4HFJA

X-ray crystal structure of a double bond reductase from nicotiana tabacum
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
342
structure length
333
Chain Sequence
AEEVSNKQVILKNYVTGYPKESDMEIKNVTIKLKVPEGSNDVVVKNLYLSCDPYMRSRMRKESFAPGSPITGYGVAKVLESGDPKFQKGDLVWGMTGWEEYSIITPLFKIHDKDVPLSYYTGILGMPGMTAYAGFHEVCSPKKGETVFVSAASGAVGQLVGQFAKMLGCYVVGSAGSKEKVDLLKSKFGFDEAFNYKEEQDLSAALKRYFPDGIDIYFENVGGKMLDAVLVNMKLYGRIAVCGMISQYNLEQTEGVHNLFCLITKRIRMEGFLVFDYYHLYPKYLEMVIPQIKAGKVVYVEDVAHGLESAPTALVGLFSGRNIGKQVVMVSRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Allyl alcohol dehydrogenase
publication title Biocatalytic Asymmetric Alkene Reduction: Crystal Structure and Characterization of a Double Bond Reductase fromNicotiana tabacum.
pubmed doi rcsb
source organism Nicotiana tabacum
total genus 109
structure length 333
sequence length 342
chains with identical sequence B
ec nomenclature ec 1.3.1.102: 2-alkenal reductase (NADP(+)).
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF16884 ADH_N_2 N-terminal domain of oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4hfjA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4hfjA01
1HWYA 1MC4A 4FC6A 5A1TA 1ADBA 1EDOA 1YL7A 5K6AC 4J0FA 4DMLA 4ZHSA 4ESOA 4BO8A 4Z9FA 4DIOA 3PJFA 1E3JA 3S2IA 3ROKA 3WYCA 2BF7A 1S7CA 2ZQYA 2NNLD 3GRPA 4GWGA 1R6DA 3OICA 1SEVA 4M8SA 2ZYDA 1E3IA 3FNHA 3PHHA 4D7AA 5EERA 1WDLA 1XEAA 1C14A 2EHDA 4I5EA 2IYOA 3DZIA 4PG4A 4XYEA 1KVTA 2EGGA 1T24A 1T2FA 4WUVA 1XQ6A 4FJ0A 2YW9A 4F3YA 3KSUA 1U3UA 1FDTA 4JQCA 1J5PA 4CMBA 2WDZA 4FFLA 4EITA 1W6UA 3DZJA 5EQFA 2W2KA 4IGEA 1SOWA 4CM8A 1IB6A 3Q2KA 1HL3A 3V1UA 3E1KA 3E48A 1LDGA 2HJSA 4IZHA 1DHRA 4CM4A 3U4DA 3H5RA 3RUIA 3MJTA 2VUUA 1DJNA 3KOUA 2ZTMA 4OYRA 1ZXLA 4QT0A 5JDCC 3GN1A 1JAYA 3G3EA 2GCGA 4AL4A 4Y9DA 2PZLA 3TDKA 2GN4A 1DIHA 1E6EA 1PWZA 2GUGA 2WE8A 3DHYA 4YACA 4TZKA 3ZV5A 1H2BA 4A73A 1O5IA 2P4HX 1UH5A 1PJQA 1DLIA 1KVQA 1Q0QA 1WVGA 1YBAA 2ZJ0A 4FOSA 4NMHA 2IODA 2VRBA 5DOVA 3IDSA 4E3ZA 1ZEJA 4E5PA 4BNLA 3AOEC 3LC1O 2Y93A 3KETA 1CIVA 4XA8A 1UXHA 1S6YA 4XWYA 1LDMA 1IY8A 3JQFA 4EJ6A 1I36A 4XR9A 1RM5A 3WMXA 4NJMA 1F0YA 3TZQA 4ALMA 1VSVA 1C0KA 2WYWA 3AUUA 1SZJG 1AXEA 5C3MA 2W2KB 4IDDA 4CM8B 3EZYA 1U3WA 3GFGA 4D0RA 5KTKA 1PTJA 3FTPA 3TFQA 1DO8A 1QYWA 3CXRA 4BNYA 4KWHA 4BGUA 1GEEA 3RKRA 4WLEA 4CM4B 3CINA 4UAGA 2VZ9A 3BMNA 4GGPA 3GEDA 3DBVO 4FFOA 4LRTB 4CLRA 1M2WA 1DDOA 1YOVA 4S1VA 2OL4A 3SEFA 1LUAA 1UXIA 2AQKA 3C1TA 1LRKA 3ITKA 3FPLA 2BD0A 2DUUA 2J5QA 2Y0DA 4NFHA 4MO2A 5KCZA 1ZH8A 4NIMA 1O8CA 1I32A 4ZICA 3W4IA 4D45A 2DFVA 2IZ0A 5KJ6A 3Q2IA 1GU7A 4FOOA 4NJMB 3I9MA 4FN4A 1E3SA 3QA9A 4B4WA 3TZKA 1YWGO 5JY6A 1CYDA 4XYGA 4P4NA 4ND3A 1ISGA 3FHLA 2YV2A 4XB2A 1YDWA 4DTIA 4DGSA 4YAIA 3CIFA 3PQFA 4FJ1A 4TRMA 5HS4A 4A5OA 3VC7A 5F21A 1Q7CA 3NUGA 3PPIA 4L4RA 2VYNA 1VL8A 2UV8A 4BO3A 3BMNB 1A72A 3QHAA 5BQFA 1YQDA 1PWXA 4J16A 4B4VA 4I9NA 2WM3A 4CLRB 3DC2A 1YOVB 2AQHA 7MDHA 2PGJA 2DLDA 1NPDA 1ADFA 3ETEA 4CQLA 1TT7A 3ANMA 2P9GA 1JQBA 2YJZA 4AVYA 1H9BA 5BSHA 4R54A 2VQ3A 3P2OA 4PVCA 1G0OA 1O6ZA 2Q99A 3M1AA 2PKQO 3WYBA 1OC4A 1LDNA 1NQAO 3KSZO 4PLFA 5JAIA 5L53A 2EW2A 1N8KA 3ZWOA 3WWZA 2WYUA 3P19A 1IL0A 1XA0A 2UUPA 1H94A 3O8QA 4RCVA 3GN2A 4BO4A 3QWHA 4TSKA 3ABIA 2Y05A 3BHIA 2BH9A 1QKIA 5DZSA 4YWJA 3T7EA 5FI5A 2BFOA 4JNKA 3AK4A 2Y1GA 1EQUA 3H9UA 3GG2A 5JDIA 3ZWXA 3NKLA 3I9JA 2ZKLA 5L4NA 2BI7A 2R00A 4B3JA 2I6TA 4RPJA 3B70A 3COSA 4MINA 4UEOA 2EGHA 1DC4A 2H9IA 2C7GA 4N5NA 4Z3DA 1BMDA 5DF1A 4AJLA 3DOOA 1IHXA 2FR8A 4RJTA 2Y1EA 5AQ1A 2QIOA 2CFCA 2I9PA 1X7GA 1DC3A 3KV3O 1TA4A 3WFJA 2HUNA 1XGKA 3FRJA 5JMWA 3KHUA 4XR4A 4GVXA 3D3WA 4BKUA 1A4UA 1JAXA 3O8QB 4W99A 4K26A 2ZB8A 1ZIDA 4CMAA 4NG5A 3ONEA 4KUHA 4N5LA 3RU7A 4E12A 4PGFA 5TSDA 1HXHA 1LBEA 3VPHA 2HMSA 1L7EA 4H3VA 4L4SA 4ALJA 5IDQA 4DYVA 1M75A 5C7IO 4YXFA 1YL5A 3PVZA 4JP3A 1QSGA 3KUXA 2UVDA 3JSAA 4I5FA 2Z1MA 4J1NA 4JGBA 3DZFA 3MEQA 3ZW8A 3OEYA 2J3JA 1Y9EA 2FR0A 4J90A 5JCJA 1E7RA 2V65A 3D5QA 4YT4A 3WYEA 1YS4A 2A35A 1EUDA 2C59A 3LLSA 3AY7A 4DC1A 5ER6A 4ZVVA 3R6DA 3F47A 4XEHA 4JX8A 4L9RA 2J3HA 4GQAA 5JXWA 3KB6A 3ZDFA 4BIIA 3QW2A 1VL0A 2IEBA 3WTBA 4BNIA 4U8GA 3ZNOA 3L6OO 2P68A 4FIZA 4CMJA 3ZHZA 1BXGA 1PGOA 1BXKA 3JQ8A 3PJEA 1Q7BA 2X23A 5CG1A 3D3WB 4D42A 3SX2A 2VOJA 1KVRA 4OKIA 2VHZA 4GH5A 1NM5A 4E5KA 3K73O 4BKPA 3DBLA 3V2HA 3OF2A 4OO3A 5CDGA 3ANLA 1JKFA 1HDXA 1GZ4A 2ILTA 2NTJA 4YTEA 1SB9A 3Q9UA 2DUWA 3U5TA 4BQPA 1NWHA 3RUCA 5JSFA 3CZMA 3LC7O 1MP0A 4GMFA 4JJGA 4B8ZA 4UVEA 1F06A 2FP4A 4MP3A 1SEPA 4YAGA 2VYND 1H9AA 1EMDA 4PLPA 1EK5A 4EGFA 3BZUA 3UKOA 2O2YA 3QV1A 2GZ2A 4NBRA 2HJRA 2I76A 1YGYA 4IPTA 3BMQA 3N74A 4EUFA 4WGGA 5A9TA 3PTZA 1VJ1A 3BTVA 2BHLA 1BXGB 1GQYA 1ISJA 3JQ8B 1R66A 1V9LA 4IM7A 3I9LA 3I6IA 5A05A 5TS3A 1ULSA 2B5VA 3W6ZA 1OAAA 5CG2A 2X5JO 4NFYA 5DBIA 1NNUA 1GADO 3WDSA 3OA2A 1EFLA 3V2GA 3RUHA 4OH1A 3RFXA 1JWBB 1VJTA 2FMUA 5IN4A 3WMWA 1B8UA 1VRWA 3PFFA 3OMLA 3DB2A 4L8VA 1W8DA 3GZ4A 3TNLA 1A9YA 5GZ6A 2C7VA 3CPSA 1NPTO 3UGKA 3VKUA 3HSKA 1ZCJA 2E82A 5IXSA 4Q3AA 2Y99A 2VZ8A 2HSDA 5TT1A 1F8GA 1MV8A 2I65A 3L4SO 1SAYA 3HUDA 4C7JA 5IDYA 1DIRA 5KKAA 1GD1O 5B4UA 4WECA 4F6LA 1T1SA 5F1KA 1ZJYA 3DONA 2FY8A 2AEFA 1IPFA 1PR9A 2FRDA 1QYDA 4GL4A 3G0OA 4CMIB 1FDUA 3JYOA 2DM6A 2QRKA 1O9BA 4QECA 1A71A 2C2XA 4B4OA 3B1FA 3S1LA 3VPFA 3PYMA 1SO8A 2FWMX 1HE4A 5LCXA 4M1QA 2GO1A 4RZHA 3EAGA 5A9SA 1ZO8A 3OSUA 3IKTA 1B15A 1MFZA 4KDEA 3IP3A 3TRIA 5EIOA 4TROA 4PZCA 3WSWA 5JCJD 5IJZA 4JJIA 4KTVE 4BQRA 3PQDA 4IDEA 2EF1A 3DHNA 3DBRB 5TIIA 1EVJA 1V35A 2DT5A 3JCZA 1N9GA 4KOAA 3WGQA 1E5QA 5MDHA 3F1LA 3BXXA 1FF9A 3BHMA 4M89A 1UAYA 2BGKA 3NYWA 2Q2VA 4GSKA 2PLAA 2XOXA 3D7LA 3JQFC 5DOZA 5JNLA 1UXGA 4GBJA 5H83A 3WIDA 1PJ3A 5CDUA 1TT5A 3NX4A 1RYDA 4MVJH 5ITWA 4CUZA 1PQPA 1BTOA 3I4CA 1Y1PA 3I9KA 4B8WA 2PFGA 4R1TA 2Q2QA 1X1EA 4GKVA 1GV1A 2Q4BA 4BNJA 5CDTA 3ZWMA 3JQBA 5HRUA 3ENNA 1I30A 5A9SB 4PRLA 2A92A 3DFZA 1CDOA 1UDAA 4DPLA 2VT2A 4PFJA 1NHWA 4NFSA 3JYNA 1A9ZA 3GGOA 1QRRA 4DPKA 1I24A 1VLLA 1LA2A 3OJOA 4QEDA 4D3SA 1H5QA 1NVMB 1HLPA 1ULUA 4R01A 4DYDA 2PA3A 2FPGA 3GUCA 1IPEA 1N9GB 3CTMA 3KZVA 2RHRA 3M2PA 4XRGA 5JW6A 3EGOA 3U49A 1LU9A 3HN2A 3RUEA 3INGA 4IS3A 1GV0A 1QLHA 2IZ1A 4WASA 4I5GA 3F5SA 3RIHA 1IUKA 1WW8A 2NWQA 1TT5B 3JD2A 3K31A 2JJYA 1T4DA 4QO7A 5IZCC 3VZQA 4D43A 3I83A 1SNYA 1MC5A 4YYZA 1NQTA 3R0IA 5B1YA 1SPXA 3PGJA 4IJKA 3WJ7A 1LEHA 4Q3NA 4HFRA 2G0TA 4R3WA 1WDMA 1GPDG 5JLAA 2VUSA 1EVIA 2W98A 2OFPA 1UXKA 5JC1A 1ZKMA 4FGSA 2V6FA 1L1FA 4E33A 3L77A 5L4SA 2GZ3A 4JJFA 1EVYA 3ZH2A 1SMKA 3NDRA 4ND4A 2X9NA 4OL9A 5G4KA 1RJWA 5ES3A 1H6AA 5J23A 3L07A 1AN9A 2JCXA 4XYBA 1DB3A 2QHXA 4TWRA 1PQWA 1QMGA 4UUPA 2P4QA 3A14A 5DDIP 1XSEA 4ITUA 5BNIA 5JYEA 2I3GA 1B8PA 3QWBA 1GL3A 4HV4A 5ICSA 2AMFA 4IQ0A 2Y68A 3WIEA 1P0CA 4Z0PA 1UP4A 1U8XX 1X1TA 1WDKA 4H16A 1YVEI 2PH3A 1JDJA 3PHJA 1DIAA 5DULA 4RPHA 5TF4A 2DTDA 3TL2A 4AJPA 5JDIC 1P1KA 1JA9A 2HDHA 3ETDA 3G1UA 4YQYA 5KWEA 3S55A 2R00C 4O5OA 5B12A 1QYXA 4B79A 1IOLA 2EIHA 3AFMA 3EHEA 4PLZA 5CPFA 4N7RA 1YO6A 4BMSA 5JAMA 4CM6A 3JV7A 5A5EA 3ONFA 2X58A 1M76A 2IEDA 4X54A 2WTBA 1K5HA 3OM9A 3JTMA 1B16A 1I01A 4GSLA 4JIGA 4S3MA 4XGKA 4XIJA 1ZMTA 3E6AA 3SXPA 4XDZA 4XZ3A 4ZQBA 5ENVA 4FW8A 3GHHA 3ZWCA 1WZIA 1X14A 2B36A 2I99A 4WLFA 3UHAA 1SBYA 4PLTA 5JAQA 4MP8A 3CE6A 3U9LA 4J2HA 1ZEMA 4O0LA 2JD2A 5DCYA 2C5EA 4OM8A 4IDCA 2JD1A 1VE9A 2FZEA 5CEFA 5HM8A 3V8BA 1K6XA 4IXTA 2E48A 4WNIA 4BHTA 1GTMA 2YFHA 3I9OA 1U2GA 2EJWA 3RC1A 2ZTUA 3TSCA 5I7FA 1Z45A 5G0UA 3QWAA 3B6ZA 4K1LA 4EBFA 1XQ1A 4LVUA 2EP5A 4TKLA 1GCOA 4ZQFA 3NAQA 4PLWA 1PL8A 4R3NA 3GAZA 2Q46A 4Z9YA 2RH8A 1EEHA 4M54A 3D5TA 4E21A 2PKRA 3DZGA 4EYEA 3F4LA 3QVXA 4HBGA 2GGSA 4UEJA 5I9LA 5KVCA 3PFWO 3ZHXA 3ZU5A 3PYLA 3RCBA 4PG6A 4F6CA 1XLTA 2DPHA 1M67A 3OA0A 5L95A 1I2ZA 4YAEA 1PGPA 3ZWBA 3H4VA 1ZFNA 4N5MA 5AOVA 4DL9A 4FR5A 2O3RA 3F6YA 3ZU2A 4EEXA 1GYRA 4CQMA 5ITVA 4AICA 1LTHR 1D4FA 1DRWA 3MZ0A 4EW6A 1Q7GA 3T4XA 4GI2A 3N7UA 3OJ0A 1WWKA 3HN7A 5AXAA 3WWYA 4GKBA 2VUTA 3VZRA 4PRKA 3N58A 5EESA 3K5PA 3PWSA 1J49A 1JU9A 3VOSA 3GEMA 1PJBA 4MVJF 2ZCVA 3P7MA 4DLLA 3AY6A 3JQDA 1SC6A 2DU8A 3B1KA 5L4LA 4BB5A 1KEWA 3C7DB 4UVGA 1B0AA 3UCEA 4PLGA 3GFBA 1QR6A 2HKIA 3GC6A 1UP6A 3KVOA 5TJ9A 5C37A 4C7KA 2G1UA 3F1KA 4BV9A 4P4GA 5COBA 3GUYA 2WSBA 3P2YA 1KC1A 1WNTA 2VWHA 2WWRA 4XD2A 2OP1A 3GGPA 4YT5A 3KSDO 3ZN2A 1LJ8A 1QG6A 2WJPA 1TEHA 4UREA 3HNPA 1T25A 4J9VA 4CQMB 4D79A 1LLUA 4FS3A 1HDOA 3FF4A 4AJEA 1K6IA 4ZN6A 1UR5A 3EMKA 5TLSA 1Y81A 3L4BA 4L0QA 4HFMA 1C0PA 1HYGA 2B4RO 3G79A 3PDUA 5L40A 1JKJA 3ASUA 2ZATA 1MX3A 4AJNA 4CMKA 5CDYA 1V8BA 3ONDA 3E82A 2G5CA 2ZQZA 4IJWA 5ER9A 4TMFA 4DPMA 3BTOA 1H93A 2OHXA 1DAOA 3D64A 4TVBA 4LISA 2C2YA 1IE3A 1HETA 1EDZA 4E30A 4IIUA 5IFLA 1N1EA 2PGLA 3SC6A 3OJLA 3AUAA 3Q9NA 1A5ZA 2VNSA 3WGIA 1E77A 4YAJA 4CR8A 4NI5A 2O4UX 3H2SA 3PDJA 2I3AA 3BA1A 4RVGA 3AY3A 4M87A 5FFFA 1VJ0A 1HDGO 1I8TA 3QVSA 2W2LA 2OGUA 3KEQA 5IN5A 1LQUA 2BELA 4RVDA 3WR5A 3LF2A 3C7CB 3PYXA 5DNAA 2NVWA 3C7AA 2X0NA 3UAGA 3T7CA 1N1GA 2B4QA 4J3FA 4GLLA 4F46A 1Y5RA 1NAHA 3E5MA 5JY1A 3BAZA 1PIWA 1P9LA 2EERA 3MWEB 3JD4A 4BOYA 2PD3A 4D46A 1DC6A 2IRWA 4ONEA 2O7QA 4LK3A 2YUTA 4R16A 3I6QA 4XDYA 4XYMA 3L9WA 3MJVA 4NBUA 2DBQA 2E4AA 4YRAA 4OOFA 5COAA 2BFAA 4CR7A 4FFRA 2Z5LA 2I5PO 3ROMA 2Y66A 3GVPA 2HMUA 3GEGA 1PGNA 4GX2A 2HQ1A 3JYLA 2VYVA 5TJHA 2QQ5A 2HMTA 3IJPA 1H6DA 2C0CA 2X5KO 2GD1O 3K2BA 3LT4A 4YJDA 1CQJA 1E3LA 1PSDA 3OHSX 2YDYA 2GYYA 3VKVA 4Z3KA 5I9NA 3OJFA 4CV0A 5GY7A 5L3ZA 4CQMD 2BRUA 1ZNQO 4J7UA 2A4KA 4A7PA 2WYVA 4IBOA 1C1XA 1E1MA 2BI8A 3CEAA 3EDMA 4UUOA 4OQYA 1E92A 2EWMA 3TQHA 4WE3A 5TGDA 4GPD1 1Y7TA 4YPOA 3HJAA 1ZMOA 5ADHA 1N7GA 3LC2O 1DPGA 3OIDA 3S2EA 3H9JA 1D8AA 1GCUA 4XJTA 4CLHA 1X13A 4BO2A 2D5AA 5JE8A 4MKRA 4KUEA 2IXAA 1TLTA 4FFPA 4OKNA 4Q3DA 4QTZA 3IKVA 3VVBA 4PN3A 1FK8A 1YKFA 3IL2A 3ZWVA 2X0IA 3IMFA 1E7MA 1W0CA 4OXKA 4L4XA 3R3SA 3VPXA 4WJZA 2NVBA 3WGHA 3DQPA 2X0RA 1T2CA 3ITDA 3WJAA 4F45A 1JW9B 2CZCA 2VCYA 3WFIA 2YQ5A 1R0KA 3D3EA 4WCDA 1ZW1A 2O23A 1C1XB 4HY3A 3PZBA 3WGOA 3Q1LA 1EUCA 4HADA 4JP2A 4HFJA 1VKOA 4II2A 4BNXA 4RVUA 3KLMX 2AXQA 4WPGA 3DEYX 3JD1A 3JQ9A 3GVIA 4HNGA 3U3XA 4O63O 4TRNA 5F5LA 3GDGA 4A03A 2CDCA 2OO5A 3AUSA 1GZ6A 4AJ2A 4GX5A 3WQQA 1R4NA 3W8DA 5JBIA 1XU7A 4CM9A 4D0SA 4GMGA 5THQA 3UVEA 4PCVA 3ZWAA 1U3TA 2GF2A 1NR1A 3ZWYA 3WGGA 1N2SA 4OOEA 1LXCA 2UYYA 2BLLA 1JN0A 2B4TO 4BO0A 1ZUD1 2ZTVA 4E4YA 4W4TA 2JHGA 3E5RA 4OGWA 1ZBQA 3HWRA 3WICA 4ND2A 1YBVA 4FCCA 4O6VA 1ONNA 4FFNA 2W2LD 3ZGYA 4BO1A 4R68A 4CUJA 6LDHA 3OETA 3S2FA 4XJSA 4MKXA 3RC7A 1TXGA 1VSUA 3U62A 4IDBA 4K28A 4E2YA 4TKMA 3HDJA 1B8VA 5L7YA 1E3WA 1GUZA 2H5LA 2W8ZA 1H6BA 2NSDA 2FZWA 2E49A 2PH5A 3H5NA 1BDBA 4HXYA 3H9QA 3DMTC 1NVGA 1R4NB 3MWDB 5AYVA 2RH4A 4M86A 3QWFA 1ENYA 3FBGA 4UUMA 5T57A 5IF3A 3HG7A 3I1JA 4IUYA 4RDHA 4WCFC 3WG9A 3LQFA 4CL3A 2GNAA 1VKNA 3VZSA 1VC2A 4INAA 4W82A 4DXHA 2G76A 3PXXA 2EKLA 4IQGA 5KJFA 5B37A 4MP6A 3IP1A 4JBHA 2O7SA 3L9XA 2X9VA 3CH6A 2V6MA 2VYVD 1LQTA 3QRWA 4BKOA 2H63A 1XYGA 5AVOA 1NXQA 1V3VA 1YJ8A 5KVVA 3X2FA 1LLDA 1ENOA 4FJ2A 3UFXA 5KIAA 4FSHA 4YBZA 2D0IA 1JTVA 4U0JA 3CZRA 3E8XA 1KVSA 1LRJA 3P5SA 2V6BA 1PJTA 5BSEA 1PX0A 1E3WB 3NJ8A 4W6ZA 4BNFA 1KC3A 2VT3A 1PS9A 1R4MA 4CMEA 2BMAA 3O9ZA 2O3TA 3UH1A 1BVUA 4UVIA 3U4CA 3PLNA 3RSHA 3L6DA 3SLGA 1WXDA 4RQTA 1GYQA 2DBZA 2B35A 1FDSA 3TN7A 1O94A 3OIFA 3RI3A 1BW9A 2G17A 3I3OA 1KIFA 2B0JA 3INRA 2EG9A 1VI2A 2X0JA 3WLFA 3JQ6A 4B3IA 1YB1A 1K3TA 1P33A 5G0TA 1MFPA 4RF5A 3WTCA 3I52A 3FD8A 2NM0A 4J1TA 5H81A 4YJFA 2QYSA 4XGNA 3EW7A 3RKUA 1E1NA 4JK3A 4YVFA 4W9NA 3V1TC 3GVCA 3BMCA 4O59O 4CMIA 4HWKA 3CSDA 2QRLA 1Q0HA 3ON5A 3DR3A 3NDIA 3V2UA 4XQEA 1B14A 3DZBA 1F17A 3MOGA 4E5MA 5KOIA 4I5DA 1R4MB 4ZU3A 5U1PA 4BO9A 4CMHA 1A7AA 2HAEA 1GUFA 4JCOA 2TMDA 2GERA 2F00A 4PZDA 5KJCA 1GYPA 1UDCA 1VM6A 3ROPA 1ADCA 2NVUA 2PZJA 3K30A 1X0XA 1Y5MA 3WBFA 5K6AA 4LW8A 2O48X 3BHJA 2VN8A 4CM9D 3KYDA 4CMCA 1BW9B 3NTOA 3F4BA 3GZNB 3DBRA 3AI2A 1Y9AA 1FJHA 1LSSA 4WOJA 5DBFA 3ZU4A 5L7TA 3AM3A 4HNHA 5BSGA 2DQ4A 4YJFB 2ET6A 3NV9A 3DXFA 3ANNA 1ISMA 3I5MA 3L4BC 5TX7A 1EZ4A 1BVRA 1GEGA 4WLVA 1EFKA 3VDQA 1KY4A 3BMCB 4QFCA 3ZU3A 3FPCA 1JVSA 1KYQA 3NJ4A 1BSVA 3WB9A 1K2WA 4CV2A 2X9GA 4URFA 1ID1A 2EKQA 3H9GA 1R0SA 4YJHA 4BGVA 1E1KA 1LLQA 3Q0EA 3EVTA 2X7HA 3FR7A 4I8XA 3V5NA 3ZV3A 2VWPA 3WNQA 1NQ5A 3G17A 2NVUB 3WGYA 1U4OA 3GAFA 4MIEA 1X0VA 2C20A 4IDGA 4AJJA 1VL6A 3QJ5A 1ZK2A 3GT0A 1NVTA 1N92A 2B83A 1KOLA 3KYDB 1QXSA 4WLNA 3RD5A 5JDCA 1AXGA 4RDIA 4AJIA 1X7HA 3EK2A 3FI9A 2Y1FA 2O50A 5L45A 4QX6A 4OJNA 2AG5A 4PG7A 1RKXA 4CLXA 4Y8VA 2R2GA 3GDOA 2AQIA 1GQQA 2YHUA 2OBNA 3GF4A 4GLOA 1XIVA 2JKVA 3K92A 4A27A 5G0VA 1HKUA 1ZK1A 1PZFA 2CDBA 1SOVA 3PIIA 4RQUA 3X2EA 5JC8A 3JYPA 2DC1A 3AOEA 3KTDA 4IDAA 5EJ2A 2X5OA 4J0EA 1P1JA 2C82A 3GVHA 9LDTA 2XPCA 1J6UA 3E18A 1ENPA 1QP8A 4YJHB 2WEKA 2E6UX 4MVJE 3DWFA 4U6QA 3NDJA 4D3DA 3MTGA 4RVHA 2GSDA 4NZ9A 3K96A 2P91A 3FWNA 1DIBA 1MG0A 4PLYA 2ZCUA 3WGTA 8ADHA 3GY0A 4WLUA 2GN8A 4PLCA 4B7UA 2W4QA 2VRCD 2AA3A 3QWIA 1PZHA 4RV9A 5DT9A 4FGWA 1NQOA 3PJDA 3D4PA 5BR7A 1W4ZA 4P8RA 5T67A 2O3QA 5A04A 5HBRA 4E2ZA 1DFHA 3PGXA 4NPCA 5K0ZA 3LU1A 5ENDA 2NU7A 3RU9A 2VZ0A 3F5QA 1NASA 2FPPA 1M66A 4DMMA 2O2SA 1PJLA 5A02A 4O1MA 3ENKA 4J49A 4XGIA 4ALIA 1HEUA 3HFGA 2V7PA 4W7HA 1C3VA 1HE5A 3GOHA 3MJSA 1H0KA 3GA0A 3TF5A 4I1IA 3HDHA 5DP1A 2ZB4A 3JQAA 3PHIA 3SBOA 3HZZA 4ALLA 2NQTA 1R37A 3GHYA 2IDZA 3NT2A 1R16A 3K8ZA 2DVMA 4R9RA 4Z6KA 2BGLA 3LT1A 3RWBA 3M6IA 4ZQEA 1L7DA 3U4IA 2QX7A 2W90A 4EDFA 3AI3A 2Q1SA 4J1QA 3RBZA 4BNKA 3PHGA 4K9DA 1DAPA 1XELA 3VTFA 3RVDA 3TPCA 4JROA 3GH3A 1Q2XA 2YHIA 3AU9A 4HFNA 4K6FA 3WS7A 1E7SA 3GRKA 4LMRA 1XDWA 1XKQA 3UCXA 3D0OA 1GZ3A 3DTTA 5KVQA 3ZNNA 3MJCA 2GZ1A 2AHRA 1EK6A 4J4BA 3RJ9A 2FHSA 3M2TA 4ILKA 4B4UA 1PL7A 3OBBA 2PKQP 3F9IA 5CPBA 4EUEA 3UN1A 3DMYA 3KM0A 3JQ9C 3FNEA 1GFSA 4XRRA 4R9SA 2NTNA 4C4OA 1OFGA 1T2AA 3JQAB 1RM3A 2LDBA 1E3EA 5G2OA 1Z73A 3BTSA 2HK7A 1LC3A 3CMMA 3GNTA 3H6KA 1HDCA 2JAHA 1HRDA 1P45A 1D3AA 2AE1A 1HDRA 3O03A 2FR1A 4KQXA 2I66A 5JCXA 4IZIA 4XCVA 1PR3A 2BFPA 4UVHA 2YHIB 3V1YA 3TOZA 1BWSA 1PL6A 1X7DA 4LSWA 1IZ0A 3GDFA 1HDZA 4AJ4A 4RPLA 1P1HA 4BMNA 4L74A 1I2BA 1M6HA 3DAGA 3DDNA 5CHEA 4MVJI 3VTZA 3OQBA 4CM1A 3ICPA 1ZXBA 2EJVA 3WGZA 1IYZA 2EEZA 1FXSA 3RROA 3NTQA 5GZ3A 1DFIA 1Z7BA 4RO0A 4UVDA 2HO5A 4E6PA 4E2XA 1ONPA 1V3UA 3UXYA 9LDBA 4JBGA 1NAIA 2YV1A 1C0IA 1I3LA 3D1LA 2FN7A 1GPJA 1YB5A 4BNTA 2VHXA 1UP7A 4IY1A 4TQGA 2X86A 2P5YA 5TNXA 3C1AA 2EV9A 4Q3EA 3ZNQA 1ADGA 4Q9NA 3WBBA 2PTGA 2C29D 1E7QA 2GLXA 2D8AA 4BNUA 4RZIA 1E6UA 4IXWA 4HUJA 3FBTA 5T6BA 1IULA 4E0BA 5A06A 4E31A 2AEMA 1ARZA 3KRTA 1F8FA 4D3FA 4ROSA 3DHEA 5A4DA 2E37A 3WXBA 1DSSG 1J0XO 4ZRMA 3TFOA 2HMVA 4GVLA 5I8WA 4ZRNA 5AXBA 2QRJA 3EUWA 1MA0A 2C5AA 2FOIA 2GPTA 4NBTA 4QO8A 3LSYA 4NNJA 1NHGA 3NGLA 1ENZA 5DCUA 5CAEA 3PIDA 3E9QA 1DBVO 2PY6A 4RVSA 1T2EA 3EY4A 4PIVA 1I3KA 2AQ8A 3JQAD 4Z0TA 4IIVA 2OXIA 4OSOA 2QYTA 3RUAA 4JLWA 5A9RA 3DAFA 4WEQA 2Q1TA 5T8KA 3KYBA 3QVOA 2I67A 5JO0A 2YFQA 2D5CA 2RAFA 4CJXA 4U5QA 1YDEA 4CLDA 1W73A 5A03A 2F1KA 2Z95A 3MCVA 1BRMA 1O0SA 3NRCA 3HADA 4BO6A 1MXFA 4BKRA 1LC0A 2YQ4A 1OMOA 4MVJG 5HA5A 3WSVA 4IQ8A 4BL5A 4CLEA 4J4HA 5FWNA 1XWFA 2XAAA 4FC7A 4WOKA 3OEWA 5DBGA 1EQ2A 4R1SA 2CVQA 2Y1OA 3PZRA 1SB8A 3RFTA 5JAZA 2FPIA 5I7SA 1N7HA 5TT0A 3G49A 2PV7A 4BS9A 1ORRA 4Y67A 1WMAA 1C1DB 4M49A 4KWIA 1DHTA 4ND5A 3GG9A 1NFFA 3H3JA 4I9HA 4DBZA 4XYLA 4YT2A 3HDQA 4BKQA 2EKPA 4KUGA 5EPOA 3TOXA 4YJGA 4BO7A 3ICCA 1LLCA 1DC5A 3C1OA 4RGBA 1LDEA 3VPSA 2D4AA 2Z1NA 3ORFA 3JQEA 4E32A 3JYQA 1PJCA 4PLVA 5I9MA 5HS6A 3QIVA 2BGMA 3BMOB 3FWZA 4J1SA 1RWBA 3LK7A 5IZ4A 3ZV4A 5IXYA 1DRVA 1CQIA 4GX0A 5CDSA 2IXBA 4IGFA 2JFHA 4TVOA 8LDHA 2NACA 4EJ0A 3ZNPA 2BKAA 1PU2A 2Y1DA 3VAZA 3KO8A 1CF2O 4Y6SA 1B26A 3SJUA 4MDHA 4XQ9A 3HE3A 1T4BA 4J9UE 1RYEA 3JQGA 4DIFA 5C7LO 1NR7A 3RJ5A 2B37A 3Q6IA 5C5IA 1U2DA 4E13A 2PD4A 3O38A 4YJGB 4XIYA 1KERA 1P31A 1ISFA 2H1SA 4KQWA 4DA9A 4XKJA 3NTRA 3OJEA 3H8VA 1C0LA 4N54A 4NQZA 3QQPA 1DIGA 3NGXA 2GDZA 5A3VA 3AI1A 2YV3A 3IUSA 4JXKA 1PZEA 5L7WA 3MOIA 3OFSA 3W4KA 1ZSNA 1RM0A 1WZEA 2ZJ1A 1O95A 1I10A 5F3RA 1B3RA 5ILGA 2JAPA 4YT8A 1AE1A 1P1IA 5A3JA 3HB5X 5LC1A 3JQBC 1ZJZA 2JL1A 5F1OA 4MPDA 3RAJA 2PNFA 3JQGB 5F5NA 2IYPA 5DN9A 5THKA 3ZWPA 2B5WA 1JKIA 1G1AA 3AJRA 1V0JA 1VPDA 4RF2A 1XHLA 5I7VA 3NT4A 4TRJA 3DBHA 2XXJA 3TZHA 4AG3A 5H82A 3FSRA 5JMPA 3IIEA 4R5HA 2B69A 3BIOA 3CUKA 4BGIA 3PLRA 4LVCA 4RF4A 4DQVA 1YRLA 2IE0A 1Y8QA 2RCYA 3VHRA 2GRAA 4BMVA 5JYDA 4HKTA 5K1SA 2CF6A 2YY7A 4DC0A 4NHEA 2CF5A 2DTEA 1YL6A 2PZKA 4RVFA 2NV6A 5COQA 5T5QA 4DRYA 1NTOA 1NX6A 4FQ8A 4H15A 3FTNA 1MUUA 3VH1A 4ZA2A 2YDXA 3ZHBA 1GR0A 1YBMA 4IS2A 2OOSA 4QUKA 4CLOA 4PLHA 3LT0A 3LT2A 2PD6A 3WX0A 4R51A 5IZCA 4ALNA 3MTJA 2D3TA 4A26A 3K9QO 2SCUA 1HE2A 2RBEA 3UUWA 2CDAA 1IZ9A 4KTTE 2QW8A 3GLQA 1WAMA 3SJ7A 3AW9A 4MVJP 5C7OO 3O4RA 3RC2A 3UOGA 1DOHA 3JD3A 3AU8A 1KEUA 4LMPA 1YQXA 3DBHB 4CPDA 3HFSA 3C24A 3EYWA 3R1IA 1Q1NA 3PWZA 4R69A 5JS6A 4QFDA 2VHYA 4OSPA 1U7HA 4E5YA 1Z82A 3CKYA 3GPIA 1U5CA 4IJUA 4ZQGA 1T26A 5EQDA 2OORA 3LLVA 1Y8QB 4U6SA 2O4CA 3QVTA 1E5LA 4CV1A 4PZEA 1Y8RA 4WEOA 2POQX 3A9WA 4KDFA 1A7KA 1KEPA 3AFNA 4EUHA 2XF8A 5JFOA 2UDPA 1UDBA 3E9NA 2NQ8A 5CEJA 1ZK0A 5DP2A 3T4EA 3I4FA 3PI7A 4J91A 4LSMA 4CLOB 3U0BA 5KJ1A 2CVZA 3W1VA 5DCWA 2BFMA 4CV3A 3H5AA 3VH2A 3OIGA 4GGOA 1EUZA 4Z9XA 2HCTA 1HDYA 5T64A 3GMDA 3WQSB 1YJQA 4FB5A 4TZTA 4DIBA 3FCOA 4B7XA 4TRRA 4BGEA 2JFFA 1PEDA 2OBYA 2Q2WA 4K6CA 5G0SA 3PRJA 4OIMA 1CERA 1P3DA 1IHYA 3U4HA 3VH3A 1EVZA 1J4AA 4MIOA 2QG4A 3I9NA 3PQEA 3OP4A 1E0DA 4CQLB 3LZ6A 3LYLA 3DAPA 4FFMA 5IDWA 4CM3A 2C07A 2GASA 2WD8A 5HWSA 3GQVA 4J7CA 4OAQA 4DREA 1Y8RB 4P38A 4EI2A 3WNVA 5FYDA 3E9MA 2G82A 3VH4A 2AE2A 1LRLA 4YEDA 1B3BA 3STHA 1LDBA 4RORA 1X15A 4BNWA 3DFUA 3HQ4O 4Q3CA 4EEZA 4FD3A 3LVFO 1R0LA 4R4JA 1R15A 3RBXA 4DUPA 2D1YA 4L76A 1UZNA 3QY9A 2X4GA 3QVWA 3RC9A 1NPYA 2DAPA 4J2OA 4BB6A 2NU8A 3F3SA 3RQSA 2Q4EA 4IMPA 2X8LA 1YE3A 1DRUA 1U1IA 1U7TA 1I0ZA 1YXMA 2HLPA 3H2ZA 3ZHYA 3IAHA 3KXDA 4E2WA 5GMOA 3ADOA 2X22A 4LRSB 1Z7EA 5BSFA 1XR3A 5FEUA 2EXXA 4QQRA 2EP7A 3H65A 3GNQA 4FDAA 4WLOA 4MVJA 2DKNA 1F14A 1WLYA 1FDWA 4N18A 5ICMA 2VRCA 3ZWWA 2AG8A 2Y67A 1U3VA 1PGQA 1U4SA 3AOGA 1HZJA 4G5HA 1FMCA 1YH3A 4CUKA 1HZZA 1AGNA 1UAGA 1A27A 3CMCO 4ND1A 1SCUA 3GZNA 3LDHA 2J3IA 4YRBA 1UZLA 4XQCA 4CODB 1G6KA 4DLBA 3OQ1A 2HU2A 3W8FA 1R12A 3JQ7A 2OZPA 4IMRA 2VTEA 1CRWG 2J5RA 2JD0A 2Q49A 2CSUA 2DPGA 4U0KA 5KJEA 2FSVA 1JLLA 4NR0A 1UZMA 5T8KC 1MGOA 1JWAB 3JQCA 3L0DA 4W7IA 3WOHA 1NFQA 4NBWA 1OI7A 1UJMA 3OECA 4MVJM 1MLDA 5CEEA 1MXHA 3INTA 2QZZA 2P5UA 4QXMA 5EMHA 1EBUA 3TL3A 5IG2A 1P74A 3ZW9A 2JFGA 1PS0A 3GPDG 3IS3A 2HK9A 3EVNA 3VVCA 3HB4X 1BXZA 2ZIZA 3H3FA 1ONOA 4A0SA 1P1FA 3R3JA 1N5DA 2ZTLA 1KS9A 1LSJA 2OMEA 5FI3A 1NYTA 3FN4A 1AHHA 1ZZEA 4P22A 2J8ZA 4B7CA 4UUNA 4BNZA 1CETA 3QP9A 4G2NA 5CP8A 3PK0A 3GR6A 1E7YA 4FBGA 1P77A 3FR8A 3DBLB 4H7PA 1MG5A 2IZZA 5B4VA 5KNLA 4YQZA 1BGVA 3JQ7B 2VWGA 1AHIA 2WMDA 1GY8A 2RIRA 4WK6A 1DXYA 1KBZA 1ISHA 2GR9A 3OH8A 2VNAA 4R5MA 1XCBA 4XB1A 1LI4A 2CVOA 1GDHA 3KYCA 1LSUA 1U5AA 5GZ1A 3GVXA 3LF1A 2PWZA 3UICA 3Q11A 1TI7A 1P44A 4RPKA 1TVEA 5G4LA 1H6CA 1YQGA 1NFRA 1BDMA 2VWQA 1B7GO 2PZMA 3BMQB 5LDGA 1K6JA 1BHSA 5F1PA 2VHWA 1LNQA 1HLDA 2NUAA 3ZCXA 1HT0A 1QLJA 1UUFA 3HDYA 1Y6JA 1XU9A 3I23A 1QV7A 4I08A 4AJKA 2P9CA 4NDNE 4AJ1A 4EJMA 3PEFA 1UXJA 3BYZA 2OP0A 1A4IA 4D44A 3MJEA 1HSOA 3DTYA 1QYVA 1XG5A 3OQ6A 3C3XA 4OHUA 4OXYA 4MIYA 2H6EA 1AUPA 1PQUA 4L75A 3EC7A 4R41A 3UF0A 4BNHA 3B1JA 4RPGA 5I7EA 5JO9A 4ALKA 5MGBA 4A2CA 3KYCB 4RLSA 4YB8A 3U09A 3B20A 1WP4A 4G65A 4Y6PA 2NU9A 4P4LA 1EE2A 1LX6A 3E03A 3DZHA 1WPQA 5TQVA 4NH4A 1V3TA 3IC5A 2P2SA 4BNGA 2VOEA 1ZVMA 4DQXA 1E7WA 4J4TA 4YDRA 3AM4A 3NT5A 2NTVA 3C85A 4MVJD 2A9FA 4M55A 3ROQA 1Q0LA 2LDXA 2J5KA 3K6JA 3AWDA 1OOEA 5KKCA 3ULKA 4ZQHA 3EZLA 4YAKA 5BNTA 2Q45A 4AFNA 2O3JA 4BNVA 2OUIA 1P1RA 4U7WA 5BT9A 4Y6RA 2CMDA 3UCFA 3VPGA 2WE7A 2CUKA 1O89A 3AUTA 2ZB3A 3WQRA 5B4TA 3WLEA 5AXCA 4J43A 1D1SA 3O26A 1U28A 3M1LA 3UW3A 4HX5A 3HHPA 1ZSYA 1E6WA 3IUPA 4D41A 3A1NA 1LDYA 4Y98A 2PR2A 3W8EA 2Y0CA 3MJ4A 4NU6A 4ZJUA 1T1RA 3W6UA 1U8FO 5TC4A 4CM7A 1YB4A 1I5RA 2GN6A 4HP8A 3ADPA 1ZK3A 4WKGA 5AXDA 4YR9A 1D1TA 1KEVA 1PJSA 2YYYA 5I8ZA 5CFZA 7ADHA 2J6IA 4ID9A 4GAEA 3IOYA 5U4QA 4G81A 1Z75A 3KLPX 3BTUA 4NK4A 4EZBA 3RFVA 3A06A 4JN6B 4ZGWA 1TB4A 3QE3A 1KETA 1OC2A 1I3MA 2NLOA 2RHCA 3KEOA 4BO5A 4KZPA 3RASA 4IDFA 3FNGA 3DOCA 4BNNA 1I33A 1OBFO 4I9UA 4AJOA 1BG6A 2HRBA 3ETGA 2XXBA 4XX0A 4NBVA 1PJ4A 3H9EO 2NADA 4RLHA 4BNMA 3PJGA 2WD7A 1DLJA 3A4VA 4NU5A 2C54A 2R6JA 3SLKA 1GQ2A 1CEQA 2P9EA 5HTOA 1CWUA 3ASVA 2A94A 4J6FA 2HMWA 1EBFA 1KY5A 1LSOA 2ZYAA 4RL6A 2NU6A 4Q39A 2EW8A 4PG5A 1ML3A 3ST7A 1HTBA 5BNFA 4KMSA 5KVSA 3GMSA 1P0FA 3G1TA 3D4OA 4BVAA 5TRTA 3VDRA 4NK5A 2DBVO 3ZV6A 2CD9A 3DZKA 4QSMA 1Z6ZA 3Q3CA 2VTDA 1KVUA 1B2LA 1G0NA 4LN1A 3RUFA 2VHVA 2J3KA 4GX1A 1U9JA 4KP7A 1ZSVA 5EINA 2Q1WA 3AM5A 3PHLA 2YZ7A 4MKZA 1NWCA 2D2IA 4WNCA 5L51A 3C8MA 2CY0A 3A28A 4GWKA 3SVTA 3PWKA 3NEPX 4L73A 1QYCA 4BV8A 2QZ9A 2DTXA 4Z0HO 1HYEA 2HRZA 2CNBA 1I2CA 1V6AA 1FDVA 4RF3A 5LDHA 3DOJA 6ADHA 2GN9A 3RUDA 4MJLA 1OZAA 2WD7B 2ZK7A 2TMGA 5G4KB 3IJRA 4R1NA 1RM4A 3ZI0A 2UAGA 5A5FA 1CJCA 1T2DA 3DMTA 1F12A 1NBOA 1DFGA 3L6EA 1JVBA 1DJQA 3RBVA 3PP8A 1QV6A 2HK8A 4WCFA 2Q50A 4Q3BA 4OMUA 1E1LA 2X6TA 3IQDB 4R1UA 3TZCA 2O3UA 2DFDA 3JD0A 4YA6A 3TJRA 4PG8A 4DQUA 3GGGA 1M6WA 4A10A 3H7AA 3ZWNA 4LCJA 1QORA 1GAEO 5FF9A 3GK3A 5G0WA 3W4JA 2X1HA 4FPXA 4B3HA 4BUCA 4PVDA 3GNSA 3VZPA 4CM5A 2D59A 4UULA 4E5NA 3S2GA 5IAAA 5K9ZA 1EE9A 4CMEC 1C1DA 1HE3A 4LCEA 4YRDA 1I3NA 3S8MA 5U9CA 5JPIA 4DBVO 2JCVA 4CL8A 5EL0A 2AW5A 4XQGA 4JBIA 3ZZNA 4CMGA 2V6GA 1ISIA 1D7OA 1PGJA 2DBRA 2JHFA 5L9AA 2AEJA 2PK3A 3TWOA 1HSZA 4WCFB 1YONA 1MB4A 3F46A 4CR6A 2Y0EA 2JCYA 2ZB7A 3BMOA 1K89A 4DLAA 4DWVA 4J7XA 1Z74A 3DL2A 1NP3A 4MOWA 4NJOA 4W9NC 3SC4A 1HF3A 2UUOA 3FNFA 4OQZA 1PS8A 3D4NA 3DO5A 5ILOA 3KBOA 4AJHA 3TZ6A 2Y1CA 2Q3EA 5IDXA 1PZGA 1GUYA 1RPNA 3QSGA 4DVJA 2PGDA 4II3A 4OXNA 4ZD6A 3K2EA 4YCAA 1H2HA 1K0UA 1WMBA 2O3SA 2FSSA 1DEHA 1ZK4A 3QLJA 2Q1UA 4IJVA 4UEKA 1HYHA 4LGVA 1PJ2A 2ZYGA 5EN4A 4IINA
chains in the Genus database with same CATH superfamily
1MC4A 5A1TA 3I39X 1ADBA 1EDOA 1YL7A 3AQ4A 3IHTA 4RY8A 3TRDA 3S4YA 4R9UC 4CF7A 4ZHSA 3IBTA 5EJIA 4EHAA 1M3SA 2WJ3A 5JXGA 3MF4A 5LJLA 2AG1A 2QTTA 1CY7A 3P8ZA 3KVYA 4BO8A 1XRPA 4DIOA 4MRPA 2GCOB 4DCJA 3S2IA 3ROKA 3WYCA 1DDIA 1YZYA 1YQUA 1ZGAA 2QJRA 1A96A 3ZX5A 1GZUA 3NHAA 4BFCA 1R9GA 2MDTA 2ZQYA 3IR6A 1BS9A 2WT9A 3MMNA 1UWKA 4QUJA 3AFGA 5AM3A 1E79A 1GVNB 1OXXK 4G0XA 4KNYA 2EHDA 1C14A 4GW3A 4I5EA 1K7CA 2G67A 3GJYA 3GJZA 5FPTA 3T5DA 4DA6A 2H7XA 2LIPA 4RIEA 4BZPA 3CW8X 4PG4A 3OCWA 4MULA 1SY7A 1T24A 2J30A 2C96A 3PX2A 4NV1A 4WUVA 4F3YA 3OOWA 4BLSA 1MIOB 1K1EA 2C9CA 2C9OA 1QGAA 4JQCA 3QXXA 1M6YA 4PBRA 2PUBA 5EQFA 2LP4Y 1SIOA 1YCDA 2W2KA 1IB6A 1RJDA 2HREA 4X93A 6AT1A 2IZ6A 1E1YA 2IHZA 1B23P 3CZCA 4X1IB 5FHQA 3E1KA 1LDGA 1ZCZA 4IZHA 4RPCA 1JEYB 2ZP1A 1C3OB 4CM4A 1P0PA 4ID3A 4LOJA 4IDNA 5ERYA 4BPRA 2OD9A 1E8DA 2AWOA 1CZKA 4O4JA 4Y2SA 1FJGB 4H77A 1V9SA 4QT0A 1TUBB 1K88A 1ZM2A 3IA2A 3RWOA 3BQMB 5DTMA 2GCGA 4RSGA 3UPTA 2OZLB 4KWCA 1LVGA 4Q1FA 3U7RA 4CI0B 2DECA 3QBJA 4YACA 4TZKA 3ZV5A 1BCSB 2CLIB 1O5IA 1DBQA 1DLIA 2IQ5A 3OLZA 5K8UA 4NMMA 4V1CI 5ERXA 2FF5A 1G20B 3IDSA 4EAAA 2C2BA 1R64A 3HB1A 2JJ2A 2GN0A 3LC1O 2Y93A 5IAKA 1CIVA 2H52A 4RH1A 4XVUA 1S2GA 1S6YA 5EWJB 1IY8A 3QVKA 4W1SA 3ZBUA 3HCRA 1G19A 2DERA 2OY0A 3A1CA 4L4ZA 5ALOA 3WAJA 1F0YA 2NZVG 3RRMA 3BEDA 1CQPA 1FNDA 4ALMA 1DTWA 1VSVA 3WLSA 3EAQA 1T8UA 5CGZA 1H66A 2R79A 3L7CA 3VR4D 4DV4B 3EZYA 3I5YA 2C3PA 5HP4A 1AH2A 1PTJA 1IRXA 2QTZA 2ZRHA 3E8MA 4KWHA 2D7JA 1GEEA 1UC4B 4WLEA 4BYGA 1F0NA 2VZ9A 5K0BA 3BMNA 2RH9B 1W19A 1Q16A 1CY6A 1SQ6A 1GPWB 3DBVO 2CEAA 4PR3A 4DJ5X 5EEGA 4AS2A 4M53A 2PS3A 4QT4A 4RIFA 3G5TA 3NOXA 5DHPA 2RGWA 1YOVA 3GP3A 3SEFA 4H1UA 2AJLI 1Q11A 1PNRA 3NWBA 4C4TA 2QUIA 3C1TA 2C3YA 3EPKA 1IM5A 2YZ2A 3ITKA 3DF7A 4MXDA 1IJEA 5DSZA 2DUUA 2J5QA 3Q40A 1U0FA 4NFHA 3ZZ1A 4KU4A 3COJA 2ZE7A 5CDHA 3M82A 2PRYA 1Z18A 3S27A 4E1VA 4HVTA 3EGCA 5KCZA 3II6X 3WQBA 3CA8A 1O8CA 1I32A 1NKVA 3W4IA 2A7XA 3MBOA 3H17A 1ISRA 4FOOA 4PFKA 2B34A 3I9MA 2BCGY 3EGXA 1PNVA 2H2WA 2HQOA 4EELA 1PBTA 1D07A 2GCPA 5MGNA 5LQUA 1PX2A 1WEHA 2NZJA 1FYVA 4KPUB 4XB2A 5BRNA 4D4LA 4DTIA 3IMEA 4YAIA 1J0BA 1KJNA 3CIFA 3HH8A 1E9FA 3B85A 4LJLA 1ZD9A 5BYAA 1NYQA 1Q7CA 4RSRA 3QYFA 3MCZA 2C4HA 3OT4A 1ODLA 4BO3A 1M8GA 1ZUIA 5AKYA 1A72A 1OR8A 3NBKA 5B2EA 2XNCA 3A4TA 4WIAA 3QPUA 2FW6A 3NBXX 2PX2A 3EQZA 5E2AA 2IV3A 4I9NA 4BBZA 5LUAA 3SX0A 2IE8A 3OKFA 5EIWA 1TIBA 2JAWA 3WP0A 2DLDA 4L02A 4M98A 1N6PA 1KO4A 1VXOA 1XZAA 2M1ZA 1J2RA 1QP0A 2P9GA 4UMVA 2WJZB 1FQOA 4AVYA 4FE7A 4M46A 2VQ3A 3VHLB 4NZYA 1G0OA 2VUHB 3M1AA 4Z51A 3EFBA 3QE2A 2HHLA 1E79D 1V8ZA 3FYSA 5E6RA 5L53A 1N8KA 3FETA 3F7OA 2G77B 2WYUA 3H18A 1YK0A 2W6PA 4ZEWA 1ZD5A 4RCVA 1H94A 3H5VA 1SCBA 1F3OA 2PSJA 3IUYA 1KAOA 2QX8A 2BN4A 4YIKA 2J5XA 3OPNA 3CVYA 4AUNA 4UNRA 5JH7F 1VBKA 3DUFA 4DAOA 4D4MA 1KYYA 4E08A 3ADCA 5FI5A 4JNKA 2E55A 3H8WA 5DI3B 1G6Q1 1A8PA 3UFBA 3ZS8A 1Z36A 3T0FA 2ZIUB 3H9UA 5JDIA 2WSSA 2PS0A 3HBFA 3ZWXA 3NKLA 3ELBA 4QUBA 2JVKA 4PC2A 5DHSA 2GN2A 4DWJA 2I6TA 5HOQA 3CRQA 3A7EA 4C5BA 3B70A 2NO1A 4Q12A 4ZHQB 4UEOA 3PNPA 2ZRGA 3D7SA 1AY0A 3I8SA 4M60A 5REQA 4EF4A 1CRLA 3MWFA 4RWEA 5DF1A 2WTEA 1OVMA 1FUIA 1GPMA 1X87A 4I9FA 3A36A 4M76B 3T1OA 4Y0VA 1XCOA 2Y1EA 4NOKA 5IBPA 1TZCA 3CG0A 5AQ1A 4OLJA 4HO1X 4LJ6A 2OV3A 2CFCA 2BKUA 2PUDA 3P9CA 4CEHA 5BOSB 2C5SA 4UNIA 1DC3A 3PD1A 4MMZB 4TWZA 1T6YA 1K7EB 2XV1A 2HUNA 4NPAA 4IDQA 3FRJA 2JJ2D 5JMWA 1R0BA 4BKUA 1JAXA 2O2XA 1CDEA 1XCJA 2ZB8A 4K26A 3UJAA 1ZRMA 4DG8A 4ZQIA 3JPWA 4U2DA 3PHCA 4A8PA 2GTIA 3UT5B 4DWOA 4EATA 5I3ZA 4MO9A 4ALJA 4L4SA 5AW6A 1M75A 3CT6A 5ED0A 3G13A 3JALA 3AZQA 3PVZA 3TQQA 1E9BA 3JSAA 3I76A 5HQJA 3N0RA 4H08A 2PH1A 3DZFA 3CB2A 5SYAA 5HZHA 2J3JA 1E96A 1DKRA 4J90A 3ZR4B 4ZYUA 1QOZA 3HCFA 2DFTA 3EA0A 3LUJA 1E7RA 2V65A 2V6JA 3IPYA 3WYEA 3AP1A 4GGMX 1EUDA 3U9SA 1WZNA 3LLSA 3AY7A 3JPYA 3QPAA 4DC1A 7GPBA 3IBGA 3JAWB 4NBKA 5K99A 4GQAA 1VI6A 4PGMA 2F55A 4BIIA 3GJQA 4I7EA 2IEBA 4Z4EA 4PXAA 2EJBA 1R5NA 5KI6A 4YDSA 4M4SA 3L6OO 4HS4A 2P9JA 4JJ8A 4F4JA 1Y9ZA 3NM6B 4JFRA 1Y3AA 1NG9A 1BXKA 1YRHA 2J3MA 2ZTHA 1EM8A 3F90A 4MICA 1Q2UA 4MB6A 3D3WB 4O8CA 2D2EA 4HK4A 1NM5A 4E5KA 1SVLA 2LTAA 1EFVB 4B4DA 5DNCA 4OO3A 4BDTA 5IJXA 1JKFA 2K6GA 3LKBA 3KC2A 4MMXB 2ILTA 1DOZA 1RACA 2VDKB 2YZMA 5I5EA 2DBYA 2BEUA 4MLCA 2GCIA 4B1FA 1GAXA 2PZGA 3AKDA 2CKDA 3L7IA 4BQPA 2FPRA 1NWHA 1TCVA 3EE6A 3RUCA 4DZZA 3E8SA 1JDBC 4JJKA 1MP0A 4GMFA 4JJGA 4C04A 3AR4A 4B8ZA 2V97A 2Z9CA 2FP4A 2CJWB 1W1UA 4U9IS 2AWNA 2P30A 5AOCA 3P0JA 1JG7A 1EFRD 3ILVA 3EOZA 2QG6A 4FYHA 4H7FA 3DGFC 4QELA 5LQAA 5T4BA 4UE3S 5FBKA 1M5RA 3UKOA 2ZWIA 3LUGA 1E99A 4FI3C 2WAMA 3D8BA 3MMSA 5BOVA 5F2OA 4ZK6A 1DBPA 3AXSA 1WZUA 1D8TA 3D59A 4NBRA 5DMHA 3U3DA 1F6BA 5HM6A 5CIQA 1JQAA 5C3UA 5EC8A 3SIPA 2GJSA 2W6CX 10MHA 1VJ1A 2IUFA 2QY6A 3MTAA 3E4CA 1BXGB 1ISJA 4IOJA 3UFXB 3JQ8B 2EKBA 3FPAA 1W36B 3DD5A 1CU1A 5AOAA 1PW5A 2OO3A 2XNKA 4RTSA 4P0TA 3O8LA 1XP5A 4L5AA 2FMKA 3FF1A 4Y1EA 2D5LA 1FTSA 1OI3A 3V2GA 4IQ4A 1L5NA 5I47A 3GP8A 4ZJPA 4OH1A 1CG6A 2GNOA 1PR4A 1KH2A 4IVNA 2A4MA 4HVLA 1SQ0A 2OAP1 4ZMSA 1GKYA 1J20A 1JPNA 2W93A 3H4MA 3LQ4A 1FMLA 1Q91A 3R0ZA 3KOWA 3R41A 3NHFA 3UB4A 2PWYA 3EXG1 5H0IA 3VO1A 2UUAB 5GZ6A 2C7VA 2IVZA 3SEZA 4W5TA 3HB0A 3UGKA 4OBEA 2XZTA 4RK0A 1TKRA 1SKYB 2WSSD 3QVMA 3GEIA 2ZVPX 1R6BX 4Q03A 5B5SA 3DBOB 1SVOA 1ZOSA 2YWDA 2GT1A 3UMJA 4NEGA 3L7AA 2EJCA 1JDVA 3L49A 1BH6A 2I65A 3L4SO 3MB5A 4IWNA 1Z5ZA 1FP6A 3L7MA 4IILA 2BHTA 4NEQA 1LFDB 1GD1O 2IIQA 4WECA 3AKYA 5FOWA 4EF5A 1JG4A 1ZJYA 2IHJA 3EIUA 3DONA 1U1GA 2BHRA 4MZDA 2XVYA 5C8YA 1EFDN 1IPFA 2Q4RA 4Y2RA 1DAFA 2H29A 3OPMA 2DM6A 2QRKA 4FZJA 1JMYA 1KYZA 4Y6LA 2Z98A 4GKAA 3S1LA 4F92B 3VPFA 3Q15C 1WSWA 3P9XA 4LZPA 2X8JA 4XPIA 5J4HA 1HE4A 2JA2A 1U2DC 2DY0A 1M7HA 3MT9A 4EJFA 1ZP6A 5JR3A 3EAGA 1R7RA 1K5PA 1U02A 1B15A 4LV8B 1U9IA 2ZKIA 3GB9A 2IGBA 2R4TA 1J09A 1GNRA 9ATCA 3P2IA 4TROA 1YR9A 3ONWA 2WPNA 4GZLA 1XQYA 5AM1A 1I6MA 4KHZA 2IHTA 4K9RA 4KTVE 4BTLA 3PQDA 3WK7A 5HIIA 3K94A 4X1KA 1HBJA 3DBRB 4BEWA 4IGIA 3A27A 1EVJA 4RACA 3WGQA 5JS1A 3QUQA 1Q0RA 3RH0A 2W71A 1R88A 4ACAA 4UBIA 1PVDA 3IMCA 4QARA 3NYWA 1P0QA 3ANXA 4HQNA 4PF1A 2JB9A 4AT1A 4QKQA 3QE9Y 5DOZA 3X1JA 4P81A 1LKZA 2IZOA 1SCNE 4JYMA 3A4LA 1K9VF 4WDRA 1JSRA 3WIDA 4ESVA 2PVCA 1NKTA 1RYDA 2QM3A 4TLEA 2O1XA 1IVNA 5ITWA 5DSXA 3TUIC 3CEJA 3I4CA 1QHYA 2PFGA 4R1TA 3O9MA 3ROXA 1T8RA 4B0PA 5CDTA 4MYHA 3SX4A 1JSCA 5AJZA 1KJQA 5KZMB 2FCRA 3ZLUA 5A9SB 1M2OA 5K0SA 3DOHA 4KWEA 1FRNA 3CRRA 4QXPA 4AZ3B 1XTUA 1DEAA 4FZRA 1EX7A 3AL3A 1T8WA 4NFSA 4QYWA 3JYNA 1Y3DE 5L3VA 1IBSA 4HWRA 1KI4A 4KKXB 4DPKA 2DULA 1I24A 5TS2A 3VHXA 4MEJA 3QU4A 3PUYA 1OFHA 1UOOA 3OZDA 1WVMA 4M9SA 4ZTZB 1CUGA 3JWHA 4IIXA 4MQ4A 4V02A 4WOCA 4F11A 2FPGA 2C8VA 2R60A 4XRGA 5JW6A 4YRCA 1N4AA 4QSHA 1Z4OA 2OQVA 4F60A 5EIXA 3OQOA 1LU9A 1T9AA 1U0EA 5LQMA 2W58A 2BFDB 1QLHA 1DMSA 4MUHA 4UQPA 2IZ1A 4WASA 5DXJA 4G4GA 3RIHA 1F2VA 1Y3HA 2ZSHA 2NWQA 4G9GA 1TT5B 2P90A 3K31A 3D6MA 4LE2A 1T4DA 3MGGA 4QO7A 3ZDQA 1CUFA 2YYAA 1EJ6A 1WY7A 1VYHA 2NXWA 2E4WA 2WF8A 4Q19A 4QEZA 3C3WA 3I83A 3U7IA 5HKLA 4F9FA 5J2TA 4S1PA 4HLUC 4LGMA 4Z8XA 2VT6A 2WP8J 4IJKA 2RK3A 4O1HA 4M7WA 3MWYW 1N2BA 3T99A 4OKSA 2B2CA 1WDMA 4ETMA 3NEJA 2PE5A 5GV8A 1SOAA 3ZS9A 2VUSA 1UFVA 3HL0A 4F2WA 2VZLA 4JR2A 4UBKA 4F5DA 1JR6A 1UXKA 3QTBA 2PUAA 2DSNA 3F6BX 3F49S 1UJ5A 4E33A 3L7YA 1ESCA 4M2LA 4HGNA 3L77A 1VCOA 5L4SA 4JJFA 1SMKA 3NDRA 2RG7A 1JHAA 3W2TA 2HWYA 2JGKA 2W5UA 4ND4A 2OCGA 2X9NA 2AI1A 3KQOA 4P35A 4XAQA 3S44A 1YIAA 4XX1A 2CBZA 2YBEA 3Q9LA 3OKAA 3OIVA 4GR5A 4MQBA 5F33A 4GC5A 3X1KA 1W5SA 4LJ7A 3P0HA 1VFPA 4HB3A 5CLFA 3L07A 5J23A 4OX9B 2GPSA 4HDKA 4YAFA 5KOJA 4MW7A 4TWRA 1PQWA 1KU6A 3N70A 2BFBB 3HVIA 2XMCA 4UUPA 5LXTB 4EY5A 4ITUA 2XWSA 3QMVA 2H1HA 2QA5A 3K0AA 2I3GA 3H16A 3QWBA 1R50A 1RWWA 2ANCA 3C0KA 4XSVA 3S2ZA 5BXQC 3BKXA 3G7NA 4IQ0A 3SQXA 2VDOB 2YHAA 1OHHD 2DWCA 3N75A 4G0VA 2GKSA 2ZBPA 2RHWA 1X1TA 2ZGVA 3HDGA 4TLCA 1YVEI 1NJFA 2DWPA 2PH3A 3PQ4A 3CJRA 4ZI5A 1G41A 2PGAA 3KOOA 4OFBA 1JMVA 3HHEA 3RVBA 1A88A 3VPCA 4AJPA 1W44A 4JD5A 2CHGA 1VHQA 5JDIC 2HYIC 4QYTA 5JS2A 3ZJ4A 3I6BA 2IX3A 2JI9A 2HGZA 4WL0A 3S55A 2G7ZA 4Z1MA 3CC8A 4AY5A 4B79A 4QREA 4J94A 4TV8A 1VIDA 2J3DA 3EHEA 1IXKA 5CPFA 1P2TA 3THOA 4DB4A 1MX5A 4N7RA 3VNQA 2WIFA 4BMSA 3D3JA 4EHIA 5CA1A 5CFLA 3JV7A 3A1WA 2NO0A 1ESDA 3CUEF 3P2EA 4O08A 3GLSA 2IW3A 5ALEA 1VHTA 5IC4A 5HTKA 1E1DA 1ZHFA 1UBSB 1Z25A 4X54A 3WLKX 4AYXA 3OM9A 4NV0A 4B7ZA 3RYCA 1CB0A 4GSLA 2CCJA 4S3MA 5I7OA 2NSYA 2PT9A 4NENB 5FAXA 3TMAA 3SXPA 4BFVA 1ZS9A 3LQKA 4XZ3A 5IPFA 1L7XA 2VA9A 3PKIA 4XTRA 3K09A 3PFHA 4N7BA 3HKCA 1PZMA 2BP7A 1RMQA 1WZIA 4AAYA 3ESDA 1X14A 2C98A 2PUJA 5CRIA 2I99A 1CP2A 2OFOA 3CE6A 4YMHA 1LPPA 1RQRA 4TXHA 2WK1A 5DCYA 5K3FB 4RUKA 5J4KA 1FFXB 2VK2A 1T3GA 5FIUA 3AJAA 4DV2B 1YS6A 5CH3A 1K6XA 2ZUSA 3CLSD 2HWUA 1SIUA 3CGGA 4IXTA 3V8BA 3V97A 3PEEA 4M37A 3T9CA 3VZBA 2YFHA 3W2GA 1SG9A 4TYMA 4DLYA 2H07A 1JECA 2ZTUA 1AO0A 1XDBA 2I6FA 3PFCA 4OY3A 4ETIA 1I80A 1MRZA 2FLVA 5G0UA 3TQTA 1RYBA 1VIVA 3QWAA 3HABA 3B6ZA 3PFIA 4K1LA 3R2JA 3G9ZA 5FA8A 1RXWA 4UATA 1Q0UA 3MELA 4UC0A 3UIEA 4D02A 1HQKA 4XWKA 4ZQFA 3DM9B 4PLWA 3JZAA 4UE6A 3F7TA 3VUEA 5BN4B 3VJLA 2Q46A 4Z9YA 1XKTA 5CT6A 2RH8A 1Q83A 4YLYA 1AA6A 3PUWA 3NRJA 3BN3A 4G09A 1RRGA 1EFTA 2NYRA 3QVXA 4TL7A 4CEJA 4LKRA 5KVCA 3AVWA 3FYCA 1Y7LA 3PFWO 4ZOEA 1R0YA 3ZHXA 3GJ7A 3T1TA 1KEZA 5TQ0A 3WKAA 1HFEL 4NC9A 4TSFA 5CM2Z 2OWDA 2PO7A 3DDZX 5EEHA 1J1IA 4YAEA 1EG2A 2AD5A 2CHVA 2YZNA 3DKVA 1PGPA 3DOIA 4MR8B 4F6RA 1FP4A 3H4VA 1ZFNA 3CF2A 2Z9DA 5IYZB 3AFHA 3RYIB 2O3RA 2OHHA 1NDQA 1GYRA 3G9UA 4Q4JB 1ZH6A 5E4JA 5ITVA 4FEEA 1OV4A 2B8NA 3RGWS 1F4PA 1XJ0A 4TTIA 5K3DA 2W9XA 2WDPA 3HN7A 4QUEA 4DCCA 4M0LA 5ALTA 1QANA 4GKBA 2VUTA 5BYKA 4XUCA 5EJ6A 3RSQA 4PRKA 4R81A 1ORIA 4EFLA 2HF9A 3W34A 3K6SA 3PWSA 4BFSA 2JANA 1JU9A 3ICQB 3WK5A 2P40A 3KPUA 4CWAA 5KPDA 3ADBA 2DX7A 4HZIA 3O8OA 4CG2A 4DLLA 3JQDA 2IPOA 4FMPA 3B1KA 4ZAXA 4BB5A 3STXA 5FL3A 2QTNA 3Q7EA 2HKIA 2VXOA 3AIOA 1N1MA 3F96A 2ZRAA 1TA9A 4C76A 2MSEB 2QAGA 2QLBA 3EXAA 4LGYA 2J5BA 3GUYA 4HTAA 2QV7A 5KYYB 5ALKA 3P2YA 3Q5GA 1AKVA 1KC1A 5PNTA 5JTUA 5EJFA 1W4CA 2VWHA 4BPBA 2Q5IA 4RABA 4YT5A 2OP1A 3AIMA 1VJDA 3ZN2A 1DWQA 3EA5A 2OVBA 3TIIA 3TO5A 3KX2A 4OPMA 4H2DA 1QG6A 5AD1A 1BFUA 1XZHA 4M36A 4N76A 4Y7CA 4C6TB 4UREA 2GBPA 5LD2C 2BMEA 1II9A 1I7PA 1N57A 1SELA 1T25A 1QC5A 3IO3A 4J9VA 4D79A 2ZXUA 2CNWA 1Z4QA 3FF4A 1M73E 4OJYA 2IDKA 1K6IA 1SUSA 4NAUA 1UR5A 1KMCA 3EMKA 1Y81A 3FFBA 3HLKA 3MWEA 1E2IA 4JLKA 4URWR 1TUIA 1KAQA 3ZPXA 5FHRA 4H1TA 4PZLA 3A6PC 2W6ID 4YBRA 1NBME 3U48A 3K0BA 3K2QA 3ONDA 4Z1MD 3F7MA 4PYQA 1RADA 4OI0A 2X1VA 3CWQA 4IJWA 2PZBA 1BJTA 5EWMB 2NP6A 1N0HA 3GAMA 2PFSA 1H93A 1VKHA 1DAOA 2HJHA 3EEYA 2D1TA 2CVFA 2D2VA 4Q4LA 3OWOA 1QIGA 3NGMA 1SUBA 4KRYA 3SC6A 3IALA 2PKWA 4MUMA 3AUAA 1QX3A 3FMPB 3NUQA 2ZRNA 5AW8A 1QF6A 4GO1A 3IYLW 3P97A 4PS0A 1S2NA 1HEIA 4YCSA 3L8ZA 1UDRA 4NI5A 5BPHA 4QC2A 1FNMA 2I3AA 1TK2A 4N40A 3CVJA 2QNRA 3DLCA 4I4TF 5FFFA 1HDGO 2Q9CA 2HIHA 2ATIA 3EZ9A 1QQBA 1Z6YA 3K05A 1GSHA 5IN5A 3UJBA 4RVDA 3GFOA 1SVWA 1N6RA 2WZCA 3C7CB 3LF2A 2NVWA 3PYXA 1YZLA 5DNAA 4CHGA 1H2AS 4ZYVA 3T7CA 1IBKB 5FWAA 5LA6B 1Y5RA 2QLFA 3E5MA 5JY1A 1EB8A 1TCAA 1ZQ9A 4GPZA 4Z5XA 3W5UA 5A7HA 5FYQA 1EFUA 4O4IF 3IT2A 2F6RA 3FMOB 1CUVA 1GFZA 1HL7A 2YUTA 3HRIA 3K6RA 4KLRA 4XYMA 3HJFA 3MJVA 1ZU4A 2OOKA 3DOEA 4MDFA 1XTTA 3HI6A 2DBQA 3KDSE 3BF8A 3DOUA 3OE4A 4L50A 4NBUA 4YRAA 4CR7A 3VQTA 2CFSA 5BY2A 5ISMA 1NYLA 4RKFA 3WLMA 3ROMA 3OF3A 1YA4A 2G9VA 4ARZB 3RC8A 1WKBA 4V0SA 3AVXA 3SIXA 3O4JA 4IIFA 5DT2A 1TFUA 3O4IA 4FFBA 1UKYA 2FN8A 2GBCA 3L79A 2ASVA 3GX1A 5ALSA 2FMFA 5JEDA 2PLFA 4GNKA 4A0QA 1ICIA 3CVVA 3PUVA 2C2GA 3M5WA 1B6RA 4MSUA 3DZCA 2I80A 4X9XA 5CM9C 2VYVA 3KQTA 4TSFD 5TJHA 3TTTA 5CK4A 1H6DA 4NAHA 4EZIA 3K2BA 3OX1A 4ZVPA 4DW8A 4EG8A 1CQJA 4KH0A 1KNXA 2P77A 2JKYA 4MUKA 1RQ7A 1G2PA 3FJOA 3WGNA 4LFBB 5EJEA 4Z3KA 3FTDA 3UG7A 4W9MC 4CV0A 1I6KA 2C1XA 4UDXX 1RHQA 4WFKA 4X8MA 1N33B 2C31A 2A4KA 2OKGA 4WGFA 3I6MA 4M1TA 4DA7A 4WKCA 1AKQA 4KJZA 4AYWA 1TQ6A 1NRXA 3DL0A 1XCGB 2BYTA 4JT9A 1QAOA 3CEAA 5GGYA 3IT0A 3NC4A 1D9XA 2JA1A 4P1ZA 3UMSA 3ECCA 2WU3A 2I2FA 5TQ2A 1N5JA 5CFNA 2OUKA 1M1YA 5TGDA 5BR4A 2FZVA 4AIIA 3A1DA 2PNJA 3ZCSA 2P4EA 2NMVA 1FNNA 1U0LA 5DXAA 1AGXA 1F60A 2B4KA 4M83A 5ADHA 4R2WA 3B2EA 3UK1A 5AW4A 4U2FA 3EUAA 2I34A 1C7FA 2OQRA 1X13A 2B8TA 3IT3A 3IV7A 4GR4A 4MKRA 2QL5A 4TTAA 5JE8A 1W93A 4NJEA 1G4UR 2DXIA 4FFPA 4J0GA 4OKNA 2PEZA 3E1GA 4PN3A 1L5HB 2VF8A 4TWBA 3EIXA 3LOQA 1Q7TA 1ZGJA 5DX1A 4MVWA 3BA6A 4O4HF 3SE7A 4L4XA 3R3SA 2EJTA 4INPA 2R5WA 2NVBA 2ZETA 3VPXA 1T3ZA 3WGHA 1T2CA 2YUIA 1TVMA 4F45A 1RAEA 2VCYA 1DL5A 1NX9A 2CNWD 3NHZA 5WRFA 5HYVA 2YRFA 5KTTA 2JZCA 2B4YA 2ZZKA 3GPCA 3TXAA 2IKSA 2WHQA 2F43A 4JMLA 4MUIA 1QGED 2LR0A 5EXEA 2J0UB 4HADA 3CB4A 3WGOA 3EG9A 1YR3A 2FAXA 2ECKA 1VKOA 3KTAB 4Q7QA 4INZA 4WPGA 3PR3A 1WW2A 5IBQA 1E6LA 1C9YA 1BX3A 2X2EA 3T4PA 3D5EA 3WSTA 5JJ5A 5F2EA 3QEMB 3T7SA 3LUAA 1M6EX 2OXEA 1N2CE 4KRFA 3ILXA 2G3YA 2QRVB 2VCEA 5AKJA 4AS3A 3BPSA 2IP4A 5JBIA 4FM9A 2Y76A 4D0SA 4DUYB 4GI7A 1CHNA 3CN9A 2XLBA 1IEVA 1N2SA 1G60A 3QKUA 4G4SO 4RHUA 1LXCA 5EZ5A 1H3EA 4AS1A 3EXIB 2MR5A 2QPAA 4BO0A 4J3JA 2Z6UA 4TYQA 3K5WA 2ZTVA 4JLBA 1MT0A 5DGTA 1ZBQA 4A4DA 1ZH4A 4X60A 4B6FA 3EQ2A 4ND2A 4IFEA 3VYWA 1YBVA 2NO7A 2F2TA 5BWMA 5A2QA 1FRFS 2QM0A 4X1OA 4P4TA 5EMKA 1QIFA 3AO0B 1KEEA 2DOKA 3OETA 1EFAA 4XJSA 4MKXA 4DR6B 1MABA 1UMDA 1DAIA 1VSUA 3U62A 4IDBA 1GZSA 4E2YA 3HC7A 1GGKA 4A1OA 1N9KA 1B8VA 1EUCB 1ORHA 2W8ZA 1H6BA 3U16A 4PX3A 3DJFA 1RYMA 2FE4A 4RETA 5BUQA 2PH5A 1DOAA 1EQAA 1JVNA 3H5NA 3UK2A 1IVSA 2COUA 1XZEA 5C1DA 1YI1A 1Q57A 1R4NB 3MWDB 4DDHA 4UEWA 4DBLC 4V3BA 3TI9A 4D25A 3EMBA 3MG9A 1NDHA 3BGOS 3FBGA 4QXAA 2G06A 1QIEA 4ATNA 5ADVA 1NW5A 4E5DA 1VKNA 1XTZA 1P4JA 1ZC4A 4OG2A 4INAA 4DZTA 3RNOA 1V1RB 5JUWA 1L7VC 1SUAA 2ILVA 2G76A 4DXHA 3A6JA 2OGWA 5B37A 1NSTA 3DS8A 1FLDA 5JMOA 2O7SA 2JATA 1Y98A 2VYVD 1FRQA 1U0HC 3FPSA 3QRWA 4BKOA 2ZAYA 1NXQA 1YJ8A 3HKDB 4YYEA 4ENPA 4D4KA 1PQ4A 5KWVA 1ENOA 4D81A 5K3EA 4UMDA 4C4RA 4UPVA 1YTUA 4XFDA 1NGSA 4YBZA 4ZT3A 2DMRA 2D0IA 1JTVA 3AX6A 4U0JA 4IO1A 3CZRA 2V3CC 4NXMB 1LRJA 1Z5OA 3H2BA 1Y42X 2V6BA 3U44A 4J2TA 4Z99A 1AQUA 1PJTA 1D2GA 4F5EA 2CT8A 2YVAA 2XGJA 1RT9A 3ADKA 3ORQA 4W6ZA 2IL1A 4CYMA 1KC3A 1VOTA 2VT3A 4YJ2F 3HM9A 1JFRA 4JZYA 3B9QA 3QKRA 2BMAA 1P81A 3LXMA 4QAQA 2UXCB 1U5BB 2O3TA 2XHEA 4RTMA 1KGDA 1Q1EA 3RSHA 5H5JA 2BKLA 4MJ3A 5K51A 4QUIA 4GRIA 5JRJA 1WXDA 2RGGA 5E38A 1CEEA 4FTWA 4O2LA 1KEKA 3X43A 1K4KA 2Z2YA 1YBFA 4HLDA 5EZ6B 3W05A 5JADA 1O94A 2BFCB 2D2XA 5T4EA 3ER9A 4DIDA 1BW9A 1SCDA 4PHHA 4Y2XA 2I4RA 1F7UA 1OAKA 2B0JA 4MQUA 4UAJA 2BEWA 4JFAA 2BTEA 2P8SA 1POXA 4X8LA 2NYAA 1P33A 1BJRE 3LPDA 2HR1A 1P7PA 1SU8A 4CG0A 3SVZA 2QYSA 4XGNA 3TZEA 1D09A 4ZI7A 1KMHB 5JXHA 3RKUA 5FLKA 3UXMA 1XZDA 3V7NA 3WHIA 2ZIVB 1LF5A 3GVCA 1DX9A 2PVSA 3BMCA 3MB8A 3SHVA 5AW1A 1X1DA 4CMIA 1SHJA 2A0WA 2IYWA 3QEJA 4FLFA 4PYJA 2PZFA 3NDIA 4P3XA 3V2UA 3GBSA 1DUIA 1P7YA 1WW3A 3VR6H 2CSXA 5E8RA 4JJ4A 4E5MA 4AX8A 4JLUA 4I5DA 3HU2A 2G71A 4PXYA 1OPRA 1LVHA 1A7AA 2PPVA 2PM8A 2XB6A 2FXVA 2ZE5A 1H4SA 2F00A 2KM1A 5KJCA 5FFMA 2RC6A 4JU8A 1XZLA 3VMMA 1A50B 5H16A 2PZJA 5B7NA 1YJBA 5EPEA 4U5XA 4K81B 3WBFA 1GT6A 4BCCA 4EUNA 3B6IA 3WIVA 3N07A 3R9XA 3FNBA 2Q9BA 4DQ0A 3H05A 4ZDKA 4G0ZA 3LHFA 2PS1A 3KYDA 1ZW6A 4WAUA 4D57A 2WHEA 4TL6A 4V3CA 3GZNB 3GLIE 1RP1A 1GKLA 1LSSA 4RXUA 3BB3A 3ZU4A 4HNHA 5BSGA 5AUNB 1UJCA 2DFNA 2W6NA 1RPTA 2AJ8A 2XUIA 3LOPA 3DXFA 2FVXA 4HAVA 5FUQA 1ISMA 3I5MA 5TX7A 4EJSA 1EZ4A 1M0SA 3ICVA 4WLVA 1GQOA 1V5IA 4GRAA 4CCYA 1PLLA 3FAKA 4JB2A 4RENA 5P21A 2MSWA 3L0OA 3DE7X 2IV7A 1LBSA 3NJ4A 4OMFG 1ZDMA 4RVNA 5AI6A 3ZZ0A 2VATA 3WB9A 4B6GA 1TAQA 1T3SA 2X9GA 4LZOA 4URFA 3GFRA 4EVQA 2ZXEA 1X1SA 2B92A 2RGDA 4YJHA 1WP9A 4G4JA 4ENQA 3Q0EA 4FCVA 1SUCA 4MV9A 3ZLVA 3EVTA 4F91B 2D3WA 3TNDA 2JLAA 1QHNA 3DMHA 3D0KA 1KAHA 1D6JA 3O95A 4HD8A 2LE0A 4KK4A 4NVRA 3ZV3A 1EU1A 1NQ5A 2NVUB 1QQTA 3WL5A 1Y3IA 3GAFA 1Q19A 4IDGA 1WD5A 4QULA 5CCXA 2O0LA 1W29A 3FHJA 3IEIA 3OZCA 2B83A 2R96A 4DDMA 1V5WA 1G3RA 2VDRB 2VL7A 4LYAA 3RD5A 3ELUA 5FQOA 1AXGA 1C30A 5EJGA 1SXJE 3UT0A 3P0IA 4L07A 4YJ3B 5LA6F 1NW8A 2Y1FA 2O50A 3FMIA 5BW5A 2AOTA 4D9CA 5L45A 1TC1A 1YTLA 4Y8VA 3PEYA 4UTRA 3RVKA 4GLOA 1E0AA 1XIVA 4FX2A 2JKVA 2HT1A 2G83A 1L7NA 1KYIA 2BHNA 3G5UA 1A5AB 1II8B 5ITZB 1PJ8A 2H48A 3FOCA 3QOWA 1U0TA 2SICE 2A1UB 1Q1GA 2WIBA 2X8WA 3KTDA 2XUDA 4IDAA 4WW0A 1BEUB 1G21E 1RKQA 3N5KA 1GKIA 2RONA 2Z4SA 3BWXA 4EUSA 1U0NA 5F12A 4Y6OA 3WA7A 2C82A 3GVHA 3AHDA 1X86B 2WJJA 1DIOB 3FZEA 4OFWA 5C53B 1J6UA 3KSRA 4IGKA 4YRTA 2WNSA 1M2EA 3BIFA 2V98A 4JMPA 4MUFA 5EP2A 2DKOA 1IEQA 2FSIA 2V58A 3FFTA 5IC6A 4B3DA 1ZU5A 2ACKA 3BM5A 4YCJA 1N5OX 4NZ9A 3K96A 3WK9A 2ATCA 2CLCX 3FWNA 8ADHA 2ZCUA 3VU0A 3WGTA 4P4SA 4WLUA 2PDAA 2BSQA 1FQKA 1YMVA 4B7UA 1IY0A 2AGVA 2W4QA 3ML1A 3NYIA 2B20A 4N6NA 4V1CA 3C3YA 4RV9A 4Q4CA 4FGWA 1MEJA 4JDPA 1NQOA 2BY4A 3JZFA 4O02B 3D4PA 1NUTA 5L3QB 1HO3A 3ETHA 3KELA 1T9ZA 4R2XA 3TMYA 1O94D 4IFTA 4OQLA 3ZEIA 3ZH9B 5A4JA 1G8JA 1VMKA 5HBRA 3NFRA 1JHDA 1TZKA 4AUMA 1V1MB 1BQ4A 4US0R 1CSEE 2NU7A 3RU9A 3SKYA 3H7IA 4LSZA 4YUVA 5BV7A 2IPNA 3BFPA 4WDQA 4RMIA 2V4ZA 3GW8A 4AY2A 2QS9A 2IY7A 3DE1X 4XB6B 3CE9A 3SQLA 3FDJA 1C3VA 1HE5A 1OAOA 1W7AA 1IPHA 1O3YA 1TKAA 3IP9A 4MR9A 1SKQA 3TQCA 4XH9B 4DZRA 3TIGA 5KVAA 5DP1A 4P5PA 2F8TA 3JQAA 5GOTA 4P7BA 2BFFB 3GCZA 3VV2A 221PA 5AK6A 2A0YA 3AG6A 3URKA 4BLPA 3QKSB 1EYZA 3L8CA 4RMHA 3IMGA 4R9RA 2BGLA 1BN6A 1ETUA 3ET4A 4ZQEA 1NJ2A 3U4IA 1DUSA 1QH1B 1VA4A 2QX7A 2Q1SA 3EH2A 4KYUA 3ZZUA 3PHGA 4K9DA 1KARA 3KJZA 2O2DA 4L2IB 3VTFA 1Y8ZA 3RVDA 2E21A 5NULA 3L93A 5C8DA 2YHIA 3IBYA 1KJIA 4N03A 4MGYR 4KITB 3ZKWB 4LMRA 1CHDA 3UCXA 5BSKA 4RMGA 5LDDC 5IFKA 1GZ3A 2FG5A 4G41A 2JLZA 2RMKA 2AOUA 5B1SA 3QX3A 3UC5A 1ZWLA 2FPPB 2CDRA 5H70A 3C3MA 4ENRA 4FVTA 2ZITA 3AFIA 2AHRA 2KLBA 2OWEA 1EK6A 1IXZA 1RJEA 2BZSA 2FHSA 3KWJA 3M2TA 3MS2A 4ILKA 1Q1ZA 1RXEA 1PL7A 3ABRB 3GJ4A 4XDGA 2PKQP 2VQSA 4EUEA 2KS6A 3KM0A 4I3FA 5KHAA 3SP1A 1P2FA 3FNEA 2J08A 4M1WA 4TLAA 2NTNA 2AFIA 4PQYA 3WQHA 1JB1A 1KA9H 5HBGA 1E6KA 3HEMA 1RM3A 4X7PA 2LDBA 5CB4F 2Z8ZA 3JWEA 1FX0A 1PR5A 1I1HA 1FYXA 5FTLA 1LC3A 4Q9JA 3H6KA 4ARUA 3GLFE 2JLWA 4HAYA 1E8MA 1HRDA 1P45A 2RGCA 4OJMX 4LGCA 2IPXA 2VP4A 3G82C 3U3ZA 3MS7A 3O03A 5GJWC 4XIIA 2I66A 1ICEA 2PT7A 3MUFA 1QG2A 4LQDA 2ZUUA 3UENA 3HS3A 3OOJA 3SDSA 2TMKA 1PR2A 4UVHA 3A6ZA 4CNQA 3L7LA 4LFAB 3SHFA 4PICA 3IIJA 2CYAA 2Y6UA 3BAFA 4YQEA 2Y0BA 2ONCA 1HRKA 3B1YA 4A6XA 3PG5A 1F5SA 3ELDA 3JRNA 5BW6B 4I81A 2RHTA 3OMWA 1AM4D 3DCYA 2CNLA 5F9FA 5FNVB 1I2BA 2PTHA 2FWJA 4MAAA 4ZT5A 4F9TA 1J8VA 3COPA 3TVTA 1FFYA 3QLUC 4D6XA 3GLGE 3I0MA 4MW1A 4CM1A 4L6CA 3B6MA 1LX7A 1U0OC 2FWNA 1Q3TA 1RI4A 3M6AA 3QVJA 3U2QA 2JGDB 2OXFA 4E4TA 1SVKA 1L0BA 3N2EA 2VTBA 1YR7A 2A9VA 4I1UA 2PKXA 3AEXA 3FJ1A 5FUBA 2YIDA 4JBGA 3TLJA 3V1MA 3QHQA 2I6UA 2VBCA 2H8GA 1C0IA 1I3LA 2YV1A 1H8EA 2ZI9A 3FKQA 1IUOA 4FZ3A 4K3UA 3RABA 4DMGA 4ZJYA 5KDDA 2FP3A 1T5SA 1PQYA 3NM4A 5D86A 1XCMA 2VHXA 5K6AC 3BK1A 3FGOA 2Z5GA 3T9DA 1QDEA 1T5HX 4YV1A 2IPLA 3TPFA 2EV9A 2OB1A 1YMQA 1ADGA 1IQ0A 2E18A 3WBBA 2PTGA 1H2WA 4JODA 1L8AA 4DMHA 3CONA 2D8AA 2Y2VA 4L95C 4MAMA 5B3JA 2JARA 4BNUA 1ID8A 2OFFA 4HUJA 5F7JA 3FBTA 4YGYA 4YMSA 2DE0X 4E0BA 5A06A