4HFJA

X-ray crystal structure of a double bond reductase from nicotiana tabacum
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
342
structure length
333
Chain Sequence
AEEVSNKQVILKNYVTGYPKESDMEIKNVTIKLKVPEGSNDVVVKNLYLSCDPYMRSRMRKESFAPGSPITGYGVAKVLESGDPKFQKGDLVWGMTGWEEYSIITPLFKIHDKDVPLSYYTGILGMPGMTAYAGFHEVCSPKKGETVFVSAASGAVGQLVGQFAKMLGCYVVGSAGSKEKVDLLKSKFGFDEAFNYKEEQDLSAALKRYFPDGIDIYFENVGGKMLDAVLVNMKLYGRIAVCGMISQYNLEQTEGVHNLFCLITKRIRMEGFLVFDYYHLYPKYLEMVIPQIKAGKVVYVEDVAHGLESAPTALVGLFSGRNIGKQVVMVSRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Allyl alcohol dehydrogenase
publication title Biocatalytic Asymmetric Alkene Reduction: Crystal Structure and Characterization of a Double Bond Reductase fromNicotiana tabacum.
pubmed doi rcsb
source organism Nicotiana tabacum
molecule tags Oxidoreductase
total genus 109
structure length 333
sequence length 342
chains with identical sequence B
ec nomenclature ec 1.3.1.102: 2-alkenal reductase (NADP(+)).
pdb deposition date 2012-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF16884 ADH_N_2 N-terminal domain of oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4hfjA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4hfjA01
3MCVA 4BNGA 2DVMA 2NVUA 2PTGA 3JD4A 4RCVA 3FTNA 5G2OA 2VTDA 4ALJA 2J8ZA 4RGBA 9LDTA 2I5PO 1E7WA 5MDHA 2JAPA 3WJAA 4GX2A 4LN1A 2NTVA 2Y1FA 4QTZA 2C0CA 1YL7A 3ZI0A 3BMQA 4BNHA 1LDMA 4MVJD 4XA8A 3UCFA 1HT0A 4P4GA 1QSGA 4XDZA 3QA9A 4BMNA 4FDAA 4JNKA 2O2SA 2PY6A 4P8RA 1W6UA 3PLNA 4CMHA 3NTOA 4L4RA 4JROA 5L45A 4GPD1 2G17A 5JC1A 2EEZA 4M1QA 5I9MA 3NT2A 2IODA 2ZB7A 4NBRA 1YBAA 2PD4A 5C7OO 2ZTMA 3JTMA 4WOKA 5DCUA 1GL3A 4J1NA 4D45A 2QZZA 5I7SA 4OQYA 2UAGA 4DIOA 3X2EA 3FR7A 1NR1A 2G5CA 3EUWA 3JQAB 1B14A 3MOIA 4ND1A 1C0KA 1HE4A 4AL4A 4BO2A 2HLPA 4NBVA 4QO8A 5EL0A 1KOLA 3ZGYA 4TKMA 1M66A 4FOOA 4RL6A 4CODB 3FTPA 1BHSA 3GLQA 1T2EA 4Q3BA 3TPCA 2HO5A 4E0BA 1JDJA 3OJ0A 3AY7A 3WLEA 2ZYAA 3ADOA 4N18A 2OOSA 3JQCA 2WEKA 4WLUA 4BMSA 4GGOA 2VCYA 2BLLA 4YJFB 1DJQA 1T1RA 3TN7A 2HK8A 2PZMA 3AY6A 4ROSA 2EGHA 1LDNA 2ZIZA 1YJ8A 4Y6SA 3WGQA 1ZSNA 2ZB8A 5T64A 3RUIA 3A06A 4I1IA 3JQGA 5ENDA 4IIVA 1NAIA 3INGA 5FYDA 1R0SA 2Z5LA 1M6WA 1PR9A 1JA9A 1UZMA 3AI1A 1KEWA 1T2FA 5T57A 4F6CA 5KJ6A 2G1UA 2GCGA 4BO4A 2G82A 5DN9A 4H3VA 4DLBA 3VAZA 2OUIA 5C37A 2AE2A 2OGUA 2NWQA 2Q1UA 1O95A 3H9UA 3UFXA 4DVJA 2GN9A 3ZHZA 1A27A 4CLOB 4XX0A 1P1JA 3G79A 3G3EA 4UAGA 3ZNQA 1ZSYA 3COSA 3LK7A 3GAFA 3FPLA 1JTVA 1P77A 4Z9XA 4YAGA 4ILKA 3ZWBA 5KVVA 1A72A 5EERA 2PH5A 4OXKA 3RIHA 3JQ9A 1RKXA 2RIRA 4XZ3A 4EGFA 4CMEA 4CLRA 3U9LA 2DQ4A 4J91A 4M86A 4N54A 3DZHA 4BNFA 3HWRA 3VHRA 1E5LA 3SC4A 4AJPA 3AK4A 1S6YA 1ZK1A 3RFXA 4CMIA 3FF4A 2D3TA 2VUTA 1UXJA 4GX1A 4IJKA 3V2UA 1NASA 4YJHA 3AUUA 2OP0A 2DTDA 4NU6A 3WR5A 2VHZA 2H6EA 3GPDG 3ZWAA 5KVCA 2A94A 3KSZO 1E6UA 1R15A 3RQSA 4B7XA 4UEOA 2BH9A 3KUXA 5IJZA 3AI3A 3EAGA 4Y6RA 1PGPA 1N7HA 5THQA 2ZQYA 1R0KA 3UF0A 1JAYA 4P4LA 3DZFA 1OI7A 5GZ6A 2CY0A 2Y0EA 1B8PA 4G65A 1XA0A 2YYYA 4CV2A 2BHLA 3SBOA 1ZO8A 2X86A 1EDZA 1VSUA 1ZEJA 5LDHA 5JW6A 3PHLA 2LDXA 3ZV3A 5KVSA 1B15A 4PN3A 4WLVA 2QRJA 2NV6A 5I7EA 2DBRA 3RC2A 4AJJA 3UUWA 1T4DA 5K1SA 4MVJA 2VRBA 5JPIA 2X4GA 1T24A 2X22A 4D41A 3UCEA 3K2EA 4K6CA 5JMPA 5AXAA 5CEJA 2R2GA 5LC1A 3PDJA 2Y1EA 3WSVA 5A5FA 2Q49A 4KP7A 4E33A 2YHUA 1KYQA 3ONEA 1PU2A 1XU7A 2D1YA 3IQDB 4RLSA 3B1JA 3DBVO 4PGFA 5EPOA 5C7LO 1GQYA 4YDRA 3K5PA 1Y7TA 3DZBA 3G17A 4FIZA 5JO0A 5JCJD 1DIBA 1WLYA 2PD3A 5CPBA 3BA1A 1GYRA 4BL5A 5H82A 4IZIA 2FR1A 4L75A 1HETA 1CETA 3GR6A 3WBBA 4E32A 3PHJA 1VRWA 3DBRA 1HLPA 3JD0A 3SVTA 3WNVA 3GNSA 3S2EA 1Q0LA 5CFZA 3HB4X 1NQAO 3P19A 3FNFA 1DHTA 4KDEA 4YAJA 1U2GA 3JQBC 3VZRA 5IDQA 4YAIA 1SPXA 1T1SA 4BV9A 4DQXA 3WIDA 5A05A 4E4YA 1AHIA 1IUKA 4GMFA 3IKTA 5FI5A 3AU8A 3QLJA 4D3DA 3L4BC 2A35A 3MOGA 4J16A 1H94A 2JHFA 4PLWA 4R01A 4BNVA 4BVAA 4NJOA 4JBIA 3SX2A 5JBIA 2Q1SA 5B4TA 3RUHA 2JD2A 4I5DA 4BNYA 1MUUA 4BNMA 1H9BA 2G76A 2PH3A 3PIDA 3QWFA 3ZV6A 2FR8A 2P4HX 2OL4A 2D8AA 4XYLA 2X23A 1LX6A 1IULA 1UXIA 4PVCA 2X0NA 4GWKA 3QSGA 3G1UA 5JDIA 3E48A 2ZQZA 1E1LA 2ZCVA 3GMSA 5B37A 5L4LA 2NLOA 1B8UA 2YFHA 3HN2A 3D0OA 3HN7A 4BQRA 3IOYA 4Z9FA 1IHXA 1GUZA 2WJPA 1Y81A 2ZYDA 4RVDA 1NFFA 3OETA 1PS0A 1U5CA 2AXQA 3RI3A 3U4CA 4W6ZA 3VH3A 4CJXA 4ZN6A 1A4UA 3K2BA 2QQ5A 1IE3A 3K8ZA 3QV1A 3W6UA 4L4XA 3SLKA 5THKA 2HDHA 4KDFA 3BHIA 1YRLA 1YKFA 2HAEA 4LGVA 3E1KA 3MZ0A 4OL9A 1E1KA 2CVQA 2VZ8A 5L7WA 3JQFC 1XCBA 4UUMA 1NP3A 2CMDA 5TIIA 3GDFA 3GN2A 4JGBA 1CQJA 2BF7A 4Y98A 5FEUA 4OAQA 1PZFA 1Y5MA 2JD0A 5FF9A 1NFQA 1I33A 4UVIA 3WYEA 4YT4A 3LT2A 2AEJA 3LC2O 3JD1A 1Y8RB 2EP7A 3CUKA 1LC0A 3IS3A 4I5EA 3K6JA 1VC2A 4LRTB 3KTDA 4CQMB 1CYDA 5HWSA 2O3UA 2GD1O 2VHVA 1B7GO 1C3VA 1FDTA 1FF9A 4C4OA 1IYZA 4XQ9A 1RM4A 5KOIA 3RC7A 3JSAA 3UHAA 5AXBA 4KTTE 1P45A 1W4ZA 2QYTA 2YV1A 3V5NA 4XJSA 4Z0PA 4IMPA 2ZYGA 1ADFA 2QRLA 2HMVA 3AI2A 1P1RA 4CLEA 1XELA 1QLHA 3BTUA 3ETDA 3OA0A 4J43A 5IF3A 1GYQA 3RWBA 1HE2A 1MFPA 2JFFA 4D46A 1DFGA 2RAFA 3FI9A 1NPDA 4WKGA 2IXAA 4FQ8A 3KO8A 4R54A 5JCJA 2Z1MA 5A9SB 4QT0A 1YOVA 1JKJA 5A04A 3BMNA 4RPKA 3BHJA 4K6FA 3DZKA 2RBEA 2DU8A 3CMMA 2O4CA 4UULA 1TI7A 3EK2A 4BNNA 3HHPA 1XKQA 3OIGA 2X9GA 1HE3A 4BO9A 1YB1A 1X1TA 1J6UA 5L95A 4E2WA 3BZUA 3ABIA 4WCFA 4ZQEA 4B8ZA 2PFGA 3E8XA 3JQ7A 1KC1A 4D42A 3F4LA 4Q3EA 2X1HA 1E6WA 2HSDA 5A9RA 3V1UA 1LQTA 3HADA 3MJTA 2CVZA 2X5KO 5TLSA 1I10A 2X9VA 2AMFA 2ZJ0A 3GQVA 1YQDA 3R3SA 5BSHA 2ZKLA 1GPDG 1KY4A 3GVXA 4NFSA 4NU5A 1Y9EA 4RVHA 5T8KC 3NUGA 2Q4BA 4BNWA 2LDBA 1PGNA 3V1TC 5JCXA 2VT3A 4CM3A 3LC7O 5JMWA 4B7UA 2O4UX 3QWBA 4CM8A 2BGLA 2GYYA 3Q1LA 3PJEA 2P91A 1HF3A 4WASA 3GHHA 4GAEA 3ZH2A 3DC2A 3KYBA 4CM7A 3DMTC 5U9CA 1NBOA 1TT5B 4J3FA 3RU7A 3ENNA 3NX4A 1A71A 1M75A 3AM3A 4ZRNA 2ZK7A 2IZ0A 4ND5A 1TB4A 2F00A 1BXGA 3NTRA 1YH3A 2NADA 4KUEA 5GY7A 4XB2A 2X58A 4J9UE 4E3ZA 1LRKA 4OHUA 4YXFA 4PLHA 5F1PA 1IL0A 1X0VA 3L0DA 3I6IA 2ET6A 1D7OA 5L40A 1RYDA 4DPLA 4MINA 3DHYA 2FRDA 3DWFA 2OMEA 1HSOA 1I2BA 3CIFA 3A1NA 3FBGA 4O6VA 4TRNA 3R1IA 4QEDA 1BSVA 5F5NA 2CNBA 5L7YA 4HFRA 4BGVA 3KZVA 1Z7BA 5F1KA 3SJ7A 2CF6A 1DRWA 1LLCA 3EY4A 4O5OA 3EZYA 3QY9A 5HS4A 3QJ5A 5T67A 4J1TA 3WBFA 1Z73A 1ZUD1 4DQUA 3O38A 3UAGA 1KERA 3I9OA 1HDCA 3C8MA 3LF1A 2GRAA 3TZ6A 3AM4A 4WCDA 2NU8A 2O50A 3VPXA 1EQ2A 2IDZA 5I7FA 1AXGA 1MC5A 4GX5A 2PZJA 3D3WA 1P1FA 3KOUA 2JKVA 5JE8A 4BB6A 1MG5A 3F9IA 1I3MA 4DA9A 1Y8QB 1YWGO 4B3JA 3HDYA 1RM0A 2Q50A 3P2YA 4L0QA 1I3KA 5ILOA 3PXXA 3WDSA 1H5QA 4NZ9A 5JAIA 1XGKA 4Z9YA 3L4SO 4RDIA 4CM5A 2H63A 1YJQA 1R0LA 3MWDB 4OKNA 4GI2A 3S2FA 3TZQA 3WNQA 1LU9A 2I76A 2DFVA 1MP0A 2WD8A 2Y1GA 1FMCA 4L74A 1WMAA 4NJMB 3JQ6A 1CEQA 4CUKA 3DQPA 2ZTLA 3GRPA 4ZU3A 3W1VA 4BIIA 5JAQA 3CTMA 1C0IA 1QV7A 2H9IA 3C7CB 4JJFA 4AJNA 5LDGA 1QKIA 8ADHA 5MGBA 2NUAA 3QVWA 5GZ3A 3PRJA 1NHWA 1DOHA 4PRKA 1BTOA 1CERA 3LU1A 5IZ4A 1ZK3A 1YE3A 4BO8A 3U3XA 2PWZA 4XIJA 2EIHA 2H5LA 3LVFO 3ORFA 3MJEA 1E6EA 3BMCB 2WYUA 1F12A 4Z3KA 4A7PA 1BXZA 3TOZA 2NTJA 2OBYA 3ZHXA 1UH5A 1IPFA 1P33A 4CMGA 2JL1A 4WGGA 1C1XA 3SJUA 3T7CA 1H6DA 3DHNA 1PS8A 2CUKA 4CMJA 5CDYA 1ONNA 1SC6A 3VC7A 2CVOA 4YCAA 3UICA 3ZU4A 4CL8A 3GVHA 3TF5A 4XR4A 1EVYA 4OMUA 5CEEA 3HFSA 3CPSA 4O63O 1EUZA 4L76A 1XYGA 2Q46A 5EN4A 1EVJA 5IXYA 2W2LD 3JYNA 2DT5A 2PLAA 2O2YA 4N5LA 1E1MA 1Q7GA 1HDXA 3WGYA 1H2BA 3K92A 4K28A 3ZN2A 4Y8VA 2AEMA 4BGEA 4RF4A 4YTEA 1N5DA 1LQUA 1UP4A 1OZAA 2DLDA 3ANNA 3GZ4A 4RORA 1GUFA 4INAA 4WLEA 2GSDA 3U4IA 2X0IA 4TSKA 1ONPA 2D2IA 3LYLA 1MGOA 3H4VA 2GF2A 1E3LA 3ASVA 1WW8A 1LBEA 4YBZA 1NQOA 4CMBA 1UDAA 3PK0A 3QRWA 2BI8A 4BO6A 5A06A 1I3LA 1H2HA 2JFGA 5CDGA 1ISHA 4E6PA 1IZ0A 2NM0A 3WTCA 3AFMA 1AHHA 3D3EA 2B0JA 1A4IA 2I6TA 3DONA 4CQLA 3GUYA 2VTEA 3PI7A 4PLCA 2V65A 1XEAA 3VH2A 1ZSVA 3DAPA 5EESA 1EZ4A 2XXJA 3JQ9C 4EUHA 1D4FA 3RCBA 4FCCA 1GQQA 3S55A 4CMEC 3U09A 1RM3A 2NVUB 2HJSA 4E5MA 3WQSB 5BSFA 2QYSA 3Q0EA 2FSSA 3FR8A 3PJFA 4DPKA 1HKUA 4NK4A 1NAHA 5CAEA 4E13A 3NV9A 1J49A 1PL8A 4IIUA 4XEHA 1JWBB 3IJPA 3NRCA 3PQEA 1DC3A 3SEFA 3BHMA 1WAMA 4DLAA 4BO7A 4R69A 1O94A 3GVCA 3BMQB 4RJTA 2WM3A 1PQUA 2GGSA 3GEMA 3BYZA 1N7GA 1WDMA 2FN7A 4Z6KA 5B4UA 3ZU5A 3ZDFA 1D1SA 3BTVA 1KIFA 1P0FA 1LSJA 1DAPA 4BKUA 1E92A 3E5MA 3V2HA 3F5SA 4B3HA 5I7VA 3H2ZA 3ZWPA 5KNLA 3V8BA 4J2HA 4W9NA 3D5TA 4NHEA 3UN1A 5IN5A 2HMWA 1WZIA 4MVJH 4CV0A 2GR9A 4BO5A 1DC6A 1I5RA 2AQ8A 4QSMA 1M2WA 2D59A 4XQGA 4B4WA 1C14A 4CM4A 3RBXA 2HKIA 1LLUA 1VJ1A 5H83A 5DBIA 3BXXA 1DIAA 3BTOA 3C7DB 5A3VA 3IAHA 3VOSA 3I9LA 3IDSA 2UV8A 1PS9A 4BKQA 4YAKA 3RFVA 5CEFA 1GZ6A 4P4NA 4NFHA 3OMLA 4ALKA 1YVEI 1HE5A 1PZHA 1WWKA 3H3JA 4XYBA 4LSWA 3RBVA 4RPGA 1OBFO 1YDWA 3U62A 4CR6A 4MJLA 3H9QA 4LISA 2Y0DA 3GAZA 3B20A 3QW2A 4OYRA 3DO5A 1I01A 3TJRA 2ZJ1A 1FDWA 1XQ1A 3AU9A 3I5MA 4KOAA 4EJ6A 3JQGB 4MIOA 5K6AC 4Q3AA 5BT9A 2F1KA 1NXQA 4ZQGA 3WTBA 2Q1TA 5L9AA 1HDOA 1U28A 1U3WA 1PWZA 1YGYA 4GX0A 2SCUA 4R3NA 3GEDA 2O3JA 2BFMA 4PZDA 4AJLA 4D7AA 4B8WA 2P9CA 1NQ5A 4R5MA 1NTOA 1NHGA 2A9FA 1RYEA 4X54A 4BKPA 2W2LA 5DT9A 3CSDA 3GRKA 3IC5A 3PIIA 2HMTA 2Q3EA 3JV7A 1PGQA 1UJMA 4DBVO 1ZJZA 4PLGA 5IFLA 3BMOA 1UXKA 4E5KA 3U4HA 4E12A 3TL3A 3EVTA 2PV7A 1HRDA 2X5JO 1K3TA 2PKQO 4N7RA 1NPYA 3I6QA 3VH1A 3QWHA 4YACA 4CLRB 1K89A 5K0ZA 1RPNA 1EUDA 1QP8A 3E9QA 4OXNA 3QVXA 1UP7A 2YV3A 2J3KA 1HWYA 1YO6A 4DBZA 1QYCA 2D0IA 3DZJA 3NT5A 1DSSG 4IXTA 4CMIB 2QHXA 3NEPX 2AE1A 4NQZA 5A02A 4YJHB 3GMDA 2IXBA 3G49A 3LF2A 3DXFA 3BIOA 3JD2A 5JDIC 1ARZA 4QXMA 3CKYA 5IXSA 2Y0CA 4FFNA 4CMCA 5K9ZA 3TOXA 1ISMA 5TF4A 1PJ3A 4AJHA 1AXEA 1BVRA 1XG5A 2AG8A 4HX5A 3F5QA 1ENOA 3Q2IA 1BW9A 2NSDA 4IQ8A 4RVUA 4AJKA 1MXFA 1C1DA 3EVNA 3GFBA 4Q3CA 3IJRA 5ITVA 4RDHA 2DTXA 3CH6A 1ORRA 3O4RA 2O23A 3K30A 3ZHYA 2ZB4A 4U6SA 1K0UA 4FC6A 4NMHA 1WDLA 5KJFA 3GGPA 4GQAA 4XGKA 3WFIA 2VOEA 5G4KA 4Z0TA 4ZVVA 2PA3A 4B4OA 4ZICA 3DMYA 5DZSA 3ENKA 1KS9A 2G0TA 4M54A 3SC6A 3EC7A 3O9ZA 2OBNA 3B1FA 2AHRA 4J2OA 4HUJA 4KUHA 2DFDA 1LSUA 3GN1A 4K1LA 3RFTA 1GEGA 5FI3A 1YONA 2NVBA 2VYND 1UAYA 3JD3A 3T7EA 2BFAA 4RQTA 5HTOA 1HDGO 2DPGA 2NNLD 2EXXA 2O48X 2FOIA 1FK8A 3CMCO 4XIYA 4EEXA 1U3TA 4E21A 1B3BA 1I0ZA 3E9NA 4FD3A 5TQVA 1EK6A 2GNAA 4KWIA 1I24A 1XLTA 2W90A 5AYVA 4WPGA 1WDKA 2AA3A 3KLMX 3EYWA 4WEQA 4LVCA 5KJ1A 3WG9A 1NR7A 4R9RA 3EGOA 4LVUA 1GV1A 4PLTA 5A9TA 5AXDA 3FPCA 2NU7A 3MJ4A 3OJEA 5ICMA 2J3JA 4HFNA 1F8GA 2ILTA 5IG2A 3DBRB 3VZPA 3OQBA 3WGTA 5KKAA 4YT5A 1PJSA 1JAXA 1ZZEA 5IZCA 4YQZA 2VYVD 5H81A 4ALIA 1CJCA 1J5PA 2NACA 3IP3A 1SOVA 4XQEA 5ES3A 3SLGA 2GZ1A 3ANMA 4UEKA 4BKRA 1JU9A 4J9VA 2HMUA 3FN4A 5KTKA 2CZCA 2WDZA 4JQCA 3CE6A 3OEWA 3EHEA 3KV3O 1X15A 3NDRA 3OFSA 3JQ8A 3PP8A 3WXBA 3ZWCA 1QV6A 3F46A 5A1TA 4PG6A 4IDBA 4YVFA 3U49A 4BS9A 4NNJA 4XGIA 4R68A 4WLFA 3EW7A 5HS6A 2FR0A 3HFGA 4QX6A 3NAQA 3DZGA 1LUAA 1TEHA 3FNGA 3GY0A 2HRZA 2YQ5A 3VZSA 1SEPA 2C20A 3R3JA 3DFUA 1VM6A 5B12A 1YB4A 1BDBA 1LDBA 4QQRA 4TRMA 3OP4A 3S2IA 4YAEA 1GEEA 1O5IA 5A5EA 4D44A 4PVDA 3ROPA 1XDWA 5EQDA 3GG9A 2V7PA 2IZZA 5CDUA 2J5KA 2HU2A 3AOEA 2P2SA 1EFKA 4GMGA 3D1LA 2V6MA 1BVUA 3C1TA 4XD2A 1U9JA 4KMSA 4NG5A 3GEGA 2P9GA 1A5ZA 3IIEA 1EK5A 4JBGA 2XXBA 1J4AA 2PK3A 3O8QA 1SNYA 1ULUA 1XSEA 4LMPA 1TA4A 1GADO 2JCXA 3PQFA 2EF1A 3VDQA 4IDEA 1T2CA 4HNHA 4LW8A 4M55A 4BNLA 2P5YA 3D64A 2O7QA 3W4JA 1ZFNA 1D3AA 2XAAA 3A9WA 2GN6A 3GF4A 1E7MA 4FB5A 2I67A 3HE3A 1T4BA 1DLJA 2E49A 4MP3A 2OHXA 1VL6A 4R3WA 4XJTA 2E48A 2O3RA 3OH8A 3AW9A 1QMGA 3F1KA 3LLVA 1Z7EA 1KC3A 3AM5A 3WYBA 3NJ4A 2CDBA 3D4OA 4RQUA 3K31A 3GC6A 3QWIA 5IDYA 5BNFA 3H5AA 4YRAA 4J7UA 5A4DA 2Y68A 4MVJM 5I8ZA 3VVBA 3HG7A 1X7HA 4W7HA 6ADHA 4EDFA 4YEDA 4B4UA 2IE0A 4WECA 2AEFA 2Q99A 2XPCA 1HDZA 4L9RA 2QG4A 1PWXA 2FPIA 2VYNA 3QHAA 3Q11A 3ADPA 3MWEB 1YBMA 2VOJA 2YHIA 3IUSA 3KSDO 5BSEA 4PG5A 3ZV4A 1D8AA 1OMOA 3DBLA 5ER6A 4ZHSA 4IDAA 3Q6IA 1V9LA 1U8FO 4EZBA 1HDRA 2EV9A 3FHLA 2NQ8A 4IS3A 2RCYA 4ALMA 4F45A 4RPLA 2R00A 1ISJA 2V6BA 4P22A 1YL6A 1YOVB 1SO8A 3RC9A 1QYVA 3BMNB 1R4MA 4QO7A 2UDPA 1LRLA 4CM9D 5CG1A 3GH3A 3ZWVA 1VJTA 4XKJA 3U0BA 1UZLA 2E4AA 2GPTA 3RAJA 1XR3A 4WCFB 3GUCA 2VWPA 1P74A 5TJHA 2B4TO 3JQ7B 2Q2WA 4DMMA 2POQX 1MA0A 2VYVA 1F06A 3GG2A 4JK3A 4YQYA 3RBZA 3WYCA 3VPHA 4DPMA 3PYMA 4W99A 3E6AA 1JLLA 5BQFA 1SBYA 4WK6A 3ZHBA 1PJQA 4MVJI 5T5QA 1H9AA 5U4QA 3I9KA 1U8XX 3K96A 4WUVA 1JWAB 3PJGA 1MXHA 2Y67A 1GCUA 1F14A 1C0LA 2PGDA 2X8LA 1IOLA 2DUUA 1MLDA 1GR0A 5ICSA 2VUUA 3GZNA 3A14A 3M1AA 3P2OA 4IGEA 4Y67A 3KBOA 4LMRA 5T6BA 1LEHA 4A0SA 5JC8A 2EG9A 4YJGB 4IMRA 2E37A 1IZ9A 3VVCA 2DTEA 3W4KA 5BNIA 1UP6A 2B5VA 2EJVA 4IJUA 1WZEA 1YQGA 3I4CA 4U8GA 2X5OA 5DOZA 5CG2A 4FFOA 3OIDA 1V0JA 1KVRA 2RHCA 4RVFA 3M6IA 3KHUA 1MC4A 2HCTA 3O26A 4L73A 1PQPA 3VPGA 1ZMOA 1BXGB 1AN9A 2WSBA 3ROKA 4Q3NA 1Z45A 3T4EA 1VLLA 1N8KA 3ZU2A 2VHYA 1V35A 5JXWA 2GZ2A 4YA6A 4IM7A 3F1LA 3QVOA 2GN8A 3RU9A 3ZCXA 3R6DA 4P38A 5HBRA 1OC2A 3FWNA 4NBWA 3I1JA 3PHGA 2RHRA 1QG6A 1SOWA 1QYDA 4Z0HO 3WIEA 3PZRA 3SXPA 4IZHA 1PGOA 3ON5A 3KYCA 2WD7A 4J7CA 1H0KA 3UCXA 2Y66A 1ADBA 2DC1A 3GVPA 4OOEA 4FW8A 3VPSA 3D5QA 2WYWA 6LDHA 2C5EA 1B0AA 3FCOA 4U0JA 3LZ6A 4GLOA 2C5AA 4J49A 4R4JA 2OFPA 3HDHA 1P44A 2IEBA 2J6IA 2OO5A 1IY8A 1IPEA 1I36A 1OAAA 4I08A 1V3UA 1PEDA 4BGUA 4R41A 3H5RA 1A9YA 3D3WB 4GBJA 1VPDA 4DYVA 2B36A 4URFA 5G0VA 1WMBA 2OZPA 1JN0A 3OF2A 3WX0A 5IDXA 4BKOA 4QFDA 1T2AA 4OOFA 5JO9A 3U4DA 4BOYA 4U7WA 5KCZA 1UXGA 2BI7A 3KYDA 3WWZA 5CDTA 4II3A 1AE1A 1QR6A 4EITA 4DC0A 2C07A 2VNSA 2D4AA 2XF8A 4LCEA 3UH1A 1K2WA 3NDJA 3DB2A 1PJTA 2W4QA 1UXHA 4R1UA 1Q7CA 2CFCA 4FPXA 1WXDA 4D3SA 4J4HA 2HRBA 4A27A 3UVEA 4ZQFA 3CINA 1LSSA 3JCZA 4FN4A 3DOOA 1K5HA 2VN8A 2EGGA 2IYOA 5G0TA 3W8DA 1VJ0A 2FP4A 2Q4EA 3ICCA 5EINA 1H93A 1R4NA 2X9NA 3RUFA 3VH4A 4CM9A 1NVGA 2B5WA 5EMHA 1N1GA 1BRMA 3E5RA 4DIBA 4W9NC 1DFHA 4FFLA 5L7TA 1S7CA 3OIFA 5L4NA 3F47A 4S3MA 1YL5A 5JAZA 4EJ0A 1DIHA 4J0FA 3TZHA 2BFPA 7MDHA 1C1XB 4N5MA 3QVTA 1ULSA 2WE7A 4Y6PA 1BDMA 2VT2A 3OJFA 3OJOA 3Q2KA 1GY8A 1LC3A 4KTVE 2TMDA 5IDWA 1I8TA 3C1OA 1PL7A 1B8VA 2EW8A 3D7LA 4RO0A 3TFQA 4AJEA 1M6HA 2HK9A 1CQIA 2IEDA 4MP8A 2ZTUA 2V6GA 1ISGA 3TSCA 3ZNNA 2VWHA 1Z75A 2Q45A 4IQ0A 4PRLA 4TRRA 4J7XA 4IDFA 4BNKA 5KWEA 1V6AA 3F4BA 4DXHA 2XOXA 3PFWO 4ZQBA 2P4QA 3PZBA 4D0SA 1ZBQA 5TT0A 2Y1CA 4C7JA 1X7DA 1GQ2A 1P3DA 1NWHA 1U3UA 2J3IA 4HBGA 2W2KA 4GKVA 3RUAA 2EJWA 4WLOA 3FRJA 1LLQA 3WSWA 4XRGA 2HJRA 1N1EA 4E31A 1MV8A 2FZWA 3WMWA 2DM6A 5G4LA 1PL6A 3JQAD 1OFGA 1U2DA 3GDOA 4GGPA 4BQPA 3A4VA 4AVYA 1ZEMA 1JW9B 4OKIA 3OEYA 5ILGA 4G2NA 4CQLB 2Y05A 5HM8A 3ST7A 5G0WA 2E6UX 1U4OA 4LK3A 1GPJA 1K6XA 4M8SA 2PZKA 4CM1A 2GERA 4GWGA 4IJVA 1DC4A 1NVTA 1UDBA 5JDCA 3E18A 3K9QO 3RUEA 3RVDA 1DPGA 2X0RA 3HNPA 3WGOA 3OQ6A 1FDVA 1N92A 4Z3DA 2P9EA 1ZK2A 4EEZA 5L53A 1QYWA 4BGIA 1LRJA 1SB8A 1VKNA 1PZEA 4ZA2A 1G0OA 1X0XA 1ZK0A 2DBVO 2Y99A 4S1VA 4GH5A 4AJIA 2DUWA 5BSGA 2Q1WA 3L77A 2I99A 1IHYA 1GV0A 2JFHA 1UZNA 3LLSA 4BO1A 2C59A 4AJ4A 1MFZA 2VWGA 1HYHA 3STHA 1ML3A 5GMOA 1HDYA 1P1IA 4TZKA 2HQ1A 2P68A 2PNFA 3D4PA 3PWKA 3V1YA 1MX3A 3KVOA 5TRTA 1PSDA 4CLHA 2X0JA 2WTBA 4ND4A 1X7GA 5TX7A 3RROA 4Q3DA 4WOJA 1U7TA 3QVSA 1R66A 4U5QA 4PCVA 5JNLA 3DR3A 1E3WA 2DBQA 1ZNQO 2CDAA 2GZ3A 4E2YA 4D79A 2I9PA 4A73A 3DBHA 1QLJA 4JCOA 1L1FA 3IL2A 2Y1DA 4NH4A 4I8XA 4A10A 1NM5A 4I5FA 4ALNA 1M67A 3U5TA 3GHYA 1Z74A 2ZB3A 1EQUA 4DRYA 3NKLA 1PTJA 1BGVA 1N9GA 3FSRA 3B6ZA 1OC4A 1EBFA 3KXDA 1E7RA 1KEUA 4HNGA 3UXYA 3C7AA 4IDGA 1B16A 1E7YA 3GK3A 4XRRA 1XIVA 1ZJYA 2JD1A 3RJ5A 5JYEA 4ND2A 4HFJA 1KEPA 3HSKA 1EMDA 4FJ1A 3INTA 5TJ9A 1E7QA 5F3RA 1HTBA 1J0XO 4YWJA 1DXYA 3PEFA 1VL8A 1Q2XA 3LT1A 4DL9A 3G1TA 3HUDA 3S1LA 1L7DA 4OH1A 3PGXA 1DEHA 3TRIA 3VTFA 1PX0A 3A28A 4CV3A 5ER9A 5DDIP 1TLTA 2BMAA 4BNIA 5DCYA 3E82A 4MIYA 5IZCC 4IUYA 3C24A 1ENYA 2CDCA 3IMFA 3AFNA 3BMOB 4YT2A 2FPPA 1B3RA 1CRWG 4BNZA 1K6IA 3QE3A 4PLFA 1JQBA 2UUPA 3LDHA 3WFJA 3UW3A 1K6JA 4IJWA 5B1YA 1T2DA 3QQPA 4EW6A 1H6AA 2VZ9A 2C29D 1U5AA 3WOHA 3EZLA 4UVDA 4ZQHA 4CR7A 4NIMA 5ITWA 4EBFA 2YZ7A 2R6JA 2B4QA 4CLDA 3RC1A 2ZTVA 4UVEA 3ZNOA 4CR8A 4D0RA 3JQAA 4NBTA 4MKRA 3TZCA 2DKNA 4DC1A 1N2SA 1JVSA 2B4RO 4MVJF 3E9MA 1A7KA 4QUKA 4FS3A 2C54A 1U1IA 4XYMA 4BNTA 5L4SA 3VDRA 1GUYA 3OJLA 1P0CA 2QX7A 1DFIA 3PQDA 5DP2A 3TDKA 1EE2A 4BNJA 4H7PA 4XQCA 3ETEA 1I2CA 4ONEA 1E5QA 1BW9B 1E0DA 1X1EA 2YDXA 3AOEC 1R37A 1C1DB 4RLHA 3CZRA 4WNIA 4XYGA 4YJFA 5L3ZA 1L7EA 2FSVA 1E3IA 4OXYA 5DOVA 1PGJA 2JAHA 3UGKA 3I52A 1ID1A 1SZJG 4XYEA 4ZJUA 1PJBA 1EDOA 5G4KB 3WB9A 3GOHA 4M49A 3DDNA 1WNTA 3AY3A 4CM6A 1GTMA 4XCVA 3D4NA 1NQTA 2I66A 2EKLA 3OSUA 1UDCA 4Q39A 1T25A 5KJCA 1VI2A 5CDSA 1GFSA 4FGSA 2PKQP 2Q2VA 5A03A 4FBGA 1QRRA 1PJ2A 4CMAA 1LDEA 5AQ1A 3RD5A 3I4FA 2BD0A 3DOJA 3GGGA 3H65A 1EVZA 2HMSA 3HDJA 1H6CA 4OGWA 4RVSA 4CLOA 5GZ1A 1NPTO 2IRWA 3GFGA 1U7HA 3W8FA 2Q2QA 3H3FA 1GDHA 4HY3A 1HZZA 1I30A 3JQEA 3M2PA 3H2SA 2B37A 5DBFA 1XHLA 5CP8A 5KJEA 4A2CA 3EMKA 2FMUA 2DPHA 3HDQA 3M2TA 1HZJA 3NYWA 1DIRA 4K26A 4AJOA 4KWHA 4XDYA 3RJ9A 4YT8A 3P7MA 3ROQA 1ISIA 4J1QA 3PGJA 2EHDA 1B2LA 1Y9AA 2YDYA 1BWSA 3PYXA 4MVJE 4PZEA 3KETA 2CF5A 4EUEA 1O6ZA 1KVTA 1EE9A 4IINA 4JIGA 3WLFA 3PDUA 4EJMA 2B69A 4ALLA 2ZCUA 1PJLA 1W73A 3H8VA 3Q9UA 2RH4A 1R12A 1ENZA 5J23A 1MG0A 1GZ3A 2YQ4A 4OSPA 1BXKA 3L9XA 4YRBA 3ASUA 2C2YA 3MJCA 3JYQA 1ZH8A 4YPOA 1P1KA 2I65A 2YFQA 3QP9A 4O1MA 4CPDA 4BO0A 4IXWA 4WE3A 2VHXA 1G6KA 2QZ9A 4I9NA 4ZD6A 1DRVA 1E1NA 2R00C 1ADGA 3PPIA 4O0LA 4DUPA 4E5PA 3M1LA 1DIGA 3JYLA 2EKPA 1UUFA 3JQ8B 2FHSA 2GN4A 4F46A 4NI5A 1AUPA 4CQMD 3LT4A 5JY6A 3C1AA 2FWMX 1AGNA 4KUGA 1EBUA 1EEHA 1NNUA 2GO1A 2OORA 2V6FA 4B4VA 4CUJA 4D43A 4PG4A 3L6EA 3ANLA 3OHSX 2J5RA 4PIVA 4OO3A 4MP6A 4GVXA 5K6AA 4NR0A 1LLDA 4L8VA 4Q9NA 5F21A 2PKRA 2BFOA 2X7HA 4NFYA 1G1AA 4PZCA 4J4BA 4MVJG 4WCFC 4TZTA 3MTJA 2DAPA 4FC7A 4BB5A 2NQTA 5G0SA 2BKAA 4WJZA 2FPGA 1W0CA 3LC1O 4XGNA 2NVWA 2VQ3A 4UVHA 4XR9A 1T26A 3LSYA 4I9UA 4GKBA 1O8CA 1PR3A 3O8QB 3X2FA 1DBVO 2O3SA 3H6KA 3PHIA 1LXCA 2DBZA 2Y93A 3QIVA 4M89A 3ULKA 1CIVA 2BRUA 8LDHA 5JLAA 2WMDA 1PQWA 4XWYA 5JY1A 4AJ2A 1PJ4A 3DHEA 3ICPA 5EJ2A 1EUCA 4GLLA 3CEAA 3NGLA 3IP1A 4NDNE 5TC4A 5TS3A 3BTSA 4W4TA 1DDOA 1ONOA 1VE9A 3H9EO 1DJNA 3PLRA 5I9LA 4UREA 3KEQA 1ZXLA 2YUTA 3FNHA 1X13A 3DAFA 4I9HA 1DHRA 4R1SA 3DFZA 4MIEA 4CV1A 1V3TA 4MVJP 1YXMA 3TZKA 5HA5A 2B35A 3HZZA 5G0UA 3VKVA 3WGZA 5C5IA 2O3QA 4UEJA 1Z82A 4HV4A 2EW2A 4BV8A 1F17A 2C2XA 4MDHA 1KY5A 4OIMA 2VRCD 5U1PA 1KBZA 5L51A 3HJAA 5AOVA 3RASA 5ENVA 5EQFA 1E3EA 4LCJA 4NK5A 5F5LA 3W4IA 1RM5A 2IZ1A 3G0OA 4J1SA 1BMDA 2BGKA 1F8FA 1PIWA 2YHIB 1DB3A 2HUNA 3KEOA 1JVBA 3ZWYA 4IGFA 4JX8A 2CD9A 1BG6A 3DBLB 3ZNPA 5A3JA 3L6DA 4GL4A 4GVLA 1U3VA 3PHHA 3ETGA 4PLZA 3L9WA 1WP4A 3TNLA 1YB5A 4FJ2A 1TXGA 1E77A 3GPIA 2C7GA 2J3HA 4HWKA 4HXYA 4PG7A 4DIFA 1ZXBA 1NVMB 4MKZA 1R4MB 2GLXA 4IY1A 4DYDA 4WNCA 3VKUA 3C85A 4AICA 1EFLA 5CPFA 4R5HA 4R51A 2QIOA 2YY7A 1Q7BA 4AJ1A 1R16A 3Q3CA 4FGWA 2W8ZA 3ONDA 3DTTA 3Q9NA 5C3MA 5I9NA 4HP8A 1HLDA 1U4SA 1PJCA 1SCUA 4MO2A 1JKFA 3GT0A 4J90A 1QYXA 3RKUA 4OQZA 1TVEA 2FZEA 2D5CA 4OM8A 2AQIA 1KVSA 4MOWA 1A7AA 2HK7A 3KLPX 2AW5A 3L07A 2CSUA 5JAMA 4EI2A 2WE8A 3KM0A 5TGDA 2EP5A 4TKLA 1P1HA 1Y8RA 3PWZA 2C82A 3FWZA 4CQMA 4JJGA 4Y9DA 5DP1A 4KQWA 5EIOA 3S2GA 3GZNB 4FFMA 3B1KA 2JJYA 4PLPA 1MB4A 3NDIA 5COBA 3RUDA 1ENPA 1V3VA 4KQXA 1Y5RA 2EWMA 4II2A 5JS6A 2OP1A 4BHTA 4CM8B 4UUNA 3C3XA 4ITUA 3WICA 4PFJA 4W7IA 3ZWMA 2VZ0A 3IKVA 1V8BA 1NX6A 3JQBA 4FR5A 1HL3A 3ZV5A 4F3YA 4RZIA 2UVDA 2PGJA 3ZWNA 1LA2A 1PZGA 3WGHA 2AQKA 3PYLA 5KIAA 3TL2A 3KB6A 4G5HA 3O03A 2O7SA 3FBTA 3ZU3A 5TT1A 3ONFA 3L4BA 3WMXA 2PGLA 5AVOA 4B7CA 5A9SA 1R6DA 2UYYA 1KEVA 1HSZA 1HYGA 4H15A 3F3SA 2D5AA 3KYCB 2WD7B 1I3NA 4DMLA 2Y1OA 4E30A 3NTQA 3NGXA 3WGIA 4K9DA 1W8DA 4L4SA 3DL2A 2E82A 3KSUA 5TSDA 2OXIA 3UKOA 3HB5X 1CDOA 3JQDA 5CHEA 1LDYA 3I83A 1DRUA 4EYEA 3DEYX 1LNQA 2VUSA 1Q0QA 3PJDA 3ZWXA 4IDDA 3DOCA 4RPHA 4OSOA 1E3SA 3RKRA 1I32A 2VHWA 1DO8A 3ZW9A 1ADCA 1QXSA 4YJGA 3NT4A 1YDEA 4G81A 3VTZA 3HQ4O 1RJWA 5JDCC 1VSVA 3EDMA 3KYDB 4JLWA 4LSMA 3MTGA 3VZQA 4ZGWA 4JP2A 2VRCA 4QECA 1I2ZA 1SEVA 3AUAA 3MJVA 3GNQA 5BNTA 2P5UA 1VKOA 2Z1NA 3F6YA 3I9JA 2EERA 4LRSB 1DLIA 3OA2A 2GDZA 3OQ1A 4FFRA 1Q0HA 4U6QA 4BNUA 1TT7A 3OBBA 4TMFA 1TT5A 7ADHA 3JQFA 4TQGA 5JYDA 4J0EA 1WPQA 4FJ0A 1XWFA 1LDGA 3KRTA 1P9LA 4A5OA 1KVQA 1HYEA 4YYZA 1CWUA 3GVIA 1GAEO 1R4NB 1XU9A 1Y6JA 1D1TA 3TFOA 4MKXA 3OECA 4QFCA 5DBGA 1P31A 2QW8A 5C7IO 1UAGA 2JCVA 4XB1A 3TWOA 1YBVA 2VNAA 4E5NA 3ROMA 4NPCA 4YJDA 3ITDA 3DAGA 4BMVA 5HRUA 3OICA 1HEUA 2WYVA 1FDSA 4TVOA 4RF3A 4YRDA 1SAYA 4J4TA 2A4KA 4C7KA 4R1TA 1ZCJA 3WGGA 5JSFA 3K73O 4A03A 4MPDA 1DC5A 2VWQA 4FSHA 4HKTA 3ZWOA 4B79A 4DGSA 1WVGA 3PVZA 2B83A 3AOGA 3H5NA 1SB9A 4DTIA 4JN6B 4CUZA 3DTYA 5DCWA 3ZWWA 4JBHA 4OJNA 3T4XA 3NJ8A 1ZMTA 3PWSA 4RPJA 4TWRA 3TQHA 2JHGA 1GU7A 3PFFA 4CLXA 1ZK4A 3ITKA 4RZHA 1Y8QA 2EKQA 5KVQA 5TNXA 4WEOA 4YB8A 5B4VA 1FXSA 4DQVA 1UR5A 2JCYA 4F6LA 2W2KB 2PD6A 1FJHA 1X14A 1A9ZA 1FDUA 5DF1A 2BELA 3N7UA 4BO3A 4R16A 1HXHA 5IAAA 5ADHA 1QORA 1F0YA 3I9NA 3ZW8A 1GYPA 1O0SA 1CF2O 4NJMA 3ZZNA 1RWBA 5JFOA 2WWRA 2YW9A 3GDGA 4DWVA 2C7VA 4GSKA 3N74A 3RSHA 4H16A 3WQRA 1O89A 3H7AA 3JYOA 4ND3A 2UUOA 2NU6A 4IBOA 5FWNA 1M76A 3P5SA 4YR9A 1YQXA 4ID9A 1SMKA 1EVIA 5FFFA 4TROA 5BR7A 3W6ZA 5T8KA 2QRKA 3CXRA 2I3GA 3L6OO 4IQGA 1VL0A 4ZRMA 5F1OA 2O3TA 1GZ4A 3DZIA 1H6BA 1E7SA 5I8WA 4I5GA 1O9BA 1LTHR 3H9GA 1YS4A 4CL3A 3BMCA 3LT0A 4AG3A 3WS7A 1LI4A 3MJSA 3I9MA 4IDCA 4IS2A 4R1NA 5IN4A 1NYTA 4U0KA 4WLNA 2A92A 4J6FA 2J5QA 2GASA 5LCXA 2BGMA 4TVBA 3DMTA 1NFRA 5COQA 3AWDA 1Z6ZA 2IYPA 4N5NA 4FOSA 2RH8A 1IB6A 4D3FA 1JKIA 4UUPA 4RVGA 2AG5A 3AJRA 1B26A 2NTNA 3FD8A 3LQFA 4JJIA 3N58A 3PTZA 4NBUA 4RF2A 1GD1O 3H9JA 5DNAA 4DREA 4KZPA 4E5YA 3I3OA 3I23A 3RUCA 1Y1PA 4BUCA 4ESOA 4JP3A 3WQQA 2AQHA 2FY8A 9LDBA 4JXKA 3BAZA 4E2XA 3FNEA 2H1SA 3V2GA 3WWYA 4PLYA 3W8EA 2PZLA 4FFPA 4GSLA 3B70A 4M87A 3OM9A 1E3JA 4RV9A 4AFNA 1OOEA 1DAOA 2GUGA 2NU9A 4CMKA 2YJZA 2YV2A 1Q1NA 5DULA 4E2ZA 1NWCA 1E3WB 5AXCA 4UUOA 1XQ6A 4O59O 4A26A 1LSOA 3GA0A 3DBHB 4RF5A 1ZKMA 4W82A 1ZIDA 1C0PA 2X6TA 3MEQA 2PR2A 1ZVMA 4R9SA 4UVGA 4BNXA 3AUTA 3R0IA 1ZW1A 3E03A 4HFMA 3JYPA 4HADA 1G0NA 5COAA 1LJ8A 3WJ7A 4CM4B 3VPFA 4PLVA 4TRJA 1ISFA 1N9GB 3GNTA 3QWAA 3AUSA 3GGOA 1KETA 2W98A 4B3IA 1GCOA 3IUPA 3S8MA 2TMGA 5KKCA 1KVUA 3UOGA 4DLLA 4EUFA 4PG8A 4IPTA 2I3AA 2Z95A 3INRA 2ZATA 3CZMA
chains in the Genus database with same CATH superfamily
1C9KA 2OZVA 3RHZA 3T9DA 2NVUA 5FXMA 1RU3A 3L6BA 3N8KA 1A9PA 2X8JB 3PNQA 1KQOA 3FTNA 5G2OA 4Q19A 4QXQA 4COKA 4RGBA 5I48A 1ETUA 2I5PO 1RCTE 5BN3B 4MSUA 4LG1A 1XXHA 4YS6A 3AJ9A 3WJAA 1AO3A 4F60A 1CRPA 4Y2RA 4HJXA 3HH8A 4S05A 1YL7A 4WFJA 2G72A 3Q5EA 4H7KA 5JPCA 1SCKA 1ZUWA 4MVJD 2FOXA 2WABA 1G3IA 5FL7A 5AK4A 4CEIB 1T6BY 5IABA 2YOHA 2H92A 2I78A 2NZ2A 3MXTA 3NTOA 1G2IA 4K6HA 2PLNA 3N53A 1ESEA 3FHCB 3H75A 1U2RA 3DKRA 3NHAA 2JA2A 3K0AA 4GPD1 4DY4A 1I2AA 2G17A 2H2DA 4FMDF 5DEIA 5FO0A 5J9FA 4U1RA 3BDIA 3M6AA 3VPDA 2DF8A 4BIMA 2DE0X 2E18A 1RABA 2IODA 3ORHA 1W87A 4AX8A 2GH1A 4KX3A 4WOKA 1IG3A 3P97A 3RTAA 3QJGA 5AJHA 1VHQA 3EVBA 3ZCSA 4KXUA 5F7JA 2QZZA 3PA6A 4HYTA 2HEIA 4OQYA 3ZX5A 1MPTA 1NNSA 3MS2A 3X2EA 3FR7A 1NR1A 2G5CA 4LV8B 2CE7A 3TW6A 1E0SA 3ROFA 4ND1A 1T10A 5K7SA 1T29A 2CXSA 2HLPA 3H2BA 4MWZA 1QFZA 1S2NA 5ALUA 4O3FA 1EX6A 1GPYA 1L5RA 1M2JA 4TKMA 1QC5A 4OB6A 4UD6A 3VOTA 1T2UA 1V4BA 2CNKA 2MYTA 2Q0HA 3A6FA 2I4TA 5DHRA 5F5XA 4CODB 2WAOA 2MHCA 1T2EA 3HJRA 1D2AA 5LA6B 3D6MA 3TPCA 3MCAA 2R9VA 3ANSA 4MKGA 4E5DA 2JIZD 2N3ZA 3OWOA 4JKYA 1GHTA 3BERA 3Q9SA 5EXXA 2OQVA 1INLA 2QI9F 1CUAA 2WEKA 4IRMA 4E14A 4GGOA 1GAJA 2SKCA 4LJYA 3UB2A 4JEMA 1M2NA 3FXAA 2XTMA 3GFFA 4ZI7A 2Q6VA 2LV8A 2EGHA 3DBIA 3DTVA 4JLJA 4OK5A 3DEHA 4GZ6A 1LDNA 2ZIZA 1H3NA 4Y6SA 5CYPA 5IW8A 1YDFA 3WGQA 4Z5XA 2GFHA 3CN9A 1DUSA 3H5IA 3RUIA 3A06A 5ENDA 3ZCPA 3LP5A 4IIVA 3KHSA 1Q19A 2OXFA 3INGA 5FYDA 4UFOA 1I7PA 4R8SA 5KWSA 5A6SA 2XA9A 1KEWA 2R1TA 5FPQA 2BDEA 4Q9LA 2UZIR 2YCBA 2BRUC 1FFGA 2DFTA 5B3AA 4A8PA 2C95A 4A8TA 2ACVA 3WLMA 2Q4RA 5C37A 2AE2A 3K05A 4PCUA 3IPCA 5FFNA 4DVJA 2ZUWA 2AFRA 1JXQA 4MV4A 3G79A 1X7ZA 1M8PA 2WJAA 2A5GA 3SQOA 3AVYA 3ZNQA 1MVNA 1BYUA 3COSA 3PI6A 4Z9XA 1P77A 4I1PA 4YAGA 4ILKA 2QTAA 4Y3UA 5KVVA 3ZHTA 2Z2KA 3TTYA 4X66B 2A0FA 2Y1XA 3MRTA 3JR7A 5EERA 1EZZA 1YVDA 2XNCA 5E8RA 4DWJA 3RIHA 5KTSA 3AR3A 3IUYA 1PBNA 4EG7A 4DLNA 3FPEA 3I30X 3VNUA 1A3CA 1VG1A 4LJKA 1Z8DA 2DQ4A 3KEMA 3QG5A 2VBGA 1JQDA 3PC6A 4M86A 4MR7B 4N54A 3DZHA 2PZBA 3LKZA 4NYJQ 4NZYA 5AJUA 4BNFA 3HWRA 2BP7A 1VA4A 3VHRA 3FSGD 2VHTA 3L0SA 1P72A 4P5EA 4KGXA 1D6MA 2HO4A 2IPLA 1Y3DE 2RFLA 1E99A 1S6YA 3AK4A 1Y1SA 1XEFA 4OI2A 4MW5A 3T5PA 1IK6A 1NP7A 2RK6A 2VPXA 3FF4A 1EG2A 2D3TA 2VUTA 3Q7SA 2XEXA 4FNOA 4G4IA 4GX1A 4XWGA 5GM2A 4CT0A 4EFMA 4YJHA 3P4XA 5AKHA 5AMXA 4DRXB 4BU1A 1PVOA 4NU6A 3G59A 3ASYA 5JASA 1EJ6A 4OATA 1JSZA 3GPDG 4HNUA 4QM7A 2A94A 1Q17A 1RQ7A 3CZ9A 3NKFA 7REQA 2J4DA 4QODA 2BH9A 3E5HA 3WRWA 4BCDA 1J9ZA 1WF3A 5DX8A 3W5SA 4HZUA 3DUFA 2EKDA 1WUJS 3R6WA 3PVSA 3OMXA 3IT2A 3SYTA 5B6JA 1MB2A 5GZ6A 4R7ZA 4UNIA 3A1WA 4G65A 3P26A 4RIFA 1XA0A 3SGLA 1EKXA 2X19A 1W1UA 3TSYA 2ZSKA 2X86A 5LDHA 1MHTA 3HRIA 3VHLB 3PHLA 3AYZB 1POWA 4PN3A 4WLVA 2NV6A 4PZZA 3IAFA 4MQBA 4MA4A 1T4DA 5AKZA 2IOFK 1N0IA 3SVLA 3OPYA 5CFPA 4NCBA 4X85A 2OC4A 3PGA1 5EFOA 3LGXA 5AW0A 2GCNA 4JSRA 4TV8A 3UCEA 1VLQA 1UBJS 1OX4A 5EGNA 4G0XA 4KGDA 3N2GB 3EXEA 2ZWIA 3IVGA 3SDBA 2YHUA 4PHCA 1KYQA 1Q1BA 4QFBA 1L5YA 1W4BA 3IQDB 3EF3A 2E5FA 1H1LA 4TMYA 3CVUA 1W2HA 3ND5A 1Q16A 1BKDR 3RSOA 3AVXA 2M6SA 3ZD9A 2FPGB 1MD9A 3DGFC 3DZBA 4W5NA 3EIOA 3O84A 4US2R 3FDZB 1MJNA 1QZZA 2PKEA 3WL6A 5JO0A 5BWBA 5CXXA 3VR0A 5JCJD 5L3SB 1EXDA 2Q0XA 5CTJA 4AS1A 1L4BA 4C89A 3BA1A 4AY6A 1AZTA 1SG6A 2GILA 3BREA 4OQXA 2D7JA 1DRJA 2Q29A 3CLHA 1EB9A 2QM8A 4IZIA 2MT9A 4QVGA 4KFRA 4L75A 2IIPA 1HETA 1U2SA 5ELLA 4ZEVA 1X7YB 1YRWA 3PHJA 3DMPA 1GGHA 1VRWA 3DBRA 4M0CA 3H1AA 3JD0A 3L6RA 1CUUA 3PC2A 1RLMA 5HE9A 3AL0C 4QUGA 1GQRA 3W7BA 3WNVA 1T3ZA 5H68A 1TZ2A 3S2EA 3IPXA 4K6OA 2ATCA 2WT9A 2I9KA 2FQWA 4UQLA 2O57A 1ORIA 2JGAA 4Z49A 1U2GA 4D57A 2VSFA 5JOQA 2HDWA 1QHIA 4GI3A 5IT4A 1SPXA 4G5OA 1EX1A 4LQDA 2NXJA 1NV8A 2YXDA 4BV9A 5A05A 1IUKA 4GMFA 5IEJA 3JAKA 2WJHA 5FI5A 2H4HA 4UZSA 2WU0A 4HWPA 1EX7A 5HXAA 4DR1B 3WLTA 4OBBA 3QTLA 2DR3A 4J16A 3OFKA 4MPTA 1GTVA 4RANA 3OLXA 3NG1A 5CFLA 3L0YA 4PLWA 4BVAA 4ZTUB 1IG0A 4X71A 1WP9A 1O03A 5B4TA 4OLAA 1J8DA 1Z4JA 1H65A 3RUHA 4Y2YA 2JD2A 3HV0A 5CB8A 1SKBA 3G0BA 2WV9A 3LPMA 3VHXB 4BNMA 1SD5A 1SZPA 3PIDA 1TX4B 4UCWA 4TUYA 2BEVA 3RIMA 1J23A 2FWNA 4MQLA 1FB5A 2I1LA 2I4MA 2VNHA 3ED5A 4JLDA 3AO0B 1KOGA 4K0KB 4PVCA 4GWKA 2VKTA 3AERB 3QSGA 5I4CA 1FYVA 5JFGA 3E48A 2IYXA 4W1RA 2VJYA 4OIFA 3BL5A 2DUJA 2O14A 2VPZA 4N39A 5H1YA 1QQTA 2W0MA 1B8UA 2YFHA 2WWHA 3CJTA 3HN7A 3OPMA 4WH0A 3IOYA 2XVYA 4RHEA 4P5DA 5H9VA 4BQRA 1M1YB 2WJPA 1Y81A 3LA8A 4NS4A 3OQNA 4RVDA 2XQIA 3SOZA 3OETA 3T1VA 3T9BA 4Z99A 3WHLA 4CJXA 3K2BA 5AK3A 2ZSAA 4P58A 1IE3A 4BFYA 4OQMA 4L4XA 1WCYA 2GF0A 3W3AH 1FXUA 1PNQA 1FEZA 1N4AA 3ZYCA 1DBIA 2VPPA 4Y2SA 4A6DA 2PBFA 1AU9A 2HDHA 2C1ZA 4KDFA 1EA5A 4PONA 1A8IA 1GCGA 1XLUA 2W2NA 4ZEMA 3WNCA 5EP1A 1N2GA 1B6RA 5K01A 2FX3A 5CDFA 4LOJA 2EL7A 3MZ0A 1UADA 1OBHA 2P77A 4ZDJA 2ZI5A 4A8JA 3T7KA 4BE9A 3JQFC 2WWGA 2CMDA 2BE9A 3HBJA 3QKIA 3GDFA 4BP1A 3I32A 4JGBA 3CLVA 1BJRE 4CMAA 5C1OA 4TT3D 2AVNA 1WSAA 1ZRSA 2H51A 5FF9A 1TM7E 1NFQA 4M1OA 2AOUB 2R7LA 4UVIA 5ALIA 5ERXA 4AKEA 3MIZA 2CHFA 1W8IA 5CK4A 1KDVA 3WOVA 4Q7QA 3ZCQA 1FYEA 3LC2O 2G6TA 4HRXA 4DFDA 1E2BA 1XZMA 2Y4OA 2EP7A 3IS3A 1I7NA 2RK3A 1XCJA 1CYDA 2ZJ5A 3KTDA 4X8HA 3II6X 4NOKA 4YGXB 3RNOA 1D2EA 5E0KB 3WL5A 3ORQA 2KLHA 4EO4A 2WLSA 4MICA 4C4OA 2W58A 3F3KA 2FE1A 3HKCA 4XQ9A 3GA7A 5TPZA 3HTXA 821PA 5BSKA 3JSAA 1XL1A 1FFEA 1PCXA 4FE4A 4RHFA 4EZEA 1JQEA 4KTTE 2AH5A 2GVNA 1BDHA 1GTSA 2PX8A 4DLKA 4KYIB 2FRVA 2IP1A 4Z0PA 4ECEA 4P0QB 3EOAI 3JAMA 4EKYA 1NT4A 4JVSB 4U7DA 1KK0A 2LIPA 4OP3A 3BTUA 1QLHA 3MWEA 3JTEA 1H4TA 2PVSA 2ZAOA 2FQQA 3JZIA 3AESB 2WTAA 4NYIR 1HE2A 1MFPA 1RRPA 1USIA 5GM1A 1QFMA 4WKGA 1R6TA 3BFKA 2XOKA 4WX2B 1MIOA 3U31A 2BT4A 2HSJA 3KO8A 4JP5A 1P18A 1JSLA 2P9QA 4ZO4A 3FNQA 4MGKR 2WMNB 3DVAA 2ZAGA 1YOVA 3HBMA 3O6VA 1J42A 4TS4A 2GWRA 3BMNA 1GTRA 4RPKA 1ZIYA 4K6FA 5FBQB 5IC4A 4Q1FA 1YE8A 4BNNA 1TZKA 4X00A 1KAHA 2SNIE 3OIGA 4OUKX 4DS3A 1N0VC 1X1TA 3AGQA 4E2WA 4TKUB 3BZUA 4WCFA 3X1YA 1BGWA 1UMCB 1VDZA 4WUTA 3DMHA 2JBHA 4GT1A 4IHJA 4FLFA 2RI6A 1JECA 3ZGXA 2AOTB 2EF0A 3NBAA 1I10A 1OT5A 3HEAA 4RIEA 3TIIA 5T7BA 2ZJ0A 3C2QA 3PUXA 3KJQA 2I1QA 3MT8A 3R3SA 2XW6A 4N82A 1GPDG 1SY7A 2JHPA 1NKSA 2XCQA 3ODGA 4NU5A 2J31A 3LOUA 3LWZA 1N32B 4Q4CA 3GFSA 2ZJYA 4YRZA 1HORA 2UU9B 4BRZA 5BWLA 2LDBA 3F7MA 5C7YA 2BSXA 2MYPA 5J2UF 1EGQA 1DXOA 1XLVA 2NUTA 3WGMA 4ZZIA 4PQRA 1NL3A 5DHSA 4B7UA 2O4UX 1PZXA 3I1FA 3QWBA 3UJ8A 1IQPA 5BQPA 3SWWA 2BAGA 1HF3A 2P91A 1LLFA 4WASA 2IYAA 3VHQA 3AEQA 2R5NA 3VNBA 4CM7A 5ADWA 3MTQA 5LXTA 3MERA 3FUTA 2EARA 5EJ4A 3RYCA 1H0SA 3PUHA 4QDUA 4H7DA 2IYTA 5E0OA 1QS0B 2QNBA 4FZ5A 4C3VA 3ZY5A 3K70D 3ZD7A 1NLZA 2EFHB 2HYDA 4IDHA 1A71A 4ZV9A 1MJGM 4ZHQA 1M75A 1JU4A 3BD7A 3G2HA 3T1OA 2F00A 3DFFA 1M6NA 1YH3A 4MUYA 2F6RA 2ZW9A 5TE9A 2WJZB 2BN4A 4GXQA 1IBKB 2DQSA 3E3LA 5E7MA 1WLSA 4DV1B 1IL0A 1F0NA 3OVMA 4OAOA 4RW0A 16PKA 1AF4A 3I05A 3U16A 4DIDA 4MWTA 3ZHVA 1FYDA 1U1GA 1B1CA 2PXXA 5DKFA 4EHBA 4FXOA 4AMZA 5JH7F 1E2UA 1FS4A 4U2CA 5DI9A 4ZVUA 2MCFA 3SZGA 4ASUA 3CIFA 3OESA 5B4VA 4QEDA 1BSVA 4KO1S 4TTVA 5L7YA 3PDIA 4HFRA 1WTAA 2FMIA 3KZVA 4NPAA 4ENVA 2GAFA 2KMLA 2PWPA 3ND7A 3ZIDA 4ZIRB 4CCYB 2CF6A 1LLCA 1USVA 3EY4A 3M3PA 4I2NA 1XD2B 3N2ZB 4O5OA 5LZ8A 4G0WA 1IQRA 1Z5UA 1W7AA 2XV1A 2JARA 2CXNA 2NTYC 3B7PA 3LUAA 1ZUD1 3UAGA 1WCIB 4ON9A 2EJBA 5DGCA 3LF1A 5CA1B 2FPRA 3SZRA 3T7RA 1JDBB 1W4RA 3TZ6A 4WCDA 2IKSA 3P0RA 1GPAA 2OYSA 1FFDA 1GL6A 1G42A 1U8EA 1XYYA 3A6EA 3H05A 3EEOA 2O50A 3VPXA 1F1JA 4Q5IA 4GP9A 3Q3EA 3N07A 4U7GA 1MC5A 4YAFA 3JATA 2PZJA 3D3WA 1P1FA 4OU5A 4L5BA 5DLQC 3SQMA 2W37A 1OR8A 5D3ZA 4BB6A 4W5RA 4TTPA 1GNSA 2ODAA 3F9IA 1I3MA 1XK6A 4LE0A 4YLYA 4MGHA 3HDYA 5TQ0B 2WWWA 3JSXA 4XFJA 1YQWA 1T0PA 1QF9A 1ZN9A 1I3KA 2WNSA 4EFLA 5ILOA 2AKEA 3GBVA 4CRWB 4MS4B 4TLLB 1I5EA 1IY2A 1SQGA 3CX7A 2YJ6A 3P27A 3RYFA 3T0GA 4PX5A 3R7FA 3WKCA 3DOUA 3MCUA 2QD2A 1JJAA 1M8KA 3PGVA 5F3DA 3ICEA 2XHEA 3MWDB 2MOKA 2XWSA 1FE8A 2BEWA 5FL7D 1C7RA 3T94A 3RBAA 2I76A 2DFVA 1MP0A 4EKGA 1FMCA 4ZYZA 1N9KA 1NW7A 1SQ6A 1CEQA 3SMQA 4BFTA 1FFCA 4RQBA 3GRPA 2IHUA 2FXIA 3CHYA 1R3UA 3GA5A 1VE6A 3CTMA 1C0IA 2H9IA 3N0RA 3FPSA 5AW1A 4I2VA 4EY4A 1G1MA 2O52A 4GWLA 5LN1A 2W6ID 3HBAA 4O1HA 2Q6OA 4XUCA 4R1PA 5LDGA 1QTQA 2BM0A 8ADHA 5JCOC 3U56A 1FZTA 2ZJZA 1FVXA 3PRJA 1V16A 4MQUA 2OGTA 8GPBA 3A1DA 4M6WB 4JGGA 2LUOA 2P11A 4DQDA 1FW6A 3U3XA 2PWZA 4XIJA 2QN1A 1RAFA 3GJZA 3MJEA 1KDYA 5JRZA 5BR8B 1L5OA 2W11A 4WFQA 3LUCA 5GAJA 2R8YA 5JHHB 1E6EA 4WCVA 1F12A 3IAEA 1Z5NA 4GL2A 2XCTB 3HZRA 2VA9A 4O4IA 4HMOA 1YCHA 4KQEA 3JWJA 4BCBA 6PFKA 1X9HA 1JTEA 1P33A 1MOQA 3K1ZA 1Z47A 1OIVA 2IZOA 3I39X 5I9TA 1CJTC 4ZYUA 5C8YB 3VO2A 1JPNA 3DHNA 1GG2A 1CY6A 2R7AA 4KO3S 5CDYA 3EFHA 5K0JA 4X1KA 2IYLD 4D82A 3WMGA 4OMUA 2AFVA 3K20A 3SC2B 4BN5A 5CEEA 3M4JA 1E60A 2G9ZA 4B2IA 1SC3A 5JJKA 4O63O 1H69A 3UWMA 3SDZA 4P3KA 2C2WA 4DQ0A 1BA3A 4PGGA 5BN4B 3OHPA 1I13A 5DX0A 1Q7GA 1KYTA 4QOSA 1NUTA 1G291 1EWYA 3HJHA 1D1QA 3N05A 3NM4A 4PE5B 4BGEA 3AR5A 5TMBA 3ZS9A 5A4IS 3ROXA 4V0OA 1KIAA 4GNRA 1RKBA 3T3HA 4EJSA 3BRCA 1Y3FE 2O2CA 1PD0A 5JCZA 4RORA 1T43A 1YGPA 2YJGA 3GLIB 4FHFA 2X0IA 3WGJA 3LYLA 4F21A 3LUDA 4X65B 2NPOA 1E3LA 1L1RA 3VDMA 5HRCA 3H9CA 3QFTA 3KTFA 1NQOA 5F78A 1S02A 2Q1XA 3NVKI 3GZJA 1AXRA 3IV9A 3PXUA 2H48A 4BO6A 3QA3E 5BQOA 5ED4A 1YQTA 2FVYA 1KORA 2WYHA 5B1HA 1H2HA 1GZ5A 2AJDA 1SHZA 3WWCA 4JLMA 3TZBA 1ISHA 4E6PA 3U4QA 1X7XB 1RRKA 3WTCA 4DG8A 2GVDC 2QLNA 3QE4A 1CHNA 1TAGA 3D3EA 2HA5A 3I04A 4CQLA 2GPBA 4TTTS 2AEEA 2PGIA 3DMDA 2V65A 2IHNA 1EFPB 2XXJA 3JQ9C 2NAPA 4IWXA 2VDWB 3BE4A 1JXMA 2X14A 4NWIA 4QPJC 3K9GA 2VSNA 3GD7A 3S55A 2Z04A 3BXGA 2VDKB 4EPXA 3WQSB 1TJ3A 5DTEA 4M8KA 3S6JA 2QYSA 3ZY4A 3VR6A 4POAA 1HKUA 2KW5A 3ER6A 2EGUA 4NK4A 4R1LA 1CW2B 5CAEA 2Q4OA 3G9UA 4E13A 1J49A 4GLBA 4KN6A 3U1TA 3AILA 1OXKB 2PRYA 3NRCA 2HF9A 3D02A 1JHAA 2ZBVA 2QE7D 2QT9A 4WN9A 3WLNA 4KYTA 3NWEA 3KSAC 1OILA 1PQUA 2JIOA 3LBYA 1AJEA 4V0LA 3CU5A 3S28A 2BWJA 4XM0A 3REQB 2BFCA 3JVDA 3ZU5A 1MHPA 1Y5NA 1PK7A 1ZNZA 1NV9A 2H5JA 4ABYA 4GOLD 2B6NA 2DMRA 1LSJA 2B6HA 3X1ZA 1DAPA 2D1RA 4LRQA 4M1ZA 4YP0A 3VI3B 3E5MA 3F5SA 3LUGA 4B3HA 3H2ZA 3ZWPA 3ZZUA 3O8OA 5IF9A 2EL9A 1D2HA 3PRKE 4W9NA 3D5TA 3DA8A 4GPZA 5EVCA 1O1YA 4DA8A 2PYZA 2VJBA 4I36A 4MVJH 1JKMA 1WZIA 3H6GA 2BGTA 4BO5A 4B7AA 1FLVA 4B4WA 5D01A 3UM9A 4YUVA 3RBXA 4PY2A 2IYUA 4R9VA 5DNUA 4CGZA 5T4BA 3H19A 3A25A 4L7VA 5DBIA 3P5BA 2H1VA 3REGA 3TDMA 1DIAA 3BTOA 2R6DA 1I9GA 3DF7A 4EG4A 5KQRA 1JIQA 2UV8A 3OTWA 2QX8A 3LTNC 3GZTB 3KVYA 4C4TA 5HKKD 1QJ4A 3L7KA 4P4NA 4NFHA 2P5SA 3VBEA 1IUNA 1CZLA 4LSZA 1YVEI 4ALKA 3AKZA 4D8UA 2HQOA 4LSWA 1SBIA 1YDWA 4DCTA 2XLBA 1GCAA 3CRRA 4L57A 4CR6A 3GRFA 1WM1A 1A9QA 1FFAA 1XD9A 3A7DA 4M76B 1P0PA 2IDKA 1OAOC 4EPYA 1Q3KA 3DO5A 4I3HA 1F9AA 3IQHX 3ZLBA 1SK8A 2B8WA 3F73A 4ZFNA 3KAKA 1YDMA 5TF0A 1CY1A 1B0UA 4Q3AA 5BT9A 1JEDA 5FWDA 1SXJD 2IEGA 2XDQA 3I76A 5BW5A 4MYUA 3B9BA 4QTUB 3WTBA 4WHMA 3C15C 1A5AB 3EYAA 4TQ9A 5L9AA 2YXBA 4QA9A 4L9WA 4GX0A 3C6XA 5E3JA 2FAXA 2Z56A 4H1TA 4B8WA 4DNFA 2FZGA 2VJMB 4EGCB 3UFXB 1NHGA 5JQWA 5DT9A 3NCHA 1SGWA 1C7QA 2BSQA 4DEYA 2XKJE 2GRJA 2RGNA 3CSDA 2DKFA 3IC5A 121PA 3LHIA 4TMXA 4GUDA 2PMBA 1IWOA 3ZZMA 5IFLA 4H60A 4RC9A 3S8EA 2EATA 2QPLA 4HGZA 3ETNA 3OZEA 3M4ZA 1V8ZA 1T91A 4PICA 4DZRA 3TL3A 3A6ZA 4TTRA 3EVTA 4MLCA 5TY0A 1BZYA 1J5XA 3IRVA 5EAIA 4FFBB 1K3TA 2PKQO 4JQSA 1KI4A 3I6QA 4X1OA 1SC4A 4YACA 1GLNA 3VH1A 4CWAA 4RFVA 4MYTA 3U39A 1C3OA 5BN1A 1UP7A 3G5MA 4MYDA 2J0VA 5LA6A 3OZAA 3V4VB 1J90A 2EVWX 5IX8A 4MWSA 4ZTBA 4DBZA 1YIAA 1VPTA 2JVKA 1CZUA 3X44A 1DSSG 1T1IA 1U8ZA 4IXTA 4ZO7A 2YWXA 3F3MA 4LXIA 2G77B 2QHXA 1DARA 2VLBA 1DBSA 3I1YA 4NQZA 4UHHA 4DR4B 3FCUB 4ARZB 4DBLE 2IU3A 1N4DA 1CY4A 5K6TA 3DXFA 4V0RA 1TJYA 4IRUB 3MAAC 3ERCA 1QG0A 3CKYA 4L5IA 1OV4A 1AQJA 1MO4A 2R8EA 1J0CA 3TOXA 3K32A 2VHUA 4F5EA 2QRHA 4GEKA 4K1XA 3ZXYA 1BVRA 1AURA 1OBCA 4RVUA 1BW9A 4AJKA 4BEVA 3ELDA 5REQB 4WK2B 3GFBA 3PUKA 4MTLA 4Q3CA 2F8SA 2HIGA 3GPCA 2PQ0A 1DC7A 3KKLA 4MAMA 3VR5A 3N3BC 1R8YA 4C07A 3ZHYA 4EG3A 1ZUNA 1KPGA 3H5TA 2NXNA 3R09A 4UHBA 4EARA 5DM2A 4ZDWA 5ALVA 1WBDA 1T1GA 2ZR8A 4M7PA 3QVJA 4XGKA 5AM1A 4CL0A 3H4IA 1RE1A 1RWWA 2VOEA 1BE0A 2OO3A 3EA0A 1V8PA 1UJNA 1KEEB 4PSKA 4ZICA 1E63A 2H1IA 2PSFA 3ENKA 1KS9A 1QB8A 3DPIA 3SC6A 3EC7A 1EYZA 3O9ZA 4GIBA 4PAWA 5C1BA 1WBJB 2CC2A 2QNIA 4J2OA 1UWVA 4Q66C 1YR8A 4N7BA 3TQCA 4EZIA 1A5SB 1QFJA 1OKKA 3GN1A 2XQFA 2IW1A 3Q72A 4K1LA 5EIWA 4HNVA 1GEGA 5C4IA 4AMVA 3R7WA 1YONA 7AT1A 2HF7A 4BQQA 4H7EA 1ZESA 3T7EA 4TYWA 2C57A 5HTOA 1HDGO 2NNLD 4RS3A 2O48X 2OCPA 4MR7A 1NZFA 5TPZD 5ALGA 1U7OA 4DDVA 3EQ2A 2CHQA 1B3BA 1Y89A 2E1RA 3PNLA 1QH1A 3DLIA 1G21E 3DO6A 5TQVA 1EK6A 2CLSA 3T4PA 4DMGA 3G5TA 4P4TA 3OZXA 4LC0A 4MKIA 2WA1A 2W90A 1JFFA 2YIMA 2ZYVX 3BE6A 4F9GA 5DLYA 3HEMA 2J6BA 4ID3A 3RRYA 4QDTA 3KFLA 2ZUUA 1P3Y1 4R2IA 2C2MA 3WLPA 1NR7A 2W6OA 3BXPA 2MSCB 2VR1A 2JCBA 2WSLA 3OM8A 4R9RA 1GV1A 4PLTA 2HDOA 4F1WA 1X86B 3OJEA 5JVDB 2K7FA 1F8GA 3MWJA 4OKSA 5FO1A 3RVRA 1V43A 1JQ5A 3VZPA 3EG5A 4ZOBA 1Q3TA 1BCSA 3U6BA 2JJ1A 2V3VA 4YT5A 3MLEA 2HPAA 1JAXA 2D8MA 3PJRA 1ZZEA 2Q28A 2PYDA 2VBCA 3O2QB 4DV4B 3R7SA 1Z0ZA 5C1PA 4WESA 6Q21A 4G0OA 1MX9A 1Z17A 1U9YA 1VE1A 2X3YA 3LRXA 1UXOA 4XQEA 4D1YA 2MINB 2BH2A 2PM8A 4UEKA 4BKRA 1UK9A 4J9VA 1O96B 2H1LA 1PDOA 2HMUA 3U3KA 5ABPA 1CS0B 5KTKA 5KYTA 4RKRA 3L8GA 1E5TA 4YP9A 1RJ9B 3DWEX 1UDXA 2JS7A 3N0WA 3UJ3X 5DYYA 3LZCA 3KAJA 3OEWA 3QF4B 3GRAA 3I2GA 3J80A 3EHEA 4S1PA 1W47A 3OFSA 4WV3A 1XKLA 5ADUS 3PP8A 5ESRA 1UIRA 4LY3A 3HCWA 3R5FA 5A1TA 4CFYA 5K0SA 1QHNA 4AUNA 1OH7A 1NXTA 3BB1A 3ID6C 3Q4GA 4XGIA 1E2HA 4WLFA 3EW7A 2P6UA 5HS6A 1XZCA 4QT4A 3K6SA 3HFGA 2J3MA 4Y7DA 4RIIA 4URWR 1CQZA 4QX6A 3NAQA 1LUAA 1QYRA 1R8XA 1TEHA 3GY0A 5HF9A 5JISA 1AOXA 4FK8A 4GU5A 3WQHA 5ERYA 3BN3A 2GXUA 4OQQA 1W29A 2QDXA 1PZNA 5KTMA 5IKXA 3B1ZA 4DVGA 1MDBA 3DFUA 4PG8A 2GZRA 3DW1X 5B12A 3K0CC 3H0EA 5G1OA 1YR3A 1LDBA 2FEKA 4I1YA 3OZ7A 4C4RA 3S2IA 4YAEA 1AK1A 1GEEA 4Q4AB 4WOBA 1BEUB 1XDWA 4INPA 5CDUA 1GLVA 2V7PA 3FLAA 4A0FA 4Q9KA 5KYWB 3CX6A 4GMGA 4DIKA 2Y0BA 4HMQA 3ADKA 4JR0A 5B58T 5JLJA 4LF4B 3ABOB 1U9JA 5LUAA 1ZN7A 1N3BA 4ANFA 3ZHQA 3W5UA 3NHZA 5FPTA 5AUOB 2IEYA 1A5ZA 2B2XA 3CNNA 3IIEA 1MTZA 1V8OA 1CPYA 3X1DA 4B3CA 1WCXA 4LE2A 3KCQA 2GCOA 1JG3A 2WZCA 4M1SA 2A78A 4L5CA 4LMPA 3HJUA 3QVMA 4PR3A 2M9MA 1KAOA 3W79A 1XMVA 1YB6A 2QL5A 3ZE8A 1NBME 2RBKA 3B1WA 3VV2A 1FFXA 5LZ2A 3KWMA 5HIKA 3TTUA 3WDKA 1OLSA 3DV0B 3W4JA 2ODEA 4JFAA 5LQMA 1CQJB 4XUGB 5GJCA 1PLJA 1PNTA 5HKLA 3A26A 3GW8A 5DCLA 5FV7A 3L84A 1VBMA 1YFZA 2OM6A 3Q3HA 4ASUD 3A9WA 2GN6A 3O8DA 5K05A 1G4UR 4IH1A 2DSNA 2OG1A 2ENUA 1DLJA 2C4HA 2E49A 1W34A 3UAVA 3L7LA 1AGPA 3NB0A 5IT0A 3H0KA 3AM5A 1RI4A 2W6CX 4GOMD 4HDQB 4MUHA 3NJ4A 4JCCA 2P0YA 721PA 1SWWA 1NBEA 1QDUA 4JJ6A 4JD5A 2O8FB 4CIAA 1O8BA 1ECPA 2CXUA 1CLEA 4OHYA 1T3SA 2VL7A 2XJ4A 5FBLB 3TSAA 3U44B 1EVQA 1SBCA 3KOXA 2C2HA 4W7HA 4OMFG 2X7XA 3PR1A 5K1ZA 3R8XA 4CKBA 4B4UA 2IE0A 2WIKA 3UNXA 1G19A 2WJWA 3NO4A 1ODJA 1IXYA 1P5JA 1RIIA 4CE6A 4N6NA 4V02A 2A9OA 4PGAA 3F6BX 2ZYTX 1G38A 3O90A 2ZWPA 1GFWA 4PG5A 1QF7A 1BX0A 2B2NA 1D8AA 4R31A 4XX1A 5ITZB 1E96A 3T5MA 5ER6A 4J0CA 4ZHSA 5IMBA 1GNVA 1PLKA 2R68A 4KYVA 2RGYA 1QH8A 2BZ1A 4QYWA 1R6BX 4B9AA 2JJ2D 2RH5A 5I01A 1NW5A 2H8KA 4LDPA 4MVYA 3WJ1A 1ITZA 2XB4A 1XMQB 1E2DA 2VCHA 3N70A 4CEHA 3PVCA 1ISJA 3KKOA 1JKJB 1SO8A 2PUJA 2OT3B 3RC9A 2AXNA 2WIFA 3ZS8A 1PZMA 1ISRA 5JNSA 3GH3A 5K45A 1WETA 2IS4A 4HGRA 4BRWA 1UZLA 2BONA 3OU2A 4KXQA 1OBOA 1QRSA 2ANCA 3QXXA 2H2IA 2R8ZA 4MI1A 2O19A 5G53C 1NF2A 3H2IA 5K8TA 2Q5CA 5TJHA 5AUQA 1E4EA 1P74A 4D9KA 4DCOA 2PGOA 2CLEB 1M74A 2JATA 2XI4A 5D7BA 4YWHA 1T0HB 4Z9AA 4KPFC 3U48A 3WYNA 4ISCA 4EF4A 2FJUA 1F06A 1A8HA 1F48A 3GG2A 1E98A 2V96A 4JK3A 4BP8A 3R3UA 3WYCA 1QOPB 2WKPA 1B93A 1JHUA 2OMKA 3WWDA 4DPMA 5IVDA 1SKYB 3R0XA 4NMXB 3WFZA 2QRVB 3QYJA 1E9FA 1Q11A 2IY7A 2P7IA 2V6IA 2IX3A 5CW2A 3ZHBA 4NOMA 3OPYI 2XOEA 3CZAA 4HDRB 4CHGA 1C3EA 1GAWA 4YO7A 1ZP6A 3KWJA 4NJEB 5IK2D 2B7LA 3EPHA 2PT9A 2V7VA 3FTEA 5IBRA 1H2WA 2XUJA 2Y67A 1A4XA 1QDEA 2GXSA 2HLDA 4AECA 4D99A 4R0MA 5C8ZA 4L02A 2PGDA 1E79A 1QP7A 4GPIB 1GITA 1IOLA 2QL6A 1WR8A 1GR0A 2QTHA 4C1NA 3PFNA 5EZYB 3X3HA 1KFCB 2X4IA 5AVYA 4IGEA 2VJCA 1XJWA 3KBOA 3QBJA 4LMRA 4MEJA 4Y67A 5L3QB 1VP3A 2EG9A 4YJGB 2J09A 2E37A 1IZ9A 4KQCA 2B5VA 2E4XA 3N7AA 2IPXA 1D5CA 4O5AA 2A1UB 4TLBA 3EUEA 1JSCA 3LHSA 1B23P 3KJGA 5J59A 3OIDA 4XLTA 2V9PA 1V0JA 5JWOA 1QFYA 5DTJA 1UKCA 3M6IA 4RVFA 3SEQA 2UXCB 2HCTA 1Q7TA 2CLDX 3VPGA 1KI8A 2II6A 2XWPA 1KEZA 1MVOA 2WSBA 3USES 3T4EA 1VLLA 1N8KA 5E1DA 5IJ9A 2VHYA 2FPOA 4WFIA 2NZWA 3THSA 1WSWA 1QZTA 2E7ZA 4LNUB 3PXEA 4X90A 3VDNB 2YZNA 4P3OA 1NSFA 3ICQB 4KN9S 3QVOA 2GN8A 3FFXA 3R6DA 4XVHA 3M1YA 2QSYA 2KBEA 1QKKA 2WTMA 3CLRD 2RHRA 1E2FA 4K87A 1PV1A 1QAMA 2LWIA 2ZT7A 3SXPA 2CK3D 2WD7A 1PE0A 4MVCA 2BEJA 1K8XB 2IYRA 3S5JA 3UCXA 2AZMA 3LM8A 2DC1A 4LY6A 3VR4D 3GLFE 2OGSA 2BR3A 1S2LA 2C58A 4GRAA 4IEFB 3P96A 4BQEA 1JH9A 2Z98A 3OE5A 2R3SA 4ZDIA 1JI3A 2JGIA 3HFJA 3RFCA 3IR7A 2OFPA 1NUSA 2AUMA 3CW9A 1EK1A 1MH1A 2OO5A 4I08A 1NSTA 2UZ1A 2Y1WA 4P3XA 2C9YA 1S3FA 3F4KA 4X3CA 4DR2B 4CKWB 2R6CA 1R5JA 2O0JA 3TNDA 5ALXA 4R41A 2FEMA 5FOVA 4U2GA 4NFLA 1QANA 4K6KA 3VR6D 3KJHA 1UEIA 1JG6A 1KI2A 4L2IA 1G5RA 1K63A 4EO9A 4P7BA 5G0VA 5DM70 2Q7XA 1F2TB 1JN0A 4IX9A 4GGMX 3CF6R 2B21A 1M34B 1PWYE 3FYDA 4XM2A 4II3A 1GIAA 4H7HA 4RA6B 1QR6A 4EITA 1WHTA 4GUAA 5LJLA 1W52X 5DMHA 3UPDA 4X92A 1N34B 1U2PA 4LXQA 1P4GA 4F6RB 4REMA 4C5AA 4IIBA 4R1UA 4RSHA 1Q7CA 1AO0A 4ZQIA 1Z3IX 2P7HA 3GCXA 4ZWNA 2CE2X 3ZDRA 4M0KA 4J4HA 2VHJA 2O1SA 2HRBA 4DLLA 2F64A 4C0QC 4M0EA 2DJ5A 4UBLA 3UH0A 2ZJ6A 3UVEA 4BZQA 4ZQFA 3JZMA 3JCZA 1K5HA 4P34A 2IVFA 2VN8A 4NYMR 2PUVA 1HRKA 5JZOA 1KYIA 1PW7A 4CNQA 3JASB 2YZ2A 1X19A 2PFSA 5BYJA 1XEXA 1OJ7A 2FOLA 3TPFA 3ANTA 2GCIA 1UEJA 5GONF 7ABPA 3VH4A 2P6PA 2RAVA 4MYCA 1X3LA 1YU6A 2DPXA 4W63A 3AHEA 1N1GA 4NEGA 4KI0A 2F55A 4YMSA 4DIBA 2OQRA 2PX6A 4Q4JA 3T52A 3ZUGA 2V59A 5LKAA 2GZDA 4FNAA 5JS2A 1G8GA 4DABA 3EXIA 2A8YA 3WZMA 1DIHA 1Q0UA 1GCIA 3OY7A 4J0FA 4U39A 2SHKA 3L7IA 1C1XB 2V54A 3TZHA 2WE7A 3UT6A 1SBQA 3OJOA 3Q2KA 1IHPA 4KIGA 4Y1FA 1GY8A 4JQZA 2OM2A 4R83A 4H4CA 2I87A 2ONCA 1YC5A 3IR5A 1II0A 4RGYA 3R3VA 1CRZA 1GKIA 1PL7A 4YJKA 4F4HA 3ZVRA 2AN4A 3MG9A 1G3RA 2WT8A 4GC5A 3HB1A 4IEEA 5E9JA 2OO7A 4ENUA 1DJMA 2R6R1 3QE0A 4RE6A 1EVEA 1CP3A 4IH4A 3CURA 2V1UA 1XEWX 1GPMA 2VF7A 3TSCA 2NG1A 3WLRA 3ZNNA 1Z75A 2G5PA 4KGVA 4QREA 4Y30A 5B3JC 1N2HA 1KO5A 1T8RA 1QZ3A 4BNKA 2QZPA 1V6AA 1J56A 4IVPA 2XOXA 1YZFA 1FBTA 3GJYA 3UV6A 4RTLA 2G06A 3VAAA 1RACA 1JXAA 1UMKA 3PC3A 3LE8A 1JBEA 5FTNA 3TR6A 2XD9A 3GNLA 1D0IA 1U2QA 2XIQA 1GQ2A 1NY6A 1P3DA 1DV1A 2J3IA 4YP6A 4HBGA 1CB0A 1P2GA 1JHPA 1RQRA 3CNOA 2JH3A 4GKVA 4RSGA 3EB9A 4XAQA 4ZCQA 3RUAA 1OHHD 3ACCA 3AFGA 4KQHA 4KPYA 5KHAA 1EK0A 1LLQA 1W48A 4XRGA 2XVMA 3OTIA 4CETA 1N1EA 4KR2A 3R2JA 1DTEA 2F59A 2JRLA 1MMFB 1F9EA 1NXXA 3CJRA 2OZEA 1MO3A 1NRJB 3A6HA 3FSEA 1AZSC 4ED9A 4IVNA 3AONB 1FQJA 1US8A 2BC9A 2QMEA 2O06A 3IT1A 4GGPA 3T7JA 4BQPA 1OB5A 1E58A 3DT8A 4AVYA 3IYLW 3OZDA 3IV7A 1OLUB 4NS1A 1PN3A 3O0DA 5BYKA 4PTYA 4BFVA 2E6UX 4XW2A 5KSOA 1K6XA 4CM1A 4GR5A 1PWHA 5GOTA 3T3MB 4HEA6 2R6HA 4EH1A 4IJVA 2P1RA 2AR0A 4MNTA 4YI3A 2C0QA 1NVTA 1UDBA 3BC1A 4HN2A 3E18A 1FTYA 4LZPA 3KR2A 1QDLB 5C31A 1RI1A 3BULA 3M6UA 4XPIB 5B3KA 1XFDA 3K9LA 3P9YA 4JVNA 3OT1B 4PX9A