2J3IA

Crystal structure of arabidopsis thaliana double bond reductase (at5g16970)-binary complex
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
345
structure length
336
Chain Sequence
MTATNKQVILKDYVSGFPTESDFDFTTTTVELRVPEGTNSVLVKNLYLSCDPYMRIRMGKQAYTPGQPIQGYGVSRIIESGHPDYKKGDLLWGIVAWEEYSVITPMTHAHFKIQHTDVPLSYYTGLLGMPGMTAYAGFYEVCSPKEGETVYVSAASGAVGQLVGQLAKMMGCYVVGSAGSKEKVDLLKTKFGFDDAFNYKEESDLTAALKRCFPNGIDIYFENVGGKMLDAVLVNMNMHGRIAVCGMISQYNLENQEGVHNLSNIIYKRNRIQGFVVSDFYDKYSKFLEFVLPHIREGKITYVEDVADGLEKAPEALVGLFHGKNVGKQVVVVARE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NADP-DEPENDENT OXIDOREDUCTASE P1
publication title Mechanistic and Structural Studies of Apoform, Binary, and Ternary Complexes of the Arabidopsis Alkenal Double Bond Reductase at5G16970.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 85
structure length 336
sequence length 345
chains with identical sequence B
ec nomenclature ec 1.3.1.74: 2-alkenal reductase (NAD(P)(+)).
pdb deposition date 2006-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF16884 ADH_N_2 N-terminal domain of oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2j3iA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2j3iA01
4YBZA 1KBZA 2AQHA 2Y93A 2VNAA 2FOIA 2QQ5A 1C14A 1HWYA 4QT0A 4HNGA 1KIFA 1JN0A 2NWQA 4YQYA 1R12A 2X23A 2X6TA 3IUSA 2HCTA 3WFJA 5A03A 3I52A 4MOWA 5I9MA 2WYWA 3QRWA 1EFKA 3KEQA 4I08A 1SZJG 2PGLA 3WQSB 5MDHA 1RKXA 5JLAA 5BQFA 4IJKA 1UP4A 2B5WA 1XEAA 1VE9A 3MJCA 1WDMA 3OEYA 4R1UA 3WYBA 4PLHA 3TJRA 5T6BA 4E21A 3ICPA 3K9QO 4E33A 2HQ1A 4DQXA 1TA4A 2ZQZA 3T7CA 5KJEA 2HMWA 3ZU4A 1EQ2A 4OSOA 4J43A 4YPOA 4OSPA 1E7SA 5C7LO 3TZQA 3FI9A 5U4QA 4W9NC 4C4OA 4DA9A 3D5QA 3S2GA 1OBFO 3PJGA 3WICA 3RI3A 3H5NA 4ZRNA 1XSEA 4GX0A 3SLGA 2HLPA 4ID9A 3ZW8A 1X1TA 2PKQO 1HDGO 4ZGWA 3VZSA 3BZUA 4W7HA 4P38A 5KOIA 2NNLD 4CUKA 4R69A 4EEZA 5I8WA 2VYVA 1HXHA 5HS4A 1ZH8A 5L7YA 3ZHYA 1BG6A 4BQRA 4DLAA 1DFGA 3V1YA 5JYEA 3OQ6A 4A73A 4BO5A 4BMVA 2NTVA 2GN6A 2OORA 2GASA 3W4JA 3FNHA 3VH1A 4BGUA 2HAEA 2Y0EA 2JHFA 4XQEA 3VH3A 1I2ZA 3RC9A 1LU9A 1P1KA 5GY7A 4RQTA 4IIVA 4KUEA 3TL3A 2NU9A 4B7UA 3RKUA 4CQMD 2AE1A 4CM8B 1YQXA 5JYDA 1X0XA 1Y8QA 2CZCA 3AI3A 2BI7A 4LCJA 1QXSA 4OKNA 1VRWA 4R4JA 5IDYA 1NVGA 4N5NA 1O89A 3G0OA 5TX7A 1EE9A 1IE3A 1SC6A 4YDRA 5IFLA 3VC7A 5COBA 1FMCA 3GZNB 1CIVA 3CMCO 1N9GB 1PQWA 1PJLA 4NQZA 4L74A 2JD1A 5JE8A 4E5KA 2PZJA 1CQIA 3I9NA 4D46A 1KERA 3GQVA 3X2EA 3GUCA 2P91A 2ILTA 1PZEA 3AU8A 5B37A 5EQDA 5HM8A 4DQUA 1PQUA 2PGDA 4XGNA 3DAPA 3I9JA 2JFFA 2VN8A 3FWNA 4MPDA 4NBUA 1NP3A 4CLHA 7MDHA 4YQZA 1Y9AA 3BAZA 1FJHA 2D59A 4N5LA 1TI7A 5G4KB 5COQA 2V6BA 4U6SA 1ZUD1 4XWYA 3KBOA 3DOCA 4FQ8A 3UF0A 1AN9A 1T2EA 4U0JA 5GZ6A 4EW6A 1EQUA 3H65A 3VPSA 2EXXA 3WX0A 3ROQA 1B2LA 3A1NA 1LDEA 4OXNA 1FDTA 5F1KA 4ZD6A 3JQAA 4ROSA 2X9NA 3DZHA 4D3FA 1LI4A 3TQHA 2B5VA 2PV7A 1GUYA 1W0CA 3CKYA 4I5EA 1UUFA 2HUNA 1ZMOA 2Y1OA 4RDHA 2ZB4A 3EK2A 2D5AA 2D2IA 5A5EA 2R2GA 3TN7A 1RYDA 2OMEA 1KVRA 1HT0A 3BHMA 3NAQA 3AUTA 3P2OA 4WEOA 2JCYA 4YJHA 3DAFA 2CD9A 3O03A 2EKLA 3IMFA 1YDEA 4MVJP 4CQMB 4TMFA 3ZV3A 1P0FA 4BNNA 3STHA 1JKIA 4IGEA 4XQGA 3KTDA 1Z74A 1P0CA 2F00A 3GFBA 1CWUA 3GPDG 4C7KA 3O9ZA 3Q9UA 2O3QA 3ZDFA 5KNLA 3S2IA 3C7CB 3Q11A 1I32A 2HJRA 4JJIA 1WWKA 4RLHA 3U3XA 4MO2A 4A26A 3FTPA 4LSMA 1CJCA 3E9MA 3UGKA 2YHIA 1HRDA 3PDUA 4E5NA 1CEQA 3F3SA 3RCBA 2X1HA 3AM5A 2PZMA 5TSDA 3WQQA 3EHEA 1B16A 1P45A 4WCDA 5JFOA 2EEZA 4EGFA 4CMCA 1E3JA 1Y81A 3MZ0A 5KJFA 1DHRA 2E4AA 2VYNA 3AY7A 5EJ2A 2PKRA 1RM4A 1VKNA 4XB1A 3VVBA 4AJ1A 3DC2A 4PRLA 3PK0A 3WGTA 3CE6A 3MCVA 1ULUA 4MIOA 5IDXA 3JQGA 9LDBA 5JS6A 1T24A 1U1IA 2J5RA 2EJVA 3L0DA 1H6AA 4E4YA 1DJNA 3H5AA 2Y68A 5DBFA 1VL6A 4Y98A 4J4BA 1NQOA 1HLDA 5GZ3A 3VPGA 3TZCA 4H7PA 4W4TA 1V3UA 3FTNA 1DXYA 1Z82A 3FNFA 1FK8A 4J0FA 4RPHA 4XQ9A 4BGVA 5HTOA 1Q7BA 1D1SA 1UAYA 2ZB8A 1JQBA 3G79A 1TT5A 3O26A 3PPIA 1DJQA 3RBXA 3L4BA 3V1TC 4L76A 1PGOA 1VL8A 3IJPA 2FR8A 2Y0CA 3DMYA 3HFGA 3WLEA 4CLEA 2H6EA 2DUUA 3M1LA 4O5OA 1Y1PA 4K9DA 5K6AC 3K6JA 3WOHA 3TRIA 2FRDA 4FSHA 4YT5A 1ZO8A 3L77A 1QYDA 2Q46A 2OUIA 4OO3A 1SCUA 3ZCXA 2D5CA 5DBIA 2Q99A 1I3MA 1XKQA 2AA3A 3WGYA 2CMDA 2FPIA 1E3WA 1KVTA 3HQ4O 3I9MA 1E1MA 4ALKA 4KTVE 4TRMA 5JY1A 3QVTA 3BHJA 3DZIA 3VH4A 1DPGA 4GX5A 3K5PA 3SLKA 2X22A 3TZ6A 1KYQA 1VM6A 4D42A 3C1TA 4WASA 4BO6A 1WW8A 4ZRMA 1MUUA 4WE3A 4YACA 1B3BA 2LDBA 5K9ZA 2HMUA 1N92A 4IPTA 3W8EA 4J2HA 3W8DA 5DN9A 4JN6B 3RBZA 4B3IA 3PYMA 4CMIB 2Y1CA 1DIGA 1XQ6A 2GSDA 2Y1FA 1NQAO 4IXTA 5L51A 2RCYA 2DT5A 3GDFA 4B3HA 4DLBA 2NTJA 3Q9NA 4FCCA 4IQ0A 1Z73A 4XYGA 1GR0A 1JA9A 4FB5A 3LK7A 1J5PA 1EVYA 1JVBA 4YAGA 2OZPA 1ZMTA 3I23A 4R9SA 2OHXA 5TGDA 1DIBA 2AQKA 3LT1A 2R00A 1B14A 3DQPA 1NYTA 2QG4A 1T2DA 4NBVA 1AHHA 3OECA 2VUSA 4CODB 2AE2A 2B36A 4ALMA 4CMHA 5I7VA 3H2ZA 4XRGA 1NR1A 1QG6A 1O0SA 4PLYA 1EMDA 4XB2A 4DMMA 4BQPA 4ZQEA 4B4OA 4AJOA 4Y6SA 3BMNB 4LK3A 4YT8A 1DLIA 3SJ7A 4EBFA 4UULA 1QLHA 3U4IA 1P9LA 3H9JA 1P3DA 1EK5A 2O48X 4BNYA 1YL6A 1O9BA 2GUGA 4FD3A 1DRVA 3PFFA 2YUTA 2FZEA 4CLRA 2GDZA 1P33A 2DVMA 2AEJA 4FFOA 2O7QA 4NBWA 5ENVA 2YV1A 5L7TA 5EMHA 1MB4A 3OA0A 3P5SA 5IN5A 1QP8A 1F14A 3E5RA 5F5LA 1V0JA 1DIRA 2D4AA 3ZWYA 3QY9A 1PJ3A 4CV2A 3IP1A 3ROPA 3A06A 5KTKA 4LVCA 3H5RA 4OL9A 2IEDA 5F1OA 3GNTA 2WWRA 4OAQA 5C7OO 1O95A 2EGGA 2PD4A 3KO8A 2AG5A 2YHUA 3EC7A 2C2YA 3DBLB 1PJQA 1UJMA 2PWZA 5BSGA 5I7EA 1ISJA 1KY5A 3IKVA 2FN7A 4O0LA 1NBOA 3HG7A 1I2BA 3HSKA 1ULSA 1EUDA 2GN4A 4J7UA 4U7WA 1DLJA 2NLOA 4FDAA 4ZVVA 2HRZA 4ND2A 4OXYA 2QX7A 3N58A 2HMVA 2ZJ0A 4KQXA 3W4KA 3V5NA 3U4CA 1DIAA 1SO8A 5DP2A 1JAYA 2SCUA 3MJSA 4OQYA 5C3MA 1XDWA 4RDIA 1EVZA 1QSGA 1U2GA 1D3AA 2YZ7A 4ALJA 1PZHA 3CEAA 1MP0A 3JQDA 5FEUA 2ZIZA 3H9EO 3IP3A 1E0DA 2WD7B 1ONOA 1MC5A 1R4NA 2NQTA 2NUAA 3K30A 3AI2A 3KHUA 3ADOA 1YONA 2BFAA 1PS0A 3KYCA 3DTYA 4YA6A 3H9QA 5DCYA 2RHCA 4PG6A 5IN4A 3B1KA 4RQUA 1MG0A 4PZEA 1PR9A 1PWXA 2JD2A 1V9LA 1Q1NA 4NIMA 4JROA 2VHZA 4GH5A 3JQFA 2BFMA 3BMOB 3NT2A 4Q3AA 4D0RA 2W90A 4Z3KA 1M75A 4HP8A 5C37A 4K6FA 4BKPA 1P1RA 1DAOA 1Y8RA 2GRAA 4QUKA 1QV7A 2RH4A 4G81A 1YJ8A 2CDCA 1H94A 1GAEO 3F5QA 4J1NA 1GY8A 1LJ8A 5F21A 1E3SA 1U7HA 5DT9A 1LC0A 1NQ5A 3L6EA 4MVJA 3MOIA 2RH8A 4PLZA 3VAZA 1U9JA 3D3WA 4PG8A 4Q3CA 1A4IA 2Y66A 1SEPA 3RWBA 5DOVA 1ZZEA 1G1AA 3LT4A 4PFJA 4IXWA 1ONPA 4XR4A 4E13A 1B7GO 1KVUA 3WIDA 4A5OA 3H4VA 4XQCA 3WFIA 4KUGA 4M49A 5I7SA 3OETA 1GQYA 3QA9A 2PY6A 4RVSA 4QX6A 4QO7A 4IMPA 4ESOA 1J0XO 1Z75A 3SBOA 4CLOB 4JIGA 2PR2A 3ETDA 3Q2IA 3RIHA 3WGQA 4NZ9A 2DUWA 2A94A 5L95A 3HWRA 4S1VA 2X5OA 3G17A 2TMDA 3AI1A 2CFCA 4CLDA 3P19A 4PG7A 5BT9A 1O6ZA 3PDJA 2AQIA 2QYTA 5DCWA 1PGNA 1PGQA 2VRCD 2B83A 1TXGA 3JQ9A 3JQ8B 4E32A 3NDRA 1NAIA 2AEMA 4ND3A 4WECA 3LVFO 4AJIA 1LDNA 4FBGA 1ISFA 3HDJA 6LDHA 1IB6A 4B79A 5TLSA 2JD0A 1PZGA 1GEEA 3VDRA 5IZCC 5TIIA 1T2AA 1OFGA 3GNQA 3QIVA 3I83A 1NPYA 1JWBB 4FC6A 5JAQA 1T26A 3I3OA 1XQ1A 3D7LA 4FS3A 4BNFA 5GMOA 1E7MA 2ZYDA 3GT0A 2CDAA 4J90A 3CINA 3OF2A 3E82A 5TT0A 4AJ4A 5CG2A 3F4LA 3ZU3A 1C0KA 3QVXA 3MWDB 1LDMA 1YVEI 4GVLA 5DP1A 2HJSA 2G82A 4KUHA 3VH2A 4IDGA 2NV6A 1QLJA 2GNAA 3R3JA 4PVCA 1LSSA 4XYBA 3NJ8A 4NJMA 1HLPA 2YQ5A 4NK5A 4W9NA 3ANLA 4MKRA 4DPMA 1YB5A 2AQ8A 2TMGA 4EJMA 1K5HA 1ONNA 3KV3O 4CMBA 3DONA 1R4MB 2I3AA 4Q3DA 2WM3A 3PZRA 4XJSA 1IHYA 4IJWA 3RC2A 1M66A 1GQ2A 2I76A 3FSRA 5G0VA 1KEUA 3K73O 5LC1A 3WWZA 2H5LA 2BKAA 3UCEA 5DNAA 4YAIA 5TF4A 4J3FA 5A04A 4TZKA 3ZN2A 2AW5A 3ROMA 3IC5A 4PCVA 3ZWVA 3WGGA 4BNXA 2ZCUA 4BNLA 3VKVA 1H9AA 5L7WA 3V8BA 1P1HA 4Q3NA 2X5KO 4BO7A 1XG5A 2GZ3A 3VZPA 2OXIA 3IAHA 4DUPA 2O23A 2EIHA 4PLFA 2CNBA 2IYPA 4WNIA 4CMGA 3TZHA 1FDWA 4IBOA 4WKGA 3K96A 4IDFA 4AVYA 4DMLA 1UDBA 3HNPA 4JJFA 4R3WA 3PLNA 1ZFNA 1T4DA 3WMXA 1U2DA 3GVCA 4ZQBA 1ENYA 2O3TA 1E7RA 3CH6A 1EEHA 2J5KA 1K6JA 3B20A 4C7JA 4A7PA 3SVTA 2V65A 4FFLA 3GN1A 4LCEA 1GYRA 1V8BA 1YO6A 1H6DA 1SBYA 1Q0QA 4GKBA 3WJAA 4Q39A 2DPHA 5ITWA 1WMAA 3IL2A 4AFNA 1GCUA 4Z9XA 3UCXA 1ZCJA 1HDOA 4J2OA 1M76A 1ARZA 4GMGA 3JQ7A 4TSKA 5B12A 4UVEA 4NFHA 3RKRA 4IMRA 5TT1A 3BYZA 3AUSA 3GGGA 4I9HA 4JP2A 3K8ZA 1X13A 2NTNA 2W4QA 4IQGA 5ADHA 3NKLA 1U4OA 2I9PA 1AHIA 4R16A 4Z0HO 1JVSA 4DC0A 2PZLA 4CV1A 4KWIA 6ADHA 2W8ZA 1LRLA 3ANNA 2P68A 3OIFA 4BKOA 2IRWA 1M67A 3KB6A 5JW6A 4NJOA 1WDLA 1Q2XA 2VTEA 3E8XA 3I4FA 4NH4A 4TROA 3S55A 2C7GA 1YS4A 1ZK3A 5TS3A 3K2EA 4R5MA 5L4LA 1BDBA 5F5NA 4BV8A 4CM9A 2EP7A 4D79A 1IOLA 4D43A 4EDFA 1U8FO 5AOVA 4BMNA 1HTBA 1E6WA 4GKVA 1IY8A 3LF1A 5CPBA 3GMSA 1JDJA 3IUPA 3TF5A 4YT4A 1X14A 4KMSA 3WSWA 4Y6PA 5A1TA 2ZTLA 4Y67A 2FSVA 3DHNA 4KTTE 4B4WA 5BSHA 1XU9A 4DL9A 2X58A 2Z95A 2YV2A 4MVJE 4CM1A 4CR6A 3GH3A 2CDBA 4A2CA 2Q49A 2WJPA 5I9LA 4GBJA 4TQGA 3VZRA 4YRAA 3RASA 3VOSA 3F46A 4GI2A 2CUKA 1IZ0A 2UUPA 1UDCA 1I24A 2H9IA 3CSDA 1U28A 3ZWXA 5B4TA 1WLYA 2IZ0A 3QE3A 1I01A 2VHXA 4CMEC 2Y05A 2I65A 2D8AA 3M2TA 5A4DA 3JQAB 4JBGA 1W4ZA 1NTOA 2CVOA 4NBTA 3INTA 4GPD1 2C5EA 4J4TA 5CDSA 5KVSA 1R66A 1U7TA 1N1EA 1VLLA 3BHIA 2YDYA 1NPDA 3X2FA 1ZEJA 4S3MA 4PLWA 4INAA 5ER6A 1P77A 3PFWO 4U5QA 4YJFA 1VPDA 5KVVA 4F45A 2P2SA 2E48A 3NYWA 4GMFA 1C0PA 1U3UA 1ZKMA 3CXRA 4JJGA 3ZNPA 3HDYA 5G0TA 1H5QA 1YKFA 4PLTA 4AJJA 5THQA 1XCBA 3PHGA 4UEOA 3RC1A 3ZNNA 1V35A 3D64A 3ADPA 4EZBA 1HL3A 5A02A 3BMCB 1GDHA 4OQZA 3DBRB 1BHSA 3PGJA 1AGNA 4LSWA 1L1FA 2VZ0A 3HHPA 3MJ4A 4WCFB 3C85A 3AJRA 4IM7A 1EUCA 2QRLA 3OQBA 4DBZA 3ITKA 3LT2A 4E2XA 1RM5A 3FR8A 3HN7A 1E5LA 4J6FA 2RIRA 1HE4A 3GEMA 5TNXA 2DFVA 2I5PO 3WG9A 2AEFA 2J3IA 2EJWA 1GADO 4BKUA 2E37A 5K0ZA 1LSUA 1EZ4A 3H2SA 5DDIP 2BD0A 3VKUA 3GDOA 2ZTUA 2EKPA 4GX2A 1TVEA 4OJNA 4TVBA 4CR7A 4YJGA 3UOGA 3JQGB 4BHTA 1DDOA 3WYEA 3W1VA 1KEVA 1PQPA 4IJUA 4Q3BA 3ZWAA 5B4VA 1MGOA 5K6AA 1P1IA 4FFRA 3WBFA 3QV1A 3OP4A 1EVJA 3IOYA 1VJTA 1PEDA 4K1LA 1E7QA 4MIYA 2W98A 2O4UX 4RPLA 1BW9B 1A7AA 4OGWA 4LMRA 1U4SA 4NPCA 1NXQA 5JAIA 1X7DA 4IINA 1QR6A 3NV9A 5IDWA 1HDRA 4JK3A 3SXPA 1WDKA 1NNUA 3ASUA 4L4XA 4ZHSA 1TT5B 1XWFA 2VWGA 2J5QA 2PD3A 4R1SA 4UVDA 2UDPA 4CM4A 2C0CA 1IPFA 1SB9A 1UXKA 1XU7A 3DZKA 1FDSA 3GUYA 3AUAA 3ON5A 1H9BA 3AUUA 4R1TA 1HDYA 2X0JA 1K89A 1KVQA 1NHWA 2BELA 1RWBA 4PLGA 2GPTA 3PI7A 3R1IA 4WK6A 4XCVA 3PQEA 3UICA 2WE7A 1H93A 2GN8A 1E3WB 4QTZA 3C8MA 2NU6A 3PEFA 4CMKA 4CM8A 1DB3A 5ILOA 2X5JO 3JQCA 2I66A 5ITVA 2ZTVA 3D4NA 1OOEA 3MJEA 5CDTA 4KQWA 2W2KB 3ZWCA 4DGSA 5JC8A 1UAGA 5FF9A 1YBMA 3OJEA 2I67A 1P74A 3T4EA 4L73A 4HFJA 4ZA2A 3BA1A 4TRRA 2Q2QA 3C3XA 4CMAA 4EUHA 1N9GA 2HU2A 5JDCC 1MG5A 1QYXA 3DHYA 1PL6A 3BTUA 1BSVA 1Y5RA 2DQ4A 3GAZA 1FDVA 1GZ4A 2Q1SA 3DOJA 5KIAA 1YWGO 1YOVB 4FW8A 3F47A 1GEGA 1BGVA 4BO8A 3GF4A 3UN1A 3UH1A 2CVQA 3V1UA 3OMLA 1VJ0A 3EDMA 3GOHA 2A35A 3GRPA 2CSUA 3PYXA 1N5DA 4DYVA 1W8DA 4YRBA 1U3TA 3KUXA 4IS3A 3ZWMA 2FSSA 1LXCA 1G0OA 3KXDA 5AXCA 3RFXA 2JJYA 2ZYAA 2G5CA 3UFXA 4EI2A 2NU7A 5CDGA 1YXMA 3V2HA 4E0BA 2ZJ1A 1GTMA 2I99A 4RPKA 4CR8A 1J6UA 2GR9A 3PQDA 3LLSA 1F8FA 1CQJA 5JCXA 5FI5A 3GDGA 4CL8A 4BGEA 1Z6ZA 3AW9A 4BVAA 3D0OA 4LISA 2WSBA 3M1AA 3P2YA 3G49A 3FF4A 4E5YA 3PWSA 7ADHA 3OJLA 2H63A 4BNVA 2G17A 4XA8A 2DFDA 1CERA 3PVZA 1BVUA 1GD1O 4WLUA 5A9SB 2NSDA 2Y99A 5I7FA 2ZB7A 1C1XB 1SOVA 5DBGA 4TWRA 4FPXA 5CP8A 3FRJA 4J1QA 1U3VA 4P8RA 1ZK1A 4XIYA 3E48A 1FF9A 3HN2A 4OH1A 4TRJA 5A9TA 4JBHA 1W6UA 4FFNA 3GGPA 2HK7A 2ZATA 2BMAA 1QYCA 3OJ0A 1I30A 1LLUA 5H81A 1LQUA 2Q50A 1DC4A 3WMWA 4GAEA 2HMTA 2FPPA 4AJ2A 2J8ZA 3RBVA 4KZPA 2ZKLA 4E31A 1IULA 1MC4A 1NM5A 3MJVA 4YTEA 3WJ7A 1QORA 1IZ9A 2DBZA 2CVZA 1NWCA 3JQBC 1DOHA 4IS2A 4D45A 3RUAA 1V3VA 1PJSA 1A4UA 4J4HA 3H3FA 3EMKA 3DOOA 3MJTA 1ORRA 3ZWOA 3WWYA 3NDIA 5I8ZA 2HSDA 2V6MA 3GAFA 2GF2A 3EY4A 1XR3A 4ILKA 3RUDA 4ND1A 1R4NB 2QZ9A 3ZU2A 3D3EA 5CEEA 2ZCVA 4BNWA 4MINA 3O4RA 1VSUA 2O2YA 3DBHA 4HWKA 2DKNA 1B15A 4CQLA 4II3A 3E9QA 3TOXA 1E1KA 1RM3A 1UXIA 4HY3A 3ZW9A 5GZ1A 2B69A 4UVIA 4DXHA 1LX6A 1B0AA 1NQTA 4RVGA 2O3UA 1XIVA 4GWGA 1B8UA 2YYYA 1WZIA 2JCVA 3Q1LA 2Q2VA 1U8XX 2Q4BA 3IQDB 2IXAA 2BFOA 4CV3A 2QRKA 3NTRA 1BDMA 4HFMA 1C0IA 3QHAA 1E1NA 5THKA 3U62A 5ENDA 3RU7A 4I5FA 1NVTA 1BXGB 2IDZA 4HUJA 2XAAA 4NR0A 5DCUA 4UUPA 4XYLA 5IAAA 1GFSA 1K6IA 1ZXBA 2BI8A 1E3IA 1XGKA 2E49A 2QHXA 5I9NA 3ST7A 1KEWA 3GNSA 4WGGA 4DC1A 2OFPA 1AXEA 1SPXA 3EZYA 4QSMA 5H82A 3D1LA 2P9CA 1DC6A 4YAJA 1UP7A 4FGSA 4NHEA 5IZCA 2EKQA 1K0UA 1R15A 1ZXLA 1XA0A 2OL4A 1YRLA 4G65A 4RVDA 1LC3A 3PP8A 4J1TA 1LRKA 3AM4A 2B35A 4MVJG 2VTDA 4R1NA 5BSEA 2GZ1A 1E6UA 3TOZA 1MXFA 1ZIDA 3UHAA 3UKOA 4E12A 3GGOA 1T2CA 3BMQA 2XXJA 1PS8A 2D1YA 2GO1A 3PJDA 4MP8A 4LRSB 3WIEA 2X7HA 2VUUA 2J3JA 4JQCA 4OKIA 4XKJA 1J49A 2HK8A 1GPDG 4O63O 4WLFA 5HA5A 4L4RA 3AOEA 3PLRA 2BGKA 2DTXA 4Z9FA 2PNFA 4RLSA 3D4PA 3HADA 4HADA 3OEWA 2VUTA 4MVJH 1J4AA 3ZNOA 2Y67A 5AXBA 5EIOA 1C0LA 4W6ZA 4DTIA 1ML3A 2ZB3A 2Y1DA 1S7CA 5EQFA 3WTBA 1GZ3A 2BLLA 2AXQA 4UAGA 1Z7EA 3FPLA 3LC7O 3PIDA 2DBRA 1YE3A 1KOLA 4ZU3A 1MX3A 3RUIA 2FHSA 4L4SA 3BMNA 5CEJA 1GCOA 4AJLA 5JAMA 4MKXA 2PA3A 3W8FA 2VWPA 4TRNA 3E03A 4N18A 3PJEA 4QXMA 3FBTA 2EP5A 3FNGA 3PHLA 4PLCA 1WPQA 5LDHA 4NJMB 3RQSA 3LT0A 3JYQA 1DRUA 3KYBA 3LC1O 2EWMA 3N74A 4BB6A 5JCJA 4ALIA 2JL1A 3C7DB 2FP4A 2B0JA 2XXBA 4GSLA 3HZZA 2O2SA 1ZJYA 4BOYA 1ADFA 1A9YA 1K6XA 1H2BA 3KRTA 4I9NA 4JBIA 3DZFA 2B4TO 2YV3A 2WTBA 1D7OA 1WNTA 2X9VA 4L75A 5CPFA 4EJ6A 1PX0A 3F1LA 3GVPA 4CM9D 1D4FA 4MVJM 4R41A 3PTZA 4ND5A 1EE2A 1ZNQO 3L6DA 3ONEA 4XYEA 5A5FA 4CMJA 3DBLA 3WBBA 4FFPA 4LRTB 1H2HA 4HNHA 4GX1A 4B3JA 5T8KA 3W6ZA 1KY4A 4D3DA 2YY7A 1ZSYA 2V6FA 4NU5A 1EBUA 3GVXA 4PRKA 1HE3A 1PTJA 1TEHA 3PRJA 4FR5A 3S2EA 2I6TA 4FOOA 1WXDA 4EJ0A 1EK6A 4U6QA 4YXFA 4ZJUA 1E3EA 3FD8A 5FFFA 5G0UA 1YJQA 2P5UA 1I10A 3DZGA 4BS9A 1R6DA 2VYVD 2I3GA 2Q2WA 3TFQA 3GVIA 4M54A 2YQ4A 1I0ZA 4Y6RA 2NVUB 4H16A 3HDHA 2UAGA 1W73A 1DC5A 1SNYA 2JFGA 3PJFA 1UXJA 2WD7A 3DTTA 1HDCA 3DZBA 3NT5A 4K6CA 3RUCA 1EDZA 4IQ8A 3FR7A 4YT2A 4D0SA 3KYDA 3INRA 1P1FA 4B8ZA 1N7HA 4NMHA 1P44A 2P4HX 3O8QA 5KWEA 1DIHA 4DWVA 2O3RA 2VHVA 3CZRA 1CYDA 4BO1A 3BMOA 3AOEC 3WDSA 1B8VA 1ZW1A 2EG9A 1A71A 2Q1UA 3OA2A 4FOSA 1HEUA 4MIEA 3ZV6A 2RBEA 4WUVA 1OC2A 4EUEA 1JWAB 2NACA 3V2UA 4GWKA 1SAYA 4PIVA 5IXYA 5ILGA 1PL7A 4KP7A 2VHYA 2IEBA 3GC6A 3AY6A 3ROKA 1CETA 2AMFA 3JD2A 4Z9YA 5JBIA 1GPJA 2A4KA 1JTVA 4XRRA 4PGFA 4F46A 5AVOA 3DR3A 3IIEA 4GVXA 3GK3A 3CMMA 1AXGA 1PJ2A 3DBVO 4W82A 2Q3EA 5DULA 1U5CA 3DWFA 1OI7A 4HKTA 3S8MA 3L9XA 3INGA 3SX2A 4A27A 4A10A 1E7WA 3JCZA 4CMEA 1MA0A 1ADGA 1RM0A 1C3VA 4BNMA 4CUZA 4ALLA 3O38A 5C7IO 1KETA 4RV9A 3OBBA 2X0IA 1KEPA 4CLOA 3I6IA 1PJBA 1NWHA 1YQDA 3MTGA 3L07A 3VDQA 5JO0A 4GLOA 3DL2A 2PH5A 4J9VA 2OP1A 4O59O 3VVCA 4QFDA 3FN4A 2EERA 1NR7A 3NRCA 4IGFA 3SC6A 4E30A 3JYNA 4ZN6A 2FR1A 3HDQA 4WLOA 4CM5A 3ENKA 2ZQYA 5BNFA 4J7XA 2PZKA 5T64A 4GQAA 1V6AA 1YL5A 2O3JA 3JQAD 3CUKA 1X1EA 4MDHA 5T8KC 2ET6A 2XF8A 4J1SA 2W2LA 4II2A 2D0IA 3TZKA 5U9CA 5CEFA 5DOZA 1KS9A 2GYYA 1YQGA 4NI5A 2JAPA 4LVUA 3HB4X 3BTVA 3T7EA 1QKIA 1Q0HA 3AM3A 4M86A 3G1TA 3WLFA 4EYEA 2YW9A 5EINA 2GN9A 5AXDA 1QV6A 4BNKA 3H7AA 2RAFA 1PR3A 3CIFA 3GVHA 3TSCA 1O5IA 3AY3A 2C54A 2GCGA 4D7AA 3RU9A 4YJFB 1GV1A 3KSDO 2JCXA 2X86A 3OFSA 3JD3A 2DAPA 1Y8QB 3SJUA 5KJ1A 3KLMX 1VL0A 3QSGA 5T67A 2JHGA 4O6VA 1HSOA 4BNHA 3AK4A 1SB8A 1WP4A 2DPGA 4I8XA 2IODA 3I1JA 2DM6A 4HX5A 2VQ3A 3B6ZA 3K2BA 1RPNA 1K3TA 3LQFA 1AE1A 1O8CA 5JNLA 2NADA 3I5MA 3LZ6A 5G0SA 4BNJA 1HYGA 2OBYA 2F1KA 4E3ZA 2IZ1A 1R4MA 1Y9EA 4DLLA 3A14A 1G6KA 1Q7CA 1KVSA 4R5HA 5F1PA 5CDUA 4YJDA 4CUJA 5DZSA 1OC4A 2GD1O 4P4LA 2DTEA 4ZQHA 2D3TA 3C1AA 3U9LA 2Q1TA 1RJWA 2VYND 1YB4A 3EZLA 2C5AA 3I4CA 2Y1GA 2IYOA 3B1JA 1GV0A 4EEXA 1B3RA 1ZK0A 4RZIA 1Y7TA 1YH3A 2C59A 3PZBA 3R0IA 3JQEA 3VHRA 2EW2A 4F3YA 1C1DA 2VNSA 3U49A 5HRUA 4B4UA 4YJGB 1Y6JA 2BFPA 1CDOA 1JAXA 2VZ9A 3NUGA 4J49A 4NK4A 3GZ4A 3U5TA 5CHEA 1A9ZA 3G3EA 2VRCA 4UUNA 1OAAA 1ENPA 2LDXA 3JTMA 3NX4A 4M89A 3H8VA 5JDIC 2WYUA 1F12A 3ZWNA 5BNTA 2X0NA 3EAGA 3NJ4A 1MV8A 2FR0A 5AYVA 3IJRA 4IZIA 1HETA 2VWQA 3D4OA 4BKQA 1AUPA 1T25A 1YDWA 1SMKA 5TRTA 4AJKA 3AFNA 4WOKA 1BTOA 5EN4A 3NTQA 1I5RA 4XD2A 2Z1MA 3R3SA 3SC4A 3WR5A 5HWSA 4YVFA 3OJOA 3A28A 1HE2A 4CM4B 5CDYA 4YAEA 1ZSNA 2RHRA 2J6IA 3PWZA 2PK3A 4YJHB 1IPEA 3LF2A 5TC4A 4CLXA 1BMDA 2WDZA 4N5MA 4QECA 4Z0TA 5JSFA 5JDCA 1PIWA 3F4BA 3WGIA 3UW3A 4AICA 1DFHA 4GGOA 2CY0A 1LDBA 2FPGA 3ONDA 3FNEA 1JU9A 2B37A 4JGBA 5JMPA 4PG5A 4G5HA 4XGIA 5L53A 1H0KA 3PQFA 3QWFA 1BWSA 2BGLA 1H6CA 3WNVA 4IY1A 1NVMB 1E7YA 4XZ3A 4JP3A 3F1KA 1DHTA 1LNQA 4OMUA 4ONEA 2YHIB 5ER9A 4XJTA 4DIOA 1DRWA 2J3KA 2O50A 3K31A 3RD5A 3UVEA 3A4VA 1LLQA 5EESA 4LGVA 1CRWG 4Y9DA 4TKLA 2QIOA 4B7CA 3JD4A 1UXGA 1ISGA 1UH5A 2OBNA 3TNLA 5CFZA 1E5QA 3AOGA 3EUWA 3ZHBA 2C82A 3ZZNA 2P9EA 2GZ2A 2C07A 1ADCA 1LLDA 3Q3CA 3S1LA 4UUMA 3E9NA 4XX0A 3BTSA 4BIIA 3QLJA 3SEFA 2AG8A 4Y8VA 4TZTA 1WMBA 3KETA 1L7DA 4GLLA 3T4XA 2C29D 4BNGA 3L6OO 1MXHA 1SEVA 1X0VA 2Q1WA 2Y0DA 4D44A 2E82A 4YYZA 1S6YA 3Q0EA 2VOJA 3U0BA 3ITDA 2BH9A 4XIJA 1MLDA 4E2YA 3I9KA 3RFTA 2NVWA 3QVWA 2YDXA 5ES3A 2H1SA 4RORA 3E18A 3PGXA 4HFRA 1LEHA 3GG2A 4YB8A 5G4LA 3LSYA 3W6UA 3QWIA 3HUDA 4Z0PA 5IF3A 1EUZA 3B70A 3C7AA 3PWKA 1T1SA 3FCOA 1HSZA 3E6AA 5BSFA 4WLVA 4BO4A 2C2XA 2C7VA 3QWAA 5ICSA 3GY0A 1XELA 1V3TA 3E5MA 3ZWWA 3IDSA 3E1KA 3GHHA 4TVOA 1D1TA 1NAHA 2HDHA 4IJVA 4KDFA 4L0QA 1ZSVA 1GYQA 1BXZA 3UAGA 2JAHA 3IKTA 1M6WA 5DF1A 3PYLA 5CG1A 4QEDA 1HYEA 3JQBA 1ISHA 4DQVA 5A06A 2P9GA 5IG2A 1DFIA 1F17A 3LLVA 4JNKA 4XGKA 3OQ1A 3UUWA 4DIBA 2QW8A 1K2WA 1M6HA 1R0LA 3RUFA 3GZNA 1E92A 4QFCA 2EW8A 1CF2O 3DMTA 3BMCA 4I5GA 4NFYA 2EV9A 3DBRA 5T5QA 4M1QA 3DEYX 1Z45A 2YJZA 4WCFA 3JQ9C 4EITA 5IXSA 5TJHA 1G0NA 1IHXA 4OOEA 1IL0A 4J9UE 4J91A 4HXYA 1F06A 4I1IA 2V6GA 1KC3A 3KLPX 1EVIA 4BV9A 1VSVA 2YFQA 4HFNA 1EDOA 4PLPA 1OZAA 1JLLA 4H15A 3OSUA 1UR5A 4DBVO 3F9IA 4EUFA 4Q3EA 4AJHA 1HZZA 3ZV5A 3ZWBA 3GN2A 2PGJA 2JFHA 3FHLA 5G4KA 4KOAA 3VPHA 2HO5A 5LCXA 5JY6A 2Z5LA 3L9WA 4ITUA 3VTFA 1ZK4A 4CPDA 2FWMX 1LQTA 3MTJA 4W7IA 1ENZA 3RFVA 3DBHB 1QRRA 3QWBA 1TB4A 4PZCA 4UEJA 1B8PA 1BW9A 3RSHA 1M2WA 5BR7A 4CQLB 4NNJA 4RVHA 3BTOA 4RF2A 2E6UX 3G1UA 3HB5X 3JD0A 4OOFA 4MP6A 5L45A 2BF7A 4NU6A 4Q9NA 3ULKA 4CLRB 4CV0A 2NQ8A 4GL4A 4MVJD 4P22A 4YR9A 4BNUA 3MOGA 4RF3A 3NEPX 2OGUA 1PU2A 3DFZA 4YWJA 4TKMA 1I3NA 1ISMA 5A3JA 1O94A 4KWHA 4CQMA 5JXWA 4XYMA 1Q7GA 1JKJA 4D41A 1NX6A 4CM7A 1I2CA 4R3NA 3WB9A 2B4QA 3DXFA 3ZV4A 4AJPA 3CZMA 3WGHA 5JCJD 2VOEA 2VRBA 2DTDA 1HYHA 1QYWA 3KSUA 1SOWA 1Q0LA 3H9GA 5JMWA 1UXHA 3DAGA 2X0RA 1YGYA 5U1PA 1U5AA 1GYPA 3Q2KA 5KJ6A 3JYPA 3M2PA 5TQVA 5B4UA 1WAMA 3TL2A 4E5PA 4O1MA 2VT2A 5A3VA 2BGMA 1A5ZA 2W2KA 4BNTA 3KSZO 1PL8A 3GHYA 4FN4A 4HBGA 4FJ2A 4B4VA 1LDGA 1HE5A 4AG3A 4E5MA 4DIFA 3H9UA 1JW9B 4NDNE 1I33A 4UVHA 2NVBA 3EVTA 2PTGA 4RGBA 4ZQFA 3NGLA 3LDHA 1GZ6A 4D3SA 4U8GA 4L8VA 1VC2A 3DFUA 4B8WA 1P1JA 3VPXA 4E2ZA 3BMQB 3HJAA 4IDEA 2IXBA 4RVFA 9LDTA 3DMTC 3S2FA 4E2WA 4GSKA 5A05A 1YB1A 2IZZA 3LC2O 4RVUA 1YOVA 4Z3DA 4WCFC 4E6PA 4RO0A 4BKRA 4JXKA 1T1RA 2CF5A 3HFSA 3KYCB 4R9RA 2VHWA 1HDXA 4FIZA 3KOUA 4OHUA 3JSAA 5C5IA 4WEQA 2IE0A 3F6YA 5KKCA 3ABIA 1P31A 3ENNA 4AJEA 3JQ6A 4X54A 4BO0A 4A0SA 5HBRA 1Y8RB 3ASVA 5G2OA 3I9LA 5EERA 2PKQP 4CM3A 3DHEA 3U09A 4P4GA 2GGSA 4CJXA 2DLDA 2VT3A 4XDYA 4YCAA 3F5SA 3K92A 3QWHA 3MEQA 1IUKA 5AXAA 3ICCA 2NM0A 1Z7BA 3TDKA 1D8AA 2X8LA 1A27A 4LMPA 1I36A 3D3WB 2HK9A 1UZMA 3GLQA 2DBVO 3ZNQA 3PIIA 3ETGA 3OJFA 2GLXA 4UEKA 4J7CA 3COSA 3GFGA 4J0EA 4LN1A 5L4NA 3ZGYA 1DEHA 4AL4A 1PJTA 1UZLA 1XLTA 4OXKA 3NTOA 5A9SA 4N54A 1C1XA 3AU9A 1YBAA 4I5DA 3L4BC 3ZH2A 1UP6A 3JYOA 4DVJA 4R68A 4W99A 2C20A 1BXKA 4BNIA 2ZYGA 3VPFA 3RUEA 3V2GA 3D5TA 3TWOA 1LA2A 3RAJA 2X9GA 3OICA 1N2SA 4BMSA 3ORFA 3IS3A 2QRJA 1R16A 1B26A 3H3JA 4IDBA 4ZICA 5IDQA 3R6DA 3RROA 4CMIA 4MVJF 3KZVA 2AHRA 3UXYA 1ZJZA 3H6KA 1XHLA 4A03A 1GL3A 3C1OA 3EGOA 3WNQA 2FZWA 2UYYA 2Y1EA 5F3RA 3ETEA 4WLNA 3ZI0A 4PN3A 3BIOA 4IDAA 1NFQA 2UUOA 2OP0A 3GPIA 1LLCA 3HE3A 3ZU5A 1MFPA 1ISIA 1L7EA 5KKAA 5IZ4A 4FC7A 3JV7A 1X15A 2W2LD 1HKUA 2Z1NA 4DPKA 2QYSA 2POQX 4FJ0A 1UDAA 2G1UA 4BNZA 3RJ5A 1PJ4A 4PG4A 1DO8A 1R0KA 4RCVA 2B4RO 4I9UA 1GUZA 2VZ8A 3KYDB 5L4SA 3WS7A 4BL5A 4UUOA 4DREA 3QVOA 1T2FA 5CAEA 3O8QB 1BRMA 1EFLA 2HKIA 2FY8A 3I9OA 1NFRA 4FFMA 4LW8A 3RJ9A 1PJCA 2CF6A 1I3KA 5JC1A 2R6JA 2BHLA 4RF4A 2PFGA 4WNCA 1JKFA 1UZNA 2Q45A 2DC1A 1NHGA 2O4CA 1ADBA 2JKVA 1NFFA 2XOXA 4P4NA 3GG9A 1PS9A 4BGIA 1GU7A 3FBGA 1PSDA 1DAPA 4NBRA 2R00C 3WGOA 4AJNA 1DBVO 1N8KA 1NASA 1PZFA 4UVGA 4BUCA 2VWHA 2YFHA 4PLVA 2PH3A 5MGBA 2UV8A 1IYZA 1LSJA 3QQPA 4XR9A 1BXGA 3GEDA 5KCZA 4YAKA 2Q4EA 3A9WA 1VI2A 4L9RA 4M87A 3WSVA 1N1GA 4IIUA 3LYLA 4WOJA 3JD1A 4FGWA 1MFZA 3W4IA 5FI3A 4CM6A 2WE8A 5G0WA 3QP9A 4K26A 4WPGA 3NGXA 5IJZA 5FYDA 3U4DA 5B1YA 4KDEA 4ALNA 4MVJI 3ANMA 4R54A 1YBVA 3ZWPA 2EF1A 1X7HA 4OM8A 1EBFA 4ZQGA 3JYLA 3L4SO 5EL0A 2BRUA 1E1LA 1PGJA 3RVDA 3GMDA 4MP3A 3WTCA 1A7KA 3EW7A 2DBQA 3DB2A 4MJLA 1R37A 4RF5A 5KJCA 2G0TA 3PHJA 4H3VA 4QQRA 2WYVA 2OO5A 1OMOA 4RJTA 2EGHA 3VZQA 5L40A 4IDDA 1TT7A 3QVSA 4DYDA 5A9RA 5L9AA 1LSOA 1U3WA 4OYRA 1YL7A 3PHIA 5JO9A 4NFSA 2J3HA 1GQQA 1NPTO 4CL3A 3OHSX 4QO8A 3GRKA 4R51A 3FWZA 1E3LA 1PGPA 4RZHA 2HMSA 3P7MA 1XYGA 4RPJA 4FJ1A 4K28A 3QW2A 3OH8A 4BO3A 3JQ7B 1FXSA 2VCYA 3LU1A 4B7XA 4BB5A 4JLWA 3WXBA 5ICMA 3KM0A 2OOSA 3WYCA 1WZEA 4GGPA 1LDYA 4DRYA 3AWDA 4N7RA 3PHHA 4U0KA 3WQRA 2ZK7A 3GA0A 3BXXA 2G76A 3C24A 4MKZA 4RPGA 1PWZA 1GUFA 1KC1A 3U4HA 4XEHA 2O7SA 4M8SA 4RL6A 3N7UA 2EHDA 4YEDA 1I3LA 4JCOA 5H83A 4XDZA 3OIGA 2GERA 5AQ1A 3OIDA 1F8GA 1Y5MA 3NT4A 1A72A 3DZJA 1R0SA 5T57A 3FPCA 8ADHA 1LUAA 4YRDA 1BVRA 1WVGA 4M55A 3JQFC 2NU8A 4IUYA 2HRBA 5JAZA 1TLTA 2WEKA 3DO5A 4ND4A 4F6LA 3QJ5A 5JDIA 4BO9A 1VJ1A 3EYWA 5EPOA 4DPLA 3ONFA 2V7PA 5JPIA 2UVDA 3AFMA 1HF3A 3NDJA 2A9FA 3OM9A 5HS6A 3CPSA 1N7GA 1LBEA 3MWEB 3GEGA 1E6EA 2DU8A 3I6QA 3KVOA 5BNIA 1RYEA 5L3ZA 3GR6A 1DSSG 1C1DB 4F6CA 3JQ8A 5COAA 5J23A 4OIMA 1LRJA 1DC3A 1H6BA 4PZDA 4HV4A 3M6IA 3EVNA 1LTHR 1ZVMA 3RUHA 3B1FA 1ZBQA 1ID1A 4URFA 2ZTMA 4PVDA 2PLAA 2NVUA 1ZEMA 2QZZA 1ENOA 4NG5A 5FWNA 4G2NA 1FDUA 2FMUA 1F0YA 2P4QA 3CTMA 1HDZA 3VTZA 3ZHZA 4J16A 4Z6KA 3TPCA 5K1SA 5KVQA 1T4BA 2P5YA 3RC7A 3ZHXA 3TFOA 1QMGA 4WJZA 2O3SA 2PD6A 4JX8A 4R01A 5LDGA 2A92A 5KVCA 2WD8A 3PXXA 4IZHA 8LDHA 3DDNA 3Q6IA 4WLEA 2WMDA 1ZK2A 4IDCA 1I8TA 5TJ9A 3UCFA 3WGZA 1HZJA 3KEOA 2X4GA 1QYVA 1E77A 2XPCA 4UREA 4BO2A 1VKOA 1X7GA
chains in the Genus database with same CATH superfamily
1DV1A 3WLOA 1KBZA 2WFAA 1ZH6A 1RAIA 5E6UA 1V9CA 2YKGA 1VKHA 4HQRA 2QQ5A 1H42A 2FMXA 2WVHA 5FWXA 3SE7A 4QT0A 1UWCA 2OV8A 2ZIWB 1JN0A 2Q4RA 3K5IA 2WFLB 1RACA 2X23A 3F74A 4PG8A 4D8UA 2HCTA 5CVDA 5A03A 2EARA 2PBLA 2WYWA 1JKXA 2E4ZA 5HBGA 3RWOA 2GTIA 3WQSB 4X6UA 5G1PA 4H1WA 3HBMA 4FI3F 3TSOA 4BV2A 4OATA 2FTKE 3MOSA 1F6DA 2PR7A 3MJCA 1CUDA 3WYBA 1KZYC 9ATCA 3K9QO 1XNJA 1HR0B 2HQ1A 1EU1A 4DQXA 4UQOA 4UTVA 3ELYA 2M6LA 4AP6A 4L8FA 1UZUA 2ZXUA 2ORYA 3L8ZA 3IBTA 2N9UA 4D92A 2G07A 2KLBA 2V96A 5EJEA 1O4VA 4FBMA 1TTPB 1WCIA 1I4LD 4AQ7A 5GINE 2YCLA 3DGFC 3S70A 3IQGX 2WTUA 2F64A 4I50B 4RX1A 2H1OA 1OBFO 1YASA 3H5NA 1XROA 1SKQA 4ZRNA 3VKFA 1S1CA 3P9IA 4GX0A 1Q0TA 5FOVA 2R6AA 2AI1A 2OD2A 1HDGO 4PO9A 5ALDA 2QTRA 4V0QA 1W34A 4ZFNA 1J39A 3LUKA 2PO5A 4W7HA 1YZVA 3D7RA 5CYPA 4P38A 5DKFA 1IHUA 5A2GA 3VM6A 4CUKA 1GNVA 4R69A 5T4HA 3ADBA 2ZSAA 4OQPA 1JU4A 5L7YA 1E1CA 2Q0SA 3HO8A 4FDMA 4Q0MA 3ZHYA 2ZJZA 4BQRA 3GEIA 3I62A 1BIFA 4FNMA 2FSGA 4LXGA 4MQMA 4PC1A 3IT3A 2H7VA 1F0KA 4HMQA 2TRSB 4Q47A 4U6NA 7GPBA 2UVPA 1UPCA 4U9UA 3Q85A 4RK0A 4IUDS 1YACA 1KJZA 5EIXA 1CNMA 2QQFA 4PFSA 4W6QA 2WPDD 1UFOA 5C3UA 5C8XA 1PT6A 2Z9BA 2VPQA 2X2EA 4WBNF 1P1KA 5ARCA 1M7GA 4FGKA 4YRMA 4LKOA 3TKAA 4IF6A 3PUZA 3C3CA 3QI7A 1U2DC 2GWHA 1N0HA 2C9ZA 3CLHA 5EVJA 4LFAB 1K7CA 1D4AA 3BZBA 1XZQA 2AS0A 2QLMA 3BSFA 1ZNYA 2XVYA 2ZROA 4Q03A 1GG9A 1WTAA 2GK3A 1GRNA 5E6RA 5C4MA 1KR2A 3AEUB 3EAQA 3KIPA 5HUJA 1HV8A 2BI7A 4R4JA 4TL8A 3X1WA 2DWUA 3U16A 1S02A 3TXAA 1B42A 1ZH0A 1RLOA 1XZNA 3BK7A 4GI5A 4LBWA 3W9SA 5TX7A 4V2UA 4QQ8A 4BATA 5KZMB 2B0CA 2ZUSA 4FYXA 4INZA 1SC6A 1IE3A 1TZKA 2OD7A 5IFLA 3VC7A 3CNQS 5BQOA 1ORVA 2ZJFA 2Q0QA 3CMCO 1N9GB 1ZIPA 4PYNA 1PJLA 3OSZA 5G02A 3ABSB 4GI3A 5EXDA 1Z6YA 2HDWA 2HT6A 3IRVA 5DISB 5TQ0A 3V7WA 3A6DA 1JEEA 3WLSA 4YV0A 1A8SA 5J4KA 2N47A 1MJGA 4G4GA 3AU8A 3FSGD 1SD2A 5HM8A 4XUCA 4DNFA 4BFUA 2PGDA 3DAPA 3O8LA 4YR7A 4DWWA 5A0VA 1VPEA 3VV3A 5DH9A 2JFFA 1PP4A 3U7EB 2IZ5A 1NKSA 3CE9A 1CY1A 4KYTA 4QQKA 4QTUB 1Y9AA 4YQZA 3T7TA 4CLHA 2MYNA 3N3AC 1FX0A 3H3XA 4OQFA 3PQCA 4WERA 2YBDA 1Z5ZA 4UU0A 3SBEA 4HI0E 3SYRA 3KQUA 4LHSA 4ZDKA 3D8UA 1GGFA 2JCGA 4LDQA 4NYMR 4OP1A 4MRRA 2NN3C 1QP4A 1F3LA 1D2HA 1ZUD1 3DOCA 4FQ8A 3ZG6A 4P08A 5F1YA 4Z54A 5JAPA 4P93A 1AN9A 1T2EA 3UF0A 4YHHB 3KFXA 2DR2A 4GOLD 1EQUA 3MSCA 4G8DA 4KN9S 3H65A 3UG7A 4G1UC 1E20A 3IQIX 4DLVA 2YICA 2WJIA 3CRZA 5F1KA 4ZD6A 2NOAA 2PRSA 3DLAA 2X9NA 2A7QA 3DZHA 1N33B 4WDRA 1LI4A 4JB0A 3VNQA 3HJRA 4B5KA 2PV7A 1CF9A 3CKYA 4G8CA 3G8AA 1QDUA 1MB3A 3SK0A 4BQOA 4UEWA 4FWTA 1IXRC 4DARA 4EY7A 5DHSA 1M54A 2OCYC 4RDHA 3MWYW 2FSVC 1MJFA 1KNQA 2J9GA 4H18A 2QD3A 3NRJA 2M6KA 1QAMA 2BGJA 3AUTA 3P2OA 5CVVA 5KUTA 1CUAA 1XJ5A 3K1JA 4WI1A 5FNVA 3O03A 3O1HB 2EKLA 4MW2A 5AVZA 2JH9A 1PKEA 2IBSA 1QJ4A 4CQMB 2NQ2C 4TMFA 3ZV3A 3IFSA 3OX1A 4RHEA 1JJFA 4C87A 3AL0C 1OFIA 1QGYA 1FS4A 3LC0A 1NBIA 1YU9A 3MWFA 1GPLA 1EVKA 2F00A 4MRMB 3K6KA 2CJFA 3O9ZA 4XD7D 1Y1QA 4RKQA 4TLEA 4UW9A 1TKRA 3CGGA 1JVNA 3RK0A 1GLNA 5AVRA 1A8IA 5LOVF 2W2MA 3L6CA 4JJIA 5JJ5A 5CB0A 1NJ2A 3RAGA 5AIBA 3JWIA 2DWCA 4MO2A 4YFYA 2AOXA 3PUIA 2QM7A 1VHJA 3M8KA 4D02A 3CVUA 2Y27A 1GNLA 3PDUA 4ZOAA 3H1AA 3F3SA 3PLAE 9MHTA 1NF8A 1DTEA 2CFIA 3AM5A 3DWIA 3F67A 5K3SA 5LJIA 1C4XA 1DAEA 1B16A 1S1MA 4DV3B 3KSMA 3CCBA 4EFDA 3R8FA 4EGFA 4TLBA 1Z06A 4RTOA 4HB3A 2PQ2A 2Z3WA 4CMCA 1TIPA 5K0CA 1ZHHA 1DWUA 1AO3A 1Z38A 3MZ0A 3LCRA 3VGPA 5F35A 2HV8A 2VO1A 1MO5A 1BYUA 5EJ2A 3RV3A 5JALA 2PKRA 5B2EA 9ABPA 2AVDA 2NT3A 3WLTA 1EX1A 1YR9A 2XQVA 4BE4A 1X92A 1R0WA 2XEXA 1ULUA 4QXQA 3WGTA 5IDXA 3JQGA 1D7AA 1WULS 3EXHA 4E03A 4UE3S 2JRCA 4ZYZA 3K6RA 2OOKA 4ENSA 4WFIA 1DJNA 3UQZA 3ZWDA 2WD9A 3BL5A 2Y68A 2HEGA 3DMDA 5DBFA 5JSZA 1QBGA 6CHYA 3CW8X 1XHEA 4L8YA 3RVBA 3T5TA 1EZZA 1N6OA 1V16B 4N0QA 1G5HA 2IHTA 4ZZ2A 3VPGA 4H7PA 1VCHA 4YRTA 3FTNA 3PVCA 2ORED 3KQOA 4J0FA 1L6RA 1YB2A 1VG1A 3BCRA 4OFXA 3VC2A 4ZYYA 1RKQA 1UAYA 3W8RA 1JQBA 1RMQA 1SOAA 1TT5A 3O26A 3PPIA 4S1WA 1KMCA 1OGYA 3CEJA 5EP3A 3THOA 4AXBA 2DRIA 2XYGA 5AI5A 5FV4A 3IJPA 3A4IA 1E9VA 1M6EX 4MUXA 4PO1A 2CDNA 2ZWAA 4BBPA 4CTNA 3VO9A 4C7VA 2DUUA 2DFLA 3QQ5A 4O5OA 5IFKA 3HXOA 3K6JA 1FTQA 3WOHA 3O3OB 4YT5A 4C7MA 1OXSC 1EVQA 1ZO8A 3HEBA 3MTBA 1ESZA 4JVLA 5ALXA 2OXEA 3ZCXA 3G7UA 5DBIA 4DSAA 3DE4X 5L6LB 2OCXA 2P4UA 1QGZA 1ODJA 2JJQA 2P9HA 1LK7A 2AA3A 2FSHA 1Y9ZA 2FPIA 3O6VA 3ZTWA 5GPBA 2XW6A 3BSWA 3OZVA 3I9MA 1ZD5A 2Q2OA 5GV8A 1XCMA 1F2TA 3PXEA 4BQNA 3PE3A 4U2CA 3KDAA 1VSTA 1U0RA 3EQ9A 3N5CA 3BFKA 2V5VA 3IB3A 5FTMA 4CHGA 1WPXA 5CB4F 1YVPA 2FQQA 2X1VA 3IEIA 2VDWA 4DIDA 1TPYA 4B81A 2Y77A 2YN0A 1KYQA 3TZ6A 4PV7A 2A5JA 1DJOA 4D42A 3STXA 4HAYA 1KMNA 3HB1A 3EGXB 1R2QA 2CYBA 3DV0A 3DM5A 4AN4A 4BASA 3ZJVA 1B3BA 4MYCA 1FFXB 2B99A 2HMUA 3ESBA 5ESXA 4ZYVA 5K9ZA 1N92A 2B4YA 4IPTA 3K0CA 3EEBA 1L5SA 2EDAA 4J2HA 2IELA 1P62B 2HBQA 5HCNA 3UMRA 3VYWA 3OFJA 4BZPA 4V0RA 4HGRA 4ZOCA 3E3AA 3PYMA 3RSLA 2Y1CA 2W2QA 5J58A 5DSZA 4PZ9A 4B3DA 2Y1FA 1EFVA 3NGMA 5AJTA 4LF7B 4LVOA 4KO8A 4DLBA 3ZU6A 1TU0A 4OD0A 3H13A 4IQ0A 3R9XB 4HC4A 2KB0A 2LTAA 1GR0A 2E7ZA 4I1UA 4A92A 4Y1FA 5EJ9A 1W85A 4D4JA 5J4HA 1JVBA 4OB6A 1XYYA 3E05A 1Y3HA 2OHXA 5DFAA 2OQVA 1G2QA 3WGJA 2AQKA 1NYLA 5A7FA 3ZBTA 1B14A 1NYTA 4TKUB 1T2DA 3UT5B 1Y6RA 2PJUA 3LS2A 3OECA 4PNHA 1GPBA 4BC0A 2FXIA 2VUSA 2AE2A 2FRXA 1LJLA 2B36A 3AESB 4RGQA 5ALUA 1ZUWA 5EMNA 1ZHOA 1QG6A 1QX4A 4QATA 1EMDA 4DG9A 1YF3A 4QDZA 3ZHOA 4DMMA 4BQPA 5T3YA 4B4OA 3KZOA 4M7RA 1Z4KA 3HCPA 3W3AH 4C0QC 1Q6YA 3G9TA 3IBGA 3EXHC 4E5SA 1P9LA 3Q0IA 4PYOA 4BNYA 2WYOA 4EHAA 2VJLA 5KTNA 5ICCA 1GAWA 1YK0A 2QTVB 1COWA 1BFUA 3VU9A 1JJ7A 4EYGA 4QVIA 1E3MA 1L9XA 1XNHA 4IZ6A 2YUTA 4F1WA 1VFNA 4G0ZA 1P33A 2NYVA 4YCJA 4ZZ0A 2AEJA 5B6PA 4FFOA 5K0EA 4AY6A 5ENVA 2FWIA 2YV1A 1N5MA 3KZ1E 3UYKA 4A0HA 2FMFA 3IP7A 3B1ZA 2R48A 1DJPA 2BTQB 4M98A 2D4AA 3MTAA 3PC2A 4ON9A 3KG2A 3ROPA 2P78A 3WWDA 2B8EA 4OL9A 3K9WA 1EJ2A 1KFKB 1YI0A 5F1OA 1XZCA 4GMHA 1JMYA 2OCIA 4PBTA 5C7OO 2AG5A 3FPKA 3HBAA 1X80B 4N6NA 1E18A 2IZ7A 4WK0B 3EC7A 1CY7A 4JOSA 1TCAA 4O2AF 3ZXSA 5K05A 1PJQA 1UJMA 3FLEA 5DSTA 5BSGA 4AB1A 2OILA 3T0FA 1FMTA 3HSKA 4DMKA 5AJXA 1DLJA 3TUIC 3E7DA 2VCHA 4HRXA 4R1PA 3B48A 4RTJA 3FCSB 5B57C 1JHVA 4HB4A 4LSZA 1PW7A 1FLNA 3W4KA 1QB7A 3I2HA 5BPFA 1RWWA 2RSLA 3LHIA 4UM5A 2G83A 4ABYA 2ADOA 4LHVA 3RM3A 5C3MA 5K5EA 4GMKA 1XDWA 4FHFA 4URWR 4HDOB 3N6RA 3F98A 1GRRA 1TC2A 2WAAA 1U2GA 2OZKA 1D3AA 1UJ4A 2YZ7A 4J0HA 1Q7RA 1RDFA 2Z2KA 3A2KA 2QMOA 4UE6A 4QQFA 4QPPA 3CEAA 5CGZA 3JQDA 4S04A 2ZIZA 1ZVQA 2ZUVA 1G64A 3IP3A 1E0DA 3TNFA 1SCBA 3R7BA 3WWEA 1ONOA 2PS3A 1X8KA 4JI6B 1G4AE 1UPTA 4G8BA 3HJHA 1FU4A 3AI2A 1R5OA 1DAKA 2Q8PA 1YONA 3ADOA 3KHUA 4YA6A 3KYCA 3IPLA 2BHRA 3OE7D 1KZ7B 1M1YA 2IHUA 2OHOA 3OKAA 4KK3A 4NQRA 5DCYA 2IPNA 3HYNA 5BURA 3TOCA 1MG0A 1X1RA 1PWXA 2JD2A 1Q1NA 4Q3LA 1IQRA 4JROA 2VHZA 4NIMA 4P3PA 3W77A 3R7DA 4WKPA 3JQFA 2BFMA 3GCXA 3NT2A 1SVKA 2QYOA 4QNRA 1JHMA 1MABA 2A0UA 3VISA 2H11A 2GRAA 1T91A 5DGTA 5HKBA 3LHKA 3VR4H 3IYLW 2ZIFA 4Y7CA 1H2YA 2FN8A 3F5QA 4PTYA 5KYUB 1U7OA 5JS8A 1E3SA 5DT9A 1J99A 1THGA 2ZRJA 4BMDA 1UQUA 4UXIA 5B2FA 4MVJA 4J94A 3L0IB 4PYLA 3NHFA 4YO7A 3VAZA 2QTBA 2UUCB 1QU3A 4Q3CA 1A4IA 1QH8B 3DAYA 4DSNA 3R3YA 4P34A 4KVFA 4AF7A 2GXQA 1TLLA 3IEPA 4KAAA 4AZSA 2CZGA 4L6AA 1BS1A 2CLEB 1ONPA 1Z8DA 4C4SA 4LJRA 3E15A 4DRZA 4I4IA 2C9MA 3SXUB 3KFVA 1R9GA 4YWHA 3B36A 1C2TA 4XQCA 1CIPA 1XQWA 2CK3A 2CXSA 2GPSA 3OX3A 2NU8B 1KPHA 4GP6A 3W1EA 1GQYA 4PFQA 4YMIA 2R7MA 4V0MA 5BW4A 5JASA 4OXXA 4C9BA 4QO7A 1C7RA 4IMPA 4ZARA 5ALNA 1PE0A 1LZKA 2QDXA 2WJZB 2ZI5A 1GL7A 2NO9A 4NOJA 4QHSA 4TV8A 3SBOA 3EA5A 2MHCA 3AKCA 4UNPA 1NL3A 1KQNA 3QXHA 2WINI 4GI1A 3WGQA 5EQTA 5KINB 1BDIA 2DUWA 4AD8A 3LIIA 1QIFA 2ZR8A 5LN1A 5HFJA 2I4LA 3L0YA 4P3XA 2CUZA 3X1MA 4KQ2A 5M34A 1F4VA 2F48A 3G17A 1XMQB 2GLUA 3R6TA 3EB9A 4GQBA 4CLDA 1QHNA 1AK9A 4OQLA 3K0AB 1YRAA 2DQKA 5BT9A 2JFQA 3C45A 5KNCD 3FHOA 5I7RA 5DCWA 1PGQA 4JY7A 1TXGA 1PLJA 2YW2A 3JQ8B 1ADJA 1KHTA 3SI7A 5JIBA 3N7AA 2AEMA 4EO9A 1W59A 1PO7A 2Y4NA 3LVFO 3SHVA 3G7SA 5IDVA 3AFOA 3B9BA 4QTTB 3V46A 2J4CA 4CCAA 3VBEA 4DCPA 1WETA 2R8BA 4OI0A 3DOEA 4D9CA 4KQ1A 1PZGA 2ID9A 4NCBA 2H54A 3AVXA 3I8SA 3FSJX 4WESA 2CFSA 1JUDA 3QIVA 3NH6A 3FIJA 4MR7B 5C2JB 4CG0A 1DKOA 4X71A 4AULA 1NPYA 2GZAA 1JWBB 1QFSA 2VJCA 1V4NA 4QQNA 4QOSA 4F84A 1XQ1A 1E2GA 4R8RA 4XM1A 4ESVA 3HC7A 2R6DA 4PGGA 3QOWA 3GJSA 2RGGA 3UJAA 2ZAGA 2AKYA 2B21A 4JOCA 5GMOA 3MJFA 4P0TA 4ZVUA 4KWEA 1P2SA 1Z2EA 3IUQA 3V4OA 3I9FA 1ISRA 1NRJB 2FN4A 3GGCA 1JLRA 3OF2A 4F92B 5IBQA 3DEHA 1NOIA 1C0KA 3FPGA 5KYVA 5TQ2B 4AW9A 2PUCA 3EIUA 4L2IB 1UKCA 2HJSA 3A10A 3HXTA 1YA6A 3NBUA 5E9JA 1T5DX 4K5QA 5E6UB 3THXB 1KOGA 1ZVKA 1QLJA 1V1MB 4C88A 1QJCA 3NJ8A 3ANLA 4MKRA 4L1KA 2A6PA 2AQ8A 2BZGA 2TMGA 4C4YA 4EJMA 5HP4A 2XCIA 1C1YA 1FPMA 3PA8A 3PCRB 5KYGA 3KV3O 1HK7A 3DONA 2FSFA 3LE8A 1R4MB 4HYEA 2NW6A 3IH5A 3TW8A 4JUDX 2WM3A 3EODA 3LTNC 1XVLA 1QVVA 3KEMA 1T0HB 2V7UA 4F4FA 2YCBA 3RC2A 4LXTA 5CCDA 1L6IA 4I55B 3KKEA 4QWWA 1OBOA 2I76A 3FSRA 2HA4A 5EE0A 5P21A 2BR3A 3DMRA 5JPDA 5JVDF 1QOQB 3WL4A 3P96A 1OVMA 2I1VB 4Y6GB 4BN4A 2WTAA 4X6YA 5DNAA 4CXMA 3QU9A 1UBMS 1OT5A 4RY2A 3RK1A 3QF7A 2RARA 2B2CA 3L8HA 4NU0A 2AW5A 2X4DA 5L3VA 3ZWVA 3WGGA 3M0EA 3TAXA 3HZHA 2HUPA 4JLDA 1EK1A 1B8NA 2FSPA 5L7WA 3V8BA 4EQZA 4Q3NA 5EYPA 1Z8FA 3M9WA 3M5PA 2GKOA 3E4DA 5DU2A 1KL7A 2GPWA 4LTDA 5TE9A 4Z51A 2OXIA 4KIGA 1R8SA 4DUPA 1Z4IA 4HDCA 2GWRA 5CVTA 4IBOA 2OQRA 2O2IA 3EWAA 1I5OA 3K96A 3LX8A 1UDBA 4AVYA 4R71A 1HBJA 1D0IA 2WKWA 3I64A 1P9NA 4DUYB 5KCMA 4R3WA 2ZUWA 3ABRB 3T3EA 2YTZA 2ZVPX 1ENYA 2O3TA 4ZEVA 4KIFA 3U44B 3CH6A 5BY2A 4KI7A 2X15A 3B20A 3AVWA 3CW9A 3LW8A 1W36C 3TI7A 4A7PA 3S2ZA 4UHKA 5DXAA 2YXDA 1GYRA 1YO6A 1YGPA 1O77A 2G8LA 2W5UA 3FVRA 1X39A 2HPAA 3PDIA 2CNKA 2MMCA 3K0KA 1AX9A 3FUVA 4GP9A 4Q19A 3WLRA 4U9HS 5EJ4A 3W5CA 2ZAMA 1WMAA 3EGVA 1GCUA 4RFVA 5DV9A 1O2DA 4Z9XA 3UC9A 1HDOA 4DT1B 2H00A 1RPJA 3MK31 3KTFA 2QRMA 3DL7A 4GMGA 5IYZA 2ODTX 2GH1A 3F9CA 4QIHA 4UCQA 5A4MS 1SUEA 3EVBA 3RKRA 5IUKC 2PVSA 2B8NA 4K7JA 4GPIB 1DAMA 3K8ZA 4HTAA 4RZSA 2XVMA 4R2JA 3R23A 1H2WA 5ADHA 4E70A 3DB1A 1PZXA 1QHSA 4EA6A 2YZ2A 4ZK6A 4O1HA 1IQ0A 4QM6A 6ADHA 1WKBA 5JSQA 1VJ5A 2FX2A 1XZAA 3ANNA 3OIFA 1RI4A 2GJKA 3OZIA 4FMCF 3KB6A 3GJZA 4GW3A 3BERA 4NJOA 2C3MA 1UJ5A 4OAPA 1W2HA 1MDBA 2VTEA 2AVNA 5G3ZA 4YBRA 4X64B 3FH0A 1NBMD 2JFZA 3EIFA 4DUGD 1YS4A 5DM2A 3RFCA 1C2YA 2P4SA 3K2EA 3R0VA 4R5MA 4NE2A 3W6NA 1BDBA 2PMBA 4FEAA 1M1YE 1S2IA 5KAMA 5IVIA 3TLEA 4K1XA 4D79A 4CU5A 5LZ8A 4TWZA 4NS1A 1NMYA 1U8FO 2H0RA 3KU4A 5TQ0B 4UZFA 1TCUA 1VRVA 3M70A 5I7OA 4P80A 2B1JA 4XX0B 1JDJA 3IUPA 1EVEA 1L7QA 4ZI5A 5IAJA 3CZ5A 3UAVA 3ZUGA 2I7CA 5DASA 1FW6A 1A88A 3AF3A 2YC2C 4JWKA 4KMSA 5FBRB 4ZQCB 3C2QA 3NHUA 4UCXA 5EP2A 4KLCA 3ZDRA 1JEAA 2AT1A 2CC2A 1MN6A 1FX0B 4TV9A 2EFJA 3MF4A 4MVJE 4LDAA 3PUWA 5LP6B 4A2CA 4AZ0B 1X77A 2VTKA 2PUHA 4QJ4A 2R8PA 5ALEA 1N6KA 1KPIA 3VZRA 3YASA 5I9LA 5KSWB 4TYYA 4GI2A 4F85A 5LQCA 1RD4A 4E2FA 1UC8A 1UDCA 4KIUA 4UJ3A 1MX9A 3CSDA 2LW7A 4ITRC 4XLLA 3SR3A 3ZHQA 1JHDA 3PNOA 2C9DA 1IEXA 5K3FA 5B4TA 5CFLA 2BTOA 3QE3A 4FYVA 1I01A 4HWTA 2VAWA 1W0KA 4P9NA 5HJ2A 1YQWA 4QXPA 4RA6A 4M9XA 4ZVRA 4EGQA 4YC7A 3M2TA 2YUIA 3NZEA 3SR0A 1PSZA 1GGJA 4V0ME 3ROGA 5KU1A 3B13B 1QH9A 1SXGA 1IOVA 5DLDA 4RLQA 3MBOA 4GPD1 2BSAA 1AMOA 4KMOA 1JSLA 2ZUFA 1LVHA 2XEDA 1UC4B 4Q00A 1FMJA 3TW6A 1CUCA 3BHIA 2YDYA 4PPYA 4PLWA 2C4MA 1NW8A 5P8WA 1YJCA 2XJ9A 4YJFA 3GFFA 4F1KA 2ESRA 2YWFA 2ZSJA 2G0NA 2IUYA 2VHTA 3HZOA 4R1MA 4TTTS 5CVCA 4F21A 1B00A 521PA 4DXDA 5KYWA 3SQWA 1N6NA 4MR8A 4NY1A 5G0TA 4F4DA 1H5QA 1YKFA 3IEVA 2XITA 4BRZA 3QZUA 2C83A 1XCBA 4TL9A 4GZ3A 4MGYR 4UEOA 2E89A 3ZNNA 1V35A 3PFIA 3D64A 4PIMA 1KARA 2FB9A 3VZCA 3A9VA 4ZU1X 4QBIA 4ZEXA 1E1QA 1G8MA 3AGPA 1X1DA 3DDSA 5CX4A 1NVDA 2Q4TA 3LUJA 4G84A 4M7PA 4DDWA 1T5OA 3FOZA 2B1GA 4DQDA 2A1UA 4QOGA 2AOTA 4HDKA 3RTBA 4TXHA 4RTKA 3HHPA 3JALB 1S2DA 3MJ4A 1E1RD 4M9CA 5A0TA 4ZODA 3AJRA 3NMUF 3L7JA 4CEHA 3V8PA 4IHJF 3OQNA 4C0AC 1G8PA 4BBAA 4YP6A 5IT0A 4ZI3A 3LT2A 1HUQA 3WLPA 4RZ2A 2L82A 3HN7A 2Q5LA 4J6FA 4Z1OA 1TKCA 4RESA 3PCXA 2AR7A 4JA2A 1Q16A 2I2CA 1FYXA 2GM3A 5EA2A 2ZU6A 4DLSA 4Z53A 1JPUA 2GCOB 4BLSA 5FTLA 1RYBA 3CUVA 1OH7A 4QGGA 3RS7A 1S3GA 4HDSA 4WBNA 2J48A 3GFSA 4MZXA 1Q11A 5GOZA 4B6JA 1ABEA 3I5YA 1TK9A 2QJWA 3CNLA 3LLUA 3PRKE 1PG5A 5TR9A 2IPXA 3JRXA 4OJNA 4PY2A 3HBFA 4TTQA 4Z7JA 3JQGB 3SQLA 2IYLD 2X13A 1LK0A 3W1VA 3ILXA 1PQPA 3KZNA 4IJUA 5B4VA 3SSAA 1MGOA 2GVDC 1CNFA 4F4CA 5L6MB 3EH1A 2WB2A 4IH1A 4RIIA 1V1JA 2R8EA 3OP4A 4FIDA 4UM8B 3CW2A 1EVJA 4ZEWA 2VK1A 5JSZB 1PEDA 2C96A 2CNDA 4K1LA 4LZNA 4MIYA 4D6PA 4PICA 2O4UX 5I3ZA 4RK7A 3CYFA 2QB5A 2A59A 3IXLA 4MW7A 4OGWA 3T1QA 1U4SA 3KOZA 3MMXA 4F5DA 2Q9BA 4Q4JB 3HCNA 1YT5A 3I5XA 1X7DA 2J33A 1QR6A 3T1OA 1UBCA 1AKRA 3IX7A 4TM7A 5IDWA 3DFIA 3MLBA 1HDRA 3A7EA 1ZCAA 4JK3A 1NNUA 3ASUA 3L8YA 4JR2A 4TWJA 1TT5B 3S40A 2UDPA 2PRJA 3GLHA 3ERCA 2R7LA 1IPFA 4HVTA 4Q9KA 3PF9A 4C29A 2XUIA 2UYGA 2CHQA 1JXOA 5H68A 2H4HA 3AUAA 3ON5A 1ZR4A 3KXPA 1SXJA 3TQFA 2B3DA 2OZLB 1PYOA 2WC1A 4LQDA 3ONVA 1WP9A 3LQ1A 2X0JA 5E9QA 1K89A 1P61B 1U0GA 5K0TA 1JE1A 4WK6A 3PI7A 4ZREA 4XCVA 4BJ1A 3PQEA 3ZCVA 2X5XA 1JHUA 4ARCA 1VSQA 2X2PA 1T6YA 4KO1S 4J6EA 1MKYA 3EYAA 5M29A 5SICE 5TPWA 5AW8A 2H1FA 5ITVA 1IK4A 1N7IA 2BHTA 3D4NA 5GJWC 4D8XA 3KEFA 4YCNA 2W2KB 4DGSA 5JC8A 2O54A 5FF9A 1GZ5A 3L0BA 1VHLA 2VDWB 3OJEA 2I67A 4PR0A 5FJJA 3T4EA 2ZWMA 4L73A 2VDMB 2XGGA 1E9RA 3BA1A 1NDHA 1VBNA 2Q2QA 4PQGA 4EUHA 4C6TA 1BMTA 3IULA 1DBSA 3TUZC 3N0VA 4ETMA 1GKKA 2IF0A 1H66A 2V7TA 3LPLA 5FUWA 3AB8A 1NV8A 2WNSA 4FW9A 2G9RA 2PDAA 3DCJA 4JHXA 5BV0A 3KQVA 4RK1A 1Y5RA 3E3MA 5TPZD 1IEVA 1G21B 1QHHB 2ZB2A 4RADA 1GZ4A 1THTA 3DUWA 1EG2A 4ZYUA 5I9TA 2PA0A 5JLJA 2G67A 1QAQA 1EFVB 4CIAA 3PFHA 5DN6D 4Y9SA 1ATIA 1K8RA 5AJWA 1UFKA 2CHUA 1OKKD 2R86A 3SP1A 4BO8A 2OV6A 2PWAA 3GF4A 3UH1A 5BWLA 4OAOA 3Q7RA 1W52X 4ZMRA 3TI9A 1NSYA 2ZANA 2A35A 3GOHA 3SICE 3K8YA 5AK3A 5D5HA 2F4VB 1O6CA 2FK8A 3S3TA 4DYVA 4FEGA 1F51E 3KUXA 3ZWMA 4OCZA 2FSSA 3TQIA 2PJDA 3NHJA 3DWGA 1FS6A 1OU0A 3TGLA 5AXCA 5HX7A 2X3UA 3RFXA 1SQGA 2F8MA 1K06A 2I6GA 1YXMA 5LOVA 4NOKA 2ZJ1A 1XQYA 1W5AA 3AR7A 1UDWA 1F8FA 2H3EA 4LYHA 1ESMA 4LYAA 3HFRA 3VNVA 1K5GA 3NLLA 3GDGA 3GUHA 2IX3A 3KR9A 3HS3A 3TAHA 2YS6A 3BREA 1N2JA 1Y8CA 1BN7A 2MSNA 2YVLA 3VU9B 4FHEA 2Z04A 2JIBA 4MCJA 2O0HA 3P2YA 4J03A 4RACA 4TMKA 4C3OB 1GAXA 1Z2OX 1J5XA 2HNKA 1URPA 2VDKB 3CKMA 3O1JC 4NMLA 3CEPB 3GLTA 1KMHB 1Q92A 3M83A 4PZPA 3UB4A 3TTSA 1XJWA 2CWDA 4Q1CA 4V3BA 2TSYB 2Y3IA 1P4RA 1QGAA 3FNQA 3X3HA 5A9SB 1XTVA 2CJYA 2VBGA 2O2CA 4UARA 2CLHB 3VYTB 3IPRA 4P3KA 5DBGA 5E3JA 3UJ9A 3IV7A 5CP8A 2GMWA 3NBFA 1WQ4A 2R8XA 1GKYA 2P41A 3FRJA 4J1QA 1PD0A 3AQ4A 4OH1A 1FF9A 2E3JA 4TRJA 5FTJA 3RGWS 5I7UA 4JBHA 1W6UA 4FFNA 1SXJC 1P80A 3GGPA 4M4SA 2HK7A 3OWXA 4DZTA 2BMAA 4QAQA 3PEWA 2BIFA 2II6A 3OJ0A 1LLUA 1YIAA 1R5JA 3E9RA 1LQUA 3L06A 3WK6A 3OE1A 3PDWA 4B84A 1G16A 3AEXA 4FMDB 2DJIA 2WYHA 4QYIA 3TRDA 4GAEA 1T4CA 4RC9A 3OUTA 4Z4GA 1TPZA 3SQNA 2P0AA 2ZKLA 1AGYA 5K2OA 2DUJA 3AHHA 2AKEA 3MJVA 1L1QA 3U9SA 4CHTA 3ZDCA 3A4NA 4A15A 2B94A 3KPJA 3FSGA 3HA2A 2QD1A 3H0KA 3RUAA 1JQLB 1LPPA 5H80A 3PWTA 1K66A 3EMKA 1ORRA 3EQ7A 3JZIA 3MAAC 1AGPA 3W5UA 5AW3A 3NDIA 2JA2A 3RYHA 3BBPA 2V6MA 4PCLA 4KIJA 5HILA 4GF5A 3R44A 4Y1EA 3ZPXA 5DM0A 2QKYA 4NDAA 4ILKA 3V9PA 3KQTA 3IV6A 1XTRA 1PKXA 1NOJA 3R7SA 3VO1A 3RAEC 1XZDA 4WH0A 2MSEB 1AY0A 2EJUA 3DC7A 2BGNA 1NVUQ 1VSUA 5EWLB 4IGAA 4MW5A 2RGNA 4QBGB 1XL0A 4H4DA 1K68A 4BRWA 3IAFA 3DBHA 4K3VA 1M1YB 3LNTA 2G09A 4JJEA 5CB4A 1B15A 3EIEA 2O8FA 1E2LA 2YV4A 4R8SA 4ETIA 2YNMD 5DB4A 2AD1A 1W2GA 2YWEA 1KP2A 1NQTA 2DP4E 5AP9A 2IPOA 2JFOA 4RXUA 2O3UA 1XIVA 1MABB 1ZUIA 4GWGA 1QVZA 1B8UA 5UKDA 2YYYA 1X86B 3Q1LA 2PHZA 5I9BA 2DWQA 1U8XX 5EPUA 2Q4BA 1H1LB 3EUFA 2WHEA 3D0QA 3JXEA 1QKKA 3S6JA 3TJZA 4YUWA 2QRKA 2IEGA 1ZWKA 2CV2A 3V00A 5CFQA 1HDEA 2WU0A 2XOKD 2P2CA 3D3KA 4PQRA 5FL3A 1DX4A 2P6NA 2ZVQX 5THKA 4TTPA 4A8TA 3SDZA 1ORTA 2QU8A 4I5FA 1M1NA 4HUJA 4RKRA 4V02A 2XAAA 4WHMA 2VSYA 4U7HA 2H9YA 4R9VA 4UUPA 5EY5B 4WSOA 4IDPA 4XYLA 2DY0A 3KLNA 1IJKA 4MWZA 3F3MA 4FT2A 2VR1A 1PD1A 2BI8A 1ZHFA 3NYRA 1TYZA 4P5DA 3SKXA 3ST7A 3MBIA 2OFPA 2P6OA 3H97A 5C8ZA 2NYUA 1U2PA 3B9RA 1GSIA 1SPXA 4H17A 4JJKA 3D1LA 3DEIA 5AJYA 2GBPA 1Y3FE 4K9MA 1HC7A 4YAJA 3QPDA 5EHIA 1UP7A 4ARZA 1KI6A 2XGOA 3HP4A 4NHEA 2EKQA 1WABA 1ZXLA 2G80A 2O1XA 2OL4A 3HBLA 4J1TA 2B9VA 2GPNA 1DEKA 1QVWA 1F4LA 1LRKA 3GLHE 4Q6WA 2XV1A 4FBLA 2OY0A 5JSYA 1Q3HA 4MVJG 2VTDA 1U0EA 3Q5EA 1FP7A 4JLVA 1OASA 1TUBA 1VPLA 2Q21A 2YIDA 4OFZA 1YZQA 3EPKA 1SXJE 1XFDA 1ZIDA 3IEKA 3TOZA 1QRUA 3MWGA 2E1PA 2PSSA 5AUNB 1MJ5A 2ZRGA 3BMQA 3IVMA 4BTVA 2J3MA 1GUBA 1S8NA 1UT8A 1EJ6A 1TVKB 4D45A 4RFLA 1AURA 1LFDB 3I0NA 3DMNA 4EB8A 2MSDB 4XKJA 2HK8A 1GPDG 3FGZA 4WLFA 3NVAA 4N9QA 4OXIA 1EWQA 2BGKA 3AP3A 4K6OA 2BFFA 3K1YA 2ZVJA 5HKKA 1H23A 4N40A 5AW9A 1K4YA 4MVJH 1N3BA 1NT2A 3K20A 3ZNOA 1YRWA 1C0LA 4WESB 3KPWA 3CGWA 1OPRA 1VMDA 3K8QA 1WCXA 2QVGA 2WJ3A 3T1HB 3WZMA 1S7CA 3BB4A 5HE8A 1GRVA 2H1RA 4LRQA 4ZT6A 4IJ5A 2BLLA 2P77A 4UAGA 3K94A 4F1JA 2ACEA 5D1NA 2VLIA 1QFYA 3O8RA 2GNOA 2X6QA 1IBCA 2DBRA 1YE3A 3T5GA 3FYUB 4JBYA 1MX3A 4HGNA 2G77B 3PSHA 4C43A 1I1HA 5CEJA 1V26A 2O8VA 1GCOA 4B6OA 2R8OA 3A2LA 5JD6A 4R2XA 2VP9A 1NJ1A 4CW7A 3F73A 1DQRA 3H04A 1GSOA 3DPUA 4YUXA 3D8SA 3E03A 3TVTA 1D09A 4NENA 5B6JA 3FBTA 2RGNC 1GN9A 4H08A 5A4FS 5JWRA 2EP5A 4X1KA 4PLCA 5HF6A 1WPQA 2CD7A 3RQSA 1CJTC 2EJTA 1DRUA 1IHOA 1ZD3A 3LC1O 3LQKA 4MQEA 4A82A 2QAIA 4OJQA 2D5LA 2WTMA 5JCJA 4DWJA 2O2HA 4B3SB 2XXBA 3A26A 3HHEA 3HY4A 4Z5XA 4JP1A 1ZJYA 2JLVA 4ETWA 1A9YA 4BCBA 3EEQA 5FR1A 1EK2A 3VPCA 1QF6A 3OZFA 4MDYA 2CYAA 2X9VA 1CFJA 2M2IA 3H6GA 4EJ6A 1DCKA 1GZSA 2IXGA 2PL9A 2XCUA 3F1LA 4JLAA 3D2BA 4R41A 4ZT2A 1GCAA 4D9IA 5JNTA 3O8BA 3PTZA 1A9QA 4DCNA 7YASA 2DR3A 4M60A 1VPWA 5FA6A 1JEDA 3ONEA 3M33A 5IM4F 4CMJA 5EUMA 3W2EA 1FW8A 3L4EA 4LRTB 1H2HA 2VDLB 4LGCA 4OHXA 5FBZA 4MGIR 1Z68A 4XFDA 1B73A 3ZVMA 1WEHA 5F3WB 4WOCA 1ZSYA 2HH9A 1NMSA 1XJ0A 2V6FA 5E2BA 3AF0A 5EYPB 4PRKA 1HE3A 2P0EA 4WXPA 1N4DA 1BE1A 1EK6A 1ZD8A 3UENA 1NC1A 4AI6A 2V9PA 3NH9A 1A8QA 5TQJA 4ZJUA 2LR0A 1JXQA 2DERA 3K0HA 3DZGA 2V7XA 4IUBS 1AOXA 5BP7A 2I6QA 4UJ5A 3J81A 2Q2WA 3WB1A 1UIMA 5LB2A 3KKPA 1A1SA 5DMHA 5J43A 4J1TC 3T06B 3ES9A 4TLCA 2NVUB 2YN2A 4R7TA 3B51X 3P4XA 2CW5A 1W73A 1DC5A 1UM8A 2JGJA 1OXBB 2QNIA 4Q7KA 1V5WA 2WD7A 3DTTA 3MD0A 3QEMA 4HNAA 3UPUA 2AR0A 4XWWA 4UMEA 4H9GA 5C81A 1XHFA 1RI3A 3P4UA 4Q1VA 1P1FA 3M7IA 2H7CA 1P44A 3RYIA 4NZMA 1U7UA 5D5QA 2GXSA 3WV4A 3N5KA 4P31A 1II0A 3O7WA 3TTWA 4JVMA 4PNZA 4NBNA 5JQWA 5IYZB 1M9NA 1Y48E 3SC2A 1KO5A 2EG9A 4JB2A 2Q1UA 2R1VB 2ZIGA 2AV6A 1HEUA 5KC9A 2K7FA 3VJRA 1N8NA 4WUVA 2N42A 1IJFA 1JWAB 3FPAA 2AIRA 1DWOA 1UJ2A 3T9AA 4GWKA 4YJ3F 5ILGA 1PL7A 2CKMA 1IN4A 2IEBA 4XAQA 4CQNA 1O6BA 1CETA 2AMFA 2DFPA 4UEQA 4DEVA 4MK4A 4Z9YA 4Q1BA 1G4HA 1SWWA 5FLKA 5IJ9A 1E0KA 1XK7A 3FFWA 1XVUA 5AVOA 4UDXX 3AJAA 2PT5A 4XVHA 1L4FA 2R6R1 3DDHA 4TMZA 1AXGA 2HWWA 3U48A 4ZI7B 2Q3EA 4B47A 4JODA 3PVSA 2QAGA 3NPMA 2M9MA 4KQKA 4XXHA 3FDIA 1I7DA 4QUEA 3S8MA 3F5MA 4F5EA 1FUKA 3A3OA 3JQRA 3LLMA 4P4UA 3SJCA 3AR5A 4JLMA 4WXEA 1MA0A 4D8TA 1EGAA 2O0MA 3VSCA 3UNXA 4CN8A 5BVGB 1QYRA 1W2WB 1G7RA 5SZHB 4S1TA 4RV9A 3RU2A 1ISSA 2P9BA 3E3OA 1JFFA 3MUFA 4S24A 5T3UA 4CLOA 3C6BA 4Q4AA 4DM4A 4FN5A