2J3IA

Crystal structure of arabidopsis thaliana double bond reductase (at5g16970)-binary complex
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
345
structure length
336
Chain Sequence
b'MTATNKQVILKDYVSGFPTESDFDFTTTTVELRVPEGTNSVLVKNLYLSCDPYMRIRMGKQAYTPGQPIQGYGVSRIIESGHPDYKKGDLLWGIVAWEEYSVITPMTHAHFKIQHTDVPLSYYTGLLGMPGMTAYAGFYEVCSPKEGETVYVSAASGAVGQLVGQLAKMMGCYVVGSAGSKEKVDLLKTKFGFDDAFNYKEESDLTAALKRCFPNGIDIYFENVGGKMLDAVLVNMNMHGRIAVCGMISQYNLENQEGVHNLSNIIYKRNRIQGFVVSDFYDKYSKFLEFVLPHIREGKITYVEDVADGLEKAPEALVGLFHGKNVGKQVVVVARE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADP-DEPENDENT OXIDOREDUCTASE P1
publication title Mechanistic and Structural Studies of Apoform, Binary, and Ternary Complexes of the Arabidopsis Alkenal Double Bond Reductase at5G16970.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Oxidoreductase
total genus 85
structure length 336
sequence length 345
chains with identical sequence B
ec nomenclature ec 1.3.1.74: 2-alkenal reductase (NAD(P)(+)).
pdb deposition date 2006-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF16884 ADH_N_2 N-terminal domain of oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2j3iA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2j3iA01
3NUGA 3GEDA 4BNYA 1XU9A 3ROKA 3TFQA 4K1LA 1LJ8A 1SBYA 1BW9B 3I3OA 1YQGA 3ICPA 3JSAA 1XG5A 4FC6A 1R4MB 4DLAA 3H65A 5I7SA 4YYZA 1J49A 3JQDA 3F47A 1XDWA 3AU8A 2BRUA 4ALJA 5JO9A 1NFRA 4EZBA 1ENZA 4CMEC 2P4QA 4J1NA 4ROSA 2CVZA 2DTEA 1HDCA 2X1HA 2Y1CA 5TRTA 4CL3A 4N5NA 2EKPA 4QXMA 2CUKA 1U3WA 4P4NA 4R41A 4J9UE 2UUPA 2O23A 5FF9A 5FI5A 4XGIA 3V5NA 4IDEA 3GA0A 1YKFA 3UGKA 3A14A 4GVLA 2FY8A 3H2ZA 1GYQA 4OAQA 5IZCC 1QKIA 4BO4A 4E32A 3KYCB 5B37A 4NBVA 4NDNE 4PLGA 1E5QA 4AJJA 4DYDA 4NI5A 4BO5A 4R16A 1TVEA 3E18A 2Q1SA 4MIYA 4DREA 5JCJD 1X14A 1CETA 1MXHA 1GD1O 3ZU4A 4BB6A 3G0OA 3BMOA 4GQAA 1C0KA 3ZWWA 3O9ZA 1ZCJA 1Q1NA 4CQMD 4EITA 2PV7A 1GCUA 5KIAA 1S7CA 2W2LD 4KDFA 5JYEA 4PRLA 4LSMA 2GZ3A 2Z5LA 3PP8A 5G0TA 2J3IA 1E6UA 2H6EA 4LRSB 2X5KO 2C2XA 3WSVA 1H2BA 2WTBA 1HDOA 1B0AA 1BGVA 1RYEA 3BZUA 5CEFA 2VYNA 5G4LA 4BNGA 3EC7A 5G0VA 1UDBA 1WDLA 4PCVA 2Q4BA 1YL7A 1SEVA 5G0SA 5TLSA 3I9JA 1D8AA 3LC2O 3JYNA 4WEQA 2DBQA 4DVJA 3AI3A 4CMBA 1V0JA 1V3TA 2O3SA 3W4KA 5MDHA 1BG6A 3JYLA 3DHNA 3OJLA 2PA3A 1OOEA 3PJFA 1XQ6A 1QP8A 3GNQA 4UULA 3OJOA 1A9ZA 2DBVO 5BQFA 1H93A 4YT2A 4W82A 1K6IA 3OQBA 4NFSA 2O7SA 3JQFC 3PTZA 4IY1A 2DPGA 3I9MA 1UH5A 4AVYA 4WPGA 3HQ4O 3CEAA 3VAZA 3EUWA 4YB8A 5F5LA 2EP5A 1J6UA 1WDMA 1AE1A 1TXGA 2I5PO 3JD1A 3BA1A 1IULA 3KLPX 4WNIA 1PJ2A 5L40A 3DZHA 4PG5A 2I99A 1P1HA 3HFSA 4CV2A 1R4NB 3QRWA 1FMCA 3DFUA 3S2GA 3OH8A 3ITKA 3MOGA 2FSVA 4CQLB 4DPMA 4HUJA 2EXXA 4E21A 2EV9A 2WYUA 4IMRA 4OM8A 5B4UA 5CG2A 4A73A 3D5TA 4E33A 3X2FA 4B3IA 3M1AA 4L73A 2NTVA 4O6VA 4PLCA 3FSRA 1PJTA 1YS4A 4NJMB 4TVOA 2C29D 1MC5A 1QRRA 4NJOA 1Y8RB 3MTGA 2C7GA 4UEJA 4QUKA 3PVZA 4ALLA 1X7DA 1T1RA 4UAGA 5JDCC 2X23A 4R51A 1HDGO 1NNUA 3H3FA 3V8BA 1ZJZA 3QVTA 1BSVA 1O8CA 1SB9A 4WKGA 1H6AA 4YXFA 2NTNA 1J5PA 4ZRMA 1PIWA 4R01A 3R3SA 3SJUA 4XQEA 4TMFA 3F3SA 3AOGA 4D3DA 2VUTA 4JQCA 4ND4A 4EGFA 1JU9A 4GLOA 1YBAA 1ZMOA 3I83A 3WLFA 3AJRA 3C1OA 5FI3A 3HFGA 3WLEA 5JLAA 3PXXA 4YA6A 1QYXA 4IDDA 1PZEA 1EEHA 2I66A 1HYHA 1VLLA 4NBTA 3WGZA 4Q3CA 3PIDA 1E5LA 1PL6A 4C7JA 3ZU5A 5T6BA 3DMTA 4BGVA 2OP1A 1TLTA 3BTOA 2IRWA 1HKUA 4XYGA 3DO5A 2DTXA 2B35A 1H6CA 1LNQA 4WLEA 1Z75A 2O3TA 5DULA 6ADHA 2Y1FA 3UAGA 1BXGB 4YBZA 2GNAA 1OMOA 4GX1A 3TRIA 4W6ZA 3NTOA 1EUZA 3NT4A 5JYDA 4OH1A 4OXKA 4BGIA 4YAKA 1A27A 4O63O 1ZEMA 1W4ZA 4Q3NA 4LSWA 4ZQGA 4ZU3A 3FNFA 4OQZA 5A3VA 4YR9A 1Q0QA 3ADPA 3WX0A 3KSUA 4A0SA 1DJQA 4FPXA 1R6DA 5HM8A 1H94A 1M67A 2NVUB 2NQTA 2ZIZA 1KIFA 2Q4EA 2P9EA 1TT5B 2YHUA 3U0BA 4O5OA 3NAQA 3ABIA 3KRTA 3QLJA 5THQA 5JCXA 1YE3A 3M2PA 4EYEA 3G1UA 3RUEA 1NQ5A 1OI7A 3ZN2A 2VHWA 1G0OA 1C3VA 5F21A 3BMNA 2QIOA 3GVHA 3RC9A 4Y6SA 5K6AC 1GTMA 2EHDA 3DZFA 3FBTA 3RUHA 1E7SA 4IS2A 1MB4A 5JCJA 2CVQA 4S3MA 1LSJA 1HE2A 1ADCA 4JBGA 4F6CA 1W8DA 3MZ0A 2HCTA 2DAPA 2HK9A 3TN7A 2DBRA 4CQMA 1G6KA 1GZ3A 4ZHSA 2ZTMA 5EJ2A 2W2LA 1YL5A 3MWDB 4YJHB 3WQRA 1AN9A 4I9HA 3PYMA 4CUKA 3WNQA 2EW8A 4OOEA 2C7VA 1P31A 3H9QA 1KBZA 2GLXA 3P2YA 4XJTA 4NQZA 2DUWA 4HP8A 4ZICA 1SAYA 5LDGA 3GAFA 3KOUA 1DOHA 3IJRA 4M87A 1AUPA 3U4CA 3FPCA 1C0PA 4FFPA 2BELA 3IS3A 2HJSA 3F1KA 3T4XA 4YAIA 2D3TA 2RH8A 4TZKA 4A27A 1K6JA 2B4QA 3AWDA 4E5MA 3ETEA 3VKVA 2A4KA 3L6DA 1DFHA 1UP4A 3K2BA 2HAEA 3R0IA 4FS3A 4LGVA 1MV8A 3OEWA 2B69A 2X22A 1FDWA 2IYOA 5KTKA 3WR5A 2NADA 4LRTB 1Q0LA 2CVOA 5KJCA 1EE2A 4I08A 3TF5A 4NG5A 1N1EA 3WFIA 1U2GA 4BNMA 3RUAA 1JLLA 3GPDG 3WBBA 3INRA 4OYRA 4CV1A 5KWEA 4OOFA 4ZA2A 2H1SA 5L45A 3ASUA 5KKAA 3QW2A 1HLDA 2GO1A 3WMWA 3EW7A 3VH2A 4NR0A 4MVJF 3WYBA 4B3JA 4L75A 5KCZA 5ICMA 2AEFA 3MTJA 1ULSA 2QHXA 4W99A 2P4HX 2SCUA 1MUUA 2WD8A 3P2OA 1U7HA 1SZJG 1NHGA 2J8ZA 3PHJA 1G0NA 4ND3A 4XB2A 3ZV4A 4PG4A 1DXYA 1YGYA 4E3ZA 2O3UA 1H0KA 4HBGA 2GASA 2J5RA 3RFVA 1C0LA 5A04A 1Y1PA 3V1TC 5I8ZA 2DU8A 2ZK7A 3V2HA 5TJ9A 2BFPA 5IDWA 4MVJP 3JQBC 4EW6A 8LDHA 5IF3A 4KQXA 3CIFA 4RLHA 3K9QO 5A03A 2VYVD 2OZPA 1KETA 1Z7BA 2VT2A 4D79A 2J3JA 1BWSA 1YDEA 4BNHA 3RQSA 1ZO8A 3BTVA 4BNNA 1YONA 4KTTE 4NBRA 3SVTA 3RUCA 4DC1A 1PJQA 5G2OA 1Q7BA 4S1VA 4LK3A 4HNGA 4XJSA 1ISHA 4R3NA 4FJ0A 1C1DA 4QT0A 3IIEA 3UW3A 4CLRA 3EGOA 3DZKA 2I67A 1QXSA 4R1SA 1PX0A 3BMCA 3DC2A 5F5NA 2VTEA 1QLHA 3PHGA 4ZQHA 4NMHA 3K30A 2W2KB 2ZJ0A 4IJWA 2R2GA 1LRLA 2AW5A 3LLSA 3BMQB 3LT2A 4IBOA 3D4NA 1X1EA 2FHSA 1R0KA 1XCBA 3BIOA 3ETGA 4FSHA 3DQPA 4WLNA 1R4MA 3WGGA 3LSYA 4Q3BA 2O48X 4BKUA 3WYEA 4J90A 3KSDO 3GG2A 1YB5A 4I5FA 5ITWA 2HSDA 3RASA 5BSFA 2BD0A 4R68A 4NFYA 2CF5A 1NM5A 3GG9A 2D1YA 4RF5A 4P8RA 1JVBA 1PWXA 2VNAA 3B1FA 3DB2A 2HRZA 4RVDA 4TKMA 1VJ0A 4RJTA 4RCVA 3F4LA 5KJEA 3ZNOA 2QW8A 1KEVA 1LEHA 1NR1A 2WSBA 1BXKA 2QYTA 1FK8A 4ND1A 2I6TA 1T26A 4B79A 3E6AA 2DT5A 4IQ0A 4U0JA 2X58A 2RHCA 3PZBA 2O2YA 1PWZA 3K31A 3GEMA 1Z6ZA 4PG7A 2UDPA 4XYBA 3U5TA 1Z82A 2VUUA 3OIFA 4I5EA 3DOOA 1X13A 2HLPA 4Z0HO 3GRKA 2EJWA 2PZJA 1NQOA 1J4AA 1EE9A 5DOZA 2ET6A 2Q1WA 2ZYGA 3L6EA 3I9OA 3F4BA 1Q2XA 3GRPA 1DSSG 4UUMA 1T25A 4WCFA 1YXMA 4WE3A 5HWSA 4HFRA 1CYDA 2RH4A 1PZFA 3QP9A 4CJXA 3DBVO 2B37A 2BI8A 3HN2A 2OO5A 5CP8A 4YACA 2YV1A 1R16A 1VE9A 3I5MA 3OF2A 1E3IA 5HA5A 3CUKA 1XLTA 4PZCA 1HXHA 1ZSVA 3AK4A 1EZ4A 1WZIA 3WMXA 3MEQA 3NT5A 3DONA 1PL8A 2O3RA 1HDZA 4GX0A 2PK3A 4ALMA 4P38A 1EQ2A 3IAHA 4FFRA 5JAQA 2C20A 5C7OO 4CUJA 1NQAO 5I8WA 4DWVA 5EESA 1YB4A 4B3HA 1VSVA 1A71A 3CINA 4CMJA 1WMAA 3ZWPA 4IQ8A 2NVWA 2XPCA 3RBZA 3BTUA 2QG4A 2ZB8A 3VTFA 1U4SA 6LDHA 1B16A 5T8KA 1GEGA 3H8VA 3OBBA 4IS3A 1B7GO 1VKOA 4MINA 5L7WA 3I6QA 3UOGA 4I9UA 4IM7A 3ITDA 4PLTA 2V6FA 1UP7A 1Z45A 4KMSA 5C7LO 3DZIA 2AHRA 3SBOA 1R12A 2JL1A 3AM4A 3JYOA 4IXTA 4U5QA 5J23A 4DA9A 2IZZA 4FGWA 1U5AA 3H9EO 1JW9B 4NK5A 3H9JA 2GZ2A 4WGGA 2FPPA 2EGHA 3TQHA 2GCGA 2IODA 3OQ6A 1CDOA 2YDXA 2FP4A 4D7AA 5CEJA 1UZMA 1LQUA 2PWZA 3UFXA 2A9FA 2H63A 3D3EA 1UDCA 2CNBA 4YJGB 3U09A 5EMHA 4ALNA 1EMDA 1DIHA 4CLHA 2C82A 3ZWVA 4RF2A 1KVUA 2JAPA 1L7EA 1ZNQO 2NQ8A 4PLFA 2PGLA 2VOEA 5L4NA 4NJMA 4RQUA 3GT0A 4II2A 5JO0A 5KOIA 4GGPA 1WMBA 2ZCVA 4DIFA 2Q46A 5I9MA 1B3BA 3EAGA 1B26A 1Y8RA 3HDHA 4CM9D 5FWNA 3IUSA 3D4PA 3F1LA 5IN5A 4CM8B 1TEHA 2HK7A 4HX5A 1ZK1A 3Q3CA 1EVIA 4KZPA 4RL6A 3QY9A 1PJLA 4TRRA 2WYWA 1XU7A 4FB5A 5JW6A 1JAYA 1QYVA 1VM6A 4J1SA 5JSFA 4I5GA 2VYVA 3DR3A 4GL4A 5TSDA 1ISFA 1YJ8A 4GWKA 3DTYA 3WQSB 3AI2A 4R1NA 3TZQA 4FFMA 3LT4A 3UUWA 4BUCA 3GVIA 3LC7O 1YRLA 4J9VA 1PR9A 3ENKA 1E3LA 3DZGA 3D1LA 3GZ4A 2X7HA 3D7LA 4DQUA 3MCVA 4FJ1A 3QVXA 5I7VA 1F12A 4E4YA 2VZ8A 4FD3A 5MGBA 4EBFA 3SLGA 1IB6A 4Q9NA 5GZ3A 3DHEA 3EVTA 1N7HA 1Y9AA 4QSMA 5DP1A 3QWFA 3CKYA 3WGYA 3GF4A 3ZV5A 2AE1A 1LI4A 2HMVA 2UYYA 1GV1A 1I32A 3FI9A 3LF1A 4K9DA 1V3VA 2X5OA 1UXHA 4MPDA 4DMMA 3GNTA 4Q3DA 3KETA 5KJFA 1WWKA 2PY6A 3Q1LA 2Q2QA 4BNKA 3K6JA 2V6MA 4J3FA 4N5LA 5I7FA 4ZQFA 3ONDA 3KB6A 4KUHA 3RU9A 1U4OA 3BTSA 4IQGA 5BR7A 4Z9FA 1PTJA 2W4QA 1T24A 4C4OA 3IMFA 1DC3A 1NHWA 2HKIA 4E2YA 3GH3A 4DQVA 5FEUA 1HDYA 1ISMA 4MKZA 5HS6A 2AXQA 3NTRA 3INTA 5U1PA 1K89A 1TT5A 2JCYA 4PLWA 4DMLA 1KEPA 1KEWA 4TQGA 3RC2A 3MOIA 2YHIB 1IHXA 4JK3A 4QQRA 3DWFA 4R5MA 2NVBA 5I7EA 3N58A 1Y8QB 3F6YA 3G3EA 5BNFA 3E03A 1D7OA 1S6YA 1VL8A 1M2WA 4QO8A 3U62A 1MP0A 2HMSA 3RJ9A 1F8FA 1R66A 2Q50A 3ZGYA 1NR7A 4CODB 1EDOA 2HRBA 3UCEA 3NV9A 4B4UA 4BL5A 3L0DA 5CDSA 1I36A 3DFZA 1ZKMA 3GGGA 1I2CA 2OFPA 1L1FA 1A4IA 2HMTA 2VHVA 4J4BA 4BO3A 2V6GA 1DFIA 3MJEA 2VQ3A 4KOAA 4ZN6A 1LDBA 7MDHA 3OECA 3H5AA 1I30A 2Y67A 3WDSA 5A02A 3ROMA 3PHHA 3C7CB 2G82A 9LDTA 1P9LA 3Q9NA 4RVGA 2J3HA 2CSUA 2YZ7A 5B4VA 2JCXA 2IE0A 3L77A 4MVJD 3TL3A 1B2LA 1GUYA 3HE3A 4FDAA 2HMUA 3W1VA 1DEHA 3R3JA 1R15A 3NKLA 5TS3A 1UR5A 4YTEA 5L4SA 1R0SA 2FSSA 1EFLA 5COQA 1NVTA 3QV1A 3P7MA 1OFGA 3KVOA 3PQFA 4UUNA 4DL9A 2EG9A 1E7RA 1ZK2A 1P1IA 2PZLA 1KC1A 1J0XO 2C59A 3IUPA 1WZEA 3D4OA 4D43A 1GUZA 4PLPA 5L3ZA 1IUKA 1U5CA 4RLSA 4XGKA 3JQ9C 1EUDA 1GZ4A 1P33A 4ZGWA 3H5NA 4M54A 3F46A 2Y93A 3G49A 3ANNA 3ZWXA 3CSDA 1ZFNA 3HB5X 3GN2A 3GR6A 3ZWAA 3RC7A 2X0RA 3TWOA 3JQEA 1OAAA 2PNFA 1WAMA 4FBGA 1CJCA 4D0RA 3C8MA 1UJMA 4CPDA 3KYDB 1QLJA 3VZQA 1Y5MA 4WCFB 1K6XA 3OSUA 4PVDA 1W6UA 2V65A 4JJFA 4R1TA 4AJHA 5JAZA 2C5AA 3NDRA 4HKTA 4AFNA 5JDIA 3GY0A 4K28A 3OETA 1UXJA 3QJ5A 4II3A 2AEJA 3GMSA 4UVHA 3WNVA 4BNIA 3LU1A 5DBIA 1E1LA 3ZNPA 9LDBA 3G79A 5BNTA 4PGFA 4EJ0A 1ORRA 2IDZA 4JBIA 1PZHA 2FZWA 4BS9A 1CRWG 2QX7A 3SXPA 4IINA 1ADBA 2ZTUA 3ASVA 4FGSA 4CLOB 2QRJA 1TB4A 4GLLA 2W2KA 3OHSX 1PJCA 1W73A 4WLFA 3BMQA 1AGNA 4U6SA 2NTJA 4E2XA 1M6HA 2ZKLA 5EQFA 1DO8A 2HMWA 2Q45A 4JJIA 3L4BC 3W6ZA 3GVCA 3KEQA 2R00A 4U8GA 3RC1A 4O59O 1TA4A 2WD7A 1ZH8A 2VT3A 3WJAA 3P19A 3M6IA 4EDFA 5CEEA 1H9BA 4BNFA 1GEEA 3B1KA 3JQ8A 1OC2A 5L7YA 4GI2A 1IHYA 4Y98A 4BNZA 1PZGA 4N54A 1M76A 5BT9A 4A7PA 4RPGA 4DLBA 3EHEA 2FR0A 4NU6A 2PFGA 1MX3A 1I2ZA 4OIMA 1CERA 5A1TA 1XR3A 4YEDA 1BTOA 4WUVA 1KY5A 1FDVA 1ZXLA 3EDMA 4R9RA 3VHRA 1OC4A 1BVUA 3GPIA 4E5KA 4BNWA 3WQQA 2EKLA 7ADHA 3Q6IA 4RPKA 4AJ4A 1E7YA 2YYYA 2FN7A 3LF2A 3SC6A 3U9LA 1VC2A 4HNHA 4FCCA 5DT9A 5ENDA 4B8ZA 5CDTA 1JN0A 2Q1UA 2CY0A 3ZWNA 4IDAA 5AXBA 5H82A 5A05A 1V8BA 3QVOA 1EBUA 4M55A 4OL9A 4AJLA 2ZQZA 1LSUA 3RROA 1HZZA 4L4XA 8ADHA 1ISJA 4INAA 4OJNA 4YAEA 2YUTA 5BSEA 4IMPA 2XAAA 4PZEA 4BO2A 2B0JA 1Z73A 3FWZA 2UVDA 2D59A 4FFNA 4RORA 3IDSA 2I3AA 4BB5A 2NLOA 1O5IA 5IN4A 1IZ9A 1YJQA 4D42A 1DB3A 1IPEA 1HEUA 5JBIA 1H6DA 4BGEA 1PSDA 1DRWA 3VZPA 2F1KA 4EUEA 2Q2VA 3AOEA 3PRJA 1WXDA 3BYZA 3WWYA 4B7UA 3N74A 2Q99A 5TNXA 2JHGA 2OHXA 2DBZA 2FOIA 2TMGA 4IZIA 1HWYA 5AQ1A 3H3JA 3RU7A 3QQPA 4GX2A 3ZU3A 1HF3A 1FDUA 3T7CA 4BV9A 4IXWA 4XQCA 4HFJA 1LX6A 4BQRA 3KYBA 4CR6A 5U9CA 4G2NA 4MVJA 4YDRA 1T2FA 2DFDA 3NEPX 3VZRA 3ZNNA 1KEUA 5L7TA 4CMHA 4GVXA 4D41A 1XA0A 3D3WB 3EMKA 2OL4A 1NFQA 3CE6A 5JY1A 3JYPA 4NBUA 3TZKA 4A10A 1IE3A 1U8FO 4WECA 3I23A 4AJ2A 3H9GA 1NP3A 2FRDA 3HNPA 4CUZA 1V9LA 4LISA 1SOVA 4WLUA 1SB8A 3T4EA 4XR4A 5CPBA 1HYGA 4YJGA 3TOXA 5KVSA 3GLQA 1P1FA 1PQUA 3WIEA 3JQ7B 4WJZA 1EDZA 4L76A 4GSKA 4NNJA 4A03A 4E2WA 5KVVA 3ZWOA 2O7QA 3DBHB 1KVTA 4DBZA 2X8LA 4CM4B 5IFLA 1P1RA 4PFJA 4DRYA 3G1TA 4XB1A 5G4KB 4GMFA 3RBVA 3ICCA 4BQPA 3H7AA 1BXZA 4L9RA 2NU8A 4FOSA 5EPOA 4JIGA 1T1SA 2WDZA 1YDWA 4GH5A 1LC0A 3DEYX 4CM8A 2DM6A 3VH3A 5GZ1A 5JMWA 3FNGA 1IY8A 1EFKA 4JP2A 4YJDA 1NAIA 4TRMA 3RIHA 5CDUA 1ID1A 1QSGA 3W4IA 1U7TA 5DCYA 3AW9A 1NWHA 2JD2A 1I10A 3ZHXA 1ONPA 3ROPA 3BHJA 1E7WA 3VH1A 1AXEA 3OIGA 3EY4A 3NT2A 3O8QB 1MXFA 1T4DA 3WXBA 2ILTA 1K0UA 3TZCA 3TPCA 1Y5RA 2BHLA 4HXYA 3EZLA 4NZ9A 4CR7A 3VZSA 1PGPA 3KLMX 2VHXA 1DLJA 3KBOA 2X9VA 4UVIA 3GN1A 2RCYA 3DBRB 3W8DA 4QFDA 1YB1A 1UDAA 4CLEA 4PIVA 2WJPA 4GWGA 3TZ6A 3IL2A 1U8XX 1O95A 3JQCA 1ZSYA 3ANLA 5HS4A 3BXXA 4IZHA 2JKVA 2OXIA 1ZW1A 1ONNA 1Y81A 2PD3A 4F3YA 3B1JA 4J1QA 1ONOA 1FF9A 2CFCA 3B20A 1JWAB 1NTOA 1CQIA 1LBEA 3TOZA 2G0TA 1O94A 1DIRA 1VJTA 4BO0A 5DNAA 3SC4A 3ZDFA 1F17A 4FFOA 3L4SO 4N18A 4NIMA 4B4VA 4MIOA 3E5RA 4D45A 3OJEA 1P44A 5HRUA 1O89A 3VC7A 3GNSA 5L4LA 4BIIA 1O9BA 2QZ9A 4IPTA 5FFFA 5BNIA 4B4OA 1HZJA 3UH1A 2YHIA 4BV8A 1QV7A 5GY7A 2WM3A 2ZB7A 5AXAA 1DC4A 4B8WA 4A26A 3DMTC 1Y8QA 3BHIA 4XIJA 5EINA 2GUGA 5T64A 2P91A 4PLHA 3PQDA 4BNTA 5TT1A 1I01A 1LXCA 1N2SA 1X15A 3JD4A 2BI7A 2CDCA 1HTBA 3C7AA 3CZMA 3R6DA 4ZRNA 3L07A 4AG3A 3ENNA 3I52A 4G65A 1ZJYA 2RAFA 2TMDA 4TRNA 1ZIDA 2VWGA 4DIOA 4K26A 3ZCXA 4ZD6A 2GGSA 3S2FA 3AI1A 5ES3A 1U3UA 3IP1A 2EF1A 2A35A 4UVEA 1N5DA 2CD9A 2VRBA 4MP3A 1E7QA 4PLYA 4EJMA 3DHYA 4KWIA 1M75A 4EUHA 4YWJA 3S2IA 4LW8A 1P3DA 1DAOA 2IYPA 3F9IA 2WD7B 3AUUA 2FR8A 1SC6A 2PD4A 4J6FA 5EERA 3VPFA 1E3WA 4XRRA 4CM1A 5JNLA 3WGOA 3HB4X 4L4RA 1HRDA 3DAPA 4F6LA 2EWMA 3JQ8B 4XDZA 3KXDA 2XOXA 4RPJA 1WDKA 3E9QA 3RUFA 3PDJA 1WPQA 5F1KA 2O2SA 1GYRA 3A1NA 2C0CA 4UVDA 2G76A 2PH3A 5AYVA 2IXBA 3ZU2A 4HV4A 4CV0A 5A9TA 2WMDA 3TL2A 4MDHA 3AUTA 1B14A 3WSWA 4CR8A 3CMMA 1FJHA 3JV7A 5F1OA 1E1MA 2WEKA 4J49A 1IZ0A 3TNLA 4GPD1 4IGEA 1R0LA 2YDYA 4JX8A 1YWGO 3O26A 2QRLA 2EERA 5ILGA 4WCDA 4D44A 3E5MA 3H5RA 2ZATA 2B4TO 3VOSA 4IJUA 1IYZA 4JGBA 3GVPA 3GZNA 1TT7A 4O1MA 4DYVA 3KYDA 1UZLA 3W8EA 3K73O 1R37A 2DFVA 3EVNA 4YT5A 1PS0A 3LC1O 1RJWA 1I0ZA 1I8TA 1MA0A 3KM0A 3WIDA 1A7KA 5C37A 3HDQA 2C54A 1UUFA 5DDIP 2EP7A 1XSEA 3RUDA 3H2SA 5IXYA 2X0NA 1L7DA 2PLAA 4IJKA 2CDBA 4Q39A 3WGTA 3T7EA 1PQWA 3RBXA 1T2EA 2D2IA 3U4IA 1V6AA 1MG5A 4M8SA 1GADO 4UUPA 4CMKA 5IXSA 2IZ1A 5A5FA 4Z0TA 4ZJUA 5KJ6A 1BRMA 1CQJA 2Y0CA 3WS7A 4BO9A 3NJ8A 3AM5A 5T57A 4FN4A 3FF4A 1AXGA 1LU9A 3QWAA 4CLOA 4W9NA 5A9SB 4ZQBA 2BH9A 3JCZA 2X9NA 3RI3A 3V1YA 1E3EA 5DF1A 2IXAA 1G1AA 4Y8VA 1PJ4A 1ZEJA 3BHMA 4UVGA 1B8PA 3WJ7A 2VZ9A 1F14A 1B8UA 3P5SA 4Q3EA 3GGOA 4U0KA 3FTPA 1PR3A 3HDJA 4LMPA 1HDXA 3D64A 3E8XA 3JYQA 4YPOA 3DXFA 5HTOA 2NACA 4XGNA 1HL3A 4I9NA 2F00A 4WOKA 3OA2A 1QG6A 3ORFA 1GYPA 1HLPA 3GDFA 4BNUA 4JNKA 2VWPA 1VRWA 4RZHA 4ND5A 1CIVA 5KKCA 3K5PA 3Q11A 3RSHA 5JC8A 1U9JA 5L51A 3PHLA 3S2EA 1ENYA 1XIVA 2AQIA 3RFXA 2W98A 4J4HA 3L6OO 3PYLA 3WTBA 4MJLA 4DXHA 2Y1DA 4ZVVA 1O6ZA 3IP3A 2PKQO 1SMKA 3F5QA 5DOVA 1F8GA 1KVSA 1P77A 2HQ1A 1ARZA 1LLQA 4PLZA 2Q2WA 1N9GB 3UCXA 1GQ2A 4L0QA 4U6QA 4M1QA 3AY6A 4CMEA 3OMLA 4XDYA 1BDMA 1YVEI 4FC7A 1GPJA 1DBVO 4K6CA 4QTZA 4AICA 2ZTLA 3IQDB 2GF2A 5CPFA 4FOOA 5GZ6A 1GDHA 1XEAA 5JAIA 3FR8A 2VOJA 2NSDA 4CLDA 1IL0A 1I3KA 3NDJA 4RVHA 5G0WA 1MG0A 1KVQA 3SEFA 5IZCA 1I3NA 3DDNA 2AEMA 5CG1A 1HSOA 1I5RA 3OFSA 2Y66A 4OKNA 3KUXA 3SX2A 2VHYA 1FDSA 3FPLA 3WGIA 1DHTA 3WBFA 1RKXA 3PGJA 4GAEA 2AG8A 4ITUA 4U7WA 1PQPA 1AHHA 2YJZA 4RZIA 3GDOA 4BO6A 5JAMA 2OOSA 1CWUA 1RWBA 3Q0EA 2ZCUA 4HY3A 2JJYA 4E30A 1MFZA 4TROA 4ID9A 3VTZA 5HBRA 3FBGA 4OXNA 1H6BA 1ENOA 1W0CA 1ZK4A 2P2SA 3FRJA 3G17A 5C3MA 4X54A 1HDRA 2LDXA 3VPXA 5K1SA 4OSPA 2GZ1A 4WCFC 3FD8A 4BNVA 3DAGA 3NGXA 1MGOA 2GD1O 5EQDA 3UICA 2W8ZA 3IKVA 1GPDG 3D3WA 1WP4A 4LCEA 3OICA 1V3UA 4CV3A 3GHHA 5F1PA 3KTDA 2GRAA 4BMNA 2IZ0A 3QE3A 3AM3A 4P22A 2J6IA 2O3JA 2NU6A 4FW8A 3LDHA 3C24A 2GN9A 2FMUA 2VHZA 3U3XA 4OXYA 1Y9EA 4RPLA 2HDHA 2W90A 4AJPA 3JQ7A 1P45A 2VUSA 1PGOA 4JN6B 3DBHA 1E0DA 3O38A 1QR6A 2I76A 4ND2A 4CM4A 4H15A 3JQFA 5CDGA 4UUOA 3OM9A 4F46A 4FFLA 1HT0A 3FN4A 4KQWA 1PS8A 1LDNA 5KVCA 5G4KA 5CFZA 3CMCO 5T8KC 4DGSA 1BVRA 3DBLB 3A28A 3I9LA 5JE8A 3FNEA 1DFGA 4F45A 1Z7EA 2D0IA 1KYQA 1NPYA 4FIZA 4BKOA 3HHPA 2PKRA 3WYCA 4R5HA 2EW2A 1SCUA 2JD0A 3RVDA 3ULKA 3KEOA 3ZWYA 3MJSA 1PS9A 1ZMTA 3PHIA 1NASA 1PGJA 4C7KA 1JA9A 1O0SA 3I4FA 4IUYA 1U3TA 4MOWA 3DTTA 4WLVA 3WOHA 4NPCA 3O8QA 4Y6RA 1E3WB 5DBFA 1WVGA 1LLCA 5AXCA 2YY7A 1UAGA 4OMUA 5F3RA 2Y1OA 3I1JA 5T67A 1LTHR 3PK0A 1FXSA 3HUDA 4RV9A 4CLXA 4I1IA 1ZK0A 3AUSA 2JFFA 1RM5A 3I9KA 4AJ1A 5JDCA 4J2HA 1T2DA 3K2EA 4WEOA 3DBRA 4YJFB 5EN4A 3O4RA 2BF7A 2Y1EA 2ZB3A 3I9NA 3TSCA 4OGWA 3GMDA 3ZWCA 3AFMA 4J7CA 4E5YA 4DLLA 2FWMX 1C1XA 2PZMA 5AVOA 1E1NA 2B5VA 2YW9A 1H5QA 1GL3A 4NH4A 2HU2A 1SEPA 3NGLA 4YRAA 1SO8A 2VNSA 4K6FA 4NK4A 5IZ4A 5DN9A 3U4DA 1DPGA 1VKNA 2UAGA 3Q9UA 4KP7A 4W7HA 4XA8A 3GZNB 3PQEA 2E48A 1LDYA 4R4JA 3W4JA 3H6KA 1A9YA 4OHUA 4Z3KA 3PJEA 3PWSA 4XWYA 3PDUA 4ALKA 4H3VA 1LDGA 4J43A 4CMCA 4D0SA 2YQ4A 5G0UA 2FPIA 5JPIA 1GQYA 1WW8A 4KUEA 3EYWA 4OSOA 2NU9A 2RHRA 1HE5A 3E82A 4JBHA 3RCBA 1YL6A 4LCJA 1V35A 4CM9A 2CMDA 5H83A 5BSHA 1PJSA 1MC4A 5A06A 3GDGA 3QWIA 2VCYA 2OBNA 2JFHA 1YBVA 4Q3AA 5DP2A 3FR7A 3IKTA 4TRJA 3A9WA 3PWKA 3QVWA 4JLWA 1NXQA 2FZEA 2A92A 1GAEO 1RM4A 2I65A 5A4DA 4XR9A 2VN8A 5CHEA 2YFHA 3GK3A 4XIYA 1JWBB 4IIVA 3RUIA 3OIDA 2G17A 1NVMB 2POQX 4RF4A 4AJKA 3GGPA 1NVGA 3TFOA 2BMAA 5K6AA 4RVFA 4KWHA 2FPGA 3WICA 4EEZA 4DBVO 5JC1A 1D4FA 3COSA 3CH6A 4L8VA 1QYDA 5JXWA 1E1KA 4E0BA 5I9LA 3EZYA 1CEQA 3LT0A 4J0FA 4TZTA 1A4UA 3C1TA 1LLUA 4GKBA 4JJGA 5AOVA 2Y0DA 2O3QA 4BKRA 5IJZA 1FDTA 4J0EA 3RD5A 3M1LA 3JQAD 2X9GA 3PLNA 2PZKA 3PPIA 2J5KA 5DCWA 4XEHA 4GSLA 3HDYA 5KVQA 1VL0A 4D3SA 2OMEA 1I2BA 3WGQA 3H9UA 2WYVA 2RIRA 3ZHBA 4CM7A 3TZHA 1Q7CA 1P1KA 1VL6A 2ZQYA 3FNHA 4URFA 1ZUD1 4E5NA 1DHRA 2BFOA 1ZSNA 4XYLA 1JAXA 2X5JO 1WLYA 3GEGA 1PL7A 4RVSA 3RJ5A 1ENPA 2XF8A 2AQHA 1ZK3A 5COAA 2GYYA 1XGKA 2BGLA 4RDHA 3JQGB 3PYXA 3PLRA 4ILKA 1JTVA 5A5EA 3AY3A 1DIGA 4GGOA 3C1AA 3FCOA 4IJVA 4DC0A 4DPLA 4DIBA 1SPXA 1UZNA 2ZYAA 5C5IA 1U28A 3B6ZA 2Q49A 4Z3DA 4BO1A 4E31A 4FJ2A 5ENVA 4E6PA 2GR9A 4P4LA 4E13A 2X4GA 2PH5A 3VDRA 1DIBA 1GR0A 3PGXA 3ZHZA 3ZV3A 4MVJI 1XELA 4AL4A 5B4TA 2Y0EA 4N5MA 4YT8A 3KV3O 2Z1NA 3NX4A 4JCOA 5A9SA 2OBYA 4OQYA 3RAJA 1A7AA 2HJRA 4NFHA 2EIHA 3PJDA 2AG5A 4GKVA 3JQBA 2DKNA 3QSGA 1BHSA 1ULUA 2NM0A 3NYWA 1T2AA 4WOJA 1I3MA 4EEXA 3HJAA 3VDQA 2BLLA 1A72A 3QVSA 3ZW9A 3MJCA 4YCAA 2FR1A 5L53A 1U1IA 1Y7TA 5JMPA 3E1KA 2GPTA 3X2EA 5ADHA 4YQZA 1JDJA 4XKJA 5JDIC 4XZ3A 3F5SA 1KC3A 2QQ5A 5TC4A 3VKUA 3ZV6A 3DL2A 3GAZA 4BNLA 1ZVMA 2OORA 3C7DB 2PR2A 3H4VA 4BHTA 3KSZO 3VH4A 4CM6A 1WNTA 1AHIA 1E3SA 3PIIA 4FR5A 4E5PA 1HSZA 2P9GA 1ZZEA 4XYMA 2AA3A 4RO0A 3S1LA 5I9NA 5A9RA 2B36A 1I24A 4Z9YA 1N1GA 3I4CA 4D46A 1N9GA 1RM0A 1YOVB 2BGKA 4G81A 4JXKA 1GU7A 3MJTA 1B3RA 4R69A 2CDAA 2YQ5A 3GVXA 2R00C 2Z95A 5JS6A 4Z6KA 2NU7A 3PJGA 5EL0A 3HG7A 4KUGA 1LRJA 2UUOA 2Y99A 4H7PA 1D3AA 1GUFA 2NWQA 2IEBA 2NUAA 3DMYA 4YRDA 4M49A 2B83A 4R1UA 3VVCA 1JQBA 3AFNA 3HZZA 4B7CA 4R9SA 1DDOA 2X6TA 4QFCA 1NBOA 3NDIA 4PVCA 4CMGA 4XQGA 4Z9XA 1UXGA 1EVJA 3WTCA 4DUPA 2D5AA 3ZW8A 3JTMA 3KO8A 3E9NA 1QV6A 2I9PA 5KNLA 3ONFA 2DLDA 3JQ6A 3GFGA 3E48A 5ILOA 1LDEA 2P68A 1N7GA 1C1XB 4OO3A 1IPFA 5COBA 4TVBA 1ISGA 3VPGA 3LK7A 1H2HA 1B8VA 3ADOA 3DZJA 4DQXA 3E9MA 3JD2A 2Y68A 1VI2A 2EJVA 1RM3A 4CM5A 1VJ1A 2CF6A 4AJNA 3HN7A 5L95A 1EVZA 3AUAA 4HFMA 4Y67A 2NV6A 2WWRA 3K96A 1P1JA 1KY4A 1IOLA 4OKIA 1YO6A 4YQYA 1E3JA 4W4TA 2YV2A 3QIVA 1F0YA 4BGUA 2EKQA 1OZAA 4HADA 3JQAA 3PEFA 4FQ8A 2NNLD 1QMGA 2QYSA 3UN1A 3MWEB 2OUIA 2PGJA 1ZXBA 3ZNQA 3VPHA 4CL8A 5ICSA 4CMAA 4PRKA 4PN3A 4P4GA 4O0LA 4CMIA 2DVMA 4XRGA 3BMOB 3INGA 4R3WA 5LCXA 4BKPA 3CPSA 2HUNA 2JHFA 5LDHA 5TIIA 4RDIA 3V1UA 1DC5A 1UP6A 4LVCA 1KOLA 3AOEC 2G1UA 3KZVA 2GERA 3GOHA 4IDCA 1P0FA 1T4BA 1SOWA 2IEDA 2O4CA 3DBLA 3Q2IA 3WGHA 1X1TA 4E2ZA 3QWHA 2Q1TA 2X0JA 2VZ0A 4KTVE 2O50A 1T2CA 3NTQA 1PEDA 1X0XA 4EUFA 3LYLA 3HADA 2HO5A 1NYTA 2AQKA 3L9XA 1EQUA 3LLVA 2BKAA 4IGFA 4PLVA 3UVEA 4BO8A 2P5YA 1MLDA 1GV0A 3RKRA 3A4VA 1XYGA 1NPDA 1YQDA 1K3TA 1LSOA 2UV8A 2C5EA 3NJ4A 1B15A 1XHLA 2V7PA 1NPTO 1VPDA 2P9CA 2VRCD 2WE8A 4XCVA 4NU5A 3QHAA 3K92A 4N7RA 3U4HA 2OGUA 2DUUA 4ESOA 4L74A 4TSKA 3Q2KA 3QA9A 4LVUA 3UCFA 3HWRA 4J2OA 1I33A 3DOJA 4YJFA 1BW9A 2D5CA 1LA2A 5JFOA 5TT0A 2Z1MA 5ER6A 5FYDA 4YAGA 3LVFO 4PG6A 1HYEA 1GCOA 1M66A 1ISIA 1EK6A 4E12A 3VPSA 2I3GA 3PWZA 4QECA 5KJ1A 3IOYA 3I6IA 4ONEA 1I3LA 2DC1A 3FHLA 4BVAA 1Q7GA 2Q3EA 1ADFA 3LQFA 4MP8A 3C3XA 2RBEA 3CTMA 3FWNA 4BMSA 1UXIA 1DAPA 1JKJA 1UXKA 4BMVA 1D1TA 1F06A 5IAAA 5K0ZA 4RF3A 5IDQA 1EK5A 3KYCA 4J1TA 4MO2A 2JAHA 4BNJA 1GFSA 2AE2A 5ER9A 2CZCA 4JROA 2PGDA 1Z74A 4QX6A 3GUYA 4NHEA 5IDYA 1U3VA 3GUCA 3D0OA 4J7XA 3OEYA 4Z0PA 3PZRA 2BGMA 1DIAA 1YH3A 3OQ1A 3PI7A 3PFWO 3ONEA 4XD2A 1ML3A 3ZH2A 3ZHYA 4WASA 5TX7A 4EI2A 4MKXA 1PJ3A 3UF0A 1X7GA 2YV3A 5IDXA 2V6BA 3N7UA 4ZQEA 1JVSA 1PGNA 3MJVA 3DOCA 1LRKA 5LC1A 2H9IA 4D3FA 5IG2A 2LDBA 3KHUA 4QEDA 1LSSA 5DCUA 4ALIA 3GFBA 2C07A 3TDKA 4AJIA 3UKOA 4IDGA 2QZZA 3OJFA 3AY7A 4L4SA 4WNCA 3S8MA 3LT1A 4W7IA 1NAHA 1XKQA 2ZTVA 3ST7A 2B4RO 2X86A 3RFTA 1GQQA 1K2WA 2WE7A 4Y9DA 4BNXA 4JP3A 2AMFA 1UAYA 2ZJ1A 1QYCA 4Y6PA 1EUCA 4B4WA 1D1SA 2QRKA 2GSDA 4M86A 1PU2A 2YFQA 4IDFA 2O4UX 2A94A 1OBFO 3D5QA 4AJOA 1NX6A 3O03A 5JY6A 4G5HA 3RWBA 3FTNA 4GBJA 1VSUA 3M2TA 3BAZA 1H9AA 3SLKA 5T5QA 1YBMA 2HK8A 5TJHA 1PJBA 4H16A 1EVYA 2PD6A 3JD3A 5EIOA 4A5OA 3W6UA 3ZWBA 1N8KA 1YQXA 1EBFA 2J3KA 4HWKA 3STHA 1R4NA 2AQ8A 1E92A 1ADGA 4PG8A 3MJ4A 3OP4A 4LN1A 2GN6A 4MVJE 4CQLA 1JKFA 1X0VA 4LMRA 2JCVA 1LUAA 2J5QA 4MVJG 4YRBA 3WB9A 5BSGA 5U4QA 3ANMA 4I8XA 3BMNB 5THKA 3QWBA 4RVUA 3GHYA 5K9ZA 4I5DA 3GC6A 3CZRA 1NFFA 1A5ZA 5GMOA 2XXJA 3L9WA 3VVBA 1KVRA 4IDBA 2EEZA 2VYND 1U2DA 1DRVA 2XXBA 2BFMA 3JQ9A 5C7IO 4CQMB 1N92A 2BFAA 2R6JA 3JQGA 4R54A 3LZ6A 2E82A 2EGGA 2P5UA 1X7HA 3AU9A 1JKIA 3R1IA 2G5CA 3ETDA 4BOYA 4DTIA 2ZYDA 2B5WA 5TQVA 3CXRA 1GY8A 4MIEA 1Q0HA 1QORA 4CM3A 5DZSA 2OP0A 2VWHA 1HE4A 1MFPA 2GN4A 5H81A 2E6UX 4J4TA 4MVJH 3ZWMA 3HSKA 4GX5A 3NRCA 4GMGA 4KDEA 4YVFA 4M89A 2D8AA 2DTDA 3C85A 4QO7A 3K8ZA 2E4AA 1QYWA 1M6WA 5L9AA 4J91A 4J16A 1LQTA 3IJPA 4XX0A 4RGBA 3RKUA 4WLOA 5B1YA 5CAEA 2VRCA 4B7XA 2VTDA 5TGDA 4WK6A 3WG9A 1CF2O 4RQTA 2DPHA 4J7UA 3WWZA 3A06A 3TJRA 4NBWA 1BMDA 1SNYA 3WFJA 5B12A 2DQ4A 2H5LA 1KERA 1HETA 3JQAB 1LLDA 5DBGA 1K5HA 2D4AA 1BXGA 4A2CA 3S55A 1P74A 3ROQA 4DPKA 3PFFA 3U49A 4RPHA 3ON5A 4CMIB 3ZZNA 4MP6A 1RYDA 2VWQA 1RPNA 1E77A 1KS9A 4XQ9A 3L4BA 2JFGA 5CDYA 1E7MA 2PTGA 3GQVA 4MKRA 4IIUA 1DLIA 4BO7A 3JD0A 4UEKA 2E37A 1LDMA 2JD1A 4W9NC 1NQTA 2NVUA 3V2GA 4YT4A 3OJ0A 1YOVA 2Y05A 1DJNA 5ITVA 4AJEA 3ZI0A 1BDBA 1E6EA 2PKQP 3B70A 3DAFA 1NWCA 1Y6JA 1ZBQA 5A3JA 1E6WA 1HE3A 1P0CA 3DZBA 3IC5A 4YAJA 2GN8A 3W8FA 4PZDA 2ZB4A 4MVJM 3V2UA 1C0IA 5TF4A 1XQ1A 4UREA 4HFNA 1XWFA 1DC6A 4EJ6A 3EK2A 4UEOA 4TKLA 1DRUA 1C1DB 2GDZA 4BKQA 2Y1GA 3UHAA 3SJ7A 2X0IA 4CLRB 5AXDA 4YJHA 3BMCB 4XYEA 3UXYA 1PGQA 1GZ6A 3OA0A 2E49A 4TWRA 1C14A 1LC3A 1TI7A 2C2YA
chains in the Genus database with same CATH superfamily
3NUGA 3DLIA 3GEDA 4BNYA 1XU9A 4E11A 1ZHFA 3BXPA 4G3XA 4V0OA 2F1OA 5AK0A 4L5AA 4MI3A 3T3NA 1PUJA 3TIGA 3ERCA 4GQIA 1NRIA 2A9VA 3I3OA 1NI5A 2WVGA 3H65A 4DC9A 3CWZA 1NW8A 1SQFA 3LHSA 4YYZA 4YFYA 1MRNA 4H77A 1F0KA 3VR1A 3AU8A 2JIZA 4I4CA 1TRHA 1NFRA 1FNSA 4KNWA 2Y27A 4XAQA 3LOUA 4CMEC 1C7RA 1W5EA 1GITA 4ROSA 3V32A 4A1FA 2RJNA 1AKWA 3L0IB 4MRAA 1ZISA 2DTEA 2R8EA 2VNJA 4L4ZA 5AI8A 4CNQA 4DMKA 1HDCA 221PA 4W5JA 2Y1CA 1E1RA 2R25B 3G9ZA 4BFLA 4N5NA 2DETA 1LZLA 1YVPA 4IIFA 2CUKA 3U37A 1NY5A 2WU0A 2WU8A 1VJDA 4J0GA 1JKJB 2O23A 3A3YA 5AW3A 1YKFA 2BE9A 1NDHA 3OWHA 2FY8A 3RJMA 2YOHA 1JVNA 2D1QA 2E21A 3FPBA 2YZMA 3H1TA 5HMMA 3M5PA 5IVKA 1GAWA 3ZGOA 4HGYA 2O19A 1SBTA 3IKJA 3ZYCA 4AF8A 2XMBA 4HB4A 2WSSA 1M0WA 4OTZA 1B4DA 3WKBA 2AWNA 4P7GA 2EBHX 3ZU4A 3L6BA 4JQSA 3G0HA 1RLJA 3QBTA 2ZANA 1AQIA 4O2BF 5AI6A 5JWHA 4CQMD 3JX9A 2PV7A 2Q6IA 3KWFA 5KIAA 4QRHA 4UTXA 4B32A 4LZJA 2Z5LA 1ODIA 2BMEA 2J3IA 2ZCJA 1E6UA 1QCCA 2H6EA 2ZI4A 2B5OA 3C0KA 3TG2A 1CX9B 2I4NA 4WJKB 4X62B 4BJ1A 2C2XA 5JSZA 1D5CA 1LI5A 2WTBA 3IYLW 1TUGA 5HBGA 3INNA 4UTPA 4GKAA 2FUNB 5G4LA 2CK3D 3ZE8A 2OHGA 3LC0A 3N2IA 4YP0A 5LLSA 3WK4A 1L5ZA 3LCCA 2RGDA 1KA9H 4KLNA 4GQBA 4MYHA 3KDSE 2E7ZA 4N0PA 3V7UA 5G0SA 1QZ3A 1C5KA 3I9JA 1D8AA 2ASVA 1MAAA 2YRXA 5E0OA 4Z1MA 2DBQA 4ODIA 4D25A 1Y3CE 5D3KA 3N2NA 1V3TA 4HD8A 3WLJA 4TLAA 1JKMA 3RARA 1JHPA 4G26A 3OJLA 4R81A 5FTLA 2UZ1A 2VDQB 4CIAA 4QOEA 5CYFA 1M1NA 2I8AA 3OJOA 5BQFA 1NX9A 1RMTA 1QNFA 4LWOA 5HW0A 1MV5A 1DS6A 2K6GA 4LE1A 1Z08A 3SFTA 3GUZA 3LQRA 1Z6PA 4DUGD 4F3NA 3PNLA 4KIUA 2XUPA 4PSUA 5H4HA 1D0VA 5BUZA 5AW0A 3A6FA 4WK0B 1UH5A 5A5VA 4B8WA 3E9CA 2FMFA 4XDHA 3O90A 3EDOA 2Q28A 3EUWA 3ICOA 5F5LA 1KZGB 2BIFA 1WDMA 4MEJA 3JD1A 1IULA 3KLPX 4MUGA 1B41A 4PG5A 3KFXA 1NVVQ 1RJDA 3D7NA 4G0OA 3TRKA 5JWOA 3DP7A 1UEJA 1KJ8A 3QRWA 4IFEA 4NZMA 4BNDB 3UOWA 6PFKA 4A16A 4E14A 2FP4B 1W1UA 2YWCA 2FSVA 1U90A 1IN4A 3JVUA 4M9SA 5BXQC 4HUJA 1S7GA 3DUFB 4Z3OA 4E21A 2EV9A 2E4UA 2WYUA 2AUMA 2AMJA 2MINA 1VKJA 4QA9A 2HYIC 3O92A 2A59A 5LNK1 1I9GA 3X2FA 1BVHA 4B3IA 4O29A 3WL3A 3KALA 3FOZA 3M1AA 3OFKA 3AJAA 4O6VA 4PLCA 1YCGA 5D8DA 3FSRA 4HPWA 4NJMB 3ZD8A 3B52X 4IFBA 1KDPA 3L7CA 3EXHA 2F3TA 3NTLA 3LHDA 2RHJA 3WA6A 1NLZA 4DMGA 2X8WA 4LQCA 3VZBA 1ZOPA 1Y8RB 5B53A 3T3GA 3HVRA 1KMHA 1QF6A 2MYUA 4UEJA 1KR5A 1J70A 5JDCC 5I4BA 3FDZA 4R51A 5DMXA 3SIPA 2ZVDA 3BG5A 3H3FA 1ZJZA 4G5SA 1BSVA 2FLVA 3CX8A 3KUKA 1CY1A 4W5OA 4WA7A 1M34B 3BJIC 3QYFA 2FUKA 3B48A 4DNOA 4Q1DA 4TM7A 5IM4F 3HRKA 3N6VA 3OTIA 3IOBA 2AVDA 1MPTA 3B3JA 4JQCA 1BH2A 1SCDA 4IVQA 4EGFA 2XGJA 3LKZA 3OX2A 3GYGA 3NR2A 1Z4NA 4Q1BA 1W59A 3PFGA 4MW2A 4X7RA 1REQA 2MCFA 3RK1A 5C8YF 1UFVA 5I7WA 3ODGA 2H3HA 1E2DA 1IEWA 1FFXA 4JFAA 4YA6A 1QYXA 4IDPA 3TVYA 4JKYA 1EEHA 2TRSB 1VLLA 2WKRA 2ZIUB 1AUVA 3PIDA 3RJTA 1ZN2A 1N9ZA 4IIEA 5T6BA 2P30A 3DMTA 1XRNA 2ON6A 3MOSA 2JI8A 4LV5B 2OLKA 2G36A 2P40A 2WJ3A 3R5KA 2WJ4A 4IJQA 4ZTUB 3TBKA 1QPZA 3WKCA 4YJ2F 2IRWA 1HKUA 2BJHA 5CVJA 3IP9A 3DO5A 2DTXA 1A8IA 2O8CB 1CY0A 2E18A 3F3MA 2J9GA 2X5NA 2O3TA 3THOA 5F77A 4NEGA 2HV8A 3A9RA 3ILXA 3UM9A 5AHWA 2GYUA 3HY4A 4JLOA 4YBZA 5JS2A 3TRIA 2GEJA 2QN1A 3AF2A 4URZR 4EA8A 5AKGA 3WC4A 3OP1A 1Q19A 2IGTA 4QHSA 3KCNA 4RCZA 3C45A 2QT9A 4BGIA 5B6PA 5ERYA 1KI3A 2EOAA 1OSNA 1A27A 1ZEMA 2IUEA 4Q3NA 4HLQB 2IXFA 4O2BB 1BDJA 4OQZA 5A3VA 4KW7A 1S8FA 1KO1A 2Y1KA 3CE9A 3TTYA 1SK9A 4QYXA 3RDPA 3TIIA 3VTAA 4A0SA 1KZ4A 1R6DA 4V38A 5HM8A 1N2IA 5JTUA 4YUZA 2ZIZA 2VUIB 3U0BA 3KQNA 3NAQA 5KYGA 1AUOA 1C3OA 5EE0A 5BRNA 4B0OA 1K92A 3M2PA 1FU8A 3QTLA 2C4UA 4OMFG 2HLHA 1OI7A 4F9GA 1Y4AE 3IP5A 1KMQA 1C3VA 2ORIA 3I6MA 2QIOA 1X8JA 3GVHA 2KW5A 4Q4CA 5TXGA 3V4OA 4ENWA 5K6AC 4ADSG 2XOKD 4KXLA 3DZFA 1ZN7A 5SZJA 1E6CA 1P4SA 1KAGA 1GAQA 4G9BA 1JIQA 2V8OA 4S3MA 1HE2A 2PLWA 4JBGA 1Z56C 2ID8A 4JS0A 1JQKA 3KQLA 1W8DA 2WUWE 3MZ0A 2HK9A 4G84A 4KR0A 2BUCA 2GAFA 2X19A 4CQMA 5K0NA 4ZHSA 4EY8A 1XXHB 1G5IA 2PZGA 2W2VA 4UOEA 1RZVA 1AN9A 3G68A 4I9HA 4YX9A 1A7JA 1TKAA 4N9QA 4WXMA 4OOEA 1X86B 3UK2A 4JMLA 1IEXA 2GLXA 4XJTA 1OCEA 4NQZA 3PL1A 4GR5A 4ZICA 5DNCA 5LPNA 4WXRA 2VAMA 4JEMA 3M6LA 1BE6A 1G4HA 3VV2A 3UPUA 4GKKB 1V7CA 3U4CA 2J3QA 4DLYA 1C0PA 1OQAA 1ESNA 2CK3A 2BELA 2WDPA 2V9CA 1KJQA 5BWBA 3Q12A 1MDBA 6ABPA 1R88A 2B4QA 2J6BA 2VQFB 5ALQA 3AWDA 4ZCLA 4DFDA 4WI1A 2F62A 3ETEA 2A4KA 1LJLA 4XPZA 1N6NA 1T9ZA 5EAIA 3R0IA 2GCPA 4LGVA 4LXTA 2F6RA 8AT1A 3OEWA 4FQ5A 4D5GA 3WRXA 4YRIA 3E15A 3W5CA 1FDWA 3EASA 4GD3Q 1X3SA 3HZHA 4QYIA 3S2YA 1KZ1A 2NADA 5KTKA 3EGDB 2GVNA 4L6AA 2CVOA 1KJJA 1J9ZA 2FFQA 3DPIA 2DSNA 4I08A 4BFCA 3Q4GA 1N1EA 2CE2X 1B6GA 2HIAA 1U2GA 1BVYF 1DG1G 1N2CE 3GPDG 2NXWA 4YRRA 5AM0A 4AP9A 4DUGA 2ZSHA 1EUDB 2H1SA 2Q3MA 4ZA2A 3MJHA 3U7IA 4A6DA 5IVPA 3GRAA 2Q3FA 4LF5B 2RGEA 3L8ZA 5TY0A 3EW7A 3VH2A 2AFHB 4NR0A 4TTSA 4B3JA 3E3LA 5EI5A 5ICMA 2AEFA 3NXKA 1PBNA 1BX0A 4DRXA 2QHXA 3TD9A 2CLLB 1DJLA 1U0EA 5B1IA 4BZXA 3P2OA 1U7HA 2BW0A 1JPNA 2J8ZA 2CVPA 1J8DA 4OFZA 1J8VA 2G0AA 3LLMA 4ND3A 2HH9A 5DGTA 1T0JB 1H4SA 1GHTA 4DS3A 4NH0A 4E3ZA 1JB9A 4HDOB 2OFXA 3VOBA 2PUAA 2EX4A 4C22A 3SZOA 5HFAA 1KI8A 3CVOA 4BU1A 4B09A 1VCMA 2YXNA 2OV4A 2J5RA 2WINI 3CX4A 3P1JA 4R6XA 5DCLA 4D98A 1FRQA 2X14A 4CKEB 1GTRA 3V1TC 4OHYA 1E3QA 3EIHA 4MA4A 1DBQA 2I80A 2GPWA 2ZDHA 2ZK7A 2ZRKA 4GM4A 4M9XA 3VZDA 5IDWA 3EUAA 3JQBC 4ZAZA 5LSAA 3LLCA 3G2IA 1KETA 1ZJJA 4ZYWA 4GOJA 1L7OA 4D79A 2LWIA 4CEHA 3T8YA 5L3VA 4C4SA 4LNHA 5IMSA 4KTTE 3T0IA 3T1HB 1EXMA 1O58A 1Y42X 3RUCA 1GZSA 5HRCA 4JI1B 4BIMA 1ZU5A 1KMCA 4XJSA 2ORWA 1KJNA 1H4TA 4FJ0A 5A7FA 3IIEA 2PCJA 3EGOA 2ZRDA 5K3OA 1I4LD 3FGOA 3CVVA 1PX0A 3VR5A 1T1EA 4E5SA 1U0BB 4P54A 1M1YE 2OORC 4FDMA 4NMHA 3VSDA 4YJ2B 3H1AA 3L5KA 3CLHA 4EL5A 3F7OA 2I2WA 1ACJA 1X1EA 4CT0A 4LXIA 1GGJA 1OROA 1A2QA 3JQQA 2H1WA 3OQHA 4J8PA 4ZI2A 1F1BA 1Z33A 2MJLA 1NNEA 1A4XA 3EQZA 4AM8A 1R4MA 1GQOA 3LSYA 4DV2B 2O48X 4HQ0A 1XCJA 2LE0A 4J90A 4JJAA 4UBKA 3FETA 1YB5A 3WHLA 3WLHA 1W47A 2XYPA 3CF4G 2FEOA 2J67A 4IH9A 3G9QA 3TMYA 5ITWA 1KJIA 1PW7A 2PMCA 2FW9A 4JDPA 2WKSA 4MITA 3VU3A 2BKVA 2NAPA 3DS8A 3EIFA 3FHCB 4WSOA 2CF5A 3GG9A 1J2YA 4D96A 1T29A 1IM8A 2NUBA 1WIWA 2VNAA 4P8RA 4LWPA 2VJCA 4RVDA 1Z29A 4G5FA 4RJTA 2ZXEA 5KJEA 3ZNOA 1PWEA 1NR1A 2C4HA 2FVYA 2WSBA 4KWEA 3FGNA 3TE6A 1FK8A 5TQ0A 3WYNA 2ZTSA 4ZMBA 1YZQA 5E6RA 4HQNA 4CG2A 1G8MA 3HUUA 2L19A 3AR8A 2L18A 4DTCA 4X1IB 1EJ0A 3LPNA 3PZBA 5M3BA 4MR9B 2ZWPA 2OA0A 1RMYA 3FCEA 2J32A 4I3HA 3RLFA 2HIHA 4UXHA 1EK1A 3W9SA 3EQ2A 1Z6ZA 4GGMX 1OJLA 2FW1A 4BV3A 1I3CA 3FVRA 4E5DA 3AVVA 1ODLA 2HLPA 3GRKA 5B7NA 2PZJA 1NQOA 4B6FA 5HQTA 3GLRA 1DDIA 4KXMA 2ET6A 2W11A 4PZYA 3W5SA 5KTSA 3O4VA 2GX6A 2ZYGA 4L7VA 3F4BA 3TZLA 2QP4A 2YN2A 3OZDA 3UH0A 1W0JD 4JB2A 4M46A 4RY8A 4WCFA 3SMVA 3WL7A 1CYDA 5B1DA 5FDFA 3QP9A 3BQ9A 1O97C 4CJXA 5HUQA 2B37A 3HN2A 1FUYB 4YLGA 4YACA 1OLUA 1MJGM 3I5MA 1E3IA 1JQLB 2R7MA 2WFZA 3CW8X 1XLTA 3NV7A 4KIWA 1YZNA 2XOKA 3BL6A 4MHOA 2P8JA 1EZ4A 1YR2A 3AK4A 5CTJA 1R0CA 1TO6A 2AMYA 1OVMA 1BHJA 1TOAA 3UMRA 4MDFA 5AK6A 1FDIA 3HGQA 2OCAA 2ZSFA 4BB9A 1P2GA 3M89A 1DU4A 3DTVD 3AFIA 4Z9AA 1TEXA 1XKXA 2GMWA 2YXDA 3IAHA 1XVTA 2HLNA 3RIGA 4N4AA 4DEYA 2ZR9A 2CMKA 2Z6UA 4N3AA 2PUJA 2V7TA 3FKSD 1GO2A 1JHUA 3D54D 1G20E 5FAXA 3ZK9A 1EP1B 1VSVA 1J1UA 1R9NA 3ZWPA 1M8PA 2GHTA 2NVWA 3H5LA 4HNTA 1MCZA 3FYHA 1KYIA 3LHKA 1E79D 2J9YB 3A4MA 3VU9B 1U4SA 5EPEA 5T8KA 1QGDA 1VBNA 4KPUB 3UTCA 3OBBA 3PCXA 5BOSB 1VKOA 1CNFA 1WLSA 4AXBA 1OA1A 4D6PA 3L6RA 3ZDZB 3HJCA 2VK1A 4IM7A 2IP2A 3AETA 3ITDA 4PLTA 2XCUA 3ZBPA 2ZEJA 4KMSA 5C7LO 3H0CA 3LY8A 4N41A 3W2IA 1BXRA 1URPA 5ALFA 5J4KA 4UM9D 2JL1A 3ZH9B 3P9YA 2PS9A 2FRVA 2V6IA 4UTOA 3EFOB 4UTZA 3ICVA 4BECA 3VPBA 5CFLA 2ZU6A 1EESA 3GCDA 4Q7MB 3AUKA 3VO1A 3T0FA 4CKXA 4FGWA 1MO3A 1N78A 3O8RA 2IWHA 3H9EO 1OA0A 2ZRBA 3BS4A 3E7WA 3H9JA 1OH5A 1IBLB 2EGHA 2IODA 1GRCA 1VGRA 2O2ZA 3EPPA 3OQ6A 1CDOA 2W83A 2YDXA 3FG9A 3P20A 4G4SP 1KL7A 1LQUA 2XVAA 2WNSA 1C7FA 3KPWA 3MMSA 3TS1A 2VF4X 1NBMD 1BGWA 4QTTB 3SJBA 2A9RA 1IH8A 5EMHA 5HG0A 3SYMA 4DIDA 1EMDA 2A67A 4EDHA 3RYIB 3GQBA 2XDQB 4MLZA 3V4SA 4CLHA 5K4HA 4Q93A 3CLTD 3GZJA 5EIBD 3ELUA 1KVUA 1Q12A 4JCCA 3NNSA 5KAPA 1XYVA 4MDYA 1ZNQO 2NQ8A 5CJJA 3T9DA 3T5AA 2E5WA 2ZBQA 5LQAA 4B7ZA 3R7NA 1LV7A 3W6PA 3RT1A 5BR8B 2ZCVA 4RJKA 3UAOA 5LXTF 5I9MA 3EAGA 1X7WB 2GUWA 3KK0A 4TWZA 3TIVA 1B26A 3BJRA 5DK6A 3IUSA 1TCVA 3D4PA 4WXEA 1GA4A 1J8FA 1LS1A 3H8SA 1TEHA 2GEVA 3HU2A 4P32A 5AK5A 2HK7A 2C94A 4HX5A 5IJ0B 5CIYA 1EVIA 4KZPA 4JFRA 3QY9A 5AM5A 1VBFA 2BOVA 3TLYA 5LD2C 2WYWA 2YZ2A 1LH0A 1XU7A 5JW6A 2AW3A 4MR8B 4EKGA 3M3PA 3G2PA 5FI0B 3MSXA 1JI3A 2ZBPA 3QYPA 4OEHA 2AJDA 3FHJA 4PE5B 5AIAA 5F78A 1ISFA 5K3DA 5TSDA 3UUFA 5KDLA 4MRVA 5IT5A 3QVGB 4HMOA 5EJ4A 3VV3A 5CRIA 1MIOA 1UDRA 2Q07A 4R1NA 3TZQA 3QLTA 3EOBI 2QMUA 4AW9A 5EIFA 1CFZA 2BM8A 1DBRA 3LC7O 1YRLA 4XIIA 3DVSX 1PR9A 5BOVA 2IIPA 1RJ9A 4XDGA 2BHTA 1VYUA 5FL7D 4QGSA 1YA6A 4WNYA 5LQUA 1E2EA 3ORHA 4LY6A 1F12A 5E8RA 1SH7A 2BVNA 2HCJB 1L5FA 3SF8A 4P7KA 2J5XA 1IB6A 3BSWA 4Q9NA 3LUDA 2POCA 2R6R1 4U7FA 1JLLB 5HCUA 2QKYA 1ECPA 1Y9AA 4F8EA 3QWFA 2YOGA 4RPIA 3GF4A 3ZV5A 3ESDA 2EGUA 1JP7A 1Q7RA 2QM7A 2UYYA 4WZZA 5HF9A 5I7RA 4CT5A 3BFVA 4XEUA 5EQTA 1AJEA 1YMUA 1FFEA 1XXLA 1ZCFA 1BCRB 2IPLA 1WWKA 2SCUB 3BH6A 4BNKA 2PGOA 5FV4A 3HDTA 2EX1A 1W5AA 1RC8A 4FLEA 1V1JA 4ZQFA 4KUHA 1KXJA 1UPTA 3KB6A 1NOJA 1U4OA 5BR7A 1K5GA 2ZE6A 2XNKA 1WOMA 2G9NA 1PNTA 2JGLA 2W4QA 5JAOA 1CRLA 5E4JA 2HW8A 5GJBA 4RTJA 4JHXA 4DQVA 2VI5A 4BFWA 2ACVA 2B8JA 5HS6A 3LUAA 4ZTZB 2AXQA 3IMEA 2JCYA 3W0LB 2FZGA 3EEYA 1KEWA 3LUPA 4JZKA 2AF4C 3AEXA 5BWOA 1Z0ZA 1N7JA 4TWIA 2WILA 4JK3A 4KNVA 4PO1A 3SZ3A 3DWFA 1VMEA 2NVBA 3M6WA 3A32A 5I7EA 5K0SA 3F6YA 4B81A 5BNFA 1IUNA 3LVBA 1IUPA 1U99A 4WZBB 1S6YA 4KITB 1M2WA 4QO8A 1CW2B 2WJHA 4NAHA 2EDCA 2VDNB 1V48A 2Y4NA 2ZIXB 3K32A 3WL4A 4P7FA 3SYRA 2IOFK 2IPOA 3PE4A 3QPUA 4Q24A 4RUKA 2XWBF 5DTJA 1U8AA 1W0JA 3QE9Y 5CTAA 5HZGA 4F86A 2OZLB 1NDUA 3MAGA 5KCMA 2MMCA 5CDSA 3FCUB 2IP1A 1L1FA 2E4ZA 5C80A 2BEWB 2O59A 1Q50A 2HMTA 3B5JA 4RGVA 1S3SA 4BO3A 1N2BA 1NTRA 4UCQA 2VQ3A 2YHBA 1CUSA 1LDBA 5KYKA 1LD3A 3DEHA 1HUQA 3H5AA 3FYUC 3YASA 1KI1A 2I54A 4Z7OB 1RW4A 3WDSA 2ZM5A 3DTVA 3TSWA 1ECCA 2EKZA 3ROMA 5K8TA 2YYAA 1XVUA 3C7CB 3GFVA 1NW6A 2XQJA 2J3HA 4Q7JB 2IE0A 1HL7A 2QGNA 3L77A 4GPEA 3FKSA 1GUYA 4MVJD 5AKLA 3JQPA 3TL3A 2VTBB 5FHQA 3FTCA 1L5MA 1R64A 4MPPA 1WUYA 4XOUA 4V0NA 4A15A 5EXDA 1K97A 1UZAA 2OV3A 3DXYA 4GIBA 4MGHA 4D8YA 3WIBA 5L4SA 1E79A 1EFLA 2ZYUX 3CLSC 3JXEA 4TUYF 4CG1A 3PENA 4HZUA 1E7RA 2CFSA 2YXBA 3SZLA 2R7AA 3IEPA 1N5KA 2O7RA 5C4MA 3D4OA 3IPXA 5EIAA 4JAVC 2XY4A 4BZWA 2H5EA 4XGKA 2H1LA 1YR9A 4GYJA 1IN1A 1KXZA 1Q1GA 3WGVA 1DCFA 4I3GA 3W2GA 1MPXA 1XALA 4M9ZA 1J00A 1QPGA 4ZGWA 3CLUD 5HPYB 1OXTA 3HKEA 3OC0A 4NFLA 2WHYA 2PM8A 3ANNA 3A58B 3JSXA 3GN2A 4IHJA 2O7VA 3D4BA 1GG5A 3ZWAA 4B40A 4F4UA 4TMVA 3EC1A 3T3EA 4DV7B 3MBOA 2QM0A 3QLUC 2ENUA 3T1VA 3ZPXA 3IELA 4KBFA 4WXPA 1CJCA 2WC1A 5H5JA 3U1VA 4D0RA 3ZD6A 4PV7A 3C8MA 1B23P 2FEWB 2NTEA 2F3QA 2W43A 1QLJA 3DJFA 4DLNA 1Y5MA 2E3JA 2B82A 4KACA 4CTOA 5F2OA 4EG1A 3OM8A 1AQLA 3CRRA 1UT6A 4EFLA 4N7JA 2RB5A 4E5VA 4P33A 2ERXA 5JV5A 4CZ2A 2QD3A 1U1FA 2C5AA 2SBTA 2HF2A 3NDRA 4AFNA 2GAAA 5JDIA 1J22A 2ID7A 2BFEB 3WLKX 4P3YA 5FBRB 2AEJA 3GMSA 4U2FA 1G6HA 3WNVA 2C8VA 2XQKA 3QKIA 3AG6A 1MQAA 1T5HX 3FBWA 5BP7A 3B6EA 3G79A 2OCDA 3U7HB 1XEFA 2C9OA 2PQ0A 3QK7A 4PGFA 4EJ0A 1VSTA 5BNTA 5DM70 1S01A 1VLQA 2ORVA 4ZZ3A 4MJ7A 1ABEA 2FDXA 3AR3A 1Z39A 4M4SA 2W0SA 3COJA 4K9NA 3REOA 1JRLA 1QH1B 3SXPA 1KJWA 1THTA 1MOSA 2C8JA 2DPYA 2XGGA 3ASVA 4FGSA 1SUPA 3ACCA 4CLOB 4KSYA 4HAIA 1NUAA 4GLLA 4MKIA 3RT9A 2W2KA 4L72A 4PIMA 4J0KA 3OHSX 4F71A 1PJCA 1L5VA 2DQYA 2DY1A 2GCNA 1ZICA 3FB1A 3BMQA 1HTWA 3PQ4A 4U6SA 2D74A 1M6HA 4OK3A 3C3KA 3FYTA 1R6BX 2PGIA 3L4BC 3FJ1A 3GVCA 2R00A 4ZI5A 4U8GA 1PJZA 1Y9ZA 1YHYA 5FL7A 1TA4A 1QHSA 1SKMA 2WD7A 2QRVB 2VT3A 4D9BA 4HX2A 4U2GA 4NTZA 4S0ZA 3FNRA 2OHIA 4UJ3A 5LLTA 1YB2A 3TINA 5FULA 3B1KA 4C21A 4N8DA 1N2ZA 3U4AA 4Y98A 3ONNA 1HT3A 3HY6A 3I5AA 4KO2S 4BNZA 1XNGA 5K8UA 2ECQA 2EL9A 2YCLA 3IHKA 2VT7A 3X3HA 5KPJA 5BT9A 3W7BA 4W5WA 3ACBA 2FV8A 2BFFB 3PF9A 4RPGA 1Z5GA 4EG4A 3NRBA 1WDTA 1MX3A 4K0RA 4U02A 1CERA 3BXOA 3EGVA 1YDHA 2MR6A 1MB3A 4NYMR 1XR3A 2XCIA 5CLHA 3KLOA 1Z4OA 4HH1A 3GRFA 4QBGB 2AX3A 3JPYA 4KQ9A 1WUTA 4NS4A 1F5SA 2H1OA 2ZZKA 4FYIA 1DG3A 3L41A 1OC4A 4X1YA 3GPIA 2BFDB 3W78A 2EDAA 4CGZA 2YNMC 2QY6A 4J0CA 2BDEA 2XUQA 5MN6A 4MQEA 4DABA 4URVR 7ADHA 3IAEA 4QAQA 4TMTA 2IXDA 4WKBA 1E7YA 2YYYA 2FN7A 1EG2A 3I2HA 2YRFA 1VC2A 1L4MA 1M7HA 1SD5A 3R3ZA 4UKDA 5DT9A 3WMEA 2CWWA 3MRTA 1JN0A 5DNVA 5FFNA 5KYVA 4BVGA 2WFLA 1BU8A 1CKEA 5FWDA 4ZPJA 1USIA 2ZQZA 3NVKI 4QGGA 1SKYB 3WAGA 3M9XA 4X97A 1ISJA 3ZDYB 3T7JA 3NB0A 4WK4B 4YAEA 2YUTA 4NBSA 4KPFC 3UHOA 5KWJA 1PEAA 1YK0A 2VTVA 4C7OB 2D59A 1O57A 2XZTA 2I3AA 3U16A 2A58A 4BB5A 2XOEA 3O3NB 2Q7DA 3SZUA 4V0SA 2CXQA 5J5AA 4AO6A 4Q4HA 3I12A 2EKDA 4D42A 1DB3A 4UQOA 4X71A 1IPEA 4MWDA 4AX8A 4DSTA 1EFVB 3H84A 4GXRA 3R9XA 1PFYA 3N8IA 2A0KA 4EUEA 4C87A 2PUGA 1J7JA 2B7LA 2O2GA 3AR6A 3N7TA 3N5KA 4C7MA 1L5WA 4MV0A 3AOEA 3L0OA 3H05A 4C04A 5KTYA 4B7UA 2FW0A 4H7KA 3WL5A 3K4QA 2HU7A 3LE8A 2OHXA 4IZIA 4ZT3A 2TMGA 3GJ3A 4TKUA 3H3JA 3RU7A 3QQPA 4F4FA 5AUNB 1UFRA 1K9VF 1F8YA 3I76A 3IJEB 1P4AA 1LX6A 1UPCA 3HBNA 3MS4A 4BQRA 5U9CA 3IP7A 1N1DA 3P9ZA 4MVJA 3F5MA 5A6SB 3SC3A 3ZNNA 1KEUA 2QF7A 5L7TA 2QRHA 4J76A 3DCJA 1JIVA 1WPGA 4LJ9A 4GVXA 1Z15A 3N5CA 1KK1A 2VYQA 3DVAB 3EUEA 5F12A 1GKYA 3L0YA 2CNWD 2JGEA 2SKEA 1UC9A 3JYPA 2EQAA 3I23A 3ZGNA 2O2JA 3DVLA 1R18A 3MLBA 1QIFA 3EFBA 2HBQA 3C3CA 3GH1A 2Q9UA 4WLUA 5LQSA 3R7SA 3UYKA 2O2CA 2JI4A 1GL9B 1LK5A 3JTEA 5CPBA 1UWVA 3MT9A 1C7IA 3EA5A 4MJ3A 3LZCA 2OWEA 4TV9B 4WJZA 1TJ5A 3FOFC 5KC9A 3CHYA 1E3MA 3OE7D 4MAFA 2O1WA 2O7QA 3DBHB 3RS2A 5H59A 4YMGA 2ZSDA 4XJVA 4I50A 4CM4B 4ZJYA 5DNUA 1A82A 4PFJA 1G3MA 1KZ6A 3ZZ1A 1Z35A 1KDYA 4KDRA 5F73A 2XVZA 2QR2A 2DB3A 1JSZA 5FPHA 4XWGA 3RBVA 3X1DA 2WJGA 3LMKA 4FOSA 1YU6A 1AQYA 1VE5A 2WDZA 1YDWA 3AT1A 3AR2A 4GH5A 4JIGA 4Y6QA 4KXNA 4YCSA 1VPWA 2PH7A 2H8GA 3G9UA 2CFOA 4QT4A 5GZ1A 3GEHA 2ZYVX 3FNGA 1IY8A 4TKVB 4JVSB 4YJDA 3A9VA 3SPXA 4CKWB 4M21A 1P7ZA 4EO7A 1SCUB 3EVEA 4C89A 3A4YA 4TRMA 2K7ZA 1KZYC 2QSYA 3H9CA 5LA6B 1JSLA 3T6KA 4C03A 4H6PA 4XVUA 5KX5F 3LS2A 5AVXA 1XLWA 1Q14A 5DCYA 1NWHA 4L27A 2JD2A 3LKVA 2FRXA 3EG9A 1UFQA 4FWBA 3L40A 3O8QB 4AP5A 2Z9CA 3RVSA 1N2CB 1ISPA 2FX5A 1MXFA 2JZCA 1T4DA 1F5NA 1SRQA 2R48A 3QLVC 4L5YA 2DR3A 3TZCA 2XE6A 2BHLA 3UWPA 4D81A 3TECE 1NQWA 3B82A 3VZSA 4HDSA 4FHFA 3VC2A 1M72A 4FGLA 1JF8A 1TADA 1QTQA 1W75A 2VDVE 2X9VA 3FROA 4MPRA 5DTQA 1AGYA 4PBRA 2IS2A 3DHWC 3C74A 1H2AS 1Y98A 2FPSA 1YGPA 3CF6R 3DBRB 4QFDA 1UOPA 3V3TA 1M8FA 1C9DB 2WHPB 1UKEA 1KAOA 1YB1A 4TTAA 1JU3A 4ENVA 1GILA 2WG0A 2YWRA 2WJPA 3LYUA 4GWGA 4I9GA 4DV3B 1ZIPA 3UT6A 4Q03A 1IWOA 2ZR7A 2HA6A 4M9CA 1K88A 1IZZA 1SWVA 1N2HA 4UBMA 3VAAA 2ZJ4A 1E69A 3N8HA 3FNIA 1Z26A 3B3AA 1Y81A 2PD3A 4YP5A 1U28C 4F3YA 1TM1E 4EY6A 2Z83A 3N8NA 5JZ9A 1EGMB 2CFCA 1YJAA 4Y18A 4AI6A 3QF4A 1NTOA 2F2TA 1QIDA 1LBEA 3A27A 2IYXA 1AF7A 1P3JA 3W77A 1I0LA 2NPFA 1DIRA 1RD4A 1Z0DA 2HF9A 5J2UF 1NZJA 1G5TA 1P5ZB 4IOKA 1EP3B 3OWXA 1F17A 5DNAA 3ZHOA 4EJSA 3VC1A 2IEAA 1WD5A 1RXEA 2R6DA 3QEKA 4MRSA 3LYHA 1E1QD 1P44A 4JQYA 4R2JA 3UW1A 5HRUA 3GNSA 4HYEA 3KSBC 2QZ9A 1N6LA 5ALXA 5IKPA 1T5OA 2H7XA 2MSEB 3AP2A 3UH1A 2PVPA 3IXQA 4K6GA 3AHEA 4ICIA 1ADYA 3DMGA 1V2GA 3LRPA 2ZB7A 3HVKA 1DC4A 1Y3IA 3LUBA 4G8BA 4L6CA 1Y8QA 1AKVA 5EINA 1E1CB 4A26A 5FTJA 4BQOA 4DQDA 1XNHA 5KNDH 1IN5A 4PLHA 2R7KA 3FNQA 2JNWA 3PQDA 1LXCA 3PS9A 1N2SA 1C4XA 2ZUWA 2BI7A 5A7GA 2KS6A 2YJTD 3KR1A 3C7AA 3H8JA 4LQLA 2ZI7A 3ENNA 1C9EA 5EZ6B 2R8BA 2RAFA 2TMDA 1EKXA 2VSFA 1BU5A 3V4LA 2TSYB 4YECA 1JFSA 4ZVQA 2R5FA 2H57A 3OESA 2IQIA 1RMQA 2JLWA 4UMFA 3S2FA 1W85B 1MJ5A 5ES3A 9ATCA 3M9WA 3TX6A 1ZA2A 2A57A 2GPNA 3KJXA 4UVEA 1N5DA 2IY9A 4FQ7A 4Q1EA 5D86A 1QRSA 4E09A 1KDRA 3COWA 3DHYA 3KHSA 3L93A 4KWIA 4LXQA 3S2IA 2BMFA 3I0ZA 3QGMA 1GZ7A 1G3QA 3EGWA 3UENA 2CCKA 1CDZA 1RQ2A 2QTBA 2QQGA 4L5JA 5G1OA 3QF7A 5HILA 3HM9A 3AX6A 3F9IA 1TJPB 2FR8A 3OLXA 4J6FA 3LX5A 1A3CA 1E3WA 1P5JA 4OB7A 3VPFA 4CM1A 5DW3A 3UAXA 2J9XB 5B2EA 4RULA 3ZGXA 1J2TA 1U2TA 3N05A 1RQLA 3ZJYA 1GPWB 4XDZA 2XTNA 2EFCB 3VBEA 4EUNA 3MERA 2R87A 3NHJA 4MCAA 3P0IA 2XUJA 1M9NA 2HREA 5F1KA 4QDOA 3H6GA 2C0CA 2GPSA 4UVDA 4BTVA 2PH3A 2ODEA 2IXBA 4II7A 1Z3IX 4TMYA 3REFA 4ZT5A 1FTQA 4DNPA 5A9TA 2PCLA 1OFUX 1G8HA 1JAZA 1KS2A 1MO6A 1B14A 1NMYA 4KBGA 2AH5A 1N77A 4CR8A 3JV7A 3E5NA 3VYRB 1E1MA 2GBLA 4FKMA 5EUBA 1J5EB 1XL0A 2M9MA 5EWMB 1TC2A 2IK8A 3D8TA 2RAVA 3KAKA 4ARZA 2YDYA 5EMLA 1YWGO 1D2GA 1X42A 1XK7A 2PSJA 2QRLA 3JWJA 3HNOA 1MVLA 3PPYA 2OUKA 1P61B 3RYFB 4D44A 2CNWA 2VNHA 3EC2A 4ZXPA 2BV3A 3H5RA 3OPMA 2ZATA 3QXSA 2HU5A 4FMCF 1UZUA 2FFJA 3GBVA 2B4TO 3RR2A 4FNAA 4DCCA 3PNBA 1R9MA 4MKFA 4XIGS 4I1PA 4IJUA 1IYZA 1RYNA 1FP4A 1NI4A 2WTAA 3VRHA 1ODFA 2IV2X 3K73O 5KX5B 3OE4A 2CCJA 3OLYA 5C53B 4QBTA 5G41A 4IIJB 3PRKE 4CW7A 4XD7A 1A7KA 2Q29A 5H1YA 2I8LA 1G20B 3OE7A 4TLEA 5DDIP 5C37A 3L7YA 4C2AA 5KREA 4O4JB 3H2SA 3MIIA 5DM4A 3BH7A 1L7DA 3PICA 4IJKA 4RHEA 2CDBA 2K7FA 3NHPA 1EQAA 3E05A 5A3RA 1CS0A 3WLIA 3RBXA 4RW0A 4D97A 3CVWA 4RHTA 2BUBA 1V6AA 1XEXB 1YC2A 1MG5A 3JARA 3UMSA 1AK2A 2J9FA 1MMFB 1YS6A 3Q9LA 1O77A 4LF7B 1AIPA 4HDAA 4RELA 1KJ9A 2QBYA 2X0FA 1ZIOA 1VFNA 4V1CB 2R84A 3E9RA 1OWOA 4DHEA 1VLHA 3G02A 4WBXC 2P7HA 2GZMA 3WGNA 1I7NA 3KC2A 2P3QA 3NJ8A 4BO9A 1NXOA 3C1UA 3HVJA 3LVRE 5AVJA 3EFEA 3FF4A 4P84A 5ISMA 3LBNA 1S8AA 4RETA 4W9NA 5CX4A 2FEPA 2N3ZA 4ZQBA 2B34A 4HQ6A 5B30A 1E3EA 1SQSA 2IXAA 2XMQA 3D3NA 4Y8VA 5AI4A 2WZQA 3AY0A 2NOAA 2B6NA 1OLSA 2ODBA 2A3RA 4PCUA 4E4TA 1DEXA 3K6RA 3JAKA 1T9GR 3GGOA 4FFWA 2QYHA 2OR3A 3K0KA 4AQYB 3CXUA 1LY1A 1UBKS 2PH1A 4GXQA 2A2ZA 4JOSA 4AJ9A 1UINA 4B6PA 3SFVA 1EP9A 4LWZA 1WUIS 4XGNA 1W2HA 3EARA 5EUCA 4JIMA 2FN4A 1QG6A 1U5BB 1GYPA 2I2AA 2YVUA 5J2UB 1HLPA 3GDFA 3TW8B 3LPAA 4PYQA 5TE9A 2ZR8A 4JNKA 1VRWA 3KV1A 5JQGA 3AZQA 3K5PA 3RSHA 4AS3A 5C4IA 2C3PA 3KDPA 1DQNA 2MSKA 2EFJA 4HLUA 3PHLA 2H2DA 4KGZA 4RA6B 1O7JA 3K6SB 2AQIA 5J2TB 1KYTA 2YJNA 4RQAA 4LGYA 2IIVA 1UJNA 2RK3A 5I5EA 1KI9A 2QPOA 5B36A 5BW4A 3SZMA 4GKJB 3W8NA 1LK7A 1O6ZA 1TUBB 1XMJA 3EMDA 1KZHA 2WQ7A 1THZA 2H4WA 1FSSA 1N0HA 1UPXA 1YU9A 4CIDA 5BN1A 1XZIA 1UPBA 2PGNA 1ZU4A 1XL1A 2M6SA 2VT6A 3EDCA 3MGCA 3MJRA 5FBZA 4HNQA 3ZDRA 1RFGE 1PF7E 2AMLA 2WZDA 2UXCB 4D9JA 3GJ4A 3IRUA 1GQ2A 4RGYA 3AY6A 5FUBA 3NC0C 4AMVA 1BDMA 1E1QA 2C3MA 1CD5A 1VQ1A 4AICA 4A0HA 5I51A 2ZTLA 3IQDB 4KXWA 1P7PA 2GF2A 4FOOA 3U39A 2V3CC 4H3HB 2NU7B 1XEAA 5JAIA 2GBCA 4LTMA 1Q7EA 2VOJA 2NSDA 4RU1A 5I8PA 3U7GA 3WB0A 3SR4A 4QJ4A 4BVHA 4H18A 3PXBA 1I3KA 2BZ1A 2HEGA 3NDJA 3NOOA 5D6NA 1XD8A 5G0WA 1JG3A 3H0EA 2NUAB 3OFND 3ELWA 1D6SA 4Q3KA 4NYIQ 5AHKA 5CG1A 4UFNA 2C7QA 1M2VA 3IUEA 2Y66A 2K87A 3EVAA 1G1MA 1YNOA 3SD7A 3KUXA 3TEJA 4RFLA 2XKKA 1G42A 4CN9A 3K0AA 3FPLA 3V8RA 1ZJWA 4O4LA 4C3VA 3EB9A 5C1IA 1H5NA 1N1MA 2FPKA 1EG7A 3T41A 1L6RA 5EXPA 4ITUA 5ALEA 1PQPA 2BSXA 1GVNB 4EPWA 1QWOA 3LNCA 4OMCA 5K03A 3GDOA 3MRVA 3HJFA 1W36B 1PK7A 2CV2A 1TC1A 2QTMA 3EVFA 4BZQA 5JAMA 3R8FA 4AZVA 4C05A 5BN3A 2JJYA 4E30A 1MFZA 1VHLA 1EFDN 1M2FA 3CCCA 4LTNA 1X7ZA 4F7WA 3IA2A 4ZOLA 1H6BA 4F72A 1ZK4A 1CEXA 2P2SA 2QM8A 2R6ZA 3FRJA 4B3RB 4AC9A 1R8SA 1U9IC 2Z3ZA 1NXTA 1G41A 4G37A 4KXQA 4TS4A 2QN3A