVMA 3ETEA 3LHIA 2ID4A 2UVDA 1P7WA 1U0NA 3G1WA 3KEOA 4WFKA 3ZOZA 3P2MA 2NTEA 1NXTA 1Y3FE 2QTLA 1HYQA 3DEHA 3K94A 3OP1A 2FW0A 2QGFA 2LP4Y 4CL2A 2ZE6A 5KQSA 3R3VA 3VC7A 5KBYA 1QHFA 1NVBA 2W2XA 1GHTA 4MUEA 4O1IA 3DFKA 1Q0UA 4UUOA 5AIAA 1IOLA 1YBHA 4W5JA 4EFDA 1A76A 4E70A 4ABTA 1C7JA 4UNQA 2ZSEA 1UQRA 1VE7A 3UXMA 3R1IA 2EFCB 1RABA 3SKVA 1TAQA 1RXWA 2Z5VA 5KWJA 3TZEA 2VLIA 2ZRJA 4LGCA 3MG9A 4KDFA 3WNZA 1S1CA 2VXBA 1J0BA 3T15A 5M04A 4PYMA 1Z6TA 3VVMA 5AKJA 4JP2A 2IXGA 1V6AA 2Y1WA 1YB5A 3GNQA 3RGGA 5I45A 4W63A 1TYEB 5HOQA 3SICE 1G5IA 5AXCA 3CVVA 1O94A 4OHVA 3OQ1A 1MQAA 1NJ8A 1U2GA 5EXXA 4HRXA 1FUUA 4MGKR 2O05A 1ESNA 1ZNWA 3EQ2A 1T8UA 3AESB 4HFRA 4IJWA 5LVAA 4OBBA 3IPLA 3ND8A 1R6DA 5ALIA 3VOAA 1OH7A 5EE3A 3RARA 4YRTA 2B1IA 4NCHA 2JFBA 4GRIA 1MO2A 5J2UB 2C94A 1SUSA 4I4NA 5JD3A 2DLCX 4CLRB 2O2SA 2G3YA 3OZGA 1VRVA 3GY0A 4X71A 4DJDC 4RTKA 3LS2A 6CHYA 1J9EA 5IJXA 3TD9A 3EZNA 4PSCA 3V4RA 3CZQA 2UUBB 5FBQB 3ZHBA 2X15A 1GT6A 1CW2B 1LK0A 3CEJA 4NDAA 1QH8A 2WT4A 3Q3GE 1O6FA 2DFKB 2HO4A 1POXA 3EPRA 3AJ9A 3MS2A 3PDUA 4S2EA 1P3DA 4JU9A 4JBLA 1YUNA 1N3IA 1QRRA 4W9RA 2QTBA 1BQ4A 1MX3A 2FETA 4GH5A 2O2GA 3ZDCA 2B6NA 4TKMA 5FOSA 5EJ5A 1G60A 4F9TA 2H11A 1AA9A 2HWXA 1NVFA 3CSDA 5L4NA 3WDLA 5JNSA 1G20B 4EI8A 1N33B 3BH7A 3G1UA 3PPIA 3V1MA 4J1TA 3LGAA 1L1RA 3DMTA 3I39X 1UBHS 3RUPA 3VOTA 4KRXA 3UJ6A 5F51A 1A5ZA 2DM6A 1EP2B 1PGQA 4XAQA 1M2KA 3JTEA 4XIIA 4CFSA 4FSXA 1WZNA 4EA7A 1X1DA 5CFPA 5EHXA 1KI2A 2GR9A 3OEHA 3VSCA 4OJKA 2WJIA 3U7GA 1EHYA 4ZVNA 3L7LA 4JGIA 1RE1A 4C4RA 5JD6A 1U4NA 1FVFA 5EPUA 1FP7A 2YJNA 1MH9A 1ZH6A 2ZYDA 3C97A 3CGGA 5DZSA 4F04A 4Q4HB 2Y93A 1TO2E 3E58A 1BC5A 1E1KA 2H65A 2MMGA 3PNKA 1KEPA 1WQ3A 1G18A 5IEBA 3O3MB 4C76A 4YUYA 5IWAB 2D5AA 1EVIA 1UPFA 3NIDB 3PRJA 1T91A 4N5DA 3KTDA 3NWBA 4US0R 3ID6C 5AXAA 1O9BA 2R6ZA 3B70A 4E11A 3RYHA 2EP7A 2I33A 3KSRA 5AVZA 1DXHA 4FSHA 2BP7B 3I2GA 4X62B 1T36A 2J5QA 2Q7XA 3CRRA 4GBJA 4HXGA 3RS7A 2ZQZA 3QZUA 4UE3S 2P3OA 4TWZA 4YV0A 3T3IA 5HUHA 4QM6A 2FKNA 4RD4A 2RGEA 3WB1A 1X74A 2C9MA 1D6MA 1CZLA 1JHYA 3TOVA 5GM2A 1TEXA 4HGYA 3H9QA 3LQRA 4RMJA 4ZOLF 5F77A 4LFCB 3E2IA 4XB2A 1EI9A 5A4JA 1N2EA 1RAGA 1FYEA 2JFXA 1HT2E 1H6AA 2LDXA 4BTEA 2AN5A 2CT8A 2JFFA 3VM6A 3QM1A 1JHDA 4FOTA 2AZXA 1Q1BA 3HUFA 4M1EA 3P26A 3V4ZA 2NWQA 4XGRA 1EUZA 4QVIA 1MZVA 3DCYA 3OHPA 4QJBA 5KJ6A 1TJ4A 4JR0A 1YS2X 2C59A 5DNEA 1U7TA 5KREA 3S1SA 4Q9KA 5KTPA 5H3HA 3V9AA 1OIVA 1U6JA 2VCEA 3KEQA 1DCKA 1G63A 1W4ZA 5K0CA 1BHJA 1ZI8A 2EW1A 5AM5A 1NC1A 5GONB 3M4NA 1G8JA 1AKNA 1SH7A 1QQ5A 2CW5A 2JFPA 4Y7DA 2OK7A 2TYSB 3PC2A 1W1IA 1RTTA 1JTEA 2AG5A 1L6RA 4IL5A 4KJZA 1FNSA 2Q5HA 3RFCA 3WJ2A 2O0KA 1LV8A 3DS8A 4G5OA 4AJPA 1GG5A 4XTRA 1LFDB 2ZTVA 3PGLA 2OZEA 2PUEA 3ROKA 1EVQA 3A06A 4M9XA 4C3UA 1HI9A 5A04A 4M0LA 4OHXA 1XZAA 2GZHA 2YCLA 1XZJA 1WW8A 2B61A 5EJ6A 1YZTA 1WSAA 1UJMA 1Z2AA 1UT8A 3DFZA 3I9LA 4HQRA 4PPGA 3WMXA 2FY8A 4TRNA 3ZU6A 3DFMA 3JQ8B 1QGZA 2XSZA 2YDXA 4UCXA 2HFKA 3OOEA 4V0LA 3KHKA 4DR5B 2O8DB 1NRIA 3ABQB 5C8YF 2RG1A 3D8RA 4KRYA 1RRKA 2VP2A 4RETA 2IYPA 3QVVA 2HF7A 3O1HB 3HLYA 3OUTA 5JYEA 1LS6A 5B1YA 4ZDWA 4PO9A 2I4TA 2ZIXA 3GT7A 2FMHA 3EDQA 4V0ME 1VGQA 1V5IA 2EP8A 1IONA 4KUHA 5F7JA 3RU7A 3WHIA 3AH8A 5K0EA 1RJGA 1E2DA 3FD8A 2WKSA 3PLAE 4NX2A 4PLTA 3TUZC 4C4SA 3BUSA 4REQB 4HD8A 4QDKA 1JHXA 3AL3A 2GRJA 1P2VA 2B36A 2YRWA 3BWCA 5JXJA 3J7AC 3QLVA 1MOPA 2P8SA 1R4NB 1ST3A 2ZXEA 3EARA 1YIOA 2HCFA 1IK4A 2SKEA 4II2A 4NNOA 4UW9A 2RIRA 1KIMA 3B6IA 5T57A 4MGEA 5JQWA 3ZE2B 5LQCA 3EMBA 4MIOA 4PO8A 2ZDHA 4Y2UA 3T3EA 4EQ6A 2ZWOA 4A1FA 2HRBA 1CRLA 3WLEA 5A5EA 4G84A 4XGIA 4YAWA 4OK3A 1MVNA 1CUEA 1RYEA 4FQ5A 4O1HA 2O59A 2O8BA 3L1HA 3Q0TA 4YQFA 5IKEA 4GWKA 3EULA 1DE0A 4UMVA 4KMMA 5FWNA 1PV1A 1P4AA 3TKAA 5KVSA 1BH2A 5TS2A 1BOFA 2Q8QA 4HAOA 3GJ7A 3G0CA 5BYJA 4ZD6A 2YCBA 3DR5A 5EMHA 4D9FA 2H1RA 4H27A 4OBWA 2BSXA 3KT3A 1NLMA 2H1SA 3CF4G 2IDKA 2XMPA 3P0IA 4BKPA 2IZOA 1GPAA 2IPOA 3UMRA 3NOXA 4DGQA 3UV6A 3JR3A 4AZWA 1CSEE 3SHVA 1HDCA 2QRVB 4YQYA 3M1LA 1KJWA 4ZI2A 2BEWA 2XIJA 3LV8A 3VR0A 4F2DA 1NATA 2HM7A 3PIRA 1VI6A 4MWSA 3SX0A 1E2BA 4QXQA 4W6QA 1Z0ZA 1IAQA 5AHRA 2QRLA 1QWSA 2B21A 3P9XA 2AG0A 5HUQA 1OX4B 4MUFA 3LPAA 1YQDA 3B3QA 5FNVF 4BJ5A 1KI9A 1DG1G 2EF0A 1XRRA 2DHCA 3KK0A 3OBIA 3V1NA 3NNSA 3QWAA 4PRKA 4CLXA 3INNA 2IA5A 1W8IA 3FTEA 3PV0A 4Z9XA 4BNNA 5TLSA 2F9MA 2XHEA 2BFEB 1PR6A 4EMBA 3O90A 2I4RA 4LIPD 5AKYA 4NG5A 3EGDA 4BKMA 2G4VA 2W58A 3ZV5A 5A4FS 1QHGA 3ICPA 4R0NA 1DG9A 3N59A 3VGPA 2PKQO 2XDYA 4KN5A 4D74A 1YGPA 3A6LA 4NBTA 4ZI7B 4OI0A 1BSVA 4JHLA 2XAAA 1THZA 2WHEA 2ZBQA 4LDPA 1QP4A 2VDNB 3FI0A 4F5WA 1DI0A 2V3VA 3AY3A 2YJGA 1RPNA 4RD3A 3TM4A 3U62A 1Q77A 1CS4C 2VG8A 1V5EA 5LYYA 1GQSA 2FPOA 2AVDA 4ON9A 2C9OA 4MTCA 4PCUA 1VECA 4QQKA 3GZTB 4YP1A 1K75A 2PZ8A 3ENVA 3ZKAA 4G56A 1PX2A 1QHYA 2CXOA 2FOIA 2VPPA 4O02B 4BUZA 3RF7A 5MGBA 3IO5A 3OPYB 1RDFA 4L4RA 5DHPA 1H2ZA 2PU7A 3TSCA 3EDRA 2UZ4A 2B1JA 5NULA 4FQ8A 3SXUB 1S7GA 4BV9A 4AYTA 1QK3A 1FLDA 2AZTA 2NZ2A 1SCUA 1ZM7A 2LKCA 4ARZA 1W59A 2I6FA 2N42A 2IEAA 3ZVRA 1D1TA 2IYAA 2LBPA 3IVXA 4P54A 1MJ5A 3FYUA 521PA 1OFUX 2CNOA 2AFIB 3GYBA 4J0FA 3FZQA 2V7QA 1Z7GA 1X7YA 1FLVA 3I4FA 4K2HA 2WKPA 3COJA 3U49A 1GCGA 2JFHA 2QNIA 2O4CA 4O4HB 4QUBA 2YZKA 2I99A 3QI2A 2Q28A 5HFAA 3X3HA 3H99A 1QE0A 1DAKA 3T7RA 4OGKA 1Y4SA 2CLDX 2IC5A 4JXJA 2DFDA 1Y89A 4YI5A 1GQ2A 1ZGJA 2FRDC 3C3CA 3L5KA 4CKBA 1ONOA 3VJKA 2Q3BA 3WJAA 2DSTA 3SVTA 5GIOE 5H80A 5JNLA 2D1RA 5AR1A 1JKJA 3NWJA 1AUVA 1KI3A 1CUJA 4WKBA 2DG2A 3HCAA 4J91A 4N12A 4QQNA 1CY2A 1A04A 2X19A 2PNJA 3RFXA 4BB5A 3H05A 4CG0A 1N8NA 1AMUA 1DZ3A 1TT7A 3K0FB 4R16A 4D3YA 1MB0A 5F1OA 3ZR4B 5C1PA 1ZD5A 2WNHA 3FGPA 9ATCA 1L5RA 5JEEA 5DHRA 1ZJ5A 4MW4A 3PD1A 4BP3A 4AP6A 4Y2RA 4DJAA 1KI6A 4BL5A 3OMWA 1XZ8A 4ND1A 1BZYA 1MIOB 1HBJA 4S3MA 5A0VA 2E5FA 2ZUFA 4N7BA 1DAFA 2FPPB 3CUWA 1FNNA 4HGOA 4N5HX 4PTYA 3HADA 1Z73A 3EK2A 1UXGA 3OIFA 4XW2A 3RS4A 3FGZA 4LNHA 5PGMA 1UDXA 2MINA 3QVLA 1D04A 3ESYA 4BOYA 3I2KA 3GDFA 3H97A 3NCHA 2LCFA 4OFZA 1Q7BA 1JILA 1MFZA 4XRRA 1LX7A 5ELLA 3TE7A 4RTSA 2HRQA 4XWGA 4Y9DA 1L5ZA 2H7YA 4ZT5A 3OPMA 5IC4A 5KOHB 3D6AA 4WXYB 1E77A 4FCVA 4BX3A 3K72B 5IN4A 1SO8A 4PANA 4TWBA 5ALEA 1NMSA 4U2BA 4A0RA 2O5EA 2EJCA 2CN1A 1NUUA 2X9VA 5DTQA 5E3HA 4D81A 1EUQA 1OE0A 2GYVA 2QYOA 2IYYA 2IV3A 4KIJA 1Z0SA 1YT5A 1LBSA 1CZRA 2X7HA 4JODA 4L0MA 4N3GA 3K1JA 3QTTA 1XTIA 4WLEA 5D51S 2UXDB 3BG5A 2A14A 5CPBA 4EO7A 3C3BA 2FQQA 1BH6A 2DWOA 3ADKA 4M0EA 1KVTA 5D1HA 3O47A 2XTJA 2HL6A 3U7JA 1XROA 4PZPA 1KA9H 2QG9A 1JJ7A 4DE5A 4BO8A 3QI7A 4BGDA 3O9MA 3BAZA 2ESRA 3QEOA 4R1PA 2QL9A 3DJYA 3WXMA 5BMVA 2XZLA 1W36C 4K8OA 3OUUA 4CMHA 4EPYA 1X8XA 1UC8A 2CVOA 1P4GA 1P2BA 2WSBA 4KO4S 4F4DA 1IXSB 2IS6A 4FGUA 2IPAB 4IO1A 4IPTA 4ZODA 4UU8A 4B47A 4EPXA 4F6RA 4B3TB 3A3KA 1IZZA 3DCJA 4YP6A 1H5UA 1BN6A 2C0PA 2C82A 1GG8A 2PX3A 3L1VA 3N75A 5ALFA 1YQ9A 3IEUA 4KVZA 5LMCA 4RGVA 1ZMBA 1XRQA 3I92A 4PLGA 3VC2A 1V9SA 1DJOA 4I50B 3PDWA 4U5QA 1JQ3A 1NJ5A 1GVNB 3IAM1 2XUKA 2YS7A 4MGIR 4RMIA 2D7JA 3PS9A 1IVSA 4A0GA 1O89A 4KNVA 5FTKA 2XZOA 3ZCUA 1RYBA 3AF6A 5EA2A 3VHLB 4MWDA 1Z8DA 1KZ9A 3JAKA 4AKTA 2QBYA 1NUQA 2OHHA 2BW0A 1P4JA 1AHNA 3GEDA 3TSAA 2X23A 1QC5A 4HDOB 3R0VA 1GRVA 4GMHA 1KQPA 3H2KA 4LY0A 4UHHA 1XLVA 4KACA 3OQBA 5EJFA 3VR5H 4LJ5A 2R3SA 4YAIA 5DT2A 1F6WA 3ZQ6A 3CPHA 3PD7A 3SQXA 1HRKA 1M1YE 2RMKA 4GG1A 1CEYA 4FGKA 2NIPA 2YWHA 4GC9A 4XE5A 1OWLA 1DRKA 3FYHA 2QUIA 2REBA 4H16A 3G8AA 2YDYA 2I55A 3ACDA 1SR8A 2FSVA 1R0YA 4WGFA 3UENA 3KYIB 4BNZA 3ISVA 4DLLA 5JYCA 3FHOA 3HJGA 1DSSG 3SLKA 1H8HA 1AC5A 1RCUA 1WMFA 5LZ5A 4NMXB 4X3PA 3GUUA 4TZKA 3I6IA 4DEVA 4JJZA 1E2NA 3T12A 1E99A 1KKLA 1QKJA 2H57A 5AVUA 3KYCA 2PKXA 2J07A 1ZW6A 4NJEB 2VRCA 4PZLA 1GTG1 4Y67A 2A4KA 1D0VA 2WMOB 3DOOA 4I8XA 4OYHA 4GEGA 3RVBA 1NXXA 4DXAA 2IOHA 4Y2TA 1S2MA 3IKMB 2KQUA 1FUEA 3MCUA 1T29A 2E4YA 1GLVA 4YACA 4BO0A 3BWDD 5DVZA 3T7KA 2OCIA 3TZCA 3GCWA 4URWR 4GBED 3NI2A 1JZQA 2F6RA 2P35A 2G71A 4JCOA 4YAUA 3ZWMA 1W5BA 1U7HA 5F1YA 2B8TA 2CF6A 1C7ZA 3QNWA 2PX8A 3AJEA 2J3EA 3JCZA 3J7TA 3PIIA 3UPDA 2JCYA 3ZE6A 2EKPA 1JDZA 1GJRA 3MWKA 2IUEA 3FPLA 1BA3A 3NOOA 4LDRA 5DO9A 2D3TA 1E96A 4IH1A 1TCAA 3UA3A 5HCNA 3IRUA 1OYYA 3PPXA 5TE9A 7AT1A 5LQMA 4JS0A 2WAYA 2HW8A 2P5UA 721PA 2Q4BA 1ADYA 4PC6A 5LKAA 1W75A 2H5LA 3PNBA 3DMHA 1U94A 2GK3A 4GM4A 4ZC1A 4FYYA 3UQZA 4C7MA 1F7UA 1OBOA 3E7DA 2QUBA 2NUAB 3IC5A 2VDWB 4RK1A 3EODA 1E0KA 1GILA 1FF9A 1LK5A 2DFVA 1MT0A 3C3YA 4KXLA 3AC0A 4AL4A 2R8EA 3F2VA 4OI1A 1OGIA 1A82A 5HYVA 3IEPA 4LYJA 2CLFB 4M3NA 3LPMA 3P94A 3KD2A 3OIWA 4HH3C 4R40A 4ARAA 5JJBA 2P68A 3SYRA 5IFKA 1XQVA 3FROA 2FDRA 4X8HA 4X1IA 1X39A 2R87A 3U2QA 5AVRA 1E3SA 1Y5MA 4MR7B 4CF6A 2XUQA 3AUXA 1UBLS 5IZCC 4DCUA 3GMTA 1OJ7A 2NPIA 4HNTA 1SRQA 1H3EA 1AXEA 2CL0X 4G81A 4IDCA 4MO9A 3DDUA 3V8BA 4I6JA 3ZQUA 1XWFA 2OD2A 3LLVA 4BU1A 3IV9A 1Y6GA 2F17A 2IW1A 1AY0A 1OMOA 4QTTB 1A71A 3GRYA 1M2JA 3KT6A 3NX4A 3PUVA 3QWIA 2Y92A 1PP4A 3M9XA 4TQAA 5BVGA 1GU0A 1T9BA 3AVTA 3UT5A 4H7IA 1RD4A 3KPYA 4AKEA 2LE0A 4DT1B 4L5JA 3UF0A 5AJUA 1MMFB 3CR3C 3TD6A 3ZKWB 2SCUA 4MV3A 3Q8XB 5IT4A 4F3NA 4C7VA 4YYZA 3HYTA 3A1VA 1ILEA 1Q17A 1WBBA 3X1DA 2ZYVX 2YXLA 2B34A 3F5MA 3WHLA 4QRDA 4LJ8A 4DCPA 1YS9A 1G2QA 2NXNA 3RS9A 3AM5A 3R7BA 4BQSA 3R7AA 5KYXB 3UOWA 1U98A 2VDPB 2YVQA 5BORA 4M0MA 4NRDA 1ULZA 1F8FA 3AB8A 2QNBA 2B8WA 1NQAO 3C1OA 4J6FA 3HL0A 4MWOA 3U4DA 4C7BA 2XB6A 3F5SA 3VH4A 4C0SA 3BWXA 4R01A 1QGUB 2AUNA 1AK2A 5B5SA 1WQ4A 2OHIA 2X6QA 3HKBA 2H0RA 3NLLA 1U63A 1JIKA 4WNIA 2V7UA 2O8CA 5CPFA 2GXSA 2WSYB 5IXSA 4PSAA 4BQQA 1I1QB 3ILSA 1I2MA 5K1ZA 3QLEA 3TIVA 4CI9A 1W4RA 3E7PA 5FBVB 3W9UA 5CLHA 2GPJA 2K2QB 3T8YA 4GE3A 3W8DA 3NTXA 1BRTA 1BD4A 1YS7A 1AQ6A 4QDOA 1A5AB 1PJZA 4ZVKA 4B7CA 5DX0A 2D0PB 2A5DA 3PRKE 2CK3A 1GKIA 1F8XA 1KYZA 1GZ7A 1POWA 1SXHA 2JFVA 3ESAA 3KVYA 1U7PA 2HJVA 3NJ8A 2GUGA 3R09A 1BEEA 4TWAA 1RWQA 3LZCA 4WI1A 1KK2A 3QBEA 2UXCB 2JZNA 4ZRMA 1M34A 3B1ZA 4OQ4A 2B4TO 4YS6A 2XF2A 1YZQA 3GEBA 4IV8A 4DV2B 1F4LA 4JWKA 5K0TA 3BCRA 5I4KA 4L57A 1IB6A 1VKOA 4KK4A 2YINC 4QRIA 2JEYA 3WKAA 4EJSC 4GW3A 3SQMA 3C8HA 3ZVMA 2JJ8A 2QAJA 4HEQA 4P0QB 4PYNA 3DFFA 1E5LA 1DDIA 2AOTA 2Z9CA 2AF4C 1ZM9A 2FPGB 2OILA 2NW6A 3NM6B 5KYVA 2GILA 2JCVA 4N03A 5LZ8A 3PUWA 4NU0A 2Q4DA 4RE5A 3W7AA 3A4LA 4QDJA 3WYEA 4JASB 4MS1B 2JJMA 3GV0A 5CX4A 3W2IA 1RP7A 2RBKA 3RVSA 5IHPA 3GH3A 5JCZA 2FEOA 1J09A 2QAGC 4AC9A 1J24A 1U1GA 3IAUA 1EVZA 3U48A 2KLHA 1YNSA 1Z62A 2LXNA 3RO7A 4KNYA 4RVDA 3D7SA 4ZKEA 3L7KA 4UEKA 2BGUA 4IG9A 3U44A 1UDWA 3H3FA 1U9ZA 3H5IA 1OQAA 4JBHA 4IRMA 4M49A 4QELA 2WB2A 3DVQX 3L6OO 1XPOA 2VNKA 4P7JA 1PT8A 5CDSA 1HLFA 4QQFA 1OBFO 1J97A 4KLCA 3VKUA 2WTUA 4QU5A 3MHTA 1GPYA 1FTNA 1P1RA 3OIUA 4EKEA 2EDAA 1TW2A 2Y2VA 3OTHA 3PQ8A 3NNNA 2WE8A 3GT3A 1QG4A 3LW7A 2VP4A 1VSQA 1IH8A 3CCCA 1ZD3A 5KTNA 4YRPA 5LNK6 4E2YA 3EZ7A 1KBOA 2FZ5A 2QM3A 3Q0EA 5BW6B 4W5OA 2NO1A 2P2DA 1OBCA 5AVXA 2GF0A 3ZJYA 2Z0MA 1FJ2A 3KV1A 3OCCA 3IAM6 4LC0A 4UQOA 1NR1A 4FR2A 4LRUA 1ACJA 3DAOA 6GPBA 2Z8YM 1JIVA 1BHQ1 1U28A 1RXYA 3GJQA 3MRTA 1NG9A 4NV1A 3G0BA 3VXKA 4EGCB 3WGYA 1FLAA 1AUQA 4LF5B 4IFBA 1H2WA 1ZESA 2DMRA 1PZMA 4MMXB 4NVRA 4U3JA 4X93A 1F06A 3SOZA 3PL1A 4HYYA 5B3JA 1P5HA 5E6UB 5LP6A 5CYPA 1XRJA 3OO0A 3OTIA 4P7BA 5F2KA 2PGJA 3EW9A 2FMIA 1RQLA 2F8MA 1U0RA 3COSA 3EVCA 1JRLA 4GYWA 1QH0A 3NP9A 4RS3A 3UJBA 4PG8A 3E4CA 2XADA 3LFTA 2GRAA 3M6MD 3NHRA 2ZZNA 1P5RA 2VJQA 4KQ9A 4EABA 1ZD4A 1WB4A 3N2ZB 3A37A 1DAMA 4LHWA 1JVBA 4LF4B 2BV3A 1M9NA 4A8JA 3L18A 2H3EA 2WF8A 3CUYA 4LAFA 4MIKA 3WRYC 1Y82A 4XM2A 3HYLA 1PHRA 2JA1A 2VYFA 4EG0A 1RVDA 2AR7A 4G9BA 3CX3A 4B45A 1GL9B 4IX9A 4UTNA 4C3ZA 3IMEA 2Q2VA 5EKTA 3MJTA 3KJGA 4PFQA 1ZXBA 2RHLA 3EBPA 1T1SA 2K6GA 5IDVA 2O6LA 2R7MA 2FEMA 3T9AA 2C3MA 3HCPA 2RHMA 1M34E 3F71A 1KJJA 4GLJA 2NAPA 4UPEA 3MD9A