1PS0A

Crystal structure of the nadp(h)-dependent cinnamyl alcohol dehydrogenase from saccharomyces cerevisiae
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
360
structure length
360
Chain Sequence
b'MSYPEKFEGIAIQSHEDWKNPKKTKYDPKPFYDHDIDIKIEACGVCGSDIHCAAGHWGNMKMPLVVGHEIVGKVVKLGPKSNSGLKVGQRVGVGAQVFSCLECDRCKNDNEPYCTKFVTTYSQPYEDGYVSQGGYANYVRVHEHFVVPIPENIPSHLAAPLLCGGLTVYSPLVRNGCGPGKKVGIVGLGGIGSMGTLISKAMGAETYVISRSSRKREDAMKMGADHYIATLEEGDWGEKYFDTFDLIVVCASSLTDIDFNIMPKAMKVGGRIVSISIPEQHEMLSLKPYGLKAVSISYSALGSIKELNQLLKLVSEKDIKIWVETLPVGEAGVHEAFERMEKGDVRYRFTLVGYDKEFSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical zinc-type alcohol dehydrogenase-like protein in
publication title Apo and Holo Structures of an NADP(H)-dependent Cinnamyl Alcohol Dehydrogenase from Saccharomyces cerevisiae
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 100
structure length 360
sequence length 360
ec nomenclature ec 1.1.1.2: Alcohol dehydrogenase (NADP(+)).
pdb deposition date 2003-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ps0A02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1ps0A01
3U62A 3C24A 2FHSA 3DONA 1P1JA 2VUTA 2V6GA 3FRJA 4BKRA 5JAZA 2P4QA 1WPQA 1BDBA 1MC4A 2FRDA 4J3FA 4B4OA 2DPGA 4YXFA 1WAMA 1M2WA 1M66A 2HKIA 2HMTA 2FMUA 4NG5A 1OC4A 1SEPA 2OUIA 2FWMX 5GZ3A 4MVJH 1K6XA 4OO3A 2X23A 3RUIA 3E8XA 2B36A 1LU9A 4RVDA 1NPTO 4YEDA 3BHJA 4ZRMA 2VNAA 3JQEA 3TNLA 4ZJUA 2VHVA 4CLHA 2IZ1A 4EGFA 1H93A 3GPIA 1DJQA 1IHYA 3L77A 1P0CA 3P5SA 4CUKA 1DLJA 1ML3A 1EZ4A 3E48A 3GHHA 4IDFA 4IMRA 2I67A 3KYCB 1DDOA 4GI2A 5CG2A 3ITKA 4OKNA 1E7SA 3JV7A 3HE3A 2GO1A 3FPLA 3RASA 3WGHA 2JJYA 3BMQB 1ZBQA 3ROMA 5A06A 2WE7A 1PGPA 4L73A 3FR8A 4J4BA 3PHHA 4DC1A 3Q9NA 2W98A 3O03A 3ZV6A 1P1IA 3E1KA 4BL5A 1OMOA 4NU6A 5L4SA 4GGOA 3FTNA 4JN6B 1ULUA 3RC1A 2I65A 2OMEA 3AU9A 4WOKA 3AK4A 3F1KA 1ZK4A 2Y67A 5MDHA 5T5QA 5TRTA 1RM4A 4BQRA 4FC7A 3GDFA 4MVJD 4OXKA 4DL9A 1IYZA 3ZHYA 2NVBA 1GZ3A 1XKQA 1JTVA 5JCJA 1C0PA 4A03A 3QVSA 5H82A 3GZ4A 2PGDA 1TI7A 3LC7O 4FQ8A 3K31A 4XB2A 1UZNA 3K2EA 1E7QA 1DIBA 2UDPA 4IDEA 1ADBA 3TZKA 2JFFA 2EERA 2DAPA 3CZRA 1SO8A 4GVXA 4D3SA 1ONNA 4PLTA 2DTEA 4JBGA 2X0NA 3UCFA 3CEAA 3F4BA 4PZCA 3PLRA 2VHYA 3T7CA 3ZHBA 4R5MA 1Y8RA 4M89A 1KVSA 3P7MA 5C7LO 4DYVA 2HK9A 2BFAA 1J49A 4YJFB 4ZQEA 3W1VA 2NVUA 4BV8A 2DBQA 5KKAA 2BH9A 5B12A 1MFPA 2EW8A 2JHFA 4NZ9A 1PJTA 2VWGA 1E3LA 1N5DA 1XHLA 4XDZA 1P44A 1EFKA 3BHIA 4CODB 1U8FO 3FN4A 2X8LA 2HAEA 1DO8A 1WW8A 1T1RA 4ZA2A 3FR7A 4RVHA 4YT8A 5IDXA 3V2UA 4CM4A 3ETGA 1D4FA 1YL7A 1SC6A 3CINA 3WGZA 3WWYA 3PGXA 2CVZA 3ONDA 1VPDA 2ZQZA 3EGOA 4LVCA 4E2ZA 3WQRA 2NNLD 1Q0LA 1EBFA 4XX0A 3RU9A 4Q39A 4R4JA 4KDEA 5T67A 3L4BA 1N9GB 3QSGA 3CTMA 2LDXA 1DLIA 3BYZA 3PK0A 4QT0A 3WB9A 3ZV3A 3AM5A 4CQLA 3WJ7A 1XLTA 2Q2VA 3D5TA 4MDHA 4Z3KA 5KNLA 4EJ0A 1EMDA 5IZ4A 1WP4A 2VCYA 3OIFA 3ZU3A 5IJZA 3CSDA 4CR7A 1C1DA 4WCDA 1A4IA 4WCFC 1HE5A 3JQBA 3LK7A 2AEMA 3ONFA 1Z7BA 2BI8A 1LRJA 4RPKA 3LQFA 4BGVA 3LSYA 4PLGA 1JAYA 3P2OA 4ZU3A 1W73A 4M86A 1PZGA 2NU7A 3JYPA 5B4TA 5L4NA 1PQPA 4BQPA 1ARZA 3VTFA 1HKUA 1Y6JA 5JY6A 4I5EA 1DFGA 5KVQA 1KVQA 4XQCA 2YV3A 1VSUA 1XWFA 4UVEA 1NHGA 1F12A 4EJ6A 1I24A 4PLPA 4B3HA 5JW6A 1U28A 5ADHA 4JP2A 1QLJA 2JD0A 4UEOA 3DBVO 2WYUA 1R16A 1HDXA 1FK8A 1Q0HA 4RPLA 3K5PA 4WLUA 4CLRA 2Y93A 1ZJZA 5EQDA 4A0SA 4FD3A 1U2GA 3OEYA 1U1IA 3BMOA 3QQPA 4E12A 3TF5A 5ER9A 4QQRA 4IIUA 2G1UA 3HN7A 3H6KA 3RUFA 2D4AA 2IEDA 4LRTB 3TPCA 1H9BA 4RGBA 5DZSA 4R51A 2NVUB 5I7SA 2GN6A 2OZPA 4QUKA 4FW8A 4BNGA 4WJZA 2JD2A 1H9AA 2HJRA 5DNAA 2W8ZA 2B83A 3UHAA 4KUEA 4YQZA 2O3RA 2O2YA 1D7OA 3LYLA 3FNGA 3U49A 3PHIA 1C3VA 2AMFA 3OQ6A 5A9SB 5I9MA 2B5VA 4QSMA 3PIIA 2ZTMA 1VKOA 3IS3A 5B37A 5C5IA 5COQA 5JMPA 5IDYA 1X15A 3HG7A 3NX4A 3GVIA 4K6FA 1NQAO 3UW3A 1HE4A 1I8TA 3L6OO 5TF4A 1H94A 4IZIA 5T64A 1V9LA 2PTGA 3GDGA 2GZ1A 4IJKA 3RUCA 3VZPA 4BO8A 3JQGA 2E37A 1ISMA 4BS9A 2BELA 4D42A 3AU8A 5AVOA 4J1QA 2GPTA 5CDGA 1GV0A 4R1SA 1HF3A 3WIEA 3FCOA 1CF2O 2Z1NA 4ALIA 4UUPA 4EW6A 2NQTA 3DZGA 4YBZA 5IDWA 2VRCD 3U0BA 1PGJA 3N58A 4KTVE 2ZB7A 3UH1A 3LT0A 4G5HA 1ADGA 4AJ2A 1YOVA 3ROPA 4XYGA 2WYVA 3FHLA 3JQ7B 4XA8A 2Y68A 1ZZEA 5JDIA 3ABIA 3RWBA 3ZWXA 4BGEA 3PHGA 5COAA 4PRLA 1QV7A 3VC7A 2C54A 4GLLA 1IPEA 3M1AA 2J3IA 4JQCA 2DT5A 3NYWA 5A3JA 3PXXA 4ROSA 2Y1FA 1XELA 1A27A 4CLOA 4LSWA 3U5TA 2CD9A 4J0EA 4NBVA 1C0KA 4GX2A 2Q2QA 4L4RA 4MIYA 3TZQA 4CQMB 1E6UA 1KIFA 2GR9A 5T6BA 2VRCA 1U3VA 2O2SA 2BLLA 1GZ4A 1PS9A 4BKOA 3GUYA 5BSFA 2QG4A 3V8BA 4IS2A 1CRWG 2ZKLA 1LQTA 3N7UA 5I7EA 4HFRA 4TROA 4CLRB 3MOGA 4BO2A 5FYDA 5L51A 4J7UA 1YB1A 3VTZA 3QHAA 4RV9A 4XR4A 5G0VA 1KS9A 4IIVA 2OFPA 3GEMA 1A9YA 2BFPA 4E2XA 1E77A 1AUPA 1PR9A 4GVLA 4FFLA 1GYPA 4O63O 4DQVA 3L4BC 4U0KA 3DOJA 1SNYA 1DFIA 2BFOA 2XPCA 4PGFA 3RJ5A 3H9GA 1ZMTA 1P9LA 1UP6A 5TQVA 4CM1A 1IUKA 2YW9A 1MXFA 2VYND 3RFVA 4BNVA 3WMXA 2R6JA 2PK3A 3RD5A 1NWHA 3MCVA 4A10A 3VH2A 3BA1A 1V35A 3L9XA 4W4TA 1T2CA 4FIZA 1V3VA 3PJDA 4KQWA 3JQBC 2ZCVA 3GGGA 4BMVA 1H5QA 3PHLA 4UVDA 1X7HA 2WJPA 4DC0A 2HK7A 3JD2A 4KUHA 3GPDG 4OAQA 3S2GA 1ZK2A 1E7RA 3JQGB 5EPOA 3C1AA 1FXSA 2QW8A 3ENNA 2YV2A 1E7WA 4FFNA 4XYMA 3H2SA 4M49A 2PD4A 3GC6A 1NPDA 4FOSA 4FPXA 4OOFA 3OJ0A 4W99A 3GN1A 2NACA 1RYDA 3BMCB 3MJ4A 1NFQA 2E6UX 3KZVA 4FJ1A 1N8KA 1OAAA 4TSKA 1SBYA 2QIOA 3UXYA 4IXTA 1JU9A 1YOVB 2RAFA 4Y98A 2FN7A 3AUAA 4FDAA 4OL9A 3U4CA 1TB4A 4RQTA 3ZWCA 3ZI0A 1SMKA 1JLLA 1KEUA 3SXPA 1HDZA 5L7WA 4BNIA 2VNSA 3I9MA 2C7GA 4IDGA 5HM8A 2W2KA 1GQQA 3QVTA 1BWSA 1NVGA 3IUSA 4OMUA 2NUAA 2ZTLA 1G1AA 4JROA 4NBRA 3I9JA 2WMDA 2YV1A 1GADO 1RM5A 4J49A 4TZTA 3WNQA 1EUZA 4R1UA 5DULA 3KO8A 2HCTA 2WM3A 1A4UA 1DC3A 3ADOA 4BB6A 3HDQA 5L53A 1ZUD1 5L45A 4BO9A 3AM4A 3UAGA 2YY7A 3EDMA 3JQDA 5K9ZA 2BGMA 1E1NA 2EW2A 4M1QA 3OETA 1GV1A 1HLPA 2B37A 2V6BA 4TVOA 2GGSA 3TFOA 3UICA 1B8VA 5L9AA 3AUTA 6ADHA 3GNTA 3MOIA 2QRLA 4EZBA 3JYOA 2C2XA 3DR3A 3DBRA 3BTUA 4XGIA 4BOYA 5L95A 4B3IA 2HMVA 2PZJA 2Q2WA 2WSBA 2VWHA 2EJWA 4GMGA 3H9EO 1IOLA 3ZV5A 5U1PA 4RDHA 4XQGA 1PZFA 3NGXA 4WLNA 2IEBA 1TT5A 1ZEMA 5C3MA 2H6EA 3K9QO 1PTJA 3F46A 2PH5A 2O3SA 4A73A 1ZMOA 1HE3A 3MJCA 1UUFA 1MP0A 3NKLA 2XF8A 4BKUA 4EJMA 1GD1O 3ASUA 3HNPA 3I9KA 3NV9A 5AXDA 1R6DA 3TJRA 2C82A 1LUAA 3HDHA 5EIOA 4NFHA 1LSSA 1GUYA 1YXMA 3VKUA 2FY8A 4O1MA 1A71A 4K6CA 2VN8A 3EUWA 2UUOA 1GYRA 3IOYA 1I3KA 2OHXA 3R6DA 4CJXA 3I52A 3OA2A 2AG8A 1Q1NA 2B35A 2I3GA 3DMYA 3QVXA 3IL2A 1HYGA 4IJUA 3X2EA 4RLHA 1X1TA 3GEDA 1O0SA 3GMSA 4MKRA 4J91A 4J43A 3VHRA 1WDMA 3K30A 3GR6A 4E5PA 3ZV4A 3ON5A 3GNQA 3KM0A 4K26A 1EEHA 3AY3A 3LT1A 4H16A 4YJHA 4KQXA 5JAIA 5HS4A 4JP3A 1LLDA 2SCUA 1KOLA 2YZ7A 3EZLA 2QX7A 2O3TA 4MIOA 4CV3A 2JCYA 3CPSA 3JQAA 5IN5A 1XSEA 1MG5A 1BW9B 3KYBA 5G2OA 1QYCA 3HSKA 1BGVA 1B0AA 1ONOA 3AM3A 4IDBA 4WASA 5F5LA 4DBZA 3VDQA 3LZ6A 3BMNB 1IPFA 1UAYA 3P2YA 3PQDA 4IQ8A 4J1SA 4MVJI 4ND5A 1KC3A 1N7GA 4BNHA 2QRJA 4CL8A 3IJPA 1F8GA 5H81A 4D45A 1G0NA 1XYGA 2TMDA 1NFRA 4TWRA 3RKRA 4CM3A 4CMGA 4YAGA 3WDSA 2AQHA 4W9NC 3INTA 4GWKA 4QEDA 3W4JA 1XA0A 2O7SA 3R3JA 3LDHA 3AOEA 1V8BA 3W8FA 3ZWAA 1E3IA 1KVUA 3ETEA 3KYCA 2FOIA 1FDSA 1JVSA 5DP2A 3WJAA 2OBNA 4UUOA 2DFVA 3TZHA 4B4WA 3PFWO 3BMQA 3F5QA 4XQ9A 4E32A 1DC4A 4NK5A 3ZHXA 2AHRA 5L7YA 2BRUA 3HJAA 3VDRA 4RQUA 3LF1A 4E4YA 4B7CA 2JHGA 3DL2A 4WK6A 4DIOA 1K6JA 1T24A 1TT5B 2DBZA 5ER6A 1HZJA 3KLPX 1PL7A 4LISA 4JK3A 4MKXA 4ITUA 3WYEA 5CEEA 4DREA 1K2WA 2OGUA 2C20A 3DEYX 2AE1A 2C59A 1N1EA 2QYTA 1DFHA 4NBTA 2D3TA 4AVYA 2HSDA 4IGFA 1OFGA 1SOWA 1P0FA 2UVDA 4OJNA 1HWYA 3JQ8A 4BNYA 3RUHA 2IZ0A 2RBEA 4A7PA 3MEQA 4FFRA 5B4VA 1N92A 3WWZA 3ZWOA 5I9NA 1A9ZA 1E7MA 1SPXA 3PVZA 1GU7A 3FPCA 4RJTA 1DIRA 2CSUA 3INGA 3OIDA 3Q6IA 2GD1O 3PIDA 4N5LA 3B1FA 4ND2A 5HTOA 4D79A 2GERA 4DRYA 3G49A 1B8PA 4XRGA 1B7GO 4AICA 3DWFA 1SOVA 4XRRA 2DC1A 4FGWA 2Y1CA 5DP1A 1UR5A 5CP8A 5FEUA 1XIVA 4CM8A 1WZEA 4YJHB 1LDNA 4Z0HO 4W7IA 1PX0A 4HX5A 5LDHA 1U4OA 3I6QA 4DBVO 2J3HA 2A92A 4Y6RA 4DLAA 1XU9A 1PIWA 2EGGA 3WIDA 1LC0A 1YDEA 1K89A 2UAGA 4IXWA 3COSA 3QVWA 4EEZA 3I23A 4QXMA 3WGTA 3M1LA 2J5KA 1XQ1A 3K73O 3OM9A 4L9RA 5CDTA 1IB6A 1PQWA 5KJ6A 2EKQA 2GASA 3DZIA 4F3YA 5HRUA 2W2LD 4WLEA 3WYCA 2CZCA 2HMUA 3WBFA 1VKNA 3GQVA 3PYLA 3LU1A 3GVPA 2D5CA 1N9GA 3QV1A 3OEWA 4UVGA 5JCJD 2GZ2A 4BO4A 3MZ0A 5JPIA 5DDIP 4LK3A 2AW5A 3D7LA 3UCEA 1DC6A 4NNJA 4CPDA 5KTKA 5TNXA 2C2YA 2D1YA 3BHMA 1E1MA 3MWEB 3SLGA 2VTDA 3KV3O 4BO5A 1TXGA 3PDUA 4N18A 4Q3DA 4OOEA 2I66A 2W2LA 1I2CA 2O4CA 5JCXA 1AXEA 2H63A 1GZ6A 4K28A 1A7KA 1XEAA 4E21A 2FSSA 2PFGA 1KC1A 1X7GA 2YDXA 3WSVA 2IXAA 2Q49A 1DIAA 4QFCA 4AL4A 1P31A 4TKMA 4NPCA 3WLEA 3JQ8B 3GZNB 3G1UA 3Q3CA 1BSVA 2DBVO 3I1JA 3V2HA 3JQ6A 1E1LA 2PKQP 3MJSA 1K0UA 5ES3A 3TFQA 2YHUA 4ZN6A 1MB4A 5DBIA 3PPIA 3GRPA 3BTVA 1LDEA 1AN9A 1D1TA 1Z73A 2J8ZA 1OOEA 4O0LA 3EMKA 3MJTA 5F1KA 2P2SA 1R15A 1PS0A 5K1SA 2H1SA 3PDJA 3ULKA 4MKZA 4HFNA 1TT7A 1Y5MA 4LSMA 3DAGA 3QJ5A 5EL0A 4CM8B 2JCVA 4TRNA 1K6IA 2ZK7A 3CMCO 5BQFA 4YTEA 3EY4A 7ADHA 5BR7A 2B4RO 1W4ZA 5G4KB 1JKJA 1T4BA 1WMAA 5TSDA 3DC2A 4OSPA 1Y9EA 4CMJA 1U7HA 4BO3A 3U4HA 3GOHA 1EE2A 1T25A 2ET6A 1U2DA 3E18A 4EUHA 2B0JA 3ANNA 3H7AA 3GNSA 1UXKA 4K9DA 1IE3A 5A9SA 2PZLA 4BO0A 4YRDA 3KXDA 2I3AA 3OJLA 4FCCA 3TSCA 4YRBA 2R00A 3GVHA 3AUSA 4CM9A 3OFSA 4FSHA 1O89A 4BIIA 1PJ4A 3IP1A 3RJ9A 1WXDA 5H83A 4NJOA 4J1TA 2C5EA 1WDKA 3DMTA 4RVGA 1L1FA 1O8CA 1PJ2A 5K6AA 5KJFA 1NQTA 4Y6PA 3WLFA 3ANMA 3KOUA 1F17A 2QQ5A 2FR8A 1YJQA 1IZ0A 3H3FA 3INRA 4NMHA 3JQ9A 4RZIA 3EHEA 3VZSA 5EQFA 4RPHA 2GDZA 4JNKA 4ZGWA 1YQXA 5BNTA 3NT4A 1I2ZA 4CQMD 2IRWA 4F6LA 3WSWA 1FF9A 3LC1O 1JQBA 1UP4A 1U3TA 2EJVA 4JBIA 4MP8A 4Q3BA 2UV8A 4RVFA 3TL2A 1EVIA 2X4GA 3RUDA 5A5EA 5CPFA 2P5YA 4WKGA 1LBEA 1V3UA 2OXIA 4ND3A 3GT0A 3JQ7A 1HRDA 2PWZA 5IXSA 4YPOA 1B15A 1XR3A 4IZHA 3PWKA 1Q7CA 4UVHA 4Q3CA 3E5MA 3E9QA 3FNFA 1PSDA 5FFFA 5G0SA 2DBRA 1FMCA 1SZJG 1HXHA 4IGEA 5JMWA 1YBVA 3VVCA 1HDGO 4RPJA 4AJJA 1S7CA 4E31A 3DAFA 1CQIA 4CQMA 5JC8A 1HYEA 4E2WA 2VHXA 1VLLA 4U8GA 4QO8A 2NVWA 4CMEA 1X13A 3HHPA 1YJ8A 4HNHA 4ALMA 3RFXA 2VUUA 1Y8QA 2PLAA 5CAEA 3OJOA 3PGJA 5DN9A 1MGOA 5JO0A 4IQ0A 4C4OA 2E4AA 4RVSA 3ZNOA 4OXYA 4K1LA 4BO7A 5F1PA 2G5CA 2DFDA 3U3XA 2IODA 1UZMA 4J1NA 1VE9A 3L0DA 5G4LA 1EVYA 3C1OA 2XOXA 1KYQA 4PG7A 4GQAA 3UOGA 4L8VA 3ZNPA 4DQUA 4IM7A 2Y1GA 3S2IA 4FOOA 1GTMA 4BHTA 2WYWA 4E13A 3V1TC 4AJOA 4DXHA 4ALNA 4GX1A 1I0ZA 4DA9A 1P45A 1ZNQO 4WOJA 1PL6A 3WOHA 4B4VA 1VI2A 4URFA 5HS6A 2NU8A 4OQZA 1KETA 1YONA 3O9ZA 2PZKA 1I3MA 3RC2A 3EAGA 1PQUA 3ZGYA 5KJCA 3Q2IA 1YVEI 4NFSA 1N2SA 2NTVA 3A14A 1BHSA 1S6YA 2CF5A 3F6YA 2Q3EA 5F5NA 1YS4A 4XJSA 5EERA 3W6UA 3C7AA 1WLYA 4NR0A 4A26A 2AXQA 3PHJA 5T8KA 3QWHA 1LA2A 4R69A 3K6JA 4KP7A 3E9MA 2AQ8A 4DMLA 5F21A 2NM0A 4GGPA 4KWIA 1SB8A 1YH3A 4XJTA 2DM6A 1SB9A 2Y1DA 1AE1A 3DOOA 2PH3A 3WFIA 4YQYA 3ITDA 3BMCA 3EK2A 5AQ1A 1X0VA 5A3VA 2X5OA 3KETA 1E0DA 1QKIA 3UKOA 1JKFA 1D3AA 2PKRA 4HY3A 1QYXA 2EF1A 2P91A 1J5PA 4AJNA 3D64A 1Z74A 3H5AA 1ZSVA 1LQUA 5LDGA 1X7DA 4DLLA 5GZ1A 3E5RA 3ORFA 3NT2A 3NTRA 4LMPA 1HE2A 1RPNA 4H7PA 4YJDA 4E5NA 1JVBA 3ZN2A 4C7JA 4DTIA 4L4XA 2GZ3A 5ILOA 2D5AA 2RH4A 1WWKA 2VOJA 2YQ4A 1LC3A 2ZIZA 5TJHA 3WGGA 4Z0TA 1JAXA 3QWAA 1Y8QB 2DU8A 2G82A 4RF3A 4YR9A 1Y81A 4U5QA 4GSKA 3UUWA 1ISIA 2HO5A 2R00C 4ALKA 1NASA 1Z75A 3K2BA 2B5WA 3FTPA 5C37A 5JY1A 1Q7BA 2IYOA 4DIFA 3RU7A 5ICMA 2CDBA 2ZATA 3VKVA 3JQFA 1K5HA 2YQ5A 1C1XB 3OH8A 3ZU4A 2V6FA 2OL4A 2Z95A 1HSZA 3ADPA 3HADA 1YO6A 3RCBA 2POQX 3JQCA 3Q1LA 3FWZA 4B4UA 3ZW8A 1P74A 2FSVA 1R4MB 5JBIA 2NU9A 4BNLA 1GUZA 1DBVO 3HDJA 1PJCA 2IXBA 4RORA 1QR6A 3CZMA 1ZSNA 1YE3A 2D8AA 3JYNA 1MG0A 1OZAA 4KMSA 1LDGA 2OP1A 3JD3A 1GL3A 2ILTA 2ZTUA 4S1VA 4NHEA 1BXKA 1T2EA 2EG9A 1XG5A 5L40A 2BHLA 3OSUA 1I32A 5IAAA 3QLJA 4UVIA 5EINA 2HUNA 4LGVA 2VUSA 1E3SA 4KZPA 5A03A 1UH5A 2FPGA 4IS3A 3GMDA 3KYDA 5JDCA 2I99A 5DCWA 2C7VA 1W6UA 2JL1A 1ZFNA 2DQ4A 3ZWWA 3D1LA 3NUGA 4I5FA 4EDFA 2Q50A 3GRKA 3UGKA 1BMDA 2P68A 4DPLA 4H15A 1LI4A 1A72A 4P4GA 3RC9A 2WD7A 2GUGA 3I83A 4PLZA 3X2FA 2ZQYA 4PLCA 3TOXA 3Q9UA 4EUEA 3HZZA 1VL6A 5AXAA 2DPHA 4E33A 4TVBA 4R9RA 1WNTA 3ICCA 1QMGA 2NV6A 2GCGA 4RL6A 2IZZA 1BVRA 3VZQA 3HN2A 1H0KA 3WQQA 5FI3A 3ZWNA 1SCUA 1ZXLA 1T26A 3IIEA 3WBBA 1U9JA 4YT4A 1KBZA 5CFZA 4BNTA 1BW9A 2VHWA 3A4VA 3IQDB 5HWSA 4YACA 3DZKA 1LX6A 4MVJE 3PQFA 1B2LA 2H5LA 2H9IA 3DZBA 1NBOA 5CHEA 3EZYA 1ENYA 3BMNA 4FGSA 3ZWPA 2GN4A 1U4SA 4WLFA 3DO5A 3O4RA 3RSHA 4B8ZA 2XXJA 4EUFA 5IF3A 4PRKA 4P38A 3GK3A 2NADA 4NFYA 5EESA 1NR1A 5AOVA 2B4TO 4FBGA 1CEQA 5IDQA 1KVTA 4ZQHA 3UCXA 4NI5A 4UEJA 1ZEJA 1DSSG 3OQ1A 3OQBA 4AG3A 3KSDO 1P1FA 3FNEA 3WGYA 4YAEA 2JAHA 2HDHA 3CE6A 4ILKA 3ZH2A 1X14A 2NLOA 4GLOA 2QZ9A 4J16A 4WE3A 2PA3A 3KVOA 3OMLA 1QORA 3WFJA 1YQDA 2FP4A 3RIHA 3H5RA 5CEJA 3PZBA 5KVCA 4JIGA 4LW8A 1HSOA 1E5LA 4DVJA 4XB1A 2ZYAA 5CDUA 3RFTA 1WVGA 3SJUA 1IL0A 7MDHA 1XU7A 3NTOA 4YT5A 4PVCA 2PY6A 4PN3A 4RF2A 1U3UA 2QRKA 3NDJA 4PCVA 3DDNA 3WGIA 4D44A 3FD8A 3IP3A 3L07A 1DC5A 3EVNA 3PLNA 4J0FA 3G1TA 5JDIC 1NXQA 1KEVA 3OECA 4XGNA 4OSOA 2BI7A 4CM5A 4J2OA 4PZDA 5KJ1A 2CVOA 3WNVA 3JQAD 3GDOA 1IULA 3OICA 1LDBA 3F47A 1ENZA 1LNQA 1ZK0A 4HWKA 1OBFO 3R1IA 2TMGA 4ESOA 4TRJA 3KYDB 1I3NA 2VWQA 2NQ8A 5TIIA 3TZCA 3DTTA 3I3OA 1OI7A 4ND1A 5U4QA 2DTXA 1JW9B 5KCZA 2UYYA 2WD7B 4DPMA 1EE9A 5ICSA 5IZCA 4MO2A 4XD2A 1ZIDA 2BGLA 1SEVA 4P4LA 1AXGA 3UVEA 4IJVA 1O9BA 2FPPA 4DQXA 2RCYA 5A1TA 1E6EA 3NJ4A 2DUWA 4HXYA 2P9GA 1PGNA 3RUEA 2FPIA 1I01A 1D8AA 1H6AA 1NX6A 2YHIA 1L7DA 4YA6A 1ID1A 3JQFC 5ILGA 1GY8A 2CUKA 5CPBA 5TS3A 3VH1A 4B3JA 3TQHA 3PZRA 4HFJA 1O6ZA 2O4UX 3O8QB 3QRWA 1BG6A 1PS8A 2XAAA 3D3WB 4CMKA 2HLPA 4MPDA 2GNAA 2BF7A 3EVTA 2JKVA 4Y8VA 4ZRNA 1LJ8A 1NPYA 2O3JA 3RUAA 4YRAA 2X9GA 3JTMA 1ISGA 2O23A 4Z0PA 1IZ9A 4BGUA 1I2BA 1ZSYA 4E3ZA 2X58A 3DZJA 4OXNA 4IBOA 4PVDA 3F3SA 5THKA 3DBHB 4BUCA 1MUUA 3V1YA 4N5NA 4LN1A 5K0ZA 4FFMA 4OH1A 1LSUA 2I76A 4CL3A 1CWUA 3VVBA 1Q7GA 1BXGB 1XQ6A 2X0IA 2VZ8A 3I4FA 1HT0A 4M8SA 1P1HA 4CMIB 3AOGA 3IJRA 5I7VA 1KERA 3UF0A 3SEFA 4MP6A 1UXJA 4WNIA 2BFMA 4ZQBA 3AI3A 3D4OA 1EK6A 1YB5A 1HEUA 1WZIA 1NVMB 2Y0CA 3BZUA 3DFUA 4JJFA 5A04A 4JXKA 3TOZA 2Y99A 4WNCA 4G2NA 5TGDA 2AA3A 5A9TA 3QWFA 1LLUA 3WR5A 2D59A 1DHRA 5B4UA 3KB6A 3U9LA 4E5KA 1G0OA 1YBAA 3LF2A 3WGOA 1EK5A 1B14A 4MVJF 2VT2A 3C85A 3GA0A 3AFNA 4RZHA 5L7TA 3F1LA 3TN7A 4AJHA 5I8ZA 5I7FA 3IKTA 1UXGA 2JAPA 4XZ3A 1EBUA 1HDRA 1YGYA 5GMOA 4U6QA 3GZNA 4PZEA 3C1TA 4Q3EA 2J5RA 1X1EA 3U4IA 4GX5A 3S2EA 3D4PA 1LLQA 4INAA 1RYEA 1JA9A 3VH3A 1O94A 2JCXA 4WECA 1DB3A 5IXYA 5TT0A 1MFZA 4JBHA 4R54A 2V65A 4X54A 4AJLA 3PRJA 3ICPA 4AJIA 3KBOA 1UXHA 4PIVA 1UP7A 1RM3A 3D5QA 4EBFA 5JFOA 5U9CA 3HQ4O 3H65A 2PKQO 4WEOA 2W90A 1RM0A 2EIHA 5G4KA 2Q46A 2I6TA 2C0CA 4UREA 1L7EA 2CF6A 1LEHA 2YHIB 4IDAA 3Q2KA 1HDYA 2CDAA 4DWVA 4R1TA 4WCFA 2FR1A 5BSHA 4R41A 4XQEA 4RDIA 4XYLA 2NSDA 3IAHA 4NJMB 5JYDA 2VWPA 3L4SO 4BNKA 2AEFA 3M6IA 1PL8A 4PG4A 4E6PA 1NNUA 4HADA 2CNBA 2B69A 1CDOA 4TKLA 3FF4A 3QA9A 3V1UA 4C7KA 4N7RA 4CMAA 2YDYA 3DHYA 3AY6A 1AGNA 1MC5A 3V5NA 3CH6A 1EVZA 3PQEA 5HA5A 5DCUA 1PJSA 2P9CA 4BNNA 4QX6A 3BTOA 3VOSA 1GPJA 2I5PO 2RIRA 2IYPA 2Q4EA 1PEDA 3R3SA 1H6CA 1GR0A 1ENOA 2F00A 3SC4A 4MOWA 4OKIA 1M6HA 4UUNA 2GLXA 3GFBA 4WPGA 4ONEA 5CDSA 3NT5A 4HP8A 1QLHA 1JKIA 2VT3A 1PJ3A 3W8EA 4GAEA 4B7UA 4DYDA 4DIBA 2EWMA 4N5MA 1M67A 1VJ1A 2EXXA 2GSDA 2CVQA 2WWRA 1PZEA 4J7CA 5JC1A 1U7TA 3FNHA 4LCJA 2BMAA 3D4NA 4MINA 1PJLA 4OYRA 3O38A 1O95A 3I9NA 1Z82A 5JXWA 4R68A 2BGKA 2NTJA 2WEKA 4KTTE 3FBTA 4MP3A 1R0KA 3CXRA 2X0JA 1WDLA 3E6AA 5HBRA 5IZCC 3TWOA 1H6DA 3IUPA 4QECA 5DOZA 3T4XA 9LDBA 4HV4A 5FI5A 4BGIA 3G17A 1CERA 4JJGA 4W82A 4XWYA 4U7WA 1UXIA 5BSEA 3MTJA 3H9JA 3ASVA 1KEWA 3ZDFA 4EI2A 4YCAA 3AI2A 3VPHA 5A5FA 3DHNA 4ALLA 4AJ1A 4MVJP 3ONEA 1ORRA 4GH5A 1ZK3A 1GQYA 3JCZA 4CV2A 3DFZA 2GN9A 3BXXA 1DAPA 3OA0A 3M2PA 1NQOA 1UJMA 3G0OA 4XYEA 4QO7A 4TZKA 1EQ2A 2HQ1A 4CM9D 4CV1A 4EEXA 1QYVA 3PWZA 3E82A 2HRZA 3VAZA 4EITA 2Q99A 1T2DA 3S1LA 4JX8A 4L75A 3KTDA 1LDYA 4FB5A 4R1NA 5COBA 4RCVA 5JE8A 1QRRA 3VPXA 5BSGA 1U5CA 4CR6A 3AOEC 4IPTA 3S55A 1N7HA 1EFLA 2Q45A 1CETA 4WCFB 4BO6A 2NTNA 2EV9A 3GH3A 4BNJA 4HFMA 4GKVA 1PJQA 5KJEA 4BNWA 4GMFA 4R5HA 4NK4A 1DRWA 5I8WA 3RBXA 1BXZA 2VQ3A 3HB5X 3L9WA 5CEFA 3DBLA 2HRBA 2VYVD 1E3WB 4MVJA 4JCOA 1ISJA 3OP4A 1QSGA 1DPGA 2Q1WA 2ZJ1A 4FC6A 1PJBA 4Y9DA 1H2BA 3WX0A 1MXHA 3RBVA 2PV7A 1E92A 4Y67A 3B1JA 3NDIA 3RC7A 3N74A 1EUDA 1T1SA 5JO9A 3NAQA 3DTYA 4XR9A 4RVUA 1B26A 1R0LA 4XCVA 2I9PA 1CJCA 4PLHA 3ETDA 4PG6A 4QFDA 2P5UA 3Q11A 1G6KA 4NDNE 4YJGA 4JGBA 1GEGA 4F45A 3PI7A 2Y66A 3R0IA 1FJHA 1GCOA 3ZWMA 5DT9A 5IFLA 1CIVA 1ISHA 2VYVA 2WE8A 4KUGA 4ID9A 4CUZA 3PYXA 2J3KA 1QP8A 2VHZA 4WEQA 5JAMA 4MVJM 3JYQA 3BIOA 5FWNA 1ZXBA 1E1KA 1R37A 4JJIA 2IDZA 2O3UA 2ZB3A 4D43A 1VC2A 5GZ6A 4RLSA 4G81A 1QV6A 4L4SA 1NWCA 2CFCA 4I5DA 4XEHA 4YAIA 5B1YA 3A28A 4CV0A 3PJFA 1K3TA 5GY7A 1DIGA 1RJWA 1PZHA 1C0LA 4O6VA 1P3DA 2Z1MA 4ALJA 4J7XA 1KY5A 1Z7EA 3B1KA 4D7AA 1T2AA 3E9NA 1Z45A 4FS3A 4OIMA 3L6DA 1EQUA 2F1KA 2WD8A 2ZCUA 4NBWA 2O50A 3H8VA 3LLVA 3FWNA 4LCEA 1LTHR 4J6FA 1PGOA 4OGWA 4Z3DA 3W4IA 1EUCA 4I1IA 2Q1SA 1C1XA 2G0TA 5KWEA 1I36A 1O5IA 2EKLA 1BVUA 3LT4A 3OHSX 4I9HA 4IJWA 1BTOA 1I30A 4P4NA 5LCXA 1J0XO 1BRMA 3GEGA 3AFMA 5F1OA 3U09A 1ZKMA 1MV8A 3UN1A 9LDTA 3I6IA 1R4MA 1W8DA 4UULA 5CG1A 2WTBA 2A9FA 4J4HA 1JDJA 3ZWVA 2Y1EA 1ZVMA 1ZK1A 3VPSA 3WGQA 4BNXA 2V7PA 1Y8RB 1ZJYA 4MVJG 1F8FA 4L74A 3DBLB 3IC5A 2ZJ0A 3QWBA 3SC6A 2DKNA 4G65A 4J2HA 2Q4BA 4DMMA 2JFGA 1XGKA 4H3VA 2YFQA 2VOEA 4S3MA 3TL3A 2FZEA 3U4DA 4E2YA 4J9UE 3GVXA 1NVTA 1IY8A 2YFHA 2R2GA 3ZWBA 1M6WA 5MGBA 1ZW1A 4DPKA 3KHUA 4ZQGA 3KUXA 3IKVA 1D1SA 4FN4A 2OOSA 4BNUA 3M2TA 4GBJA 2GF2A 4CM4B 4GKBA 2DUUA 4R9SA 4YJGB 4D3DA 1CYDA 3OJEA 4TQGA 3RI3A 3LC2O 4F6CA 5T57A 4NH4A 3G3EA 1NAHA 3K8ZA 3NJ8A 4PLFA 5L4LA 2PD3A 3QVOA 4OM8A 4A27A 3ROQA 4TMFA 5I9LA 1E7YA 4FFOA 3T4EA 3ZW9A 2O3QA 1V3TA 2VTEA 4FJ2A 4Q9NA 3K96A 1WMBA 5TJ9A 4Z9YA 3GHYA 4DUPA 5IN4A 1HDOA 2CY0A 4BVAA 1NQ5A 1W0CA 3I9LA 4CQLB 5G0UA 4CMHA 1H6BA 3NTQA 2X86A 2GYYA 4AJEA 2HMSA 2O48X 5TLSA 1LRLA 3Q0EA 4O5OA 2BD0A 4R01A 3LLSA 1DRUA 4B7XA 1JWBB 1QG6A 3F5SA 3STHA 1B3RA 1VJ0A 5KOIA 1C1DB 5AXBA 3HFGA 3KSZO 4R16A 1UZLA 4RPGA 3FSRA 1JN0A 1EVJA 2BKAA 1H2HA 1PR3A 3FBGA 5ENVA 4U6SA 4BKPA 4TRRA 4J4TA 4CM7A 5AXCA 1VRWA 1DJNA 4ZVVA 1NFFA 4D41A 1YWGO 2J3JA 4Q3AA 3TDKA 3I9OA 3MTGA 3TZ6A 2J6IA 3B20A 2V6MA 3DMTC 1QXSA 5K6AC 1ADFA 1IHXA 1OC2A 3P19A 1HLDA 4GSLA 4D0RA 1GFSA 3KRTA 4DLBA 3I5MA 3GLQA 3QY9A 3WTCA 2QHXA 3RQSA 1C0IA 3JQ9C 2E49A 4J90A 5BT9A 3OIGA 5A02A 2DTDA 4A2CA 3DZFA 2EEZA 2C07A 1C14A 1TVEA 1VJTA 2HU2A 4DGSA 3QW2A 4CLXA 3EC7A 3LT2A 4BMNA 1ADCA 4YAKA 1TLTA 2QZZA 1B16A 3PEFA 3BMOB 4IUYA 4II3A 3ROKA 3CMMA 1JWAB 1B3BA 1KEPA 5BNIA 2EP5A 1J6UA 1FDWA 1R4NA 4R3NA 2Q1UA 1DAOA 4I9UA 2ZB4A 2HMWA 2Q1TA 3OJFA 1QYDA 2QYSA 3GY0A 3T7EA 5A05A 1Y9AA 4L76A 1U3WA 1KVRA 2EGHA 4IQGA 3ZWYA 1UDAA 1TEHA 4KWHA 4XYBA 3H3JA 4GWGA 2A94A 2ZYGA 2X1HA 3C7DB 4CMBA 1XCBA 1NM5A 3IDSA 3SLKA 4XDYA 3JYLA 1HL3A 4BNFA 4IY1A 1GDHA 2OORA 2GN8A 4IDCA 2WDZA 4CLDA 3MJVA 1HTBA 4PLVA 4WLOA 4UEKA 4W9NA 1B8UA 1HZZA 4CMEC 2C29D 1F06A 3H9UA 4XKJA 3W4KA 5A4DA 3V2GA 3QE3A 5EN4A 1Y5RA 4J9VA 1LSOA 1UAGA 3JD0A 3HFSA 2X9VA 3AJRA 2PNFA 1R12A 3GG9A 2A35A 1SAYA 4HBGA 3KEOA 1ZH8A 4AFNA 2VZ0A 4D3FA 2G76A 3D0OA 1DIHA 3PP8A 2PGJA 4XIJA 2HK8A 2EHDA 2VYNA 3ZHZA 1RKXA 2Y0EA 4GPD1 3D3EA 3ANLA 3HWRA 1DXYA 4LMRA 3HDYA 1GUFA 2PD6A 4UUMA 3O8QA 3BAZA 3HUDA 3S8MA 6LDHA 3D3WA 5TT1A 2ZYDA 3QIVA 4N54A 4PLYA 1X0XA 2CDCA 3ST7A 3AWDA 5F3RA 3LVFO 1A7AA 1YB4A 3JSAA 4W6ZA 4BNZA 3RBZA 1NP3A 1GQ2A 2YUTA 3NEPX 2EP7A 1RWBA 2XXBA 3F4LA 3S2FA 3ZCXA 4FR5A 4A5OA 2Y1OA 4Z6KA 1Y7TA 4IDDA 1NYTA 4IINA 3CKYA 4KOAA 1R66A 2X7HA 3DBHA 4NBUA 3K92A 4Y6SA 1EDOA 3VH4A 1ENPA 4TRMA 4B79A 4CLOB 5JNLA 4WGGA 4RF5A 3H9QA 4YYZA 1YRLA 3ZU2A 4CLEA 3ZNQA 4XGKA 1DEHA 1BXGA 2HJSA 1M75A 5T8KC 3GAFA 3VPGA 4II2A 3PFFA 3H5NA 4CMIA 5ITVA 5FF9A 2NU6A 5G0WA 3W6ZA 3TRIA 5KKCA 5DBFA 2E48A 1Y1PA 3UFXA 5J23A 1R0SA 3SJ7A 4FJ0A 3KEQA 3HB4X 3WS7A 3RAJA 1EDZA 3IMFA 4E5MA 2PZMA 1FDUA 1V6AA 3CIFA 1LSJA 1M76A 1NR7A 3DHEA 4XIYA 5DF1A 5DOVA 4Q3NA 3I4CA 1R4NB 3GUCA 1E5QA 3OBBA 3WXBA 4AJPA 3C7CB 2D2IA 2VZ9A 2ZTVA 4Z9XA 3B6ZA 1ZO8A 4RF4A 2E82A 1VM6A 4YWJA 5TC4A 1ZCJA 4U0JA 3OF2A 5L3ZA 2J5QA 2ZB8A 5JAQA 3DQPA 2X6TA 2UUPA 5A9RA 4M54A 4ZICA 4I9NA 4PFJA 1MA0A 3WICA 1CQJA 5TX7A 1NHWA 2LDBA 4PLWA 1FDVA 3A9WA 4GL4A 1YBMA 2O7QA 2IE0A 1NTOA 1AHHA 3CUKA 4YDRA 4AJKA 4L0QA 3RVDA 2OP0A 3WQSB 1Q0QA 1T4DA 1PGQA 8ADHA 1MX3A 3QWIA 4PG5A 1T2FA 2AG5A 3GAZA 1P33A 3WMWA 1YL6A 1E3JA 1U8XX 3A1NA 3VPFA 4CR8A 1J4AA 3GGPA 5C7OO 3DZHA 2C5AA 2G17A 5C7IO 8LDHA 3F9IA 1PU2A 3H2ZA 3NGLA 4NIMA 2RH8A 5KVSA 1QYWA 2X5KO 2X9NA 1YQGA 2Z5LA 4B8WA 4OQYA 5EMHA 3RKUA 5EJ2A 4NJMA 1VL8A 4P22A 3ZZNA 1GPDG 2PGLA 5ITWA 1YL5A 3EYWA 1V0JA 4LVUA 4JLWA 1GEEA 3PTZA 3PYMA 1Q2XA 3DOCA 3MWDB 4E30A 3AI1A 3C8MA 4GX0A 4HUJA 2W2KB 5LC1A 2A4KA 1F0YA 3KSUA 1GCUA 2EKPA 1BDMA 1TA4A 4CMCA 3GF4A 5DBGA 1N1GA 3AW9A 2YJZA 3E03A 3FI9A 1ISFA 1DHTA 2AQKA 3W8DA 4Z9FA 2AEJA 3AY7A 3DAPA 1I10A 1NAIA 3DXFA 1F14A 1HDCA 1I33A 1ONPA 3KLMX 3GVCA 5JS6A 2P9EA 4CM6A 5JLAA 1GYQA 1P1RA 5JDCC 3WG9A 3SVTA 2NWQA 3ZU5A 4ZQFA 4BO1A 3GN2A 4WUVA 2RHRA 1LDMA 4P8RA 4EYEA 4MJLA 2RHCA 4O59O 1YKFA 1LXCA 1VSVA 3ZNNA 4YVFA 5BNFA 1XDWA 3WTBA 2FZWA 1P77A 4YAJA 4PG8A 1DRVA 5DCYA 1AHIA 2DLDA 3GGOA 4D46A 1E6WA 1I3LA 2OBYA 2W4QA 1Z6ZA 2Y05A 3DBRB 5JSFA 4YB8A 3SBOA 2JD1A 4UAGA 2AE2A 5JYEA 4I5GA 4BKQA 2Y0DA 3GG2A 2YYYA 5AYVA 1LLCA 1ULSA 3BTSA 4ZHSA 5THQA 4F46A 2P4HX 1UDCA 5G0TA 5KIAA 3H4VA 1A5ZA 3L6EA 1FDTA 3NDRA 4ND4A 4HKTA 4WLVA 3SX2A 2CMDA 3C3XA 1E3EA 3PJEA 2VRBA 2X0RA 3G79A 4IMPA 4W7HA 2FR0A 1UDBA 4YT2A 1U5AA 3DB2A 3JD1A 4I08A 3EW7A 3QP9A 4KDFA 3JD4A 3MJEA 2X22A 4QTZA 3RROA 5IG2A 3PJGA 5CDYA 5KVVA 4OHUA 2D0IA 4BNMA 3ENKA 2GRAA 4BMSA 4AJ4A 1YDWA 2X5JO 2PR2A 4HNGA 2AQIA 2OO5A 1P1KA 1GAEO 3AUUA 4BV9A 4I8XA 1DOHA 1PWXA 3O26A 4ZD6A 4MIEA 1I5RA 3A06A 1HYHA 4E5YA 2DVMA 4M55A 1VL0A 1PWZA 4RO0A 1MLDA 4FFPA 5ENDA 4M87A 4YJFA 1E3WA 2JFHA 4NQZA 3B70A 4NU5A 3VZRA 3WYBA 3PWSA 4CUJA 1LRKA 4LRSB 2B4QA 4R3WA 3JQAB 4D0SA 4BB5A 4E0BA 1HETA 1KY4A 3GFGA 3NRCA
chains in the Genus database with same CATH superfamily
1UMCB 3U62A 3IOEA 1ZRNA 4R9VA 2PZAA 3ZC3A 1NMZA 2FHSA 3RJMA 1LZLA 3N86A 2V6GA 5IT5A 3ECCA 5JAZA 2B1JA 2FRDA 3IE2A 3HA7A 1Y4AE 4J0CA 2HMTA 1M2WA 1M66A 1VFNA 4RKRA 3LDUA 1FYVA 1SEPA 1QHGA 2OAQ1 2PUJA 2BZGA 2WC1A 3HJTA 2O57A 2X23A 1OGYA 4OO3A 3KR0A 5BMVF 9ATCA 4RBNA 1JB1A 3TW4A 3NVKI 2V8OA 1DPFA 1J99A 1RKBA 2HC9A 4QPNA 4HZIA 4JU9A 2VNAA 3OCUA 2QRZA 4JUIA 1X80A 1IN5A 4ZAFA 2GBLC 1H93A 4YMLA 3H87A 1KJYA 3TQSA 2NAFA 4A8TA 1RJ9B 5LLSA 2J46A 3NHYA 1U9IC 2BFEA 1ML3A 1BC5A 2W83A 4BFCA 1D6MA 2VP5A 1DBRA 3GHHA 4KHZA 4P2GA 1RZVA 3N59A 1KEKA 1O9HA 3HY4A 3ITKA 1E7SA 1XZHA 1VBKA 3JV7A 3FPLA 3IILA 5CIYA 4WNYA 3WGHA 2VSNA 4RA6A 5JFTA 1VJGA 1F0NA 1KI3A 3L7OA 3GJ8A 3GXOA 3TOVA 5EUBA 2OZEA 1PGPA 5EJGA 3UMBA 3VV2A 4ENQA 4J4BA 4OREX 3L8FA 4D92A 1PSWA 4OP2A 3BORA 1RBMA 5KVAA 3E1KA 2HBYA 3UATA 1OMOA 3NORA 4NYIR 4NU6A 4GGOA 2XRFA 4UDOA 3KWJA 3FA2A 2G9VA 4ZXPA 1DEKA 1GPLA 1N75A 3MWGA 4TLLB 4DDKA 1FS6A 3AK4A 1ZK4A 5BSMA 3AONB 4S2UA 2MT9A 5TRTA 1RRPA 1OI4A 5A3SA 2G72A 4MVJD 4OXKA 3WNBA 4QOGA 3ZHYA 3LQ1A 4DZZA 1GZ3A 5BWOA 1SXPA 4L0MA 5JCJA 3JAWB 4L02A 4EHKA 3CO5A 2ZRHA 5H82A 1ULHA 1A3CA 4QXQA 1O8BA 4FQ8A 3LFUA 2R48A 4RENA 4D4MA 1COWD 2UDPA 1Q20A 1QGUA 2AKYA 4IDEA 5EZQA 4EHNA 2JFFA 2EHJA 2C8JA 1QGZA 3JVUA 4ENWA 3CZRA 1YZ3A 1R0BA 4KX3A 2XVYA 1O5TA 1JTFA 3LQKA 1EINA 1ORHA 3UCFA 2DEUA 4C9BA 4BFSA 3IDFA 2VDWB 3AESB 3N9IA 4L51A 4PO1A 3TCKA 4H7IA 1REQB 1TE2A 2RHWA 1Y8RA 3OFND 3FB4A 4D82A 1IIRA 1U9ZA 1X70A 3P7MA 4B3CA 3HBMA 2Q5QA 4KAJA 2D1TA 1J49A 3W1VA 5CA0B 3W5DA 1E5VA 2I6GA 4MB2A 2BCEA 5IMSA 2LKDA 4G5YA 3Q6MA 2BH9A 4NAUA 5I47A 3ADDA 2JG3A 2EW8A 2JHFA 4OBXA 4NZ9A 3D6TB 5LL6P 2K6GA 3VZDA 2ZS8A 5AVSA 2VWGA 1E3LA 4Q4CA 1FRVA 2Q29A 2Y9MB 1PR6A 1XHLA 3BHIA 2L2QA 3NHPA 2HAEA 4H6WA 2V97A 3IUNA 2EX0A 3EODA 1NG1A 3L04A 3L92A 4Y9RA 4Z99A 5DNVA 3S2SA 3UUGA 3V2UA 3LFHA 4B6RA 1KP9A 4EG3A 1QQ5A 2FWBA 3TZEA 4DQUA 3BD6A 4P0QB 2WWIA 2XCQA 4G9BA 3B7GA 3ESAA 4GIBA 3MBOA 3QV2A 3WGZA 3R77A 4ZDWA 1VPDA 2QMZA 3FMOB 2C83A 3EGOA 4LVCA 4KQ9A 3E9EA 1TW3A 4G0XA 1BQ4A 3H75A 4G5OA 4OJTA 3RYFB 1MQSA 2GNPA 4ZVTA 4OQNA 1CUSA 2QUHA 3T5GA 3HVJA 2V4ZA 1E62A 4KXYA 4KFSA 3BXFA 4ABTA 3L4BA 1N9GB 4R2MA 2JIQA 1WCXA 4JI0B 3WB9A 1VRCA 2P79A 5C52B 1OXBB 3TMKA 4CQLA 4DR2B 1E1QD 2Q2VA 1GNRA 4MDHA 4Z3KA 1NATA 3KR9A 3QTTA 3RIXA 1FXUA 1OW3B 3I05A 3LECA 3PX3A 1ZI8A 2JEOA 2RI0A 1WEHA 1CKEA 1WCYA 1DXQA 2JLCA 2PYZA 1IMOA 2XODA 4NZZA 1YC5A 5KSYA 5I7AA 5HIAA 2IXFA 3OIFA 5AJTA 5M3BA 4XWTA 5B57C 5FWXB 3T3EA 1A4IA 1TFUA 3KP1A 4FNGA 5EG5A 3E23A 1Q6ZA 3JQBA 1MNQA 1M73E 2JFOA 2X8JB 4PTLA 3ONFA 2QM7A 4YHBA 1JQ3A 1Z7BA 2HU7A 4BGVA 4RPKA 5KX5F 1G7TA 1RPTA 1UAAA 2LRHA 4IZOA 5L3RA 1JKXA 3MNFA 4HAWA 3SLRA 4P3KA 1GNVA 4KODA 3ZCPA 4AB1A 4B80A 5B4TA 3GLGB 1SKQA 2JC3A 4HHEA 4IX9A 1PQPA 4BQNA 1ARZA 6NULA 3VTFA 3NGMA 4WY8A 4HGQA 5JY6A 1BE6A 1DFGA 1N5RA 2VYCA 3T7SA 4BB9A 1RZ3A 1PR5A 4DDMA 4UVEA 1F12A 3H99A 4EJ6A 5LQJA 1ISPA 1JDBC 4MS3B 4JP2A 1QLJA 4F8YA 2R1VA 3QVUA 3SYNA 3JRNA 1KOJA 4FINA 4JENA 4RJIA 3RTCA 1ZU4A 3MWFA 3DVSX 5F9HA 1VL5A 4KLNA 2K2QB 3P9ZA 3QHQA 3UAOA 5E4YA 3WFZA 3WDKA 4RPLA 5LQUA 4AN0A 4ZMRA 4IQ4A 2BIFA 5FWAA 2ZJZA 5ESWA 1A9TA 1J9GA 3L7KA 4PNPA 1J8DA 2WF7A 1QHIA 1KTVA 2Y93A 2I3ZA 5EQDA 3I9V1 1BGXT 1CUWA 1U2GA 2LWIA 4GOLD 4E12A 4GR4A 5B3JC 5B6PA 5JCZA 2O7RA 2WM2A 3M82A 1ZVQA 3A05A 2GEDA 4REQB 3IELA 1T0HB 2OC4A 3IAM6 1H9BA 4JLNA 4YCLA 4GR9A 1NL3A 1ELOA 2DR2A 5CB0A 1RFGE 2P7IA 4OHOA 3U0VA 5I7SA 2KMLA 1ZD9A 1T8PA 5KQRA 4WJZA 2JD2A 1R6TA 3BL6A 4U3JB 4AY6A 3HBFA 2W8ZA 3P9SA 3UHAA 2ZUCA 1NZJA 3AG5A 2LCQA 5DJ5A 5JEEA 2O1SA 5ALVA 1KMHA 5BRAA 4PEVA 1D7OA 2W6ZA 3UB4A 4DMHA 3PHIA 2ZWIA 1SURA 3NM4A 4GU5A 3OUTA 1NQVA 3DL0A 3TOSA 1PUXA 1Z4PX 4X6XA 1K86A 5COQA 2R8RA 1X15A 2WLTA 1G8YA 3GVIA 5DEOA 3SIRA 1L4YA 1UJNA 4ZOLA 5HCUA 3UW3A 1EP1B 1ZD4A 4N8DA 1A88A 2FWIA 4UNSA 2C9ZA 3G8BA 1P3Y1 3FBWA 1A5BB 4LY6A 2C5LA 2ZOSA 1T5IA 1IY1A 3JQGA 2C2ZA 2C8VA 4XX0B 5B3LA 5MN4A 3U4MA 1GILA 1ISMA 1I6LA 1XPRA 2PH7A 4V1CA 2R68A 5JAHA 4PSVA 4J76A 1CF2O 1JU3A 2VJOA 2Z1NA 5FNZA 4UUPA 3CF4G 3DJFA 2PQ0A 3D31A 4JYMA 1VBNA 3C70A 3RWOA 1M1ZA 1AGYA 5TVGA 1W25A 1A4RA 3GRYA 1L1EA 1JEYB 2AK2A 4KTVE 3A4YA 3IDQA 2C7PA 1ZH6A 4L16A 3DOIA 4G5HA 4OAPA 4XWGA 1ADGA 1AUOA 2L82A 3NH6A 1D4AA 1KYTA 4TMVA 4X1IA 2AN5A 3UUFA 5FAKA 3R4VA 3U1BA 3E7XA 4KITB 1GZHB 5IK2D 3ESDA 4LF5B 3R40A 3C98A 2ETXA 3HCFA 1FOEB 3OU6A 5J40A 5I7RA 4C3ZA 4DV4B 4BGEA 3PHGA 5COAA 2I1LA 4O2LA 2WDPA 3BULA 1L5HB 1AT1A 2YASA 5E0OA 1PEYA 1Q7RA 4IIEA 1TM3E 1E8MA 1JEOA 1UMDB 2HSZA 2J3IA 1QF7A 2DT5A 4JQCA 1NVKA 2PEYA 3TGWA 4YMVA 1FY2A 2LNDA 2Y1FA 4MRMB 2C7OA 1NOKA 3I1IA 2CD9A 3U5TA 1F6WA 2Q3CA 1WUTA 4NZNA 2BMDA 4CFZA 5JSQA 5DE3A 4MIYA 1CQIB 3VXKA 1T9ZA 2ZS9A 2FVYA 2VRCA 4KQHA 2G0AA 5J63A 4PHCA 1I7SB 1GZ4A 1PS9A 4BKOA 3AUKA 5BSFA 2QG4A 4AO6A 1XL1A 2PMDA 1R8YA 5BMVB 3K5IA 5I7EA 5SZHB 2PLNA 1V41E 1MRSA 3HGMA 4L3VA 5FT9A 2QL7A 2O0JA 4EFMA 4KYUA 4AZ3B 5JS2A 1ZR2A 4CEIB 3ZI7A 2GHQA 2A78A 2Q1XA 3QKRA 3QHAA 3KE8A 2PKWA 2XVZA 4EZEA 1NJ1A 5B7PA 1KS9A 3QPAA 1VLQA 2FDCA 4DA7A 2EQAA 5BR8B 2WWHA 1GNQA 4LZWA 1Q7TA 2H2HA 1AUPA 1Z17A 4MWGA 5EPUA 1JQ5A 2VK1A 3E05A 5A7GA 1GYPA 4M21A 3NCHA 1E32A 1P39A 4FR2A 2PVSA 2FEOA 1P5RA 2ZIGA 5I3CA 2ODNA 2XPCA 3E0XA 4D4GA 1MIOA 2C1ZA 2JW5A 3SCZA 4RTPA 1QIGA 3H9GA 1P9LA 1NYQA 1UP6A 4Z4QA 3G88A 1I4EB 2YW9A 4LYYA 4Q18A 2I78A 3AT1A 4BLPA 4D25A 4K6KA 5KYYA 3KQOA 1XAIA 3DTVA 5BMOA 1ZD1A 2JANA 1NWHA 1N6PA 3GLIE 3W5VA 4LXGA 1O87A 1SN7A 4W4TA 3I92A 2P1ZA 1T2CA 3SFZA 2YQZA 4QULA 1BKSB 1V3VA 3PJDA 4KQWA 1ULZA 4Q6WA 3Q8LA 2PXXA 2Y77A 4TTAA 3ROXA 3UAVA 4DIEA 3PHLA 1FJGB 1Z0SA 2FFQA 3ZGLA 5FTWA 1R8XA 3RU2A 3JD2A 4X1YB 1D2CA 2OSBA 5AKKA 3HYTA 5AMXA 1AS3A 1TQDA 4MWDA 3W7AA 2HT6A 3S2GA 1GKIA 4U9IS 3WIBA 4E5VA 3MS2A 4W8HA 3T7RA 4MWBA 4Q01A 2DQYA 3S0JA 1BWRA 3ENNA 4HGPA 1UBNA 4UNRA 1E7WA 3AUFA 4B9AA 2OZLA 1BOFA 3UKJA 4AY2A 2PUDA 1U28C 2FJUA 3B6EA 3HWSA 1M34A 2N1BA 3NC1C 4BXOA 2JZOA 3J80A 1H5NA 3OJ0A 4JELA 4W99A 5FPYA 3SF8B 4IIFA 4BAUA 2R44A 2XDWA 3LRXA 2BOVA 1HQDA 3MJ4A 4ZT4A 1HFWA 1NQWA 1Q11A 2E6UX 3KZVA 1N8KA 3F49S 2WTNA 1Z56C 3IB6A 4Y98A 1R3UA 2JZNA 1GZ5A 1RJDA 5ES4B 4BLSA 4QBTA 5JZBA 5LVAA 1E3DA 1JLLA 1KEUA 3SXPA 1CNEA 2ZE6A 4BE4A 4RCZA 1SJ9A 3QFRA 5F33A 4BNIA 1V8ZA 3I9MA 4J07A 4IDGA 3Q85A 2XA1A 3V00A 4JOCA 3CT4A 4G84A 1SRQA 1GQQA 1JHVA 3BE6A 4F4HA 3EZNA 3S29A 1E9EA 2ZTLA 4Q3OA 5LYJA 3SGLA 4JROA 3Q3EA 1JX6A 5IBQA 3VRHA 2C98A 2WIJA 4UHJA 3RE1A 1HG0A 4LDAA 4Q4HB 2ATEA 5D3MB 4PO3X 4R1UA 3EASA 3CB4A 2VIIA 4BC0A 2R79A 4ENRA 1FBNA 2HCTA 1AN0A 3H2GA 1GITA 3ORQA 2IIBA 2VDRB 3C4QA 4BB6A 4GYJA 4B75A 1WZNA 4F11A 4CRWB 1UQRA 3P2IA 3OF3A 5IABA 4HL6A 3AM4A 1P0IA 3UAGA 1IC6A 1X19A 1N8SA 2VSOA 3DV0A 3DKPA 3CF2A 2GA8A 2EP8A 3F7TA 4HQ6A 4EO7A 1HNXB 4X9XA 2XLBA 4I4NA 1C9YA 2FSHA 3KUUA 4JQOA 4M1QA 1ZOSA 1JEDA 1GV1A 1SA0B 4PW0A 4AS3A 1P5ZB 1DAIA 3TFOA 2ISQA 2YIVX 1W96A 4IYRA 4BECA 1E4EB 4DB4A 2OWEA 1GAJA 3SYTA 5JT1A 1BCRA 1RACA 1TK2A 3AUTA 5ECYA 5L9AA 5DW0A 1LZKA 3D6AA 2W8BA 2OCKA 2CLEB 3I2GA 3DR3A 1A2OA 3KPVA 5AJHA 4BRWA 4CF5A 3DBRA 2IEIA 2WHYA 4LBVA 4RJKA 1MNAA 1KZ7B 1Q83A 2GKGA 2HMVA 2WSBA 2UYCA 1PDVA 1SCQA 2ECKA 3PC4A 1RZRA 3CPHA 3R7WA 2IYXA 2AN3A 5EZ5A 1IOLA 1L4NA 2I2DA 5U1PA 4XQGA 2WYOA 1JEQB 3C6ZA 1JIQA 2FW8A 2IEBA 3NGXA 3PGKA 3X1XA 2YRFA 2H6EA 2QB5A 2XTAA 3G7NA 4H1HA 4JLPA 4KC0A 5LIPA 3C3KA 1JEJA 3HZRA 1A8SA 1ONBA 4V2IA 2R4TA 1V37A 1ST3A 3FCSB 4QM6A 5EWLA 5DX1A 2WF6A 2PXHA 1Y80A 1SXJA 4OLFA 3SICE 4ATNA 2Q5JA 4EL5A 1NJSA 1D07A 3NZEA 3OUZA 4M38A 3X1DA 3E1SA 1IXSB 3MINA 2X4IA 3K32A 2V7BA 1ZN8A 3O31A 4XFDA 4O1MA 4PGHA 4JJKA 4PNEA 3ZYZA 1JT9A 1J33A 3B3AA 2VN8A 2V5VA 1K5DA 3EUWA 3FXAA 3SSOA 1RKUA 3CZ9A 4K81B 1GKLA 4N40A 4YPVA 2OHXA 1KOFA 5EUCA 4HXGA 1ND6A 1SXHA 3IA7A 4KPFC 1PG5A 4S24A 2OTCA 3RF6A 4C7BA 4YMSA 4HNTA 5J4VA 3SIPA 3DMYA 3QVXA 2GZSA 4JUFA 5GADl 1CZUA 1QS0B 4IJUA 4DY6A 2QMOA 4M9ZA 1X1TA 4ZOCA 3VDMA 3G0HA 3WYFA 5K4GA 3SHQA 1LS1A 4MKRA 4O02B 2VHEA 4EY8A 4B73A 1WDMA 2OGTA 3DE0X 4D4KA 2IPLA 3M5CA 1NMSA 1LTQA 4QXRA 2XJ9A 5FL7A 4CVNA 3K9FC 4CI9A 3AY3A 1Z4JA 1VLJA 2REOA 4YJHA 3A6DA 2P35A 4OI1A 3DA8A 3SSAA 4ARZA 4DUZB 5IHXA 2YMLA 1VZ3A 5CVUA 1UINA 2FFBA 1MW9X 5AKGA 5TXGA 3WC4A 2Z3WA 2RC6A 2YZ7A 3EZLA 1UPXA 4MIOA 1G21A 3JQAA 4KYTA 2A0KA 4XX1A 3KZXA 1UMKA 3KYBA 4R0VA 5G2OA 5KNBD 3HSKA 5BWLA 5FV4A 4LXQA 5HF5A 1O77A 1EP2B 3W05A 3IHKA 3ESZA 2V03A 4JDUA 3VDQA 2MSWA 3IVXA 1B23P 3P2YA 4GPEA 3PQDA 4MVJI 4I9FA 4IQ8A 4UM9D 2G1PA 4LHYA 4KQJA 3FHJA 1N7GA 3GJ0A 4L9WA 4PO8A 1RWKA 5F52A 1LVHA 1J2UA 4CL8A 4D8XA 5JVDA 1OHHD 1Z0KA 2ZBDA 3CCBA 2YXDA 2WVJA 1NFRA 4F2PA 4CM3A 4C4SA 4IFIA 4R2IA 4CMGA 5CFNA 1Z0ZA 1ND5A 3WGKA 3ZJUA 1MD9A 4RETA 1CDEA 3AR3A 3IPCA 5JANA 4OQLA 4AUEA 1E5XA 3KSMA 4P31A 1VYHA 2DFNA 2WAXA 3TLYA 3ETEA 3KYCA 1NJ8A 3LY7A 3THSA 1YB7A 3AVOA 3IP5A 1CJUC 2FOIA 2P0YA 2ECOA 2OBNA 3NTVA 3M33A 2WY2D 3TZHA 3PFWO 4BRZA 4MI1A 2OVBA 2J31A 4E32A 3ZHXA 1PBTA 3W8NA 4F86A 4ZOBA 3K4QA 1T4CB 1TAQA 2AHRA 4NV3A 3VNSA 3IT2A 2AIRA 3T3DA 3NFRA 4JLAA 2HDNB 3OOHA 4OTZA 1V1MA 1NP6A 4DRXB 2SECE 1GCAA 3I01A 2UZAA 5D01A 3DM9B 2Y27A 4WK6A 5DGIA 1Q74A 1YHNA 1IRXA 4QDTA 1DP4A 1QOPB 4MB6A 3SJAA 4G1FA 1VI6A 1ZH0A 1OLUB 4MKXA 2J9YB 1W88A 1HE1C 2EGUA 2IDKA 4ITUA 4JHXA 4DREA 4MGIR 1K2WA 2C20A 5I4BA 2OKGA 2QYTA 4M99A 1DFHA 2PS1A 3SKVA 3ZS8A 1YRHA 2ZU0C 1SHZA 4D02A 2F8SA 1XAGA 2G08A 2HGZA 3GLSA 3VVMA 2UVDA 3K0KA 5CCEA 4JI8B 1HWYA 1THGA 1YVUA 3JQ8A 3UJ9A 4HLCA 1XRQA 5DHFA 4BNYA 2Q0HA 1FYWA 1G9SA 2FQYA 2RBEA 3AGPA 3IDOA 3MEQA 5ETJA 5AVKA 1U8YA 2RK4A 4R1LA 2JFWA 4KQFA 4QXOA 5DHPA 2P6NA 4LRWA 3TR5A 5B4VA 2YWHA 1J0DA 4NLLA 1MV5A 5E2AA 1A9ZA 4PFQA 1E7MA 1SPXA 3PVZA 2IS6A 4HGRA 3FPCA 4ARUA 4RJTA 3EMVA 3OIDA 1IATA 3C8ZA 3CX8A 4NU0A 4YO8A 1LV7A 1C9MA 1XDZA 1AM4D 2J33A 2PBRA 2QTFA 1DV2A 3EIXA 5BURA 1KK2A 5HTOA 3GEBA 3I01M 2ZE5A 4PAGA 3NQ41 1T0BA 1C30B 2AJCA 1XMSA 3JYHA 2X2FA 1B7GO 4DCCA 3DWFA 5DYIA 4UU7A 4DLWA 3QX9A 1R0CA 1TNDA 3T9CA 1FU8A 4CM8A 2GJ4A 3WSTA 3WWOA 3AC0A 3GZTB 3KQWA 3KOMA 3OEEA 4Z0HO 3AKYA 4KB5A 4W7IA 4HX5A 3T1QA 1U4OA 2WINI 3A3PA 3ENVA 4HLDA 4D9NA 1L6RA 3LUGA 4DBVO 3L1IA 2AOTB 4D26A 4GNRA 3ANXA 4AYWA 3KD3A 2A92A 1ESDA 4K3VA 5GV8A 2DF8A 2RC5A 1K8XB 2G5GX 1ADYA 2GETA 3O0DA 3OCZA 4JFAA 4JT2A 4QBFA 4XPZA 3WDLA 5KINB 3NOXA 1FFAA 1BYIA 1EUYA 3WIDA 2WJVA 4ZWNA 3G6KA 1XDUA 1Y4ZA 2YINC 4BMYA 4RSMA 3OLYA 1K89A 5BOSA 2UAGA 3CVVA 2MWMA 2O6LA 1LK0A 3COSA 3QVWA 4QGAA 2ZROA 1FLDA 3LCCA 4IG4A 4QXMA 3M1LA 3ZHUA 5J2UF 1II0A 4OLBA 3BRWA 5CDTA 1QHEA 1XFAA 1VZ2A 3C48A 4QDUA 1PQWA 3S5UA 2VF8A 4CETA 2R84A 4QVGA 4BEBA 6REQA 3TNFA 1AH2A 3LLMA 3IEUA 1QRSA 1JDUA 2XKJE 3WBFA 2DECA 4EG1A 1M5RA 3PYLA 4I2NA 1SCDA 3EPPA 4I55F 3DDOA 2WQ6A 4DR3B 1EK1A 5I9TA 3NPAA 3GVPA 1SVLA 5FOXA 3E7PA 3THOA 1HEYA 1NXXA 1XF1A 5C51B 2BFBA 1K1EA 2QJTA 4G36A 5JCJD 3NM6B 2R8BA 3O4VA 4LK3A 4CXMA 4MV6A 3WJ1A 1DC6A 2A3RA 2CXRA 4G89A 3KL2A 4YALA 1V1RB 3CZAA 4ZV9A 2GEVA 2A14A 4CPDA 1SUFA 4QSHA 4FHGA 2W2TA 1P17A 3CZPA 2D1YA 1GZVA 5B6JA 3MWEB 4MJXA 2DHDA 3T7IA 3KV3O 1U0JA 1WUIS 4RL4A 1TXGA 1VG9B 3W1WA 5E9AA 5K0EA 3ZD6A 2HXSA 4KNVA 4Z2AA 1U7XA 3SBXA 5LN1A 1OZHA 5FNVF 1EVQA 3GUZA 2H63A 1RR6A 1TKCA 5HVNA 3KVYA 2FSSA 3DULA 1X7GA 1XZLA 3WSVA 3MXOA 4EHFA 2IXAA 3C87A 4AL4A 1HMYA 4TKMA 1RQNA 4LRXA 3PKIA 3MAGA 4CKEA 3G1UA 3GROA 3Q3CA 4OYHA 4CNBA 4EATA 2DBVO 1Y6FA 2XB4A 1AMNA 3WZMA 5DTMA 3STXA 1E1LA 3MJSA 5DTEA 2A6PA 1PV4A 1KH1A 3TFQA 3CR8A 1MB4A 3GWZA 4KXNA 1YB6A 4D9FA 2PKYX 3BTVA 2MOKA 3C0KA 2COEA 3ZVKA 1OOEA 4ML3A 4P3NA 3DWGA 3UB3A 3PPYA 1M10A 2JDIA 4IRXA 5FPPA 2IKSA 4EQ6B 4DWJA 1TJYA 2PWPA 3AIOA 3H2BA 2JI9A 3IVAA 4M0CA 1KWKA 2WKSA 5K1SA 4NABA 2H1SA 3PDJA 3IKLA 2LZ0A 4LSMA 3RSOA 2PQ2A 1NMQA 1U1EA 3DAGA 3NH9A 1FU4A 4UOZA 4MVWA 2JCVA 4NJEB 5TQ0B 5CA1F 1K6IA 2FSFA 4AWAA 3EEOA 3CW8X 2GEBA 4MV5A 2FLVA 2V3CC 1JKJA 2DH6A 4DEVA 4YAUA 4X71A 4CMJA 3GLHB 3ZJVA 1NVWQ 4OHXA 3ZE6A 3U4HA 4TS4A 2EYUA 3IRUA 3VNBA 3EXIA 2HWYA 3UJ7A 2ET6A 5IJ0A 1U2DA 3E18A 2B0JA 3ANNA 4KFRA 4O4LF 3H19A 2KQUA 1R88A 1TUIA 3GNSA 4KMOA 1IE3A 4ZO4A 4F5ZA 4EELA 2PZLA 2BRUC 4YRDA 1K66A 1E1RA 1PJRA 4FHDA 4FCCA 2ZIUB 1B0ZA 1ZOIA 1Q1GA 5AM4A 3GDWA 5EY5B 4YRBA 3LQRA 3GVHA 2GJ8A 2GWHA 3I5AA 1KI2A 1CFJA 1O89A 1PJ4A 1MTOA 1RPJA 1Z6YA 3OFSA 5AHWA 1WXDA 4ZOAA 1L1FA 3M4ZA 1DQZA 3DMTA 4TX1A 3ROZA 2WTUA 1G2OA 1O8CA 5KJFA 4XXHA 2IDMA 3ZDCA 1JDBB 4Y6PA 3MM4A 1KFKB 3N2GB 1XD2A 1H23A 1IEVA 3L7BA 2M98A 3K1TA 1LB1B 4FCVA 2ZT8A 1M2KA 5ALIA 1MOPA 3H3FA 3OQHA 2C9DA 2CLHB 4NMHA 5FOQA 3EHEA 3G68A 2A1UA 4ZGWA 1YQXA 3T5MA 5EZ6B 1FRQA 3A2MA 1VE5A 3L0SA 3NT4A 3OAAA 4HVCA 3AYXB 1BRTA 2OUKA 1OXMA 3EC2A 5J4KA 3LC1O 3MA0A 4EAQA 1AA6A 4JBIA 2A0XA 1LPNA 2KE5A 3MGGA 4M53A 1WTAA 5EGSA 1EVIA 3EZ2A 2MTBA 2WK1A 2YH2A 3OKFA 4X91A 2E5WA 2A0YA 2I34A 2I03A 3OURA 3IVGA 5DWDA 2KI5A 2P77A 1NNSA 1R0YA 4ND3A 3JQ7A 5G3YA 4LMAA 3E3NA 2OXIA 1HRDA 4KEAA 3VGPA 2OK8A 3K1AB 5AIBA 5J47A 4ND8B 2H5EA 4IZHA 3PWKA 5TQ2B 1F2DA 5F7JA 4J03A 1F9EA 3W6PA 3SC2B 2VO1A 3UENA 1KYXA 3E5MA 3KUCA 3FNFA 1F2VA 2XZDA 2K2WA 4O2BA 2A9QA 4EPYA 2XE8A 4DMKA 3QEJA 3DSRA 4YY3B 3PFCA 1T9BA 3JXEA 5EUQB 5ALLA 1LF0A 4AJJA 1OGIA 1S7CA 3IAUA 2XUOA 1TM1E 3OLXA 2IYTA 1YJXA 2IUSA 521PA 4BVEA 5L3SB 5B1IA 3NAGA 3FRHA 4YASA 3GMIA 5EJ7A 3CRVA 5BSVA 5FWYB 2VUUA 3WAGA 2QLNA 2FRDC 3ETLA 3K0AA 3KQHA 1MGOA 2PWBA 4JX9A 5BN5B 1G7RA 1MO4A 1A8PA 1S3SA 5CTAA 2JIPA 3SR0A 3V32A 2F3UA 4WFKA 4XIGS 3W8RA 1I6WA 1OLSB 5F1PA 1F5SA 3U7EB 2G5CA 2YC2C 3PDIB 2I29A 1UWLA 3T52A 3BEOA 3L0DA 4NDZA 4YREA 5G4LA 1ZC4A 2OESA 1L3IA 1FC0A 3USZA 1XVVA 3S1SA 3SZGA 3NWPA 1V8PA 4PG7A 5JS7A 2ARKA 2YWXA 3JWGA 3KJNA 3KKPA 4GQAA 3EBPA 2WILA 4Y2QA 5JJCA 3AJ8A 5IT0A 3BXGA 1FX0A 1FDIA 5BQPA 2FUG6 3AFGA 3OVMA 4WLVA 1KRWA 2QVCA 1FYFA 5JSUA 4DQDA 1MF7A 4MS4B 3PRHA 3T34A 3VX4A 4URFA 5HS6A 1NVEA 2CHFA 3DNPA 2PZKA 3NHBA 1I3MA 1S2LA 5E6SA 2QNBA 3DE1X 1X1QA 1GKUB 1MENA 3FOBA 2VSFA 4O4HA 4V39A 2H2FA 3VUEA 3KT3A 1POWA 4R31A 4HN4B 4E13A 4IRMA 5KJCA 4PICA 1G8MA 4U39A 2IA5A 2QMUA 4EKYA 2WHQA 1N2SA 2P62A 2JGFA 2ZI7A 3JASA 1BHSA 3UT0A 3GI1A 2HMAA 2A88A 5AKEA 4QXAA 4R6XA 4EYQA 1WLYA 1NUAA 2V7TA 4LYFA 3ZJTA 1R74A 4POAA 3GAMA 3UXHA 1QO0D 3QWHA 1LA2A 1CR4A 2J9ZB 2VHUA 3K6JA 3VR1A 4MRSA 1OWOA 3E9MA 5IVHA 4DMLA 2I6FA 3P2KA 4OAOA 1GXSB 3B2QA 4AF8A 4KWIA 3M49A 1ODSA 4PSDA 1SB9A 2X7XA 3PG5A 2Y1DA 1AE1A 2J5BA 3PA6A 3WFIA 3E2MA 4OHMA 1Q21A 2QE7A 3A9UA 4UBNA 4YQYA 3R7LA 4DXAA 4MQEA 4I8DA 2VBCA 2REXB 3PXCX 4AIIA 3TG2A 5A3VA 3GUUA 1E0DA 2XUQA 4JB3A 1EZZA 2B8JA 5A0TA 1YDGA 4NWIA 4BE9A 3FIUA 2Q3LA 4OJYA 4DGSA 3I34X 3SBEA 1YZLA 2OCIA 1MB2A 2DWUA 3SM3A 1QYXA 4DMUB 1J5PA 1L5VA 3JAKA 4AJNA 5K0BA 5GAJA 3HJFA 5LUAA 5A0VA 1DXHA 2OCBA 3H5AA 4L7VA 1F2TA 5JARA 1X38A 1XMOB 1MORA 5LDGA 3SVLA 3STYA 2NZWA 4BWGA 3OTQA 3E5RA 2JBAA 1DJMA 5ALUA 3NT2A 5DH9A 2BEJA 4KN9S 4YJDA 5E3JA 4E5NA 4URXR 1CEYA 1PKEA 1N5JA 2BLNA 2FNAA 1L5ZA 1SKUA 2X8AA 1JG3A 3EXG1 4HVTA 2GZ3A 3AKCA 3EXAA 3L8HA 3D4BA 3IV9A 1ATIA 2XCTB 1W5SA 3OBIA 2YQ4A 2EVWX 2OY0A 4YLEA 1VXRA 4MV1A 4KQGA 3OZDA 2IHKA 1GL6A 5TJHA 3DMDA 4QYWA 3X3HA 5BT8A 3DTVD 3WGGA 2ZTHA 1B00A 3FNQA 5J2UB 2X77A 3D8NA 4G23A 4OK3A 4Q21A 1K97A 2I4IA 1O97D 3SDSA 3G2OA 2WJZB 3DEFA 2GARA 3U9SA 1G2QA 3SI7A 1QGED 5T4EA 3LJKA 2HPVA 4M1ZA 4QELA 1JV2B 2JH9A 2YZ2A 1SVSA 2CMFA 2DRIA 1DX6A 1MT0A 1QTRA 1NASA 1TQHA 3K2BA 4FNAA 1BD3A 4WFJA 3I8XA 5DN6A 1N1DA 4I55B 4J7AA 4DCJA 4ZIRA 1Q7BA 5D87A 2IYOA 3AG6A 2VEDA 2HCFA 4WI1A 3KQSA 1NYRA 3HSYA 3UC9A 4BFZA 4OUKX 2ZJBA 2VJCA 4YRQA 4AKHA 3FGZA 1C1XB 2O0LA 1NF3A 3AHIA 1UBTS 3G2JA 4GM0A 4Y2VA 1I4TD 2A0FA 3PGMA 2RHJA 4MJ7A 4YDHB 4YH1A 1E4VA 4KU4A 3F4KA 3ZU4A 2CWWA 2WG1A 4TT3A 3ISVA 3Q1LA 4DM7A 5AVTA 1QKJA 3Q5GA 4FNOA 4ETNA 1T10A 2B1QA 3AVTA 1BMTA 2NU9A 1J07A 4M88A 5A1JA 2ALJA 5M2QA 1K8QA 1Z08A 1QQTA 1GUZA 1DBVO 1O54A 4FYKA 3HDJA 4HB4A 4UU8A 4ZYWA 3UJPA 4OXIA 4RORA 2J9FA 2F90A 3CZMA 5EE3A 2G83A 1ZSNA 1YE3A 3SYMA 5F1YA 2P6PA 1C3JA 1CFZA 5KYWB 4KMSA 5FPTA 2PKEA 3PT5A 5HM6A 2Z57A 3W3AA 4MW7A 1T2EA 2EG9A 2QN1A 2XMRA 4LY3A 5FNVB 5JR3A 3ML1A 4HYEA 5EZYF 3Q9SA 5HF8A 4WZZA 3PNOA 1GDTA 1I32A 4ZKEA 2AX4A 1SQSA 3B60A 4AMZA 1GPNA 4EPTA 2Q27A 2VUSA 5GGYA 1AKRA 2B30A 3E9ZA 5FUQA 1CDDA 1ECCA 3I32A 4KZPA 4MW0A 3WLSA 1W5TA 5A03A 4PO9A 1GGHA 3WLMA 4B3GA 3KYDA 4R2JA 1L9KA 5DLYA 3P32A 1OZFA 4PONA 3EWIA 1W6UA 1UFQA 5JD5A 2DQ4A 3Q41A 3IHLA 3NUGA 3ZWWA 3NMUF 2PGXA 4I5FA 4EDFA 3GRKA 2NSYA 4B84A 1X3LA 1W2WB 3FETA 2KW5A 3FFBA 1HNZB 4H15A 5BN4B 3G9XA 4XCQA 2EWVA 1GGJA 4HVAA 2VR1A 4IVQA 1QPBA 4K6GA 3TLZA 3VR4A 4O1HA 4PLZA 3RHFA 3U17A 4AROA 4EPVA 1F7VA 5JD3A 4OJKA 4U7DA 5D3QA 1FVXA 2HWXA 4PLCA 3Q9UA 4CYMA 4EUEA 3AEUB 4I3HA 5HFNA 1A8HA 5CA1B 1U2GC 2YYZA 4Y2JA 5AXAA 3TSYA 4TKUB 4TVBA 4HDQB 2NV6A 1I7NA 2GCGA 2V58A 2PRZA 1Y1LA 4P53A 1W46A 1XXHB 1WZCA 2UUBB 1VECA 5E8RA 4BNTA 5DSXA 2VHWA 2V0CA 3A4VA 3PD0A 1A9RA 2IUFA 1I4LD 1P0PA 1YK0A 4UFNA 1F51E 2WYHA 1JSRA 4O4LB 1LX6A 5HWSA 2H5LA 1C9EA 2H9IA 2F17A 1NBOA 3EZYA 4FGSA 5TE9A 3BD8A 3CKLA 3NKFA 1NVFA 2GN4A 1DC8A 4GM1A 1U4SA 2V1XA 4MUKA 3PI6A 1E2DA 4EUFA 3AKZA 5F3WB 2VKTA 5DPMA 1Z16A 3ENWA 1OPRA 4QPDA 5E2IA 5EESA 1PG2A 4L6IA 4YCJA 3DEJA 3KQPA 2D2EA 1CEQA 1FSSA 3RTBA 421PA 3UJNA 3KZCA 4GLFA 4MYHA 4JI4B 2I7VA 1WOYA 3QX8A 4NI5A 1BJRE 3NIBA 1SXJD 4KR3A 3V4ZA 4B31A 3PGA1 1P1FA 2B7BA 1S0UA 4DIDA 5C81A 4QYIA 1DJPA 3EFEA 4ILKA 1AQUA 1C3XA 1CUGA 3GBVA 4JLJA 1ONSA 2WUGA 4M9CA 4O1IA 2AJBA 4QLOA 1PD1A 4OQPA 1QF6A 4G0WA 2PA3A 1ZVJA 2BGUA 1QORA 3CS3A 3DAHA 2DFLA 3LUJA 3OMLA 3WFJA 2JGDA 2FP4A 3RIHA 3H5RA 4NYMQ 3PZBA 4KIUA 4C7MA 4UTNA 3WLLA 1KO4A 2FUNB 1KU6A 2IIQA 3GQBB 1HSOA 1E5LA 1M8GA 2GO7A 4LNAA 2QRVA 4TL7A 5CDUA 3SJUA 8OHMA 1WQ1R 1XMIA 3BVPA 4OUDB 1EX9A 2XMDA 3RYHB 2VXCA 4PN3A 1UC4B 1KI6A 1Q1EA 5BP7A 2O8CB 1KI8A 2QAGB 2QTTA 5BWMA 3NDJA 1KRXA 1YRYE 3E3LA 1I3OA 5FL7D 2FX2A 3IP3A 4JMLA 4G8CA 1MVLA 1FB5A 3G1TA 1NXQA 2ZYRA 4V0LA 3EA4A 4UKDA 3NW9A 1KEVA 1YJBA 2XYQA 4TKVA 4MDEA 2BI7A 1DO2A 1CHDA 2QWXA 4UXHA 4J2OA 5KJ1A 3HDVA 4YP1A 1KF0A 3JQAD 3RKSA 1XD9A 2DR3A 3MS4A 5FHRA 1BQEA 1LDBA 1ENZA 1H2ZA 3F47A 3IUYA 4R8LA 1ZK0A 4XDGA 4HWKA 3RVBA 1OBFO 3Q0IA 5KC8A 2FPGB 1QHXA 4AECA 2G4LA 3OJXA 4RU1A 3QELA 2RCNA 4HS4A 1XQVA 2VWQA 1YMVA 3KR1A 4FGZA 3IOCA 5HUJA 1VMKA 3DTTA 5EP1A 1OI7A 4PAMA 2GJ9A 4RK1A 5HTKA 4MWSA 1II9A 2A5GA 2FH5B 3GYBA 5EHQA 1JW9B 5D85A 4LC1A 3RT9A 3VI3B 3NRBA 1USWA 3W2IA 3UV6A 1M7BA 3QFCA 1Z38A 4MO2A 4ZCMA 1ZIDA 5BYBA 1U2RA 2BFFB 1SEVA 1OX4A 8ATCA 2H4ZA 3BIFA 1YS7A 2VSYA 4I4LA 5A1TA 1JBEA 2XT0A 2IXGA 2DUWA 4HXYA 1PGNA 4GZMA 2FPIA 5E4FA 1D8AA 3M83A 1NX6A 2IF0A 3DVQX 1L7DA 2ZRCA 4YA6A 4BVLA 4LOKA 3QEMB 1GY8A 4B3JA 5KUTA 1D2MA 1Z37A 4HFJA 1RFLA 2O4UX 5HK9A 1TYAE 2FG7C 3OPYA 4OQQA 4BGDA 3QRWA 3ZDRA 3UA3A 1PS8A 2FKNA 3D3WB 4NCNA 1IVYA 2HLPA 2ZJ4A 4X7MA 2GNAA 2IUUA 4U2GA 4BLTA 1V95A 2JKVA 4ZRNA 2O3JA 1XK7A 4ZQIA 4KXWA 3RUAA 2XVAA 3JTMA 3IRVA 1TQ2A 2O23A 2QTHA 2BVNA 3CZCA 1O97C 1UIRA 2EATA 1ZD8A 2RHHA 1IZ9A 3QEKA 3IQWA 4BGUA 2VTBA 4MA4A 4NNOA 4MSUA 3HK2A 3G0DA 4JAVC 2WUVA 2O0MA 4E07A 3ONNA 4HOYA 4Q4AB 3K9LA 2X0DA 3DBHB 3KZMA 1CR6A 5NLLA 1H1TA 3P8ZA 5BR1A 2ZU6A 1QR2A 1EI9A 2II6A 2WF9A 4OH1A 1P1CA 1I13A 1E0AA 2WICA 3ZGNA 3PUYA 1VJRA 1BXGB 2GQ0A 2X0IA 3I4FA 3P9PA 4GZ6A 5DNYB 1HC7A 1P2UA 2Q9CA 2P6RA 2BMEA 5REQA 3WGMA 3WRXA 3EMDA 4RVNA 4NCBA 1ZCZA 1YE8A 1FUEA 2BFMA 4ZQBA 5B1DA 1PTKA 3MOSA 3LPMA 4PE5B 1R5BA 1MOZA 3DFUA 2E85A