4HFJA

X-ray crystal structure of a double bond reductase from nicotiana tabacum
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
342
structure length
333
Chain Sequence
b'AEEVSNKQVILKNYVTGYPKESDMEIKNVTIKLKVPEGSNDVVVKNLYLSCDPYMRSRMRKESFAPGSPITGYGVAKVLESGDPKFQKGDLVWGMTGWEEYSIITPLFKIHDKDVPLSYYTGILGMPGMTAYAGFHEVCSPKKGETVFVSAASGAVGQLVGQFAKMLGCYVVGSAGSKEKVDLLKSKFGFDEAFNYKEEQDLSAALKRYFPDGIDIYFENVGGKMLDAVLVNMKLYGRIAVCGMISQYNLEQTEGVHNLFCLITKRIRMEGFLVFDYYHLYPKYLEMVIPQIKAGKVVYVEDVAHGLESAPTALVGLFSGRNIGKQVVMVSRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Allyl alcohol dehydrogenase
publication title Biocatalytic Asymmetric Alkene Reduction: Crystal Structure and Characterization of a Double Bond Reductase fromNicotiana tabacum.
pubmed doi rcsb
source organism Nicotiana tabacum
molecule tags Oxidoreductase
total genus 109
structure length 333
sequence length 342
chains with identical sequence B
ec nomenclature ec 1.3.1.102: 2-alkenal reductase (NADP(+)).
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF16884 ADH_N_2 N-terminal domain of oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4hfjA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4hfjA01
4MVJA 3K2EA 4CUJA 1QG6A 5DP2A 3TZQA 2BFMA 3E48A 3DDNA 3K31A 1A7KA 4A03A 3OA2A 1NVGA 3JQ8B 1LBEA 4CV3A 2V6BA 1VJ1A 4TRJA 1V9LA 2Q1WA 4FC7A 3CUKA 4D45A 2GDZA 4BNXA 4ZN6A 2Q1TA 1Q1NA 5DOZA 3C7AA 2D4AA 1H93A 3HADA 1FJHA 1EUCA 2RHCA 3O9ZA 3RD5A 3T4XA 4ZQGA 4WCFC 3I9OA 3IJRA 4E5PA 4D7AA 1OOEA 4U6QA 4OXYA 3I1JA 1X1EA 4DQVA 1PJLA 2RBEA 3IOYA 3F5SA 3CSDA 5CG2A 1HDYA 4KUEA 4KMSA 3VHRA 3EZYA 1QYVA 3ZWYA 4BO0A 3B6ZA 1GTMA 3NYWA 4CM6A 6LDHA 2P5YA 2Y66A 2QZ9A 4CLOA 4IQ0A 2PR2A 2HMVA 3HQ4O 3VPGA 3DO5A 3L6EA 1WXDA 1N1GA 4KWIA 2VYND 2GZ3A 1V3UA 4W6ZA 4F6CA 5L7WA 1Y8RA 2YDXA 4CLOB 4NPCA 3P19A 4NI5A 4AJ4A 1C1DA 2PD3A 1HEUA 1WDLA 1W8DA 3AFMA 4M49A 3ZWBA 1HDGO 1QSGA 2VWGA 4KP7A 3ZV6A 1Y8RB 3AOEC 1HDCA 1XKQA 1R0SA 5HBRA 4E3ZA 1DC6A 1E5LA 4FFOA 4BNHA 1PR3A 3JQAB 1YRLA 2VHVA 2WYUA 1B8VA 4HFRA 1LC3A 2CSUA 3FWNA 2DC1A 1R4MA 2NACA 4LN1A 4BNWA 3UH1A 1V0JA 2VT2A 3PEFA 3RUDA 3ZU4A 1ISFA 1QYWA 1R4MB 1XYGA 3JYQA 1BXGA 3NUGA 4EJ6A 1WDKA 3OBBA 5THKA 4E4YA 2EW2A 1GYPA 1DRVA 1YQGA 1YVEI 1W73A 4BV8A 1V6AA 3ANNA 2Q2VA 3ZHYA 2PV7A 1ZEJA 3KYDA 3HHPA 1ENOA 3UVEA 4AJPA 3DB2A 1Z82A 2HO5A 4XZ3A 2QRKA 3F9IA 4OQYA 2CMDA 1XDWA 3KYDB 1R12A 4U0KA 3SVTA 1PZGA 1Z45A 2Y67A 4E2ZA 3GVPA 2RIRA 3JQGA 3L6OO 3DOJA 1UDCA 2FPIA 1Z73A 1Y5MA 3PYXA 3JQGB 4JIGA 5JCJA 4BMVA 4TRNA 1BMDA 2OO5A 2PD4A 2CUKA 4ZD6A 4Q3NA 1X0VA 4E2WA 1GL3A 4H15A 2UDPA 1D4FA 2Y1FA 4ND2A 2WWRA 4O1MA 1DIBA 4I5GA 2BI7A 3HFGA 5L45A 1YQXA 5BR7A 5A4DA 2Z1MA 5TLSA 3TOXA 3GAFA 4XYMA 3ZW9A 1H9AA 4G81A 3ZWWA 4BNYA 3U3XA 4CM4A 3HE3A 3H7AA 1J4AA 4YJFA 3H2ZA 3M2PA 3ZWNA 4EZBA 4PRLA 1PX0A 3AOEA 5F1KA 1H6BA 1HE2A 3RFVA 1GZ6A 4YJFB 4E31A 3E6AA 4AL4A 1HL3A 5G4KA 1HE4A 2EKLA 3EMKA 3GOHA 3SXPA 3A06A 3FR7A 2GNAA 3LQFA 3QWHA 4GMGA 3DR3A 4D42A 3U4CA 4P4GA 1C3VA 3O4RA 4XYLA 1CEQA 3M6IA 3OJLA 1UXIA 1OI7A 2P68A 3IQDB 1BG6A 1WZEA 4QFDA 3ZWCA 1NR7A 1A5ZA 3OETA 1G0OA 1DHRA 3CMCO 5B37A 3NJ8A 4MVJM 1ORRA 8ADHA 2R6JA 1GQ2A 5IN4A 3GHHA 2ILTA 4QX6A 1L1FA 3U62A 4Q39A 1MP0A 2Y1CA 1JLLA 1EVZA 1E92A 4EDFA 3GPDG 3FPCA 2O7SA 2P4QA 3G49A 3I9LA 1WNTA 1C0LA 1Y81A 2VYVA 2ZYDA 4PFJA 4AFNA 3QRWA 4XD2A 4CMCA 4OH1A 1PGPA 4RORA 2AQ8A 3DONA 4MP8A 1S7CA 2GR9A 2NLOA 3NDIA 2HRZA 3PRJA 4BGEA 1IHXA 3EVNA 3NT5A 4GKVA 1HE5A 3HDYA 3FD8A 2HK7A 4YTEA 1H2HA 2PKQP 3TZ6A 3ZWPA 1CQIA 4YQZA 4XGIA 4E6PA 3PWZA 5AYVA 5JY6A 3DZBA 1KYQA 1X7GA 2BRUA 2A9FA 2YDYA 2VOJA 5CHEA 5HA5A 2HKIA 4BQPA 1HDRA 3B1JA 3JQFA 1BHSA 2ZJ0A 4OXNA 4IS3A 4LCJA 3ETDA 1VE9A 4AJ2A 3KB6A 3PYLA 4B4OA 3GDFA 4IM7A 1IPFA 4U6SA 5A9RA 4GVXA 1T1RA 4WKGA 3KRTA 3JQ9C 2V7PA 1Z75A 4D44A 1TT5B 3QVWA 1OZAA 2EP7A 2HDHA 2FSSA 3RROA 1X14A 2UVDA 3JD4A 1JQBA 4WLVA 2XF8A 3ZWMA 1KEPA 5L9AA 2EJWA 3S8MA 2O4CA 3S2IA 5I7VA 1NTOA 3MJ4A 4D79A 1KBZA 3FNHA 4R5MA 1QLHA 3AI2A 1YB4A 4ZA2A 3H6KA 1UAYA 4J9UE 3FRJA 2ZJ1A 3T7EA 2EXXA 3G1TA 1V3TA 4PLPA 4WUVA 1Z6ZA 4IJKA 3PZBA 5DP1A 3RJ5A 3V2UA 2ZQYA 4DWVA 4OHUA 1XWFA 5B4VA 4GX2A 1LTHR 2B83A 1LDGA 1LLUA 1BDMA 1DEHA 3WIEA 2I76A 3OJOA 8LDHA 4NJMA 3PZRA 4ONEA 3F46A 1K89A 2EW8A 4JQCA 3F1KA 3LT4A 4GVLA 2PH3A 3OQ6A 3GFBA 3HG7A 1XEAA 2E37A 2VTEA 3K73O 3DAFA 5ES3A 5KTKA 3FN4A 3VKUA 1C0KA 5DT9A 3K9QO 3FI9A 1ADBA 2X58A 3NV9A 2W90A 4A0SA 4J1NA 1IYZA 4WLOA 3C7CB 3ZV3A 3WGGA 5JDCA 4RVDA 3GVCA 1NHGA 3TZHA 1U5CA 3QVSA 3GNQA 3HDQA 4E2YA 5C7LO 5JXWA 3WX0A 2WSBA 4RGBA 5CPBA 1UZNA 3RUEA 1H94A 4U0JA 1F0YA 2OGUA 1ZBQA 3HJAA 3OHSX 4W99A 5HS6A 4BHTA 9LDTA 3G17A 3JQ9A 5JPIA 1VKNA 4TRRA 3WTBA 1DOHA 1DRUA 3GG2A 1E3SA 3WNVA 4MJLA 3CMMA 2FZEA 1NQAO 2P4HX 3AOGA 4LCEA 2DBRA 3CTMA 1X1TA 5JAQA 1ISIA 5TQVA 1U4SA 3WGOA 1U3WA 3CKYA 1MG5A 2X0JA 2FR0A 4NFSA 5DBFA 3VZSA 2W2LD 1KVTA 3CZMA 4CL8A 5TGDA 5KVVA 2P5UA 3U4DA 3ZWXA 3B1KA 4RCVA 3JCZA 1WMBA 1PWXA 3H5NA 4R5HA 1Y1PA 1RPNA 5T8KA 2HJRA 1L7DA 5ENDA 3I9NA 1EBFA 3H8VA 4Q3EA 4PLWA 1K6JA 1ID1A 2AQIA 2E48A 3GUCA 3WR5A 4CM1A 5FWNA 4ND4A 4CJXA 4PRKA 3OF2A 5EERA 5HRUA 3U5TA 3WGTA 1BGVA 3SBOA 1O0SA 2HMUA 3S1LA 3W6ZA 1M67A 3H9QA 4IDFA 1ZVMA 5F3RA 1BW9A 4WEOA 5KJ6A 4C7KA 4RPGA 3T7CA 5I8ZA 4FOOA 1PJSA 2Q4BA 4WEQA 3JYNA 2PFGA 4C7JA 4HKTA 2ZQZA 1DIHA 5EINA 4MP6A 3AY7A 3VDQA 3DOCA 1VJTA 1NXQA 2DQ4A 2D1YA 4AJNA 3ITDA 3KBOA 3U4IA 2B35A 2CNBA 2GN4A 4IIUA 1A4UA 5KVQA 1EK6A 3A1NA 3ENNA 5JCXA 2X4GA 3DFUA 1X7DA 4CV1A 1N92A 2DBZA 1EE2A 1VRWA 1X0XA 2E49A 3A9WA 3DMTA 1I5RA 3KSUA 1Y9AA 4RVGA 2Y99A 2H6EA 3JYLA 3IKVA 4Z9YA 4CQMA 3KUXA 4ZQBA 1LNQA 5GY7A 3PHIA 1H6AA 3PGJA 4CLXA 5B4UA 4L75A 5K0ZA 4K6CA 1AHIA 3ZI0A 5AXCA 4A5OA 2YY7A 4FJ0A 2AEFA 3JD2A 4PCVA 5G0SA 4BNTA 1YBMA 4P4NA 2CVQA 3PPIA 5COBA 2O2SA 1O5IA 4GKBA 1T4DA 3NX4A 3PHGA 3SX2A 1IB6A 3D7LA 2I99A 4IJWA 1T26A 3BYZA 4EGFA 3GNSA 3NGLA 3PIDA 3DHYA 5KKCA 3VPFA 4FOSA 5IZ4A 1DLJA 2OORA 3NRCA 3BIOA 4H7PA 3QW2A 2EHDA 3IDSA 5TS3A 4L9RA 5BNFA 1QXSA 1XCBA 2DFDA 1JKJA 2ZIZA 4FFMA 4JBIA 2VRCD 1DIRA 1N7HA 5TX7A 4U8GA 4CM9D 2DBQA 2DU8A 4BQRA 2ZCVA 3AUSA 2UUPA 3E8XA 4MVJE 2X7HA 1GV0A 4GQAA 4R54A 2C54A 1AXEA 3GAZA 4ZRNA 2PWZA 3ZZNA 1CRWG 1C0PA 5U1PA 4RVSA 4WLUA 3VVBA 5HTOA 3AU9A 4GWGA 2B4RO 4BGIA 4TVBA 4TKLA 5BNIA 2NU7A 5EMHA 5JO9A 4PGFA 1H6DA 4D43A 5A04A 3O03A 1BWSA 1CERA 3O8QA 4YJDA 3D3EA 3O26A 1U28A 4PIVA 4BKRA 4K26A 3VZQA 4XR9A 3AW9A 3VH2A 2XOXA 5CG1A 3MJSA 5KVCA 4JGBA 1E3JA 3JD3A 1JDJA 1UXGA 3LT1A 4HFMA 3EGOA 4BNKA 1JU9A 1ZO8A 2A94A 3DHEA 1NASA 2GYYA 4DRYA 2JKVA 3F1LA 4R69A 3AUUA 4CLDA 3WSVA 3EZLA 4BL5A 4DIOA 1GR0A 3MEQA 2AEMA 4JN6B 2WJPA 4Z0TA 4W9NA 3H5RA 3R1IA 4Y8VA 1PZHA 1YJ8A 4WLNA 3I9MA 4XRGA 4RF5A 2H63A 1P1HA 2O3RA 5L7TA 2IDZA 4NBWA 1GD1O 3C8MA 4RLHA 4YR9A 5IXYA 1B8UA 4ZRMA 4WOKA 3ZNQA 3N74A 4HADA 5CP8A 1T2DA 1PS0A 2EGHA 4CR6A 5ITWA 5JC8A 1TEHA 3L77A 5L51A 3CEAA 2NU9A 3CPSA 3AM3A 1MFPA 1NFQA 2QW8A 4A2CA 3GT0A 3FPLA 4HFJA 4DYDA 3PQFA 5KJCA 4XYGA 3VTFA 4WOJA 5DCWA 4BNVA 3DFZA 1NVMB 4GSLA 4RF3A 3UF0A 3VH3A 3FWZA 1JA9A 4IMPA 3WGIA 4MIYA 3GEMA 4FFRA 4P22A 3AY6A 1GUFA 4CMJA 3V1UA 1U2DA 2Z1NA 3W4KA 1QYDA 4HBGA 1NM5A 1P44A 1PTJA 2PNFA 3TQHA 1E7YA 2UAGA 2YYYA 3NT4A 4FSHA 3R3JA 4JROA 1W6UA 4IDAA 4R01A 4CMGA 3RIHA 5JY1A 1OAAA 3PLRA 2VWQA 2IEDA 3GFGA 3RCBA 2NTJA 1PL7A 1CIVA 4GGPA 1E5QA 4J49A 4J9VA 5LDGA 4A73A 4B79A 4B7CA 3GN2A 2Z95A 5DNAA 5K1SA 1SB9A 5IDQA 3DTTA 1E7WA 4E30A 3ETGA 3E82A 1DJQA 4YAGA 3D1LA 1ZH8A 4B3IA 5BSEA 1NYTA 2GO1A 3MJEA 4O0LA 3FBGA 3ZV5A 3KSDO 4B7XA 2PZMA 1E7QA 1WP4A 4KDEA 1SPXA 2BH9A 3I4CA 1E3EA 2X22A 3UHAA 3RC7A 2DAPA 4KUHA 1OMOA 2I65A 2ZTUA 2AW5A 5EESA 4LRSB 1A4IA 1IHYA 1SEPA 1XU9A 3LLVA 3WLEA 1I8TA 1QKIA 4NR0A 4M89A 2V6GA 1PJ3A 1R66A 3GRKA 2BGMA 4RDIA 3SC6A 3TL3A 2JJYA 4OGWA 3GR6A 4EUHA 3SC4A 4BS9A 1WDMA 5TIIA 5L53A 1C14A 1J49A 2XPCA 4DXHA 2HAEA 3UAGA 3NTQA 4PZDA 1BVRA 3RI3A 4ND5A 1DFIA 4IDDA 3VTZA 2BMAA 3MTGA 5EQFA 2AQHA 3WJ7A 2O3UA 1UP6A 1B16A 4FJ1A 3BHJA 1DIAA 2D8AA 3H65A 4Y9DA 2C5EA 4HFNA 4ALJA 4WASA 4RZHA 4YT2A 2JAPA 4NK5A 5JMPA 5GZ3A 4IGFA 4OQZA 4CV0A 4UAGA 2BI8A 2GF2A 3ZHXA 1VL0A 1I3NA 1FF9A 3U4HA 2ZB8A 3EC7A 2W98A 4CV2A 3WOHA 3JQ8A 4XIYA 5F21A 3ZCXA 1ADCA 4ALKA 1B7GO 5CDTA 4DQUA 2RH8A 2ZKLA 4IIVA 2SCUA 2D2IA 1LRJA 3KOUA 5I7EA 2A92A 2EV9A 1LDNA 1Z7BA 5FYDA 1HE3A 2O2YA 3PTZA 4XIJA 4YRBA 5IDWA 4UVHA 2ZTMA 5JFOA 1M66A 1RM0A 1YJQA 4FFPA 4D41A 2O50A 1T2FA 3JQAA 1F8FA 4AJIA 2DTXA 5DCUA 1O89A 5TRTA 3UW3A 3RUCA 1UDAA 4NIMA 4Y67A 3UKOA 2HSDA 3RJ9A 1Z74A 4MO2A 3PQEA 3MWEB 3LC2O 1LRLA 3E03A 4DA9A 2Y1GA 3OJ0A 4ZGWA 3IL2A 3FCOA 1FMCA 2FP4A 4D3SA 1XU7A 4EEXA 4JJGA 5LCXA 1NPYA 3WXBA 1UDBA 2XXJA 1JAYA 5KJ1A 3COSA 3D5QA 3TFOA 1PZFA 2FR8A 1M2WA 4XB2A 3WDSA 3C85A 3WJAA 1XELA 2C2YA 4WCDA 4YB8A 2R00A 1E7MA 4RVHA 5LC1A 1JAXA 5BSHA 1MV8A 1SCUA 3L4BA 3JV7A 3N7UA 3QP9A 1I01A 1LQTA 1N7GA 1IOLA 2AHRA 1JKFA 1LSSA 3ONEA 5DZSA 1A9YA 2NQ8A 1I2BA 1B3RA 3MOGA 3GVIA 1QLJA 3HWRA 1BXZA 1NBOA 3BMNA 4MVJI 1YGYA 4PLVA 2E4AA 4DLAA 3BMNB 2J8ZA 4IZIA 1BXKA 3PK0A 3W6UA 4PZEA 1MFZA 2OXIA 4CLEA 1T4BA 1J5PA 2J3JA 2Y0DA 2RHRA 4YCAA 4HWKA 5I7SA 3WICA 3Q3CA 1GEGA 1QV6A 3DOOA 1CF2O 1VL6A 3JQFC 1I0ZA 2JL1A 1EDZA 1NAIA 2PGJA 3RASA 2Y0CA 3EY4A 3KXDA 3UN1A 4LW8A 3HNPA 3OJFA 4II2A 2JHFA 3AWDA 3U0BA 2IE0A 3ZHZA 1JWBB 4CM8A 1R6DA 1YL6A 3GEGA 4EUFA 2OP0A 2CVZA 2VHYA 4Q3BA 1CJCA 3DBHB 2EGGA 1XGKA 4AICA 4BB6A 3CH6A 4CM8B 4Y6RA 4BKQA 5HWSA 4NFHA 4FN4A 2EIHA 1HSOA 4CR7A 4R68A 3VH4A 3PDUA 4D3DA 1YKFA 3K6JA 1U7TA 1YS4A 1L7EA 4XYBA 3VDRA 1CYDA 4DLLA 4RQUA 3C1OA 3DQPA 4E2XA 2NTNA 3TF5A 3F5QA 3EHEA 3GMSA 3H9GA 4CMHA 2IXAA 2VHZA 2X0IA 2X86A 2A35A 3F6YA 4MVJF 5CDYA 3PHJA 3WMXA 1Q7CA 1QV7A 1LDEA 3LT2A 4WPGA 4J2HA 5ITVA 1QORA 3BTUA 3H4VA 1VL8A 3PIIA 2QZZA 1G1AA 1ZXLA 2YHUA 1FXSA 3JQ6A 1DBVO 2NADA 2Y1DA 1JW9B 4FFLA 4XGNA 2Q3EA 1KOLA 4DUPA 1AXGA 1HZZA 3ZN2A 3PJGA 4JLWA 1T25A 1IE3A 2G82A 4OOEA 5A06A 2D5CA 4PVCA 1NVTA 4BB5A 3RVDA 1NPTO 1UZMA 3ZGYA 1QP8A 1W4ZA 4Y98A 2D3TA 2ZB3A 1A7AA 3Q6IA 2FN7A 2EERA 1X15A 1UP4A 3DEYX 4IJVA 1V3VA 2A4KA 3GMDA 4FGWA 4DL9A 4HX5A 1P74A 4DYVA 1GCOA 3EVTA 1MA0A 1MG0A 2PGLA 5ADHA 3I5MA 4OSPA 4XDYA 3HB4X 4JX8A 3RU9A 5JDCC 4GX1A 3NGXA 4NJOA 2QRLA 2WMDA 2G1UA 3KYCA 4PLFA 2UYYA 1LA2A 4EI2A 2OZPA 2CVOA 2EG9A 4YT4A 1AE1A 4FB5A 2GGSA 3PJFA 3KYCB 5FI5A 3S55A 1TT5A 3RBXA 3OSUA 1N9GB 5IDXA 1D1TA 1R16A 1ZNQO 1PJQA 3EDMA 3JTMA 4W82A 1FDTA 1U3UA 3Q9UA 2QG4A 2DT5A 1UAGA 3WG9A 3FNEA 3BMQB 5EQDA 2PD6A 2VZ0A 3WGZA 1U5AA 2BFOA 3C1TA 5CPFA 1M6HA 3WGYA 1SMKA 4ZHSA 4I5DA 2B69A 5I8WA 2VUUA 3IUPA 4IGEA 2VQ3A 1E3LA 5IJZA 4CM5A 4RPKA 4QEDA 2AE1A 3H9JA 1U3VA 1R15A 3NKLA 1WMAA 5MDHA 4HXYA 1U7HA 3H3JA 3DZFA 3I6QA 4GPD1 4HNHA 4CMKA 3BZUA 3DC2A 1OFGA 5T8KC 4E5MA 2C20A 2J5QA 4R41A 1YOVA 2VN8A 1PEDA 4OL9A 3R3SA 1RKXA 3VC7A 1AN9A 1U3TA 1DRWA 1Y9EA 1YOVB 1PGQA 1P33A 3OJEA 4PG4A 1H9BA 2QIOA 3GK3A 4NBTA 2O3JA 3OQBA 2DPHA 3TWOA 5IAAA 3FNFA 3NDJA 4OOFA 2VNSA 5C37A 1D1SA 2Q1UA 2B4QA 4J4BA 4TMFA 4UVIA 2EKPA 1NQTA 3L6DA 1P1IA 3IP3A 1BSVA 3ON5A 4ZVVA 1WLYA 4NBUA 4BMSA 3DXFA 1VSVA 1Y8QA 3S2FA 3GVXA 3GDOA 3KEOA 4PN3A 5L40A 4AG3A 1Y8QB 2D0IA 4BNUA 2O48X 1EQUA 3DBLB 3EK2A 3KETA 4J90A 2PK3A 5G0UA 4Y6PA 4PVDA 2DFVA 1QYXA 3DMTC 3ZNNA 2GRAA 3KVOA 1MB4A 3MOIA 2ZCUA 4HV4A 2X5OA 1W0CA 2HUNA 2X0NA 5T57A 5IF3A 2CY0A 2ZK7A 4NHEA 4Z0PA 4WLFA 3B20A 4B4UA 4A10A 1YDEA 4RLSA 1E1MA 4DLBA 4JXKA 1HSZA 1E7SA 2NUAA 4NZ9A 1PJTA 3LC7O 1EMDA 2CF6A 4NDNE 3ZWAA 1PWZA 3Q2KA 3GNTA 3P2YA 3SEFA 4O59O 3WQSB 1MGOA 3ZV4A 1LI4A 4CLHA 1P1FA 5AVOA 3EUWA 4KUGA 5I9MA 2TMGA 3INTA 1R0LA 2IODA 3C7DB 4HNGA 1T24A 4DC0A 3CE6A 5ER9A 3PFFA 4D0RA 4BIIA 3MZ0A 2TMDA 3PWSA 4NMHA 5A5EA 4ND1A 1KETA 1NPDA 3WQQA 2V6MA 2FPGA 2FPPA 1SBYA 3LZ6A 1U8XX 4I5FA 4YAJA 1RM3A 1RM5A 4CMEA 1B14A 3QVXA 3I52A 1ENYA 2DUUA 4GLOA 3A14A 1ONOA 3AY3A 4RPJA 2VYVD 4RF2A 3WGHA 3K2BA 3UCFA 3OEYA 3NAQA 4GMFA 1ISHA 5H83A 5A05A 4BO4A 4FCCA 4LVUA 5CFZA 1H2BA 1U9JA 1GQQA 2NNLD 1B15A 2NV6A 4D46A 1EVIA 1ZMTA 3C24A 5BNTA 1YL5A 4LISA 2GD1O 4WK6A 4ID9A 2P9EA 3ZNOA 2QYSA 2VNAA 1GUZA 4R4JA 5L3ZA 2ZATA 4XB1A 5KNLA 4J2OA 2IEBA 4J7XA 4R1SA 1NR1A 1PJ4A 4Q3CA 4LK3A 4BO7A 4J91A 3DZJA 3WB9A 2HQ1A 2WD8A 4K6FA 3HZZA 1ISMA 1XG5A 6ADHA 3DAPA 1ZCJA 4YVFA 3SJ7A 1LDBA 5B4TA 4R16A 4OYRA 4JP2A 1N1EA 4ROSA 4KTTE 4LSWA 4UUNA 3STHA 1NAHA 3BMOB 3QJ5A 2I67A 2YW9A 4KQXA 5C3MA 3EYWA 1RWBA 5KKAA 2FHSA 3V1TC 4YA6A 2V65A 1J6UA 1I36A 4XYEA 5AQ1A 1ZJYA 3MWDB 5K6AA 1GZ4A 3BXXA 4Z3KA 3DBVO 3GZ4A 5MGBA 3AUAA 4B7UA 4MKZA 3PXXA 4W9NC 3OFSA 4NG5A 3BHIA 1VSUA 4GX0A 2GN8A 1TI7A 3EAGA 4I9NA 5JYDA 1DC4A 3QE3A 2CF5A 3U9LA 4EUEA 2QYTA 3INRA 4P8RA 1GEEA 1LUAA 3NDRA 2ZYAA 5F1PA 3G0OA 3KEQA 2JD0A 4GSKA 3KV3O 4GWKA 5G0VA 4BV9A 1DPGA 1PQPA 2HK9A 5ICSA 3AI3A 4BMNA 4MPDA 1TB4A 3LT0A 1ZUD1 5JSFA 3QWFA 4BO5A 2PLAA 3Q11A 3GPIA 3RC2A 3VZRA 1LDMA 4M87A 1EDOA 5ENVA 4ND3A 4NFYA 4ZICA 3OP4A 4XX0A 4URFA 2ET6A 5DCYA 2GCGA 2X1HA 4UEOA 1KVRA 4F6LA 1ZZEA 4MVJP 3W8EA 4NK4A 3RC9A 4GX5A 1YBAA 2O7QA 3QV1A 3OECA 4D0SA 5J23A 1XLTA 1EZ4A 4FR5A 2BKAA 4E5NA 1XA0A 5HM8A 4DVJA 2F00A 2POQX 4JP3A 5ILGA 2GLXA 2JFGA 3KSZO 2GASA 4IY1A 5CEEA 5G0WA 4W4TA 3Q2IA 2G0TA 2X0RA 1NWCA 3GY0A 5A3JA 1XIVA 1I3LA 5GZ1A 3RU7A 2OFPA 4CMAA 4YT8A 2Q4EA 4WECA 3VKVA 1TLTA 3WBFA 1I32A 4YEDA 4DPMA 1VJ0A 4BGUA 2W4QA 3LLSA 2GN9A 5AOVA 2JFFA 3WS7A 1LC0A 1KVUA 3NT2A 4BKPA 3X2FA 3FF4A 4AJHA 4BKUA 3UXYA 2J3IA 1Q2XA 3KHUA 3QWBA 2BHLA 2OUIA 2OBYA 4BNGA 3RC1A 2XXBA 2YFHA 4S3MA 3DMYA 1SEVA 4WLEA 2BD0A 2X6TA 3P2OA 3C3XA 2G5CA 3BTSA 3JD1A 3RAJA 1O94A 1Q0LA 2O3SA 4XKJA 4R3WA 2C82A 4BNZA 5JNLA 4DQXA 1Y5RA 5TT1A 1LX6A 5I7FA 3E9NA 5JMWA 4ALLA 1NNUA 2BFAA 3LF2A 5T64A 1DC5A 1KIFA 2C7VA 2BELA 4D3FA 2J3KA 3H2SA 2X5KO 1UXHA 4M86A 2VYNA 5TSDA 3JYPA 1DAPA 1HKUA 3GDGA 4LSMA 4N7RA 3RUIA 1U2GA 2WYWA 2H1SA 4E12A 1EEHA 2QHXA 4H16A 2LDXA 3CZRA 4LVCA 2B5VA 3L9WA 2WE7A 3KO8A 1PSDA 1I10A 1HDXA 2HMTA 1KC3A 4I1IA 4BO2A 1HETA 1RYEA 3WNQA 4QQRA 4CUKA 4E32A 2NWQA 4FQ8A 1Q7BA 2DM6A 5ILOA 3MCVA 4HP8A 2JD2A 1HF3A 4RVUA 4QTZA 1LLQA 1KVQA 3BTVA 2UUOA 4CL3A 5CDGA 4K9DA 1F12A 1GYQA 2DKNA 5ICMA 4G65A 2BFPA 1WAMA 4UVDA 1ZK1A 4PG5A 4AJEA 4CQMD 3S2GA 2IXBA 2I3AA 3ZU5A 1I30A 3I83A 2P9CA 4P38A 1KEVA 1E6UA 3GN1A 1HLPA 1NP3A 2J6IA 3UFXA 3DZKA 5GZ6A 1B8PA 1GPJA 3ABIA 3I3OA 1F06A 4QT0A 3KTDA 4YBZA 4O6VA 1PZEA 1DAOA 5ER6A 3E9MA 4CM3A 1BVUA 2VWPA 1QYCA 3VVCA 1GDHA 3W8DA 3I6IA 3ULKA 4J0EA 2C7GA 4UVGA 1ISGA 1YONA 1P0CA 2IRWA 3VAZA 3WYEA 1OC4A 4A27A 1P1KA 2QX7A 5KVSA 5JBIA 1M6WA 3Q9NA 2DVMA 1F8GA 5FI3A 3RUAA 4JNKA 4UULA 2P9GA 4ZQFA 4RV9A 3VZPA 3ANMA 3ROQA 3HDHA 2X9NA 3W1VA 2BF7A 3PLNA 3D3WA 4I8XA 3HDJA 4BKOA 1TXGA 1QMGA 3F47A 1ZMOA 2RAFA 1LRKA 2ZTLA 1E3WB 3B70A 3ICCA 4IXWA 4B8ZA 1E0DA 1JTVA 1MC5A 1I3KA 3D3WB 4UEKA 3PGXA 4AJJA 3WWYA 2VCYA 2X23A 4R51A 1VPDA 1T2EA 4OMUA 2GSDA 4TRMA 1JVSA 2CDAA 4GGOA 5BT9A 3RKUA 1FDVA 4YPOA 2WDZA 3GGGA 3F3SA 3GEDA 2CDBA 4QECA 4ZJUA 3W8FA 5IDYA 4J43A 3H9UA 4IMRA 1M75A 2R00C 3ST7A 1HZJA 1MLDA 2HMSA 2OOSA 5TF4A 3LF1A 5COQA 1GZ3A 1V35A 4IDCA 2Y68A 3L4BC 4FFNA 2VTDA 5JW6A 3QIVA 1UZLA 5L4LA 5JE8A 3L07A 3HFSA 1E6WA 4YYZA 1B26A 1PGJA 4NBVA 5DDIP 3SJUA 3DL2A 1CQJA 1DXYA 4DMMA 3QVOA 4FC6A 3GA0A 4M1QA 4MINA 1Q0HA 3ASUA 4PLCA 4AJKA 1SC6A 4MVJG 2C0CA 4J7UA 4XQCA 1MXFA 2X9GA 1UR5A 5G4LA 2B5WA 1I24A 1IUKA 3S2EA 5EN4A 4YJHA 3R0IA 4ALMA 1I2ZA 1K5HA 4NH4A 3LC1O 1KY5A 4YJHB 1EVYA 4BO9A 5C7OO 1UXKA 3G3EA 2ZB4A 4PLTA 3DZGA 3ROPA 2O3TA 4YWJA 5BQFA 1K2WA 2AMFA 4ZU3A 1D8AA 4CR8A 4E33A 4DBVO 2G76A 2E6UX 3WBBA 4YJGA 2OBNA 3PHHA 2DBVO 2DPGA 1PU2A 3BAZA 2OMEA 4U5QA 5L4NA 4CUZA 4YJGB 1P3DA 1PR9A 4IQGA 2IYPA 1C0IA 1EFKA 1U8FO 2PZLA 1JN0A 2Q50A 3QLJA 4HUJA 5JS6A 5IFLA 3TNLA 2CZCA 4BO6A 1C1DB 2ZTVA 3D4OA 3M1AA 4RL6A 1LXCA 4FD3A 3WMWA 3AK4A 1ULUA 3TN7A 2HU2A 4QXMA 3OIFA 4WNCA 3IIEA 1B3BA 5EL0A 1ZXBA 4Z9FA 4W7HA 3ONFA 4INAA 3V2GA 3TZCA 2I6TA 4YXFA 2JCYA 4OM8A 4ALIA 1UP7A 3JD0A 4KOAA 5CDSA 4J1SA 3ANLA 1YDWA 1B2LA 1ISJA 1BXGB 2I66A 3KZVA 4DREA 3AUTA 4BNMA 4IDEA 1IZ0A 5COAA 4J16A 1P1JA 1YE3A 4NU6A 4OKIA 1UH5A 3V1YA 3H3FA 4E5KA 1FDWA 5KIAA 3P7MA 3LK7A 1GYRA 1DHTA 2NM0A 4XDZA 5KJEA 4M55A 5B12A 5BSFA 4YAIA 1FK8A 1X13A 3V2HA 1VKOA 4KDFA 1HYHA 3HN2A 1K6IA 1S6YA 1NWHA 3DBRA 3NJ4A 1NFFA 4J4HA 2BLLA 3D5TA 4WCFA 1H6CA 4WGGA 2YZ7A 3DZHA 3DWFA 1GY8A 3DBRB 3GLQA 5JAZA 5AXAA 1C1XA 1P45A 4WCFB 3DBHA 2EP5A 4GAEA 2J3HA 1ONPA 3R6DA 1WW8A 4IXTA 4YAEA 1C1XB 1MXHA 4OSOA 1SB8A 2JHGA 2PY6A 4DTIA 5JC1A 2Z5LA 3QSGA 3EW7A 3W4JA 3E5MA 4KWHA 5L95A 2HRBA 1CETA 3FNGA 4I9UA 3RFXA 1ZK3A 2IZ1A 4X54A 3FSRA 4YRDA 5DF1A 4R9RA 1GADO 1GPDG 4CM4B 5JYEA 1Z7EA 3OIDA 4Z3DA 5G0TA 4PG8A 4FS3A 4R9SA 1PQWA 2RH4A 4R1NA 5JO0A 4RVFA 3UOGA 4ZQHA 1G0NA 2IYOA 2J5KA 3ZNPA 2VRBA 3MJVA 5TT0A 4B8WA 3HUDA 3PP8A 4IQ8A 4WNIA 1ENPA 4Z6KA 1AHHA 1VM6A 4B3HA 1O9BA 4KQWA 3WYCA 4DMLA 3ZDFA 2W2LA 1K6XA 1SZJG 1YQDA 4S1VA 3ZH2A 5JAIA 2YQ5A 2JD1A 5G4KB 4Q3DA 4B3JA 2BGKA 5K9ZA 1Y7TA 4MVJD 1HDOA 4N18A 1O8CA 1R4NA 2FSVA 3IC5A 1AGNA 4O63O 1R4NB 3JSAA 4RQTA 1PS9A 1YB1A 1T2AA 3UUWA 1EQ2A 4QO7A 3WWZA 3KLPX 5JLAA 3GG9A 1HYGA 2YJZA 3V5NA 2O4UX 3DHNA 3QHAA 4IBOA 4M54A 4B4WA 4PZCA 4DPLA 1DDOA 2B4TO 4FJ2A 1H0KA 1WWKA 2GN6A 4FPXA 1KY4A 5KJFA 1UJMA 3GHYA 3I4FA 4Q3AA 4WJZA 3UCEA 1E1LA 3BHMA 3ZHBA 7MDHA 3FR8A 4PG6A 1E1KA 3D4PA 3DAGA 3OH8A 2HCTA 5TJ9A 1N9GA 1X7HA 3UGKA 3WGQA 1ZW1A 4UUMA 5AXDA 4EITA 2PKQO 2D59A 2NVBA 1KEUA 3Q0EA 1KC1A 4P4LA 3ORFA 3BMQA 5G2OA 2Q2WA 3PI7A 4XGKA 1XQ6A 3ADOA 2G17A 2YV1A 3PVZA 3QWIA 4OO3A 1UXJA 4E0BA 5CEJA 1ADGA 3JYOA 3JQBC 3JQAD 2JFHA 1ML3A 3QY9A 1SOWA 2EWMA 4GBJA 1LSUA 4E13A 1IULA 3UCXA 4J0FA 4KZPA 2NVWA 5TNXA 4J1TA 1V8BA 3GQVA 1I33A 4R1TA 4HY3A 1PJ2A 1HRDA 2OHXA 2DTDA 3F4BA 2HK8A 1EVJA 1DC3A 4XWYA 3C1AA 1E7RA 3LDHA 5IN5A 3VH1A 2X8LA 2ZYGA 2CD9A 4BNFA 4EEZA 4TZKA 2UV8A 3WFJA 3IKTA 1SO8A 2VOEA 4IINA 4XCVA 5IZCC 3GVHA 3GC6A 1U4OA 2OL4A 4AJLA 1DO8A 1PL8A 2FRDA 1ZJZA 2VHXA 4MKRA 4CMEC 2FWMX 2IZ0A 2Q46A 4JBGA 1RYDA 5L4SA 4NNJA 5T5QA 2Q45A 2VRCA 1XR3A 4IS2A 1KVSA 1YO6A 3D64A 3GH3A 4CM9A 4IZHA 3IUSA 5JCJD 1PJBA 4TVOA 2AXQA 3H9EO 4MIOA 4DC1A 4RPLA 4MOWA 3RFTA 3DBLA 1R37A 3RWBA 2WD7A 4JBHA 1DFHA 3TZKA 5H82A 2YHIA 3PYMA 4IPTA 5B1YA 4GH5A 5A3VA 5F5NA 2WD7B 3RBZA 3I23A 4JJIA 4NJMB 2YHIB 4I5EA 3F4LA 1ZK0A 2AG8A 4FW8A 1ADFA 2DTEA 3BA1A 1YL7A 4NU5A 2VWHA 1JKIA 4Z9XA 1BTOA 1DFGA 4RDHA 1QR6A 3LVFO 5C7IO 2WM3A 1SAYA 2HLPA 3JQBA 3TOZA 4N5LA 5I9LA 4DPKA 4IUYA 1N8KA 4YRAA 3E5RA 4BNIA 1IZ9A 1TT7A 1RJWA 3RUFA 3WTCA 4XEHA 3QA9A 1MX3A 3IJPA 3E18A 4G2NA 1ZKMA 5T6BA 2B37A 5T67A 4C4OA 4TROA 1LQUA 5K6AC 1GU7A 2Q2QA 4LMPA 3WYBA 3AU8A 1H5QA 3W4IA 4XJTA 5IXSA 2PZKA 1E77A 3KLMX 1NHWA 1FDSA 3AFNA 4FIZA 9LDBA 1LDYA 1KERA 1YWGO 3WLFA 1PGOA 4I9HA 1HLDA 4BO1A 1PJCA 2C29D 4F3YA 5IZCA 4BVAA 1GUYA 4OXKA 2W2KA 2JCVA 4K1LA 4EJ0A 3PWKA 1EUDA 2RCYA 4DIFA 3ZWVA 4L74A 3GUYA 1CDOA 1NQ5A 2W2KB 1A27A 4EYEA 2AG5A 3HSKA 3LYLA 3JQDA 1EK5A 1XSEA 2IZZA 1G6KA 4MDHA 5DBGA 1E3IA 2Y05A 3JQEA 3D4NA 1Q7GA 4XR4A 5EIOA 4BOYA 3M2TA 1TVEA 4DGSA 7ADHA 4R1UA 3QVTA 1M76A 3VPSA 3KM0A 2EKQA 3ENKA 4Y6SA 5DULA 1XQ1A 2CDCA 3MJCA 1ZIDA 1BW9B 2O23A 2V6FA 2WTBA 3SLGA 1B0AA 2Y1EA 4BNNA 4PLGA 4MP3A 3BMOA 2FY8A 5A9SA 3RQSA 4OJNA 4ZQEA 3IS3A 3LU1A 3K5PA 1XHLA 5EPOA 2YV2A 3AM4A 4CM7A 3PHLA 5A9SB 4BO8A 3P5SA 4EW6A 3BMCA 1A9ZA 5CAEA 5C5IA 1YH3A 3RSHA 4MVJH 1ZEMA 3CINA 1U1IA 2GUGA 2YUTA 1ZSYA 3BMCB 2P2SA 3L4SO 4PLYA 4J6FA 3IMFA 4J3FA 3PQDA 4QUKA 1ZFNA 3ZWOA 1TA4A 1NX6A 4YAKA 4G5HA 4DIBA 5I9NA 2NU8A 2D5AA 1EE9A 2Q99A 4L8VA 2EJVA 1ONNA 1J0XO 3QQPA 4II3A 5IG2A 4CQMB 1P31A 2JAHA 3LSYA 3ICPA 3G79A 4H3VA 5FF9A 2AA3A 2DLDA 1OBFO 3G1UA 4AJOA 4LMRA 5DBIA 1ZK2A 4JK3A 2HMWA 4CODB 3TDKA 2O3QA 4XQGA 4XJSA 1VC2A 2BGLA 1E1NA 3JQCA 3VPHA 2YV3A 4TKMA 2Y0EA 5JDIC 2Q49A 3E9QA 2W8ZA 4J4TA 5L7YA 3HN7A 1PIWA 5A03A 1AUPA 1KEWA 2I5PO 3OEWA 1WPQA 4TQGA 3A28A 3X2EA 3N58A 4PLHA 1HWYA 2CFCA 4CMBA 2VZ8A 5A9TA 5LDHA 2PTGA 2DUWA 4XQ9A 4UREA 4XA8A 3FBTA 3ZU2A 3ZW8A 1PGNA 2NSDA 3KYBA 3TL2A 3IP1A 5A5FA 2H9IA 2VZ9A 3O38A 1OC2A 2QQ5A 4GLLA 3IAHA 4LRTB 3ROKA 3T4EA 3U09A 1GFSA 4YQYA 3JQ7A 5A1TA 2YQ4A 3TPCA 1DJNA 1UUFA 2VT3A 3OQ1A 3PJEA 1DSSG 2EEZA 3JQ7B 3SLKA 4CPDA 3VOSA 3ONDA 1F14A 4W7IA 3RBVA 1FDUA 4N5MA 1I3MA 4A26A 4BNLA 5KOIA 1GAEO 3O8QB 2H5LA 5FFFA 5F1OA 3WIDA 2HJSA 3K96A 4IJUA 4FDAA 2NU6A 1YBVA 5KCZA 4ITUA 1LJ8A 3MTJA 1PQUA 1HTBA 1T2CA 4XQEA 2C2XA 1IY8A 5DOVA 3GF4A 4CMIA 4RPHA 5DN9A 2VHWA 3PFWO 1T1SA 1BDBA 1VLLA 3ADPA 4TWRA 3RUHA 4MKXA 4CMIB 4L4SA 2AQKA 3CIFA 2WYVA 5KWEA 1PL6A 3WQRA 2Q1SA 4PLZA 1N5DA 4UUOA 2PZJA 1GV1A 1O95A 1ULSA 2VUTA 3GZNA 5BSGA 3RKRA 4AJ1A 5CEFA 2PGDA 3K92A 4OAQA 2NVUA 2WE8A 1A72A 1A71A 1ENZA 1ARZA 4QO8A 4ESOA 3ROMA 4LGVA 3GZNB 1P1RA 5JDIA 2YFQA 3TFQA 2NVUB 3L0DA 1N2SA 4L76A 1LEHA 2FZWA 4ILKA 3HB5X 1LSJA 1LU9A 4NBRA 4Z0HO 3NTRA 3ASVA 5H81A 3UICA 1NFRA 5A02A 4N5NA 4CLRA 3TJRA 5FEUA 3BTOA 1LLDA 4EBFA 4OKNA 4TZTA 4YACA 2AEJA 3I9KA 4CLRB 1EFLA 1EBUA 1HXHA 1LSOA 1WZIA 2FR1A 3OA0A 4L4XA 2JCXA 3WFIA 1NQOA 2GPTA 1HYEA 4QSMA 1KS9A 3GGPA 3MJTA 1P9LA 2VUSA 4EJMA 2NQTA 3K30A 4E21A 2Y1OA 2PKRA 3AJRA 2LDBA 1HDZA 4NQZA 1Y6JA 4RJTA 4GL4A 1JWAB 3AI1A 2P91A 4A7PA 2I3GA 3U49A 3OICA 4BGVA 3GGOA 1D7OA 3Q1LA 4F45A 4BNJA 1GQYA 1QRRA 2FOIA 4CQLA 5EJ2A 2QRJA 4IDGA 3H5AA 4DBZA 1CWUA 5U4QA 4CQLB 5JAMA 2R2GA 1WVGA 1K3TA 5TJHA 3ZU3A 3OMLA 4XRRA 2J5RA 3WSWA 3CXRA 4L0QA 3GRPA 4QFCA 4BO3A 1IL0A 2AE2A 3M1LA 4B4VA 2X5JO 4UUPA 2XAAA 3OM9A 4ALNA 1R0KA 1JVBA 3V8BA 2X9VA 2F1KA 3QWAA 4L4RA 4JJFA 3DZIA 4FGSA 4I08A 4RZIA 2B0JA 4J1QA 2C5AA 1SNYA 1EUZA 1ZK4A 4RO0A 1ZSVA 1PS8A 1O6ZA 1RM4A 1MUUA 2B36A 1K0UA 3L9XA 4K28A 1E3WA 2OP1A 1Q0QA 4IDBA 2EF1A 1SOVA 2NTVA 4J7CA 4E5YA 5HS4A 2GERA 3VPXA 4OIMA 3FTPA 1ZSNA 2FMUA 4M8SA 4RF4A 1YB5A 1MC4A 4O5OA 1I2CA 2PA3A 2Y93A 2ZB7A 3A4VA 3B1FA 3D0OA 4MIEA 5THQA 3TRIA 1P77A 1F17A 4UEJA 3NEPX 3E1KA 3ITKA 4KTVE 4WE3A 1D3AA 2E82A 3AM5A 1DIGA 3TSCA 3DTYA 4GI2A 3I9JA 4F46A 5U9CA 4UVEA 3K8ZA 4FBGA 1DB3A 2GZ2A 3FHLA 4BUCA 1LLCA 4Q9NA 3PJDA 4TSKA 5TC4A 5GMOA 2WEKA 5CDUA 2GZ1A 1GCUA 4YDRA 4YT5A 4R3NA 1P0FA 5AXBA 4AVYA 2I9PA 1IPEA 2C59A 2PH5A 4N54A 1BRMA 3PDJA 1HT0A 3INGA 4L73A 4U7WA 1DLIA 1YXMA 5F5LA 4PG7A 3FTNA 3NTOA 3ETEA 3OIGA 2C07A 1VI2A 1E6EA 4JCOA
chains in the Genus database with same CATH superfamily
3I6ZA 4F86A 3WMGA 3M9LA 5CYOA 2CXNA 4NBLA 2CLSA 2EFGA 4B2YA 5K3OA 1A7KA 3F6SA 1NVGA 2HIHA 3JQ8B 4WADA 4WHMA 1WMEA 2YWXA 1U3DA 3OJCA 4S2EA 3C5HA 4KNWA 4X65B 4HDAA 2GF0A 2Q1TA 4J2TA 3UMJA 3V80A 3GCWA 3KG2A 1NNI1 1JB9A 1H93A 1T91A 2QIPA 1FJHA 2GD2A 2R4QA 2X8WA 1EUCA 3N7AA 3VO2A 3WKEA 5JSUA 4HXEB 4O4HB 3C4QA 4ZQGA 2F6RA 1KOGA 1U0HC 1RWNA 2MWMA 3I9OA 4CQNA 2XB2A 3D1VA 1JG1A 1NULA 1IBRA 2X14A 4NQRA 1X1EA 4DQVA 5BNWA 3QNUA 3VTAA 3F5SA 3R6WA 2V59A 3CSDA 5CG2A 5F33A 3IUQA 4AP6A 4BE9A 3ZBPA 1E2DA 2A2ZA 3B6ZA 4XIGS 1TAUA 1K63A 2BGIA 3KVYA 3ZX5A 3HABA 2DZDA 4DUGD 2XQVA 1XC7A 6LDHA 4JP5A 1VLHA 1YE8A 2WP8J 1DZ3A 2PS3A 1IY2A 2HMVA 4LVNA 3EVAA 1JQAA 3DO5A 3L6EA 4OUDA 2LXNA 5L7WA 2K6GA 1W4LA 2VYND 1G2OA 1VLVA 1XVUA 1E79D 1EFPA 2PYDA 2W2PA 3AZQA 3QIAA 4MB6A 5EEHA 4CLOB 2J0UB 4YAUA 1C1DA 1TL7C 1QCDA 1J8FA 4M49A 4EMBA 1QSGA 1D6NA 1MRSA 1Y8RB 1Z4KA 2BFBA 2IHTA 2YXLA 2O20A 1HDCA 3MBIA 1P29A 3IT2A 4NYIR 1P6XA 2AMVA 1E5LA 1JG6A 1MH9A 4FFOA 2IYLD 3L06A 5AVVA 2VHVA 3UPDA 2XVAA 4PNHA 1LC3A 2CSUA 1R4MA 2NACA 3D6VA 4JLSA 2EZ8A 4C88A 4ICIA 3PF8A 3ANSA 1CDEA 2VT2A 2D5IA 1KEZA 1TD9A 1ISFA 1G2PA 1QYWA 1XCJA 5FD8A 5ITSA 1WO8A 2AYXA 1O97D 1NDHA 3MWYW 4LF8B 1C9YA 4PZLA 2O9JA 2BPOA 3JALB 3WMRA 2JFYA 1YVEI 1KAOA 2NTEA 1W73A 3GFOA 3RU2A 2C61A 3ZHYA 2Q2VA 3FHOA 1OHHA 3TRDA 1MPXA 1ZEJA 3M6XA 3GFQA 3HHPA 1SXIA 3RADC 1G7RA 3LL4A 3LMKA 1Z7WA 4TGLA 2QRKA 3KKOA 5EYPA 4D3XA 3TG8A 3F9IA 4OQYA 4U0KA 1XDWA 3BEDA 2Y67A 2LGJA 1NN0A 3MJDA 2QTRA 4NL4H 4I50F 4D2IA 2QMEA 2LUOA 3ZXUB 1LS6A 1RBMA 1VIMA 2MU1A 2P2NA 4ZVOA 1G6OA 1N5KA 2Q6OA 4XSGA 5EP2A 3SF8A 3MMZA 3BN3A 1NG1A 3DOJA 1UDCA 4L3WA 5HMMA 3CNBA 3CZPA 1Y5MA 4TMVA 4R6WA 1AQUA 4LZOA 1SHLA 1YA8A 5JCJA 1EX9A 3TVDA 1BMDA 4KREA 1Q1QA 2OO5A 2CUKA 3DWEX 4IH1A 4O2AA 4Q3NA 4E2WA 1ZC3A 4AMGA 1UPFA 3QELB 3CVJA 5CM9C 2Y1FA 4N6OA 4ND2A 1I1NA 3SF0A 3UT5A 2WWRA 3C74A 3GGJA 4O1MA 5J2TA 2JZNA 3AKZA 2IDMA 4J03A 4K9RA 2ZIAA 5A4DA 4RETA 1XZPA 1EVQA 5DIFA 1JDPA 4QDXA 2CCJA 4BDTA 1ZL2A 1DQNA 3ZW9A 4L0CA 5LP6F 3PUHA 2VO1A 3EMVA 3P8ZA 1LTQA 2WA1A 4I55B 1GTSA 1SUCA 4BNYA 5CW1A 1PFWA 1E89A 2PG3A 3PXGA 3IA7A 2JFOA 3ZY4A 2CT8A 3H7AA 2FSGA 2HCRA 3H2ZA 3M2PA 4PRLA 5FB3A 2WAOA 3AOEA 3A4NA 5HW0A 4TWBA 4FWTA 1KAMA 5A3RA 3I4LA 9MHTA 2XIJA 1AB6A 4E31A 5B7QA 1NNLA 4AL4A 3Q3JB 1M8FA 4KXLA 4WKPA 3NYRA 4EQZA 2LZ0A 4RZ2A 4FMBB 4FR0A 2PU5A 5T3YA 4NKRA 2WZQA 3QWHA 2HA6A 5IJ9B 1WHSB 1NZDA 1HNZB 1AIPA 3OCXA 4Q9LA 3U4CA 4P58A 5CX1B 4AXXA 2XWJI 5HDQA 4FLFA 3A70A 4E1AA 1ULAA 3GBVA 3IEKA 1NF2A 1UXIA 3L6UA 1OI7A 3HKCA 3QGMA 4IZ6A 4JUIA 3UM9A 3V7NA 2V55B 5TEVA 3ZWCA 1NR7A 1A5ZA 2GEJA 4WWHA 2J4FA 3NJ8A 4HNUA 3NP9A 3L6BA 2R6JA 2X0KA 3K6KA 1W9HA 2GVDC 5IN4A 4IFIA 2VRWA 3P97A 3ZOZA 4R2LA 3TFWA 4Q39A 4KN6A 4L6IA 1F7UA 2CYBA 1QAQA 1N2OA 2VEDA 3EAQA 4KXVA 4EDFA 5KTRA 1SHTX 3GPDG 4H7HA 3FPCA 3NDPA 4F84A 5KU7A 3LXUX 1E69A 3I9LA 1Y81A 5J3JA 3IESA 3HYSA 3IEPA 4AFNA 3QRWA 4XD2A 4EATA 1L5ZA 3DXZA 4BCCA 2YWDA 2AN9A 4OG2A 1JA0A 5E4YA 2GR9A 8ATCA 1I6KA 3SHQA 4EVRA 3PRJA 3WWCA 4BGEA 4AKSA 5K0BA 4P5DA 3FKJA 4BBAA 2D0PB 2WNIA 2Z2KA 3KYJB 5CFRA 5J4HA 3RSQA 1K08A 1WEKA 2BGRA 3JZDA 1CQIA 4J0HA 4MROA 4E07A 1JLMA 2QE6A 2Q0XA 2HPHA 3KAKA 3QXXA 3PWZA 2XWSA 4PO3X 4JLDA 5E1DA 3S6JA 4AB1A 1AK9A 5JNUA 4ACAA 1X7GA 2VNJA 3KYIB 3GO4A 3K0FA 3KS9A 1EU1A 4LYFA 2IVZA 1CEXA 5HA5A 4BQPA 1GRVA 3LS2A 1SG0A 3N0TA 2ZJ0A 4OXNA 4IS3A 3VHXB 4W63A 3T3IA 3JWHA 1POXA 1DG1G 3HZRA 4O4IA 1MVOA 5BSTA 2OD9A 3F6EX 4UCWA 3B82A 1IPFA 3NAZA 4IM7A 4U6SA 2GWHA 2C0QA 5FL3A 5D6OA 3U26A 2BLNA 1E66A 1T2VA 2R5FA 1ODFA 1X74A 2X8BA 3F90A 3R5XA 4HDKA 5AR1A 3WK8A 1ZNYA 4BASA 3Q3HA 2YZMA 1QR2A 3AEYA 1W44A 1OZAA 2EP7A 1GVNB 2HDHA 4ASUD 3A11A 5EHNA 2UVDA 2PUEA 3AXSA 2REBA 1ECGA 4IIJF 2EJWA 1QC5B 1UMKA 1X8LA 2XYGA 4FP9A 5BOSB 2D74A 3K09A 3RE1A 2QF7A 2Q21A 3DNMA 3HLTA 3OAAD 4B9EA 2PUAA 3N70A 5F9MA 4EY4A 4D8XA 3KWJA 1US8A 1QLHA 1O57A 3MIIA 4ZA2A 5ICFA 1JJVA 2MSCB 3NAGA 4ZHQA 4J9UE 5JS8A 4ZPXA 3PD0A 4EKIA 4ZYXA 4X24A 2ZJ1A 1HMPA 4WUVA 4ENUA 3R09A 5DLPA 1DKLA 2HEGA 3FM9A 3PZBA 2P9QA 4JB3A 4L8GA 4O4LF 1RWPA 4JA2A 3RLFA 4HN4B 2VTVA 4PHCA 4DWVA 3G9XA 5LD2B 1RHKA 2EGUA 2XLCA 4PO9A 4GX2A 3R7BA 3ZLBA 2B83A 1RKQA 1UC4B 4X1IA 2NUPA 1W47A 3R75A 1BWRA 1DEHA 3SXJA 3UMFA 1SBNE 1ZY2A 2I76A 2F67A 3NOQA 3LT4A 5AD1A 1JFFA 2BGNA 1ZD1A 2WJGA 3UB3A 1KJIA 4IYJA 3HG7A 1L5HA 4AUNA 4QD3A 3L7OA 3AHFA 2FZLA 3BDAA 4ZARA 5FTWA 1P7CA 3I34X 4CIBA 2VXYA 4G0VA 3FN4A 5IRCD 3K9QO 2VUHB 4EHAA 1ADBA 1ZD5A 2WOOA 4JB8A 2AJDA 4MWDA 3TBHA 3MCWA 3TEJA 5ISMA 2EX0A 4D82A 4HDSA 4OSEA 1TU4A 2Q6IA 3C7CB 1NVEA 3MTQA 3QOYA 5FFNA 3U7EB 1DAEA 1ZD3A 2PSDA 5CXXA 5H70A 2R7KA 4M7RA 3EW9A 1S0UA 3IIKA 3ZXXA 1NHGA 3CYFA 3EIHA 4UBOA 5DYYA 1QJCA 3QVSA 4HQFA 4V0QA 3TZHA 4DWOA 1N2CA 2JCGA 4N12A 3T5AA 1JWLA 3WX0A 2WSBA 1Q7EA 5CPBA 4LF4B 2JA2A 1ZIXA 1ZYUA 2PMEA 1F0YA 1YDMA 2W6PA 1F6WA 3USZA 3WK7A 1ZBQA 3O92A 4JH0A 9LDTA 3AF2A 2HTFA 2PYZA 4G97A 4LOHA 1DO2A 1KAGA 3WTBA 1XO1A 1E3SA 2IA5A 4O25A 4UBIA 4B2PA 3JVEA 4MJLA 4AKIA 1AZWA 2ID4A 3KB1A 2WV7A 3N5CA 1FVXA 1QVVA 4YRQA 3P0RA 5LJIA 1GM5A 3EA5A 5KYTA 4R2IA 3ZBQA 2XD9A 4G5GA 4CKBB 3CKYA 3BXHA 4YJ3F 2X0JA 3HJTA 2VSOA 2RJNA 3VZSA 2W2LD 1PI3A 2ZUUA 5KVVA 3AIOA 4NPHA 1TKRA 3U4DA 3FZQA 3GX1A 2PS0A 3U81A 4X1YB 2H1RA 3TG2A 3E58A 1JR3A 2PH7A 3GWGA 4PYRA 2QNRA 4B6SA 4EA9A 4RTMA 1L7DA 3H2GA 1XUOA 4JFRA 2V3VA 2YUIA 5GJWC 3L84A 4BFSA 4CCYB 1K6JA 1GPAA 1JQJC 3D0QA 4EH1A 5CFMA 2I3BA 2QD5A 4CJXA 2HLDD 2EJTA 3DSRA 3OF2A 4PRKA 1BVHA 2IUTA 1BGVA 3LUPA 4G5OA 4M9RA 2Q5HA 3AEZA 1LCIA 4NMMA 3SBOA 4ZZ3A 5F7XA 3OWHA 1Q7RA 3F8WA 1FTQA 4P3NA 3ROEA 3U1VA 4B2LA 3B78A 1NXVA 1G7CA 5IUNC 5HYVA 3ZCQA 2EQAA 2YL2A 1L7BA 3A9CA 3NQ41 4FOOA 5I8ZA 1EVEA 2Q4BA 5C53B 3RC8A 2IUFA 1YQEA 4RSRA 2ATIA 2FDCA 2Y92A 5EINA 4KO2S 4MP6A 4DTCA 2HGZA 3SK0A 3UMGA 3DOCA 4FSXA 1N6OA 5AKEA 3VNAA 3IBTA 2FW7A 3ITDA 4YLEA 2C2MA 2DUJA 2GN4A 3ESRA 3GUVA 3V8RA 5BSVA 1NJ1A 1GSOA 3GJXC 4RD3A 4AIIA 2VZLA 4IHQA 2AZTA 4OQ4A 3E7FA 5BV1A 2W58A 2XB8A 1Z17A 4CV1A 2ZSHA 4ECAA 1X2EA 1G8FA 3A9SA 3SSAA 1FUYB 1X0XA 2E49A 3A9WA 3DNPA 2YIDA 4GBMA 1I5RA 3KSUA 1S9DA 3SVZA 4G8JA 2Y9MB 3MBKA 3IKVA 1OA0A 1BFKA 3FDJA 3R76A 1TZCA 5CB4F 3V4ZA 5EMLA 3PHIA 3PGJA 3EXG2 4OHFA 1L5NA 4XVCA 4BU0A 1HR0B 1CJBA 3DE2X 4X5OA 3HU2A 2W43A 1EKXA 3EDCA 1FFEA 2GPYA 2O5RA 1NYRA 2VBCA 3GGDA 3OZVA 2GAFA 1TA9A 3NHWA 4P7JA 1AHIA 4JP1A 2X0DA 4RABA 3U0VA 4D3YA 4A5OA 4J3NA 4BNTA 3IE2A 2HSZA 1IZZA 3A0UA 3EQ6A 3IHKA 3T7AA 1O03A 3I72A 3F9RA 5HILA 1QVRA 4WIAA 1GXSA 1I5EA 4F85A 3M81A 3NX4A 3PNBA 3PHGA 4Q4DA 4Y1RA 5FJIA 3VKWA 1ZMBA 3BD6A 3BXPA 3BH0A 1T26A 1OYOA 3BYZA 4FBLA 3DHYA 3TM4A 2FK7A 1RACA 1O95C 2BJWA 2OILA 3WRXC 3IUYA 1AQIA 3C14C 4DLPA 3NRCA 4X92A 1ULZA 3NIGB 4LTDA 3IDSA 2JFVA 3SM3A 2LCIA 4L9RA 1QXSA 1FXUA 2Q3CA 3EF1A 1KDOA 2DFDA 2C4HA 2Y0PA 2ZIZA 4KLZA 2WM2A 5FOXA 2JGIA 1XDBA 1YBHA 2Y2UA 1IBMB 1XP5A 1Y8ZA 2PSHA 4KMOA 4U8GA 1SA0B 3RNOA 3G9QA 4P31A 3I1YA 4A91A 1LB1B 4C6HA 2AX4A 2ZCVA 3HMQA 4QBKA 2A84A 1FNDA 4TYYA 4OQDA 1KK2A 4O2LA 5KVAA 4KZKA 1U0RA 3AVWA 4F2PA 5L3SB 1P5FA 2C54A 1I13A 4HUQB 3E7WA 5CK4A 1S4QA 4YRTA 3ZZNA 4DZTA 1V8OA 3U3JA 1C0PA 1AKNA 1TM1E 2OO3A 2XX3A 1JLHA 3VR4H 4R71A 3KXIA 3UMSA 1WB5A 3Q87B 4B6EA 3L6CA 1NZFA 1AT1A 4BGIA 4KQ2A 2FH5B 3ABZA 3L0IB 4QYIA 5IVPA 5JO9A 1QIEA 4PGFA 4BC0A 1H2XA 4D43A 3PXCX 2G9NA 4EY3A 1JILA 1F3LA 2OCIA 4BRWA 3UMVA 2IEGA 3EOZA 3C3YA 3Q41A 4OFBA 3U13A 5A62A 3QH4A 3HTXA 5D7BA 2OFWA 3BHNA 4JP8A 4XSVA 2E4VA 3V00A 3NVMB 3AW9A 4XR9A 2XOXA 4ZANA 3HGQA 2MSNA 4L02A 4F1KA 4JGBA 5A4MS 2WHXA 3UMYA 3HHEA 3BKXA 4P2BA 3PRYA 5EVJA 5H80A 4X8OA 5C8YB 1DZIA 4PV7A 4S1NA 4N1AA 3CVWA 4TWJA 2HWUA 2FN8A 4JEHA 2QTCA 4RVCA 1I6WA 1ZO8A 1GGNA 1NASA 2ZSBA 3PD1A 2OYRA 5CURA 2Q3LA 3AUUA 3DLIA 1V1RA 5KYUA 3WSVA 8GPBA 1AD2A 3HXPA 2ZS9A 4CKEA 1VKJA 5J4YA 1I1QB 3LI2A 2EFYA 2F4VB 3LY9A 1PR2A 1NMZA 2B7LA 3KOOA 1BMTA 2WJPA 4EMSA 4H3HB 2PLWA 4RIEA 3R1IA 3TVTA 2V7GA 1SUPA 1CUDA 4OXRA 1TJ3A 3NM5A 1PZHA 1TUBB 3KL4A 3ACDA 1P1HA 2R84A 3ABOB 4F3KA 4HH1A 4NF2A 2KB0A 2VF4X 1Q91A 4GUDA 1AS2A 4UMEA 2VP9A 1SIOA 3THYB 1KZ1A 4YR9A 3GFPA 4ZRMA 1TTPB 4WOKA 1VHDA 4HG2A 3ZZ1A 4WZBA 3C5CA 1LFAA 1OF1A 1UKEA 1T2DA 2ZREA 3RVRA 4CR6A 1JZSA 4ZI3A 4IUCS 2ZJFA 4KPUA 1JFRA 1T5DX 3ODPA 1P3Y1 2IWHA 1JU3A 4EAAA 3AM3A 1MFPA 1Z88A 1NFQA 2F48A 4A2CA 4AKTA 4HFJA 1YDFA 4AC9A 3PQFA 4EG0A 1TE2A 1NXPA 2QGNA 4XYGA 2VKQA 4FFBB 4Y9TA 5DCWA 2FCRA 1EWKA 3ER9A 4MYCA 3DFZA 4D80A 1HNNA 1J8YF 2B25A 5REQB 1JA9A 4N0DA 3A6FA 4EHNA 4LWPA 2SKDA 3O2JA 4P22A 3HMKA 1GUFA 2J67A 3ZDYB 1R0BA 3KVVA 1KI1A 2Z1NA 1UZUA 3W4KA 1QYDA 1G9XA 3GW8A 4JT8A 5G40A 4IL5A 1OWLA 3K0CC 1PTJA 1WQ4A 2OLKA 2PNFA 3GEHA 2XHEA 2PMBA 3GDWA 1SQ0A 2YYYA 4GG1A 4LOLA 5KAMA 3TGLA 2VSXA 1W6UA 4IDAA 3E5HA 4D0GA 3MYYA 3TDNA 4MLPA 5JY1A 3PNSA 3PLRA 4RDCA 3BWXA 3PUVA 1DV1A 1TAGA 5ITZB 3R7WB 4IQ4A 2EHJA 3LOQA 2NTJA 1PL7A 1AVTA 1BCRA 3HGMA 1CIVA 4Y9SA 4BECA 2HMAA 4B4DA 4A73A 1CS0B 2XCLA 1MEJA 5MN4A 2JLBA 2NXEA 2WM9B 5DNAA 1OLOA 1WXFA 3IOBA 3RS3A 3P71T 4QOSA 5IDQA 3DTTA 4DBLC 4ZOBA 3H42B 4E30A 2VQ6A 3ETGA 1DJQA 4ENWA 4AD8A 2VK4A 4NAVA 1ZH8A 3D6TB 3BGDA 4KE9A 1NMSA 1NSTA 2P65A 3A25A 4O0LA 3FBGA 1C7ZA 3KSDO 4B7XA 3U4MA 2PZMA 1XVTA 1E7QA 3ESQA 4X93A 1UMCB 3KPJA 1WP4A 5BMOA 4L9AA 1CFJA 1SPXA 3A4MA 2X22A 2YFYA 2WLTA 2NPFA 2PJZA 2XZLA 4MR9B 3AR2A 1WX1A 1OMOA 1P0PA 2I65A 2ZTUA 1SIUA 3H3XA 4H3KB 1J00A 4GYKA 4KRGA 5CNKA 1Q1GA 2HWYA 5C31A 3ZXYA 4F2DA 1A4IA 1IHYA 2HPAA 4I50B 3VZBA 7ABPA 3WLEA 1I8TA 3BCUA 5LA6F 3WGKA 4L8YA 4CEJA 5LU9A 1QFSA 2C99A 2O8EA 5KOHB 1R66A 3U9SA 4MDYA 3GRKA 3QSYA 4CT4B 1JIKA 3E4DA 2JJYA 4OGWA 2OQIA 5SV2A 3AUYA 3IOMA 4IUDS 2GSWA 4MRMA 3CG0A 2XUPA 1OAOA 4HNAA 5BWCA 3W6ZA 2HZBA 1WDMA 4F5DA 4ZIRA 5TIIA 2ZRNA 5FR2A 3L7AA 4AS2A 1GRRA 3GXOA 2XPCA 5F23A 3AR7A 4YMIA 2WJAA 3KQNA 1YCHA 2RC5A 3GT3A 4II7A 3RI3A 1DT3A 2R8BA 2G9ZA 2WAMA 4ND5A 4NEQA 5K1ZA 5EP3A 1DKMA 2OV8A 1SKQA 2BMAA 1V25A 2OXFA 3R9KA 4KPGA 1RXYA 2ZGVA 5I4KA 5HJEA 4EUNA 4QTUB 3UJBA 2AQHA 3KCQA 1MDFA 4M76B 1KYZA 1WB6A 2HQRA 2IYFA 3T1TA 1DIAA 2ONKA 3ZI7A 4K9KA 3KKNA 1OV6A 1SKBA 3SOPA 1JKXA 3GLHE 4YCBA 1CXZA 4DSAA 3EOAI 2X15A 3LFTA 4RZHA 4BLRA 2VAPA 4CTJA 2ZJ6A 3AJ9A 4MRSA 4CU2A 1E9BA 2XE8A 4YT2A 4LY9A 1TTTA 3T99A 3VKFA 4EGQA 5GZ3A 4IGFA 1T6NA 2PQ2A 4UAGA 2BI8A 2ZT8A 4HTFB 4PYIA 4DDKA 4S05A 4TS1A 3H5WA 3IEUA 4HJRA 3SG0A 2EBFX 3EC7A 3TD9A 2C83A 1Q0ZA 4CV2A 1HTWA 4PBRA 1Q2UA 16PKA 4N9WA 5KYGA 4XE5A 4DQUA 3ILYA 1N2EA 4NECA 2WYIA 2O5CA 5I9BA 4WX2B 1U8CB 2YCBA 2D2IA 2O7NA 1VHLA 2ATVA 3AEUA 2OB2A 1PF7E 4AWAA 2QVGA 3SSNA 3UOWA 1SUIA 3JATB 1RD4A 3KQHA 4GD3Q 2O2YA 3RV4A 4DDTA 5IVIA 4X8MA 1SUBA 1XRNA 4L8FA 5DH9A 3FSGD 2P1ZA 1HQYE 1I2DA 3AR4A 1D6JA 2GD6A 4D41A 1VMDA 4QNRA 1X86B 2H06A 2Y76A 5DHAA 1IRXA 3JR7A 3TQIA 2BDUA 1T2FA 1GL7A 3KUCA 4NS4A 1C8VB 4AX8A 4F71A 2MT9A 1TKAA 5A5GA 1LBSA 1XK6A 2N1BA 3CBQA 4Y1GA 3PGLA 4RKYA 2MOKA 1N5LA 1J21A 5DWDA 3UKOA 3RSCA 1Z74A 3AUJB 3KXLA 4OV6B 2Q4OA 3PQEA 5C4IA 1XKLA 3MWEB 1EH5A 4P3XA 2AJLI 1GZUA 1JECA 4LF7B 1RRGA 3GRUA 4UCXA 3PE6A 3PQ4A 3E03A 2JGEA 2WUWE 1QFMA 2Y1GA 4G2TA 2CLEB 5B3JC 4ITVA 2G36A 3FCOA 1XAIA 1DJPA 4MITA 1LVUA 4FUTA 2DMRA 1IK4A 1W52X 2P2CA 3IQEA 4X64B 5DM70 4H27A 1NPYA 4KXXA 5LCXA 1U94A 4WXPA 5FUMA 1TVKA 1ZGZA 2FFAA 3FBWA 1DI0A 5EGSA 5M5BA 2XXJA 1JAYA 3EGEA 4IH9A 3UWOA 1GGHA 3TFOA 2GZSA 1L4MA 4KFRA 3NASA 2BFEA 3RAGA 1CR4A 2ZDQA 1FS6A 2R751 3G2IA 2KW5A 4TTAA 2PL3A 4UM9D 5FV7A 4LNUA 5FPYA 4ZOQI 2XEDA 1AKYA 1J7KA 3C85A 5A6SB 5ECGC 1LV7A 1W5TA 2C2YA 3WJAA 4B2IA 1H1TA 3IURA 4RVHA 2X8JB 1U9YA 3AKYA 4O4JB 5K8CA 1PYGA 3D54D 1SBCA 2XTZA 3SI7A 7REQB 4TQUS 4YRFA 3T5CA 5A0VA 1JEQB 4NULA 3UH0A 1G17A 3R7DA 1IOLA 2AHRA 3GFVA 3ONEA 4TZ0A 4IIDA 1I2BA 1T8TA 5GADl 3GQBB 1LBTA 3TGPA 3QY0A 2PANA 3QF4B 4IIJB 2IU6A 1NBOA 3CS3A 3D6JA 4KGDA 3PFIA 4PLVA 3TE7A 1QK5A 3T5GA 4DLAA 2OM2A 3LW8A 3H6GA 2J8ZA 2P6RA 4QRHA 3VV3A 2ZBUA 2ZI9A 4LECA 3OU6A 5FAKA 5TVKA 2IBTA 3TW8A 1J5PA 2J3JA 5LR6A 3MTAA 3G7NA 3R0VA 4HC4A 2XF2A 4L0MA 4XAQA 4O4LB 3WICA 2VJMB 5KC9A 3DEHA 5CD1A 4WY5A 4LCBA 1D09A 5KYWB 2CWWA 5JCOC 3JQFC 4NE9A 2JL1A 2XE7A 3X2SA 1NAIA 2PGJA 1KDYA 3RASA 3TOCA 1CR1A 2ZTHA 3EY4A 4RZSA 3UN1A 4CZ2A 1Q3TA 2WWWA 4LW8A 4II2A 2JHFA 3U0BA 3V6LA 2H11A 3N8NA 1JR3E 4RX1A 3ZHZA 4B3FX 1WOYA 3CZ4A 1Q21A 3GEGA 4DY4A 4NX2A 3H13A 2CVZA 2L69A 4EUFA 5JD6A 1CJCA 3TRIA 1Q22A 1XGKA 2D1TA 2EGGA 1KO7A 2I1VB 2OZEA 3FX2A 3FXAA 5B1SA 4Y6RA 4AICA 4XFKA 5J1TB 4PGHA 3UG7A 5DSZA 5AW9A 5JJIA 3LUJA 1HSOA 3CLTD 2IU3A 2QD3A 1Y3HA 3O8OA 4A4DA 3B7GA 4F21A 4PWYA 4BP8A 5B2FA 1L7EA 1YF3A 2VSYA 3BWDD 1Z35A 4JY7A 4NV3A 3A4IA 3BL8A 3Q5DA 3C1OA 1XRJA 4BFVA 3HYTA 3NVAA 2IPAB 1QGUA 3DQPA 4M60A 5UKDA 4E2XA 1ZD9A 2NTNA 3NHBA 3EHEA 2I2DA 3JQRA 4W9MC 2VDMB 2X86A 2A35A 1H2ZA 2XMSA 4LDNA 3PHJA 2ESRA 3KU1A 1D04A 4YQEA 3RYIA 1E9VA 1QV7A 1K66A 1FFYA 3AEXA 3AETA 3M5PA 4GMDA 1X1DA 1M33A 3V7YA 3BMXA 3PIIA 4DA0A 2FW1A 5FWXB 1D2AA 2QZZA 1RAHA 3JQ6A 1FXSA 2D1SA 4GXTA 3NBAA 5KQPA 1AUVA 3LDAA 4L27A 1HZZA 2NAPA 2PMWB 1IE3A 5KTOA 3D6FA 2D5CA 1GQRA 1NJFA 4BB5A 4Z5XA 5MFPA 2RGXA 4JMLA 4GZ6A 5ERGB 1B73A 3UV6A 3G8AA 1NPTO 1C7EA 1W4ZA 3EYAA 3MCTA 3QFTA 2PEYA 5ALRA 1WXIA 4XVRA 4Q7EA 3RVQA 3AB8A 4Y0AA 3C5WP 3DOIA 1S2IA 4YJ3B 1UP4A 2RAUA 4HLUA 5E3HA 2UYQA 3C3EA 3IVXA 2IVFA 5H1YA 4Y2XA 3L1HA 2CNKA 4FGWA 5K0FA 3IKLA 4HX5A 1ZUNA 4DYVA 4EY6A 3IIMA 4PPYA 3KKQA 1MG0A 2EDCA 2PGLA 3I5MA 3HB4X 5CCXA 1KJ8A 3K0AB 1L2TA 3ABRB 4GX1A 2JJ1D 3NGXA 2A88A 3P9XA 3L4JA 2QRLA 5LMZA 4DUYB 3FZYA 1N57A 3L1JA 4ZVPA 5CLQA 2XCRB 3ZK7A 3DC7A 3QENA 3AF6A 3PJFA 4P0TA 4I1VA 4MPPA 4PPGA 2GFHA 1TQDA 3SZGA 4KX3A 1D1TA 1R16A 3ESAA 2ES4A 3JTMA 3SM9A 3PX7A 1U3UA 3DPIA 3Q9UA 4MTLA 4LQ4A 3NUQA 4UDYX 1DX6A 3FNEA 3M8KA 3BMQB 1N5IA 1GFWA 1M5TA 4JZYA 1YI1A 2BFOA 3DBIA 4DHWA 3WGYA 4ZHSA 3KUDA 4ZOAA 1Y82A 4BVHA 1USWA 3AR6A 4IGEA 2OO7A 2VQ3A 2QVLA 1WCXA 4ZEOA 1E5XA 3AH8A 3RS2A 4RPKA 5CJJA 3VYSB 3FVTA 2WDPA 4GNRA 3WL3A 4C4TA 5G1OA 5HMLA 2AE1A 4UOZA 1U3VA 2ZJ7A 3NKLA 1ECFA 4BLUA 5AW5A 4YCCA 1V16A 2PNJA 3GJYA 1W1IA 3H3JA 2JW5A 3EGXA 4CMKA 4JLOA 1TM3E 2RDMA 4IHJA 5HJ5A 4LY3A 2AXPA 2QMYA 1X92A 1MCZA 5T8KC 2ZUTA 3ACBA 3GPBA 1OHHD 2MYUA 3LQQA 2IQ5A 3R3SA 2YXDA 2HO4A 1A5BB 3CPHA 5FPHA 3N0WA 3N87A 4BQSA 1YOVB 3REOA 4G9EA 1JDTA 3CB4A 2BEUA 2QX4A 4D9JA 2QIOA 3GK3A 4N65A 3FFXA 2DPHA 3NDJA 1E4OA 1FZQA 1S5PA 3FROA 4D92A 1ATZA 5C37A 3RTAA 2IZ6A 2OBLA 1Q5PA 2B4QA 3KE8A 3B1XA 3VXKA 1G8AA 4KAAA 2Q41A 2XQIA 3L6DA 3H1BA 2BFCA 3KQLA 1NR5A 2W2QA 4G6ZA 2LKDA 3IP3A 4TS3A 5E2IA 3UY4A 2C78A 2XOKA 1IB0A 2HR1A 1B43A 4YAOA 3QW4B 1VE7A 1BEEA 4GR5A 4WUTA 1UJ6A 3GDOA 5GVSA 5HE8A 5ANRB 1OREA 4EARA 4RTLA 2ZI7A 1Y8QB 5BSWA 1EQUA 2A33A 3ZDCA 3V8QA 3NW9A 4IMRA 2PK3A 3RNLA 1XEWY 1M5RA 3OSZA 1RVV1 2DFVA 2FZCA 3E35A 3DMTC 3HPQA 2GAAA 4KG7A 1JI0A 3TLYA 4EO9A 4BWFB 2VHUA 3I61A 3FPJA 1NXTA 1OZGA 5CA0F 4NHEA 5AHRA 1L6RA 1SJ9A 3B20A 2J9FB 5AWFC 4A10A 4WZBE 2D62A 3M9WA 3OCJA 4HLNA 1PEYA 2PSEA 1P4AA 2QZJA 3BXGA 3C15C 2YN2A 2R6FA 3IUBA 1J22A 4FGUA 4JXKA 2BP7B 1XVLA 2XGOA 2NUAA 2ZUSA 4ND7A 4TV8A 3UJPA 4C30A 1N77A 1PJTA 4GGMX 1JEYA 2SHKA 2PRSA 5CVJA 1H5NA 1HFJA 1PFVA 3F8SA 2AIRA 3ZWAA 1PWZA 3RJMA 3Q2KA 1KTVA 2WKQA 2W6IA 1MD9A 3H2YA 2B4KA 4QQFA 1G7TA 1Y8CA 2F3UA 2X2OA 4GR9A 4NRDA 2FSFA 2QTFA 4O59O 3TTSA 1OV4A 4CG3A 1W49A 4DIMA 1GA6A 1SGWA 3T9DA 1G6HA 1J39A 2OORC 3PC6A 4OI2A 3O4FA 1KY2A 1ZVVA 3IAM1 1U9IA 5DNDA 4DC0A 4IGIA 1P7WA 4NMLA 4D0RA 2AD5A 4ER3A 1WOMA 2HRDA 5K6TA 1NQXA 4JODA 4CFSA 1FY2A 3SIPA 4QM7A 1RXWA 2FPGA 1HLFA 2QN3A 2E21A 3OQNA 2CUZA 4HR7A 3A9TA 4I5FA 4MGEA 1MKYA 1D2GA 3I3SR 4DG5A 5LMCA 4BPBA 1UF9A 1XRPA 1B14A 3NORA 4LBVA 3OZ7A 3QVXA 4LJ4A 2FAXA 3FOCA 4N3BA 5IT9A 3C6ZA 5D2CA 1VP9A 4GI1A 3WGHA 2MDTA 2A5FA 4EB0A 2AN1A 2KMLA 3NHAA 2DQSA 3OEYA 1FA9A 4I1SA 5H83A 1T13A 4ZI5A 3PDIB 1G41A 2HOQA 4FCCA 1EFCA 1H2BA 4WY2A 5KYXA 4MI1A 1VGQA 1Q83A 1RZUA 2ZWOA 5FJJA 3ZQKA 1PRYA 2R6ZA 1EVIA 3JR3A 3KKMA 4HQNA 3LCMA 3HC7A 1J09A 3Q8LA 2PO5A 4A6PA 1FJXA 4WK6A 3ZNOA 2VDOB 3HM9A 2ANBA 2D6FA 1OTHA 1F4PA 1U99A 1SXPA 4KGZA 4L78A 1SFRA 1CUYA 3DMDA 2ZATA 4MHOA 1U28C 2GHQA 4ZJPA 5DGTA 3PCTA 4R1SA 4V1CB 5F1YA 1TM7E 2FKAA 3I76A 1Y9DA 4V39A 5BY2A 4YCSA 4BO7A 4J91A 1A77A 1S8NA 2WD8A 4NNOA 1NX9A 2Q6KA 4U39A 3USES 3E53A 3LZDA 2YMLA 1LDBA 5B4TA 3OFJA 1P1BA 1VBMA 4R16A 1IEXA 1N1EA 2BTQA 4ROSA 3QVVA 5E0OA 4LC0A 3KTFA 4TL8A 3HBNA 2C4UA 1H4QA 1WPXA 3W3ZB 4XW2A 1KIMA 2IITA 4M98A 3V1TC 4V38A 4M0DA 4HB2A 4DR2B 3ESZA 3I2KA 5AQ1A 1M2OB 1QPBA 2R79A 3ABQB 1VSQA 2ZANA 3MWDB 5IS2A 1U7ZA 2QLNA 3ELDA 4Z3KA 4JI4B 4JOQA 2J0SA 3GZ4A 1LBHA 1Z0DA 1ND5A 1W0KA 2YIVX 3KTAA 5IYZA 4NG5A 2CZGA 1DKOA 4F8EA 4GX0A 2KLHA 3EAGA 4MZXA 3S2SA 1X9IA 1F51E 1VPLA 1DC4A 3OPYA 2XA1A 4Y2YA 1DBQA 1K8XB 1XEWX 5CA1B 1T2UA 2F43B 2WBLC 3NOOA 5JSQA 4P8RA 4PX3A 1K0FA 2R85A 1LUAA 2R7AA 1Z0SA 3JTEA 2ZYAA 4MW0A 3OZGA 4UFNA 5F1PA 1K4MA 5K3DA 4BFYA 3VQTA 5LZ9A 2Q5FA 4KYVA 2P2GA 4H31A 4GWKA 1YFZA 4UAVA 1J23A 1CJSA 2HK9A 1U0NA 4EG6A 3CO0S 4O5AA 2TMYA 1WSAA 3OX3A 3R41A 3DMFA 3OZWA 1QH9A 4BO5A 1KFKB 3JWGA 3OQVA 5FBHA 1CUZA 1P60A 1Y3DE 1QO0D 4INOA 2P0YA 3B6JA 1QS0B 2P3SA 1YVDA 2WKWA 4P35A 1X7XB 4V0SA 5JNVA 1Y4ZA 5TQ0B 1EDOA 3GLIB 3TBFA 3AF4A 4XX0A 3WRYC 5K0GA 1DKQA 2AOVA 4OLAA 1KJYA 4ARSA 1JFVA 4URFA 4DQDA 4X6XA 3IYLW 2GCGA 1MO2A 4F6LA 1XP8A 3RAFC 1ZZEA 2IBSA 5EMKA 4R8KA 4MUIA 1L5SA 4ZCIA 4CKWA 3THWB 3FWPA 5DGDA 1QDUA 5EMNA 3GJTA 3OECA 3V48A 4DAOA 3L1IA 4ETNA 1LNSA 4D0SA 5AW6A 3U16A 5J23A 1QBKC 2UXCB 2BKAA 1X7WA 1S4MA 1UKZA 2IY8A 2PUVA 2YV5A 4QU8A 4UU1A 1NG9A 2QKYA 5HM8A 4JHXA 2QLJA 4G1EB 1YHYA 3OX4A 3M5WA 4G1UC 1O97C 1UCFA 5IM5A 5LA6B 3PCXA 4IHAA 2GLXA 4KVGA 3UENA 2QU7A 3OHMA 4F4HA 2GASA 3QMMA 1GUAA 3PPWA 3ZCVA 5IBPA 3QHPA 1RJGA 1TCVA 4DEYA 5E9QA 1NWCA 3GY0A 4BLPA 3EVEA 1NTRA 1L1EA 1GSAA 3GJ8A 2ORED 2QTHA 3AL2A 4OHCA 5HGJA 1U1EA 2ZPTX 5A5VA 3ZH9B 2R5NA 3QV2A 1J8VA 5I5GA 1WU7A 4U7DA 2FV8A 5JPCA 3KSRA 3EG9B 5KNCH 4QXOA 3DUWA 1N2JA 3DTVB 5IM4F 4AJHA 4TTPA 2PFSA 3OT1B 1Q2XA 5JEEA 2BHLA 4A6DA 4BNGA 2XA9A 4J0DA 3LHSA 4F6RB 1JHAA 1RWOA 2BD0A 3P2OA 1IEWA 4ZV9A 3U7HB 2PBLA 1EEXB 4C89A 3JD1A 3CJTA 1O94A 2ETVA 4XKJA 3ZE9A 4MPRA 1U0JA 1JR3D 2MMGA 2QV7A 4ID3A 3TUJC 4M4SA 3VU9B 4ALLA 5BW5A 5KTNA 3GUHA 1K9SA 2QUBA 4Q3KA 2BFAA 3AVXA 3T0FA 1DC5A 3IERA 2JBAB 2C7VA 3F2VA 1REQA 4X63A 5JAUA 1IG0A 4KR3A 3OT5A 2RMKA 1PT6A 2C4KA 3FDIA 4LZAA 3PVSA 5TSDA 4UHJA 3JYPA 3PITA 1DAPA 1NF8A 1RW4A 4CF3A 2WJZB 2XEXA 5B2ZA 1M8KA 1T2NA 3RUIA 1MU0A 4C0KA 3S7TA 4E12A 1EEHA 2YRWA 2CLCX 4MV1A 4OYHA 5AK0A 3ZE2B 2LDXA 2GEVA 4ENQA 5HQ3B 3A9RA 3CZRA 2IYVA 2B5VA 1IXKA 2A1TR 3V4RA 1CJKC 5JXJA 4BBJA 3BZBA 4BWVA 3KXPA 2ZJ5A 1HDXA 3FMOB 3MUNA 4V3CA 5CXSA 4RELA 3SAJA 4CUKA 5B2EA 1W87A 4FCVA 3KAPA 5AESA 2JD2A 4ZQCB 2TRSB 4GYJA 4QTZA 1LLQA 3K8OE 4KGXA 5LL6P 3G0HA 1KVQA 3CHYA 4BE4A 5HX7A 3BTVA 2UUOA 1OR8A 2IXTA 5CDGA 2B4YA 4K9DA 4N0MA 4Y30A 4N01A 2BW0A 4RKFA 1CY7A 1ITZA 3SHVA 3T4UA 4BMYA 1QP4A 1NW7A 3E23A 4P7GA 2R44A 1MR3F 2OA0A 2HIMA 4KK4A 3RVBA 1ZK1A 2H65A 3M34A 3S8EA 3LUHA 3LNTA 3JRXA 4TMWA 1IVYA 1FYDA 5IMSA 1GPH1 3QUCA 1P2GA 3JU3A 2P9CA 1PE0A 2C0PA 2WOJA 3G9ZA 4OHZA 4IIBA 3DWIA 3ONWA 3ZUPA 2J6IA 2IX9A 3DZKA 3NHFA 4BWGA 3SQDA 3QNMA 3TS1A 1GPJA 4DSZA 3QMPA 2YVKA 3TB4A 1CRQA 2XMPA 3VYVA 4UBKA 2QTWB 3BWCA 4G4SO 1HT1E 5I8PA 2CJYA 1C3EA 3AHEA 2HRQA 2DPXA 4M83A 3W5DA 2J87A 2A0YA 4KO1S 1ZH6A 4NENB 4QUIA