4HFJA

X-ray crystal structure of a double bond reductase from nicotiana tabacum
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
342
structure length
333
Chain Sequence
b'AEEVSNKQVILKNYVTGYPKESDMEIKNVTIKLKVPEGSNDVVVKNLYLSCDPYMRSRMRKESFAPGSPITGYGVAKVLESGDPKFQKGDLVWGMTGWEEYSIITPLFKIHDKDVPLSYYTGILGMPGMTAYAGFHEVCSPKKGETVFVSAASGAVGQLVGQFAKMLGCYVVGSAGSKEKVDLLKSKFGFDEAFNYKEEQDLSAALKRYFPDGIDIYFENVGGKMLDAVLVNMKLYGRIAVCGMISQYNLEQTEGVHNLFCLITKRIRMEGFLVFDYYHLYPKYLEMVIPQIKAGKVVYVEDVAHGLESAPTALVGLFSGRNIGKQVVMVSRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Allyl alcohol dehydrogenase
publication title Biocatalytic Asymmetric Alkene Reduction: Crystal Structure and Characterization of a Double Bond Reductase fromNicotiana tabacum.
pubmed doi rcsb
source organism Nicotiana tabacum
molecule tags Oxidoreductase
total genus 109
structure length 333
sequence length 342
chains with identical sequence B
ec nomenclature ec 1.3.1.102: 2-alkenal reductase (NADP(+)).
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF16884 ADH_N_2 N-terminal domain of oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4hfjA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4hfjA01
4TVBA 4XD2A 1LTHR 2CF5A 4AJEA 1VKOA 1VLLA 3VC7A 1E6EA 3OM9A 3OQBA 1Y1PA 3K96A 3PDUA 3M1LA 1UXKA 3FWNA 3VH1A 1P1FA 1E7WA 3L0DA 4I9UA 1I24A 2HO5A 3RIHA 1VC2A 3H9GA 1UP6A 4FOOA 2SCUA 4DPLA 3RKRA 1ZIDA 4FDAA 1QSGA 4BIIA 4R4JA 3EGOA 4OMUA 1YS4A 3F3SA 2JL1A 3U4HA 2C59A 3I5MA 1IPFA 5AVOA 2Y1EA 4BB6A 4IDBA 3GZNB 1EE9A 4Z9YA 1LRLA 4TROA 1K6XA 1GY8A 4YVFA 1IZ0A 2IRWA 2VRCA 1C14A 5LC1A 4YPOA 4G5HA 5I7SA 4R3NA 3QP9A 3SXPA 2EKLA 4G65A 4HY3A 1U3VA 4FJ0A 2XF8A 5JS6A 2E4AA 2NTJA 3H9UA 1QV6A 2AMFA 4Z0PA 1KOLA 2ZTUA 2B0JA 4WLFA 3VTFA 1FDWA 5B1YA 4WUVA 1Q0QA 2PGDA 4CLRB 1LSOA 9LDTA 3WJAA 4CQMB 4M54A 5LCXA 4CM9A 3O9ZA 2YUTA 2IYOA 2C0CA 2VYVD 5KVSA 1X1EA 5A3JA 1LUAA 3JD3A 3K8ZA 1NX6A 3ZWCA 3OH8A 5KWEA 1PJTA 1HDXA 1XYGA 4EUFA 3I4FA 4UVIA 4CMGA 4NJOA 2WYWA 1LLDA 1ZK3A 5JCJA 3ZWNA 4BNMA 1LDMA 5L4LA 4AJIA 1X7DA 5GZ6A 2HK8A 3DC2A 5DBIA 3BHJA 2W4QA 4CM4B 3RJ5A 3PQEA 2GD1O 4D3FA 5JYEA 2EGHA 5CHEA 1NP3A 1PS0A 3FBTA 3TZ6A 2QRLA 3ZWBA 1NAHA 3BMOA 3OICA 2NNLD 1MXFA 3Q1LA 1U4SA 4Z0TA 2UUOA 1NQTA 3K6JA 1BXGA 3OSUA 5U4QA 2DPHA 4BS9A 4RORA 1O6ZA 2VUTA 4GSKA 4KWHA 3ZNOA 2BI8A 3D4PA 2PWZA 3JYOA 1KY4A 3ZWYA 2BGLA 2UYYA 1BVUA 1P45A 3NGXA 3A28A 2ZCUA 1B15A 1SBYA 1JAYA 3EY4A 3SBOA 4FFPA 2HJRA 5KVCA 1NPDA 1E7MA 3OHSX 1NFRA 4EYEA 4W4TA 4FIZA 3ZNQA 3C8MA 3H2SA 1O95A 4OXNA 8ADHA 3C1AA 1KYQA 1RWBA 2DPGA 4CLOB 2CY0A 3V2HA 2X9NA 4RLHA 1VL6A 1U2DA 3FNFA 6LDHA 3UGKA 4YJFB 4DYVA 3DAFA 1ZBQA 4FQ8A 3W1VA 1M75A 3NEPX 4PLCA 5JDIC 3HN2A 3PQFA 1LBEA 1Y81A 2HMVA 1H2HA 1I3LA 5IZCA 4D3SA 3I9LA 3MTGA 1SAYA 1XLTA 3OJEA 3HDHA 4YEDA 4BV8A 4H3VA 4EGFA 2EHDA 5KJ6A 1R4NA 2Q99A 4RPJA 4QX6A 4PG6A 3CZRA 4E3ZA 2O3JA 5A4DA 3UCXA 3DZIA 3TQHA 2J5KA 3DBLA 4ND2A 2F00A 3ANLA 4E21A 4CMIB 1G0OA 2AA3A 4CM7A 5IAAA 4MVJD 2ZQZA 3I6QA 2GYYA 2O48X 3RROA 4QTZA 2EF1A 3PIDA 1B0AA 4CM3A 1HDOA 3TOXA 1WDKA 2DVMA 2ZB8A 4NJMB 4DRYA 2VYVA 4BQRA 3PDJA 1DHTA 1HE4A 4XJTA 5KCZA 4TZTA 1JU9A 2VCYA 1JVSA 2G82A 4HADA 4PLWA 4UVHA 1CDOA 2O3RA 2ILTA 4A73A 2X23A 3U5TA 4BMNA 1KBZA 2YFHA 3A4VA 4QFDA 4UUPA 2NVBA 4UVGA 1C0IA 4R41A 1W6UA 2Y1DA 1E92A 1GYRA 1AHHA 3CXRA 1XG5A 1ZK0A 2CFCA 3TJRA 1DFIA 1E3WA 1QR6A 4KDFA 4ZRNA 3NTOA 4TKMA 5L53A 1O9BA 5G2OA 4NFSA 3VHRA 1GCUA 3FNGA 3TL2A 1GYPA 2QRJA 1Q7CA 4PLPA 3SJ7A 4RGBA 1RJWA 4GGOA 2GPTA 3PJGA 1VM6A 1X13A 3H5AA 4X54A 5IDYA 4B3IA 2HCTA 2XOXA 3GZ4A 1Z75A 3GUCA 1EMDA 5L40A 5THQA 3W8FA 3DQPA 3JQ7B 3SVTA 4PCVA 4PZDA 4B8WA 2UVDA 5T5QA 4IUYA 2R00A 3WWZA 1BHSA 3ZHZA 2CDAA 4BNWA 1GQ2A 4MIYA 4Q3NA 4WEOA 2I66A 4XQ9A 1T25A 3NTQA 1JDJA 1WPQA 5AXDA 5A04A 1JVBA 3WNVA 1CETA 1ZFNA 4XYEA 2AQIA 2OBYA 1Z73A 2NM0A 3IJRA 3OBBA 1UXJA 3DWFA 3K2BA 3MEQA 4BO9A 2AG5A 2DFDA 3RAJA 4D43A 5IN4A 1P1KA 4FGSA 4DBZA 5I8ZA 3AFMA 3DAGA 3P19A 4CQLB 2ZIZA 1M2WA 3RUEA 1I30A 3FI9A 4II2A 2Y1CA 5JC1A 4J16A 2C29D 2C2XA 2FP4A 3D64A 2NWQA 4MOWA 1NQAO 3SJUA 3B6ZA 1GPDG 3PP8A 1K0UA 1TB4A 5HRUA 1ZXLA 3NT2A 2VHWA 3VH4A 4BO1A 3B1FA 2D5AA 3V5NA 4UEJA 3DBRB 1LSUA 1Z7BA 2Y1FA 3WNQA 1HDYA 3CKYA 3PFWO 4TRNA 2IYPA 1HEUA 1Y8RB 1YB1A 4MVJA 4E13A 2LDXA 2VYNA 1GADO 4BNIA 3AUTA 1C1XB 1OZAA 3LDHA 3VVCA 1Y8QB 3DAPA 5AXBA 4BKRA 1DBVO 3JCZA 4BNUA 3ABIA 4M86A 5HWSA 5JY6A 5JAZA 4LVUA 1WP4A 1F06A 1KC3A 4HNGA 4KTTE 4BNTA 2H9IA 3QWHA 4EBFA 2G1UA 1DRWA 3JD1A 4Z9XA 2GZ3A 3RQSA 1HL3A 2QX7A 3D4OA 1E7YA 4XIYA 2AQKA 1ADFA 2JD1A 5TIIA 3MCVA 1CWUA 1PR3A 4IS3A 5I7EA 5I9NA 5DDIP 3VZQA 1EK5A 3S55A 1Y6JA 2DFVA 2FPPA 2DQ4A 2Y0DA 4WLUA 1ML3A 3F1LA 2VHXA 3WGZA 2FY8A 4HP8A 4EW6A 3GVPA 1PR9A 1XDWA 1ZEJA 3HB5X 3IL2A 2YHUA 1EVYA 1QYVA 1EK6A 4DMMA 1ZZEA 2QG4A 3DOCA 5BSHA 3KEQA 2ZB3A 4JK3A 4TWRA 4OAQA 3Q11A 4QT0A 2VNAA 4JJGA 3W6UA 1PGOA 1D1TA 1E1LA 4FFRA 3ZDFA 3ICCA 4XB2A 4GAEA 3IJPA 4CUJA 1AXEA 5JAIA 2YW9A 2W2LD 2FRDA 3LT1A 4OKIA 4WLVA 3JQFC 1DIBA 2BD0A 4JROA 4RDHA 4NBTA 2WYVA 3QV1A 1H9BA 1I3MA 3PRJA 1JKJA 3I9OA 3CE6A 3AI1A 4GLOA 4CV0A 3GAFA 3A14A 3LVFO 2DT5A 3EYWA 2YY7A 2JHFA 1HZZA 3OA0A 3MJVA 4QO8A 4NPCA 5DCWA 5G4LA 4BNYA 3RBVA 4DIFA 4IQ0A 4AJPA 3M1AA 4ILKA 3R3JA 3D3WA 3S2IA 3AU8A 1PJQA 1P1HA 2A94A 1MP0A 4WPGA 1H6DA 4Y6RA 1I5RA 1NR1A 3GHHA 1XSEA 4ZQFA 3OQ1A 4FFNA 1VL8A 4CM8B 3CEAA 1A5ZA 3FTNA 4NBRA 1TT5A 1Y9EA 1WVGA 3DBHB 3PJFA 3JD4A 4Y8VA 4UEKA 3H4VA 3V8BA 1GPJA 4R54A 3Q6IA 3ZCXA 3I83A 3GRKA 2DAPA 2A9FA 1LLUA 2BRUA 3U9LA 4L4RA 1YOVB 1H5QA 2Q45A 1KC1A 4LISA 5EQDA 1R6DA 3RFVA 3DZHA 3ZU5A 4YB8A 1GD1O 3NX4A 1UJMA 2NVWA 4MJLA 5G4KA 3BMCB 3FBGA 2FR0A 1VJTA 1ZSYA 5K9ZA 3NV9A 4DTIA 2Q1UA 1XA0A 1PZGA 3E6AA 2JFFA 3DHEA 1PS8A 2PFGA 3GZNA 1P0FA 3RUCA 4OXYA 3SLGA 4FSHA 4W99A 4L75A 3WOHA 2UAGA 2FPIA 4WGGA 2EERA 4AJJA 4IM7A 5T64A 2VZ0A 5ER9A 4PLYA 3S2FA 3QE3A 4HFJA 1DO8A 5U1PA 4CL8A 5A9SB 4ND1A 1TA4A 5DN9A 1I33A 4CQMA 2Y99A 4GKVA 3ZU4A 3NRCA 4BO0A 4PLGA 1B14A 4ZRMA 3UICA 4BGEA 1PZFA 3Q9UA 2V6GA 4XYBA 5AQ1A 1TLTA 1ISGA 3RFXA 3FHLA 1I2BA 3H5RA 2C2YA 4TRJA 4BNXA 1M76A 5A06A 3NT5A 4BO6A 5BSFA 2VOEA 4K1LA 3T7EA 3UCFA 1XKQA 3GPIA 3JQGB 5G0SA 1U8XX 5LDGA 4Q3BA 4ONEA 3WLEA 4BNLA 5ENDA 2PY6A 2EWMA 4L8VA 2W2LA 3NDRA 5CEJA 4CM4A 2YYYA 4ZU3A 3BMQB 3ROMA 4IDAA 4H15A 1GU7A 2EP5A 3LT4A 3ZW8A 2GRAA 1LX6A 3MWEB 2RIRA 1U9JA 1C0LA 4RDIA 4MVJE 3RC1A 1RM5A 1AUPA 3EZLA 4RO0A 4CUZA 3QA9A 2WDZA 4XRRA 5I7FA 1I01A 2PKRA 1XCBA 3VOSA 4RF3A 4CL3A 5DT9A 1J0XO 4CMEC 2X58A 3GDOA 5TLSA 5DP1A 4AJLA 3QVTA 1DC6A 1E3JA 5FYDA 3GF4A 1A7AA 4FOSA 3O8QB 2OO5A 3AY7A 3LT0A 1X1TA 2POQX 3GEDA 3BYZA 3HQ4O 5BNIA 2C82A 5L7WA 3O4RA 4NZ9A 2G0TA 3TL3A 2ET6A 3EW7A 3Q2KA 2Q49A 4TSKA 2NU9A 5DZSA 5J23A 4RV9A 3KZVA 1JLLA 2XAAA 4BKPA 4FJ2A 3VZPA 4OHUA 3MJCA 1MG5A 1T24A 1T4BA 4R68A 1NNUA 3PWSA 3KLMX 4GX0A 1K2WA 1DFGA 4W6ZA 1NVGA 4DQVA 2HK9A 4DREA 2NADA 3WSVA 1C1DB 3F5QA 1EZ4A 3WBBA 5KNLA 2V6MA 4M8SA 3AY6A 3MZ0A 2NVUA 3C3XA 3JD2A 4QEDA 3WQSB 3AI2A 1QYCA 3INGA 5C3MA 1HDZA 2WM3A 1UR5A 5BSGA 5ENVA 2PZKA 1NQOA 4NNJA 3PPIA 3H65A 1HDRA 5KKAA 3JQCA 3HB4X 4R3WA 1HE3A 1PWZA 5KVVA 2IEDA 3CIFA 3V1TC 2VRBA 3DR3A 3ZHXA 4CMIA 2R6JA 5IZ4A 4D42A 1K6JA 3AM3A 5CEEA 3L9XA 2O7QA 2DLDA 3DZFA 5AOVA 2P5UA 2BFPA 1H94A 4BO2A 2EJVA 2VRCD 3CZMA 3E82A 5TQVA 3RUDA 5B37A 3W8DA 4J1TA 3DFUA 1A71A 3PJDA 2YQ4A 3WSWA 4EITA 2PTGA 3U4IA 1HE2A 2DBRA 3EZYA 4XCVA 4GVXA 1EDOA 4NK5A 3EVNA 4IY1A 4AFNA 2BMAA 2A35A 1NFFA 1QYWA 4FCCA 3QQPA 1E3SA 4RCVA 3KYCA 4ZN6A 2ZJ0A 4CM9D 2FR8A 1QORA 4NI5A 3NTRA 4P22A 4YTEA 3PHIA 3AUUA 4PGFA 4O0LA 2C5EA 3HWRA 4WOKA 1V3VA 3JYQA 4CV2A 4EZBA 5L51A 1R0LA 3V2GA 1IE3A 4A7PA 2PK3A 3LLSA 3UF0A 1Y9AA 4YQZA 4AG3A 5IDQA 1DC5A 4YWJA 4AJ4A 1MX3A 3ZW9A 2ZTLA 4GVLA 3STHA 3W8EA 4A2CA 5G0TA 5A03A 3KRTA 1N92A 4NDNE 3ICPA 3MWDB 4R1TA 4E2WA 1Q7GA 1QXSA 1M67A 3X2EA 3HE3A 3FN4A 3IAHA 4RQTA 3TRIA 3GVCA 4KWIA 1GUFA 2JFGA 5EPOA 4OIMA 2E49A 2PV7A 1N1EA 3UKOA 1PL8A 4YXFA 5JSFA 4WJZA 4NBWA 3SEFA 1D1SA 2QZZA 1FK8A 4R9SA 1ONPA 1E7QA 4L73A 1CJCA 3DHYA 1HLDA 5DOVA 2X9GA 3WIDA 3GEGA 4YAKA 1ZH8A 4R16A 2X1HA 2H6EA 1BTOA 2GN6A 4E33A 2Q2VA 3GNSA 1OI7A 1V8BA 4F3YA 4F46A 2W2KB 2WD7B 2AE1A 4XJSA 1LQUA 3QWFA 1EVIA 2X9VA 1R15A 4FB5A 4D0RA 2J8ZA 2GGSA 4PZEA 1NPTO 4AICA 2RH4A 1GV0A 2OGUA 3MTJA 3VKUA 3ZWXA 3JQ8B 4DPMA 3PFFA 1OMOA 3GAZA 3IOYA 1DPGA 1U4OA 3TPCA 1PL7A 1ADBA 1GZ6A 1RYDA 2VUSA 1MGOA 5F5LA 4BOYA 1PGPA 4J91A 3BXXA 3WR5A 3DO5A 3WYEA 1B16A 2VWPA 2AEMA 1PX0A 1U7TA 5JO9A 1HZJA 1N5DA 5JLAA 2BGMA 4XGIA 3U09A 1P1IA 5CDGA 1N9GA 1XELA 3U49A 1ISIA 3RU9A 3GFGA 1HWYA 2OORA 1RYEA 2YHIA 1DOHA 4XWYA 2J3KA 3T7CA 1C1XA 4FC7A 4LSMA 4W82A 1Y8QA 4A03A 4XGKA 3QLJA 4RPHA 2Q2WA 4M87A 4WOJA 3WWYA 1WNTA 3VPXA 3ZV5A 2YFQA 3KB6A 1ISHA 1L1FA 3COSA 1GCOA 4Q3EA 1MG0A 2JHGA 3KM0A 4PLHA 4JX8A 3GK3A 1XR3A 1LEHA 3PIIA 1VSVA 3RC2A 2GN9A 1CERA 3PHJA 3FR8A 1PSDA 3SC6A 1CIVA 3L4SO 2V7PA 1M66A 1GQYA 3NKLA 4YQYA 1LSSA 4DLLA 1P1JA 3L07A 2YDYA 3PGXA 2BFAA 4LN1A 2BGKA 1HSZA 4N54A 1PGQA 3TFQA 4NK4A 3LQFA 3WFJA 2Q1SA 3GRPA 4E5KA 1PJ4A 1WAMA 1X7HA 4WCFB 5TJ9A 2X8LA 1VSUA 4YAGA 4J4HA 2NV6A 3KEOA 4BQPA 2AEJA 3QWBA 3TZCA 2ZYDA 3FD8A 1KVSA 4CR7A 1IYZA 5ITVA 5TNXA 1RKXA 2X86A 3Q2IA 4RPLA 1EVJA 1UP4A 2I3GA 2JCYA 1ZSVA 3ZU2A 2EP7A 1QRRA 4FGWA 3DMYA 4LCEA 2PLAA 4DYDA 1OFGA 1LRJA 2NU6A 4R9RA 4DQUA 3BTOA 5TJHA 4H16A 3P7MA 3VVBA 3ENNA 3GPDG 1JTVA 4YAEA 2PH3A 1NAIA 2I99A 1IUKA 3KUXA 3JQ6A 3WDSA 1YRLA 3OIFA 3WGGA 1U3WA 5KJCA 1J6UA 3F47A 3KTDA 4PLTA 2JKVA 3TZQA 3K5PA 3NYWA 3QVSA 1V6AA 4R5MA 4MVJF 1GZ3A 1NWCA 4BKUA 4L4SA 2HRBA 4JCOA 2Y66A 1ZO8A 4WNCA 2IE0A 3LC2O 4LGVA 4J4BA 5DBGA 4HKTA 4PG5A 4TQGA 1GAEO 3OIGA 3W6ZA 5L7TA 4W7HA 1U5CA 4IS2A 4Y9DA 3ROPA 4IXWA 1YOVA 4LCJA 4U0KA 1YL5A 1WLYA 2C7VA 2RHCA 2X22A 2RH8A 4LSWA 3VZSA 1S6YA 4S1VA 4YJDA 4XX0A 1SB9A 3K30A 3LLVA 1ZVMA 3BAZA 4IXTA 4RVDA 1B8UA 1EEHA 2BKAA 1PJCA 3JQFA 3NAQA 4QO7A 2O4CA 3KLPX 3KVOA 1ZJZA 4RF5A 1EFLA 4ROSA 3W4JA 2VYND 3E8XA 4UREA 4EJ0A 1G1AA 1KVRA 5DCUA 1PTJA 5MDHA 1CEQA 3ANNA 1ZK1A 1BGVA 4KQWA 1KEVA 4DIBA 2DTEA 3GMSA 1NXQA 1XWFA 2FHSA 1AHIA 2PZJA 4J7UA 2EG9A 3NJ8A 4K26A 4JGBA 4I5DA 4Q3CA 3KV3O 4GX2A 4E6PA 4MPDA 1E5QA 1P9LA 1OC4A 3G1UA 3UHAA 3W4IA 1PIWA 2B83A 4YRAA 1F17A 1HETA 4GI2A 1SEPA 2DBVO 5JXWA 4YAJA 5DBFA 3KYBA 3JQGA 3P5SA 1IHYA 1Q0LA 2NQTA 1H6CA 2I76A 2IXBA 1Q1NA 3UAGA 5HTOA 2OHXA 2BELA 1DEHA 3GG2A 4JN6B 2HDHA 4CLDA 1SNYA 2P2SA 2Y0EA 1DIGA 2FPGA 2UV8A 2OMEA 4NR0A 2Y67A 1VE9A 1EUCA 3QVXA 2D3TA 4IBOA 4XQEA 3QWAA 3GUYA 4XB1A 1F12A 1H6AA 1UDCA 2DTXA 2E37A 4IIUA 4DUPA 3GDFA 4XDZA 4XYMA 1U3TA 1CQIA 4JJFA 1T2DA 5EMHA 1P44A 1Y7TA 3ZHYA 1EE2A 2DUUA 4WASA 4ZVVA 3W4KA 4FFLA 1O94A 1ISJA 3TSCA 1G6KA 3QRWA 1KVTA 4EJMA 2D8AA 1YQXA 4J1NA 2RCYA 3LF2A 4OL9A 4R69A 1DJNA 1QLHA 1DXYA 4FS3A 2XPCA 2OP0A 2GUGA 3GN2A 1L7EA 1DDOA 1O89A 1W0CA 2PR2A 4CMKA 3ZV6A 4IINA 3TF5A 2EEZA 3E9MA 3EC7A 1HE5A 4IZIA 3PWKA 4DWVA 4FC6A 4B8ZA 3I9KA 4H7PA 1DLIA 3EK2A 4IJUA 4O59O 3PTZA 3DEYX 2QIOA 3UW3A 2A4KA 5DP2A 2C5AA 1DC4A 5JPIA 3NGLA 5HS4A 4IQ8A 5ES3A 4IDCA 3OECA 4EUHA 4CM6A 2DC1A 3OETA 2Y1GA 3KSDO 3KHUA 3PJEA 2VHZA 4D45A 1LDYA 5A9TA 5L45A 4HXYA 3ZH2A 2TMDA 4MP8A 3H2ZA 3CINA 1YL7A 4DLAA 3H9QA 1ZK2A 2EKPA 3E9QA 2PKQP 2WE7A 4B7CA 2PGLA 2B4TO 2CDBA 4P38A 1YDEA 1TVEA 3HUDA 1PZHA 4CMEA 4JP2A 1Z45A 2W98A 4JXKA 4IMPA 3JQBC 4MKZA 4RLSA 1H2BA 2NTNA 2HAEA 2GN8A 5IFLA 2ZJ1A 3H3JA 3GEMA 2VWGA 3FF4A 1EDZA 5ADHA 3ROKA 4TRRA 1D3AA 4YR9A 3GVIA 1HT0A 5C7IO 3M2PA 3GVHA 3FPLA 3R3SA 1ONOA 5H81A 4PRLA 4O63O 5HBRA 3ZNNA 1WXDA 2H1SA 3AW9A 4LRSB 1FXSA 5L7YA 4CQMD 2QYSA 1BW9A 3FNHA 3IUPA 3ASVA 1A4IA 4OQYA 4NHEA 3U0BA 1GEEA 1R16A 4E2ZA 3GOHA 2VUUA 4D3DA 1ZSNA 1F14A 3OQ6A 1JN0A 3FPCA 1TI7A 2OL4A 5I8WA 3AU9A 2B5VA 2GZ2A 2J3IA 3AM4A 1BSVA 1EUZA 2QRKA 2EW2A 4TMFA 4ND4A 4ALIA 3DZBA 4ID9A 5CDYA 1OOEA 2P9GA 1YGYA 2X4GA 1WMAA 4J9UE 4GPD1 4BGVA 4TZKA 4IDEA 3S2GA 3JQAB 5JC8A 3BMNB 3GR6A 4R1SA 4MVJH 4TVOA 2C54A 5FI5A 2V6FA 5L9AA 2NU8A 3AWDA 5H82A 3FRJA 4NBVA 5EINA 3BMOB 4J7CA 1B3BA 1I10A 9LDBA 3WTCA 1W73A 1UXGA 1XHLA 2CD9A 2VQ3A 4J90A 3WBFA 1LDNA 1ONNA 5CPFA 3AK4A 5ILOA 3R0IA 4WKGA 1P3DA 1I0ZA 2HMWA 3ENKA 5F5NA 3TDKA 4YT2A 2BI7A 2AQ8A 2D5CA 1BXZA 2O3UA 1P31A 1V9LA 2H63A 3L9WA 2GCGA 4J3FA 4UULA 2CDCA 5A5EA 1R4MA 2Y1OA 3PK0A 3HG7A 3JQ8A 2RAFA 3Q0EA 2PD6A 5EJ2A 5CP8A 5A3VA 1BG6A 3JSAA 2AXQA 4FD3A 1UXHA 5I9MA 1N7GA 4P4GA 8LDHA 5TC4A 1UAGA 4K6FA 1MC4A 3INRA 2LDBA 1RM3A 3ETDA 3D7LA 5HA5A 2ZQYA 4PFJA 5K6AC 3WQRA 4O1MA 1GTMA 3PXXA 4YA6A 5CDSA 4EUEA 4R1NA 2CUKA 3NT4A 4K9DA 4PZCA 4E30A 1LSJA 2NSDA 3IIEA 3RBZA 4KMSA 3ASUA 1GV1A 2O2SA 3K31A 3OMLA 4P4NA 1PEDA 1OC2A 3HNPA 4D0SA 3QSGA 1WWKA 4FPXA 3OJFA 3FCOA 2Q2QA 4J0EA 1Q7BA 1R4NB 3ONEA 5IG2A 1PQUA 4GWGA 1KERA 4OQZA 2CZCA 3M2TA 4QQRA 4M49A 2VN8A 3VPFA 4CLRA 3ZHBA 5JO0A 2VOJA 1R66A 3ONDA 5CAEA 4GX1A 4BMSA 4B3JA 4ZICA 4CR8A 3DBLB 2UDPA 1MXHA 5G0UA 1E5LA 3VDRA 2J3JA 1XGKA 3G17A 3I23A 1HYHA 3WB9A 1HF3A 2WEKA 3I1JA 1D8AA 2AHRA 3Q9NA 5JAQA 1ULSA 4J6FA 1V35A 3JV7A 4WCDA 4E5PA 2ZTMA 3BHIA 2JJYA 3ONFA 3LC7O 4BGIA 4RF2A 4GQAA 2EV9A 2Z1MA 3PLNA 4PLFA 5A05A 1LA2A 4J4TA 4S3MA 4XR4A 4YRBA 5AXCA 1O8CA 3DZJA 4FFOA 1FDTA 3CH6A 2C7GA 3OJOA 1LXCA 2GN4A 4PLVA 4GH5A 2WYUA 1DIHA 1V0JA 3ZN2A 4ZQGA 5B12A 1BDMA 1PL6A 3VH3A 4IIVA 2GNAA 2A92A 4PG4A 4XDYA 1NYTA 3WXBA 2P91A 2X0IA 3D4NA 1HTBA 5KTKA 4W9NA 4IGEA 2G17A 1C3VA 3G3EA 2D59A 1DJQA 4IDFA 2YV1A 1UZNA 1LDBA 1ULUA 1A27A 2DBZA 2VZ9A 2WD8A 1TT7A 3GC6A 4IJWA 2OUIA 2OOSA 5JY1A 1YVEI 2IXAA 5FF9A 5JDCA 4FN4A 4JIGA 4B79A 2O3SA 4WEQA 2AW5A 2P4QA 1I3NA 3ZU3A 5TGDA 2HMSA 1QYDA 1CF2O 4CLOA 3OA2A 1F8FA 2PKQO 3PWZA 4E2XA 2PA3A 4YJFA 3TNLA 3MOGA 3HJAA 4I08A 4I8XA 1UAYA 3U62A 1LLCA 3N74A 1R12A 3AUAA 3DBVO 5ILGA 3GLQA 1AN9A 2BLLA 1SMKA 2EKQA 3G0OA 3OEWA 4IJKA 1T1SA 3ZWVA 2ZK7A 2JD2A 3EMKA 4GKBA 3JD0A 4KDEA 4ZQBA 4BKOA 3RUHA 1HDCA 2X5JO 4CMBA 1IULA 1QG6A 1WMBA 1E0DA 2Z1NA 4DQXA 4OSPA 4QUKA 3L77A 3H9EO 3U3XA 4TRMA 5FEUA 3LC1O 1IY8A 5G0VA 3HDQA 3RJ9A 2VZ8A 3UOGA 1RM4A 2Q4BA 1T2AA 4N5NA 1NVTA 4Y6PA 5L3ZA 3WTBA 4J9VA 1SOVA 4NJMA 4OM8A 1VRWA 3GDGA 3AUSA 1ZXBA 2X0RA 3DOOA 3GN1A 4YJGB 2HU2A 4Q3DA 4E0BA 1ENZA 3ZV3A 1B3RA 2VT2A 3DHNA 5G0WA 1E3EA 1QV7A 3C7AA 3IKVA 4BVAA 1PJLA 3I9JA 4PRKA 1KEPA 4GBJA 5EQFA 5K1SA 2YQ5A 3B70A 4QXMA 1I2ZA 5IDWA 1DFHA 4UEOA 3RU7A 3DTYA 1PJSA 2WWRA 4XIJA 1LNQA 1FJHA 4ZA2A 3RUFA 4A10A 1YQDA 4A0SA 2H5LA 2DU8A 5F1PA 3VAZA 2HKIA 3WG9A 5HM8A 1Y5MA 1NTOA 1UDAA 2IZ1A 4MINA 4E32A 1LI4A 4EDFA 4ND3A 4WNIA 1ZNQO 5L4SA 3D5TA 4JNKA 1YQGA 3UUWA 4RJTA 1UH5A 4E2YA 1J4AA 2E48A 3KSUA 3JQ7A 1PQPA 1XU7A 3LZ6A 4OOFA 4HFNA 5EIOA 4YT4A 3FSRA 3WS7A 4AJHA 4U0JA 1GYQA 4RVGA 4JQCA 5FI3A 4RPGA 1ZKMA 1C0KA 2ZB4A 2B69A 2CSUA 5EERA 1DRUA 4OO3A 1YJ8A 3RWBA 4E4YA 4MIEA 4CM5A 4BL5A 2GR9A 1T2CA 2O4UX 1X7GA 3QIVA 3C7DB 3KYDB 1E7RA 3PYLA 3RC7A 4BO3A 3I6IA 1NASA 4BNJA 3B20A 4CLXA 4CQLA 1MLDA 1Z82A 2FSSA 3R6DA 4M89A 1B2LA 2B37A 3RBXA 1KY5A 3JYNA 5ITWA 5THKA 1VPDA 1PGJA 3G1TA 3FTPA 2HQ1A 1A9YA 2I65A 5C7OO 2VWHA 4N18A 3D3WB 1PJ2A 7ADHA 4XZ3A 3CMMA 4L74A 3ZWMA 4J2OA 4I5EA 4L76A 2V65A 3MJSA 3DBRA 1LDGA 2CVQA 4F6LA 3FWZA 4CLEA 1K3TA 4ZQHA 1MFPA 4WCFC 2PZMA 1TT5B 5BNFA 1Y8RA 2OZPA 3RUAA 1W8DA 2Z95A 4XGNA 2X0NA 4DXHA 5DNAA 2E82A 3HFSA 2P5YA 3V2UA 4W9NC 1EBFA 2B5WA 4LVCA 2IEBA 5CG2A 5COAA 1N8KA 3DFZA 4QECA 4YJHB 3GG9A 4NBUA 3GT0A 3GGGA 4BNKA 3WGHA 1SOWA 4NFYA 5L4NA 3KETA 1PWXA 3E1KA 3EUWA 1B26A 5G4KB 1O0SA 3UVEA 3JQEA 4BNZA 5JDCC 5A1TA 1PS9A 1N7HA 2PH5A 1JA9A 3UH1A 3IMFA 3TN7A 4CMHA 5JMPA 3RUIA 1MB4A 2GDZA 3INTA 3ZNPA 4GL4A 1YKFA 4DBVO 3PHLA 4XA8A 2EW8A 3ZV4A 3LYLA 4Y98A 5TRTA 5I9LA 2E6UX 3I9MA 4EEZA 1KS9A 4GX5A 4U6QA 3D3EA 4B4OA 4AJ1A 2C07A 4Y6SA 4KQXA 4K6CA 5CDTA 4AJOA 3WJ7A 1NWHA 2CMDA 4RVUA 1DB3A 3AFNA 3PEFA 4DIOA 1CRWG 3L6OO 3PI7A 1I36A 3OEYA 1W4ZA 2QYTA 2B35A 3F5SA 2O50A 1N1GA 3GFBA 2GZ1A 1E1MA 3AOEA 1YBVA 1NQ5A 1E3LA 1ISMA 1A9ZA 2I6TA 3DMTC 3VZRA 2VTDA 3JQAA 3RCBA 3DZKA 5JCXA 3BMNA 3GGOA 4IDDA 2NQ8A 2D4AA 2X0JA 3C1OA 2PGJA 3HHPA 2AQHA 3JQBA 4MDHA 6ADHA 4B7XA 2FN7A 5I7VA 3A1NA 4A5OA 2EJWA 4LK3A 4KP7A 1E3IA 4C4OA 5CEFA 5JMWA 5BNTA 3E9NA 5T6BA 1P1RA 1GQQA 2DBQA 3KSZO 4BUCA 3R1IA 4CM1A 4XRGA 4TKLA 3UCEA 4BNFA 4CV1A 1QP8A 4JBGA 4QSMA 4CM8A 4OKNA 1EQUA 2Y68A 1BXKA 2CVOA 4GSLA 3CTMA 3QWIA 1NVMB 1XQ1A 4RZIA 1IHXA 3JYLA 5TS3A 1U28A 3ZZNA 3DBHA 4D41A 3M6IA 3I4CA 4PN3A 1T2EA 4DL9A 2WTBA 2FOIA 3E03A 2ZCVA 4RVFA 4GLLA 1AE1A 3IP3A 5A5FA 5KJEA 1DC3A 4RVSA 4BKQA 1WZIA 2FR1A 5T67A 5C7LO 4YT8A 3ZWPA 2BH9A 3RD5A 3BMCA 3GQVA 4ZGWA 2Y93A 1KEUA 1WZEA 1SC6A 3D0OA 1MUUA 1U5AA 4BNGA 1Q0HA 1J49A 3MOIA 3OIDA 3VTZA 2I3AA 1VKNA 3MJEA 4O5OA 1YONA 3OJ0A 4FW8A 4IZHA 4JP3A 4CUKA 1ENYA 3CSDA 2NVUB 4MVJI 1YDWA 3DXFA 1F0YA 4UVEA 3VDQA 4OH1A 3ZI0A 1Z6ZA 2FSVA 5A9RA 5EN4A 5IXYA 3H7AA 4J43A 4I5FA 3DOJA 3WYBA 5JNLA 1FMCA 5A9SA 3ST7A 3WGIA 3PZBA 4YDRA 2GASA 5ICMA 1YL6A 4KUEA 2GERA 4Z3KA 1TXGA 2DTDA 1NM5A 2HMTA 2DKNA 4J7XA 4P8RA 4YAIA 2HLPA 3VPHA 1X0VA 2JFHA 5DCYA 4KZPA 2FWMX 4PVCA 1GR0A 1R0KA 3L4BA 4HX5A 4WLEA 3ZGYA 2Q46A 4HV4A 1FF9A 1VI2A 4R01A 2J5RA 4Y67A 2Q1WA 4E12A 1GUYA 4HFRA 2FZEA 3GH3A 3IC5A 4E5YA 3ZWWA 4CV3A 5K6AA 5ER6A 3BMQA 2JCXA 3U4CA 3WGTA 1HYEA 3KYCB 4BO4A 4EJ6A 4A26A 3BTVA 4YACA 2NU7A 2FZWA 5JW6A 4YBZA 1HSOA 1I2CA 1KETA 4Z0HO 2YDXA 4EI2A 4ZJUA 5TX7A 4ZHSA 3WMWA 4Z9FA 1V3TA 4OYRA 3E18A 4CJXA 2JD0A 4II3A 2X7HA 2PZLA 1YO6A 2Q1TA 4GMFA 4HWKA 1ENPA 1GDHA 2W8ZA 3ANMA 2I9PA 3ON5A 3QVOA 4AJNA 4B7UA 4E5NA 3GA0A 1L7DA 5K0ZA 3PYXA 2IZZA 1OBFO 2IODA 3DB2A 1H93A 2QHXA 3NDJA 2Q50A 2XXBA 4PG7A 1R37A 2O3TA 4JBHA 1XEAA 3O8QA 1DAOA 3H9JA 4IJVA 5EESA 3TZKA 5C5IA 3MJ4A 3JYPA 3E5MA 3HN7A 1D7OA 3V1YA 4M55A 2WE8A 4ESOA 2YJZA 2BFOA 2UUPA 3L6DA 4EEXA 2V6BA 1HYGA 5JE8A 1Z7EA 2X6TA 4BNHA 4CLHA 5DF1A 3G79A 1RPNA 3CMCO 5F1OA 5IXSA 4DPKA 4R1UA 3OFSA 3F9IA 3H8VA 1KVUA 3EAGA 1DIRA 5T8KA 4BNNA 2VNSA 1ZMTA 4G2NA 5HS6A 2RHRA 2O7SA 1C1DA 1DHRA 2X5OA 4DGSA 4MVJP 2OFPA 2WSBA 4CPDA 1WDMA 4NMHA 1X0XA 4FR5A 2QW8A 4N5MA 2J3HA 3ULKA 5DOZA 4ALKA 3AOEC 2P9EA 3AJRA 3EVTA 3HDJA 4U6SA 3SC4A 3NJ4A 3IDSA 3AY3A 1YB5A 4UUMA 4QFCA 1K6IA 1SCUA 3E48A 1E1KA 3TFOA 1PJBA 4Q9NA 1PQWA 4Z3DA 3GNTA 3N7UA 1JKIA 5TSDA 2ZYAA 3DONA 1N9GB 2P9CA 1NBOA 5KIAA 2YHIB 1K5HA 3C1TA 4YJGA 1EVZA 2Z5LA 3GHYA 1M6HA 4ALNA 3K73O 4FFMA 1IB6A 3MJTA 3IP1A 2GO1A 2WMDA 4PLZA 3EHEA 5A02A 4U5QA 1U2GA 1XIVA 2GSDA 5F21A 3KXDA 2VHYA 5C37A 3E5RA 5GY7A 1D4FA 1JWAB 1PU2A 5IF3A 3L6EA 1TEHA 3VPGA 5TT1A 4YRDA 5H83A 1LJ8A 5GMOA 3VPSA 1KIFA 2C20A 4XKJA 2GLXA 4NU5A 3AM5A 2Q3EA 3FNEA 1IL0A 2CNBA 3GVXA 3UXYA 4OSOA 1EQ2A 4OJNA 1ADGA 2VT3A 3PGJA 4WLNA 2QZ9A 2OXIA 2ZKLA 3WIEA 3EDMA 5MGBA 2NACA 3O26A 4BV9A 1YB4A 2IZ0A 3WLFA 2ZB7A 1QMGA 4PVDA 4GGPA 1E1NA 1P74A 5IZCC 4LMPA 3X2FA 1U8FO 1T4DA 1UXIA 2DM6A 1QKIA 4ALLA 3WFIA 3QY9A 2J5QA 4XEHA 4PG8A 3ADOA 1BXGB 1ZJYA 4DVJA 1U1IA 1P77A 2R2GA 3AOGA 3JQ9A 1DLJA 5BR7A 4UAGA 1YBMA 1MFZA 3JQDA 1ZK4A 1AGNA 3KBOA 1I3KA 4MO2A 3WQQA 1N2SA 5FWNA 3WX0A 2CF6A 1MV8A 5IN5A 2W2KA 2WD7A 3DDNA 3KYDA 1JAXA 1NPYA 1HLPA 2QQ5A 3BIOA 1GEGA 2BHLA 4J1QA 5JAMA 4I9HA 1ZUD1 4RL6A 5DULA 2WJPA 1U3UA 1DRVA 4K28A 3ETEA 1CYDA 1EUDA 1VL0A 1VJ0A 2TMGA 3L4BC 4MVJM 1JW9B 4P4LA 1H0KA 4E5MA 1X15A 3RASA 1FDUA 3H3FA 4URFA 4BO7A 4I9NA 4NG5A 4I5GA 5GZ1A 5KOIA 1XQ6A 3NDIA 4A27A 1ARZA 3C7CB 4WE3A 3IUSA 2D0IA 3O03A 4BGUA 4J0FA 1UZLA 2D1YA 4LRTB 5COBA 4IMRA 3GY0A 1WDLA 2JAPA 2HJSA 4Q39A 4CODB 1HDGO 1LC3A 1ENOA 1PJ3A 3ZWOA 5JBIA 4DC1A 4OXKA 1J5PA 1BVRA 4N7RA 1ZMOA 3P2OA 5LDHA 1B8VA 1UDBA 2IDZA 1IZ9A 4C7KA 1G0NA 1NR7A 1LC0A 3F4BA 1U7HA 3GMDA 1BMDA 3LSYA 4LW8A 4XQGA 4B4WA 5GZ3A 5KJ1A 3Q3CA 3HDYA 4YJHA 3PHGA 3UN1A 5COQA 1FDSA 1LQTA 2P4HX 4ZQEA 3NUGA 3ETGA 4CMAA 3VKVA 1E7SA 4XYLA 1HXHA 1LRKA 2Y0CA 5IDXA 3IQDB 1SB8A 3QW2A 1I8TA 3F6YA 4XR9A 2FMUA 4BO5A 4F6CA 3ORFA 5KJFA 3OP4A 2O23A 1MC5A 1V3UA 1T26A 1KVQA 1ADCA 2YZ7A 4PIVA 4RQUA 2R00C 3BA1A 5CDUA 4BHTA 4ITUA 3KO8A 2AEFA 1O5IA 2VWQA 5ICSA 2RBEA 3F4LA 4YT5A 2ZTVA 3PHHA 3WGQA 1ZCJA 5AXAA 1Z74A 4Q3AA 4CR6A 5T8KC 1BDBA 1ZEMA 4B4VA 5BSEA 1SZJG 3ITDA 3ITKA 5B4TA 2JAHA 3PVZA 4WCFA 5F1KA 2W90A 3BHMA 4L4XA 4B4UA 3D1LA 1E3WB 3T4EA 4M1QA 3LF1A 3G49A 1DSSG 5EL0A 2BFMA 1NFQA 2DUWA 3H5NA 5CFZA 3QJ5A 1UP7A 2EGGA 3A9WA 4KUGA 3S1LA 3K92A 3PQDA 3C85A 4U8GA 3VH2A 4CMJA 4DC0A 2AG8A 3RKUA 4FJ1A 1P33A 4U7WA 4D79A 3BZUA 5AYVA 3LU1A 4XYGA 2JCVA 2PD3A 3BTUA 2O3QA 3SX2A 2VHVA 4DMLA 2PD4A 5IJZA 3ADPA 1VJ1A 7MDHA 1JWBB 1QYXA 1MA0A 2OP1A 4O6VA 3C24A 5CPBA 4JLWA 5T57A 3I9NA 3OJLA 3PLRA 1Y5RA 4L0QA 1E6WA 1OAAA 5B4VA 1UUFA 1T1RA 5BQFA 1ORRA 3ROQA 3TWOA 4JBIA 3RVDA 1RM0A 4UVDA 5TT0A 1JQBA 4HBGA 1YXMA 1ZW1A 4GMGA 1K89A 4IDGA 4W7IA 3TZHA 4J49A 3IS3A 1Q2XA 1HKUA 1ISFA 3K9QO 1GFSA 4N5LA 2YV2A 4D46A 2B4RO 4DA9A 1PGNA 2I67A 5B4UA 2D2IA 4HNHA 2HSDA 3WYCA 4D44A 2PNFA 3DMTA 2ZATA 1YBAA 4BNVA 4J1SA 1EFKA 4OGWA 2GF2A 3JTMA 1IOLA 4FBGA 2I5PO 1XU9A 1M6WA 4R51A 3TOZA 2F1KA 3P2YA 1YH3A 3D5QA 4KUHA 1A7KA 3DTTA 1CQJA 1H9AA 3U4DA 2G76A 4WECA 2BF7A 4BO8A 4B3HA 4HFMA 3DL2A 3B1JA 5L95A 3RI3A 3JQ9C 3IKTA 3AI3A 1SO8A 1JKFA 4ND5A 3V1UA 5BT9A 2EXXA 4Z6KA 4AL4A 1E6UA 4NIMA 4KOAA 1SPXA 1WW8A 4XQCA 3DZGA 1R0SA 3HZZA 1LDEA 3PZRA 4WLOA 3LT2A 4MP6A 2B4QA 4MKXA 3WGYA 3QVWA 4UUNA 3LK7A 3WGOA 4BMVA 3S2EA 3ZWAA 1PZEA 3OF2A 4MP3A 1H6BA 3I3OA 5TF4A 1BWSA 4AVYA 4GWKA 1LU9A 4INAA 2NLOA 3WICA 4ALMA 3F46A 1UZMA 4OOEA 3O38A 3HFGA 4I1IA 4LMRA 1HRDA 2YV3A 3CPSA 4HUJA 1BW9B 2O2YA 1SEVA 3B1KA 1AXGA 5JDIA 1NHGA 1NHWA 1YE3A 1C0PA 4AJ2A 4IQGA 4RZHA 5F3RA 2OBNA 1E77A 5JCJD 4AJKA 1B8PA 2Q4EA 3GGPA 4IGFA 4NU6A 3N58A 1A72A 2HMUA 3H6KA 3JQAD 3A06A 1F8GA 5CG1A 5FFFA 5JFOA 1EBUA 5KVQA 1FDVA 2CVZA 1DAPA 2HRZA 4WK6A 1GUZA 2Y05A 1YJQA 3RSHA 1T2FA 3K2EA 3UFXA 2X5KO 4NQZA 1A4UA 4UUOA 4MVJG 3RFTA 4J2HA 2EIHA 4RPKA 4YYZA 3FR7A 3QHAA 2AE2A 3SLKA 1B7GO 5U9CA 2VTEA 2XXJA 4RF4A 4E31A 4ZD6A 3CUKA 3KOUA 4KTVE 2J6IA 3S8MA 4L9RA 3HADA 3I52A 2ZYGA 4MIOA 2P68A 1I32A 1KEWA 1LLQA 2B36A 4F45A 4DLBA 4G81A 1IPEA 1S7CA 5JYDA 4IPTA 3BTSA 4NH4A 1DIAA 4D7AA 1QLJA 1YWGO 2NUAA 2HK7A 3T4XA 2G5CA 1X14A 2HUNA 1GL3A 3F1KA 4C7JA 4MKRA 2NTVA 3PYMA 1GZ4A 3RC9A 5KKCA 3WMXA 4BB5A 4R5HA 1R4MB 1ID1A 4YCAA 4ALJA 4CMCA 1P0CA 3HSKA 4NFHA 1BRMA 3GNQA 4RVHA 4JJIA
chains in the Genus database with same CATH superfamily
5JH7F 5KNCA 2YVLA 2B1IA 3WGJA 4AXBA 1CUHA 1NZFA 1AV7A 2LPMA 3GDHA 1T9BA 1VKOA 2G80A 2QI9F 5AJVB 1E6EA 1ETHA 2QR5A 4JX9A 3OC6A 4R83A 1HA3A 3ZBUA 1EYZA 1CZNA 1IUNA 1R0XA 1UXKA 1P1FA 1E7WA 2GZMA 3SDSA 4EYOA 2JIPA 5IBRA 2GLTA 4ZZIA 5JVDF 2W42A 5DM4A 3QVUA 4K86A 3DM5A 4KO2S 4BIIA 3EA0A 3GWZA 3Q9LA 4MQFA 5BW4A 2A4MA 3H17A 4R4JA 4ZEOA 1R0CA 1VBMA 2HA2A 4EY4A 1FYDA 2WUDA 3SPXA 1RHJA 4IDBA 4Z9YA 1LRLA 1A2BA 1OTHA 1SULA 1D7AA 2OV3A 3H1FA 1K6XA 1WS6A 3HWX1 3JATB 4TROA 2P9TA 6YASA 2VRCA 3LX4A 3JR3A 3HGMA 3UJ7A 3R0VA 4IJ6A 1K68A 4OHXA 2XF8A 1DADA 2NTJA 2P9BA 3H9UA 1A82A 1YBHA 1QV6A 2AMFA 4Z0PA 2P6RA 1RW4A 2B0JA 3HCFA 1U65A 4MA5A 1RAIA 2M32A 2PGDA 1P2GA 5B1YA 2PVSA 4V0RA 2ZRLA 3ITNA 1XQWA 5CAEB 3MLEA 3EODA 1XEXA 2YUTA 4JYPA 2VYVD 3UZUA 2HJ9A 2WWTA 3QX8A 1X1EA 2IYUA 2V7VA 4B0OA 4BC1A 1L4KA 5KYGA 3K32A 3YASA 1PJTA 5AWFC 3VMMA 1YI0A 2O54A 4BGDA 4UBKA 3DF9A 4WKBA 3WMEA 2DETA 2WYWA 4PQFA 1V41E 1ZM2A 1FNNA 1LQ2A 3W6NA 3ZWNA 4HTFA 2QORA 4BBAA 4DXAA 5BSWA 2G1AA 4ON9A 3C7TA 3R7FA 3SVLA 1MABA 1EHYA 1BVYF 1V4BA 2P3SA 3DC2A 3QBDA 2JFZA 4MW6A 2ZSHA 4HLNA 1WXGA 4OA5A 4QTUB 1P7ZA 1NMYA 1PWHA 3H0CA 5HNKA 1NP3A 1R64A 3MA0A 2QRLA 2WM9B 2OV2A 3MD9A 3SIXA 1TUEA 1GFIA 1QTQA 3R0XA 3GJ4A 1SCDA 3DCYA 2EFDB 3ZCUA 3N7AA 3K6JA 4Z0TA 1BXGA 5U4QA 4RORA 4TKZA 1CIJA 4WJLA 2G9VA 2QTVA 1JU3A 2R6DA 4X7MA 5CJJA 4YDSA 4R1OA 1L5NA 4KWHA 4LXIA 2BI8A 3G5MA 3JYOA 1FX0A 5HCIA 4DR3B 2FW6A 4BMPB 2Y4OA 2UYYA 3EC1A 1LK0A 3K0HA 1SHTX 1P45A 3OI7A 4L5BA 1ZQ9A 1V1RA 1JAYA 2HJRA 5KVCA 3NHFA 4OFWA 2Z4SA 5HSGA 2PMFA 2X6RA 1NPDA 2ZBUA 1J42A 3K1ZA 2DYKA 2EARA 3NNDA 1YOBA 1ETUA 3T34A 2PHZA 2D7CA 4M8NE 3USCS 3EPLA 5TGZA 4ZCMA 4LJYA 5BY2A 1YJ5A 2XTAA 5KC9A 1EDDA 3C8MA 2B8NA 1JZSA 1O95A 2HDWA 3C5CA 1KAOA 1YAJA 4G8CA 5FAXA 1RWBA 3VR6H 3ANSA 1MO2A 1VRCA 2X9NA 4EMUA 3JQPA 1W94A 2IK8A 3S1AA 4LWPA 3VTAA 3UGKA 2C77A 2AZMA 4NCNA 5LQJA 2FR8C 1XCPA 3E9YA 4HCJA 4C4SA 4EFMA 2HW8A 4W8HA 1X70A 4LWQA 3M33A 4OQQA 1DG9A 3KPWA 4PC6A 3EZNA 1QVRA 2PX2A 1BH2A 4QC2A 1OBHA 1LBEA 1PV2A 1V48A 2EG5A 4QRHA 2FW0A 2FZLA 4WW0A 5K3SA 3ZGXA 4D3SA 4EHIA 3I9LA 5IZCA 3ABSB 3DE2X 3OJEA 4JLSA 3T38A 4DFDA 3TD6A 4BV8A 2H8GA 5HRAA 3MM4A 4YXWA 4EGFA 5D1HA 3T1NA 3FYSA 2Z5VA 1PVVA 1RQ7A 1G63A 3K6RA 5JJLA 1RJ9A 1R5NA 3CNQS 3NFRA 5IABA 1CFZA 4BVJA 3LGAA 2FZ4A 1KH1A 5KYUA 2AJDA 1A98A 3T5MA 1H2AS 4PO8A 2J5KA 3DBLA 4ND2A 2F00A 1AHPA 1YBFA 3ICEA 1F1JA 3IIMA 1G0OA 3DLHA 3CF4A 1TNDA 5BUCA 5J2UA 4OJYA 4DSOA 3AHIA 2ODQA 2YCBA 5EIXA 3RROA 1YZNA 4QTZA 2XT0A 3VR5D 1Z4IA 2RDMA 3TOXA 3ROGA 3UJHA 4S1PA 3UHJA 2PA0A 2QJTA 5AVYA 1Y6QA 1JR4A 3VC3A 4PSKA 1FBNA 4E09A 1DHTA 1HE4A 4PZ0A 3CHYA 1JU9A 2AMJA 2Z8YA 2WPNA 1N2JA 2ZSEA 3CUTA 3FDZB 2XVAA 3R3XA 1CDOA 2BFEB 2ILTA 2XWJI 2G77B 4Q37A 1OWOA 1EAYA 5H3LA 1KBZA 3CSSA 4O8ZA 1YQEA 2NVBA 5DXFA 4DE5A 4P4TA 1C0IA 1JQ5A 3JY6A 1W6UA 2YZNA 5LDDC 4UFPA 4LGMA 2JLCA 4DIEA 2M6SA 1QGDA 1LW7A 3AF4A 1YC5A 4QPPA 1QP4A 1QQTA 1ZK0A 3PNLA 2NNWB 4OV6B 5LN1A 5IJ9A 4KNYA 2VP9A 3ACCA 4KDFA 2YYZA 1FFGA 1EVEA 2ZJZA 3BIFA 4URHA 3UJNA 5CYFA 1O9BA 1H8EA 5ANRB 2P5SA 3VHRA 1GCUA 5LLTA 1UBLS 1Z0SA 3TCXB 3P4XA 4JB8A 4K3VA 5IAJA 5DM1A 3H19A 2I2DA 3PA6A 4Q00A 4F7DA 2OECA 1XK6A 4Y1RA 5E4TA 4AMVA 5IDYA 2Z6UA 1GRRA 2C2ZA 2D8MA 2HK6A 3AHEA 2QRQA 1KAEA 2PT6A 3I5AA 1QCDA 3EBLA 3WIBA 5MHTA 1Z75A 3GUCA 5E6RB 5EA2A 4F5DA 1MX9A 3HLTA 2CMKA 3W8FA 2FVYA 4PCVA 1G3RA 3IHTA 1RZVA 1FSSA 1NUHA 2RHOA 2UVDA 2VLIA 4RTRA 5GIPE 4QJ4A 4RXUA 2Q9CA 5KHAA 3UPUA 1GQ2A 4MIYA 2ZLBA 1K98A 2QVGA 3M81A 4XQ9A 3MT0A 3C3CA 2JAQA 3NGMA 3NTQA 3LYUA 3PC8A 1JDJA 1WPQA 4QE3A 4RAQA 2PNJA 4L8LA 4UOEA 1CETA 2EBUA 2XUAA 3PF9A 3M3DA 1YMUA 5T4HA 3IQEA 2Y9MB 2BH2A 1J8DA 2FYTA 2NSJA 1YS7A 4HDMB 3K2BA 2CYCA 2AG5A 1ZUIA 4WOBA 3SJCA 4YI5A 3QFTA 2J9GA 3E35A 3V4OA 3TUZC 4HH3C 1R6UA 2R8YA 5I8ZA 1EAMA 1K27A 3DAGA 5DB4A 4UBMA 1RI1A 4CQLB 5INTA 3RUEA 5CA1B 4NV3A 4NNPA 2ZUBA 4L4ZA 2NWQA 3QX3A 2BEUA 3OWOA 3OG9A 3B6ZA 2VK1A 3PP8A 1V5FA 2NP6A 4EABA 1TB4A 3G6WA 2H4FA 3OKPA 3NT2A 3TIXB 2VHWA 1N1MA 5A0FA 3B1FA 1DT3A 4AKSA 3D4BA 7YASA 4YJ2B 2XA1A 3EXHB 1G9SA 2EZ9A 1M8KA 1GARA 2Y1FA 4IEEA 5THXA 4EPVA 5JHGB 3PGVA 4ZJZA 4DLYA 5KYXB 1K8XB 2A59A 4UM5A 4BLQA 1IEQA 1DG3A 1XAIA 3A3YA 4KXYA 1QM5A 2GBLA 5AVKA 3LXUX 4MUEA 3GCGA 5GJCA 3N76A 2OV4A 1R5JA 1C1XB 3AUTA 3VVCA 2XGJA 2C3MA 5DM70 3CLTC 4P7KA 3SZMA 2YJTD 3CRRA 3O4VA 3UAOA 4BKRA 1IMOA 3ABIA 4MSUA 5KYTA 3UGQA 5BUQA 3VXKA 3DV0A 4ZDWA 2AOXA 3DCJA 3IV6A 1D1QA 4LVUA 4PCUA 1WLSA 1WP4A 3EIFA 4JYMA 1JFFA 2HPVA 1KC3A 4LDZA 4XUEA 4BN0A 5KHOC 9ABPA 2WQZA 2W6JA 3WKBA 4EBFA 5PNTA 4YONB 2YIJA 2FF7A 3KXIA 4CXMA 4OREX 3ANTA 5KNDD 5FUXA 5B1HA 1E7YA 1PJRA 3E05A 3NOQA 3R3HA 1ADFA 1RBMA 3PC2A 3VHLB 4B3BA 5A3QA 5I47A 5DDIP 2HCJB 2J30A 4NAUA 2DFVA 2Q3DA 2OO3A 2Y0DA 4NE7A 5JQWA 1ML3A 1UINA 1C9YA 3F1LA 4HD8A 3IT3A 2P7IA 2VHXA 2WPDD 1W2WB 1E9CA 2HIMA 2FZCA 3N0WA 3R6TA 4HP8A 5ILQA 2JF0A 4UTVA 1U2DC 3MK31 3T8YA 2R5NA 1SZPA 4RESA 4XASA 4CTJA 5HIAA 4MQMA 3Q8WA 3TMKA 3BMXA 4J3NA 2VHCA 1QYVA 3CKKA 1XLUA 3DPUA 2QQGA 2QG4A 3C6XA 3KEQA 3RARA 4TWRA 2BV3A 4JK3A 3LUPA 3FMGA 4PC7A 5FBKA 3H83A 1G8MA 4EAAA 1CR2A 1SD2A 3GCZA 3TGPA 1H2RS 4WMLA 4F9EA 4XB2A 5HDQA 3CVVA 1XXHB 4U7HA 1AXEA 1JHOA 5B3LA 1NOIA 1BE0A 1J8FA 3L7LA 4UPVA 1SURA 3QEMA 3UUGA 4OKIA 3WA6A 2WU0A 1T36B 2WVGA 1TZMA 1XO1A 2AZ4A 3HDTA 4X61A 1V8ZA 3JQFC 3IBTA 5EHGA 4RDHA 3AVVA 2AHOA 4G37A 1PKXA 2E89A 2YWXA 3P2MA 4ZT5A 3EUAA 2ZWMA 3A14A 4LY0A 1K92A 2XD9A 3DP7A 1XDUA 3P32A 2YY7A 3PRKE 3TQCA 1Z8NA 3OTGA 4GOKA 1OYOA 1YV9A 5BYKA 3GJRA 1PTJC 5HZMA 1SPBS 1ZM7A 1YVRA 2H48A 2IIQA 4AUEA 3AUKA 2PQMA 3LRTA 1TYEB 3NVKI 3WRXA 2HDNB 4ILKA 2YRWA 4RW0A 3D3WA 3MGAA 4ARAA 5FT9A 2A94A 5E9WA 2DHDA 4Y2HA 4JBNA 2GFQA 4WPGA 1I5RA 5J2TB 3MWJA 5T3YA 3C39A 1XSEA 4WVFA 4ZQFA 1I4WA 4FFNA 1ORWA 5KQRA 2WAOA 2NP7A 2HSGA 1AGXA 3CEAA 4ZCIA 3FCAA 2G7MC 4QYMA 2V7BA 3BEOA 4HDRA 2G5TA 2H0QA 4NBRA 5H3HA 1Y9EA 1WVGA 3FMOB 3NZEA 4FZ5A 3H4VA 4UEKA 1OF1A 5JRJA 5D00A 5A62A 2BBOA 3R5KA 3E9CA 2IPAB 1LLUA 2J4FA 5KMGA 4YMTA 2XT9A 1YRHA 4MTCA 4E08A 4JT4A 2CDNA 3G1WA 4LISA 4Q3LA 2ONJA 2HSWA 4B5KA 1GLVA 3RFVA 3DZHA 2V1XA 2WIGA 4FYPA 3ZI7A 4HNTA 1GD1O 1TK3A 1VKRA 3WP0A 3RYFA 1DZ3A 1L4NA 2FPKA 1L5GB 2PIDA 4URXR 4MJLA 2K7FA 4DMGA 2QTGA 4E1AA 4MMXB 4X8LA 3FBGA 2DUNA 2FR0A 1U7ZA 2JATA 2RHMA 4EVRA 1U3DA 2RB4A 3NV9A 2Q1UA 3VKFA 2DEUA 1XA0A 2R68A 1SVKA 1WXWA 4YP5A 1MQ8B 4KJZA 4XJXA 1PS8A 1BFUA 2OCGA 2PFGA 1L5RA 1QZTA 1D07A 1L7NA 3B6MA 3NHWA 1P0FA 1UK6A 1ZVVA 1Z2DA 2L2QA 3QA3E 3SLGA 1RLUA 4Y2TA 2H8KA 4ZVNA 4PHTA 2Q0XA 3V6MA 3S2ZA 4CDRA 4L75A 1BYUA 1QC5B 4OJTA 1XCOA 2FPIA 3ILVA 5JPDA 1Z5ZA 4U2GA 4WGGA 5CLGA 1XPRA 4DCUA 3WYDA 4AJJA 2OCYC 5ER9A 4QVIA 5FLEX 3A6ZA 4HFJA 4OD0A 3S2FA 4BKMA 5FBWB 1QDUA 3LVQE 4C7XA 5A9SB 1W52X 2OGSA 3NHKA 3RVPA 3IRUA 4CQMA 1JNXX 1KO8A 2A5YB 2Y99A 3M9WA 4HLCA 3T9EA 3IO5A 3TTTA 5BQXA 3K70C 1B14A 4ZRMA 3A0UA 4B35A 3OOJA 2O7RA 2V6GA 2H0RA 4XYBA 1ISGA 5BV8A 3F9RA 1Z6YA 3H5RA 4TRJA 1VJRA 5A06A 1GP2A 3B3GA 1A8QA 4QYIB 3PFGA 4IDHA 2VF2A 2VOEA 1AQLA 3Q1KA 2JS7A 4NL4H 5DXJA 4D4HA 3FCCA 3NUZA 3SF8A 1WBBA 1JEYB 2AR0A 4XLZA 4Q3BA 3T3GA 5F2NA 3NVAA 2YWGA 4Z3OA 2VBGA 1RYYA 4L51A 2X8JA 1KEEA 2GAAA 2EWMA 2JNWA 4CDMA 2W2LA 1ACLA 2JGLA 4KX5A 5CEJA 4H9GA 1T9ZA 1G20A 3L7NA 1RHUA 3T0GA 2X77A 5AW0A 4IDAA 2CNWD 5EKTA 3QPVA 4ZDIA 3THWB 3ZW8A 2F59A 4A0QA 2GRAA 1J90A 4MUYA 3MWEB 2RIRA 4E1VA 1U9JA 2X2EA 4WERA 1QTNA 4RKEA 4CW7A 3AEKA 4N82A 2CHEA 1AUPA 1M0SA 3UAVA 4WHMA 1NQVA 2REQB 1TPZA 3EARA 3PCRB 3PG5A 1NF2A 1BYIA 3NH6A 5BXYA 3O5AA 1Y7LA 2PZGA 1BWRA 2PKRA 2I62A 2VRWA 3KD3A 4I81A 3VOSA 3BRSA 3DYVA 3AJDA 4CMEC 3IP8A 3CVYA 1M1YA 5TLSA 3DO6A 1KAQA 1L8OA 1WEKA 4OQNA 3H11B 4Y1FA 4O4HA 1E3JA 3BA6A 1A7AA 3O82A 4FOSA 1ZINA 3LPCA 1Z6GA 621PA 1RAGA 3O4RA 2G0TA 4ZEVA 2ET6A 5BW8A 1GFZA 1MF7A 1W88B 3KQTA 4DDMA 3H99A 4RV9A 3LX6A 4C7VA 2XAAA 3IAUA 4D6YA 4KGZA 1T9HA 5AI5A 2P35A 4FYVA 1CZHA 4MS1A 4OHUA 1Z6AA 4XQ0A 3KOZA 1T24A 4R68A 1T4BA 3ZVMA 5IT4A 4JP5A 2HMAA 3N8DA 2ZJOA 1VI6A 3KLMX 4JJ8A 2AGVA 1E4EA 1MAUA 1N2CA 4GX0A 3USES 1XTQA 3GCDA 1DFGA 1SCBA 2K2QB 3RHFA 1NW6A 1NVGA 5CH5A 2HK9A 1C9MA 1YR7A 2R2AA 3LUBA 4F5ZA 2AFIB 1XEFA 1MVNA 1EZ4A 2ODTX 4MUJA 2FQWA 3PEYA 1AVTA 4MDFA 3WA7A 1W4CA 2WF6A 4QEDA 1OWMA 4UEWA 3AKZA 1QYCA 3RS7A 2WM3A 3LE8A 1UR5A 2CEAA 3I0NA 4M60A 1SC3A 1R9GA 2FSIA 4FFBB 2PZKA 4TS4A 4N6NA 5BSGA 4YGXB 2IKSA 3VGPA 3PPIA 2FRDC 5EXDA 5IBCA 3HB4X 4X85A 1DKOA 5H4GA 1IH8A 4QJ5A 1SU4A 1A7JA 5KVVA 2PRZA 2ZJ4A 3JZAA 2QN3A 2YOFA 3AR5A 4RKQA 3DR3A 3S5UA 4RFLA 4B8YA 1Y4SA 1VL2A 1K6JA 3AM3A 1R6XA 1G5FA 3JWGA 1XRMA 2WINI 2VNJA 2ZAGA 3L9XA 4J29A 2DLDA 2FLKA 4KXNA 3LYAA 2Q5EA 3CT6A 1KDVA 3U3DA 5I5EA 1CR1A 4ROTA 4P4SB 1IBMB 1G60A 2HSZA 5AJWA 1DC7A 5BNWA 1K4KA 1PO7A 3QPAA 2EBFX 2FH5B 5JZBA 5LP6B 3ACDA 3U4IA 1D6SA 2DBRA 3FKSD 4XCVA 5BQPA 3HKDA 2DPMA 3EVCA 4AFNA 4ARZA 4J07A 5FBVB 3U56A 1JJIA 3QQPA 4CIBA 4RCVA 1DCTA 2W2QA 1NF3A 3MT9A 1XBTA 4C22A 3KYCA 3TKYA 1WPGA 1QFXA 2QSUA 3H1AA 2VPYA 4KH1A 1RCFA 4FP9A 2GPBA 2C5EA 1GRQA 4O0LA 1V3VA 3RTCA 3SQOA 4EZBA 4G5QA 4RD6A 1YMQA 3NH9A 4ADSG 1KQPA 3F5MA 4QYWA 4MCHA 1NXVA 4L95C 3V2GA 4TZ6A 2PK3A 4G89A 2YH2A 4OBXA 2FMHA 1T2NA 2BEKA 3FUCA 2D5BA 4G5GA 4WXYB 3TE6A 4OSEA 1Y9AA 2BWJA 5E3IA 5HJ2A 4JB2A 4YQZA 5AK4A 4K9RA 5P8WA 3DKRA 3VYRB 3FLMA 5IDQA 2QBYB 4GVLA 4MWCA 4BAUA 3WV5A 5G0TA 1J9EA 2ONZA 2V7GA 2XDYA 2JLRA 4LJ7A 3B60A 3IUNA 4P92A 5TGTA 2QD1A 3ICPA 5JWOA 4YO7A 4XGQA 1M67A 3O4GA 4JYZA 2UXDB 2J9ZB 2WF5A 3TRIA 1FOEB 3GVCA 5CLQA 4ZODA 2QVLA 2JFGA 5EPOA 1D2EA 2E49A 2GAJA 4M36A 2IYWA 4IWNA 4EGCB 3L1HA 2AI1A 3BL6A 3SOPA 3UKOA 4GR4A 4YXFA 3DP9A 3CLTD 3CZ5A 3ZDRA 5J5CA 5HQ3B 1D1SA 1G7SA 4M88A 2Q4TA 4F8JA 3A8TA 4H60A 1ONPA 4R9SA 1CJCA 2C3UA 1IG0A 1A50B 2Z04A 3D31A 5ESRA 5ECYA 1B2RA 4TTPA 3THOA 1XLWA 2YJNA 4K6HA 4O33A 3FVQA 1KPGA 1X80A 2PL1A 4LZNA 4E33A 4HLUA 1PX2A 1OV6A 3DEHA 1PLKA 1OX4A 1EP1B 1A2OA 1AQJA 2VJBA 4Q16A 4XJSA 1UOQA 4REOA 2X9VA 1R15A 3W5DA 3OC0A 4NE2A 2IUUA 2O8DB 4YV1A 4XVHA 4D0RA 1NT4A 1U2EA 1H1LB 1P9RA 3DW3X 4X00A 3BG5A 3V8EA 4K05A 1JQKA 4UE2A 4I46A 1GV0A 1PE0A 3ERCA 3C6BA 1DJOA 1MDFA 1B4DA 2OGUA 2YIVX 3JQ8B 3VKUA 3ZWXA 1NC1A 5HQJA 3GAZA 1TTQB 2WHXA 1ADBA 3SXUA 2VUSA 4K7JA 4I4LA 2VJMB 4B34A 3EH2A 1MGOA 4DBLE 2E1PA 1FYXA 4D9MA 2JJ2D 5CD1A 4IWYA 2FSFA 3C1UA 1I6KA 3HVIA 3NXSA 3RSOA 1ZITA 5CA0F 3WR5A 1I1OA 2B2CA 2OA0A 2I4MA 5IX8A 2VWPA 1HZJA 4R0MA 1BU8A 1TM3E 3E8MA 3QPCA 4QGFA 1B1CA 3I1FA 4PHCA 2BGMA 3RIEA 3FDFA 4AF8A 2HWXA 3CWCA 2PBRA 3OJXA 1P1IA 2IXEA 3KC2A 1ISIA 3RU9A 4FHCA 1GNRA 1HWYA 4TZ0A 3SHVA 2VEDA 4XWYA 2I33A 4D8TA 2FW7A 2J3KA 2Z83A 4DZTA 5ADUS 2WZDA 4FCWA 4MRSA 4LSMA 4W82A 5EJFA 1Y8QA 2RGYA 2FPLA 2QSYA 5DGXA 3S40A 4A03A 1C3JA 4FYIA 4L6AA 1RPZA 4AYXA 1Q6YA 1RQRA 4C6TB 3H5VA 3FETA 1ZL0A 5EKXA 1UMDA 1YKSA 2BMDA 4QDTA 5AO9A 1YRWA 4M87A 4AU1A 4WOJA 4GC9A 3VPXA 2YHBA 1AZTA 2YFQA 3SM9A 4F92B 1ISHA 1Z22A 2RBGA 3KZKA 4JXJA 4BWYA 4RL4A 2VF8A 3UAXA 3LVBA 3BRWD 4P7BA 2WF9A 4BTVA 1E8DA 3IVXA 1QH8B 2JHGA 4O2BF 4Z4FA 1P3Y1 3JRWA 4D0LB 2OQ2A 5C5EA 5P21A 5DBEX 2I22A 2J3MA 4MRMA 2NO0A 1YIAA 4TLBA 1VSVA 4TV9A 4O4JB 5F2KA 1DXHA 1WUHS 3RYTC 1BZYA 2XVXA 1OLXA 3SC6A 3TTVA 3L4SO 4RM2A 2V7PA 4KRXA 1M66A 5FFMA 3RVMA 3NKLA 2DX7A 4ZCLA 4LGCA 3ZTYA 4DLLA 4RHEA 3T7IA 1UPBA 3R8CA 5IP5A 2BFAA 3ZXXA 4BQNA 1DKLA 3MT8A 2AK3A 2BYTA 1I1HA 1YVPA 1VFNA 1Y9DA 5FLXA 5FV7A 3NWEA 5KWJA 2HU8A 2XKJE 3CU5A 2HWWA 4RVCA 3WFJA 4ILEA 1J8MF 2OHGA 2OYSA 1WAMA 2WTNA 4AD8A 5KNCH 2UXCB 1OCEA 1P1CA 4MB0A 4L6IA 2G83A 3Q7QA 5CLJA 2AJTA 3KEOA 4C76A 5DKFA 2VA9A 1QHIA 4LJ5A 2YY6A 3SSMA 4AG6A 3JWJA 4JEIA 2ZYDA 3SKXA 5B2FA 3EEYA 4OLJA 1KVSA 5DLEA 5AT1A 3SYTA 1IYZA 2H4XA 1S9HA 2X86A 2XQKA 2E87A 1LTKA 3CZCA 5T5QA 3NATA 4BTLA 2WQ7A 1EVJA 3T4UA 3ZU2A 3SAJA 1A9XA 3LUDA 3ZGOA 3COVA 3DMNA 3W2EA 1V39A 2PLAA 5L3RA 1LRJA 1YU9A 4UTXA 4R9RA 3PQCA 3P27A 4JVNA 4I50F 4DQUA 3BTOA 4ZI2A 1V1JA 1GXSA 3P7MA 1BDIA 1T3ZA 4H7HA 4HWTA 3VVBA 4FT2A 5J63A 3GPDG 1JTVA 3QY0A 5HP4A 1P9WA 1R18A 1YSCA 3PUIA 1NVUQ 1U7XA 1FQJA 3NTUA 3NHBA 4MR8A 4HMPA 2C1XA 3WGGA 3RU3A 2GYUA 4NEHB 3FOWA 3MCUA 1JB9A 2XQVA 4P83A 3NTLA 5IARA 1JG2A 1A76A 2JKVA 4INPA 1P19A 3U13A 2DSNA 3TZQA 3PV0A 1UMBA 3QVSA 3OQOA 3Q4GA 3S8YA 4PQGA 2RMKA 4R5MA 4MVJF 3ZCSA 4L4SA 4DRZA 4JCOA 3K70D 1M6NA 1R0YA 1ZO8A 4WNCA 2IE0A 4DT1A 1C7ZA 3O2SB 1PT6A 4C9BA 3UTDA 4PG5A 5FQNA 1GAEO 5KKNB 3AVUA 1JXAA 3OIGA 2OZLA 2RGBA 4KBFA 4RVOA 3W6ZA 4TQAA 3K09A 4DJDC 1B0UA 1ZD2P 4PWZA 4UCWA 4W7HA 4DJ5X 2PO5A 4IXWA 1F3OA 2W6IA 2FCRA 1EHIA 3QPUA 3L8ZA 1RXEA 3VISA 4OPMA 2RHCA 5JD5A 3ZE0B 4G4SP 5IM5A 2MSEB 4MAFA 4B4KA 5EHZA 4F9TA 3CC8A 4D02A 1R8YA 3LLVA 2YFYA 2O19A 2O2GA 3NC1C 4P3KA 3BXZA 3RVLA 4UKDA 5ALSA 5TQ2A 4LOIA 5JARA 1SCAA 3U3KA 5CUQA 1YCHA 3Q0IA 1E3MA 3TTXA 4GRAA 2TECE 3KKOA 2XV1A 1YTUA 2DMRA 1UOEA 1S3GA 2VHQA 4M0DA 1WSDA 4UREA 4K9PA 3WY9A 2DWOA 4G36A 3GLHA 5CVCA 2PV0A 3O0TA 1ELOA 2YZ2A 3TRJA 5IJ0A 2BGRA 2CLIB 1UBGA 3LCVB 4IVQA 4JC4A 3C43A 4XCQA 5AHOA 1EE1A 1SKBA 1KEVA 2BR3A 4IMJB 4HDKA 2WAMA 3JZFA 4JJEA 3WMRA 4AUKA 3IDZA 1KKLA 1XVUA 3TUIC 4F2GA 1XWFA 2PWAA 3KKKA 2QP4A 3OOYA 2EG9A 3H4IA 3LK6A 3HBFA 1RXUA 2UZ1B 2RHJA 3QUSA 4JMPA 1GNQA 4YV7A 4I55F 4Q3CA 5EMNA 3KV3O 3W2IA 3AONB 3ZG6A 4E6PA 4IL5A 3JYHA 1E5QA 3G1UA 2WW8A 1P7VA 4MPDA 3UHAA 3ZDZB 4DMRA 2B83A 1EB9A 4MUKA 4ZV7A 4F93B 4YRAA 5BVHA 1F17A 1INLA 5JXWA 1NNLA 1SU6A 3GL9A 3PXEA 4AQYB 4JQSA 4LSGA 5FYQA 3THXA 2FEWB 4OLAA 2GBIA 5AVUA 1M8FA 4X8HA 2NQTA 1H6CA 2I76A 3GFOA 3QUQA 5H70A 3KT6A 2QZJA 4O3MA 4K9QA 2JGIA 3GG2A 5AICA 1MQAA 1TCAA 3N8KA 4PFKA 2VT7A 3EXHC 2HDHA 2IYEA 1W4RA 4LDPA 2IUFA 2BMJA 2FPGA 2W4MA 4U4AA 4Z4IA 1M34B 3A58B 3BULA 4MYTA 3U3OA 4AN1A 5JADA 5KZMB 3ZDAA 3SU8A 1JEQA 1CY1A 1Z3CA 2J45A 1WXHA 2D3TA 4GI1A 5JMOA 1A88A 2EWVA 3GUYA 1LD3A 3G2NA 1I13A 1QG2A 3LIPA 3QMVA 2NYAA 3H42B 4UHDA 2E37A 2PE5A 5JXGA 3A25A 2YY5A 3GDFA 3MCZA 4XDZA 4XYMA 1U3TA 2QE7A 1XZQA 2A7QA 3V48A 1LPNA 3RSGA 1EFUA 3IUJA 5FA5A 5B1DA 4BE4A 2DUUA 4L3OA 4WASA 3W4KA 4LXUA 2BFDB 4FEAA 2Q2OA 4AB1A 1O94A 4UTNA 1P4SA 4RZXA 4EF5A 2NZUG 2TMKA 2PQ2A 4EG1A 4Q7EA 3TLMA 2D8AA 1YQXA 3HFRA 5KB3A 2O1XA 5HYVA 3AZOA 3RHTA 4RMHA 1DJNA 1FP4A 1OUMA 3IDOA 1QHYA 1JDSA 1FNCA 4FS3A 1HR0B 3ZDCA 3QKWA 3R6LA 2XUHA 3IB6A 3KAPA 3LHFA 1ESCA 1L7EA 2NYRA 2RB5A 5DYTA 4EKYA 1UPTA 2CLEB 3H1EA 3KALA 4J8PA 4LFBB 2QV7A 4LHEA 4JLMA 1E79A 2EEZA 3E9MA 3K0EA 5DTMA 4B87A 1HE5A 5LPNA 1II9A 3E9RA 4DWVA 4ZPJA 4NOJA 4JI3B 5ALOA 1DLIA 1ATIA 3EK2A 4IJUA 2PZAA 4O59O 3PUHA 4AP6A 4DCJA 2QIOA 3MJRA 2ZUUA 5DP2A 2QPOA 1RS0A 5JPIA 2NUAB 4S1TA 4Q1CA 3H97A 3PDHA 4IQ8A 5EZYA 5ES3A 3IOCA 5AVWA 3HB1A 4S24A 3GRFA 1CP2A 3DDSA 4IV8A 4Q4JA 4EUHA 3OE1A 4EJ2A 2ZJYA 5FA8A 5FX2A 3PJEA 3F78A 5ESDA 2FETA 2VHZA 1VJCA 2IEZA 5I4KA 2R6ZA 4MP8A 2XNSA 1FMLA 2C96A 4GI3A 3AVOA 4R1MA 2ZI4A 5TPZD 1HO3A 3B5JA 4DLAA 3S8EA 3MS4A 1ZXXA 5AK5A 2EKPA 1WCWA 4KQ9A 3BK1A 3A11A 1QTRA 2WE7A 4RIEA 4Z1OA 4P38A 5EIFA 3R3VA 3ZGLA 3X1XA 1O1YA 1Z45A 2ZBEA 4JXKA 4IMPA 4OHPA 5IANA 1UJ6A 1NVVQ 1X1CA 2NTNA 1VIVA 2GN8A 4LWZA 4M1TA 4YRQA 5E6UA 5FHRA 5IFLA 4K6MA 3OZXA 4CFYA 1II8A 3H5OA 3FF4A 1EDZA 4LOLA 5ADHA 1CZRA 1Z07A 2Q1YA 4BWFB 1M0EA 1MW9X 4KACA 3GVIA 1HT0A 1SCKA 4YR9A 2FDCA 3UB3A 1EFPA 3PCXA 3V32A 4C08A 5LNK6 3KE8A 1K5DA 1UIMA 2P2LA 3GA5A 3LGXA 1NL3A 2OFWA 4IEIA 1M2GA 2GNOA 4L2IA 1ONOA 2KYRA 1G6Q1 5H81A 4DUGD 1XVVA 1UFOA 3AYZB 4X1KB 3AW9A 4ENRA 1FXSA 1P39A 3M5CA 5L7YA 4OMFG 1G2QA 1JPJA 1WB4A 2ERXA 4H7DA 5IK2A 1YA4A 3FNHA 3IUPA 2QU8A 1VHQA 3I2GA 4NHEA 4Q82A 4RYLA 4I1RA 3IIJA 4E2ZA 3GOHA 1J1ZA 1UBMS 1XEXB 1X1RA 3U6KA 3OPXA 1JN0A 4EGSA 3A1SA 1KR5A 1TI7A 2Q7OE 1IG3A 3KKEA 1FXWA 1LFAA 2N0SA 1XKTA 3AR2A 1FLVA 1TF7A 5DO9A 2GZ2A 3N8GA 1AKTA 2EW2A 3MMZA 3PGLA 3DZBA 4R0NA 4OUDA 2ZR8A 1OOEA 3FSEA 1MRZA 1ZRHA 1DCFA 4WK2B 3GFQA 3DDHA 3CB4A 4HTFB 1DQSA 4RTQA 2QTBA 4K0KB 3Q3EA 3MWDA 4PHFA 4BFVA 5JC8A 1G6OA 4RSHA 1JH8A 4ENTA 1YZUA 2MDTA 2WB2A 2P9JA 1QKKA 4W63A 5CURA 1EFCA 1KOJA 4A6EA 4D26A 2NU8A 3AWDA 3TLXA 4EMSA 5DWDA 2JLYA 5CTAA 1ND5A 4PINA 4MPPA 5E9JA 3DDCA 3DEJA 2PJZA 3HKCA 4C3VA 2VQFB 1K7CA 3O0DA 1FU8A 4B1FA 9LDBA 4EFLA 4XVUA 4D9HA 3UMFA 1UXGA 2VAMA 4FINA 3VQTA 2O8CA 2GX6A 1U5BB 4J90A 1ZIPA 1LDNA 3AJ8A 1G5PA 4HQ0A 4QJBA 3AK4A 5ILOA 1XQYA 2DLCX 3G2KA 4WKGA 1GG5A 1P3DA 3ENKA 2OKGA 4BQOA 1FX0B 1IVYA 1F0NA 2BR4A 5H9VA 4FW9A 2AQ8A 1BXZA 5KDOA 1V1RB 2GCGA 2WHRA 2YR0A 4J3FA 2AOUA 2CDCA 4UULA 3TQQA 3VX4A 4DV3B 2Y1OA 3DUWA 2CFIA 3VU3A 1GPUA 1FMTA 2XVYA 1VB3A 3NP9A 1KFEB 1WMFA 2PD6A 3ELYA 5ECDA 2WBLC 5JSZA 4TMKA 2WFLB 5A3VA 3WYGA 3L5KA 2MSKA 3JSAA 4ZANA 4RGVA 4YV0A 4ZYUA 4P4GA 1WW2A 3GEPA 1VP3A 1KSGA 4WZAE 3KQHA 1MC4A 2I34A 3VJMA 1X87A 5K8IA 2JK1A 3ELBA 4FS8A 2FFRA 2QL5A 2YXNA 4PFJA 3S1AB 3MN1A 4WESA 4C5AA 3BE8A 5L3VA 4EUEA 1FFDA 2YVAA 4K9DA 2W2VA 1FRNA 4A8PA 4E30A 1TOAA 2NSDA 4FT4A 3ASUA 3NCTA 1G8SA 3K31A 3OMLA 1HY3A 3DSRA 3OZFA 4KB5A 1GG8A 1WRBA 3LPMA 1PEDA 1CNFA 1LI5A 1YJAA 1OC2A 4FKMA 5F2EA 3QSGA 3LL4A 1WWKA 2FG5A 1T5TA 3FCOA 4QPDA 4J0EA 1YQQA 1BXRB 5CT9A 1J56A 1TM2A 4X45A 5IG2A 2ZZKA 3O91A 2QLBA 1M2HA 3QEOA 3TRFA 1SCQA 1RJ9B 2CZCA 2WV7A 3OTWA 2C4KA 4UNRA 1W36B 3P0EA 1L5OA 4LBWA 1FRVA 1TM7E 5K45A 1BVHA 3KQYA 2QZPA 5LQCA 3DBLB 2H1OA 1MXHA 1SHZA 3UB4A 2CLFB 5DLQC 3A27A 3I23A 3PHBE 5AKHA 1HYHA 4I6EA 4Y0NA 2WEKA 3KL4A 2VATA 1K8RA 5JAQA 1U0OC 4RLFA 4X3OA 1FYVA 1H42A 2JJYA 3ONFA 5DYGA 3LC7O 4Q24A 5MFPA 4HXEB 1E2FA 4IIFA 3O7MA 3FNQA 5EIEA 2DR0A 4J4TA 4Q93A 5I51A 2FU5C 1OXXK 3DZJA 1FDTA 3C5VA 3CH6A 4N5HX 1GLGA 2AX4A 3B78A 1WHTA 5JANA 1WY5A 1GAQA 1RVDA 2K87A 1ZUNA 1QFZA 1BDMA 5DM2A 2VPTA 4C14A 3GAMA 2CV1A 2COEA 2W0SA 2EFYA 3TG2A 2GNAA 4CTOA 1UZAA 1PSZA 1DUVG 4PG4A 4HNUA 4CTNA 3UMRA 1KK0A 4LECA 2Q2NA 4YCBA 2X0IA 2PMDA 3EG9A 3PFIA 4Z49A 4HAOA 1NULA 1WQ3A 3TINA 5LOVA 1EJ6A 4X7BA 3A6DA 2R5WA 3G3EA 3PXAA 1WXIA 3I05A 3B13B 2AC4A 3LFTA 4JFRA 2RFLA 2XCUA 4TTVA 4U63A 5ICFA 1X6VA 1IWPB 2IIBA 4B2PA 1NJ8A 2PS9A 2QN6A 2K5UA 3N6XA 1L4HA 2JRCA 2QUIA 3D9QX 1YZHA 3NLLA 4A0FA 2VZ9A 3PX3A 1AMNA 1SXJB 3OPYI 4R8KA 1VXOA 2P62A 3ETLA 1E60A 3NYIA 4RD1A 2G28A 4IJWA 3TLZA 4D8XA 3CONA 4YMHA 2E4ZA 1CQXA 1YVEI 2IXAA 2J46A 4LKOA 5JDCA 4FN4A 2X0KA 4JIGA 4JWKA 3UMVA 2BFFA 4WEQA 2ZE6A 2AW5A 2BC9A 2P4QA 4YJ2F 3RANA 1I3NA 4ND6A 3ADCA 3IVGA 2Q41A 4K9KA 1E4YA 1G9XA 4NJEA 5LP6C 3V46A 2HMSA 1TU4A 1UFVA 2CVFA 1CD5A 1QYDA 2FQ1A 2FUKA 2HSJA 2R44A 2ZWPA 3EZFA 3KL2A 3L79A 4OL0A 4XI9A 1EEXB 2AKYA 2REBA 3CO0S 3TM5A 1UBCA 4UM7A 4GOOD 2VK2A 3IA7A 1NI5A 2B30A 4G24A 4LZOA 4YJFA 3TNLA 3MOGA 3CO5A 4ZKDA 1FPMA 3HJAA 2PZ8A 4I08A 2YZKA 3ZDEA 2H1VA 1STOA 1U04A 2CJYA 3M49A 2A86A 1JJAA 2BLLA 2FW9A 2HF8A 2FJ0A 3OFKA 2OK7A 5GV8A 4YDHB 4M22A 3ZJYA 5A6SB 2YOHA 7MHTA 4S0XA 3G0OA 4HN9A 4Q9DA 1T1SA 3TYXA 3FJ1A 3JD0A 4ZQBA 1Y82A 2V55B 2XOEA 2XYVA 4ZOQI 1RMQA 4QASA 1VYTA 3EZ7A 3FMPB 4JB3A 4CMBA 4IICA 1WMBA 3LX8A 4POAA 1X42A 4DQXA 3FYUA 1WA5A 4ED9A 4HO1X 5LIPA 2V0GA 1AM4D 3KQOA 3A0RB 3HH8A 5K4HA 3LC1O 1EX9A 3EEBA 2JGAA 2YN0A 3NASA 1JDBB 3Q0TA 4N1AA 3FDJA 3G8AA 4YCSA 5BUSA 1T2AA 3LA6A 5ENZA 1XZKA 3OM1A 1EX7A 4C0BA 3V3KA 4PAMA 3ZD9A 4QEZA 2Q62A 3N3BC 2GBPA 1AZLA 3GDGA 1QCYA 2C61A 1ZXBA 2QTRA 3H2GA 2XUIA 4Q3DA 3D2AA 4MR9A 5KSPA 1ENZA 2QD3A 4AUNA 4DRXA 5C1DA 1OFTA 1ZI8A 3DHNA 4RA9B 2HY7A 1FY2A 2HIHA 1U3FA 1MC8A 2LV8A 3DV0B 3V4VB 2FAXA 3H1TA 3ZTTA 3IKVA 1C7IA 1Z6PA 1T8TA 4E7OA 1KEPA 1JFFB 1OHHD 4UM9B 1IJKA