2J3IA

Crystal structure of arabidopsis thaliana double bond reductase (at5g16970)-binary complex
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
345
structure length
336
Chain Sequence
MTATNKQVILKDYVSGFPTESDFDFTTTTVELRVPEGTNSVLVKNLYLSCDPYMRIRMGKQAYTPGQPIQGYGVSRIIESGHPDYKKGDLLWGIVAWEEYSVITPMTHAHFKIQHTDVPLSYYTGLLGMPGMTAYAGFYEVCSPKEGETVYVSAASGAVGQLVGQLAKMMGCYVVGSAGSKEKVDLLKTKFGFDDAFNYKEESDLTAALKRCFPNGIDIYFENVGGKMLDAVLVNMNMHGRIAVCGMISQYNLENQEGVHNLSNIIYKRNRIQGFVVSDFYDKYSKFLEFVLPHIREGKITYVEDVADGLEKAPEALVGLFHGKNVGKQVVVVARE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanistic and Structural Studies of Apoform, Binary, and Ternary Complexes of the Arabidopsis Alkenal Double Bond Reductase at5G16970.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Oxidoreductase
molecule keywords NADP-DEPENDENT OXIDOREDUCTASE P1
total genus 85
structure length 336
sequence length 345
chains with identical sequence B
ec nomenclature ec 1.3.1.74: 2-alkenal reductase (NAD(P)(+)).
pdb deposition date 2006-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF16884 ADH_N_2 N-terminal domain of oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2j3iA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2j3iA01
3GZ4A 1N92A 3SX2A 4QUKA 3WICA 5KNLA 1NASA 4OSOA 3OIDA 1QYXA 4E4YA 3D3EA 2BFOA 3GNTA 2W4QA 1ZO8A 2EG9A 1DJQA 1WP4A 1VKNA 3AFNA 3FPCA 1BDMA 1E7QA 4BNZA 1LX6A 2PTGA 1PWZA 2FPGA 2YDXA 2Y1CA 5KKAA 2VHZA 3SXPA 2B4TO 3RBVA 3QVXA 4GLOA 1UAYA 3HN7A 1DIAA 2B37A 2LDXA 1U2DA 1O8CA 1GUFA 1NPTO 2B5VA 3GHHA 5BQFA 4YWJA 4BB5A 3GG9A 1BMDA 1DIBA 4OXNA 4PZDA 4EUFA 1MXHA 3L07A 4OHUA 4PZEA 2Y0DA 3GPIA 1ISMA 1X0XA 3MJ4A 2GZ1A 2O2YA 3F3SA 4Z9YA 2IYPA 3CPSA 1PGNA 1GQYA 3BMNB 1NQOA 1E3IA 3G17A 1E3LA 2TMGA 1WAMA 3GT0A 3VDRA 4MIEA 4NQZA 1QXSA 3PEFA 3AY6A 3TJRA 2P91A 1UP6A 5I9LA 3NKLA 5C7OO 2G5CA 2Q4EA 2AG8A 4JBGA 1E3SA 4F6CA 2BRUA 2UUOA 1Z45A 5JC8A 3I23A 5K6AA 2AMFA 2A35A 3OHSX 2X5JO 4ID9A 4CV2A 5LDGA 5BSGA 4IM7A 1BVRA 4O63O 2VTEA 2Y1EA 3WLFA 5IG2A 3NV9A 1YQXA 4FFOA 4YB8A 1EUDA 2JAPA 3HHPA 3WQRA 3DQPA 3ZU3A 3ENNA 3I9LA 5L7YA 3MEQA 5AXBA 2JHFA 3ZH2A 3AW9A 2YV1A 4N7RA 5DP1A 4ALJA 3RFTA 1AXEA 1I24A 1ID1A 3ZI0A 5JBIA 1JQBA 1UXJA 2DAPA 5KJCA 4F6LA 1HYEA 2O7SA 3QJ5A 2O3JA 4M55A 3ETDA 1P1HA 4NI5A 2Q3EA 2OXIA 3JD0A 5CFZA 3I52A 5EIOA 1LSOA 3B6ZA 3RFVA 1SOVA 2OZPA 5EINA 5F1OA 1ADFA 1IYZA 2NU7A 4LCJA 2CF6A 4GX2A 3A28A 3WFIA 2CVQA 4IGEA 5KVCA 1VRWA 3ZU5A 3P2YA 4CMIA 4EUHA 1GZ6A 1UZLA 3FSRA 2Z1MA 2DBQA 1IHXA 3QVTA 2CVOA 3BAZA 5CDYA 1SAYA 2GCGA 4INAA 4A7PA 2R6JA 4R1UA 5TX7A 1VKOA 1WZIA 4BNXA 2UV8A 3GRPA 3KHUA 5FWNA 3H2SA 3WWZA 2WTBA 1R6DA 1O95A 3H3FA 5H82A 1E1KA 1RWBA 1ZMTA 4XYMA 1EVIA 4UREA 2FWMX 3Q0EA 3GAZA 1R4NB 1G6KA 3GNSA 3H7AA 5EQDA 1B8UA 2BH9A 3DHYA 1JAYA 2D4AA 1YL5A 3TSCA 1J5PA 5L4LA 4YJHA 1XELA 4N54A 4NBRA 1E77A 3R6DA 2WSBA 3L9XA 3K30A 3BMCB 5A3VA 3RUIA 3QVWA 4FS3A 4J3FA 2O4CA 1CERA 3H9QA 3TN7A 5G4KA 2ZJ0A 3EAGA 1WDMA 2X58A 3MJEA 1SMKA 3FNFA 4J9UE 3KYCA 2HCTA 1YS4A 3NDRA 2HK8A 3H3JA 4IXTA 2NADA 3V1UA 4GBJA 1A4IA 3ADOA 4P38A 1CF2O 2Q49A 9LDTA 5DZSA 5F1PA 1F17A 3GEDA 3ZWYA 5ENDA 2Y1GA 3ASUA 3C3XA 2Y99A 3RKUA 4F45A 1MV8A 3ZNNA 3ZV3A 5TSDA 1P1IA 1ZCJA 3JQBA 4YA6A 1JLLA 4P8RA 3ONFA 3F6YA 5CDTA 1HLPA 5A04A 1WVGA 2V6GA 3KV3O 1I3NA 3NJ4A 5HTOA 1HDZA 2C07A 4ILKA 1V35A 3VOSA 2YYYA 2DTXA 3EY4A 3MOGA 1GYRA 2E48A 1I2BA 1LTHR 3MCVA 2QRJA 2YHUA 4TRJA 1IE3A 1O94A 3V8BA 2W98A 3SC6A 1H0KA 1LRKA 2WE7A 3PDUA 3PYLA 3RC1A 3PGJA 5JPIA 4HNGA 3DMTC 4DXHA 5KVVA 1BDBA 4R1NA 4BVAA 3DMYA 2P9GA 4TKLA 1DRVA 2NSDA 2VWGA 4G81A 3KYDA 1V8BA 2Y68A 4Z9FA 3OP4A 4WNCA 5ILGA 2PKRA 1YQDA 3I9KA 2Q1TA 1ZNQO 3U0BA 4PZCA 1NQ5A 1LSJA 4U5QA 4YT8A 2RHCA 3H6KA 3ICPA 1VJTA 3E6AA 4R01A 3RBZA 5JCJD 1ULUA 3K5PA 3KVOA 2I99A 3OQBA 4KTTE 5I8ZA 4ALIA 4CM9A 3F1LA 3KZVA 3I6QA 1ISGA 4Z3DA 4D3FA 1DJNA 4NJOA 3CIFA 3R0IA 4XGNA 3JQ8A 3OM9A 2D5CA 5BSHA 2I65A 5MDHA 3KUXA 5B4TA 3D0OA 3GVXA 2FHSA 4J43A 1EDOA 4RQUA 2VYVD 5G0TA 1UDBA 2I3GA 2IEDA 4E5MA 3K6JA 3PLNA 4ZU3A 4D3SA 3IDSA 4R68A 1Y5RA 1WMAA 1V3VA 4B7CA 4YQYA 3DFZA 1B7GO 1CRWG 2NACA 2B36A 3HNPA 4ZQBA 5L9AA 4RZIA 2G82A 1A71A 1TLTA 3DBVO 4CM5A 4WCFB 2DQ4A 4PLCA 3AI3A 5C3MA 2HSDA 4CL3A 4TWRA 3A14A 2AXQA 1H6DA 2ZTUA 2Q2VA 3G3EA 4C7JA 1CEQA 4XQEA 2AE2A 1T2EA 2EGHA 3DBRA 3TL2A 4NZ9A 4PLVA 2P9EA 3UN1A 3IUSA 3QE3A 4H16A 3WGQA 2OUIA 4K9DA 4J1TA 3DZFA 4ALNA 1NVGA 4YJFB 1E5LA 1F8GA 2C2XA 5FFFA 2HO5A 4DUPA 3WGOA 4WEOA 4DQUA 1QYDA 2VT3A 3HFGA 4JLWA 1IPEA 2EIHA 1U1IA 1XLTA 1EUZA 2Q46A 1A5ZA 2I5PO 3O4RA 4N5LA 4S1VA 4WGGA 3WXBA 4BOYA 5JAMA 2ZTMA 1F8FA 1MP0A 1S7CA 3PP8A 1LU9A 1E92A 4XYBA 3KSUA 3EGOA 1P1FA 1NP3A 3VKVA 2X6TA 4CLXA 4PLZA 1K0UA 2GERA 4XEHA 1ZJZA 4EBFA 1T2AA 3QWFA 3BHMA 5T8KA 3H2ZA 4RVSA 5F1KA 3RUAA 5JAIA 5AQ1A 4EEZA 4R54A 3ADPA 4GX0A 1A4UA 2O23A 1NVMB 2P5UA 1E7WA 1SEPA 2HK7A 3PJEA 2C59A 4B3HA 4Y6PA 3JQ7A 4ND2A 5A9SA 3OJFA 5FF9A 1PZGA 1OFGA 4JP3A 3LT0A 1XU9A 4IPTA 2H1SA 5AOVA 2A94A 4UUMA 1MX3A 1HDRA 3OJ0A 4R9SA 4J4BA 2OP0A 4P22A 2CVZA 3TDKA 2YFQA 4L0QA 4B4OA 3F46A 5DCYA 4BV9A 5BSFA 1H9AA 1XU7A 3TOXA 3L77A 2AG5A 5A4DA 3FCOA 1K2WA 1NR7A 4K28A 1I32A 4UEKA 4BKUA 3DTYA 3JQFC 5U1PA 4B4WA 3RUFA 4J2HA 1SB8A 3TFQA 4RPGA 1D3AA 2NLOA 2PGDA 2A4KA 4BO0A 5JDCC 1U3TA 5DF1A 3B1KA 3EVNA 2BMAA 4XGIA 3ZWXA 4MVJD 4UVDA 4FFPA 4WE3A 4N5NA 1OOEA 1VLLA 4WOJA 4D45A 1XG5A 4M54A 4ZQFA 4XZ3A 1TA4A 4FJ2A 3AM5A 4RF3A 3GFGA 2X86A 3UGKA 2EF1A 3WTCA 3L4SO 3RCBA 3KB6A 3WG9A 3GC6A 3MJSA 1G0NA 2AHRA 4M89A 4WLUA 5JFOA 2GPTA 1T4BA 4PGFA 1NWHA 3ROKA 1Z6ZA 4GLLA 3T7CA 1PZFA 4Y9DA 4NFHA 1LBEA 2NUAA 3A1NA 3L0DA 3OJOA 4R69A 3U4HA 4HKTA 3WIEA 4GWKA 4PG5A 4XRGA 2ZYDA 4DIBA 4YBZA 4Q3DA 3NJ8A 3I83A 3NDIA 2PNFA 4NU6A 1LDEA 3I9JA 4NBUA 3GR6A 3LLSA 4HADA 2FY8A 1SBYA 5TT0A 4A5OA 3AWDA 4JQCA 1PS9A 4PLTA 5ES3A 1MG0A 2VZ8A 2IZZA 4DC0A 4CV1A 5JYEA 2H5LA 4IDFA 1ZEJA 1ADCA 5JDIC 4MJLA 3ZHZA 1ZVMA 2PZLA 3JD4A 4IGFA 2Y0EA 4GX5A 3DHNA 5J23A 1D1SA 1N9GA 4MVJI 4YTEA 1PJ2A 4AJNA 5CEFA 1C1DB 3Q3CA 4DMMA 3FI9A 2ZB7A 1SC6A 3MJTA 1K89A 1KC3A 4PG7A 3TZHA 3U4IA 5HWSA 3DOCA 4KQWA 2PFGA 2LDBA 2VTDA 1GCUA 4WPGA 5K1SA 3UVEA 3VC7A 4CLRA 5JS6A 3L4BA 1I5RA 5HA5A 4CUZA 4CR7A 3HDQA 3RSHA 1FDTA 3DB2A 5JAQA 4BNMA 2HKIA 1PR9A 2NTJA 3FNEA 2P4QA 2VQ3A 4D46A 1MB4A 2OFPA 3T4XA 4WCFA 3WNQA 4Y6SA 1OI7A 4CQMB 4W7HA 1CYDA 3HE3A 2YV2A 1ARZA 3AI1A 2AEFA 4D0RA 2QX7A 1GR0A 3RBXA 4BGIA 4A2CA 1U8FO 2OO5A 3UCFA 2DC1A 3G1TA 2C7VA 5EMHA 4RLSA 2DFDA 4GMGA 4MIYA 3TZCA 5HS6A 3RFXA 3SLGA 5CDGA 4GI2A 2VYVA 1CETA 1QSGA 1Q0QA 2J5QA 3S1LA 4HFRA 1DC5A 4EI2A 5K0ZA 1GEGA 3EDMA 3GK3A 2H6EA 2B4QA 1JW9B 3S2FA 3GUCA 4D7AA 2Y67A 4ZRNA 4CR8A 5A5FA 6ADHA 4PLYA 4RGBA 4CLOB 5A9RA 4DVJA 4DGSA 4IDBA 3ABIA 4E13A 1CJCA 4E33A 4WLNA 4YDRA 2V7PA 3DO5A 1H6BA 4YT5A 4XCVA 4AFNA 5DBFA 4LRSB 5KJEA 1ZK4A 5JO0A 4EITA 2AW5A 1AHHA 1N1GA 4NFYA 1ONPA 1WPQA 4E6PA 1GL3A 1YOVB 3M2TA 4J6FA 5A3JA 2DBVO 2C7GA 3ROQA 1UP4A 5HRUA 4RQTA 5L40A 1TXGA 4J1SA 5A9SB 2WWRA 2HMTA 1GZ4A 3G1UA 5CEEA 4FCCA 1DRWA 2HMVA 3QV1A 5L3ZA 1YQGA 3P5SA 2BGMA 1JDJA 1GCOA 1HTBA 4FOOA 5IDYA 2Z95A 3GDFA 3I9NA 2OHXA 3D3WB 3VPSA 4GPD1 4IY1A 2Y66A 3WBFA 3WMWA 5GZ6A 1GY8A 3VZSA 4JP2A 5K6AC 3RKRA 1YXMA 3QHAA 3OFSA 3WIDA 2CZCA 1DIGA 1XQ1A 3IKTA 1XA0A 4J1QA 3PHLA 4TQGA 4N18A 1KC1A 2D5AA 2OGUA 1KY4A 2PD6A 2J6IA 3B1JA 1BGVA 5GY7A 3V2GA 4EZBA 1GV1A 2QQ5A 2EKQA 2PGJA 1E7MA 3RQSA 3GFBA 5EQFA 3VTFA 1ZSVA 3PVZA 4EEXA 1ZK0A 4R4JA 2P68A 5TIIA 3Q11A 3CTMA 4IQ8A 5JW6A 3RIHA 1X1EA 3FNHA 4CMGA 3G49A 3W1VA 1X7DA 1CIVA 4LMRA 5L7TA 5U9CA 3GZNA 2E4AA 4IIVA 4L8VA 1LLQA 2H9IA 3JCZA 1ULSA 3K2BA 4BHTA 4YAJA 5F3RA 2WD8A 3WYEA 4J4TA 1K6IA 1NFQA 1RM5A 3A06A 4DQXA 1GUYA 4CR6A 2PA3A 1EVYA 1H5QA 4Q9NA 1D4FA 1M6WA 3R3SA 4NK4A 3PQEA 2GF2A 2EP5A 1DAPA 1R12A 4CM8A 4PFJA 4TRMA 5KJ6A 1LDYA 3PTZA 4H3VA 1XEAA 2RHRA 4G2NA 2I67A 4NR0A 1E1LA 2PKQP 1OZAA 2DTEA 3K96A 2I3AA 2BGLA 3QWHA 3ONEA 4EW6A 3F5QA 1LA2A 1QKIA 3F4BA 4GQAA 4UAGA 4WECA 5DP2A 3MOIA 4JK3A 3VAZA 2A9FA 3Q6IA 1P1JA 3PIDA 3AK4A 4YQZA 5DCWA 3VZRA 2BELA 3D5TA 4JBHA 4JGBA 2PR2A 3ANLA 3U5TA 3RAJA 3PHIA 4NBWA 4IMRA 5ENVA 2JAHA 2ZQZA 3B20A 3CMMA 3DBLA 1U2GA 4XD2A 3F9IA 2I9PA 2DKNA 3UKOA 1I2ZA 1DFIA 4DYDA 3PK0A 3RJ5A 4WLOA 2GLXA 2JCVA 4GVXA 3WDSA 2VWPA 2VN8A 1YBVA 3QY9A 1WMBA 5H81A 4OIMA 1N2SA 1YONA 4FN4A 4ZD6A 3D1LA 1UUFA 4YPOA 2VHYA 4O6VA 4M86A 1KERA 2CDBA 1DEHA 2IXBA 1ZZEA 4LMPA 5AXDA 5KVSA 4II2A 3DZIA 4R5MA 3RUEA 4EGFA 5C7IO 4ITUA 1GU7A 4O1MA 1YDEA 2BHLA 2HUNA 3IOYA 1FDSA 1N8KA 4CLOA 4GX1A 1F0YA 1GUZA 4E12A 3UCXA 2ZYAA 4C4OA 2PWZA 1LDGA 1IZ9A 1UZMA 4BO5A 2VNAA 4AJ1A 5CDUA 2GR9A 4PN3A 3DZJA 1GPJA 1Z74A 4MKRA 4RPLA 4NH4A 1W4ZA 4CM1A 4FFMA 1C0PA 1LUAA 1YE3A 2EWMA 4JJIA 1Y8RB 3HDYA 3HWRA 3I4FA 1GYQA 3LLVA 4NFSA 1DRUA 1LQUA 2HQ1A 3U4DA 3QA9A 3JQGA 2IXAA 3WSVA 1XKQA 3IKVA 4L4RA 5DDIP 4RZHA 2PH5A 1EMDA 3BMCA 4BKRA 3PZRA 3RC2A 1ZSNA 2VOJA 3AY3A 1EVJA 1HE5A 1U5AA 5IDXA 3KO8A 1O9BA 1U8XX 4OYRA 1P31A 4XRRA 1L1FA 1AN9A 4WLEA 2J3IA 3TZQA 4FQ8A 2Q4BA 1LC3A 3KEQA 4ZRMA 2ZTLA 3SLKA 2PK3A 3LYLA 3FWNA 4AJOA 5KKCA 4XQ9A 3U49A 4DBVO 3QWAA 3TL3A 5CAEA 5A5EA 5G0UA 5B37A 4GWGA 2XAAA 1A9ZA 2IRWA 1HSOA 4KUHA 4E32A 4CUKA 2NQ8A 3H5AA 4B79A 3AUAA 1DC6A 4CM4A 3VPXA 4TVOA 3TQHA 1XDWA 3JD2A 1P0FA 1I33A 2YQ4A 3H65A 3WQQA 1N9GB 1BWSA 1Y81A 1JVBA 4HXYA 1B3RA 3NT5A 3OMLA 3WFJA 4XDYA 4PLGA 1HE2A 4YJGB 4G5HA 4BUCA 2C29D 2WD7A 3WJ7A 2OORA 3IC5A 3PHJA 4DL9A 4RDHA 4ZQGA 3LC7O 2HMUA 4LW8A 2BLLA 2ZKLA 4WKGA 1ADGA 3CXRA 3JD1A 3GRKA 4ZA2A 1U3WA 1LLUA 1DFGA 2HAEA 3GVCA 2UVDA 4D3DA 3U62A 4R9RA 4CQMD 1IZ0A 1WLYA 4MPDA 3PYXA 1E3WB 8LDHA 3U4CA 4BNJA 1NX6A 4MP6A 4PVDA 3PI7A 4XJTA 1ZJYA 4MINA 4HY3A 5JYDA 2ET6A 1LDNA 1ML3A 1C0IA 4XQGA 5CHEA 4BNVA 3W4IA 1KVTA 3JQAD 4UUPA 1P33A 4RL6A 1K5HA 4XIYA 3WS7A 3ZWAA 1UR5A 5CDSA 1V6AA 5JXWA 1HZZA 2JD0A 1G0OA 1VSVA 2BFPA 2GN9A 4Q3CA 4IS2A 5JDIA 4KWHA 1GQQA 4BIIA 1F14A 1BW9A 1P77A 1PTJA 3IUPA 3OA2A 3GQVA 4NJMA 4TROA 3V5NA 3RVDA 4RO0A 1PJSA 2BD0A 4YAEA 3FNGA 4MKXA 3GGGA 4XWYA 1P0CA 3CUKA 1NXQA 2IZ0A 1ONOA 1ZKMA 4L75A 4P4NA 4XR4A 1AXGA 4IDEA 3LK7A 3HB4X 4XX0A 4A10A 1K3TA 2BFMA 2EP7A 3KSZO 1R0LA 2F00A 2UAGA 1KBZA 3NAQA 3Q2IA 4L4XA 4YACA 3UCEA 3WYCA 3FN4A 1JKIA 2EV9A 1JWBB 3WGIA 1GDHA 3ANMA 5I7FA 4IDGA 1A7AA 2CF5A 3QP9A 4B8ZA 3OH8A 3FWZA 2J8ZA 2GSDA 1LXCA 5FI3A 2R00A 2YV3A 4UVHA 2VNSA 1H6AA 2RH8A 2W90A 1QYWA 2XXJA 4YT2A 5B12A 3IL2A 2PZJA 4BO3A 1NPYA 2HRBA 3O9ZA 4BV8A 2RAFA 4KQXA 3IP1A 4B7UA 3AM3A 3GMSA 1KY5A 1HLDA 3KM0A 3KLMX 4NG5A 1M66A 3QWIA 4EJ6A 4UULA 3JD3A 5FYDA 3QQPA 1U9JA 4CQLA 2IE0A 1DHTA 1H94A 5AXCA 3C1OA 2Y1FA 4HUJA 3RU9A 2XF8A 1UDCA 3DAPA 2IEBA 3BYZA 5TQVA 5EN4A 1ISHA 5BNTA 2A92A 3UF0A 1WW8A 4CLRB 1LDBA 2IDZA 5U4QA 2RBEA 2UDPA 4XJSA 1FF9A 1LLDA 2C5EA 1WDLA 3HB5X 2X0IA 3WGHA 3ORFA 4QTZA 3O8QA 3Q2KA 1ISIA 2OOSA 2VUTA 1EEHA 1JWAB 1PGJA 4N5MA 3V1YA 3JQ6A 4J9VA 2JHGA 5JCXA 1IY8A 3GZNB 4NK5A 3AU8A 5H83A 1U5CA 2BI8A 2HJSA 2IZ1A 1I36A 2NU6A 3E1KA 3LDHA 1TVEA 4WLVA 2NWQA 1HDYA 1JVSA 5BNIA 2E49A 3JYPA 3HFSA 3JQDA 1FDWA 2GD1O 1QP8A 1ENZA 2B83A 4ND5A 3BZUA 4YXFA 4IDCA 3NX4A 4PLFA 3ZWPA 4CQLB 3GVHA 5TLSA 1HDXA 3UICA 4TZKA 2V6BA 3GY0A 4DRYA 4BMSA 2FRDA 3OIGA 1N1EA 1PX0A 4I5DA 4PRLA 4Y67A 5IN5A 5JC1A 2W2LA 5IJZA 3DZGA 1YOVA 1ZW1A 3AI2A 4I9HA 5DOZA 3UOGA 2Y1OA 2D3TA 2D1YA 4MDHA 5HBRA 2Z5LA 5C5IA 4NNJA 1NYTA 3KSDO 1ZIDA 2X22A 4RVHA 2HDHA 2DVMA 4U0KA 4NU5A 3RUHA 1W73A 3VH2A 4HP8A 1SO8A 2YFHA 3WOHA 4K26A 5DOVA 1RM3A 5COBA 1Z7BA 1VPDA 3DBHB 3L4BC 1HKUA 4IDAA 3BMOB 3BXXA 1Q7CA 4GSKA 3AOGA 4Z9XA 4DLLA 1HXHA 3JQ9C 1QLHA 4D41A 4YAGA 3DZKA 1KVSA 3AM4A 5TJ9A 4DTIA 3RC7A 3EZLA 1B14A 2G1UA 2QIOA 2DT5A 1N7GA 3K73O 3HDJA 1GEEA 5COQA 1TT7A 5I9NA 1H9BA 1HYHA 3GOHA 3I5MA 4RLHA 1UZNA 2GN6A 2Q1UA 4DPKA 4K1LA 2NM0A 4Y8VA 3H5RA 1R4MB 1J4AA 1EE9A 5BNFA 3PFWO 4QT0A 1Z82A 5DBIA 3RASA 3S2GA 1P74A 3WQSB 3D4PA 4BO6A 4U6QA 3DR3A 2O3UA 3VZPA 3ZNPA 3M1LA 4AVYA 2W2LD 4RVDA 3BTUA 4ALKA 4ZGWA 4FBGA 4GVLA 1JTVA 1VJ1A 2V6MA 1D7OA 3ZDFA 5DULA 1YL7A 1C14A 2NTVA 5TT1A 4HNHA 3NDJA 3PWSA 4TRNA 1JAXA 4D0SA 4FC6A 1QG6A 1I3LA 4AJEA 3M2PA 2QRKA 3QSGA 1PL7A 5A1TA 1JN0A 1PJ4A 2GUGA 1K6XA 1PZEA 2YQ5A 1O6ZA 2ZIZA 4UUOA 1O89A 3INTA 4XYEA 4OOFA 1M6HA 1KVUA 1BRMA 3W6UA 3P7MA 2YW9A 4YJGA 4CMEC 2VZ9A 1GAEO 2AQIA 4CQMA 3NEPX 3VH3A 3L6OO 1BVUA 5BSEA 3VKUA 4OMUA 2AE1A 2WM3A 3ZV4A 1PQPA 1M2WA 1QLJA 1LSSA 2O4UX 4BO8A 1E0DA 4IDDA 2VWQA 3WMXA 5IDQA 1NWCA 2D0IA 1NPDA 3CZRA 3ZGYA 3H9EO 2AQ8A 3DDNA 5JE8A 5JNLA 3E5RA 4J1NA 3F1KA 3ZWBA 2HLPA 3LU1A 1PEDA 1GQ2A 2VZ0A 4WK6A 4BNGA 4YRAA 1KEPA 4ND1A 4JXKA 3PLRA 2JD1A 3O8QB 5IXYA 2FSVA 3JQGB 4HX5A 1X7HA 1LNQA 3OETA 4E5KA 1PS8A 2I76A 4AJLA 3N58A 2YJZA 3GUYA 1NQAO 1VJ0A 5JAZA 2J3JA 3I9MA 2O2SA 1M76A 1BHSA 3JQ8B 2PZKA 5T8KC 1QRRA 1IULA 3F4LA 2B0JA 1EDZA 4A26A 4U7WA 4L9RA 1OMOA 5A02A 2O3RA 3JQAA 5EPOA 3CINA 4ZHSA 2CMDA 3AOEC 4Z0PA 5L7WA 3ZV5A 4QEDA 3FF4A 4AJHA 1A27A 4YAKA 1WZEA 3DMTA 4WEQA 3AUUA 1GZ3A 3QIVA 2ZCUA 3OJEA 1AHIA 4M1QA 1OAAA 1PWXA 4IINA 1LC0A 1MUUA 1E1NA 3PHHA 3EUWA 4JJFA 4QO7A 1TB4A 2O3TA 5F21A 3OBBA 4MKZA 3WX0A 3KYDB 2X5KO 4YAIA 5JLAA 4PG6A 4LN1A 3JQFA 1ONNA 5KJFA 2GNAA 2HJRA 1Y1PA 3OEYA 4RVFA 4YEDA 3FR7A 4AJPA 4ND4A 1U7TA 2X1HA 3E5MA 5BT9A 3NRCA 3PWKA 2JCYA 2YY7A 4IIUA 4ESOA 1CDOA 4EUEA 4GKBA 1EVZA 4RF5A 1VL0A 1E3WA 2PKQO 4JNKA 2C82A 3GGOA 1P1KA 4GKVA 4RCVA 5GZ1A 1LEHA 5LC1A 1AUPA 3ZNOA 2Y1DA 3DTTA 2HMSA 1E6EA 1BW9B 4DIFA 1EK6A 4OSPA 4AJKA 3RC9A 3HG7A 1XSEA 1VL6A 1DPGA 3WLEA 1ZXLA 3JYOA 4KMSA 1LJ8A 4UUNA 1HWYA 4KOAA 1BXZA 1GTMA 1WWKA 3DAGA 3RI3A 1FMCA 2QZZA 1EFKA 5TF4A 1LSUA 3L6EA 3TNLA 3D4NA 3G0OA 3DWFA 3KYCB 1HSZA 1YB1A 3C7CB 4B8WA 2AQHA 1TI7A 3ASVA 2CUKA 4L76A 4Q3EA 3W8FA 2CSUA 4A27A 5TGDA 1TT5B 3WB9A 1SPXA 3GEGA 1IPFA 4OH1A 5T6BA 2VHVA 4CM4B 4F3YA 4Q3AA 2PZMA 3S2IA 1VM6A 1AE1A 2FR1A 3W4JA 1O5IA 4WJZA 3O38A 3OQ1A 2DBZA 3LT4A 1MGOA 1BXGA 4OGWA 3HDHA 2VRCA 3BMQB 4ZN6A 2QW8A 3PZBA 2ZB3A 2X9GA 1PL6A 2XOXA 3PRJA 3PDJA 4G65A 4HFMA 4I5FA 5JMWA 4CMCA 5A03A 1C3VA 1PU2A 7ADHA 2O7QA 3NTOA 1U4SA 3ROPA 1YWGO 2VOEA 3CZMA 3GDGA 4R51A 4BL5A 3QW2A 2QRLA 1H2HA 1GFSA 2C2YA 3PIIA 4FGWA 4E30A 1Z73A 2H63A 1I01A 3LVFO 2W8ZA 3DBRB 4QQRA 5ILOA 3ENKA 4CV0A 4W99A 2VWHA 5TC4A 1T4DA 4Q3NA 4IZIA 5DT9A 3DAFA 4CPDA 4CV3A 4PCVA 5G0VA 1T26A 1ZUD1 3VH1A 3AUSA 1C1XB 2Y05A 3PYMA 4ALMA 4RF4A 3S55A 3B1FA 4D43A 4IBOA 4AJIA 1HYGA 5ICMA 5B4UA 3GVPA 4Z6KA 2C20A 3X2EA 3H8VA 4YYZA 4NBVA 3H9JA 5TRTA 4YVFA 1UXHA 1LLCA 1U3UA 1Z7EA 3GN2A 1QYVA 1QV6A 1E7SA 1Y8RA 4J0EA 4PRKA 2OBNA 2ZB8A 4UVGA 5I7VA 5A9TA 5L4SA 3ITKA 3PJFA 4MVJG 3AJRA 3BTVA 1DLIA 1NFFA 2NVWA 1H6CA 1NHGA 3C85A 1ZK3A 3EZYA 4R1TA 4BMNA 2O3SA 3Q9NA 1UXIA 1ORRA 4JJGA 1UAGA 3NT2A 4WLFA 3CMCO 4DMLA 5I7EA 3IMFA 3MTGA 3P2OA 4MOWA 4AJ2A 1DC3A 1HDCA 1O0SA 2G0TA 4NJMB 5IZCA 2VUSA 4W9NC 1V3TA 1ZFNA 5COAA 1T2DA 3FR8A 5DCUA 5F5NA 5GZ3A 1SZJG 4FIZA 4OXYA 3GH3A 1DC4A 4HWKA 2JD2A 1P1RA 3KBOA 1EUCA 2E82A 4HV4A 3QVSA 2OL4A 3VZQA 1SOWA 2VYNA 4BNNA 3GEMA 5AVOA 4IUYA 2VUUA 4P4LA 2NU8A 2JCXA 2QYSA 1MXFA 4KUEA 3PFFA 1I3KA 4LSWA 2FZEA 1UH5A 2Q2WA 4MVJH 1KVRA 5HS4A 1HL3A 4J7XA 4JBIA 5FI5A 5IAAA 4BNLA 3PPIA 3ICCA 4OO3A 4YR9A 2EGGA 5G2OA 4KP7A 2FR0A 4TKMA 1GPDG 2Q50A 1P45A 1Z75A 2Q99A 4R41A 4IZHA 4XIJA 3PQDA 4JCOA 1MC5A 1Q2XA 3GLQA 3I4CA 1Q7BA 2X0JA 1YH3A 1LQTA 1TEHA 4E31A 2WD7B 1IUKA 1E3JA 4OQZA 4ZICA 4BNIA 5C7LO 3HUDA 4OOEA 3ZZNA 4H15A 5G4KB 4B7XA 3ZWMA 3VPFA 1I10A 1K6JA 3ZWWA 2CNBA 3STHA 1JA9A 2PD3A 3FHLA 4BNYA 3ZNQA 1XGKA 4KTVE 4QFCA 2YDYA 5ER6A 3TRIA 4QFDA 3VTZA 1IB6A 3EW7A 3TF5A 1XYGA 1ZK1A 4DC1A 3JSAA 1HEUA 3NTQA 2JKVA 3GA0A 2VHWA 4KUGA 4CMAA 4KWIA 3EVTA 1VC2A 2J3KA 1YGYA 3D64A 1VL8A 5I7SA 2X9VA 3KETA 4CM3A 1KYQA 5KCZA 2GDZA 5DN9A 3NUGA 5FEUA 2B69A 2G17A 2CD9A 3VVBA 3ZHYA 4XQCA 3I9OA 4XDZA 3F5SA 4CL8A 1BSVA 1ISFA 4NBTA 1GV0A 4CMIB 4CODB 3DZHA 7MDHA 4UVEA 2YHIA 3H9GA 1F06A 5IN4A 4JROA 1LRJA 3IJPA 4QXMA 2E6UX 2PY6A 3I1JA 3UAGA 2XPCA 3UFXA 1ZXBA 3JQCA 1CWUA 1B3BA 1IL0A 4W7IA 3BHJA 1ZMOA 3EK2A 1B16A 1DIRA 4ROSA 5ITVA 3K92A 1Y6JA 4OKNA 1NFRA 1UXGA 2IYOA 2XXBA 3W6ZA 4FB5A 3WGTA 4FR5A 3ZU4A 4B4UA 1KEVA 1ENYA 2VCYA 3HADA 1E7RA 2X5OA 3FD8A 2RH4A 3ST7A 8ADHA 5KVQA 2SCUA 3D4OA 4K6FA 1DFHA 2DFVA 4MIOA 4PLPA 2C54A 2DLDA 1V3UA 5LCXA 5T57A 4XR9A 3K31A 5L45A 4TVBA 1PSDA 3ZHXA 2R00C 4F46A 1U7HA 4BNUA 3CH6A 4AICA 3DL2A 2ZK7A 1W6UA 4NDNE 2EXXA 3DBLB 2FSSA 1U4OA 1Q1NA 2EW2A 4URFA 3PXXA 3AU9A 4EJMA 1PIWA 1Y7TA 3I3OA 4IJKA 3GAFA 4I9NA 4CM6A 1V0JA 4GL4A 3WJAA 1B8VA 3JYQA 1Q0HA 1HE3A 2OMEA 4E2XA 2HK9A 3EYWA 4J2OA 1N5DA 2PGLA 4CMKA 3WTBA 3W8DA 1YB5A 2OP1A 2X9NA 1EQ2A 1KVQA 2J3HA 3AFMA 3CSDA 3JQBC 4RPKA 2J5KA 4W6ZA 2NQTA 4M87A 2X23A 3S8MA 2Q45A 3E82A 4M8SA 1DAOA 3DC2A 3MJCA 1P9LA 5TJHA 3ZV6A 1NVTA 1CQJA 1R16A 3K8ZA 1HT0A 2GGSA 2BFAA 5CPBA 3QVOA 1Q7GA 2FPIA 5JY6A 2BKAA 3IAHA 1UP7A 1OC4A 1YJ8A 3KXDA 3P19A 4U0JA 4CMBA 3IP3A 2AEMA 3ZHBA 3ULKA 4BO4A 1EFLA 3T4EA 4BGVA 4J4HA 1B8PA 3NTRA 5B1YA 2VT2A 3E18A 3JQEA 1KOLA 4DYVA 1B2LA 3HN2A 3WR5A 5KWEA 4MVJE 1DLJA 3JV7A 4GAEA 3SVTA 2DBRA 2WEKA 4BGEA 5EL0A 1WDKA 1G1AA 3O03A 1SEVA 3FBTA 1NM5A 1B0AA 2J5RA 2X7HA 3ROMA 3U9LA 4PVCA 1YBMA 1PJBA 4XYLA 4CJXA 3WYBA 4MVJA 5THKA 5JCJA 3WGGA 3JQAB 3ETEA 3UXYA 1C1DA 1E7YA 4QSMA 3ZU2A 2CFCA 1I2CA 3RROA 1KEUA 4QECA 4LVUA 5BR7A 4XB2A 1NHWA 1SCUA 4FD3A 4CM8B 1J6UA 4FJ1A 3GVIA 2PH3A 3DEYX 3QRWA 4WASA 5ADHA 4AG3A 1T1RA 1EE2A 1ISJA 1PJ3A 3OSUA 4UVIA 3GPDG 1MFPA 3UHAA 4J0FA 3D3WA 3DOOA 3H4VA 3CE6A 3BHIA 1YDWA 2ZATA 3OIFA 1C1XA 2OBYA 4NPCA 4W82A 3E03A 1RKXA 1PGOA 4TSKA 3QWBA 2HRZA 1U3VA 1EQUA 1HF3A 2FZWA 4XB1A 5JO9A 1NNUA 3RWBA 3S2EA 4GSLA 3TFOA 2VHXA 4ONEA 4Y98A 4Q3BA 1JKFA 3WSWA 3JYLA 2Q1WA 2GO1A 1L7DA 4YCAA 2EERA 5A05A 4L73A 1NQTA 2RCYA 4UEJA 3GGPA 2NVUB 6LDHA 1ENPA 4TMFA 4J7CA 1E5QA 2O50A 2QG4A 4L4SA 5IXSA 1RM4A 1ZH8A 1WNTA 3LF2A 2Q1SA 4IMPA 5MGBA 3TWOA 1QMGA 1YJQA 4YT4A 4RV9A 5DBGA 1KETA 1R66A 3E9NA 4R3WA 5I8WA 4IXWA 4A73A 1MA0A 3RJ9A 1MC4A 3GHYA 3OA0A 4JIGA 5HM8A 3OQ6A 4EYEA 3SEFA 5KIAA 2AEJA 1DBVO 4BO9A 4ZQHA 2BF7A 4BKOA 2P2SA 3OECA 5KJ1A 2AQKA 1Y8QA 2GZ3A 4ZQEA 3BMOA 1T25A 4B4VA 5TS3A 1NAIA 3DBHA 3FTPA 1X13A 1Y8QB 5EERA 3L6DA 5THQA 4FFRA 4OXKA 5IFLA 4B3JA 1ENOA 3HZZA 3X2FA 3PGXA 5T5QA 5EESA 3L9WA 2VYND 2DU8A 3LQFA 1E3EA 4I08A 3VPGA 2EKPA 1BTOA 1RYEA 3C7DB 1H2BA 4J49A 2B5WA 3MWEB 2DTDA 2WYVA 3JQ7B 1EBFA 4BO2A 4C7KA 4FJ0A 1I3MA 1KS9A 2VRCD 2EJVA 4I1IA 4J7UA 4W4TA 1ZSYA 4CLEA 4PG4A 4LK3A 3T7EA 1DXYA 2UUPA 3ZW9A 4LGVA 1PJCA 4HBGA 3C1TA 5JY1A 3NYWA 4BNKA 4GH5A 5A06A 4O0LA 4HFJA 5T67A 3VHRA 2C5AA 4E3ZA 2JFGA 4B3IA 4CM9D 4PG8A 4X54A 2QYTA 1A7KA 1DSSG 1RPNA 2FMUA 2PD4A 4CLDA 3EHEA 3KLPX 3KYBA 4TRRA 5ICSA 4I5EA 4K6CA 1KIFA 4O59O 2FN7A 4YJFA 3UH1A 4AL4A 4YRBA 3H5NA 2POQX 2D8AA 5L51A 4QX6A 1PGQA 1B26A 1DDOA 2CDCA 1MLDA 4A0SA 3DONA 3MJVA 3LF1A 4J90A 1XCBA 4E5YA 5KTKA 4DA9A 2BI7A 5L95A 3IIEA 2ILTA 3ETGA 4PLHA 1ADBA 1A9YA 4IJVA 1RYDA 3SC4A 3FPLA 1SNYA 2Y0CA 3OJLA 3BTSA 3C24A 3AY7A 2NU9A 1N7HA 1D8AA 2EEZA 3DOJA 3TZ6A 1YVEI 4HFNA 4O5OA 3RUDA 1XHLA 1W0CA 3LSYA 4J91A 4DPLA 1DHRA 2X0NA 2RIRA 1GD1O 2EJWA 4OKIA 1X1TA 4Z0HO 2EHDA 4LCEA 4A03A 5CG2A 1I30A 4WOKA 1NAHA 2GN8A 3A4VA 1BXGB 2VRBA 1HZJA 4S3MA 4NMHA 4ALLA 2CDAA 4BQPA 3VPHA 3JQ9A 2NV6A 2WE8A 4PLWA 3RU7A 4P4GA 4OJNA 3SBOA 1F12A 1X7GA 3D7LA 3ON5A 3COSA 3M1AA 3R3JA 1Q0LA 4XA8A 1TT5A 2ZJ1A 4R16A 4BKPA 4GGOA 4KZPA 4D42A 4ND3A 5IZ4A 2JFHA 3IS3A 2DPHA 1PR3A 1I8TA 1HDGO 4I8XA 3UW3A 4WNIA 3FTNA 5KOIA 2TMDA 3ZW8A 3E48A 1RM0A 4U8GA 3PJDA 3V2UA 3GMDA 3IQDB 1C0KA 2AA3A 2B35A 2X4GA 3WNVA 1PQUA 4PIVA 4E21A 3VH4A 3G79A 1R4MA 4E5PA 1JKJA 4R1SA 3W8EA 1Y9EA 2YZ7A 4DLAA 1I0ZA 3LZ6A 2B4RO 2P4HX 3RUCA 1XIVA 4BQRA 4BB6A 2DPGA 2BGKA 4YJHB 3W4KA 1NR1A 1UXKA 2NTNA 5IDWA 1IHYA 1P3DA 4CLHA 2ZB4A 3F47A 1NBOA 3DFUA 2QZ9A 5LDHA 3I6IA 1YRLA 5K9ZA 3MTJA 4Z3KA 1U28A 4RVUA 5G0WA 3SJ7A 1QV7A 4MVJM 4NHEA 5L53A 4CMEA 3E9MA 1DIHA 4GMFA 1A72A 3JYNA 4NIMA 2D2IA 1MG5A 3JTMA 4BMVA 4BS9A 4DBZA 3GN1A 1T2FA 4CMHA 1LI4A 1XR3A 3GDOA 2O3QA 4E2ZA 1ZK2A 3Q9UA 4D44A 1T1SA 4RVGA 3ANNA 1X0VA 2ZCVA 5G4LA 2V65A 3HJAA 3PHGA 1B15A 4FOSA 4DIOA 4RDIA 4MP8A 5ITWA 3R1IA 4RPHA 1YB4A 1H93A 2JFFA 1QORA 4DQVA 4WCFC 3GF4A 3TPCA 4LVCA 2E37A 3OICA 5DNAA 3INRA 5AYVA 1HRDA 2I66A 2V6FA 5G0SA 2WJPA 1EZ4A 3FBGA 1HDOA 4RPJA 1R0SA 2F1KA 4ZVVA 1IOLA 2CY0A 3K2EA 3N7UA 4E5NA 2EKLA 4EDFA 4FFLA 4E0BA 4L74A 1W8DA 4KDEA 2HU2A 1M67A 4CM7A 2R2GA 1PJLA 4I9UA 4DLBA 2P5YA 3IJRA 3MWDB 3B70A 4BNFA 2Z1NA 3PWZA 3Q1LA 3C8MA 4JX8A 2DUUA 1OC2A 1YBAA 1ZEMA 1YKFA 4DWVA 4FFNA 2HMWA 5IF3A 1CQIA 4J16A 2GASA 4GGPA 4IS3A 3ZWOA 1BXKA 4CUJA 1LDMA 4BNTA 1EK5A 3NGXA 4OQYA 3CEAA 3UUWA 3EMKA 3U09A 1M75A 4RF2A 5B4VA 3KEOA 3C1AA 4JN6B 4TZTA 1PZHA 1R15A 3DHEA 1VE9A 5L4NA 4I5GA 4MVJF 5T64A 3FRJA 4CMJA 3K9QO 3ONDA 5CG1A 4DREA 4AJ4A 1OBFO 3EC7A 2EW8A 1UDAA 2Q2QA 4FW8A 2FP4A 5I9MA 4II3A 4DPMA 3CKYA 4R3NA 2JJYA 4LISA 4XGKA 3GNQA 3VVCA 4FDAA 3M6IA 3V2HA 4FGSA 4WUVA 1BG6A 1PJQA 2DUWA 3HSKA 2C0CA 4IQ0A 4OAQA 3LC2O 2IODA 1HE4A 3BA1A 1D1TA 3OF2A 3U3XA 2WMDA 4MO2A 4UEOA 2D59A 4BO7A 3VDQA 4R5HA 3D5QA 3KRTA 4BNWA 4Y6RA 4YJDA 1PJTA 2I6TA 3HQ4O 1X14A 4BNHA 3NGLA 1YL6A 3LT1A 3KOUA 3PQFA 5AXAA 1RJWA 2PV7A 4FSHA 5JDCA 3LT2A 4YRDA 3DXFA 1VI2A 3WGZA 2WYWA 4AJJA 5JMPA 4EJ0A 4OM8A 5CP8A 1J49A 5IZCC 3PJGA 1E1MA 4W9NA 4BKQA 4RORA 1DO8A 1T24A 4D79A 3BMNA 1DB3A 3A9WA 2ZTVA 1P44A 1ZBQA 1WXDA 1E6UA 3TOZA 3AOEA 4LRTB 4FPXA 5EJ2A 1FXSA 1GADO 2G76A 4MVJP 4XYGA 3GG2A 1V9LA 3WGYA 4IJUA 3SJUA 1NTOA 4U6SA 1PGPA 3BIOA 1E6WA 1PQWA 1R37A 2GYYA 3AUTA 5C37A 1L7EA 1FJHA 1R4NA 4OL9A 2NNLD 5ER9A 5TNXA 5GMOA 4IQGA 4LSMA 3V1TC 3E9QA 2JL1A 3ZN2A 2ZQYA 4BGUA 2P9CA 4MP3A 2PLAA 2ZYGA 4KDFA 4ZJUA 2NVBA 3WBBA 1Y5MA 4IJWA 4E2WA 3O26A 3ZWCA 5F5LA 1DOHA 4M49A 2GRAA 2YUTA 1S6YA 2X8LA 3BTOA 3RD5A 1C0LA 3KTDA 4WCDA 3NT4A 1PL8A 4BO1A 2DM6A 3DZBA 2W2KB 2FPPA 3ITDA 3ZWVA 3ZCXA 1X15A 3WWYA 4E2YA 4Z0TA 2NVUA 3QLJA 1UJMA 1GYPA 5CPFA 1HETA 1MFZA 1QR6A 1VSUA 5JSFA 1EBUA 2FR8A 2W2KA 1R0KA 3OEWA 3LC1O 1T2CA 2WYUA 1PS0A 2O48X 3H9UA 2X0RA 2GN4A 1J0XO 2YHIB 1AGNA 1JU9A 1FDVA 4H7PA 3C7AA 9LDBA 1FK8A 2Y93A 2WDZA 1LRLA 4RJTA 3BMQA 3ZWNA 3N74A 1YO6A 1XQ6A 2UYYA 2FOIA 1KEWA 4FC7A 1QYCA 3E8XA 3MZ0A 1SB9A 3TZKA 1FDUA 4Q39A 5CEJA 2GZ2A 1XWFA 2QHXA 4QO8A 1Y9AA 3INGA 4XKJA
chains in the Genus database with same CATH superfamily
1DBPA 3GZ4A 5K0GA 4OBBA 3KQPA 3R9XB 2IPMA 1N92A 1UBSB 3SX2A 5JWRA 4P4SA 3A7EA 1BU8A 2IDJA 2ZJ6A 3MG9A 1DMSA 4YAOA 3TW6A 1QYXA 4U9UA 5DMHA 4ZIRB 2BFOA 1ZO8A 1ZHOA 1C7FA 3BXPA 1RVDA 3RG8A 1PWZA 1TECE 3C3PA 3SS7X 1RFLA 1Z5ZA 5BV0A 2F1JA 4JI3B 3SXPA 4X1YA 4TS1A 3CCCA 5EKTA 4X00A 1OROA 4F84A 5JSQA 5JTUA 3OPNA 2RD2A 1UAYA 3ECSA 3EBPA 4LPKA 1DIAA 2LDXA 2ZAMA 1O8CA 1P2TA 4B47A 4UM9B 1GUFA 3KU1A 3EEFA 1JDPA 5BQFA 4UATA 2AGVA 5EFZA 2WT8A 4BB5A 5HQ3B 3I0NA 1OT5A 1SGWA 2WUVA 4ZCIA 5BN4B 4RSHA 1NNLA 1AKUA 3CN7A 4OHUA 1CCWA 2HRQA 5K01A 4PZ9A 2BN4A 2Y0DA 3R0VA 4UBLA 4HDQB 3K0FA 1SQ6A 3RYTC 2WR8A 2O2YA 4Z9YA 3RS0A 2B1QA 2IIQA 1I5EA 1BMFA 1PGNA 4ZZ0A 1GQYA 3B9BA 1YV9A 1E3IA 3OQJA 1WBDA 1E69A 3SPXA 1KAEA 1SVMA 2PYIA 4NQZA 1F2VA 1QXSA 1XRLA 3KLOA 4Y1FA 4EF6A 5C8YB 1MVNA 1VKHA 4G9EA 3WAKA 1P8AA 4YWHA 2OA0A 2FK8A 5AJTA 5F73A 1P3Y1 3VTAA 2YKGA 4QD3A 3E2PA 5C7OO 2ZRIA 2Q4EA 2HMAA 3RSSA 1LWOA 5JWOA 4NXMB 3N07A 3NM4A 3E8SA 3SMVA 1ES9A 4IF4A 5MN6A 2PUAA 1N34B 3F8SA 4MHTA 4JUCA 1EFDN 4KBFA 3R9XA 3ESDA 2UUOA 1NU6A 1Z45A 2FEKA 4FMCB 4IO1A 5TPZA 3G9QA 1E1RD 3OHSX 3HV0A 4JYBA 1CLEA 5LDGA 3TW0A 1FW6A 4IM7A 1BVRA 1DDIA 2WRZA 1G98A 2CLOB 3BGWA 4UUBA 4UM9D 1IIBA 4O63O 3RS2A 3NBZC 1P2UA 1QQAA 2FMTA 2P6PA 2MYUA 4L51A 5DIZA 1UJ5A 3WK4A 2EBHX 4B0PA 2AG0A 1GTSA 4EKDA 2XGJA 2BEUA 3I37X 3ZZ1A 3UT0A 1XBTA 4A0HA 4D9MA 2TRSB 4BLQA 3MFYA 4D9IA 1VSBA 3WQRA 1RAHA 2VDWB 2FUCA 3ZLVA 5DYGA 3ENNA 5L7YA 1W88A 3OZEA 4MKGA 3ZE0B 4AMVA 4YCNA 2IZOA 3FKQA 4XTRA 1GVHA 4BQEA 5DP1A 3ILHA 2QZSA 2GJAA 3UAZA 5IM4A 4NYIQ 2O7VA 5H70A 5KJCA 3SE0A 3LSTA 1HYEA 2GYVA 2O7SA 3ISTA 3DO6A 1E2IA 2NZYA 2IYEA 3JRWA 3MTBA 4YREA 3UV3A 5LPNA 5EP2A 1PZXA 2AB0A 3NXSA 4JODA 3BSYA 3VC1A 5LKRA 2Q3EA 1EXVA 2OXIA 1S3GA 5DXJA 1T5SA 3JD0A 3E27A 2PXAA 1XRPA 2XUKA 1LSOA 1QRAA 2NSYA 2VP0A 2PJUA 2D1FA 4BVEA 1E3MA 3FHJA 5F1OA 1QP0A 1IYZA 1MKYA 4M2LA 5TQ0A 3FYUC 1H4VB 5J2TA 1Z2PX 3NVAA 1EH5A 3HKDB 4P5PA 2Z8YM 3SI7A 2CVQA 3UAYA 4FQ5A 4DIMA 5JSYA 3P2YA 4KNVA 4CMIA 1OE0A 1JFFB 2Z1MA 1EI9A 1IBRA 1L1RA 2G0AA 1WPGA 1IHXA 3QVTA 4YV7A 1A5SB 5CDYA 2JGJA 1DMRA 4R6WA 5H5JA 5AHXA 5I45A 1PUIA 3DUWA 3AF4A 2Y9MB 2I7CA 1XVVA 1F9EA 2FPRA 1WZIA 3FGZA 1WMDA 4K6KA 5FR2A 5TX7A 3AF6A 1X87A 2GJ4A 1HO3A 2ECQA 2VO1A 1B0UA 2AR7A 1E1KA 1BDJA 1E4EA 4MV8A 1ZRMA 4AO6A 1KO8A 2MSNA 3C6YA 1RWBA 1ZMTA 3R0JA 1BMTA 4ZEXA 2FWMX 3EDYA 2ST1A 3H7AA 2PMBA 4QUBA 5EQDA 3GFQA 3U26A 3I9FA 1FS6A 3DHYA 4O4HA 4Q1CA 1YL5A 3ZDCA 2QAGB 1J5PA 3EXG1 4TOIA 3WK9A 1YDMA 1Z8NA 3KAJA 1L7OA 1PG0A 2JLVA 3R6DA 4X3OA 2LWIA 2VTBA 3CZQA 5K4AA 3K30A 3EF0A 1I3OA 4FS3A 4HWRA 4F4IA 4J3FA 3D4IA 2I2WA 2DWUA 2J4CA 4OM7A 2FWJA 1TO2E 2YJ6A 2RGNC 2BR3A 3MJEA 1AUQA 1SMKA 3KYCA 4BAZA 1YS4A 3SZ3A 3UJDA 3DQQA 4Q9AA 5DSXA 1XYVA 4A5SA 5HJ2A 3SJBA 4BJ1A 4URHA 3W9UA 4L6CA 2NO7A 1VHLA 5JCPA 2M98A 2WFMA 3T6KA 1CF2O 2Q49A 3JPYA 9LDTA 1O6CA 3KB8A 4A91A 5FRDA 1V1RA 2QYOA 2XBLA 2DEUA 2GWRA 2RB5A 5TPWB 5M7EA 1VLMA 2CVPA 5HEKA 3KWFA 3AVQA 2XUPA 4P8RA 2X0EA 3FRIA 1HLPA 3DS8A 5A04A 4G1CA 4Q7JB 3DTVD 4RQBA 3NNNA 4IHAA 4DANA 2ZITA 1R8XA 1XTJA 1FNDA 4G5OA 1NOJA 2DTXA 2Q5HA 3NR2A 4GG1A 1GYRA 2CKDA 2E48A 1I2BA 2FZVA 2PS9A 2VT7A 2QRJA 3IQIX 3PBKA 2YHUA 2PLFA 3WO1A 4HAVA 4RZXA 3NUQA 3OQMA 3K9FC 1C8KA 1PSZA 3TQRA 2W98A 2WUEA 3RFUA 3DV9A 3UBTA 1LRKA 3GOQA 4PX5A 1NIPA 4HNGA 4DXHA 2HQSA 1BDBA 3DMYA 1Z37A 4EB8A 4TMKA 4ESHA 4ZEMA 2NSDA 1IWBB 1WM1A 2AZDA 2GCEA 2Y68A 2ZI9A 2O8VA 4MS1A 3BRSA 3GP5A 4MVXA 3WLIA 4KPEC 4WNCA 1VCMA 3RTGA 3TKLA 1YQDA 2QSZA 3IERA 1IEQA 2Q1TA 1V45E 1ZNQO 2OV6A 4JC5A 1NQ5A 1VPEA 1A9SA 1UC9A 1ZD4A 2E5FA 3DEJA 3KZCA 3PQCA 2NO4A 4IL5A 5JCJD 3AFIA 3ESZA 1I4WA 1ULUA 3K5PA 2I99A 3KVOA 4ALIA 4CM9A 1QGUB 4RDCA 3R5JA 3KZVA 2PZGA 3C43A 3QA3E 4QATA 2QGFA 4D3FA 3H4MA 4XKJA 1E2HA 2YWXA 4MR8B 4OAPA 1P2FA 3DLBA 2I65A 4JMLA 3SJAA 4JZYA 4O5AA 4RTKA 3QVKA 1ZITA 4FUTA 3D0OA 3WKEA 3GVXA 2FHSA 4E09A 2C9MA 4JLUA 3ZZUA 4J43A 4KYIB 1PUJA 4Y2GA 5F7JA 1UDBA 2ZVJA 1QH1A 1DG3A 1Y3AA 4M36A 3CRVA 5CLIA 5EG5A 2Z2ZA 4ZU3A 4D3SA 4HTFA 1WMAA 1Z25A 3E8MA 4PZUA 2GBPA 4D4JA 1CZHA 3ORYA 3AZPA 4QDZA 4PYQA 3LUHA 5L9AA 5BR1A 2DPYA 3SSAA 5AI5A 4BFWA 2VH5R 4FZ5A 1TW3A 1OVGA 5AVKA 1Z4MA 1SOUA 3DZCA 3ESYA 3V7YA 2HF8A 3RVPA 2FFRA 2LKCA 3G2LA 3CVVA 3AI3A 2AXEA 2P5TB 5IUKC 2HSDA 1JBQA 3QVGB 2CL7X 4JUDX 2ZTUA 5FJIA 4KQFA 1AGPA 4RL4A 3MRXA 4C7JA 2XYGA 3OSZA 1T2EA 3TL2A 5BUQA 5T4BA 3AIMA 2BFCB 1KAQA 2XE6A 2VF7A 4G9BA 3PR3A 2OUIA 2PEZA 1JGTA 4NNOA 4HDNB 3DZFA 4BKMA 4E94A 3PT9A 4F21A 5JZOA 4FIDA 1NVGA 4MGKR 1E5LA 4XUGB 3S7TA 2PT6A 3IAFA 4YUVA 5KHLB 4K5QA 2BISA 3C15C 1JNYA 5AM5A 2HSEA 3C3EA 2OO7A 3TNJA 2P3QA 2ZSDA 1PRYA 1XLTA 2QMUA 4BP9A 4R3UC 5HOQA 3WXBA 5FEMA 4TXNA 1CP3A 2G28A 4BZPA 3BVPA 3NBUA 4WHMA 4BOYA 1MP0A 3KALA 2C2MA 5KNCH 4RXMA 1ECJA 2HCFA 3PP8A 4LPSA 4P54A 4XYBA 3KSUA 4IXMA 1WULS 3I2HA 3L7DA 1TKCA 4FEYA 5DLDA 1G7TA 3F78A 4XEHA 4ZQCB 3TVTA 3BHMA 4ETMA 3GFVA 4Z4EA 3NVMB 3TOSA 3DXYA 3IPRA 1KZGB 3O94A 1F20A 5DK6A 5CA0F 1KH1A 5IXJA 1G20E 4C2UA 2FG5A 3CG0A 2V7WA 2VAXA 2WMOB 3T4PA 1YT5A 1A4UA 2A9VA 1IXZA 3DGEC 3M49A 4XX0B 1ISPA 1AQLA 3DWGA 1NBME 4IIXA 4MO9A 4AZTA 2PH7A 4BQIA 1EINA 4OQMA 2ZUEA 1N5IA 3AR3A 4L1KA 4HDSA 1RCFA 1K8QA 1RRCA 2CWDA 2JFYA 3WADA 1VKRA 2QVGA 2O5EA 1XU9A 4ZTUB 2H1SA 5AOVA 4HQKA 4LVNA 4UUMA 1Z07A 2JGLA 4NPAA 1XTPA 1KEEB 1V5GA 2LXNA 3NHUA 3QF4B 1E2UA 2PS0A 4R7ZA 4LGYA 5DHQA 1W34A 1Z2OX 1OAOC 1M2OB 3QKSB 4L0QA 3F46A 1RKVA 3OF5A 3FJ1A 4Y9RA 1H9AA 4HI0E 2J5BA 2ZBRA 3N0VA 2OAEA 4OUDB 3W9SA 3V8MA 3ZXXA 3UK0A 1DO0A 5LR6A 2P77A 4RW0A 1TA0A 2AG5A 1Y4AE 3CRZA 1RTTA 4MQLA 4ZO4A 4AECA 1K2WA 1U65A 4OHXA 1FTGA 1I32A 1KU0A 5KJ1A 3LQKA 4B4WA 1NW7A 3LUDA 4FILA 2GCOB 1RZUA 4J2HA 4L4YA 1PT8A 2ZJ7A 4P7GA 4RPGA 3RARA 1UDWA 4BO0A 4H1TA 4DJAA 1T9HA 1SHJA 5DGDA 5DF1A 1V9SA 1TZKA 2ZI3A 4INOA 1FVHA 1YRAA 2I55A 2MU1A 2KBEA 4M0LA 4JDUA 1S8NA 4XSGA 5EIBC 5LBUA 3EVGA 3U3MA 3UJCA 2FKAA 3EVNA 4XGIA 4MVJD 1DI0A 1HORA 3KKQA 1MEEA 1CJSA 3M9LA 4FFPA 4NV0A 4X7BA 3ZE2B 1I1NA 4I1RA 4WOJA 3HEAA 2FZ4A 2J5XA 2XWBF 4X1OA 2DCUA 4Q47A 3GA5A 1NBHA 2HWWA 3N39C 5TGTA 1F5SA 2CK3A 1TA4A 4FJ2A 4PAMA 4G1UC 3C45A 2C7OA 2Q8PA 3STUA 1QQTA 4ZFNA 4C0QC 1UPTA 1KRWA 3QF4A 2W6QA 3NEYA 5TPWA 1ZL2A 3TSYA 1FFBA 4I1VA 4JC0A 1Z35A 4V0MA 2E6KA 4AM8A 4C3OB 3N0TA 4JOSA 4P86A 4S24A 3BH0A 1S2GA 5JFOA 1T6ZA 4HQRA 4HG2A 4MVCA 1SQ5A 4QLAA 3ROKA 4EGAA 1I7QB 3T7CA 1XD8A 3TIXB 1UKZA 5JJKA 4DWWA 3B12A 4UBIA 4G0YA 1T9CA 1WU8A 1Q1GA 2VUHB 1SXJD 1UBLS 4FYPA 3GBSA 4FFVA 4P3NA 3FSEA 3T9CA 4B3CA 1L2TA 1Q95A 3DAYA 3DVQX 3DF7A 3EISA 4YBZA 3NJ8A 3WLHA 4YRNA 1R50A 2XD4A 1LDEA 2C78A 3MJHA 3GR6A 3ZVKA 5EMJA 2FY8A 4Y9TA 4M9ZA 4CVNA 2GCIA 1D6SA 1YCHA 3MXTA 5LXTA 3KTAA 1V43A 1KPGA 3ODPA 4JQCA 2D5IA 3G0DA 5E6SB 5ES3A 4TTVA 5D84A 2J9XB 1MG0A 1U4NA 3A6FA 4A23A 4F71A 1VOTA 1W19A 2IZZA 3GDWA 3LQ1A 3DE6X 2NPIA 1ZGCA 3QZUA 3VSEA 4DC0A 5C8YF 4KO3S 3HEBA 1VL2A 1Y0BA 1QP4A 5HK8A 4YUZA 2Y0EA 4JUBA 4GX5A 2A1TR 3G7NA 1N9GA 5J23A 1KZ4A 1V5FA 3K72B 5BQOA 3Q3CA 1Q12A 2AFVA 3BWVA 3CEJA 3UKDA 2NSLA 5LQDA 3AONB 1T1JA 2OBFA 2JIZA 5GGYA 5KTRA 2FN9A 2RJNA 3DOCA 5EJGA 5LOVB 3R5HA 4JT8A 5B57C 4H59A 1WSAA 1EFRA 4X1KA 1I5RA 4YRTA 1QBKC 2FPUA 3FB4A 2VP4A 2F3UA 3DB2A 2HKIA 1WSDA 4M1YA 2HXYA 4BNMA 4CTNA 3QXCA 2UUCB 3FROA 3HGQA 3IKJA 3L06A 1SXQA 1GZ7A 2OOKA 3FNEA 3ZW7A 3KL2A 3QOWA 1SCQA 5BSUA 4D81A 2W6ID 3DWIA 5JXHA 4ZOQI 3WNQA 1UFQA 4CQMB 5EE0A 2EF0A 4NV3A 3MAGA 3HE3A 1RWNA 4NX2A 3UANA 2VLBA 3IEPA 3ZLJA 1ARZA 2AEFA 4RC9A 4US0R 3B6KA 3OIUA 4MVWA 4A2CA 1U8FO 1J2TA 4MWSA 2DC1A 4MQEB 1Y5NA 3WL8A 3GJ7A 1EM8A 4LX0A 3SDBA 2XHEA 1RRMA 2QTTA 4RLSA 1ND6A 4GMGA 3THOA 1AZTA 1CUIA 4D9GA 3WBJA 4Q01A 4TWIA 3SLGA 1XMOB 3K20A 3ILVA 1IY2A 1P5ZB 3OCCA 4AD8A 1Q0QA 3S1LA 3CLKA 1WD5A 1J2EA 2F9FA 4IKEA 5K0ZA 1UWVA 3BL8A 3EDMA 4LI0A 3OY7A 4LJYA 3UXHA 4R1LA 2WQ7A 2H6EA 4XJXA 2WPDA 3S2FA 4D5GA 1SWVA 4D7AA 2B1GA 2Y67A 1ISSA 4CR8A 4E7PA 5DO9A 1X80B 4RGBA 3K05A 3WQBA 4IDBA 5IX8A 3U0VA 1X7WA 1NL3A 5E8RA 2AUNA 2XODA 2J9RA 2QORA 4K9OA 4N48A 4YT5A 3JTEA 1UBJS 2AG1A 2CNKA 2EFGA 3C3YA 3MWEA 3L41A 4GIBA 5TB5A 2HA6A 1JPUA 2C0QA 3QIAA 4FKZA 4LRSB 3V8NA 3ZKAA 3ZQ6A 1Y9JA 5ALDA 3K32A 5TE9A 5C35A 4WZ6A 1U0GA 3H5IA 3ONWA 2W6JD 1ONPA 1WPQA 2PFKA 2P9FA 1YOVB 2WZCA 1CQZA 1NBMD 3FA2A 3QBTA 1QH8B 1V5WA 4OQQA 1E8MA 1L4KA 4HS9A 3FPBA 4QC2A 3ROQA 3RVLA 4OI4A 1CR1A 4J1SA 1GZ4A 5DYWA 3HKBA 4MUFA 4YCDA 3T0GA 3TFWA 4ZQIA 2P27A 4AO8A 2P6UA 3N6XA 1IJKA 2HMVA 2BGGA 7GPBA 5JANA 5L3ZA 2W22A 4NQRA 3ES9A 3KQSA 1TJYA 1NLMA 2G88A 2FFBA 2WJJA 1ZLXA 3TNFA 4C22A 2FPWA 3GLFA 4JZKA 4RA6A 2B4KA 4GPD1 2QG9A 3L1HA 4IY1A 3WV4A 2WKSA 2Y66A 3WMWA 2L0XA 3HFRA 4KLAA 3DLHA 4MEJA 5HUQA 4JP2A 1M0TA 2BR5A 1LBIA 4OHFA 5K6AC 4WI1A 3BEDA 2CDRA 1Z0ZA 4FYMA 5IAKA 1JQJC 2WKRA 3OFSA 3WIDA 3I6BA 4K2AA 4HWOA 3C3BA 2OV8A 3QMWA 5M04A 3AB7A 1CVLA 2OLJA 3KWJA 1DWQA 4AYWA 4Z2AA 1KC1A 3WGMA 2OGUA 1KY4A 1UADA 5AKJA 1XNRB 4ZMRA 3FMGA 4BTEA 3MCAA 13PKA 1UAAA 4C4PA 3ML1A 2QQ5A 2X1MA 3PVSA 4ZARA 2VSNA 3VNVA 3T1HB 3R77A 3IHLA 3RQSA 3GFBA 5HKBA 4P83A 4ON9A 2PUTA 2V7BA 4OGFA 4B6OA 2R5WA 1XVTA 1ZSVA 4EEXA 2G72A 4YFYA 1JWLA 2VTKA 3WI7A 3CSUA 3KIPA 4E4TA 4QG3A 2FTKE 1XTKA 4JVSB 2PG3A 2B9EA 1N32B 5CBKA 5LIRA 1XXLA 2J3LA 2R96A 3BGVA 3G49A 3JAKB 4KSYA 4ZEWA 1M7BA 5U9CA 1WCYA 4DCUA 2AFRA 3AUKA 1V1MA 3O2QB 4P5EA 3K2BA 4JCCA 2OFWA 2XE7A 3Q3GE 3WYEA 1M2VB 1WBJB 1K6IA 2AMVA 1AS3A 3AP2A 8ATCA 4GR4A 3LCJA 2XDYA 3QXSA 1HKHA 4JL6A 4MCIA 4TV8B 2X3FA 5DB4A 3VOTA 1KEKA 3TZBA 4CR6A 3EBLA 4KN6A 5BR8B 3UPUA 2AKAB 2VSYA 5KAPA 1M6WA 1A8UA 3BIWA 4NK4A 4AQYB 3D31A 1J22A 1HGXA 1M5UA 1DAPA 1QFJA 3ISVA 1Q84A 1NLYA 3PTZA 3N8GA 5FI0B 4H3VA 2DR3A 2JEZA 1BE8A 1XEAA 2RHRA 3K5HA 1WV1A 1E6CA 3QUQA 3K96A 4K3UA 2MIIA 1T5IA 5IW8A 1XAGA 1LA2A 16PKA 1MTOA 3LW8A 2TSYB 3ZX5A 1B93A 1NRIA 3UV7A 4LC9A 4E03A 3EY9A 2I2CA 1P1JA 3LYAA 3VZRA 1UMBA 4ZCTA 1NZFA 3IXMA 1L4UA 3NGMA 4YRSA 5KU1A 3P45A 4JGBA 2PR2A 3ANLA 2IV2X 1F5NA 4I3GA 3U80A 1I14A 3N5KA 3M6XA 1BYUA 3MTEA 4L57A 5CYPA 2P3OA 4AUEA 1YR2A 3KXKA 4OCZA 2HNAA 2JAHA 5LYYA 1WZUA 1JDBB 2OWEA 3QV2A 2D00A 1J07A 1KRHA 1TQDA 2PRIA 3F0TA 1CULC 2OSBA 1DFIA 4ZO9A 4DYDA 2JCVA 3A1SA 4EUNA 2EP8A 2OILA 2V3VA 4I8DA 4QXOA 1YBVA 1U9YA 2QAGC 2CVFA 3KUKA 5CLJA 4BVHA 4C4RA 4CF4A 2HFKA 4QU5A 1IWPB 1PFKA 4Z1MD 1Z4PX 4ENTA 4DRXA 2CDBA 1DEHA 5B1EA 2XIQA 2RGWA 5BN4A 1YQ9A 3ABRB 2WNSA 5IMSA 4YDHB 2I78A 3PEWA 2I2FA 2P7HA 2A0UA 3KKMA 4MGYR 1T8SA 4AYTA 1T5DX 1YDEA 2J9YB 4ID3A 2H5JA 5LB4A 3SBXA 4D56A 1ZOPA 1KF0A 1JR2A 2VVTA 4OJYA 4JI1B 4E12A 2PZAA 5AW2A 4A15A 3VU1A 4O25A 3EZFA 2LGJA 1PE0A 2Q5JA 2ZYAA 3NC0C 1LDGA 3QLUC 3ZLBA 5JXIA 1N78A 3R5KA 4Y2SA 3SC2A 4K8OA 5T41A 4EO9A 4AJ1A 5TV2A 5CIYA 3MCTA 3DZJA 1T5TA 2X15A 2AVNA 5PNTA 4QSHA 1FRNA 4YLYA 4NH4A 1RXEA 4ZIRA 4XASA 4EAQA 1O08A 2UZ1A 1X9HA 1DARA 1JG1A 3HDYA 1WQ3A 3LLVA 2CKMA 4PZYA 3U4DA 4AIIA 3I09A 1QH9A 3USES 3HR4A 4YAWA 4FHFA 3FOWA 3IKVA 4C2BA 2XBMA 1QK3A 1UKVY 1PVDA 5DT2A 3V3KA 3B9RA 1ZSNA 3FPHA 4ZVLA 4LWPA 4O4HF 2CB0A 3KO8A 1O9BA 5J5AA 3FCYA 4DCTA 3VR4A 2J3IA 1UODA 2C2WA 2GZDA 2NV0A 2Q4BA 1NMYA 3B6MA 4ZRMA 2B98A 3S68A 3U9TA 4LF8B 1FNBA 1S4QA 3LYLA 4PYMA 3THXA 4AY2A 3EEQA 3MUFA 3FUTA 3O75A 5HF9A 1N77A 5J4KA 4CCWA 3DKVA 1LW6E 4FKBA 4IHQA 5EQJB 2FUKA 5CLLA 3RC8A 2JH9A 5DXFA 2Q28A 1P5RA 4Q1EA 3R41A 4KUHA 3SQLA 4E32A 1QG4A 3Q41A 5CNJA 1KR5A 1SHLA 1RYNA 2VHTA 1JI0A 1RZRD 5GJCA 1M6YA 1NJ8A 2CXRA 4IVNA 4TVOA 4REOA 3QFCA 4UNRA 1TCBA 1PR5A 2EFHB 2O0HA 3JD2A 3OLXA 3BILA 1KFCB 3AHFA 2JJQA 1BWSA 3KKOA 1B3RA 2YJ3A 3OMLA 1MHPA 4R9UC 4PLGA 5LP6A 2ETXA 3U5ZB 5FHQA 4IRUB 3WJ7A 1QHFA 2GEDA 2OORA 2N1MA 1CF9A 3PHJA 4RDHA 3BXFA 4LW8A 2BLLA 3A4MA 3SC2B 1ADGA 3H6HA 3KR0A 5D5QA 1SZCA 2CEKA 3JD1A 3VJKA 2G0NA 3KB2A 3P2MA 1U3WA 1MJFA 3UGTA 3GVCA 1G18A 2PXHA 2UVDA 1XN1A 3WGVA 2HUPA 5A3JA 4BQQA 2BFFB 1L7QA 2BMDA 3U4CA 1XAHA 3ZE7A 4PVDA 4LHXA 1TCVA 1UOOA 4XJTA 1TQ4A 3U1TA 1JHYA 2ET6A 1LDNA 2JVJA 3RAGA 4TUYF 5G02A 5JZMA 4OKSA 3Q72A 2A4MA 1NDHA 3EDQA 3M1YA 4NCNA 1S96A 1K68A 4XQGA 3UMCA 3W4IA 2A5FA 5M3BA 1KIMA 1P33A 4D8YA 4HVLA 4O2BF 1AU9A 2AFHA 3WWDA 4HUQB 1AO3A 4X66B 5ALJA 5JXWA 5GJBA 4LTNA 4UDNA 2ZBVA 3E9CA 5KCMA 2PX6A 3T7RA 1ECGA 2IQIA 3M6MD 4AQDA 4XM1A 3HNOA 3G13A 4D57A 5JDIA 2IHNA 4BIIA 4Q9JA 2VHUA 3HB1A 1BW9A 1NMQA 1P77A 1PTJA 1R6AA 3IUPA 5EIHA 1P7VA 1KEEA 2WWVD 3RVDA 4DY6A 4RO0A 4X1IB 3CBQA 4L6AA 4YAEA 5J40A 3W3AD 3BF8A 3W90A 3CR7A 3DLIA 1R5NA 3HKEB 3I12A 1N8SA 1JTFA 1QVWA 3UWPA 1ZJWA 5FLEX 3NIWA 1N2GA 2REBA 4P4NA 4XR4A 4YRRA 3UJ6A 4MQUA 2XA1A 3CLRC 1COZA 3LK7A 4XPIB 4F5WA 5LWQA 4XX0A 1LQ2A 1W46A 1MOZA 2EBWA 3DDWA 1IG0A 3PGLA 2UAGA 4HX9A 3WK8A 1L5QA 1KBZA 1IWOA 1TU3A 3NAQA 4L4XA 2JLAA 4Q1DA 4ABYA 1FIUA 1KH2A 5FWXA 3HJFA 4ZK2A 2PBZA 3OOYA 4CW7A 3BK1A 3NU1A 2VPQA 4O02B 3ANMA 3GV0A 1RI2A 2QS9A 1L7PA 1C8BA 5BXQC 3UAXA 4EJ2A 3AQ4A 2BTOA 4LHSA 4Q4AB 4IDHA 3SHWA 4IJ6A 4CCYB 3PI6A 2H1WA 1I2MA 1JKJB 4OF4A 3AC0A 3SG0A 3UTDA 2IH5A 4HPXB 3RHSA 2PX5A 2XCSB 1QO9A 5FOXA 4B3SB 1GL7A 5B12A 1TM4E 1WXEA 1RYYA 2FG7C 2PZJA 4U7TB 3O9ZA 4M1MA 4DAEA 3ZVLA 4KQXA 4KSCA 3WMGA 4EA6A 4F93B 3TECE 4PU0A 5EKSA 1SQFA 2Z57A 3ESAA 1T3GA 5E2BA 1JG3A 3REOA 1M66A 1QG2A 3QWIA 5JQGF 5FYDA 1RC8A 2E1PA 5AM4A 4CQLA 4F9FA 2IE0A 1DHTA 4L95C 3WP0A 2VDQB 2PLWA 4HUJA 4QVIA 1M9NA 3DE7X 2DFPA 1P4GA 1UDCA 2QLFA 3CNOA 5C1BA 3DJFA 4D26A 3MGCA 1XDDA 2FWAA 3RGWS 1LDBA 5JAHA 2VJOA 5GP1A 2A9PA 3B1XA 4MR9A 5CDHA 2QF7A 4QT4A 4ER0A 1OIXA 1VLQA 4LZOA 3EIUA 3E61A 3AHDA 2J1LA 4L5AA 2I54A 1MOSA 4O4IA 3EPHA 4EI7A 4LC0A 1E9EA 2OBLA 3Q2KA 2O1SA 2OOSA 2VUTA 5AI4A 2I22A 4A8PA 5LXTB 3PXDA 1AG9A 3FLAA 4ZTBA 4F5DA 3DZDA 3OJXA 2REXB 1IY8A 4OHMA 1D2NA 5NULA 2VDPB 5H83A 2IZ1A 1Q7RA 1RBMA 1PL0A 2IY7A 3C74A 3OZAA 1TIPA 5CA1F 3EX7C 4ZU6X 3A9RA 1A9PA 1FDWA 1N2CE 2HH9A 1MEJA 4JLJA 4LBWA 3ZOKA 2B83A 3DV0B 1MV5A 3I5YA 5BNZA 3CW2A 4IDCA 1WO8A 5FUBA 4PLFA 4C4SA 5DX1A 1L3CA 4A6PA 2NO5A 5C18A 1U2TA 3J81A 1WXFA 5HHTA 1Y33E 1PW5A 3GY0A 4DFDA 4DRYA 4ZO6A 3AERA 2B3DA 4N7MA 2HRRA 2FRDA 3OIGA 2XYVA 4MW0A 1NN0A 2ZDHA 1ZXXA 2YC4C 5IN5A 1QH8A 3RYIA 4OHCA 3SEZA 4D8VA 2X3UA 4LZWA 4I9HA 5TXGA 1U9ZA 1C30B 4C76A 2ECKA 2D3TA 2D1YA 2Z5LA 1I80A 5BW5A 4FCVA 1EDEA 2HDHA 1U9IC 4IWXA 5EHNA 4GZ3A 2GRUA 4AMGA 2VBGA 3D6MA 4L3OA 3C4JA 4X63A 3CNBA 5HIIA 4HP8A 3VH2A 421PA 2Z3VA 3P9KA 1SO8A 2YFHA 3WOHA 4K26A 2EJTA 2N9UA 5CX4A 2YHAA 3U48A 4Z4GA 2OXCA 2R3SA 1EVLA 5EXDA 2NYVA 2HA5A 3NJRA 2QM3A 3JATA 4DMGA 1A9OA 3U3OA 5A4AA 3BMOB 3OZDA 1U3CA 5GTDA 4DA7A 2B20A 3SDZA 1KJNA 1N2XA 1REQA 3PNMA 3MGKA 5GM1A 3RG2A 4B5KA 3DZKA 3PF9A 3PUIA 4GC5A 3VR5A 1F2UA 2JZNA 3EZLA 2G1UA 4IIBA 5COQA 2CBXA 5ALQA 2EZ8A 3W5CA 2ZIGA 5C51B 1JZTA 3L7CA 3SSOA 2C94A 2WFAA 2WAAA 1PFVA 3ELUA 4X93A 5DHUA 4Q9HA 3TG2A 1MPTA 4GZLA 4R83A 1J4AA 1FQKA 1NW4A 3FFBA 1B43A 4Q05A 2LR0A 3DG9A 5BNFA 1KPHA 2O06A 2BP7A 1G4AE 3IDFA 1AF7A 3S2GA 4AF6A 2GKOA 1P74A 1UEIA 1RWQA 3WQSB 4F06A 2D2FA 3X2SA 2FPXA 2YZGA 1DTEA 3H18A 2O3UA 1JEOA 1X74A 4IW3B 4NDZA 1N3LA 3U7QA 4AVYA 4LF5B 3NORA 2O54A 4V39A 4M0EA 3F97A 3OLQA 4BECA 1A8QA 3TS1A 5DLYA 3EVBA 1U0OC 3H6GA 3OPVA 1MJHA 3RUPA 1DRKA 2C4MA 2NTVA 4HNHA 3PWSA 1FRZA 4N0MA 5TT1A 4PGHA 4NYIR 5DHRA 3QLVA 4FKMA 4AJEA 2ORWA 4MGIR 2Y76A 3U3DA 4BFVA 2CE7A 3ISJA 1CW2B 2GUGA 2AZXA 1UBOS 2YQ5A 2ZIZA 4AY5A 1QAQA 3TCXB 3UT5A 4C78A 2OLEA 1GGEA 1U8AA 2DUJA 4D80A 4FNGA 1CE8B 1JR6A 1Z6PA 4Z53A 3UKJA 2WK1A 1JTEA 1VXRA 2YW9A 3IHWA 4UMDA 4CMEC 2VZ9A 4U3JA 4WGFA 4PRZA 3M4JA 1Y3IA 1DO2A 3BUSA 4H1UA 4CQMA 2XVXA 3GP8A 4YMLA 1Z22A 2NAPA 3FJOA 4B40A 1N0HA 2WW8A 3ZQ4A 2B1RA 3N2GB 1PQPA 4RTOA 1YR9A 3RVQA 4NBKA 3CRRA 1G60A 3D3KA 3S0JA 1TGYA 4J0DA 5CMLA 3KZ1E 4NZOA 4JHLA 4R1QA 4B84A 1C50A 2ZUWA 3GJSA 5J2TB 2IYQA 3FMPB 3QNWA 4DDMA 4ZI3A 5AJXA 3M3HA 3CZRA 1J06A 2HEGA 3H9EO 4XVHA 2GZRA 2COEA 1XZHA 2QNRA 3H2JA 1YB6A 3OTWA 4GE0A 4EB6A 5E6RA 1YZUA 3E5RA 5JE8A 3L0SA 3F1KA 4QDTA 1V2GA 3QEKA 1P80A 2QUHA 2V7XA 4ND1A 2DH6A 2DHQA 1MX1A 5L6MB 1CNFA 2JD1A 1RDFA 2HSGA 4EF5A 1E4VA 4OK3A 2MINB 2IUUA 5IXYA 5LLDA 3CLSC 3WLOA 2FSVA 3LBYA 2QPAA 3G0IA 3OETA 4ZYLA 3CLSD 3OU2A 2XB9A 5JU6A 4HNQA 3ZJ5A 4EY5A 4PPNA 1XZAA 1LNSA 1K4MA 4OHBA 5KYXB 2YJZA 5JAZA 2C1XA 2FZLA 1M8FA 1A96A 1Y1RA 1WUYA 1YDFA 3G2NA 3RGGA 4F86A 1P8JA 4JYCA 1ZOIA 4GLFA 2O2SA 3MJFA 3QJGA 4ADSG 2PZKA 3D7NA 1AO0A 2IEAA 2V96A 3LDUA 2IZ5A 5IT5A 2B0JA 1W0JA 1EDZA 4GOOD 4RMNA 1VCHA 3O8DA 3PDIB 4N9WA 2BGWA 2NYAA 3F90A 1ECCA 2KI5A 3MLBA 1CHNA 3B7WA 4GUDA 2EKDA 3EULA 1C7ZA 3RNLA 4D3YA 2WMYA 2A0FA 4ZHSA 3BK2A 1JA0A 2VJYA 3ER8A 2AH5A 4AJHA 2C0PA 4RIIA 1KYXA 3DMTA 4WEQA 3AUUA 3PUYA 4ZXFA 5KINB 3GGCA 2SKEA 3RE1A 3EGWA 3PUVA 1XLTC 2GD2A 1GARA 1OAAA 4MWBA 4FYKA 1PWXA 2FW8A 2Q5IA 4IINA 1LC0A 3GYBA 3PHHA 2WJ6A 1U3GA 2VQ6A 4V0KA 1TB4A 2W8BB 2O3TA 5F21A 1L5VA 5GGXA 3ZQKA 1SN7A 2A1UB 5G1NA 1I94B 3HMQA 3KYDB 1E9FA 5ERXA 3SU8A 2Z09A 4PG6A 4LN1A 1M33A 2CLHB 3JQFA 4D9KA 4HNVA 1ONNA 1VGVA 5F2OA 4DA4A 5KKNB 5KJFA 2OCLA 2YYAA 1VJGA 2VJKA 4POOA 2P1RA 3GLHE 2PGIA 3PXUA 4RVFA 4TTAA 1O7JA 2D54A 5DN6A 3R7WB 3GLHB 1U7TA 3MD0A 2X1HA 3E5MA 5JS1A 2FDXA 1R27A 1H66A 5I51A 4ESOA 4TMYA 2ZANA 1OREA 1W59A 4XM2A 3OUZA 4YS6A 4EUEA 4GKBA 4M7RA 1EVZA 1OX6A 3DMPA 1A2KC 4BLTA 5IKOA 2Z8ZA 2C82A 4CKXA 1S2LA 3EQ7A 5GZ1A 3OZCA 2ID7A 4DIFA 4OSPA 1UBNA 3GLSA 3P20A 4JLOA 2VTVA 1VL6A 4JR0A 3TO5A 3WLEA 3KWMA 4B6SA 2J0QA 1ZXLA 2Q27A 4OH7A 3U44B 1CQPA 1LJ8A 4UUNA 4K7JA 3VR6A 1OXVA 3RI3A 3OJWA 2QZZA 2WYHA 2B6NA 4OB8A 3TNLA 4B6FA 3G0OA 1IEVA 2I62A 2I3ZA 2X1LA 2YVUA 3D7MA 4H6PA 5EZSA 5A5VA 3QLEA 5LJIA 2C3UA 2OQ2A 4OSEA 1KMIY 3V8RA 5AOBA 2CUKA 1EDBA 3TINA 3OPMA 2AF3C 1CUZA 1ZKDA 4C20A 5DHSA 2XB2A 4M1OA 4HAUA 3OFJA 3EIEA 5CXQA 2ZUCA 5G1OA 3T38A 4OH1A 2VHVA 1TD1A 4P1ZA 4Q3AA 5F4BA 5KX5B 3AY0A 4PQRA 1F51E 3QENA 4KO4S 1AV6A 4WJZA 4F91B 7MHTA 3DEKA 3O38A 3RV3A 5TQ2B 4FYYA 2DBZA 1Z5WA 2C58A 4QPJC 3C5CA 3RLIA 3V3TA 3PTAA 3SF8A 4A0GA 1XKTA 3QFHA 1FRFS 4O4JA 1P6UA 2ZPUA 1W0KA 2C5GA 5TVGA 4ER5A 1E4EB 5JNUA 5K3FA 2XOXA 1Z0FA 4I5FA 3K9CA 4HFMA 2B78A 2QJRA 4DNQA 2B7CA 4GVPA 3PITA 1XROA 3TLGB 7ADHA 3FYUB 1QPZA 1QU2A 1JE0A 4UDOA 2P7IA 1HT2E 1KO1A 1G2PA 3EN0A 3GDGA 4R51A 1XE3A 3GB9A 2QRLA 1H2HA 2CUZA 5A4JA 3PIIA 1ZQ1A 3A27A 4E30A 3AT1A 4BLOA 1BCSB 4BPRA 1EWTA 3AGPA 3DBRB 4JBNA 3STTA 4QQRA 5C5DA 3ENKA 3V6MA 5C5EA 4CV0A 1FSZA 1IVNA 1CR0A 3CNQS 5D3KA 5TC4A 1TW2A 3KP1A 4BJ5A 3DB1A 3V2UA 4A6XA 3KFXA 2HR1A 4ZYUA 1T26A 1ZUD1 5AJYA 3AUSA 2IOQA 3PC7A 3SDSA 1FOEB 1Y98A 4IBOA 4RWZA 1ZH2A 2ZYVX 1KI8A 4ZV7A 3RRJA 3OPYA 1DUVG 1LFAA 2QM0A 4MS1B 7REQB 3A3KA 1RLTA 2FCRA 2AUMA 4B6GA 3CEMA 1D9XA 3H8VA 5BO5A 5TRTA 4YVFA 4F5EA 4L08A 2G06A 1VYTA 2OT3B 4RESA 1HMPA 2FX3A 1QV6A 2YMPA 2BGRA 3KFLA 5L4SA 3ITKA 4M8NE 3D81A 4XPIA 4GM0A 3MMSA 2R65A 1TCAA 2HC9A 2OCPA 3AJRA 3BTVA 4LG1A 2DZDA 4MVJG 2OVBA 3EZYA 3NOXA 4R1TA 5TF0A 3FTFA 1MA3A 1YSCA 4HZUB 1AIPA 1UFVA 3TYXA 1ORRA 2F90A 1D2AA 1VI6A 2WIAA 3GT3A 4JJGA 2ZS7A 1IMOA 2MMCA 2VEOA 2RHBA 1QDEA 5KZMB 2OCXA 4MOWA 2E87A 1WXGA 2IYAA 3TE6A 4AJ2A 4F5ZA 1SG6A 4W9NC 1V3TA 4ZOCA 2FQWA 1XD2B 5COAA 4MR7A 1K0FA 4U8HA 5DCUA 2WIGA 1V1RB 1YFKA 5EWLA 2CL0X 2PWBA 4FLMA 2BL4A 3KBOA 1MTZA 4AP9A 1A5TA 2E82A 3PXAA 3EPJA 3QVSA 1R3UA 1EFVA 3KYJB 2FSUA 5AVOA 4BNNA 4IUYA 5CB4A 2R87A 4OP2A 1DAGA 2QYSA 4KR7A 2EIXA 5IP5A 5AK3A 3DT8A 1ZL0A 4C6TB 2P2DA 2X42A 2FZEA 3MLAA 3C8ZA 1UH5A 1KVRA 1FQWA 4MQEA 2SICE 3WLTA 4QIHA 4C7OB 2VNIA 3GP3A 5EPUA 4N0DA 1OWLA