1PS0A

Crystal structure of the nadp(h)-dependent cinnamyl alcohol dehydrogenase from saccharomyces cerevisiae
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
360
structure length
360
Chain Sequence
MSYPEKFEGIAIQSHEDWKNPKKTKYDPKPFYDHDIDIKIEACGVCGSDIHCAAGHWGNMKMPLVVGHEIVGKVVKLGPKSNSGLKVGQRVGVGAQVFSCLECDRCKNDNEPYCTKFVTTYSQPYEDGYVSQGGYANYVRVHEHFVVPIPENIPSHLAAPLLCGGLTVYSPLVRNGCGPGKKVGIVGLGGIGSMGTLISKAMGAETYVISRSSRKREDAMKMGADHYIATLEEGDWGEKYFDTFDLIVVCASSLTDIDFNIMPKAMKVGGRIVSISIPEQHEMLSLKPYGLKAVSISYSALGSIKELNQLLKLVSEKDIKIWVETLPVGEAGVHEAFERMEKGDVRYRFTLVGYDKEFSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Apo and Holo Structures of an NADP(H)-dependent Cinnamyl Alcohol Dehydrogenase from Saccharomyces cerevisiae
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
molecule keywords Hypothetical zinc-type alcohol dehydrogenase-like protein in
total genus 100
structure length 360
sequence length 360
ec nomenclature ec 1.1.1.2: Alcohol dehydrogenase (NADP(+)).
pdb deposition date 2003-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ps0A02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1ps0A01
4ONEA 1DAPA 3GHYA 3S2EA 4I1IA 3NX4A 5HS4A 5KJEA 1R6DA 2Q45A 5G0VA 3E9MA 3TJRA 4WCFA 4R1NA 5DP2A 3ETEA 3A9WA 3OQ1A 3DFUA 1DHRA 3D3EA 1GEGA 2FR0A 3FPLA 4BB5A 4DPMA 1HE5A 2VT2A 3PI7A 3RJ5A 1NQ5A 1RYDA 4BKOA 4F45A 1CDOA 4CMEA 5C7OO 1XA0A 3W6ZA 1C1DB 2OL4A 2R00C 3JSAA 3RC2A 4E31A 2X0JA 1B14A 1V35A 4IM7A 2AQHA 2JJYA 2X4GA 4E6PA 3TZHA 4B4OA 3NTQA 5U1PA 1J49A 2VYND 1KETA 4FDAA 3VPXA 4AJLA 1GYQA 4UVHA 4PLYA 2DBQA 3LLVA 4I9NA 2Y99A 1HYEA 1PJLA 1AXEA 1QSGA 3HQ4O 1LLUA 1Y9EA 4IQGA 4ND2A 3BMNA 1EUDA 1YO6A 2C20A 3HSKA 1DC4A 4R9SA 1DDOA 4BNKA 3RD5A 4RV9A 4OQZA 2NLOA 2FMUA 3FTNA 3RAJA 3C1TA 4Z3KA 4CM4A 1R4MA 4KUHA 5ADHA 3KO8A 3FN4A 3NTOA 4DBZA 3D3WA 4XQ9A 3VZPA 1GL3A 2Q2VA 3GHHA 2A35A 5JCJA 3EYWA 1E3WA 3OA0A 4AFNA 2P9CA 5AVOA 3E5MA 4YWJA 4MIOA 5AXCA 5C3MA 1EUCA 3ORFA 4G65A 3QLJA 1JU9A 2NSDA 3EGOA 2GF2A 1HDCA 2RHRA 4WLNA 4FC6A 2D0IA 3HE3A 4PCVA 1PL6A 5K6AA 3D4PA 1YE3A 2V65A 3CSDA 4G5HA 2PNFA 4MVJH 3JCZA 4OSPA 2GO1A 1A4UA 3JD3A 3NGXA 4MKRA 3GPDG 2PGLA 1HETA 2YZ7A 3OICA 1H6AA 3GA0A 2J3JA 1CERA 1KVUA 7ADHA 4HXYA 2GDZA 2VTEA 4GVXA 2CUKA 3KOUA 4JP3A 3KVOA 2CDBA 1DB3A 4P4NA 4DWVA 1I3KA 3GC6A 4XB1A 4BGUA 1NPTO 1U4SA 1BTOA 4CLEA 4O63O 2GZ3A 3GLQA 2C5EA 2ZCVA 1P1RA 5H82A 3AJRA 3PEFA 3CH6A 1NM5A 5TX7A 4PFJA 2VUUA 5FF9A 4D3DA 1DLIA 1PJ2A 4WLEA 2HU2A 4DTIA 4B79A 2OMEA 2VN8A 4BO0A 1FDWA 3KYDA 2VNAA 1FMCA 2G17A 4OGWA 1NASA 2OP0A 1BVRA 3WGYA 4GVLA 2C5AA 4R01A 3WBBA 3KSZO 3CKYA 3WOHA 1E5QA 1UP4A 3AW9A 4XRGA 5IFLA 3GVPA 3QQPA 4Y6SA 4AJ4A 4HUJA 4NHEA 3VH4A 3RROA 1E6UA 3W4IA 3TZ6A 3FI9A 1LC0A 4CLXA 4JBGA 4FW8A 1IY8A 4LSWA 1PJCA 4M54A 2DPGA 1LDMA 3KEOA 5G4LA 4WNIA 3WGOA 5DCWA 3GNQA 4CUZA 1GUYA 2HO5A 3DB2A 5DF1A 2OUIA 1NVTA 2XPCA 3I6QA 4HY3A 3TN7A 4BKQA 4ZN6A 3ZWYA 4E5NA 5I7FA 3OJOA 3L9WA 5EPOA 3FCOA 1M6HA 2PD6A 3UKOA 1B8VA 5JFOA 3PWZA 4HP8A 1X7DA 4H3VA 3QHAA 4J7CA 4NJMB 5FFFA 2ZB7A 3CMMA 3CEAA 1PJSA 4IXWA 2BF7A 4IJUA 3OA2A 4GMGA 4RZHA 5L3ZA 5AQ1A 1E3LA 2DT5A 4P38A 3JYPA 4OXNA 1TI7A 4Q3AA 5CFZA 3U49A 1V9LA 3ZCXA 4DA9A 4PZDA 4BO2A 5A5FA 2W2LD 5DBFA 2V7PA 3OFSA 1D7OA 1Q0HA 3JD2A 3O03A 3F6YA 3AOEC 1YH3A 4JJFA 4J9UE 5IAAA 4D7AA 1KVQA 4L4SA 2VRBA 4I5GA 4Z9XA 3ULKA 2VCYA 4YAGA 3LF1A 2P9GA 2HAEA 3HFGA 4F6CA 4J2HA 2DAPA 4WCFC 1GQQA 3RKRA 1UXHA 1YL7A 1QLJA 1UZMA 3HADA 3TRIA 5FI3A 5JBIA 1ONOA 1WZEA 5A03A 3DFZA 3AY3A 1NPDA 3H4VA 3AI3A 3E9NA 5IXYA 2ZB8A 4BGVA 4E21A 4OJNA 4CLRB 2POQX 1DRWA 4O1MA 3I52A 1PL7A 4GBJA 4P8RA 1AHHA 2W2LA 4UEKA 2J3KA 2NNLD 2FR8A 4R3WA 3PFWO 4JJIA 3LC7O 3QWIA 1DJQA 1L7DA 3X2EA 4IGFA 3S2GA 2HQ1A 2YDYA 2BGLA 4RF4A 1XU7A 1LRLA 3I4CA 4KTTE 1AGNA 3ZWCA 1K0UA 1E6EA 2YV1A 3WFJA 4DL9A 1KBZA 1RM3A 1BDBA 1AN9A 1VSUA 2P5UA 2P68A 5JXWA 3ZWNA 1XGKA 3MJVA 4R54A 3RKUA 3BTUA 1P1FA 3NT2A 4PVCA 4Y8VA 4WEOA 1EVZA 1XU9A 2NVBA 3C8MA 4GKBA 3H9QA 1E3SA 3LSYA 5FI5A 4TVOA 4B3IA 3FTPA 1N9GB 1A9YA 3LVFO 1LRJA 4A5OA 2DC1A 2PD4A 3DO5A 4NBTA 4FB5A 5CG2A 3ZHYA 4XZ3A 1ADFA 1IHYA 1B8UA 3HDYA 5EMHA 1NTOA 4OH1A 4ALLA 2I76A 3RBVA 3UHAA 2DUWA 1BXKA 5F5NA 4BUCA 4W7HA 1UXGA 4XYLA 3AUSA 1GV1A 3PIIA 4TKLA 4NBUA 3MEQA 3FWNA 4NK4A 3X2FA 4CV3A 1VSVA 1DIAA 3I6IA 4BNIA 3IKTA 4CLDA 4EJ0A 1E7WA 5L45A 1MFPA 2X8LA 3H9JA 3BTVA 4CMBA 3I9NA 2BFPA 4A27A 3JQ9A 1A4IA 1ZIDA 1SEVA 3ZU4A 2VQ3A 4CM9D 4IDDA 3D1LA 4LMRA 3NRCA 2IEDA 5A9RA 4N5LA 1I2ZA 1MXFA 1OAAA 3GFGA 1GEEA 3KB6A 4ZHSA 4LMPA 3HZZA 2WYUA 4WECA 1CETA 4EGFA 3GOHA 5A3JA 3GY0A 1BMDA 3PJFA 1PGQA 3ZV3A 3ZWPA 4A10A 4YQYA 1Y8RA 4XEHA 1CQJA 1EBUA 4YRBA 4CJXA 4WJZA 2YV2A 4Z0HO 1NQOA 1KVRA 3G79A 4Y9DA 1T2DA 4GMFA 1K6JA 2D5CA 1MUUA 2JFFA 4ZQBA 3WICA 4QQRA 2Y1FA 3PJDA 1P45A 3DHNA 3GVXA 2PGJA 4QECA 4E5MA 4YT4A 1ZK3A 3FR7A 2C59A 3U0BA 4DC1A 4KDEA 4C7JA 4UVDA 3AM3A 5BNIA 1ZXBA 5I9NA 1R4MB 1YXMA 1DXYA 3D3WB 4QXMA 4GWGA 3WQQA 5B12A 1ADBA 1IZ0A 3PRJA 1DHTA 2IXBA 1Q2XA 1E3WB 2CFCA 2QYSA 5TF4A 4E13A 3WXBA 4NFSA 1E3EA 5TQVA 3RI3A 3WX0A 1P74A 5JMPA 3BHIA 2GSDA 1H9BA 2FP4A 1CIVA 5JC8A 3STHA 4NR0A 2WMDA 4O0LA 3DTTA 4MDHA 4R4JA 2G82A 3RFXA 5JCXA 3WQSB 4MP6A 4GL4A 4D41A 1K3TA 4TVBA 1EQUA 2FPPA 4IY1A 1VJ1A 1JVBA 1Z7BA 3GEMA 1LSOA 2CF6A 2WD7A 4CMGA 3AWDA 4GPD1 5F1KA 5K0ZA 4FJ1A 2QZ9A 4YVFA 2CZCA 1NQTA 4R68A 3WTBA 4FS3A 1JDJA 4I5FA 4BO8A 4FC7A 3DOCA 2AEMA 3BTSA 1UH5A 3CPSA 3U9LA 4ND3A 3C1AA 4EITA 3VHRA 1HLDA 3FNEA 3N7UA 4WNCA 2RCYA 4HKTA 4TZTA 2NVUB 2GGSA 3VH2A 5CAEA 4YB8A 1ULSA 5DDIP 5T64A 1H5QA 4YAJA 5JLAA 2E6UX 3NJ4A 5EERA 2XXJA 1FDTA 4E2ZA 3SLGA 3L4BA 3W6UA 1GCOA 4YA6A 3RBZA 3WGQA 2NTNA 3ZNQA 4B8WA 4QFCA 5KVVA 3IOYA 3LK7A 5F1OA 1SPXA 3KEQA 3WDSA 4XA8A 1HZZA 3WJAA 2OFPA 1EVYA 2WSBA 5TT1A 3UAGA 4OAQA 3ZV5A 1ZMTA 3FNFA 1Y6JA 2AE1A 1PSDA 1E6WA 4EDFA 5BQFA 1GYPA 3H8VA 4NFYA 1EK5A 3RCBA 1XG5A 4MO2A 4QEDA 4U0JA 2GYYA 2IEBA 3ITKA 4YAKA 1B7GO 4Q9NA 3TDKA 4R1UA 2Y1CA 1VKOA 1HDOA 1ISMA 2Q50A 4QO7A 5TLSA 3L77A 1GU7A 1IL0A 2B4TO 1CWUA 4BQRA 2YDXA 2C2XA 2DBVO 2VUSA 2P9EA 1D8AA 4HBGA 2E4AA 2BMAA 3DMTA 4KQWA 1ZK4A 3V2HA 4EUFA 4DPLA 2X9GA 3VZRA 2EKQA 1E7QA 2DBZA 3GNSA 3PHGA 1E1MA 1RM0A 4PLFA 2ZYDA 3I9OA 4Z9YA 1VL6A 1RYEA 2UYYA 2BFMA 1RKXA 2FY8A 4FN4A 2Q2WA 3TOXA 1QKIA 3BMOB 1V0JA 4QO8A 2P91A 3HFSA 1VRWA 3WIEA 1U3VA 2IODA 5U9CA 3L6DA 1L7EA 1I01A 2Q46A 3FHLA 4OM8A 1ISJA 3DBLB 3OIFA 4XX0A 1T1SA 3H2SA 2AXQA 3HNPA 1YDWA 3L9XA 1VC2A 2I9PA 1YJ8A 3AFNA 2AW5A 3ZWWA 5IF3A 3A1NA 2QRLA 4YTEA 1P0CA 4ESOA 1ZSNA 3JD1A 1T4DA 4ND5A 1JWAB 3RC9A 2FPIA 4XKJA 2R6JA 4LK3A 2JD1A 1NYTA 2RBEA 3A28A 3HG7A 4XYEA 1QMGA 2CY0A 1EVJA 3OECA 2VTDA 4FOOA 1RPNA 2NM0A 1GV0A 1A71A 4FR5A 2UDPA 4U8GA 5DNAA 4Y98A 4CMHA 5LDHA 2H63A 1OC2A 3UUWA 4XDZA 5T57A 2HK8A 5G0TA 1X1EA 1DLJA 3DC2A 2C7GA 5HRUA 4J7UA 4J7XA 4CUJA 2WDZA 1ZO8A 3CIFA 4URFA 3OF2A 3WSWA 5JDIC 3KM0A 4G81A 4FPXA 3D4NA 2W2KA 1S6YA 4CM4B 5ICSA 4RVFA 5KVSA 4AL4A 2Y68A 4KP7A 1ML3A 4UUNA 1HL3A 1NQAO 1E92A 1SOWA 1VLLA 3SJ7A 1D1SA 3JQ8A 1UUFA 1YBVA 2A92A 5EN4A 5GZ3A 5L7WA 4QTZA 4CV2A 1LU9A 4A26A 4DIOA 3CTMA 1PJBA 3ZW8A 2BD0A 2JCXA 1YQXA 4DIFA 2HK9A 1F0YA 5COAA 1UDAA 3UICA 2NTVA 3F3SA 4ZJUA 3RVDA 3ZWOA 3VOSA 4B7XA 1P1JA 4HWKA 1HDXA 1SB8A 3WIDA 4AICA 4WEQA 4J1TA 4MP3A 1EEHA 3HB4X 4DIBA 4L0QA 3ZWMA 3D7LA 4J9VA 4CQMB 1OI7A 4I8XA 3TZKA 1N7HA 1NFQA 1BVUA 4XCVA 4WCDA 1QLHA 3FBTA 2OBNA 1GY8A 2AMFA 5L4LA 3OIGA 3TNLA 3E82A 4RLHA 5T8KA 5KJ1A 1Y7TA 1P1HA 4C7KA 4DC0A 3DZKA 5EQDA 3EUWA 1WDMA 3OP4A 4N54A 3TQHA 5MDHA 4W9NC 3VAZA 3CZRA 3IUSA 1U3UA 2Z5LA 3T7CA 4XQGA 2RH8A 3E18A 4PG6A 3CMCO 1KY4A 4A0SA 3QIVA 1KC3A 4L75A 1GUZA 2C07A 5C7LO 4KUEA 1ISIA 5EJ2A 1X1TA 4D0SA 1E7SA 4J90A 1C0IA 3PDUA 3UVEA 2EV9A 2VWPA 1Z6ZA 3ITDA 4YT8A 3AM5A 1QR6A 3RBXA 5GZ1A 1YOVA 1ZUD1 2B37A 4YRDA 4EI2A 4U0KA 4BNTA 3L4BC 3WTCA 3JQDA 4PZEA 4BNMA 1U8XX 4TMFA 5KJFA 1ZKMA 1C1DA 1BXGA 1DAOA 4P22A 4XYGA 3RQSA 4RGBA 1JW9B 3PFFA 1BHSA 1C0KA 2J6IA 3PQFA 4EBFA 2SCUA 3UOGA 3WLFA 1NPYA 2VWHA 4K28A 4DQXA 3RUIA 5CEJA 2DPHA 3VPFA 1YQGA 4DLLA 2JAHA 4L9RA 3GDGA 4B4WA 2NUAA 3DBLA 4PLVA 3IL2A 4JXKA 1KEWA 2PKQO 2ZQZA 1M6WA 2DFDA 3BMQA 3I83A 3INTA 4GQAA 4OOFA 1JTVA 1H6CA 1UDBA 5THKA 2EP7A 4DMLA 4S3MA 2PA3A 1BWSA 1B0AA 1JKFA 3ZI0A 4Z6KA 3R3SA 2X0RA 5G4KA 5KVCA 1F17A 3DWFA 4BO4A 2J5KA 1AHIA 1J6UA 1VL8A 5JAQA 1IUKA 4BB6A 3VPGA 1RM4A 4CLHA 4J1SA 4BNVA 2TMDA 4JN6B 3O8QA 1NBOA 1NNUA 1R4NB 3E9QA 1P77A 4J6FA 1PGPA 2YV3A 3K30A 4CMAA 2EP5A 3UF0A 1MA0A 5AYVA 2E37A 4W4TA 5JAZA 4OL9A 4ND4A 2QG4A 2B5WA 4NIMA 1T4BA 3ROQA 5JO0A 5I7EA 1E5LA 2VYNA 1R66A 4IDAA 3HDHA 4XGKA 3L6OO 4FQ8A 3E48A 5CEFA 3FBGA 2HJSA 3DZJA 3PXXA 1C3VA 3JQ6A 1IPFA 5KKCA 3EY4A 3OBBA 1OFGA 4W9NA 3DAPA 5CDTA 1QORA 3KLPX 3P2OA 4WLVA 2X0NA 2GN9A 1Z45A 1ONPA 1MC4A 5JAIA 4BQPA 3ENKA 4NJMA 3LC1O 3PJGA 1VJTA 1EK6A 4WLUA 1HTBA 3U4HA 1I3LA 1QYWA 2H5LA 5JCJD 1PIWA 2O3QA 1A72A 2OHXA 4AJ2A 5I8WA 3KUXA 2OXIA 1ZW1A 3DBHB 5C7IO 5FWNA 3KSDO 2GNAA 4BNWA 3F1KA 1X0XA 3FPCA 2J5QA 1NFFA 2D8AA 2HMWA 1B3BA 1Z82A 1B8PA 2X7HA 3C1OA 4D3FA 1XDWA 4I5DA 1T1RA 3NJ8A 3JQ7A 1ZK0A 1UR5A 3I5MA 4CMKA 3IP1A 5LCXA 1EE9A 3LT0A 4DGSA 2EJWA 3JQBA 1D4FA 1EE2A 3EAGA 4JCOA 4WKGA 1CYDA 3ZW9A 2PZLA 4DYDA 2BFAA 2D2IA 2HK7A 5C37A 2Y1DA 1N92A 2V6GA 1I3NA 4Q3DA 4TRNA 3ROKA 3GF4A 5TJ9A 2EW8A 5G0SA 2Y67A 2O4CA 1YS4A 2GRAA 4KZPA 2IZ0A 1YB1A 1B3RA 1LLDA 4XWYA 3GUCA 1PS0A 3FWZA 4J4BA 4F6LA 3F9IA 2VNSA 2YFQA 3K5PA 1IPEA 1HF3A 3VPHA 3VDQA 1WMBA 2AA3A 3B70A 5DCUA 3IIEA 1YJQA 4XJSA 1CRWG 3SX2A 4KUGA 5AXDA 3C85A 5K9ZA 1I32A 1KEVA 4MVJA 2I6TA 3ON5A 2Y0EA 1PQPA 3T4XA 2ZTMA 4INAA 4BNLA 2X0IA 2A94A 1MG5A 2PZJA 1ZJYA 3K9QO 2EW2A 4TRRA 3O4RA 1ISFA 2JHGA 2X9NA 1KEPA 3PGJA 4AJHA 3DAFA 5JE8A 4RPJA 1Z7EA 2CDAA 1LLCA 2D1YA 1MC5A 1NR1A 1DO8A 4PRKA 1R12A 2CSUA 1LNQA 3JQGA 2VHZA 4JNKA 4R5HA 3PGXA 4A03A 3QWHA 4FGSA 1LQUA 3C7CB 2C2YA 4AJIA 1UZNA 3W4KA 3DR3A 1GCUA 3WWYA 4AVYA 3P5SA 1MGOA 1I10A 3JTMA 1WWKA 3M6IA 5JDCC 4GAEA 3WLEA 2GASA 2O3UA 2YY7A 4LSMA 4GGPA 3BMOA 4CM5A 2AE2A 3MOIA 2VHWA 4LISA 5JO9A 1DC3A 1YKFA 3P2YA 4P4LA 1DFHA 2B69A 2G1UA 2VUTA 3Q2IA 5A3VA 4ALJA 1HE3A 1N9GA 1L1FA 4S1VA 3V2GA 2I99A 1XCBA 2Q49A 3GZNB 5G0WA 1GQYA 1PL8A 3W8DA 3DBRB 4PN3A 2TMGA 3IS3A 1R4NA 1WVGA 1Y8RB 5I7SA 3H7AA 3OSUA 4E0BA 4D3SA 2D3TA 4PLTA 3TSCA 3TF5A 2GZ2A 2JCYA 1BG6A 4PGFA 2JFGA 2WE7A 1GZ3A 4A7PA 5LC1A 4CMCA 2G76A 5ITWA 1FDSA 3PHJA 5H83A 2AQIA 4HFRA 1OBFO 1J0XO 1X14A 2PZMA 4OOEA 4ID9A 4B8ZA 3OMLA 3P7MA 1LLQA 2IRWA 1TT7A 3TZQA 4CMIB 4OXKA 5AOVA 3WMXA 2QYTA 1NAHA 3OJ0A 5ICMA 2H1SA 2GN6A 3VH3A 3W8FA 2FZEA 1O94A 4MJLA 1G0OA 1ZVMA 1X0VA 2R00A 1ENPA 1W4ZA 2IDZA 3R1IA 3L0DA 4IPTA 4B3JA 1OC4A 3ROMA 3GT0A 5JYDA 2BH9A 1VL0A 4M87A 2O50A 3NAQA 2BELA 1V3UA 2HMSA 2I3AA 3KRTA 1S7CA 2E82A 4CMIA 3F1LA 2CVQA 3NUGA 1D1TA 3RASA 1E7YA 3ZHXA 4Q39A 3MTGA 1O9BA 3GFBA 2JKVA 4B4UA 4BO5A 2Y66A 3O38A 2ZKLA 1LC3A 3DHYA 3DQPA 3I3OA 3RC7A 2WYWA 4NU5A 2GERA 2X23A 2C7VA 2ZTLA 2VOJA 5BR7A 3PTZA 3SJUA 4CMJA 3DOJA 4HADA 2DU8A 2GR9A 4EUHA 4E33A 4WOJA 1EVIA 3AY7A 3HB5X 4XGIA 5A02A 1ZZEA 4GX5A 2NU7A 3EW7A 4LN1A 1KC1A 1PZGA 4FFMA 4FFOA 2EKPA 3MWDB 1NVGA 4BNUA 4K9DA 4R16A 5B1YA 3IMFA 3ZWXA 1NR7A 1TVEA 3KYCA 3AUTA 4E4YA 3H2ZA 3U09A 2QRJA 1H6DA 4U6QA 1QYVA 1U3TA 3IJPA 4WUVA 3H6KA 5IN4A 1P1IA 1XQ6A 3GRPA 3PWKA 5IDXA 2HRZA 3H5AA 4IMPA 4Q3EA 3VZSA 2GCGA 5J23A 2VZ0A 2CMDA 2ZB4A 2PY6A 4CM1A 3ADPA 1ORRA 1U2GA 2GUGA 4Z3DA 2Q3EA 4M86A 2DM6A 1HXHA 2DTXA 3LT2A 1ZJZA 5JSFA 5B4TA 4WLOA 1C0LA 4LGVA 1R16A 3C7AA 4J0FA 4L8VA 2QZZA 1KOLA 4YYZA 1YQDA 2FSSA 5IJZA 1IULA 4GI2A 3ZWBA 2C82A 4PLCA 1PR9A 4JLWA 3OJEA 1VJ0A 3KETA 2WD7B 4D45A 3PPIA 3ANMA 1LDEA 5A9TA 5H81A 1MB4A 2P4HX 4TRJA 4CR8A 1HDRA 4BO3A 3LDHA 3DTYA 2GZ1A 1Y9AA 4BV9A 4YRAA 4Y6RA 3NT4A 3D5QA 3I1JA 4ITUA 3B20A 3CXRA 1N8KA 5JS6A 5KCZA 3Q0EA 3TFOA 1UZLA 1XLTA 2Y93A 4FGWA 3SLKA 3V2UA 3E5RA 4CM7A 4QT0A 2X9VA 1W8DA 1KVTA 2NWQA 2ZIZA 4GLOA 5MGBA 1LSSA 3R3JA 3DDNA 4TKMA 4IDCA 4GSKA 2ZCUA 4BNGA 1MXHA 1EFKA 1KS9A 1JN0A 4YJHA 1DC6A 3JQEA 4N5NA 5KWEA 1GFSA 2H9IA 4BL5A 5EQFA 5EESA 1UAYA 4DLBA 4IDFA 9LDBA 3PDJA 1G6KA 1GR0A 4BHTA 4MVJD 2UV8A 3MTJA 4ZVVA 1U7HA 2Y1EA 4CV1A 3JQAB 3VTFA 4B7UA 4NU6A 4H15A 2GLXA 1PS8A 5BSGA 4FFNA 3GAZA 1ZK2A 3GG2A 3WMWA 4BMNA 1Z75A 4H16A 1EFLA 4L73A 2OOSA 1LDYA 4YJGA 3HDQA 2V6FA 3OETA 5DZSA 3LF2A 2Z1MA 3UXYA 4YCAA 2ILTA 2PH3A 3NDIA 3VVCA 1BXGB 2PKRA 1P33A 3N74A 1Y5MA 2QHXA 4E12A 3DXFA 5A9SB 2JL1A 2VWQA 3QRWA 4DQVA 3SC6A 1I24A 4FSHA 3M2PA 1QXSA 4CLOA 2JD2A 4CR6A 2FWMX 2VWGA 3Q11A 4BNHA 4TRMA 4YDRA 4FJ2A 1X13A 3WJ7A 1Z73A 5CG1A 1NP3A 4MOWA 4KOAA 1RJWA 1Y5RA 2EF1A 2JCVA 1F12A 3ZV4A 1AE1A 4L76A 4OQYA 3SEFA 2RIRA 4UUMA 5G4KB 3QWBA 4BGIA 5BT9A 4BS9A 5L4SA 4CMEC 4FOSA 1YRLA 2QW8A 1F06A 1ZFNA 2BRUA 3LT4A 1IYZA 1XELA 4WPGA 1UXIA 1K89A 2NQTA 2X5KO 3IP3A 4MVJE 2WJPA 4NQZA 4QFDA 1I2BA 4MKXA 4HFMA 2CVOA 1LUAA 4YPOA 2X5JO 1ID1A 1CJCA 3RUDA 2EG9A 3WWZA 4XD2A 3Q9NA 3CZMA 4ZGWA 4J2OA 4BOYA 3PJEA 1ZEMA 1N2SA 4LRTB 5THQA 4HFJA 4KMSA 5I8ZA 4BNNA 2DVMA 3H3JA 4RORA 3L6EA 3RFTA 1HRDA 2FPGA 5HWSA 2VZ9A 3CUKA 5F21A 4BIIA 2YW9A 4DBVO 4YQZA 1K5HA 1ENOA 3AU8A 1Y1PA 1LDNA 2EHDA 2UUOA 2NV6A 4IZHA 4JQCA 4JJGA 3V5NA 5HS6A 1W6UA 1UXKA 1LSUA 2VOEA 3GN2A 2OGUA 4ALKA 4J43A 3K73O 4RVUA 3DHEA 3N58A 2NTJA 3TPCA 1HE4A 4J0EA 2NVWA 3BIOA 3GDFA 4JP2A 3GH3A 3I9LA 5K6AC 1YOVB 2X86A 2X1HA 1IOLA 1E1LA 2I66A 4MPDA 1PJTA 5JY6A 1NHGA 2HRBA 2VHYA 3D64A 4W82A 1LA2A 1W73A 2WWRA 4CV0A 1E77A 4J3FA 1OOEA 1AXGA 1X7HA 4BNYA 1JAXA 1SC6A 3KTDA 2IYOA 2Y0CA 1FXSA 3PZRA 3RUAA 1ADGA 2XOXA 4DVJA 1PGOA 2CVZA 4R3NA 3ZHBA 4RL6A 4Q3NA 1MV8A 2O2SA 2PD3A 1HKUA 2V6BA 4RJTA 4Z0TA 3GGPA 3H5RA 2X6TA 1YVEI 3TZCA 1ZSYA 1JA9A 3BXXA 2PLAA 3F47A 5JMWA 3WBFA 1QV6A 3QWAA 8LDHA 4NZ9A 5CEEA 3DZGA 2OBYA 1DFGA 2CD9A 3DZIA 3ROPA 4E5PA 3SBOA 2OORA 4CQMA 2HLPA 3M2TA 1P3DA 3JQ9C 3V1UA 3BMQB 3DL2A 2YFHA 3PP8A 4R41A 3IJRA 2Q99A 2EGHA 3LT1A 5TS3A 4YEDA 4Q3BA 2B5VA 2R2GA 3AU9A 2P5YA 4OKIA 1WLYA 2J3IA 4PRLA 5KTKA 3JQCA 5GY7A 2VYVA 5DOVA 5HBRA 5HM8A 1UP6A 2VZ8A 3GK3A 4XYBA 3DBVO 1Y8QB 3VTZA 1LRKA 1T2AA 1ZMOA 3H9GA 2NQ8A 4ZA2A 4CR7A 2I65A 2OZPA 4BNXA 4CM3A 2BGKA 3ADOA 3I4FA 1ADCA 5DN9A 3PYLA 1BW9B 3SVTA 2W8ZA 2BFOA 3F5SA 5ENVA 4ZU3A 1WPQA 1XSEA 2WE8A 5DULA 1EQ2A 1XKQA 2W98A 4OSOA 3BHJA 3W4JA 3BAZA 1GDHA 1YBAA 2RHCA 3UCFA 3HWRA 3ZV6A 1U5AA 1SMKA 1QYDA 1JAYA 3JQFC 3AUAA 3VKVA 4II2A 1TA4A 4K6CA 2HJRA 2F00A 3BMNB 4YJFA 3A14A 1YWGO 3V1TC 4ZQGA 4RF3A 3WGZA 1I0ZA 5CDSA 3HJAA 1B2LA 2EWMA 1WXDA 2B0JA 4CQMD 2NU8A 4DREA 1BW9A 4E5YA 3RUCA 1AUPA 1JWBB 2Y1OA 3Q2KA 1YDEA 3GVCA 3GEDA 4NG5A 3JD0A 2ZJ1A 3OEYA 1DRVA 2VRCA 1E7RA 2VHXA 4BNJA 1Q1NA 5A1TA 4OHUA 1R0LA 3L07A 4XRRA 1VM6A 3DZHA 3R0IA 5JW6A 4MIYA 5CP8A 5T5QA 2PK3A 2WEKA 3OJLA 4GKVA 1DSSG 3AOEA 3GMDA 1J4AA 4IIVA 2V6MA 4YJDA 4IBOA 4EZBA 4XQCA 3FRJA 3G1TA 2HKIA 1P31A 3H9UA 3JYQA 3WGHA 2YHUA 2EGGA 1KVSA 1I8TA 3GVHA 4M89A 3EC7A 3LU1A 4KWIA 4IQ8A 3D0OA 3EVTA 4NK5A 1I5RA 5DOZA 5ES3A 1O0SA 4N18A 3RUHA 4MVJM 3PQDA 4OYRA 4PLPA 4Z9FA 4YT2A 1JLLA 1C0PA 3BMCA 5ILOA 1DIHA 4ZICA 1P1KA 3VKUA 3TL2A 2DLDA 1FF9A 2ZK7A 1YL5A 5B37A 3IUPA 1LEHA 3G1UA 3P19A 1XEAA 5ER9A 2UVDA 2ZYAA 3E1KA 3HUDA 3QVWA 1V8BA 1ZH8A 2QX7A 4U5QA 1UAGA 3KYDB 3ZWVA 1F14A 1KIFA 5F5LA 2PV7A 4C4OA 1HEUA 1U28A 1H0KA 4GX1A 3G3EA 3CINA 2J5RA 4TWRA 2AQ8A 2GN8A 3JD4A 1GPJA 4ROSA 2BGMA 3BYZA 4EEZA 3GAFA 3PQEA 3S55A 4R1TA 3BHMA 2QQ5A 5IDWA 2O3RA 5IG2A 4D44A 5TNXA 1ZSVA 3W1VA 3GN1A 3TL3A 4H7PA 4J4HA 5L9AA 3ANLA 3O8QB 1KERA 2NACA 3IAHA 3MJEA 1MX3A 2WD8A 1NVMB 2HMVA 4PLHA 3LZ6A 1LI4A 5JDIA 1PR3A 4OIMA 2FZWA 3M1AA 4UVEA 3K2EA 2Y0DA 3NTRA 3PYMA 1O95A 4NI5A 2AQKA 1HZJA 2YQ4A 1PWXA 1PJ3A 3GUYA 3K31A 4EUEA 5TGDA 1LDGA 2Y1GA 3OEWA 5AXAA 4RO0A 4D42A 1SCUA 3UGKA 3VVBA 3I23A 2I3GA 5KJ6A 1EDOA 3KHUA 1ISHA 4RPKA 4BO7A 2AHRA 3O26A 4CLRA 3DAGA 3NEPX 4TZKA 3GEGA 5GZ6A 4X54A 3FSRA 4XR9A 2D4AA 1V3VA 1SNYA 3E8XA 4I9UA 1NX6A 4UUPA 4EJ6A 2EKLA 1LJ8A 4Y6PA 3DEYX 5ER6A 1WZIA 4DMMA 4BMVA 3JYNA 4BKPA 3MCVA 2IZZA 4FIZA 3WYCA 1H93A 2VHVA 5B4VA 2ZTUA 1X15A 4XJTA 1A7KA 4RF2A 4LRSB 1T2FA 2GPTA 3QSGA 1MFZA 2CNBA 3PZBA 4FD3A 4JIGA 3S1LA 1FDUA 3OM9A 4NPCA 3U5TA 2PWZA 1PZEA 2DTDA 4CLOB 1EUZA 2PTGA 2XF8A 1SZJG 2Q1UA 3PK0A 2YHIB 1PWZA 5CDGA 4XQEA 2WTBA 1JVSA 1NAIA 3QA9A 2YUTA 1TB4A 2ET6A 4UAGA 4AJNA 5BSEA 1LXCA 2O7SA 1BSVA 4HX5A 1GD1O 3MJCA 3QJ5A 3IQDB 1UXJA 4I08A 4UUOA 4NDNE 1HE2A 2Q1SA 3WGTA 3ANNA 4MIEA 3RFVA 1UDCA 3FNHA 2EXXA 4ILKA 1J5PA 1SBYA 2YQ5A 3COSA 5CPFA 4ZRNA 3ZNNA 2O7QA 3JQFA 3KZVA 4J1NA 1GZ6A 3BTOA 2BI7A 4R5MA 3RIHA 2W4QA 4PLZA 5TSDA 4E2YA 1EMDA 3I9JA 1DEHA 1PX0A 1H6BA 3SXPA 1YONA 3WS7A 1C14A 3EZYA 4O59O 1U2DA 1SO8A 3WSVA 2JD0A 3GMSA 1DIBA 3HHPA 4CPDA 3JQAA 3TFQA 4PVDA 3JQ8B 1O5IA 5T6BA 3MWEB 4IQ0A 4KDFA 4II3A 3DMYA 3LC2O 1EZ4A 4BGEA 3MZ0A 4RQUA 4BO6A 1YGYA 5FYDA 1MP0A 2QRKA 1LDBA 4I5EA 1OZAA 1FDVA 5DT9A 4AJ1A 4AJKA 4IS3A 3GRKA 3JYLA 4PG5A 4FFLA 1BGVA 1ISGA 4RLSA 3ASUA 4J49A 1XWFA 3F4LA 4ZD6A 3QWFA 2Z1NA 1PQWA 2X5OA 4MINA 1EBFA 3K2BA 4N5MA 3QV1A 3G49A 1DIGA 5T8KC 3WGIA 2YJZA 3ETGA 3I9MA 3MOGA 2B4QA 3F4BA 3G17A 4IIUA 4WASA 1RWBA 1GADO 1UP7A 3KBOA 4OKNA 3EHEA 4IMRA 4Y67A 1T25A 1CF2O 1A7AA 3EZLA 4Q3CA 1OMOA 5A5EA 1N7GA 1I30A 1IZ9A 3BA1A 3NT5A 4ALMA 4RDHA 2DQ4A 4I9HA 4XIJA 1HDZA 2NVUA 3RWBA 4CODB 3V8BA 1WW8A 1H2HA 4WLFA 3WNVA 3M1LA 4PG4A 4UVGA 1VKNA 5T67A 3ASVA 1YBMA 4CL3A 1M76A 3QY9A 3L4SO 2Q1TA 2DFVA 5KNLA 3AK4A 1PGNA 3QVSA 2Z95A 4IUYA 3V1YA 3GZ4A 1YB4A 4U7WA 5JC1A 2B36A 3RJ9A 1HDYA 2FRDA 3FR8A 4XR4A 4ZQHA 3RUEA 5C5IA 4FCCA 3GNTA 2O23A 1T2EA 3KYCB 2HUNA 3NV9A 4G2NA 4RVSA 5I9MA 3JYOA 2DKNA 4K26A 3W8EA 2D5AA 1FJHA 2Y05A 3ABIA 1N1EA 3PIDA 2IYPA 4KWHA 1WAMA 4FJ0A 1ULUA 3ICCA 1DFIA 3RUFA 5TRTA 3LQFA 4RDIA 4MVJP 1C1XA 3INRA 4YXFA 3K96A 4PG7A 5TC4A 4U6SA 5ENDA 3JQBC 4BMSA 4ND1A 4ZRMA 3MJTA 5DBIA 4HNHA 2HCTA 4RF5A 1BXZA 1R15A 3Q6IA 3OIDA 1P9LA 4RCVA 4J1QA 4XIYA 4D46A 3PLNA 4WCFB 5IXSA 3Q9UA 1U5CA 1D3AA 3QVXA 5A04A 4WK6A 3U4IA 4E5KA 4RVHA 4XYMA 4FBGA 3ZNOA 2DTEA 3T7EA 4JBHA 4MVJF 3B1JA 3F46A 3DMTC 2RH4A 4MVJI 1Q0QA 1TLTA 4IDEA 3WGGA 1I3MA 1H94A 1VI2A 4PLGA 3UN1A 5JNLA 3OJFA 3AI2A 3EMKA 4M1QA 2O3JA 3OH8A 2GD1O 5IZCA 1YB5A 2JAPA 1DBVO 1G1AA 4YACA 4DPKA 5B4UA 4GH5A 3TOZA 1TT5B 1KY5A 4JBIA 3K6JA 4BO9A 1QYXA 5I7VA 1IE3A 1VE9A 1ARZA 1A9ZA 1WMAA 1XYGA 2EJVA 2HMTA 4DUPA 4XB2A 5I9LA 3ONEA 1PQUA 1ZK1A 3WB9A 1PZHA 5JYEA 1ENZA 3HDJA 5BSFA 4DLAA 4LVCA 4CUKA 4LCJA 2ZTVA 2LDXA 2C29D 1DC5A 4LCEA 4DQUA 1GYRA 4FFRA 5JDCA 1NFRA 1ZXLA 5IDQA 1B16A 1E0DA 3QVOA 4ZQFA 3TWOA 4CQLB 3ONFA 3VPSA 2LDBA 4YAEA 2BI8A 5COBA 4RVGA 3PWSA 1R37A 3ZN2A 1PJQA 5IN5A 3EVNA 2O48X 2O3SA 1PS9A 2WM3A 5L4NA 3EK2A 4JROA 4GGOA 3JQ7B 5F3RA 2W90A 4UEOA 3Q3CA 1P44A 1U4OA 1ZEJA 1HSOA 3GVIA 4AJPA 3A4VA 2ZJ0A 3NKLA 4IJKA 3RSHA 5GMOA 1MG0A 5JPIA 4YJGB 1PEDA 3VH1A 1Q7BA 5BSHA 4EYEA 3FD8A 4CM8A 2BLLA 3S2IA 3GPIA 5TJHA 5G0UA 3PHHA 1BDMA 1T24A 2D59A 4NMHA 1K6XA 3KV3O 1E1KA 4OXYA 4WGGA 3ZU2A 6LDHA 3PYXA 4F46A 1VPDA 4BKUA 1DRUA 4NFHA 4QSMA 5DCYA 4PZCA 4NJOA 3JV7A 5COQA 2AEFA 1A27A 1HLPA 2B35A 2ZB3A 1PGJA 3DZBA 4PIVA 1Z74A 4RPGA 4E2WA 3R6DA 1K2WA 4LVUA 3H3FA 3C3XA 1A5ZA 1O89A 3U62A 1O8CA 3OQ6A 1NWHA 3NYWA 4TSKA 5DBGA 3GG9A 4WE3A 3RU9A 4GLLA 3Q1LA 1X7GA 3MJSA 3OQBA 3ZH2A 4W7IA 4YAIA 1K6IA 3NGLA 3JQAD 3LLSA 4NBRA 4RQTA 2OP1A 5BNFA 2BKAA 3ST7A 3U4CA 1KEUA 4R51A 4UREA 4ALNA 1Y81A 2EIHA 1F8FA 4LW8A 1T26A 2A4KA 3ZNPA 4BV8A 2BHLA 4JGBA 1M67A 1U3WA 1C1XB 4IXTA 5KJCA 1H9AA 3AM4A 3GGOA 2HMUA 5ILGA 2VYVD 3WG9A 1U8FO 2I67A 1PJ4A 3OHSX 3E6AA 3B1FA 4MP8A 4NBVA 5HTOA 2IXAA 3B1KA 3PHIA 1HYHA 1M66A 2PH5A 4YR9A 3F5QA 3QVTA 4TQGA 3JQGB 1QRRA 4L4RA 1F8GA 2FOIA 1M2WA 3HN7A 5AXBA 1HDGO 4RPLA 2JFHA 5KKAA 4K1LA 2C0CA 4O6VA 2EEZA 1HYGA 2A9FA 2YHIA 4QUKA 4BNFA 3PHLA 2UAGA 4R1SA 4EJMA 2PGDA 2E48A 2UUPA 3ZU5A 2FHSA 4CM6A 2ZQYA 4GSLA 1QP8A 3D4OA 4B3HA 3K8ZA 5EIOA 4E2XA 2FSVA 3GGGA 1GUFA 2Q2QA 3H5NA 3QW2A 3ZHZA 1JKIA 1ZCJA 5CHEA 1U7TA 4J91A 3K92A 4L4XA 4IDBA 1GAEO 5L53A 1YL6A 4E30A 1GQ2A 4R69A 1SB9A 4K6FA 2GN4A 1PZFA 4IJVA 2W2KB 1P0FA 4M8SA 3RU7A 4OO3A 5DP1A 3E03A 4L74A 4UVIA 1PTJA 1JKJA 1UJMA 1H2BA 4CQLA 4RVDA 2AG8A 4JK3A 5G2OA 4UULA 1Q7CA 1QG6A 3SC4A 1E3IA 1Q0LA 4BKRA 1T2CA 3QE3A 5EL0A 2HSDA 5L95A 3S8MA 5A4DA 2X22A 1TEHA 8ADHA 1LQTA 2PFGA 4JX8A 1Q7GA 2P4QA 4RZIA 4RPHA 5IZCC 3KYBA 1GZ4A 3AFMA 5CDUA 1W0CA 3WFIA 3ICPA 3T4EA 4CM9A 1I2CA 1DPGA 2DUUA 2E49A 4IDGA 4F3YA 3AY6A 2AEJA 4BO1A 2CF5A 1M75A 2VT3A 4O5OA 4XGNA 5FEUA 2I5PO 5HA5A 2XXBA 5L7TA 3VZQA 1TXGA 1WDLA 3ZGYA 2IZ1A 3H9EO 2H6EA 1N5DA 1WDKA 3FF4A 1SAYA 2CDCA 5KIAA 3UW3A 1LX6A 3C24A 5KOIA 4IZIA 3A06A 3VDRA 2G5CA 4CM8B 3KXDA 3GDOA 3I9KA 5KVQA 1I33A 3ETDA 5IDYA 4A73A 4IINA 2O3TA 1BRMA 3NDRA 3WNQA 2J8ZA 5EINA 3U3XA 3MJ4A 4A2CA 1G0NA 3PVZA 1DIRA 5K1SA 2QIOA 5CDYA 1V3TA 5A06A 4TROA 2HDHA 1JQBA 4KQXA 1ONNA 3IKVA 4YJFB 2O2YA 4J16A 1N1GA 6ADHA 4B7CA 1WNTA 2AG5A 3AUUA 4AG3A 4HFNA 3FNGA 3KLMX 2ZYGA 3D5TA 4PG8A 4YJHB 4DRYA 4HNGA 1MLDA 1R0KA 3UCXA 2G0TA 1PU2A 4AJJA 1ZNQO 3INGA 7MDHA 2ZATA 4GWKA 1O6ZA 3IDSA 4MVJG 3ONDA 4J4TA 1NXQA 3HN2A 4BNZA 3WYBA 1R0SA 3U4DA 5A05A 3PLRA 2Q4BA 1QV7A 2EERA 1SOVA 5TIIA 1XIVA 3EDMA 2P2SA 3DOOA 1GTMA 3WR5A 1CQIA 4IGEA 1NHWA 4P4GA 4ZQEA 2PR2A 5TT0A 4PLWA 3DZFA 5CPBA 1V6AA 4EEXA 3UFXA 2PZKA 3AOGA 2FR1A 2J3HA 1ZBQA 3BMCB 3RC1A 4R9RA 1E7MA 1I36A 1EDZA 4CL8A 4KTVE 2B4RO 3O9ZA 1LBEA 3H65A 2B83A 3DONA 4AJOA 1IHXA 4W99A 5ITVA 1E3JA 4IJWA 3DBHA 1XR3A 4GX2A 1GPDG 3QP9A 4E3ZA 4DYVA 1HWYA 1B15A 1RM5A 5U4QA 5F1PA 1DOHA 3CE6A 4UEJA 1E1NA 1QYCA 2Q1WA 4YT5A 3WYEA 2Q4EA 4FFPA 2FN7A 1HT0A 3S2FA 2JHFA 4M49A 4QX6A 1CEQA 1XQ1A 3ZDFA 2X58A 2XAAA 2NU6A 3AI1A 4Z0PA 3UCEA 3ZU3A 2YYYA 4AJEA 1U1IA 5LDGA 5IZ4A 4D43A 4N7RA 3DBRA 2DBRA 4NH4A 1Y8QA 4D79A 3BZUA 2PKQP 4D0RA 1LSJA 3NDJA 1TT5A 1XHLA 4XDYA 3ZZNA 2NADA 1KYQA 4HV4A 5L40A 2O4UX 2IE0A 5JAMA 3UH1A 4B4VA 5L7YA 2NU9A 1NWCA 2C54A 1IB6A 1U9JA 3GZNA 4EW6A 1ENYA 2VRCD 4DXHA 1LTHR 1HSZA 2F1KA 2WYVA 3IC5A 3LYLA 3GR6A 4YBZA 4MKZA 3ENNA 4ALIA 1DJNA 2RAFA 3C7DB 4NNJA 5JY1A 4E32A 4BVAA 3KSUA 1WP4A 4IS2A 4M55A 5L51A 4WOKA 3B6ZA 1SEPA 4OMUA 3WQRA 9LDTA 3GQVA 3VC7A 4GX0A 4NBWA 3G0OA 5BNTA 2OO5A 1B26A 1FK8A 5A9SA 3ZWAA 4W6ZA
chains in the Genus database with same CATH superfamily
3PQ2A 1KZ1A 3VU9A 5KJEA 4PINA 5G0VA 4GFDA 1I7QB 1RKUA 3AL0C 1DCFA 3ABRB 3ILHA 4WCFA 5H9WA 2WIDA 1Z0IA 3T9DA 1X92A 1VXOA 3WWOA 5I7UA 3F9CA 4XFKA 3D2CA 4FOPA 2RHGB 4X6LA 2ZU6A 2VT2A 2A5JA 5AT1A 3PE6A 3OQMA 2XKJE 2QRVB 2ERXA 4E5UA 1NQ5A 3RIYA 3T3DA 4N6NA 4F45A 5C7OO 4QXPA 3HXPA 3ESCA 1L4BA 5BOSB 2PQMA 5AKGA 1B14A 4HEJA 1KAEA 4MW4A 2JFBA 5KNDD 4QUAA 3NBFA 1B6TA 4E6PA 2OESA 4Q82A 3TZHA 1TYAE 3T99A 4B4OA 4X61A 5U1PA 3EQ6A 4GOND 4CF6A 3QKWA 2VYND 5CNJA 4QIHA 3KT6A 2ZIFA 3I9V1 4UVHA 3EC2A 3FCEA 3CX6A 3H2KA 4PLYA 2FUG6 4URYR 3KEGA 4HPWA 2VXBA 1KARA 1AXEA 5C18A 4IQGA 1CVRA 1Y9EA 2OM2A 1YB6A 3BMNA 2QM7A 3P52A 1G19A 1DC4A 4R9SA 3STUA 5IT5A 4G5RA 1NSFA 4OQZA 2NLOA 4TL9A 2ZBPA 5HKLA 3TZLA 3COZA 3FUVA 4G86A 3A9CA 3RRZA 3U3OA 4Z3KA 4IF4A 4KMRA 5ADHA 3ABOB 4H3SA 1NG9A 1HG0A 3FN4A 1Q0TA 2HXGA 2O5EA 4CG2A 1TAUA 4DBZA 3IPAA 3GHHA 2A35A 5JCJA 2XSZD 1RCFA 1TAHA 1DGQA 4KV7A 1E3WA 3UBMA 3ICVA 5AVOA 4PHHA 2QTVA 2AF3C 1G3IA 1KRHA 4JLMA 3E5MA 5GM2A 1Q91A 1SCNE 4YWJA 3KOOA 3WWPA 5INTA 2BEVB 1QQBA 5AXCA 2J6HA 2PX2A 3MTBA 1EUCA 3ORFA 1JV2B 3NYRA 4G65A 4PYOA 3Q7TA 4FONA 3B7PA 2RHRA 3NUQA 4UM7A 5BMVB 1II0A 4FC6A 1OFHA 3GJZA 1CLEA 3HE3A 4PCVA 3HKCB 5TEWA 2FE1A 1R0ZA 3BGOS 4D8UA 4MDYA 2PNFA 2C5HA 3JCZA 4OSPA 3Q8LA 2ZE7A 3IEMA 2IYRA 3O84A 1M1NA 3NGXA 5DLQC 3CVYA 3CYFA 2EZTA 1VA4A 3OICA 5C8YF 1Q21A 5CB0A 3IBYA 1CQWA 4EGJA 4KVZA 4EFDA 4HXYA 2GDZA 2LD4A 5KX5B 2VTEA 4GVXA 3RVQA 1XPUA 2CUKA 3QEMA 2Q62A 1DB3A 2FSPA 4KSYA 4P4NA 1PZXA 4DWVA 1USKA 3GC6A 1XNJA 2JLQA 1U4SA 3SSMA 4E1BA 1EYZA 4URWR 4O63O 2HD4A 5TPWA 4YAOA 3ZPXA 4F4DA 1Y7LA 4GP9A 2AXPA 3FNBA 1HA3A 2R1VA 3E7XA 4FMCB 3AJRA 3GPLA 3TLAA 1USUA 1TZBA 4B6OA 1GG9A 5F64A 4HB4A 1UDRA 1DLIA 1JAIA 2QT0A 3OT1A 1X8KA 4GDMA 4DTIA 3H5IA 4ZOLA 4BO0A 4KH1A 1B1CA 1U8TA 3KYDA 1Z7GA 1FMCA 2ZOSA 3N2LA 2I62A 2OP0A 1BVRA 4OM7A 2C5AA 3SNHA 5KTSA 3CKYA 4S35A 2DGDA 1UP4A 3Q85A 4WD3A 4XRGA 4NSNA 3QQPA 4Y6SA 3HA7A 4NYJR 3STXA 3ZXXA 2DY1A 4HUJA 3ZYCA 4MA4A 5HIAA 4NEQA 2V8OA 1S9HA 4ZOLF 1NIJA 2WVAA 3DEKA 3ZDEA 2BCGY 2FMHA 1L7RA 2PZBA 2XNHA 3EVGA 3EARA 1E3TA 4FW8A 2BSXA 4TTTS 2DPGA 1SHKA 3KEOA 5T4FA 5HZKA 1YA6A 2P2DA 5DCWA 2G9NA 1R6BX 3GNQA 4CUZA 1SXJA 4UTZA 2I2DA 1IN1A 3IE1A 4FB4A 5DF1A 5LU8A 1GOTA 1NVTA 3TN7A 4ZN6A 4V0SA 3MAAC 3OJOA 1C1HA 4FWIB 4M9RA 2VDLB 4XTCS 3GCZA 3TW8B 1N78A 3A3PA 1T8SA 2WVGA 3PWZA 3D0RA 2G72A 4HP8A 5JR3A 5DRTA 1YS2X 1X7DA 3FYCA 4GR4A 4H3VA 4BMXA 5AVWA 3GEBA 1KJWA 2O8CB 1ZX1A 4IAOA 3ZDCA 1J8YF 4WBNB 1SHTX 5CDHA 3K71B 2A1UA 2PDAA 4P38A 1Z4OA 5KHOC 1AKUA 4TLMB 1ZGJA 3UB3A 1MB0A 2I1VB 4NLLA 1L8QA 2OUKA 2WJIA 3FROA 1THTA 1UM9B 5K3BA 4ZC8A 1MTOA 1Q0HA 2AKYA 3ISVA 3PUIA 1U2GC 5LBUA 4AMZA 4EY4A 4BVKA 4JJFA 1OPRA 4CEHB 1Q1ZA 4H0CA 4ABTA 3G0BA 1W36B 3QPDA 4OHPA 4I5GA 1ZN8A 1XFDA 4RGVA 3E61A 2W71A 1SVOA 3KKEA 4NAUA 1EGAA 3L46A 4D26A 4IXMA 4OF4A 3EEFA 1L1QA 4JXJA 1YULA 1VL1A 1M1XB 4KNVA 5EE1A 4AWAA 1JJVA 3NP9A 1UXHA 1NJFA 1YL7A 1QLJA 4HEA6 4ZVRA 3KB2A 1C2TA 1UZMA 2V7WA 4C04A 5H16A 3SF8B 5T41A 3T3NA 3II6X 5JBIA 2HZ7A 1RQGA 4Z0NA 1WZEA 4C3UA 1T4GA 2IQ5A 2QLJA 1RWMA 3ND5A 2WVHA 2EWVA 3H5VA 3TUIC 3S44A 3U7EB 4FLMA 3JAMA 4MITA 3RS0A 4GI5A 1G98A 3QGMA 2WDPA 1Z5ZA 3ZK9A 2IYSA 5ALXA 2QORA 2I7XA 1S4MA 4BGVA 5K03A 4E21A 4OJNA 4CLRB 3MMSA 3A6EA 2GFIA 5H7XA 1A77A 2RGAA 3NP7A 1PL7A 3ELBA 1TA0A 2ZE6A 2BKUA 2J3KA 3ONVA 3TKYA 1CUVA 1QFYA 2FR8A 4KN6A 5JI2E 2W2QA 3HV0A 3L8EA 4JJIA 4QTXA 3S2UA 2VF2A 4IGFA 4PC7A 4OBWA 2CXRA 1XU7A 2WJZB 2XHEA 3QW4B 4C2UA 4R31A 1CUIA 5TB5A 2IU0A 1J5XA 1O9GA 3A1SA 3W2HA 1K0UA 1E6EA 4IHJF 4J0JA 4AS1A 4MTCA 1EHCA 5ALDA 1VKJA 3GGJA 3NRBA 1KBZA 1S3FA 4A0RA 1P5FA 1RM3A 1BDBA 2AMLA 3VSDA 3W6NA 2H4XA 1K9VF 4HDRB 1CG6A 3HNRA 4O2RA 2B6HA 4Q4JA 4R54A 2FPUA 3WKEA 4LX8A 3DP9A 4EMBA 4UTVA 3T1QA 1T35A 1X39A 1DQRA 4J94A 4WEOA 3GJRA 5BP7A 1RQ2A 4B46A 3L7JA 3N05A 4ER0A 1L5OA 3PNQA 3R5SA 4RS3A 4TQAA 4YRZA 1MJFA 4LJ5A 2FEKA 4ARZB 2X6RA 1QE3A 1USGA 1RRCA 1W7AA 1Z88A 1JTEA 1T91A 1H3FA 2J9ZB 2PV0A 1TAGA 2H4YA 4JI6B 4ZYTA 2ISCA 4BECA 2B3DA 3CG4A 3DCNA 1B8UA 1NTOA 4JHLA 4TSRA 2PRIA 1P72A 4IWNA 3VAYA 3OFVA 1PD1A 2MSNA 4R8KA 1RBQA 3DXYA 4WFJA 3RBVA 1TQDA 3SJAA 2I7CA 4BUCA 1T29A 4XYLA 4DNXA 1NX9A 3PIIA 5FUVA 3KVYA 6Q21A 2XGJA 1YI8A 3JZFA 4NDZA 4UOQA 3UTDA 3DOHA 2AR9A 4ZGGA 2PYZA 2E5FA 1ECFA 2V58A 2XECA 3LKZA 4PTZA 4BKMA 4L7VA 1LI7A 3O73A 2HSGA 2IYUA 4Q7QA 3K8QA 1POWA 4CLDA 4EJ0A 1E7WA 1L5FA 5L45A 4PYQA 2FPGB 5CFRA 1WTAA 2PXCA 1ILEA 4U2DA 4EHDA 3GCWA 3CKLA 4TKUB 5F4ZA 3MNFA 3H4MA 1A4IA 1ZIDA 1RJDA 4OHVA 1S5PA 3PCRB 2GQ0A 1NVUQ 1P7ZA 3WGMA 2AN3A 4MV9A 4UCQA 1SU8A 5A9RA 1K2VN 4BLUA 1Q11A 2WT9A 1I2ZA 2RH9B 3FLMA 1BS2A 2H1WA 4QZVA 1F3LA 3GFGA 4NOKA 1R74A 1ZLYA 3JXEA 3BFVA 3ZBPA 5A3JA 2INGX 4QYMA 3SEAA 3L5OA 5IPFA 3GUUA 3OUZA 3SZUA 1JYFA 1EP9A 2Q9BA 1PGQA 1Z36A 1F2UB 1BX1A 2NYAA 2XCIA 4FHEA 3ZV3A 1EFHA 3ZWPA 3G5MA 3GGCA 3ZG6A 5EJ6A 1CQJA 1SFRA 1SKQA 1XVAA 2JIQA 2NYVA 3T52A 1E2EA 1TEXA 4WJZA 2YV2A 4MB6A 5BOSA 2X15A 1PBNA 3AF4A 5FPYA 3G79A 5DX1A 4Y9DA 1T2DA 1I2AA 2VXCA 3NYQA 3RSQA 3IOEA 4ES6A 3GRVA 3GEHA 3ZEIA 2I78A 2PX6A 2RI1A 2WU8A 1S8NA 3SF0A 4HSEA 1A9XA 5J59A 1U2SA 1ABFA 1V71A 5EMNA 5DHAA 2FW8A 3HY4A 3M3PA 5K05A 3ESZA 3WKDA 1A9TA 4ENRA 1D4OA 1E4VA 2FQWA 3O3MB 4A4DA 5JHHB 4KN9S 4O8ZA 4UOZA 4ZCIA 1P45A 3SF8A 1GT91 3Q6NA 4D3XA 3GVXA 3AHIA 4X1YA 5HKAA 1FX1A 4PEVA 1FQJA 1ZK3A 2AN5A 1JBEA 1RPJA 2GLTA 2DJ5A 4NEHB 5ALYA 4UVDA 3AM3A 4C7JA 4D8XA 1RYMA 3MD0A 3UBTA 3NU1A 1N3YA 1KYTA 2WHYA 4LXXA 5SY6A 4IHAA 1BYIA 3L01A 1CDZA 3PFIA 3WQQA 1O4VA 4GWGA 5FBKA 5B12A 2FF5A 5CITA 2GCEA 3PRJA 4QAQA 1DHTA 1ODTC 3WLNA 2L18A 4Z7JA 2C95A 1E3WB 1SQ6A 1SUFA 5ALUA 2CFCA 2RGRA 2QYSA 1KOFA 4E13A 3OP1A 3UAXA 1X8LA 4EF6A 4JUFA 1E3EA 1NJ6A 4HB3A 5TQVA 4F1WA 5JMPA 1DS6A 2C2WA 2K2QB 3L0CA 3DW3X 3BEDA 2ZRKA 3QEOA 4UOEA 4L4ZA 4MGIR 4X1KB 4TZ6A 3CTPA 1EVQA 2WMDA 4O0LA 2GXAA 3SG0A 3AVUA 4MDHA 1N0WA 4NMXB 4YRTA 4CF7A 5EZ6B 3A04A 4DRZA 4D41A 5F98A 3F6BX 4IY1A 3A6ZA 1Z7BA 1XCOA 4HDRA 2O8FB 2CF6A 3ROFA 2J9YB 5ECWA 4GPD1 5F1KA 4YLEA 3FPAA 5DBHX 1E2BA 5KX5A 4ZT3A 4FJ1A 5HXAA 5DYIA 4V2UA 3ZIAD 5K0TA 2P6OA 4W5OA 1FBTA 1ZVQA 4R68A 5JEDA 3ZDAA 3OQJA 1ZJ4A 5K3OA 1JBQA 4KODA 3THOA 3P9QA 1VHTA 4A6EA 3CPSA 4I4NA 4ND3A 5DGTA 3C1AA 4P34A 2WZBA 1K9SA 2Q5CA 2PMDA 1NXOA 3L8GA 2P6MA 4LXIA 1HLDA 3RS3A 1WABA 3M5WA 5A5DA 2JLWA 5DK4A 1P3JA 2ZT8A 4N8EA 5EP2A 5IRCD 4W5QA 1CUYA 3FTCA 3PF9A 2NVUB 3VH2A 3RR2A 2M98A 2CNOA 2XNDA 1WULS 1QFXA 4K81B 4BASA 2H3HA 4YAJA 1UJ2A 5KQMA 5JLAA 1ZH2A 1V9SA 3ANSA 1CUEA 4E2ZA 5LMUB 3L4BA 3DOIA 3KLBA 1GCOA 1E79A 1AF7A 1G5HA 1UBMS 2HBYA 4YA6A 4FDLA 4RTMA 1P3Y1 5KVVA 1DWOA 1K3UB 2YXBA 3LVQE 5K4HA 2ZAMA 1U1GA 2VHEA 2WTXA 2ID9A 1HZZA 1NZJA 2OFPA 4MQEA 3KOYA 3IT2A 5K3AA 4C6TA 8OHMA 1TYDE 1ZMTA 5KTMA 1XJ5A 3FNFA 3VNRA 1KWGA 1VLVA 1ZMRA 3OO1A 1Y6JA 5BN5B 1PSDA 2Z5VA 2ZGVA 3PQCA 4YRRA 1ST2A 2RHLA 3FPSA 3H87A 4REQA 3H8VA 4NFYA 4XUCA 4R81A 3Q7IA 3VNSA 1NE2A 3GLGE 3RCBA 2F1HA 4DCPA 4EJSB 5EJ4A 1Y6FA 4QEDA 1LBHA 1P4RA 2J3QA 2XA9A 4K7JA 2IEBA 1U8EA 1V8PA 2O2ZA 2QX9A 2Y1CA 3ZGVA 1VKOA 2FG5A 4EMTA 3JS5A 5TLSA 4B3SB 3W8NA 3EQ2A 1LTKA 4RMHA 3T1TA 3IMKA 5GVRA 1LVUA 1QTIA 2HA5A 4K9PA 5DTRA 3RS8A 4N7BA 5IBCA 1FNDA 3FZGA 2REBA 2DBVO 4QM7A 2P9EA 1M1NB 3TNJA 3GLUA 2O8EA 1A8HA 1JHRA 2Z5FA 1C7FA 1M1YB 4KQWA 4W5WA 3I0MA 4BN5A 3A1DA 3UJ8A 3LQYA 4II7A 1MHPA 3KPVA 3ZH9B 3CPJB 5LVAA 3VZRA 2YMMA 3NHMA 5AM1A 1SPBS 5D5HA 3OFNA 1RM0A 3KQYA 4KSBA 4M6WB 4WY2A 3UANA 2BFMA 3O91A 1WMFA 4OQEA 3LQ2A 4IXNA 1C9EA 4S12A 4NOMA 1A9OA 2P91A 1VRWA 1U3VA 3MW8A 3QLTA 2Q5HA 3OPVA 2D0PB 3DBLB 1JLRA 1T1SA 4KO4S 2A58A 3MTEA 2GPAA 1SIOA 3L9XA 3S99A 1YJ8A 3AFNA 3QYFA 1H23A 3B6JA 2I2CA 2V55B 2C4WA 4G8JA 4ZAGA 2GTIA 3HVIA 3NEYA 3TZEA 4YTEA 4P0PB 1ZD8A 1BD3A 1C41A 2ZIUB 5I9IA 3B2EA 3BWBA 1T4DA 2I6QA 2YWBA 3RC9A 4EY3A 3L6BA 4QGSA 1Y7IA 2ODEA 3EMBA 3KJEA 3UUEA 1AZTA 3FSJX 2BGRA 3BSWA 2QM8A 3A28A 2VPPA 3ER8A 2CY0A 1LQ2A 4TPKA 5LQUA 1GCGA 1Z6XA 3C8UA 1A8PA 3P0RA 1EVJA 4BYGA 1VXRA 1X7ZA 4QVIA 4PSCA 1IVNA 5JNRA 4QU0A 4KV9A 4FOOA 3T0IA 2PVSA 4IX9A 1LBIA 3ZXIA 1G8GA 4BVGA 2EKBA 4QGGA 1A71A 1MOZA 4UJ5A 1V5EA 2XUDA 4IP0A 5C34B 4CMHA 2FB9A 5IU6A 5EC8A 3FOWA 3AIIA 5JSZB 1ZAKA 2EBHX 2PO5A 4XDZA 4YHBA 2GB4A 4JYPA 1DLJA 1N25A 1W2GA 3DC2A 4V02A 5HRUA 2EBWA 4MKHA 1CS0B 1N2CA 3LVBA 4CUJA 5JDIC 1FB5A 5FI1B 3Q9LA 5BR8B 5BUSA 4PM4A 2JW5A 3DCIA 3TD9A 1U9IA 4TMWA 3OE4A 4X8OA 4CM4B 1T0IA 3PKZA 1AGRA 4DWJA 4KP7A 3CO5A 4HLUC 4JKOA 1DJOA 1LF0A 1M1UA 3G2QA 1SK9A 1T10A 3K09C 3R9KA 4I3GA 1HL3A 1NQAO 4FEEA 1VMEA 4V0RA 5EY5B 1K8RA 1SOWA 3T5BA 1BJRE 5KWVA 4C29A 3L7KA 1UUFA 1C0EA 2GJ9A 3LA8A 1RI3A 2HCRA 5GJVC 2NO7A 5L7WA 4L6IA 1LU9A 3AW8A 3F2IA 3TL6A 4D0GA 1VHDA 4UBOA 1G8HA 2Q3BA 4DEXA 3HR7A 4KH0A 2JCXA 2PEYA 4TQ9A 5JARA 2HK9A 1XZNA 1F0YA 2IOQA 5MFPA 1AMUA 2NTVA 2D1SA 3I3SR 1V3QE 1GNTA 3FYUB 3RVDA 2DFPA 4U63A 4YP5A 4OB6A 2H4WA 2P9YA 4Q0MA 3WIDA 4AICA 1T2NA 3FDZA 2XUHA 2TMKA 5BSUA 4C7XA 4DEVA 1F0KA 2XMBA 1U2EA 4L0QA 3ZHOA 1DQZA 3D7LA 3ZWMA 1OI7A 1TJ4A 4D57A 2V9ZA 1NFQA 2A0WA 1JUDA 1BVUA 4XCVA 4DCMA 1EGHA 1V4NA 1W1UA 3UEOA 1TNDA 5IX8A 3VVMA 5A0VA 2OBNA 3C4JA 3UW1A 3AB7A 4RLHA 5T8KA 1Y7TA 3CCCA 2OFOA 5TE9A 1D0IA 1YCGA 3V8MA 5L3SA 3LT5A 5EQDA 1PFVA 2WKWA 1G7RA 1WDMA 5AI9A 2IUYA 3W5JA 3G8AA 1NP7A 3L02A 1JQDA 3NBQA 3RYIB 5LL6P 2HTEA 1ZGHA 3IUSA 1GTJ1 5AUQA 3AQ4A 2C92A 3QXJA 5DM70 2PLWA 5BXQC 1D8TA 4X7RA 3PE3A 3E18A 2G40A 4LJYA 3F6SA 1MAUA 3QIVA 4L75A 3AG6A 3PRHA 4QUJA 4TV9F 1RI5A 2AWOA 4ZZIA 4J90A 3AUKA 1VCOA 4BU1A 3IALA 1QWSA 4IVNA 5JADA 5AVXA 1CDDA 1JB9A 4MPRA 1Z6ZA 3VOAA 3AM5A 3EDOA 4M0PA 5K3DA 2IZ6A 3TZBA 1ZGCA 2J33A 3A2MA 4BX9A 3RBXA 4BLTA 1YOVA 4X41A 2A0KA 4HYTA 3LXRA 2ODTX 4ND8A 1T1IA 2GHQA 4WADA 1GTRA 4UXIA 4EUSA 2BFEA 4HTFA 1XL0A 2NQ2C 2ZJZA 3L4BC 2G9RA 4TTRA 5B7GA 1GA4A 2Z58A 4JLNA 3SJBA 5EIBC 1NY6A 2JGIA 3AL2A 1BXGA 1DAOA 1WKBA 2MSCB 4J16C 4P4TA 1WU8A 3KR2A 4F7WA 5IJ9B 2HFKA 3LTEA 3LGSA 1Q0SA 3B8EA 3CEHA 1P5HA 1F9EA 2C84A 2J6IA 1HO3A 3DP7A 3LD9A 4G36A 4N12A 3UOGA 3W2IA 1G3RA 4Y6LA 1JHZA 4P3NA 3WLFA 2GYUA 2VWHA 3CN9A 3EGEA 2WWFA 3GU3A 4K28A 3TLMA 4DV1B 1KYYA 1OXTA 2JAHA 1XTZA 4L9RA 1RAHA 4RTNA 1EFTA 1P9OA 4G97A 1E2MA 3DBLA 4CU5A 4PLVA 1ZH4A 2F43A 4JXKA 3TXYA 3N07A 3E3OA 4I55A 4GQAA 3O6VA 1PNTA 2QD1A 1GP2A 2ZJ7A 3NPMA 3R5HA 4OOFA 4QXQA 1H6CA 2YVLA 2ZEJA 3PPYA 2WVJA 5C0OE 2WOJA 2X42A 1Q1EA 1BWSA 5DISB 2WM2A 1A9XB 3KQKA 1KRWA 4M1EA 3LUBA 1EHIA 1CUCA 3R3SA 4F71A 3CF4A 4NCBA 3IUNA 2NSJA 2XDQB 3OLCX 4Q4AA 3NHKA 3IV9A 1FLDA 3REOA 1VL8A 4YMGA 1O94C 4WN9B 5FBQB 2H31A 3U9TA 5EEGA 3RFFA 3VPGA 2VZLA 4J1SA 3DEZA 2HXSA 4H7FA 1FP6A 3FETA 3O8QA 4JN6B 1P77A 4J6FA 5EXDA 3K30A 3T1VA 1NNSA 1LZLA 2EP5A 1GAXA 2H1LA 5JAZA 2ZUEA 4GXTA 4ND4A 1R10A 4NIMA 3ROQA 1OXUA 2FP3A 4X45A 4Y3UA 4B4KA 5C81A 4NF2A 1R66A 3PKIA 1T43A 4IDAA 4PRYA 4FQ8A 2IY9A 1ISSA 2P2CA 3BD8A 5CEFA 6ABPA 3Q1KA 1JLLB 3DTNA 3FTFA 1I80A 1O2DA 4UASA 2VYFA 3H18A 1TTTA 4JP8A 1SRQA 4HDNB 4U9IS 1LJLA 3SYMA 3LRPA 3WMGA 2C1ZA 4F4HA 4EG6A 4PQFA 2UXCB 1L6RA 2WWGA 3DMHA 5JAIA 1QK4A 2WSMA 4H7JA 3SFVA 3ENKA 2P41A 4BQPA 4BTEA 5I7HA 1KJJA 1EK6A 2R8XA 3U4HA 5ITSA 1M34B 1I3LA 3U16A 3G9QA 3THYB 1TF2A 5AJTA 4ZKDA 4JL5A 3F98A 1JEAA 3KJNA 2WWWA 3DW1X 3JX9A 3PGVA 1N4AA 4WBNA 5I8WA 5IVPA 1IZ8A 2QTRA 3KUXA 1ZW1A 2ZSKA 5C7IO 1EP2B 2F1JA 1Z3CA 3ZY5A 4BNWA 4TTSA 2YYZA 1AKEA 3CURA 5KYXB 4KR9A 3IUMA 4CHTA 4EGQA 2FPWA 2ZUWA 1VE6A 3R3YA 5E8RA 5IBRA 4DNFA 2RKBA 2X7HA 2V8BA 2IHUA 4D3FA 2R1TB 1V47A 1RRPA 1FTSA 1W0KA 2LXNA 3AFIA 3NJ8A 3O92A 3UNXA 4EJSC 3T1YB 1ZK0A 2HHJA 5FV4A 2JLUA 4AY6A 2HU5A 3IP1A 3SDBA 3LT0A 3K1JA 2C5GA 3JQBA 3PFGA 5ARCA 1EE2A 4XSVA 2VJDA 1SOUA 4WKGA 5CW1A 3ZE0B 3ZW9A 4AROA 4MHSA 2VDQB 3HA3A 5DV9A 5KNBA 2VQFB 1XMIA 1FU8A 4KPEC 2QTWB 1N92A 1BH2A 4LF8B 4TTAA 2EQBA 3P45A 2HEIA 4BIMA 1M5RA 5DHTA 4O08A 2COKA 2I3DA 4CF4A 3SSAA 1GHTA 3Q7EA 2C4KA 3ML1A 5DWDA 2H1VA 3V00A 4BP8A 4WXMA 4E5VA 1B3RA 1E1QD 5AMXA 3RTAA 1XTTA 1S0UA 3F9IA 1JJFA 3K5PA 1HF3A 3BX1A 2VCHA 3AT1A 1WMBA 2AC2A 5DCUA 4C43A 3AHDA 4XJSA 3VGPA 2Z2JA 1I32A 2FFQA 5K8JB 1E1RA 2I6TA 2X3FA 3HEMA 1W52X 4XOIA 1Z26A 3RHFA 2Y0EA 3BFPA 3LDGA 4INAA 4XWTA 3HSSA 2RGCA 2H0RA 1SHZA 1EWQA 1IN8A 4NZZA 3HEBA 4TRRA 2WSYB 2B25A 2R8YA 2FRXA 2X9NA 2A78A 2OR3A 4YI5A 3HBMA 4EG7A 4WI1A 3KCQA 2OSVA 1QFZA 4R6WA 5JE8A 5AH0A 3QVVA 4N5HX 1Q95A 2D1YA 1Q16A 4P92A 1NR1A 3CEMA 4L4YA 3SC3A 3UB4A 9MHTA 3UUFA 2WU0A 3MN1A 1MC8A 4GRAA 2CLDX 1UEIA 1VBKA 2UZAA 3QWHA 1BE6A 5AW8A 3RLIA 4EO4A 2C2YA 4P32A 3UJBA 3WWCA 4AJIA 1PR2A 5TF0A 1R9JA 2BEWB 2QJFA 1NI4A 4IHJB 4AVYA 5KTRA 4IIJA 1I10A 2WQ7A 1WWKA 3BIXA 3KJIA 4J29A 4GAEA 3EIFA 3WLEA 4JUIA 1W5FA 4F96A 5CNIA 2AE2A 1PWYE 2GOYA 4AYTA 2UXDB 1ORDA 2OXEA 1L9KA 3PC4A 3NGMA 2LW7A 2YN2A 4P4LA 5BW5A 5J4YA 5FIUA 1NNLA 4E5SA 1JR3E 2VUTA 4X24A 3G89A 4ALJA 1W29A 2ZUVA 2QN3A 2VK8A 2W6NA 5AJHA 1RBMA 4QJ3A 3EXHC 2I99A 1YZHA 3GZNB 2DE0X 1GQYA 4ZVMA 3W8DA 4UTPA 4JUCA 3IBTA 2TMGA 3NONA 4QOIA 1Y8RB 5DLEA 3MGKA 1SQ5A 3AH8A 3OEHA 4D3SA 3O8RA 2RCNA 3V4SA 1B4DA 1FZTA 2H4HA 2WV9A 4M36A 2FSVC 1BVHA 1WEKA 4KRXA 4EVIA 1GZ3A 1RE1A 2G70A 5E3JA 2ACWA 3IQGX 4WMLA 5LC1A 5T6MA 1UKEA 3BT7A 4QVGA 1I0IA 1FDSA 3KQMA 1O8BA 1Z3IX 1V5FA 2YFKA 1X14A 4H3KB 3NWEA 1VMIA 1X1BA 3OZEA 4HFRA 4B8ZA 4QJ5A 4YMSA 2IRWA 1PZNA 3BAFA 4LC9A 4A1OA 4CMIB 4OXKA 4QNRA 5M29A 3SZ3A 4DIDA 3WNCA 4MWTA 2HN9A 5J5CA 2F3SA 3DAOA 2AN4A 2Z9BA 3AP2A 3WMXA 1MB9A 2H5EA 2CB9A 2H16A 5A7HA 2AL7A 2OG1A 2CHFA 1H66A 2JJ1D 3V33A 4JL8A 1V1JA 2ZYVX 1U0OC 5FA5A 1NVWQ 4G0PA 2ZI6A 1ABEA 1ENPA 1W4ZA 3NANA 4U8HA 2HMAA 1E9BA 2AR7A 3MFYA 4EKIA 4F11A 2OHGA 1T5BA 3CC8A 2ZSAA 4MO9A 3TE6A 1Z16A 1CXZA 3EISA 1PQ4A 3MT0A 4KWCA 4L78A 2O50A 3NAQA 4XUGB 3RARA 3KKOA 3PQ7A 2BELA 2HMSA 3DUWA 1I3OA 4LYEA 2FJ0A 1T3LA 2QVBA 2UYGA 3F1LA 1D7AA 4DKXA 3T5CA 5EIFA 4HDMA 2ERYA 1E7YA 5IT4A 1OV6A 1TIPA 3BIFA 1AA9A 1LC3A 1MPTA 1NBMA 2J0VA 3I3OA 1IBLB 2ZBFA 1PLJA 3HMKA 2WTEA 3F7MA 1VZ2A 4GVPA 1BMFA 1XP5A 1RU3A 4W9MC 1P29A 1GLVA 2PUBA 3DOJA 4HADA 2DU8A 2GR9A 4C5CA 2I4TA 4GZ3A 4JEMA 4EMSA 4YUYA 1FYWA 2FMTA 4DJDC 5IHPA 1TZCA 2WUDA 3KEMA 1HEIA 1P2SA 4NBNA 4NDAA 4MUAA 1HMPA 1PWHA 4NTZA 3MJHA 3V46A 3U3RA 3VZCA 2NU7A 3EW7A 1PZGA 3RYFA 3MWDB 2AK2A 2MINA 4BNUA 3RYIA 3Q87B 4D4IA 1Z8HA 3ORQA 5FBRB 2WBLC 4J8PA 4QOEA 1PEYA 3IMFA 1NR7A 1HRKA 4YAWA 2YICA 1I6WA 4YO7A 1HV8A 1MVOA 3A4YA 1U3TA 2ZI3A 1Z17A 1RKVA 2WAYA 5DTMA 5B57C 5DLYA 3ZBQA 3M3DA 2YNMD 3EXHA 5DHPA 1XQ6A 3GRPA 4YXWA 3FWKA 3SOZA 3ZS9A 4IMPA 2WKPA 4Q3EA 4CKZA 3U19A 1YBFA 1PCXA 4R0NA 4X90A 3SIPA 1RAAA 1G41A 2Q6TA 4L5BA 3I5YA 2C58A 1NMQA 3FHJA 4CNQA 4UUAA 2O07A 4TKZA 4ZV4A 2YQZA 3LT2A 1Q3HA 3PXBA 1ZJZA 2G1KA 1QIIA 4J0KA 4YCDA 4DCTA 4KQFA 3RVJA 1C0LA 1NV9A 1MOPA 2FPXA 3L8ZA 3RU2A 4ETIA 4EY5A 3TK1A 4DSUA 2Z3WA 1SQSA 2CLMB 2Y76A 3PHCA 4OJKA 1XVIA 1ETHA 2QZZA 4XXHA 5IUNC 3PD1A 2FSSA 4N0QA 1T1JA 4NICA 4LF7B 3FYSA 4GI2A 4BFTA 2C82A 3OFKA 2FN3A 2YJ5A 4D45A 3K2QA 1LDEA 1X1AA 5A9TA 4GM4A 1T13A 1MB4A 4E22A 2VFAA 2CE2X 1E8MA 5M34A 3DMGA 4PW0A 4BAUA 4HLDA 5KYWB 1HDRA 1BDJA 5HKKD 2D6FA 1CQZA 2G80A 3DDHA 4BV9A 4CTNA 3QPUA 3D5QA 1J8MF 3WZLA 3BGSA 2I3ZA 2PS3A 3CXRA 2BHNA 2R96A 3LCCA 4KITB 2ETXA 3TFOA 2OPHA 4OFXA 2MCFA 1H2WA 3WLAA 1I1NA 5E7MA 3V2UA 3Q3VA 2L2QA 1OGYA 5AM2A 1C7EA 1NF3A 4EL0A 5FPHA 5L8VA 4ND6A 4OU5A 1YT5A 1KVTA 1G5PA 1LNZA 4GLOA 1N32B 1LSSA 5KCMA 2HCFA 1QO0A 1TC1A 3DDNA 4RFSA 2Y1WA 4IDCA 5HPYB 4GSKA 4BNGA 5F7JA 5H1YA 1KS9A 2JAQA 2BJHA 4WN9A 3I39X 4E07A 1ZM7A 3BVPA 3NAZA 3ODPA 4LDQA 4CKBB 4DR1B 5GPBA 1UBOS 2QD4A 2JGNA 1RYZA 1FP2A 2IA5A 1MZVA 2WINI 3NOQA 1G6KA 3FMFA 3TSOA 4OFZA 5LZ9A 1J2YA 3BL6A 1R88A 2P79A 4ZVVA 2GF0A 4CV1A 3JQAB 4B7UA 1M0EA 3A11A 4JASB 1Z83A 4NBLA 2A1TR 3NLLA 2GLXA 3Q8WA 1DAHA 5LZ8A 3NC0C 4NCXA 5A2QA 1EFAA 3L7MA 4EAQA 3IPLA 5E2AA 4PGAA 2H1HA 4GI7A 3WMWA 5IANA 3C48A 2ZSIA 4I1RA 2AJ8A 4BLWA 4HRVA 4DQDA 1BOOA 1RFLA 1CNEA 2PT6A 3HDQA 3FPBA 5IAOA 3R40A 3CPHA 4MRMA 3FHCB 4Q6BA 2ZUTA 4I8DA 2BEJA 3PNYA 4U7TB 1Z56C 5HCNA 3W2FA 1BXGB 1L5ZA 2PKRA 4BE7B 1UZAA 2ZCJA 4JT2A 3ZI4A 5K0EA 3FAKA 1AXRA 1WA5A 2HIHA 1TCBA 4PC6A 3UG6A 3D8RA 3QYAA 4N0MA 2QSYA 2Q7XA 2QMZA 1OKKD 2C9CA 3WOVA 2O8EB 1M1YA 1I24A 1XTPA 2X3UA 1IXYA 4PICA 1T15A 2DFKB 4CLOA 3FTEA 1X87A 4HHEA 4PCLA 5LOVB 1RXCA 4C0QC 2FWMX 3A10A 2G4LA 1SM4A 5LQCA 1EDEA 2I6UA 3BH6A 3M82A 3FMPB 4BNHA 5LU9A 4TRMA 4FJ2A 3WJ7A 4H0FA 2C97A 4K5QA 1L8XA 2EF1A 3OF5A 4KOAA 5T4EA 2FK8A 4FK8A 1AN0A 3UKJA 2TRSB 4YS6A 5JQWA 4FFVA 3U56A 1N7IA 3PC6A 3DMPA 4MYUA 1Z5VA 4FOSA 3SC2A 3CM0A 3B13B 1WXQA 3GLHA 2VJOA 1IYZA 1NBWB 3KB8A 4OKSA 3W90A 2HOQA 5DNCA 5MHTA 1QQTA 3S81A 1Z25A 1QGZA 4MKXA 2VH2A 4AWBA 2QF7A 5FOXA 3E9RA 1OWPA 4YPOA 2YN0A 1CJCA 3RUDA 4XD2A 5A4MS 1UQTA 3Q9NA 2G9QA 4J2OA 4H7KA 3PJEA 5HCIA 1N2SA 2DQYA 3LH5A 4N3BA 2I29A 2C2MA 3GW8A 3H3JA 4AP5A 2X2PA 4JDPA 2JA1A 3L6EA 3PD0A 3S1SA 1OTYA 5HWSA 3H13A 4O4JB 3H8JA 3RHTA 1KEZA 5BMVA 1AKWA 1FBNA 4YQZA 3EEOA 3AU8A 1HMYA 4OXQA 4I3HA 5WRFA 1KJ8A 3BB4A 1LDNA 2ZJ8A 2EHDA 3SMVA 2NV6A 1ZY2A 5DWQA 4DJ5X 3RM3A 1ZRHA 4GG1A 2RJNA 1DUVG 1GPMA 3CJRA 4D5GA 5HS6A 3EG5A 4ER5A 3MMPA 3OBIA 1UXKA 1LSUA 1VGVA 2ERCA 2I3BA 2VOEA 3I76A 3OWXA 3IP5A 4K86A 4J43A 5EGNA 1AC5A 1G4UR 3MBIA 4NEGA 1DL5A 1XZQA 4YCLA 4EO9A 3DV0A 1R27A 3D6VA 3KXPA 1IUPA 4MW5A 4WZBB 1DBWA 1BEZA 1RJEA 3D1JA 1SUDA 1EFVA 3FSGD 4MSUA 1R9GA 3IH5A 4ZCQA 4RELA 3OQIB 3P4XA 4IXDA 3P9NA 1MB3A 3GH3A 3I9LA 4MEJA 2QRVA 3TIVA 5K6AC 3HR8A 2I66A 3IB3A 4FR0A 3BOSA 3D64A 4MX8A 4CV0A 1GL9B 4F3NA 1PNRA 4ZT2A 4M3NA 2A1IA 1N6NA 2Q8PA 3OHMA 1DJMA 2WJAA 1G16A 1SC6A 4MWOA 2Y3IA 4RMGA 2UZ3A 3NIGB 1ADGA 3ZZTA 2EFGA 2HLDD 4JLOA 4Y9UA 2PL9A 4R9VA 4JSTA 1FJXA 2IL1A 4JUBA 4ZPJA 2GEDA 1XPOA 4TMXA 4RD6A 3GGPA 3H5RA 4Z0TA 3RVPA 5BSRA 1YVEI 4MS3B 1ORTA 3M6FA 4BPBA 2Z2ZA 5FP0A 5LUBA 4F0JA 3BXXA 2JAOA 4L08A 3RWMB 3A1WA 4B5LA 4NZ9A 3NRJA 4ER6A 2B98A 1ZHOA 3OQOA 4O4JF 1NMEA 3SBOA 4DV3B 1FRQA 1T9GR 3EXEA 4NKRA 1NQXA 1MOSA 1P3DA 1ZONA 2GUWA 3BMQB 1X42A 1FYFA 4LGCA 3OOSA 4FKBA 4R41A 4CKYA 4DOMA 4C2TA 3BZBA 5TS3A 4JB3A 4Z4HA 2P5YA 4QC2A 1AQLA 5KTKA 4YY3B 2VAPA 2XCTB 1LK0A 5GY7A 1VCNA 3RNOA 5DOVA 2P5TB 1L7BA 4I1VA 4TXJA 4QTTB 1KSFX 4MWGA 4B6EA 1MA3A 1U28C 4ZALA 1DI0A 3ENZA 5EVJA 5FOWA 3LUDA 5A4KA 5ERYA 3EPKA 1YSCA 1QB7A 4CKWA 2BGKA 1ZI6A 1GWNA 3ADOA 3I4FA 3SVTA 1BW9B 4XVCA 4ZI3A 3F5SA 2OM6A 4Q9JA 5FAXA 3AR4A 3SN6A 2QRZA 2WE8A 5KDDA 5EJIA 4EGCB 5IVKA 1GIAA 4EYOA 2BFEB 2W98A 3BHJA 4HTFB 3PRKE 1Z2AA 1L5VA 1MVLA 1YBAA 4GBED 1KFKB 1PFUA 1U5AA 1QYDA 1AK2A 3SIRA 3QE9Y 4CVNA 1JPNA 1JAYA 3HB1A 1BDIA 5LOVA 4REOA 2C8VA 1CYEA 2XBMA 3BMNB 3K1AA 4YJFA 3V1TC 1AU9A 5LLTA 4MHTA 1XE3A 2MSLA 1LVGA 3MMZA 5K0CA 3V1NA 3HJAA 5TPWB 1AQUA 1WXDA 4YMWA 5DSTA 2B0JA 1OQAA 1IG0A 3FGOA 1CUUA 2Z56A 1RXWA 2J9FA 3QPBA 1JWBB 4KAAA 3GRAA 3LUPA 3Q2KA 5D51S 3GVCA 4BX3A 4OLBA 4YUAA 1QHHB 3GEDA 2JANA 1CHDA 3JD0A 2ZAIA 1NSTA 2VHXA 2ACEA 4BNJA 4ZZ0A 1R0LA 3L07A 5KMGB 4RZ2A 1RYFA 3LCMA 3DZHA 3JU3A 3KUKA 5BVGB 2OZKA 1TJYA 2CL5A 2D2EA 2PK3A 3LX5A 4MK4A 4AMYA 4IUCS 2O1SA 4RQBA 3VO8A 3OJLA 1VKZA 4RZSA 4DANA 1DXQA 3AOEA 1J4AA 4IIVA 4A8JB 1NNI1 5GIOE 2G9VA 3UXHA 4M8LA 3KWMA 4KJZA 5DVZA 5FNVB 4IBOA 4EZBA 4XQCA 5D7BA 3JPYA 4YRSA 1P31A 3M49A 3B78A 4OPMA 1ZJWA 4QDUA 3H9UA 3BSSA 1UWLA 2EGGA 1YIAA 2YHUA 4A6XA 1KFCB 4L22A 2HPZA 5JNTA 1KVSA 2AR0A 3BD6A 4BMZA 2WR8A 3GFRA 1QV9A 2R9VA 1SUPA 3WP1B 4IQ8A 4CGZA 4MQ5A 3D0OA 1XMPA 3EVTA 4QJ4A 4EI8A 2BDE