1PS0A

Crystal structure of the nadp(h)-dependent cinnamyl alcohol dehydrogenase from saccharomyces cerevisiae
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
360
structure length
360
Chain Sequence
b'MSYPEKFEGIAIQSHEDWKNPKKTKYDPKPFYDHDIDIKIEACGVCGSDIHCAAGHWGNMKMPLVVGHEIVGKVVKLGPKSNSGLKVGQRVGVGAQVFSCLECDRCKNDNEPYCTKFVTTYSQPYEDGYVSQGGYANYVRVHEHFVVPIPENIPSHLAAPLLCGGLTVYSPLVRNGCGPGKKVGIVGLGGIGSMGTLISKAMGAETYVISRSSRKREDAMKMGADHYIATLEEGDWGEKYFDTFDLIVVCASSLTDIDFNIMPKAMKVGGRIVSISIPEQHEMLSLKPYGLKAVSISYSALGSIKELNQLLKLVSEKDIKIWVETLPVGEAGVHEAFERMEKGDVRYRFTLVGYDKEFSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical zinc-type alcohol dehydrogenase-like protein in
molecule tags Oxidoreductase
source organism Saccharomyces cerevisiae
publication title Apo and Holo Structures of an NADP(H)-dependent Cinnamyl Alcohol Dehydrogenase from Saccharomyces cerevisiae
pubmed doi rcsb
total genus 100
structure length 360
sequence length 360
ec nomenclature ec 1.1.1.2: Alcohol dehydrogenase (NADP(+)).
pdb deposition date 2003-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ps0A02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1ps0A01
1U7TA 2HLPA 4GWKA 3ZN2A 3WS7A 4CQMA 1XU7A 4QECA 5COQA 1OMOA 5CEJA 1IL0A 1PL6A 1E5QA 1WP4A 2D59A 3LT2A 5TF4A 4CL8A 3ZWBA 4DYDA 3HDHA 5KTKA 4C7JA 3NX4A 2HUNA 1DHRA 3CE6A 4G65A 4GVLA 3INRA 1V0JA 1NPYA 3GAZA 5ILGA 5AQ1A 2G1UA 5JAIA 4KTTE 1TVEA 4KUGA 1UDBA 2UYYA 2NU9A 1P9LA 3NAQA 3OH8A 1KC3A 1ZXLA 4OSOA 3GAFA 3MWEB 4U6SA 5IDYA 1O8CA 1E6UA 4WE3A 1GYPA 4WCFC 1P1FA 3VPGA 3GHYA 4MKRA 1LLDA 4IZHA 1EZ4A 1J49A 5I7FA 1RPNA 1ZSYA 3PI7A 2IXAA 2RBEA 2QZZA 1DPGA 5T57A 1FDWA 2HRZA 3CZRA 3HG7A 3L6DA 1MP0A 4EW6A 2EWMA 3BTSA 1XIVA 3VKVA 2Q1UA 3MEQA 5HWSA 1E1LA 4Q3DA 2FZEA 2HMUA 2GCGA 4XYGA 3LVFO 4MPDA 3T4XA 5JC8A 1D8AA 1ADGA 1ZVMA 2HMSA 3HADA 5KVVA 1Q7BA 4FFOA 4XGNA 4JP2A 1B8VA 3AU9A 1LLQA 1HRDA 2DAPA 2FSVA 5BSHA 5KNLA 4IMPA 2VUSA 3HDQA 3OICA 3VHRA 1B3RA 3TN7A 1KETA 1PQUA 3R3JA 4YAIA 3TRIA 4FIZA 3RU9A 3OQBA 1LQUA 1I3NA 2B4TO 3P19A 3OM9A 2AEMA 3E1KA 4R9SA 4B3IA 2BFPA 3UAGA 5G0UA 2P68A 3L4BA 4OXKA 1DIAA 4YQYA 4DBVO 5IDQA 2V6BA 1OOEA 2JHFA 1NP3A 1HDZA 4MVJF 3QIVA 4MKXA 4PLYA 4YEDA 2ZYDA 3RBXA 3INGA 4D3DA 2EJVA 3C24A 5H81A 3LC2O 5A04A 5K9ZA 3LC7O 4GSKA 3GDFA 3H9EO 1DXYA 3RSHA 2GF2A 2UUOA 1R0LA 2RAFA 5I7EA 1G0NA 2C7VA 2CMDA 2RH4A 3O26A 1T4DA 1TXGA 2NQ8A 4G81A 2C2YA 4FC6A 3H5NA 2CY0A 5I8WA 3GG2A 3CZMA 1P31A 4JBGA 1W0CA 3D3WB 1F06A 5JPIA 3ZW8A 3VH3A 5EIOA 4IDFA 4YR9A 4J49A 2HK9A 2J3JA 3RVDA 5F1PA 4J0EA 3WSVA 4Y9DA 3SC6A 5I9NA 2P2SA 1LDEA 1ZEMA 3LF2A 4FBGA 3TL2A 3ADOA 2X5JO 5KKCA 5A5FA 1XYGA 3C8MA 1QP8A 5A06A 4XYEA 5TX7A 4R1UA 3WJ7A 1HYGA 2D3TA 3PGXA 4OO3A 2BFMA 1Y8RA 2C54A 2JD0A 5ICSA 3PZBA 1LLUA 3ENKA 5T67A 4F6LA 5JC1A 1GY8A 3BMCA 3LLSA 2PGJA 1I10A 5TSDA 3M2TA 4NMHA 4CMJA 4NR0A 1LNQA 3RD5A 3F5QA 4XKJA 4BO7A 2I3AA 3GY0A 1CQIA 3GDOA 3OETA 1AN9A 4MVJG 3G1UA 4RF2A 3F5SA 4MIEA 1Q2XA 3GPIA 3IC5A 5JNLA 3ICCA 2VQ3A 1FXSA 4AJEA 1RM3A 2EP7A 2D8AA 4PFJA 2YUTA 4NJOA 3SJUA 4A0SA 3G1TA 4XGKA 4J4TA 4ND5A 3D0OA 2ZIZA 3K2EA 4NU6A 2ZB3A 3GVCA 5LDGA 1LSSA 2YDXA 3DZFA 3PYMA 1JN0A 1T2FA 3AUUA 3KO8A 1UXIA 2GD1O 4HY3A 4CV0A 4UUOA 5KKAA 4CMCA 4XEHA 4AFNA 4RVGA 2EW2A 2OP0A 3INTA 4OKIA 1PS9A 2X0NA 1I2CA 2Q99A 4LSWA 4ALKA 4ND2A 3QVWA 4YAEA 3WNQA 3BIOA 4CLOA 4KUHA 3BMOA 3O03A 1MUUA 3TJRA 4L74A 1NQTA 4YAKA 2ZTVA 1XCBA 4I9HA 3OJOA 3GRPA 4HV4A 3TOXA 3JQGA 3EDMA 4WGGA 4RJTA 3DQPA 3A1NA 4B4UA 3U9LA 2VUTA 3LZ6A 4EJMA 2Q1TA 3SEFA 1WMBA 2AEJA 3U0BA 3ETEA 2UV8A 2B0JA 3VVBA 2EERA 3FWZA 3NUGA 1B26A 3PWZA 3QE3A 4GI2A 4Q3NA 3V1YA 2VRBA 1CEQA 3WDSA 5CDYA 1P44A 3AI1A 1OC2A 4YRDA 1R16A 1DSSG 1CIVA 1WAMA 3H3JA 3L9XA 3JQ8A 3ZW9A 4BKUA 1GQYA 4MIYA 1PS0A 3DZJA 1YL6A 1JWBB 4R1TA 3IDSA 1XQ6A 4RQTA 3GNSA 4BGEA 2WTBA 4BUCA 2EGHA 4URFA 4E5MA 1PZGA 3BMCB 3W4JA 1HSOA 3I5MA 1C0PA 4A7PA 2FHSA 4PRKA 3ZHYA 4FS3A 2ZKLA 2CZCA 4U8GA 1DAPA 4FD3A 2OGUA 5H83A 4IS2A 3FD8A 1KS9A 3S1LA 2DBZA 4B8ZA 2OFPA 3H9QA 4HNHA 1QYWA 3D5QA 1M6WA 2OP1A 5K6AC 3DFZA 3WYCA 4BNYA 2X0JA 3OECA 4UVIA 3CINA 4BQRA 4BHTA 3VZRA 1ZMTA 1ZO8A 4DLAA 3PJDA 4CMKA 1UJMA 2R2GA 1DFIA 1DC3A 1GZ3A 4FR5A 2A9FA 1WVGA 2FRDA 2PD3A 1T26A 1ULSA 1AGNA 4OOEA 6LDHA 5L51A 1RKXA 5T8KA 1PZEA 1EE9A 1O0SA 1Y9EA 3DZHA 3G17A 4XQGA 4YAJA 5AXAA 4CUKA 4Y8VA 5BR7A 1LDMA 1BDBA 3RROA 4QFCA 1PX0A 3D4NA 1UDCA 1AXEA 3DZBA 1DIHA 1Q0HA 1E3EA 1NBOA 1UR5A 7ADHA 4IZIA 5G4KB 2ZCUA 3RIHA 4AJ1A 4R4JA 3WGTA 4E33A 4HFJA 4MKZA 1GPDG 1GQQA 5BT9A 3AM4A 3P5SA 4GGPA 2DKNA 3ITDA 4FFRA 3L9WA 1D4FA 4KUEA 3NEPX 2X0IA 4UUMA 1QYXA 4GGOA 5CP8A 1C1DA 2P4HX 2C0CA 4UEJA 3PHGA 3W6ZA 1N1GA 1YL5A 3ABIA 1XKQA 1MA0A 3GRKA 1A5ZA 5DBFA 1EVIA 4QTZA 2G5CA 1RM5A 3TFQA 2ZQZA 5G0TA 4IDGA 4Y98A 2PZMA 1U3VA 7MDHA 2VHVA 1EQ2A 1UH5A 2J8ZA 4IDDA 3GT0A 1RYEA 4MVJD 4IPTA 4IM7A 4M8SA 1E0DA 3TZCA 2OO5A 1KEPA 3BMQB 4YT8A 3ETDA 5GMOA 4BGVA 1QR6A 2JCVA 3PHJA 1JKFA 4PLHA 5F5LA 4D44A 5CG1A 1SB9A 4ILKA 3SXPA 1OI7A 2JCYA 2EEZA 5KJ6A 1KYQA 3WSWA 4Q3CA 3AOEC 3D7LA 4UREA 1PWXA 3WGGA 2W2KA 5JAMA 4I8XA 1RWBA 1LX6A 4BKRA 1F12A 2Y05A 4J1TA 4QO7A 4QSMA 1F14A 1HXHA 3JD3A 4H15A 3IKVA 4E30A 3W8EA 4BNNA 4RGBA 4XIYA 1GYRA 3L0DA 4H7PA 1DAOA 2C2XA 3OHSX 4CR7A 1U8FO 3WTBA 2NTVA 2B35A 2VZ0A 3KYCA 4BGIA 2UDPA 1NM5A 2VTEA 2CD9A 5CAEA 5EQFA 3BAZA 1JVBA 4BNFA 1EDZA 4RVUA 3F6YA 4IQ8A 3JTMA 2P9EA 1KERA 4Z9FA 3FTPA 2IEBA 3ST7A 4RVDA 2Q46A 4NJMA 4RVFA 3JYPA 2UAGA 4ZD6A 3H2SA 5ITWA 3B70A 5DNAA 2HMTA 3F46A 1EUDA 2GGSA 3CMCO 4EBFA 4MVJA 3ICPA 4R68A 5DCUA 2FWMX 3HE3A 5FF9A 3ZWVA 4E2WA 3AI3A 1FDTA 3ZV4A 4Z6KA 2ZYAA 1EVYA 1PIWA 4IDAA 4PZCA 4TZKA 3BMNB 4UUNA 4W7IA 4OKNA 4J9UE 3ORFA 1E3LA 5HRUA 2YHIB 2PKQP 1Q7CA 4TROA 3PIIA 1N8KA 3GFGA 2PKRA 2G76A 2NVUA 2HU2A 3TQHA 2X0RA 2PTGA 3GNQA 4RORA 5A9SB 2DUUA 3SBOA 5ER9A 4IUYA 3L77A 1U4SA 4AJNA 2NUAA 4O1MA 5A03A 3PWKA 3C1AA 1HF3A 3WFJA 1OFGA 9LDBA 3SX2A 4RPLA 4OQYA 2YFQA 2QQ5A 1BRMA 3L07A 2HQ1A 3E18A 4L8VA 4MJLA 5JDCC 2ZQYA 4CJXA 1J0XO 1UXHA 1NPTO 1P77A 4CM7A 2GZ2A 3VDQA 4HWKA 4GQAA 4BNHA 4YWJA 4EJ0A 1BXZA 4NJMB 4CLXA 4DMLA 2YYYA 3VH1A 3GVHA 3NKLA 8ADHA 3Q2IA 3T7EA 3W6UA 4E2XA 1UXKA 4G5HA 4BOYA 3WWZA 3HZZA 5COAA 2O2SA 3I9LA 1H6CA 1WZEA 2AW5A 1TLTA 4FSHA 1I30A 4IGFA 2CVZA 4PZDA 1VRWA 4TRRA 2D5CA 1KVUA 5IDXA 2VWGA 1E1NA 3EY4A 2XXJA 5IXSA 2WE8A 4AJIA 1HE4A 1UAGA 4FPXA 4PGFA 4DUPA 2WYWA 1Z45A 4OQZA 4WASA 4R5MA 3RBVA 1E5LA 1A7KA 2BI8A 3IQDB 3PWSA 1GD1O 2W2LD 4ZRMA 5JYDA 4J1QA 3VPHA 4K6CA 4UEOA 1C1XA 4YJFA 2Y0DA 3MJCA 3N58A 2NADA 3H5RA 3DXFA 3E9QA 3GN1A 4P4GA 4BGUA 5THKA 3U09A 4FJ1A 5BNFA 2QX7A 3U4DA 1PJ2A 2J3KA 5JY1A 4J90A 1P33A 4PLVA 1NHGA 3PJFA 4I5DA 1FMCA 1LDGA 4AG3A 4UEKA 3W4KA 4CR8A 1E7QA 3ANLA 2O3JA 3NTRA 2VHXA 4JBIA 4NBTA 2Q4EA 3U5TA 1K0UA 4HFMA 4A03A 2WD8A 1BHSA 4ESOA 4I5GA 3E9NA 2Q49A 1GEEA 3QWBA 4LVUA 4R5HA 4DWVA 1ZSNA 4CMEC 1GQ2A 3HN2A 1I0ZA 2POQX 2GR9A 1DLJA 4I5EA 5G4KA 3VH2A 2WYVA 1B14A 4TVBA 1YVEI 2PGDA 4B4OA 4R1NA 2PKQO 3IIEA 2CF5A 4ZRNA 5DZSA 3RAJA 3U4HA 4A2CA 2BFAA 4P8RA 2DFVA 4L9RA 4IDBA 4N18A 1DO8A 2DPGA 1KVTA 1ZW1A 5EN4A 3ZHZA 1PJTA 3OJ0A 2PNFA 4GMFA 3ZU5A 2C29D 1EK5A 2XF8A 3Q1LA 2R00C 4IDCA 4BMSA 4BS9A 2W90A 4A73A 3OQ6A 4L75A 2DU8A 3M2PA 1QSGA 4WEQA 1LBEA 4Z3DA 1SBYA 2DUWA 3GPDG 1WDLA 4IJWA 3DHEA 1QXSA 4KOAA 3RUDA 3H9UA 4XD2A 1I8TA 3ANMA 3K30A 1HWYA 1UXJA 1LXCA 3JQ7B 2O3QA 2Y93A 4PG5A 2YW9A 2DTEA 3E8XA 2J6IA 5EMHA 2GZ3A 2AEFA 3ENNA 3JD1A 1V3TA 1MFZA 5L7YA 2BELA 2BFOA 5AXCA 4XWYA 1DHTA 1ZNQO 2HDHA 3PIDA 2X9NA 4OSPA 3BMQA 1NQOA 3U49A 5U4QA 1R0SA 2C59A 2OHXA 4IJKA 3WX0A 3U3XA 3LF1A 4Q3AA 1PQWA 2JD2A 3I9MA 5DBGA 2GN8A 2A4KA 3DOJA 4I1IA 4CPDA 3WNVA 1HT0A 5JAQA 1GDHA 3CIFA 3MZ0A 2Q1WA 4NK5A 5FI3A 5L4NA 4WNIA 1XDWA 4BNIA 1ZK0A 1HLPA 2PY6A 1BVRA 5DDIP 5KJFA 5IN4A 3C3XA 4RPGA 5B4TA 3VAZA 1H9BA 4NZ9A 5EQDA 3ZU2A 1R4MA 4WLOA 1DBVO 1EFLA 3O4RA 1T2CA 3DL2A 2NVWA 2WM3A 2Y66A 3RUAA 5JMWA 3ROQA 5C7IO 3D1LA 3ZWMA 4CQLA 4GLOA 4IDEA 1AUPA 2IE0A 1WZIA 1FDSA 4Q9NA 4BO0A 4II2A 3SVTA 1BVUA 3F1LA 1A27A 1QLJA 1XWFA 1DB3A 1QV7A 4Q3EA 2X22A 3AOEA 2EIHA 4BNVA 4AJHA 5I7VA 2Y1CA 2VTDA 1Q1NA 1GTMA 4PZEA 4KP7A 2HO5A 5GY7A 4M87A 1DDOA 2EJWA 3DAFA 1NAIA 5KVSA 4CMAA 5KIAA 2P91A 3OF2A 3PK0A 1V9LA 3ONDA 4BO4A 4YRBA 1Z7EA 3H7AA 3LT1A 4RV9A 1HTBA 1IB6A 2QRKA 4PG4A 5F3RA 2VN8A 3DBLB 4JXKA 3X2FA 4DPKA 2X6TA 4JGBA 2BI7A 1B3BA 3S55A 4ZN6A 4L4XA 2FOIA 2C5AA 3AUSA 5G0WA 2Y0CA 3ZHBA 4DYVA 5A9TA 3E03A 4FB5A 3TPCA 2DQ4A 1A9YA 3JD4A 3KLMX 1T4BA 4IQGA 2I6TA 2IODA 4FN4A 2X5KO 4NU5A 2DBRA 3RFVA 2YDYA 3DR3A 4NDNE 4NPCA 3WTCA 3OIDA 4CM1A 4D0RA 1HETA 2NU6A 1YDWA 4PLZA 4IMRA 3TSCA 4TRMA 3OFSA 4ZJUA 3LDHA 1PR3A 2FR0A 2CDBA 3JD0A 1IY8A 1GFSA 4YYZA 4O6VA 4TQGA 1MC4A 3H9JA 5IZ4A 1C0LA 1LSUA 4CMIA 3A28A 6ADHA 3LT0A 4K26A 4U7WA 3KYCB 3GMDA 1ISHA 4R41A 4PLPA 2G0TA 3N7UA 2C5EA 4CLRA 2CUKA 4CUJA 2QG4A 3WIEA 3HSKA 5K6AA 5L4LA 4TKMA 3F9IA 3QRWA 5JDIC 3EVTA 1GUZA 3DZGA 3GNTA 4WCFB 1PJSA 3ZV6A 4NFSA 1K6IA 2FP4A 2J5RA 1YQGA 2P9CA 3VZSA 1JWAB 4Z0PA 3WR5A 4D3FA 4PLTA 1FK8A 3PFFA 4WK6A 1E7WA 3ZV5A 2V6FA 1Y7TA 1ADFA 1BSVA 3AFMA 5IZCA 4ITUA 3D4PA 3LYLA 1IOLA 5TQVA 1UAYA 2BGKA 4BNGA 2DLDA 2X8LA 5TC4A 3WJAA 1XGKA 3OEYA 2GERA 2VCYA 2X5OA 4U0KA 2NU8A 3QJ5A 5JFOA 2C20A 3C85A 1OAAA 3T4EA 4DC1A 4OMUA 1QMGA 1WNTA 3OJLA 3JQCA 4E12A 4YTEA 3KBOA 4FFNA 4J6FA 3PGJA 4JN6B 3ROKA 1VL6A 1P1HA 2NTJA 1HDRA 3QP9A 4KDFA 1LSOA 5HTOA 3PYLA 1W8DA 1Y1PA 1JU9A 1YONA 1LTHR 3DO5A 3JQBA 1IZ9A 4L76A 3DFUA 4O0LA 3SC4A 3U62A 3PHHA 4CODB 4E13A 1D7OA 4YJHB 1ZK1A 1CWUA 4LSMA 5CDTA 3GA0A 3GH3A 4NI5A 3WIDA 3GUYA 2YHIA 4ALIA 3HJAA 3VDRA 5BSFA 5EINA 3U4IA 1BWSA 4E0BA 4EEZA 1VL8A 1V3UA 3W1VA 3STHA 4JBHA 4BKOA 5EERA 5HS4A 1JTVA 3PPIA 1EMDA 3PXXA 1N9GB 4GMGA 4KWHA 3V1TC 4Y6SA 3PQEA 1T2DA 4XQ9A 1H6BA 4CM4A 3ZWNA 1H2BA 1I33A 4BKQA 4EEXA 2I5PO 4E5KA 1I32A 2PFGA 3VPSA 3EHEA 2I99A 2EXXA 5JCXA 1E3WB 2BF7A 1KEUA 3S8MA 3FI9A 5A1TA 4RLHA 2CDCA 1O94A 1ADBA 5ENVA 2R00A 3ASVA 3AY3A 4Q3BA 1DLIA 2ZB7A 1ZJYA 2HMVA 1JDJA 1U5AA 3BHJA 3D3WA 3OMLA 1Y8QA 3KSZO 1YOVA 1DRWA 2D4AA 3JQ8B 1BXGA 2PH3A 1UP7A 1WDMA 4XX0A 1S7CA 5LC1A 1JAYA 1MG5A 4CLEA 1NVMB 4WLFA 2O3TA 3V2GA 2DBQA 2H5LA 3ZI0A 5TT1A 2CF6A 4O5OA 1DC5A 4NNJA 3P2OA 4YT2A 3DWFA 4EUFA 2AG8A 4JJIA 1H9AA 3QVXA 1NQ5A 1Z73A 2NV6A 4HFNA 3WQQA 3JQBC 1B16A 1B2LA 3UFXA 1X1TA 3GN2A 2I66A 2I3GA 3GDGA 1R4NA 1EUCA 3UICA 4GX2A 3F3SA 1QYVA 5JS6A 4DQUA 3GEDA 1GAEO 3H6KA 2RCYA 4BNTA 4JROA 5GZ3A 1BTOA 2PLAA 3UH1A 3ZNQA 4BO5A 5KCZA 3TFOA 4ZU3A 1V6AA 3I9JA 3OJEA 3IS3A 3ZDFA 4AJJA 2BHLA 1ADCA 4Y6RA 5TNXA 2Z1MA 5IXYA 4CLOB 4DRYA 1O95A 4PLWA 2H9IA 1YH3A 4DREA 1PL7A 3M6IA 4CL3A 1LRKA 4KWIA 3MJSA 1HKUA 4EYEA 3MJEA 4L4RA 1GZ4A 1PJ3A 3QQPA 2DBVO 2VZ8A 3GHHA 3RC7A 1CF2O 3HB5X 2XPCA 2HKIA 1ZKMA 3QSGA 4R16A 4DPMA 2JFHA 4E5PA 1BW9A 1LEHA 2PZLA 2V7PA 2WE7A 2X1HA 2FR8A 3FTNA 3MWDB 1P0FA 1VSUA 2YV3A 1DIBA 1Y5RA 1A71A 3PRJA 2YY7A 3I9OA 3RQSA 2W98A 3I1JA 2GPTA 4P4NA 3B1FA 4JIGA 5KJ1A 2W2LA 2F00A 4R69A 3DB2A 1LRLA 1OC4A 1DC6A 5C37A 2P5YA 4E5NA 5ENDA 3ZNNA 1YS4A 3AUAA 4XJSA 5KJEA 1MC5A 4M54A 4BNXA 1ISJA 4AVYA 1VKNA 4AJ2A 4E6PA 4DC0A 4RF3A 1JKIA 1TB4A 2ZJ1A 2B83A 4U6QA 4B4WA 2B69A 2QRLA 3L4BC 4CLHA 3I52A 4J7CA 3EUWA 1I3MA 2GN4A 2VNAA 1NHWA 3JCZA 1I3LA 1YJ8A 3RFXA 2VWPA 4OOFA 3V2HA 2BKAA 3DAPA 4OJNA 2V6GA 1D1TA 1NFQA 1F8FA 3EK2A 1I2ZA 4QUKA 3K73O 3AI2A 3GGOA 1NTOA 1P0CA 3NT4A 4BVAA 4RDIA 2QYSA 3HQ4O 1IYZA 1T1SA 3GMSA 5TGDA 3QVOA 1B8PA 3OBBA 4HXYA 1MLDA 1KBZA 1LRJA 2JD1A 3K6JA 1SPXA 3NDRA 1JA9A 2C82A 2O3RA 1VKOA 5IFLA 5KJCA 1HEUA 4KZPA 1F8GA 3S2FA 1DRVA 3DMYA 4UUPA 1PL8A 5G0VA 5A9RA 1CETA 2CFCA 4B8WA 4E21A 3HFGA 4I5FA 3JQAD 1GR0A 4CR6A 3E48A 4LRSB 1KEWA 2JFGA 3RBZA 3GVPA 1LU9A 3DAGA 3RFTA 5CG2A 3K9QO 3B1JA 1NWCA 2Q50A 2B4QA 2B4RO 4LVCA 5G2OA 3W8DA 4AJKA 2DFDA 1YJQA 2JAPA 5C3MA 1DJQA 1BDMA 1Q0LA 4AJOA 3KOUA 4WLUA 1CRWG 3NT5A 4O59O 4MDHA 2IZZA 3DBLA 4BO3A 1PU2A 2VYNA 3KSUA 3H4VA 3ZU4A 1U3UA 3VH4A 4WOJA 5F5NA 4BIIA 5DULA 2ET6A 4XB1A 4WJZA 2JHGA 4ALJA 4BNJA 2TMDA 2NSDA 3IAHA 4F6CA 1MV8A 3JQAB 1IPFA 2IRWA 3NT2A 3FBGA 3CPSA 2WSBA 1ENPA 4QEDA 2IYOA 2QW8A 4ND4A 4YVFA 1FF9A 4CUZA 4MVJH 2B36A 3PEFA 1EK6A 1M6HA 1H6AA 1N9GA 1P1KA 4IY1A 3UKOA 2BGMA 5JCJD 1FDUA 3A06A 4RVHA 3KEOA 1VLLA 2NU7A 3BYZA 4GBJA 4JP3A 2NM0A 4BV8A 2J3HA 2CNBA 4F46A 4CLDA 4BNLA 4X54A 4BNZA 1YE3A 4G2NA 2WJPA 3IP1A 1SO8A 1XSEA 4H16A 4J4HA 4B79A 4N5LA 4PVDA 4YT5A 3KVOA 4MVJE 4XJTA 5DT9A 4PG7A 2W2KB 1VJ0A 4FGSA 4XQEA 1X15A 1HSZA 4PLCA 1H2HA 1U4OA 3V8BA 4F3YA 4JX8A 1NFRA 4IXWA 1P1IA 1MGOA 3PQFA 2A94A 4RCVA 5TJHA 3H8VA 1X0VA 4NH4A 5T8KC 3RJ5A 3IKTA 4EGFA 1NNUA 4DQVA 3KLPX 3IUSA 4RDHA 3NDIA 4J7XA 4R54A 1YL7A 4BNWA 1M76A 5IZCC 4HNGA 1W73A 1DJNA 3KSDO 1LLCA 3KHUA 1U7HA 4DA9A 4Z0HO 3I23A 1K5HA 3F1KA 3ZCXA 1IULA 1NYTA 1GADO 4MOWA 3ZWYA 3SLKA 1GUFA 4AJPA 2Y1OA 1U28A 2A92A 3IL2A 4L0QA 1ZK3A 4RPJA 4QX6A 1LI4A 3QLJA 2RHRA 1PQPA 3I6IA 4PCVA 1M67A 4RQUA 5L95A 3K92A 2O48X 2W8ZA 3ZWOA 1T25A 2ZYGA 3I9KA 3CTMA 4K6FA 1XA0A 3JYLA 3MJ4A 4GWGA 1I24A 4W9NC 5CDUA 2HJSA 3DC2A 1HDOA 3GZNA 4FJ2A 4YRAA 1X7HA 5TLSA 4MINA 2WYUA 1V3VA 3DBVO 1VJTA 4MVJI 5A3JA 1H93A 1QLHA 1DFHA 1FDVA 2PD4A 3EMKA 4D41A 5ITVA 1QRRA 3L4SO 4TKLA 1Z74A 2AQKA 2I76A 3MOGA 1J5PA 4KTVE 3PLNA 5IDWA 2X4GA 3I4FA 3TNLA 3WOHA 1Q7GA 3KB6A 1LDNA 4UVGA 1VE9A 1E3WA 3HHPA 2Y68A 4FCCA 3CUKA 2WDZA 4Y6PA 4B7XA 4E3ZA 4XRRA 5HM8A 2QYTA 3N74A 3OA2A 2PH5A 3KYBA 4BKPA 5L4SA 3BTOA 3ADPA 1H0KA 4WUVA 4GVXA 3CSDA 3JQ9C 4FOSA 3R1IA 4FJ0A 2DVMA 2PA3A 3DONA 1YQDA 4NBWA 4PVCA 3WYBA 4NBRA 1C0IA 5ER6A 3LK7A 4OAQA 1U9JA 2ZB8A 2HCTA 3Q11A 3ANNA 4YJGB 3FRJA 4A10A 3TDKA 4WCDA 3RJ9A 1YRLA 5JY6A 2OMEA 4YA6A 2JKVA 2Y0EA 4U0JA 1PJLA 1LA2A 1Y81A 4PG8A 1ONNA 2EG9A 3MTJA 3Q0EA 4IQ0A 5GZ6A 1E77A 4CMHA 1E6WA 1SCUA 2GUGA 3D4OA 1GV0A 3RC1A 1O5IA 1PZHA 4GL4A 2I65A 1R12A 1EBUA 1Y6JA 1R37A 4YJDA 2IDZA 4N54A 4IIUA 1G6KA 3PDJA 4K9DA 4XR9A 1EEHA 3GGPA 3PHLA 1CYDA 4J0FA 4DQXA 4KQXA 3GZNB 2Q45A 2XXBA 3QWHA 4Q39A 4YB8A 1NR7A 4YPOA 3RUEA 5A4DA 1IHYA 5B4UA 4MIOA 1H6DA 1YOVB 2NTNA 2OUIA 4BNKA 3RUIA 1U3TA 1A72A 1D3AA 5L3ZA 4GSLA 3GUCA 2GSDA 3F47A 5MGBA 5DOVA 2X9VA 3WGQA 2VOJA 1C14A 3FSRA 2GN9A 4CMIB 3JQFA 3G0OA 3RUCA 1WMAA 1FJHA 4PRLA 1DIGA 3HUDA 4DXHA 3HNPA 2ZCVA 2AG5A 4WKGA 4OHUA 4WOKA 5EESA 2DT5A 1EDOA 1L7DA 3AM3A 3UCXA 3WGHA 4W7HA 4FGWA 1U1IA 1X13A 4ZGWA 1W6UA 3AU8A 1WW8A 3NJ4A 2C07A 3UVEA 4IJUA 4S3MA 4TZTA 4TVOA 4I9NA 4L4SA 1WLYA 3UHAA 4IS3A 4ZA2A 5K1SA 1KEVA 3AUTA 1DOHA 4MVJP 3LU1A 3I3OA 1HZZA 4N5MA 5TRTA 3GG9A 4INAA 2Z5LA 2JFFA 3UGKA 4LMPA 3IJPA 2B37A 1BGVA 5A9SA 1T2EA 3DZKA 3KEQA 3O9ZA 1B8UA 5JE8A 2NVUB 1PGPA 2J5KA 3ONEA 5JCJA 1R6DA 1ARZA 3AOGA 3E82A 2O23A 3F4BA 3VTFA 4BNUA 4BO8A 4DMMA 4F45A 3C7AA 3M1AA 3ROPA 1U5CA 4IINA 1N1EA 2ZTLA 5A5EA 3QHAA 3PZRA 3FNHA 5AXDA 2E49A 2AA3A 4WLEA 3VPXA 2P9GA 3QA9A 1R0KA 5BSGA 4P38A 1X7DA 1QYDA 3IUPA 1ZJZA 3EAGA 4DIBA 2YQ4A 2ZJ0A 1Z6ZA 2AHRA 3LSYA 1NX6A 4GPD1 3PLRA 3ZWAA 1HYHA 4CMGA 3TZ6A 2VNSA 4Z9YA 4BO9A 1DIRA 2NACA 1EBFA 2AE2A 3CMMA 3SLGA 4KDEA 1B0AA 4GX1A 3FR8A 3JV7A 4JCOA 3RKRA 3JYNA 2FPGA 1R4MB 3WGOA 3IMFA 1KOLA 5JBIA 5FFFA 4YJHA 1PJBA 2I67A 2EKLA 3WQSB 1AHIA 3GF4A 3DTTA 1JLLA 2Q2VA 3MTGA 2LDXA 2JCXA 2H6EA 1Y9AA 4CM9A 4FFMA 3JD2A 3ZU3A 2OBNA 2V65A 5DN9A 4BB6A 1SOWA 2Y1EA 4IGEA 1VC2A 3IP3A 3TZQA 1SAYA 1LQTA 3ZWWA 4TMFA 3A9WA 2Z95A 1LDBA 3RCBA 2J5QA 4GKBA 4DIFA 1ZUD1 4DL9A 1H5QA 3ASUA 4OXNA 5IJZA 3OIGA 3I6QA 4OM8A 1BMDA 3FN4A 3EW7A 3BZUA 4EI2A 3FF4A 1C0KA 1K3TA 1U3WA 4MVJM 3RKUA 1HDCA 2OZPA 2RHCA 5H82A 3U4CA 2DTDA 4JQCA 2O50A 1YBAA 2E4AA 4ALLA 3R3SA 3UCEA 4ND1A 4N5NA 3NGXA 1YB1A 4ZQGA 1Y8QB 4W6ZA 3EZLA 3UF0A 2GLXA 5HS6A 1O89A 4R51A 3BMOB 1SEVA 1E1MA 3BA1A 5LCXA 4CM6A 3I9NA 2BGLA 1S6YA 1HDYA 3K8ZA 3S2EA 3V2UA 4LCJA 1UZNA 4FDAA 1T1RA 4ZQFA 4NFHA 1EE2A 1K2WA 1QORA 1GL3A 3KTDA 4CM9D 1YWGO 4FFPA 4NHEA 4TRNA 4FFLA 1UZMA 5JO9A 5F21A 3ZNOA 1F17A 4R3WA 2X7HA 1ZSVA 5JSFA 1SNYA 5IF3A 1ISGA 5B37A 3BXXA 2XAAA 2OXIA 4CV1A 3LQFA 2GRAA 9LDTA 1VJ1A 4MO2A 2VYVA 4RPHA 4EUHA 4H3VA 2Y1GA 4HP8A 3WYEA 3B20A 3GLQA 3ZHXA 5BQFA 1ZCJA 1R66A 3D5TA 1SC6A 4YBZA 3RUHA 4IIVA 1PWZA 5GZ1A 5IG2A 3O38A 3TZHA 2EKPA 4D46A 1I5RA 2P4QA 4FC7A 4GAEA 5TT0A 2YZ7A 1R15A 1YB5A 1XR3A 1Z82A 3FNGA 3NDJA 2DC1A 1MB4A 1I01A 2O3SA 1L7EA 4EITA 1MG0A 2ILTA 2I9PA 1KVQA 1HE5A 3PJEA 4KMSA 4XR4A 1AXGA 2OL4A 1L1FA 5AXBA 4OL9A 3RC9A 3IJRA 3UXYA 3HDJA 3HFSA 3ZNPA 4Z9XA 5THQA 4TSKA 4XQCA 4E2ZA 3A14A 4EDFA 3F4LA 4R1SA 3UW3A 5U1PA 4IXTA 2O4CA 1LC3A 2HSDA 4NG5A 1ZBQA 1AHHA 1ISMA 2FN7A 2VWQA 3L6OO 3WG9A 4GH5A 1E7YA 1E1KA 1VPDA 4JJGA 4LK3A 3OSUA 1YO6A 1N7GA 3MCVA 3ULKA 1N7HA 2CVOA 1M2WA 3VPFA 1LDYA 4M89A 1HLDA 3H9GA 4UAGA 4LMRA 3RASA 2VT2A 2PD6A 3H5AA 2VWHA 4D79A 3ZZNA 3UUWA 3P2YA 2Q2WA 4LCEA 2TMGA 3G79A 3W4IA 3MJVA 1NPDA 3GC6A 2G82A 5ADHA 1TT5B 3OEWA 1QYCA 4DPLA 1SEPA 1GCUA 4M1QA 4LW8A 4II3A 1ML3A 4J1NA 2QIOA 4FQ8A 3LT4A 4J2HA 2VYVD 2NWQA 2E48A 1ZMOA 2IXBA 1HE3A 3HDYA 1E3IA 2C7GA 3Q9NA 4Z0TA 2GYYA 4HBGA 2BLLA 5JXWA 2A35A 3AWDA 1PGQA 2D0IA 2P5UA 5EL0A 2EF1A 4AJLA 2R6JA 4ZVVA 1VL0A 3CXRA 1GPJA 4YACA 3NRCA 1C1DB 5DCYA 3WGIA 4ALMA 2YV1A 3WGYA 4CM8A 1PEDA 3KYDA 3DTYA 3WLFA 3QWIA 4HX5A 1WPQA 3FWNA 2QRJA 3H65A 3Q6IA 4RZHA 4XYMA 3UOGA 2AMFA 1NWHA 2Z1NA 4M49A 1LSJA 1ZEJA 5BNIA 4AL4A 4KQWA 1KVSA 1EUZA 3X2EA 5DP2A 3KM0A 4JNKA 4W4TA 4UVHA 3WFIA 1U8XX 4CQMD 2X9GA 4HADA 3Q3CA 3RWBA 4J7UA 1YBMA 5JMPA 2RIRA 4OIMA 1ZFNA 3DEYX 3KYDB 3BTUA 1A9ZA 1LJ8A 3TWOA 1ZZEA 2ZB4A 1PTJA 1NVTA 3M1LA 1CJCA 1SZJG 3KV3O 5IAAA 1OZAA 4C4OA 1UDAA 1TI7A 3QW2A 4WLVA 3RUFA 4D43A 4XDYA 4E5YA 2ZTMA 4JK3A 3KXDA 2OOSA 3LC1O 1BXKA 1XELA 1NAHA 2EW8A 4HKTA 3JYOA 1IUKA 3FHLA 3IOYA 1UUFA 1DC4A 2PK3A 4CQMB 4GLLA 2H63A 5JAZA 4S1VA 3RC2A 4XYLA 4L73A 1ORRA 3WBFA 1YB4A 4LN1A 2BH9A 3I83A 4DBZA 5J23A 3DOCA 3WWYA 1XEAA 3O8QA 5L9AA 2D1YA 1ZIDA 4WCFA 4XDZA 4ZQHA 3S2GA 1NFFA 3PJGA 4BV9A 5BSEA 4J3FA 1ISFA 5KVCA 4OGWA 3VKUA 4DLBA 3GEMA 5CFZA 1XHLA 3QWFA 2PZKA 3I4CA 1PGNA 1YXMA 4I08A 1E3JA 4ZHSA 4LRTB 2GZ1A 4PG6A 1KVRA 2HK7A 4CV3A 3ETGA 2GN6A 1CQJA 3GVIA 5CPBA 2PGLA 1KIFA 2DM6A 4RF4A 5DBIA 4D45A 1YBVA 3GGGA 2CSUA 5B12A 1EFKA 3JYQA 1PS8A 2J3IA 4RO0A 3RU7A 3O8QB 1QV6A 4YQZA 2X86A 5EJ2A 4E4YA 2FPPA 4CMBA 4C7KA 5CDGA 3RI3A 2YQ5A 4J4BA 4WPGA 3JQDA 4OYRA 4RPKA 3WMXA 4YT4A 5AYVA 2HJRA 4AJ4A 1YKFA 2NVBA 3KZVA 3EC7A 4ND3A 3PYXA 4ONEA 5JDCA 1IPEA 3TOZA 1X14A 4OXYA 3A4VA 2WD7B 1YQXA 3H2ZA 5G0SA 3WBBA 4E31A 4HUJA 1N92A 2AE1A 4XCVA 4QO8A 2SCUA 3DHNA 4ALNA 1KC1A 3VZQA 4DVJA 1PJCA 2CDAA 4J2OA 3JQ6A 1O9BA 2XOXA 4RZIA 2AQ8A 3WMWA 1BG6A 1ISIA 2WMDA 4BQPA 2NLOA 3E5RA 2D2IA 2B5WA 4YDRA 1UP4A 3WXBA 4D7AA 2PZJA 4K28A 1LUAA 4BB5A 4CQLB 3GEGA 1NR1A 1PJQA 1AE1A 2WD7A 3DZIA 3K5PA 4EUEA 2OORA 3CKYA 3DBHB 3FCOA 3OP4A 5B1YA 4J91A 4R3NA 1YDEA 3PP8A 5U9CA 3TL3A 5FWNA 4AICA 1ONPA 3AY7A 3AM5A 4CM4B 4Z3KA 1GUYA 2EV9A 5TJ9A 2FR1A 2X23A 4BO1A 4J9VA 3C7CB 2DTXA 3GK3A 3BMNA 4CMEA 1V8BA 1Z75A 2VT3A 5A02A 1ENOA 4WECA 1I2BA 3DMTA 1HL3A 1A4IA 3AY6A 2V6MA 4JJFA 3C7DB 2PV7A 4EZBA 3OIFA 5I7SA 3K31A 1E92A 1M66A 4P22A 4PLGA 4WLNA 3SJ7A 3VTZA 2FMUA 3QV1A 2BMAA 1RM4A 4WNCA 4Y67A 1QKIA 3LLVA 4B3JA 1R4NB 3JQEA 4J16A 1E7RA 1TT7A 2H1SA 1UXGA 4MP3A 3VOSA 4W82A 1E3SA 3ZH2A 3WQRA 4XRGA 4B3HA 3PQDA 2IYPA 4UVEA 1JKJA 4XGIA 3G3EA 3ZV3A 4QFDA 3WGZA 5LDHA 3PFWO 3CEAA 2ZK7A 5HBRA 4CV2A 1OBFO 3QVTA 1TT5A 1O6ZA 3JQ9A 2BRUA 4MP6A 1GCOA 4RL6A 3ZWXA 4YCAA 5AVOA 1C3VA 1P45A 1QG6A 1I36A 4BMVA 3GVXA 1EVZA 2QZ9A 4A26A 3ON5A 4B4VA 3DOOA 1IHXA 2VHWA 3QVSA 3DDNA 2YHUA 4E2YA 2LDBA 4GX5A 3AW9A 4PIVA 1G0OA 1T24A 4U5QA 5ICMA 2RH8A 2YV2A 2O7SA 4ROSA 1HYEA 1IE3A 3TF5A 2D5AA 4I9UA 4QT0A 3ZWCA 1JQBA 4BMNA 2UUPA 2NQTA 1V35A 3ZGYA 3G49A 4R9RA 1HZJA 1VSVA 3C1TA 4YXFA 2Q1SA 5A3VA 1HDXA 2OBYA 3GR6A 5AOVA 5C7OO 1K89A 2VZ9A 4EJ6A 1CERA 1PGOA 4DGSA 2Q2QA 1JW9B 3QWAA 1HDGO 2GASA 1Q0QA 1VI2A 2Y1DA 1WXDA 4O63O 2O2YA 1H94A 3PHIA 3ZWPA 1E7MA 5TS3A 1GV1A 1MX3A 2VHZA 2WWRA 3B1KA 4W99A 2YFHA 1G1AA 2DPHA 4P4LA 4D42A 1P1JA 1K6JA 3AJRA 2EKQA 5L53A 1WWKA 4NBVA 2YJZA 8LDHA 3C1OA 2BD0A 1SMKA 4GKVA 4DIOA 1P74A 5ES3A 1SB8A 3BHMA 3GQVA 3MJTA 4CM8B 5T5QA 4TWRA 3JSAA 4ZQBA 5T64A 2HRBA 2Y1FA 1Y5MA 1KY5A 3VC7A 1GZ6A 1NXQA 3OJFA 4OH1A 4D3SA 3E6AA 4YAGA 4BNMA 3EVNA 2AQHA 2X58A 4IJVA 4XB2A 5JW6A 3COSA 2WEKA 4HFRA 3R0IA 5KOIA 4UVDA 3TZKA 5DCWA 3PDUA 2FY8A 1VM6A 1ID1A 1C1XB 1N5DA 2VYND 4YJFB 1J6UA 4NIMA 3VZPA 5L45A 3E5MA 2O3UA 3JQAA 3K2BA 2W4QA 1T2AA 3AFNA 5G4LA 3DHYA 1ENZA 2EGGA 3P7MA 3T7CA 3W8FA 2PWZA 4ZQEA 3ITKA 1X1EA 4ID9A 4PLFA 1P3DA 2EP5A 5F1KA 3JQ7A 5I9LA 2GNAA 3OA0A 4BL5A 3FR7A 3VVCA 3CH6A 3D64A 2IEDA 4MP8A 4QXMA 3K96A 1HE2A 2GO1A 5ILOA 3MOIA 2VUUA 2E37A 3KETA 1DFGA 2AQIA 3NTQA 1GU7A 1P1RA 2FPIA 3FBTA 3Q2KA 1ONOA 1EVJA 4CM5A 3KUXA 5BNTA 2Q3EA 3S2IA 1JVSA 1XU9A 3NTOA 3WLEA 3PVZA 5L40A 1BXGB 1ZH8A 2HMWA 4FW8A 1E7SA 1D1SA 5CDSA 4PN3A 3H3FA 2O7QA 3E9MA 3KRTA 1ENYA 2VRCD 4CLRB 1WDKA 1RYDA 5CPFA 1U2DA 4CM3A 1PZFA 2FZWA 3AK4A 1YGYA 3FNFA 3L6EA 4J1SA 3ONFA 3DBHA 5F1OA 4D0SA 5I8ZA 1DEHA 2VOEA 1MXHA 2Y67A 3DBRB 3GZ4A 2Q4BA 4M55A 4RVSA 4UULA 3EYWA 3BHIA 1RJWA 4XA8A 1IZ0A 4NK4A 4BO6A 1XG5A 2EHDA 5JDIA 1NVGA 3WB9A 4W9NA 2E82A 4JLWA 4RLSA 5EPOA 1MFPA 3NJ8A 5FYDA 4LGVA 3UCFA 4DLLA 4YJGA 3QY9A 3EZYA 1W4ZA 1TA4A 1UP6A 1B15A 1MXFA 4XIJA 5C5IA 4J43A 2NNLD 4E32A 5TIIA 1E6EA 1PSDA 5COBA 1KY4A 4RF5A 3V5NA 3Q9UA 3FNEA 3NV9A 4WEOA 5MDHA 4M86A 5L7WA 3ROMA 2IZ1A 1Z7BA 5FEUA 1K6XA 2FSSA 1DRUA 3GOHA 4B7CA 2CVQA 2ZTUA 3HB4X 1EQUA 1LC0A 5JO0A 1PGJA 3HWRA 5K0ZA 2JAHA 3V1UA 5KWEA 2HK8A 2QHXA 5CHEA 3D3EA 5L7TA 3DMTC 4TRJA 1NASA 5I9MA 5KVQA 3FPLA 4A5OA 1ULUA 2JJYA 1A7AA 5C7LO 3UN1A 4ZICA 4XYBA 1CDOA 1PJ4A 4A27A 3B6ZA 1I3KA 4BO2A 1J4AA 1F0YA 5IN5A 5JYEA 1NQAO 1X7GA 3DBRA 1Y8RB 2ZATA 1BW9B 4NQZA 5DOZA 2O4UX 1GEGA 1SOVA 1ZK4A 3JQGB 2GDZA 4B7UA 1N2SA 3JQFC 1UZLA 2B5VA 2UVDA 5JLAA 2F1KA 3NYWA 1B7GO 4NBUA 5CEFA 2HAEA 2VRCA 1A4UA 4NFYA 1M75A 5HA5A 1X0XA 1JAXA 4LISA 3EGOA 3R6DA 2IZ0A 3WICA 4N7RA 1ZK2A 5DF1A 1PR9A 1XQ1A 1XLTA 2E6UX 1GYQA 1TEHA 3GFBA 5T6BA 3BTVA 2JL1A 2VHYA 3HN7A 4K1LA 4GX0A 2PR2A 4IBOA 4DTIA 2Y99A 5B4VA 1U2GA 5DP1A 5CEEA 2G17A 3PTZA 1ZXBA 2AXQA 4R01A 4QQRA 5A05A 5FI5A 4XZ3A 3FPCA 3OQ1A 1RM0A 4FOOA 3NGLA
chains in the Genus database with same CATH superfamily
4MVWA 4MQEB 4FMCF 3H5WA 4CKWA 1H85A 3P9QA 2HGSA 4ZAVA 3ZCVA 3RIGA 4CQMA 3PPVA 1OMOA 1L5WA 3L0SA 1PL6A 1XD2B 4N3CA 1TM3E 4YRPA 5FJJA 3S7ZA 3KU1A 1S8OA 4FMDF 4GLFA 2INGX 5LUBA 3D02A 5IBPA 1VJ5A 3RVQA 1LPSA 1NUUA 4Q1VA 3DWEX 2B30A 2O14A 3WK4A 5KTKA 4UZSA 2FLWA 1I1QB 4WD3A 3WK9A 1DHRA 3OF3A 1KK1A 3NWJA 3PQ4A 4RKQA 4GVLA 2QORA 2PSDA 2E55A 5CUQA 1U9IA 1C4KA 2JGEA 4HQKA 1WVMA 3ND9A 1LWOA 5JAIA 4KTTE 1TVEA 3V48A 2BH2A 1DC7A 2EARA 3S2ZA 5BMOA 2NU9A 5DNYB 3FW1A 3NAQA 3ZJVA 4U6SA 1KC3A 1ZXLA 2RGXA 2ZBPA 2XDAA 1O8CA 4JODA 3TPZA 1MMFB 3T1OA 9ATCA 1F38A 2JF0A 4C0BA 4KGVA 1I7QB 3OZ7A 4RY8A 3V6LA 2NU7B 3ZCRA 4MKRA 4HK4A 1AU9A 1LK0A 3FKJA 3NBZC 2CXRA 1V1MA 3FTCA 2VJMB 4M0EA 4EATA 3QYFA 2FW1A 2C04A 3GIDA 4F71A 4YRQA 2C1XA 1W8IA 2RBEA 4ZAXA 4PGMA 3THYB 2QZZA 2EAUA 3HG7A 1JB9A 4EW6A 1MQSA 4B7AA 1WNFA 2W6ID 4Y9SA 2JLXA 2WFMA 4B6FA 1XD8A 5F2NA 3FX2A 2AOUB 2QUHA 3M6AA 3QU4A 3ZCQA 3IMCA 3MEQA 4KG7A 1ANKA 1PF7E 2MYPA 2PT5A 4XYGA 1U1EA 1CS0B 1C3OA 2JLSA 3HADA 5KAPA 2AK3A 1CKEA 3CQ9A 4D4KA 3MQ2A 3FFAA 5BN4A 1LLQA 1HRDA 4IG9A 3UA4A 2O9JA 2RIPA 4DCCA 1MNQA 1ECPA 3VHRA 2E2WA 4IHJF 1JJVA 3PGKA 4QOSA 1XHEA 3SOZA 3R3JA 3TRIA 3OQBA 1LQUA 3P19A 3ABZA 3JAWA 3GLSA 2OCLA 3T1QA 1FC0A 1W87A 1WULS 2D2EA 2J0EA 4C7VA 1CVLA 3PQ8A 2GBFA 2BFPA 2P3QA 4RXTA 4NATA 1TM5E 3B9QA 5IK2A 1PUXA 1YR1A 4YQYA 2JJ1D 1UBEA 1XZFA 1F4VA 1NI4B 1MEEA 1SK9A 2JHFA 3ZIAA 2Q5OA 5BV1A 1K63A 1SVLA 2J48A 2CZQA 4MVJF 1XP5A 1SCKA 1A9QA 1V96A 3FDZA 3NPAA 4MCHA 4P5PA 4YEDA 2BGGA 2W7TA 4V3CA 2RDMA 2P9YA 3ELUA 4R8SA 3QELB 5GQSA 1SXJD 4K40A 4D3DA 5HKAA 3QU5A 3C24A 3T9FA 3PV0A 1XTZA 5IH7A 3TJZA 1OZHA 2GAIA 3F6EX 4KNVA 4PXAA 1YI0A 1UBSB 4KO3S 3L7BA 5IVPA 2VSXA 1MTZA 3MGGA 2YJ3A 2EZUA 2RAFA 1GL6A 3BWBA 4TPKA 1WU8A 1RI4A 1L6IA 4JU8A 2NQ8A 4IIJA 3TJMA 1PR6A 2ZM6B 3DHVA 1OLXB 2PMFA 2GPSA 2RHTA 2C7BA 1P2VA 1P31A 1TTHA 1EZ1A 3IP9A 2W2TA 4JBGA 3R76A 4OREX 1FS5A 5LQJA 2FWJA 2OENG 4B5LA 2PUFA 3VH3A 5K01A 3UMBA 1FBTA 1GRCA 1V71A 2PLFA 2RK3A 4HTFB 1JFRA 3PQ6A 1M2FA 1XXHA 4MKIA 4RACA 4J49A 3UJPA 2HK9A 4RMNA 2VH1A 3VU9A 3VYSB 3OZRA 3W8NA 5BN4B 1JEJA 5F1PA 4ED9A 5GV7A 1PKEA 1XPOA 2I0FA 5ULLA 2OLJA 4PCAA 4HSGA 5HKKA 3OT5A 2GBLC 2W4IA 2ZRCA 4NZZA 3O1JC 1SBIA 4DRZA 4FBGA 3HJRA 1U80A 3ADOA 1V43A 5KYVA 5GTDA 1JQAA 3ORYA 1E4VA 1RQGA 1IVNA 2QSUA 4UBOA 2OECA 3MAJA 5C32A 2OFFA 3WJ7A 5C0OE 1HYGA 2D3TA 2ZRBA 2C5SA 1FDRA 1SKUA 4FEEA 5GVSA 1L4EA 4K8RB 1YBHA 4PNPA 4R8VA 2C3PA 1NONA 3B78A 4XQ0A 4U7FA 4W5JA 4ZVOA 4PQFA 3FLEA 3LM8A 5LPNA 3WKAA 2OZLA 4AECA 1I10A 3OOSA 1JDVA 4GD3Q 4DE5A 3QX7A 4NMHA 4YV7A 2P4SA 3NC4A 1LNQA 3UT5B 3SIWA 4NTZA 1Y3CE 5ENZA 4EX7A 2YXEA 1H2XA 5K4HA 1IJFA 3GDOA 3OETA 1AN9A 4RF2A 3G1UA 1NRJB 3RNOA 3PVSA 4HWGA 4ZAGA 1W29A 5KOHA 1SUPA 3C15C 3ICCA 3WRVA 1JX6A 3V97A 1E1RD 1N8NA 2DFTA 2D8AA 5JXGA 5L6MB 2YUTA 2IHTA 5JD4A 2PMEA 3PDIA 4ESVA 4J0QA 1YB6A 3G1TA 3F3MA 1AGYA 3OOWA 3F3YA 5B1HA 2FZCA 1N34B 5FAXA 3HA7A 4RTQA 4KR0A 3IX7A 5KNCH 4FXOA 3D0OA 3K2EA 3NBXX 4I1UA 3A37A 1LSSA 1JILA 1CIPA 1USKA 2YDXA 4XWWA 1T2FA 2O57A 4BEBA 5ALRA 1UXIA 5CYGA 1SULA 3IT1A 4OLJA 2D1QA 4YIKA 3GQBA 4AFNA 4RVGA 5FBKA 3UBMA 1VLMA 3OG9A 3WL3A 2BYTA 4DSTA 3RSZA 1CT9A 1TNDA 4GPIB 5AK3A 4M8LA 1XCGB 4QD3A 2GK6A 2FUG6 1G9XA 3O4VA 4L8WB 4BN4A 5DTQA 5A6SA 3K9CA 2RKWA 4YAEA 5EKXA 2H2HA 1FCJA 4KUHA 1KRWA 2PH1A 3BFXA 5IKOA 2FRVA 1XALA 1NI3A 2I34A 2IA5A 1NQTA 3K9GA 3A6FA 3H5LA 5K0NA 4YAKA 5F73A 2BW0A 3GT3A 3GRPA 2A9RA 3N0TA 1SBQA 3BQNB 3MT8A 2ST1A 4JX9A 6CHYA 4ISCA 1GARA 4DDVA 3SZGA 4B4UA 1A50B 3AERB 2R1TA 3LZ6A 4FOPA 2QM7A 4X1IA 1UT5A 2AEJA 1ZOSA 2UV8A 1GZHB 4EY6A 1OZGA 2QGFA 2EERA 1V7QA 3PWZA 4Q3NA 3QE3A 2ZJFA 4Y9UA 4HS9A 2WF8A 3V34A 4YUXA 1LBHA 5CDYA 2X8JA 2BWJA 2PFSA 4YRDA 2D1RA 2OC9A 4M76B 1WAMA 5K8IA 1A8IA 3TGLA 3KQKA 4Z51A 3ZW9A 2PIDA 3FHTA 2GSWA 3ZW7A 1GQYA 4G8DA 2ZQ5A 2IH5A 2ECOA 4PTLA 1PS0A 3IKLA 3KAQA 5CVJA 4A0HA 4YCLA 1I13A 1ORDA 1XQ6A 1J00A 4LJ6A 1CR1A 1M0TA 2YL2A 3GNSA 3R9XA 2IUUA 2WTBA 1FDIA 2VO1A 1EEXB 3IDOA 1QM5A 2C2KA 4E5MA 3W4JA 4BVGA 3D2LA 4MV0A 1XF9A 4JEUA 5I4IA 1EI9A 2XUDA 3HGQA 4L7QA 5D3QA 1HYBA 2JFXA 3Q7RA 4FS3A 2CZCA 2R8ZA 3RRJA 1UK7A 4AZTA 4U8GA 1TKAA 3TZBA 2UZ3A 5IAGA 2EATA 3H4IA 5H83A 4WZBE 4B8ZA 1BDJA 3VYTB 4BBPA 1Q1AA 1NNI1 2IXGA 5JEDA 1QYWA 1M6WA 4MQ5A 3PJRA 4O8ZA 5K0TA 2J7KA 4AJ9A 3L6CA 4BNYA 4BQRA 4MZDA 3RFFA 4I8IA 4YCSA 3LY9A 2ZPTX 5AT1A 3UMGA 3VZRA 4ER7A 2HPAA 4DLAA 3PJDA 4TMVA 2XMGA 3CLRC 3ZQ4A 2J9YB 4BCDA 1LBTA 4GOXA 1UJMA 2EF0A 2R2GA 4GKJB 1CJMA 2JLVA 3JZDA 3V7FA 1WVGA 4MPPA 1ULZA 5E3HA 4NAVA 3A1DA 3U7QB 1W5TA 3CONA 4MYUA 5CHYA 1Z18A 1JTEA 2KI5A 5T8KA 3DZHA 3G17A 3W3AD 4CUKA 1UBMS 1GT6A 1LDMA 4J0DA 4BLUA 4QFCA 1AKMA 4X1OA 5FI1B 2WJ4A 1NN5A 4W63A 3OFNA 3GWGA 4A6XA 1IY9A 5TS2A 2DY0A 3IHLA 3GLVA 3JWIA 3DE0X 5HKBA 1Q0HA 1EUYA 4QNRA 1B8OA 1KDOA 4TT3D 2ZCUA 3S5JA 4I55F 4D8WA 1CUCA 3WGTA 2QSJA 2JH9A 4NQRA 4C2TA 5EJ8A 3WKBA 1GQQA 5BT9A 3I76A 4KQKA 1GGMA 4HHEA 1LW7A 2P4UA 4PQYA 1WB5A 4RESA 4FFRA 1B1AA 4P3YA 1D4FA 5FPYA 1K88A 5DIZA 1RVDA 3VBCA 1YZYA 5B36A 2XOEA 2P4HX 2VC2B 2B3TA 3VU8A 4LF6B 4UEJA 5DTJA 3DUFB 5AICA 1N1GA 1YL5A 5CA0A 1XKQA 2O54A 1IXZA 3NHLA 2ZJ7A 3DNFA 4EJSA 3D6MA 5LQDA 3VUFA 1QNFA 3O92A 2ZUTA 1X77A 3AVPA 3DV9A 4RIEA 4D98A 4KR7A 1N3LA 2ZQZA 4B6PA 7MDHA 2V4MA 1DKOA 4IDGA 4RA9A 3U7IA 2VHVA 5EWLA 2Z2XA 1KZGB 1Y1RA 2J8ZA 2N47A 5BW4A 3GCWA 2OO5A 4TS9A 2QDKA 2J33A 2GJ8A 5AKEA 1QR6A 5F5LA 5DXFA 4D44A 5CG1A 1Y4AE 3CZ9A 4AYXA 4E6EA 2O2EA 3SXPA 3EQ6A 1QZUA 3Q0TA 4DMKA 2G28A 3VI4B 5CA1B 4YX9A 1ZVQA 1F6BA 2DWPA 1NULA 3KR2A 3AOEC 1OLUB 1X7WA 1XZNA 3D7LA 4GVPA 4HGPA 4F9GA 2BMJA 1VCOA 2O7NA 1LX6A 3LWDA 4I8XA 4MS1B 4TTAA 4UQOA 2Q4DA 3IQGX 1IHPA 3COPA 4H15A 1DQNA 2PQMA 2R4TA 1VE7A 3IKVA 3TB4A 4E30A 2HXSA 1K6EA 2BEKA 2G25A 2W6CX 4QICA 4BNNA 3Q72A 1S7GA 4H7PA 4W5WA 1DAOA 3OHSX 4FZ3A 3F49S 4X71A 4BMCA 1C3LA 3WTBA 4XWAA 1LPOA 2I8LA 1DWPA 5B7QA 3KYCA 3R74A 5AW3A 5CD9A 3P45A 3H9BA 2DETA 3D3JA 2FZLA 2VTEA 5HQJA 3VU1A 3AR2A 1AOXA 2OCIA 4IFEA 2GCPA 2PX3A 1E64A 1THZA 4IQ8A 5CFOA 2CL5A 2G36A 4Z9AA 3H0CA 3E9RA 3W90A 1G8FA 3N39C 3OQVA 2BGTA 4Y1FA 4P31A 4RVFA 3WKDA 5K3AA 4DMUB 1YULA 4XIFA 4ZD6A 3WKCA 5J58A 2C5BA 1G2OA 3B70A 1GRVA 2GGSA 2N42A 3PKZA 4MWSA 1GTVA 4EBFA 4WVLA 1TEXA 4R68A 1PWYE 1T5DX 1UDWA 4RD6A 2FWMX 4UNNA 2CMGA 4MAFA 4H77A 4YRFA 3ZDRA 3ZZMA 3ZV4A 1XNRB 2BUAA 4ACAA 3EA4A 1L1QA 2RK6A 3MWEA 3BMNB 4UUNA 3LDAA 3KUCA 4J9UE 4ZEOA 4MUAA 1EXNA 2H16A 1JFTA 1G8PA 3TQOA 3SZMA 4QYWA 3PIIA 4TROA 5EZ5A 5KS2A 2HU2A 4UOQA 1Z0ZA 2PTGA 1JWLA 2VDVE 4BPRA 1RDFA 5A0TA 3L77A 1U4SA 3KP1A 2AJCA 3RVMA 3UWSA 4ZZIA 3MSCA 3C8ZA 3N7TA 4TGLA 4GEGA 1QKJA 3C1AA 1YUNA 1T36B 3AUYA 2EL9A 1HF3A 1VLHA 3B8EA 1OFGA 3D7SA 4HZUA 4IW3B 4PONA 1U8YA 1MOQA 5CM2Z 2AKAB 3OJXA 5AJYA 3SX2A 2WP8J 3IVAA 3C39A 4XXHA 1FNNA 1MENA 1YS2X 5BQXA 4YHHB 3R3YA 1CHDA 1DDIA 2IYWA 2JBHA 3SE0A 2NO0A 2GZ2A 3BD9A 3L02A 4HWKA 4CIYA 1WDWB 1Q95A 2XNJA 3AT1A 4NJMB 4O33A 4DADA 4DMLA 5JVDF 2CW5A 2PPLA 1FFGA 3NKLA 1GKKA 3EWAA 3W6UA 4QODA 4E2XA 4YJ3A 3GRCA 3IPRA 2NX2A 4FFDA 3GPCA 3I9LA 4YBRA 2E5WA 3LY5A 3W2IA 2AW5A 3MHTA 1YI1A 2JIZA 4LC0A 1TLTA 1R8YA 2YJGA 1I30A 5LZ2A 1M0EA 4R05A 1CUYA 2XQGA 3E9DA 4PZDA 2VEOA 2ZYHA 2PR7A 3R40A 1PR2A 1VRWA 2QTTA 4U2FA 3T7AA 4B34A 4YV2A 3GJRA 5TQJA 4KYUA 2XDQA 4FR2A 2XA2A 3D2AA 4XDGA 4OX9Y 1BJTA 5JAHA 4DUPA 1RPJA 1C4XA 3N59A 3VR2A 1Z45A 4ZI7B 5BRJA 4OQZA 2IHYA 4FE3A 3AR7A 3TKLA 3AM1A 2FX5A 3RBVA 1E5LA 1ZW6A 1EFCA 1TM1E 2VJKA 1VYHA 2VPPA 3FFTA 5LXTB 4KU4A 1D7AA 2L19A 2L2QA 1WUHS 3RSGA 3U48A 4JYZA 2ZBQA 2JGFA 3A4TA 4M1YA 3RSOA 3VPHA 1NRWA 3M8KA 3GLFB 3GFFA 4LQDA 5AHRA 1U3FA 3OY2A 4BJHB 4DNQA 2Y0DA 5EHXA 2HBQA 1XLVA 5A3RA 1F51E 4FYHA 3BSWA 3R3VA 4BGUA 4LDJA 1AUQA 3F74A 2X41A 3S27A 2QX7A 4K3VA 2J3KA 2ZTHA 1X70A 2WHYA 2AFVA 1FMCA 3K0AB 5A7FA 4BLQA 2ZOSA 3OWXA 5ALPA 4CR8A 3OEED 3RRBA 2LP4Y 2A84A 2YJ4A 4MHSA 3Q2OA 3PCTA 2JJ1A 3X1YA 2BEWB 4QXOA 2XOKA 4WADA 4RTOA 4HQLA 1C7FA 1WETA 1UBKS 4ESOA 1ABEA 4U3JB 3IODA 4BXOA 3E9NA 3FZEA 1XLWA 3HXQA 3H8SA 4HEQA 4N9QA 3HL4A 1ZSNA 5EKUA 2QMZA 4Z7OB 4FYYA 3VH2A 4TVBA 3FPAA 4PN7A 3GPBA 5EWJA 1T2NA 3IIEA 2CF5A 4ZRNA 4Y2GA 1GFIA 2PT9A 3U4HA 2AZXA 4M0KA 3O94A 2DFVA 5DE3A 3T54A 4KHPB 1XDUA 3H1EA 5CR9A 1DCTA 1Z34A 3ZK7A 1PJTA 3OJ0A 1E2GA 3W0LB 4GMFA 4LZOA 1SUWA 1E1RA 1EK5A 3THYA 1VFPA 3DOFA 1RZRA 2CNOA 5JR3A 3N2KA 4ETNA 3IMEA 2XYHA 1KFEB 1ZKDA 3WXMA 2H2FA 4BS9A 5EHGA 4KACA 4L75A 3N8GA 4WEQA 3B7WA 4Z3DA 4NICA 2F4VB 1BX3A 1MAWA 3BIWA 4JI6B 3WYFA 5EE9A 3W1EA 1VCNA 5CM9C 5IVHA 4BAUA 3H9UA 3KZOA 4XD2A 5B58T 3A25A 4QAQA 5HILA 5H4HA 1R5BA 5B7GA 2GM5A 4L7VA 3JQ7B 2O3QA 3MQFA 4PG5A 2BBOA 2ISQA 2LCFA 1XRNA 3B6KA 2QJTA 1B00A 3FDIA 2CZGA 1VKRA 1V3TA 2E3JA 1KJWA 2BFOA 4UE2A 1LKZA 2A0WA 5JJ5A 4ZC1A 1KQGA 1DHTA 2QVYX 4OK3A 4Z4FA 2X9NA 2UXCB 3BMQA 1T5LA 4TL8A 4YPVA 3PLAE 5TY0A 2FMXA 2R79A 2QQGA 5J4HA 3EPJA 1F9AA 3IEPA 3CUWA 3MRXA 4JC4A 5FLKA 3ZHYA 4Z53A 4DGQA 2XDWA 1STOA 2OHXA 3OLXA 3VV3A 3WX0A 4BNZA 1ZOIA 1F0PA 1QF9A 3ACDA 2A4KA 4KAAA 4CPDA 3HXTA 2FDRA 2VKQA 3QV2A 5GIOE 3MZ0A 2LPMA 1QIIA 4NYJR 7REQB 2XHEA 4KN5A 1ZK0A 1V4NA 1HLPA 4R9VA 4EUSA 1F6DA 3ACCA 5KSWB 4YMIA 1RVV1 3ETHA 5FL3A 3EZXA 3FIJA 4RPGA 1JLRA 2UUBB 4HB2A 3L79A 2IZOA 4ZO7A 4BUJA 2WWWA 3IE2A 5TQ2B 3R9KA 3PXDA 5EQDA 1C41A 3UYKA 2Z8ZA 3C70A 3STVA 3ZU2A 1G4HA 1AV6A 1GSAA 4WDRA 1DBVO 3HJUA 2AZDA 3RVRA 5DNDA 2WM3A 3RYFB 4M2LA 4IXMA 2B4YA 4LBVA 3IVCA 1DCKA 3D1LA 3B5JA 4BWVA 2JGNA 3ZWMA 1Z2PX 4WKNA 4GLOA 1Q6ZA 3C4JA 4XD7A 2WUWE 1FDSA 4I66A 1P0MA 3JRNA 3MS7A 4FDUA 4C43A 3SVTA 1PNVA 2G04A 1JSLA 1XWFA 4HDCA 1QV7A 4JT2A 3MWYW 2X22A 1NJ5A 8ABPA 2F3QA 4BNVA 3EG5A 3P9RA 4PC6A 4EHLA 1Q1NA 1GTMA 5CDHA 4PZEA 2HWYA 5LKAA 3AF1A 4O0MA 4ZDIA 4KP7A 4RHCA 4YY3B 1NW3A 3AEYA 3LZDA 2FWAA 2J9GA 3WYGA 2YWXA 4NOKA 3KTAA 4HAXA 1NAIA 2AI1A 2XGOA 1VBMA 1NQUA 1ADJA 2I4MA 4BO4A 3PK0A 1V9LA 3ZQKA 1TIPA 5LP6A 4P83A 4DS3A 5JANA 2QL7A 1UOEA 4AP5A 4RV9A 2GYUA 3OCZA 3DE3X 4PG4A 5CM8B 4JXKA 3X2FA 2PJDA 4C4SA 1M5RA 2H54A 3S55A 5BW5A 3BDVA 1CE8A 2GN1A 3T7JA 2XGJA 1OY1A 1VDZA 4NEGA 2C00A 3BRCA 3DNPA 1LH0A 3N9IA 1D0VA 3P9SA 4P5DA 5FWYB 1QZXA 3MJFA 3VR0A 1F4PA 5H68A 3ZHBA 3P4UA 3JVEA 5A9TA 2H5IA 3ISTA 4DYVA 3EE6A 2DQ4A 3T5TA 5C5DA 4H3KB 3HMQA 4L72A 5KNDH 1EAYA 1JL3A 1RMYA 4MW2A 4GXNA 1W581 3BGDA 2CL6X 3AHFA 3OTGA 2X5KO 3KPUA 4JR1A 1Z7GA 1NVKA 2DBRA 3FCYA 3T0GA 1Z6PA 2C7RA 4FFBA 4NU8X 5CLQA 4CM1A 821PA 1HETA 4GICA 2VK8A 1DGQA 1VPEA 1YDWA 3LSTA 1NKTA 2XKBA 3BWEA 3GEEA 4TRMA 3LDHA 3HY6A 3UQZA 2IS4A 4HGOA 4OBEA 1IN8A 3JD0A 2FJPA 1IY8A 3WWPA 1GFSA 4Q21A 5LLTA 5CLFA 1WQ3A 2GM9A 3CYFA 4Y0AA 5IZ4A 3IJEB 4MQ6A 4CMIA 3FLBA 1ZD4A 6ADHA 4QREA 5FR2A 2QE7D 3SMQA 1E3MA 2WJAA 2EKBA 3QEOA 3KQOA 1CUIA 3GMDA 4H1VA 1K27A 4LNAA 2YNMA 4LI0A 2H1OA 1PT8A 2NZXA 5DGHA 1TE2A 4RH3A 3T5PA 4OX9B 3TXAA 1R27A 1XJWA 1NNEA 4CUJA 5LJLA 4KLCA 2HNBA 3HSKA 4JBLA 1JEEA 1LTKA 2QRPA 3RK0A 5JDIC 2FN9A 1QQ7A 5SY9A 1D07A 1NU8A 3KCNA 3NALA 2CNKA 3USZA 3GNTA 1LPPA 3MCUA 1PJSA 3PEEA 1XYVA 4WCFB 1NOKA 3TQCA 3V4FA 5LN1A 2J5RA 1YQGA 3VZSA 1T34A 3ECAA 4D3FA 1G5PA 2FKNA 2ZJ8A 3KKLA 4PLTA 2PG3A 4OP3A 4B33A 3FTEA 1KQOA 1E7WA 2HRQA 3KNZA 3N05A 3N6VA 4CXMA 1UDRA 1X8JA 4JKOA 2OQRA 5BSKA 4ITUA 4ZMSA 3FB4A 4B3CA 1B1CA 4EQZA 2DLDA 3KJFA 1G59A 3D59A 1IG0A 3WJAA 2OM6A 2VCYA 2OAP1 3WL6A 3DDZX 2QVCA 1ST2A 2C20A 3C85A 1ND6A 5JFOA 3FSGD 1JXOA 1OAAA 2IS6A 1NBAA 3CKKA 1QMGA 3GCZA 4OMUA 5HW0A 1WNTA 4WNAA 4E12A 1U5BB 3OZCA 2JHCA 3PGJA 4J6FA 4JN6B 3X1KA 4TTQA 5BQOA 5IX8A 3GBPA 2NTJA 2YIJA 4CKEB 4AQYB 3NTXA 2MOKA 4QLAA 4UPDA 1NURA 4WUTA 4F8EA 1QLWA 1UKBA 1KOFA 3U62A 5F9HA 2PZBA 4L5IA 3LO8A 3A3OA 4YJHB 4JYCA 1ZK1A 4LSMA 5CDTA 4GP7A 1JMKC 2GBCA 1VYVA 4P4SA 2CLDX 2CVFA 3A27A 3KYJB 4UQLA 3RYIB 3F7OA 2UYGA 2EL7A 1GA1A 1PE0A 3BJIC 3TIVA 4ALIA 3HJAA 4US0R 3ANSA 5EINA 2VUIB 2ZSIA 1OTXA 2AJLI 2QLTA 3I2HA 1F7VA 2FQ1A 4URVR 2JFWA 2V1XA 3CEJA 1QUEA 5EERA 5I47A 3OOHA 5HS4A 1TUIA 3A31A 4P9NA 2I4OA 2Y0BA 1YZKA 1Z0KA 2BP7A 2CNWD 4GMGA 4QSHA 1IU9A 1VGRA 4Q9IA 1E0KA 1PBNA 1RKVA 1JUDA 4ZI7F 2G77B 2WAXA 3C5VA 3DKKA 3ZWNA 1GFWA 3FBWA 4EEXA 5BVHB 4IIJF 5EIBD 2PFGA 4C4XA 3EHEA 2EXXA 3S5UA 6YASA 4AZ3B 2R5FA 2YICA 5EXPA 3R7LA 5KWJA 2XZTA 3QPWA 3QTLA 3TYXA 4B4KA 1A9XA 5IAJA 3AP1A 3FI9A 5KNCA 2OLKA 4FKBA 4EAAA 5ENVA 6REQA 3REFA 3TCXB 3ER6A 3AY3A 1DLIA 2Q4RA 3OM1A 4DNPA 2ZB7A 1F8XA 1ZJYA 1JDJA 1DWOA 2HMVA 4EHHA 3F5DA 2PZ8A 3CF4A 2VDMB 1X7YB 4A0FA 3FVQA 5BSRA 4BLTA 1ZUHA 2CV0A 2WM9B 3M5PA 2G63A 3A2NA 3BDIA 4XX0A 4C4ZA 3HJBA 4KRGA 2Y2VA 4RGVA 2GN2A 4CLEA 2HF9A 3CO5A 2AIRA 1SKBA 1JEQA 3PC8C 4LZZA 3A9TA 2F9MA 2BVNA 2O3TA 5FWAA 3V2GA 5J4LA 4IIGA 4POAA 2CF6A 1RMQA 5CNMA 2D4HA 3C3DA 1DC5A 3AXSA 1RFLA 2QL9A 3VV2A 2VQFB 4EUFA 4JLDA 3U4QB 3QQ5A 2WWTA 1N6IA 2AG8A 2EQ5A 2PZEA 3UW1A 2JJQA 2DH5A 3BXHA 3X0DA 3E35A 3ZIUA 4U9IS 1B2LA 1CP3A 4JLJA 4TTRA 2GKOA 3GN2A 3RTAA 3ES9A 1LJLA 3N75A 1PEYA 4G5FA 4U2KA 2I3GA 1V5GA 4M3NA 1WXFA 4LZNA 3WIUA 1EUCA 1MC1A 4LGYA 3UICA 3IMGA 4NENA 1N0UA 4RZQA 4H59A 4WOPA 3TZEA 1QYVA 5KTYA 4DQUA 4AKHA 1W4AA 3GEDA 2EHJA 1W93A 3IIKA 3H6KA 1SHZA 3BWYA 2RCYA 1XV5A 4ENWA 3ROXA 2RJ3A 4XWKA 2J41A 3QVVA 5CVDA 1GTZA 2YFYA 2YJNA 3LBYA 3MGCA 2WINI 4HDSA 3FXAA 4HN2A 4OQEA 4P3NA 1R5NA 3UH1A 1P60A 1TDJA 1V6AA 3FMGA 3I9JA 1E6LA 1VE3A 2QX6A 4MYRA 5ALWA 3SZRA 4ZK6A 1K7XB 4GT1A 4M46A 5GONB 2XWPA 1L7BA 2CFRA 1ADCA 3UT0A 4UM8B 3LLUA 1NP7A 4DRYA 2OK7A 3I2JA 4P93A 4EPXA 5EJ5A 5KQSA 1YH3A 1OXMA 2AN5A 3I32A 5FH9A 4D5EA 1PL7A 3M6IA 4CL3A 5I7HA 1AUXA 1NW7A 3H75A 3OKCA 4FBLA 1HKUA 3DVAA 3KZCA 3IQEA 1GZ4A 5G1OA 4EYEA 1PJ3A 1VRCA 2V7QD 4FTWA 2D5BA 3I28A 4JVSB 4N6OA 3OVMA 4ER6A 4EP1A 1OBHA 1UQTA 4QBIA 5EKDA 4URHA 1JQDA 3QFFA 4BPBA 1SVNA 3QSGA 4O4IF 4UMVA 1W0KA 3FGZA 1WCV1 2JFHA 3ZS8A 1BW9A 2FFBA 1XE3A 1LEHA 3W5SA 4XOUA 2CJWA 4RTMA 1VSUA 1Z4PX 1A71A 2ACWA 1UWKA 3TH5A 1GKUB 2P8JA 5JH7B 1EUQA 3N2GA 5K4AA 4R0VA 4LRWA 4P08A 4V0LA 4XWOA 1RHUA 5KJ1A 3A3NA 3IAM1 3HBNA 1RMTA 3PL1A 4KMOA 4L6IA 1LRLA 4RTNA 5C37A 3PD1A 4QYTA 4BQOA 3D1JA 5AW7A 5ENDA 1UANA 1PFWA 2IEYA 2YHBA 5DMXA 5KJEA 4A8PA 4XAQA 5AHKA 2QRHA 5FQNA 3OLVA 3QE0A 4TSRA 3RB8A 5JAOA 5J2TA 4LZWA 2AR7A 3VYRB 2XYRA 4BX0A 1S89A 4Z8YA 1J33A 4E6PA 4GI7A 2CMFA 3IMKA 1VIMA 1TB4A 4MSUA 3FOAA 4U6QA 4B4WA 3QIAA 4PO9A 1WSBA 1PJ8A 2B69A 2BKLA 2QRLA 3L4BC 5EMKA 3U2QA 1S02A 3I04M 4F8JA 2Q0XA 1YE5A 4RD4A 1E2JA 4RK1A 4UHHA 5F9FA 3OPXA 2GN4A 1NHWA 3L0BA 3V4ZA 3BF8A 1VMEA 1A95A 3AEUB 3OKFA 3JVDA 1GAWA 2C58A 1ZU4A 1MOPA 1D1TA 4IVRA 4OJNA 2NUTA 5FUMA 2NXWA 3EK2A 3RVPA 1MW9X 5GIPE 4JMPA 5EIFA 4QUKA 2JLZA 1C0EA 1NTOA 1USUA 3KTOA 2X8AA 3QVKA 3T35A 3WL5A 1FJGB 2QYSA 1BFUA 1IYZA 1T1SA 3H5OA 5CYFA 5E1OA 5E2IA 4D0LB 5TGDA 3QVOA 1B8PA 3MTDA 4HXYA 4RK4A 1VKJA 2HU8A 1DP4A 4Z86A 4Q4AB 3U0VA 3UHOA 1KRXA 1S1CA 5IABA 2IU0A 2Q9AA 3AF2A 3T95A 5IFLA 4FU0A 2QNIA 2ZR0A 1JF8A 1HEUA 3QPVA 5KJCA 5AOCA 1F8GA 1UKVY 4Z1MA 2ZROA 3ECCA 3S2FA 1N36B 4UUPA 2IYEA 3TKYA 5A9RA 3NW9A 3CVXA 2VNIA 3KPYA 1X1BA 2J7PA 3UMYA 1SVMA 1A88A 4FCTA 4JLUA 1NMYA 3E48A 3E8SA 3KDSE 3PDHA 4MUBA 2J9FA 2JFGA 3GVPA 3ONNA 1YFLA 2ZANA 1BQ4A 4HRVA 3B1JA 4LVCA 3A4MA 5K99A 4QBGB 2O8CB 3KSRA 1RXYA 1YJQA 4A9AA 4BLWA 5IK2D 2CEKA 4H6PA 2W93A 1EWRA 1R0WA 1EH5A 3OU6A 4WZZA 1BDMA 1L5OA 1T5IA 2BFNA 3KOUA 4WLUA 5K3FA 3KU4A 3ME5A 4O59O 3EJ6A 5D3KA 5AKKA 1C8KA 2VYNA 1OI4A 1Z2EA 2QR2A 2RGGA 2JK1A 2GTPA 2I7TA 2IYRA 3KSUA 1DQZA 4GECA 1FFBA 4FNOA 3K05A 5B1IA 5BN5B 3G0GA 1F20A 3M5WA 2DHRA 3DCJA 2EP8A 3RG2A 4BIIA 2ET6A 1RBZA 1QGUB 1FUKA 4Y1EA 4ALJA 2TMDA 3MB5A 2NSDA 3QKSA 3IAHA 4BECA 3NYIA 1F2UA 1ZIOA 5AESA 4KREA 1QVWA 2ODPA 3CPSA 2A1UA 2GBPA 4RCZA 1ZP6A 3SZ3A 3Q85A 1A8PA 2K2QB 3VRHA 3JARA 1RWNA 4ND4A 4R2HA 2QZJA 2XUAA 4JOQA 3A9UA 3TGPA 1E63A 2BEWA 2VQ6A 3DL0A 4W9RA 3PEFA 4JV5B 2C9YA 3KUDA 3NHPA 1P1KA 2FW0A 3UKOA 5IT5A 3K2QA 1T8RA 5EIAA 5FV4A 1FQOA 4IFIA 1SOMA 2BGMA 3V80A 3UA3A 2BCJQ 1IBRA 3Q4GA 1KHHA 5EMJA 1UPFA 3A06A 5G3YA 2CNWA 5EJ6A 5LQNA 2NU7A 1Z5UA 3BYZA 4H9GA 4BV8A 4LNUB 5C1OA 3TQSA 1ZESA 5B7PA 1I94B 2CNBA 4F38A 4H0NA 4Q16A 3V4PB 1H1LA 2HM7A 5ALLA 4JYPA 2MYUA 3UNXA 2WVJA 5JHHB 3UT6A 1AKQA 2NGRA 4CFZA 4Z7JA 1YHZA 4OI0A 2RMKA 3PX7A 2BJVA 3N8NA 4M37A 4WK0B 3DE6X 3K0SA 3SDBA 3ZDYB 2ISSD 3O3MB 4YT5A 4PVDA 3P2EA 4LGMA 1KAQA 4XJTA 2QS9A 4KYTA 2VJAA 1AMOA 2PO7A 4U7TB 1AS0A 2IY9A 2FKAA 1T15A 1QP7A 5KYKA 3CZPA 3FVVA 3O2JA 3OCXA 4K9PA 4KQMA 4PLCA 1U8CB 4XQEA 3KQYA 5CLGA 5GJVC 3H2JA 1NFRA 3JASA 5FOUA 2A94A 1FSFA 1PTKA 4R81A 2RI6A 3GJ7A 1TVMA 3K1JA 1TQ8A 3H8VA 1X0VA 5B55A 2ZUDA 3LW8A 1G7CA 5H3HA 3IKTA 3K5IA 3CRRA 4DQVA 1D0SA 4GZ3A 4BP3A 3T1VA 3NDIA 3CR7A 4Q01A 3VOAA 4LX8A 5A2GA 1B43A 3DW1X 4R54A 1H66A 1KO5A 5E38A 4CG3A 2MSDB 2HH9A 2JAXA 3KQPA 5EHZA 1Z12A 3NG1A 1M76A 5ANRB 3IBTA 2X4LA 1W73A 4NMMA 4OHPA 3KHUA 2YXNA 2ZI9A 1DQSA 3UHPA 4UBMA 1BROA 2O6LA 4Z0HO 1XMXA 3I23A 3LVBA 4BYMA 4TVSA 4OBWA 1RKUA 3TX6A 1R0BA 1QIFA 3CE9A 1GADO 1O58A 4G24A 4FW9A 4MOWA 2PNJA 3SLKA 4BQQA 3EPKA 4NCIA 4RH0A 4N48A 2Y1OA 4L0QA 1ZK3A 3TLAA 1HTWA 2I62A 1D4ZA 3H3XA 2OB2A 1NN0A 4QX6A 4HBZA 4WXMA 2RHRA 4R0NA 4RTPA 1ZAYA 1LZKA 2WHEA 1S0UA 3PQ2A 4I4TA 2OBBA 4MW0A 2GXSA 4KQIA 5L95A 3JWEA 4FGUA 2C3OA 1Y4DE 1UK8A 1CUHA 1E9FA 4F72A 1P9NA 3TIGA 3I9KA 2DXIA 3DTVD 4K6FA 1B6TA 3DNMA 1N0HA 3TW8A 4LWQA 3QU7A 1YZUA 3MJ4A 1OWLA 1GZDA 1LV8A 5D6OA 1UPCA 4MGHA 2HJSA 3DC2A 2PU5A 1ITZA 1MJHA 3GZNA 4YRAA 1M1XB 1D6MA 2ZUFA 3LBFA 2DHEA 2DHQA 2WYUA 4NY1A 2CL7X 3NATA 2XQFA 3BREA 3ZZUA 5A3JA 5LD2B 1MQ8B 1QLHA 3O0TA 4IEEA 4BZZA 5IPFA 4AB1A 2IIQA 3F6CA 3MWJA 1QJ4A 5ITVA 2W8BB 3W2EA 1Z74A 1T0HB 2I76A 3WLLA 4X64B 3CLRD 4LWOA 4KTVE 1UC5B 4NOJA 4MV8A 1I5OA 2PRIA 3HKDB 3KB6A 3HGMA 3UQYS 1DPFA 1E3WA 1XWIA 4FCCA 4D0NA 4Y6PA 2WDZA 4B7XA 5JT1A 4IQFA 4E3ZA 4WV3A 4XRRA 2JFYA 3S40A 5A3QA 1VB5A 1YU6A 3ZXSA 1E2NA 1FA9A 1E69A 1GPLA 3BTOA 5J1SB 3HKEB 4GVXA 4QL3A 4L16A 4FOSA 4GPBA 4ZVTA 3RVJA 1O95D 4FJ0A 1L5RA 3ZHSA 1UL1X 2OCYC 2QDXA 5EJ4A 2QN6A 4RKRA 2VJNA 2P7IA 3NORA 4NBWA 3TW4A 1M0WA 5KB3A 3THWA 1M2KA 3KTAB 4RIGA 3WLOA 2XECA 2YN0A 1C0IA 4V1CI 1M8KA 1SU4A 3R0JA 4MPTA 3WWOA 1U9JA 5F1YA 5FFMA 2RGCA 2YWJA 3AJ9A 2E87A 3Q11A 1DU4A 3PD7A 4HAYA 4MV9A 3P96A 2HREA 4PNHA 2QRNA 3IOCA 1TJ3A 3OPYB 4A10A 1FFAA 4M1KA 1VTKA 2ZYVX 4WX2B 5JY6A 3K9LA 1F48A 4H6XA 1M0SA 3KLOA 5JG7A 2ACKA 5CITA 4U0JA 2DGDA 2OHJA 1K86A 3HTXA 4JJ7A 2PWPA 4RJIA 4KXQA 1CF9A 3H7IA 3NNNA 3PNKA 4QYXA 1TAUA 2R84A 5DGIA 4IRUB 3AHIA 1DKLA 3MTJA 4TLMB 4WIAA 5D00A 1Q16A 1TYAE 1SELA 4PZUA 1E77A 2JGJA 3S81A 1Y7HA 1G9SA 1SCUA 2GUGA 3SX4A 3D4OA 1R18A 2GO7A 5EA2A 5JIBA 4WTOA 1GLNA 1KYYA 1YQEA 1JBEA 2I65A 4E5VA 4EAQA 1Y6JA 2VCHA 1CUWA 4B09A 3PFHA 1RWMA 4S12A 5IWAB 1BMFA 1NMXA 3L4JA 3NBFA 2ZZMA 3ZBUA 3GRZA 3WY9A 5FTMA 3NCHA 3FCCA 4EENA 4MXDA 4I19A 1CIJA 2I33A 4KQXA 2J4FA 4AS3A 4YUYA 3KXIA 3I2YX 4FLEA 3TSWA 2D13A 5ALMA 4C7OB 1E9AA 4HGYA 4NEQA 4WKPA 3KLBA 2R86A 3D6HA 5A4DA 2NO4A 1JKXA 1CB0A 3H9CA 4LF4B 1SBHA 3CPHA 2C2GA 1X7XB 5CVUA 2A3RA 3B85A 3D54D 3RVKA 4AK9A 4DV3B 1M10A 3VR3D 2RHHA 3AJAA 4AY2A 1A72A 1D3AA 4GSLA 2GSDA 3HCPA 2FG6C 5FTKA 5MGBA 1C14A 1I3CA 1T1IA 3FSRA 4J0IA 2BZSA 4YI3A 4Y2SA 2G9ZA 3AB7A 1YDFA 2BSAA 2YZNA 3EFEA 4UMEA 3PITA 3FF1A 5H70A 1SJ9A 3ECSA 4W1PA 4QDJA 1MB2A 1T35A 4NHOA 4X0EA 1SQFA 1QF7A 4IOJA 4ZXPA 2R62A 5HOEA 4YJ2A 2FPGB 2JIQA 4W7HA 4KVZA 1U1IA 3W2GA 2R6R1 2P0EA 1XPJA 1NGSA 2RG7A 4FXPA 4BMXA 1WW8A 2AT1A 2C07A 3LLMA 5I8PA 3Q8MA 4IJUA 5J5VA 3BJZA