1PS0A

Crystal structure of the nadp(h)-dependent cinnamyl alcohol dehydrogenase from saccharomyces cerevisiae
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
360
structure length
360
Chain Sequence
MSYPEKFEGIAIQSHEDWKNPKKTKYDPKPFYDHDIDIKIEACGVCGSDIHCAAGHWGNMKMPLVVGHEIVGKVVKLGPKSNSGLKVGQRVGVGAQVFSCLECDRCKNDNEPYCTKFVTTYSQPYEDGYVSQGGYANYVRVHEHFVVPIPENIPSHLAAPLLCGGLTVYSPLVRNGCGPGKKVGIVGLGGIGSMGTLISKAMGAETYVISRSSRKREDAMKMGADHYIATLEEGDWGEKYFDTFDLIVVCASSLTDIDFNIMPKAMKVGGRIVSISIPEQHEMLSLKPYGLKAVSISYSALGSIKELNQLLKLVSEKDIKIWVETLPVGEAGVHEAFERMEKGDVRYRFTLVGYDKEFSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Hypothetical zinc-type alcohol dehydrogenase-like protein in
publication title Apo and Holo Structures of an NADP(H)-dependent Cinnamyl Alcohol Dehydrogenase from Saccharomyces cerevisiae
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 100
structure length 360
sequence length 360
ec nomenclature ec 1.1.1.2: Alcohol dehydrogenase (NADP(+)).
pdb deposition date 2003-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ps0A02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1ps0A01
3C1TA 4CM5A 4NU6A 4YTEA 5BSFA 1LU9A 1Z6ZA 4IS2A 5TF4A 4CUJA 3I83A 4WCDA 2HUNA 1NAHA 1PGOA 1HF3A 4IJWA 1BWSA 3WX0A 2YV2A 4BL5A 4CV2A 2JFGA 3E9MA 4KUHA 5JXWA 3P2YA 1H0KA 4NJMB 4W4TA 2QRKA 3ZNNA 4K28A 4D3FA 2ZYDA 3GR6A 4NBVA 4DREA 1GZ6A 3PEFA 2XOXA 1NFFA 4WLFA 1P1HA 1PJ2A 1JAXA 3WQRA 3RUIA 3WBBA 3TFQA 1JKFA 4FS3A 4EUHA 3RC2A 4CR8A 1HEUA 3D0OA 4CMIA 3W4IA 3SC4A 3KSUA 3RJ9A 1VL8A 1XLTA 3JQAD 1BVUA 1ULSA 3X2EA 2WYVA 2Q3EA 3EC7A 4DIFA 3R0IA 4M49A 2Q2QA 5JMPA 1GYPA 4I9UA 4NI5A 5TLSA 1GPJA 2RAFA 4BNXA 4DLBA 4G65A 1HYHA 3RJ5A 1LDGA 3WGTA 1BW9B 4I08A 5GZ6A 3DBVO 2B4QA 5THKA 4LSMA 2CDCA 2PK3A 5FI3A 1YWGO 2GGSA 4KMSA 2OO5A 4K26A 5AYVA 3GFBA 2OMEA 4IZIA 3WYEA 1E6EA 4QECA 3B1KA 2P2SA 1H94A 1DAOA 1PQUA 4XDZA 4LW8A 3PQFA 1VE9A 1P74A 5IDXA 3HDQA 3PJFA 3AJRA 3BMOB 3V1UA 4YT2A 1ZKMA 4IDEA 3WFJA 4J7XA 2G82A 2BFMA 4UUNA 2GRAA 2OGUA 1U7TA 1WMAA 4H3VA 3AOEC 2TMGA 1MV8A 3PRJA 2BMAA 5JAMA 4DPLA 1CYDA 1RM4A 1UZLA 3LSYA 3AOEA 1H6BA 3WGOA 4J7CA 4AJ4A 2HQ1A 3DTTA 1HDOA 3RUEA 3T4EA 5KJ6A 3OH8A 3WXBA 1IUKA 2VWPA 4MVJA 1PZGA 3ZWWA 2GR9A 2O3RA 1JVSA 4GSKA 1U4OA 5K9ZA 1U8XX 1UXKA 4CLOB 3QQPA 1F06A 3WTBA 4BGVA 1LRKA 1S7CA 1W6UA 2X5KO 4I5GA 1JW9B 3RKUA 3C85A 3ZWPA 2NNLD 4YJFB 3RASA 3LT1A 4PLTA 5FEUA 3NJ8A 5I8ZA 2QHXA 2Q99A 3H5AA 2Y0CA 2JL1A 2WTBA 5HBRA 1NP3A 4NQZA 1HKUA 3L6EA 4MVJI 4BNUA 2CVZA 1ENOA 5AXAA 3PHJA 4YJDA 1BG6A 3GMDA 4D42A 4EDFA 4N54A 3HDHA 1K5HA 3I9MA 2JKVA 3EVTA 3D4PA 1QORA 4BO5A 1XYGA 3L6OO 4MIOA 4JN6B 3EMKA 4L75A 1P0CA 4CLHA 2VYVD 4IINA 1RJWA 2VT3A 1ZFNA 1HETA 1XR3A 4H15A 1I3MA 4E13A 1I0ZA 2V6GA 3LT0A 3PHLA 4MIYA 3I9LA 2O4CA 5I7FA 4L8VA 5ER6A 3RSHA 1Y5MA 1NASA 1R15A 5JY1A 4E5MA 4WKGA 3I9JA 2ILTA 1SOVA 3VVBA 4C4OA 3IUPA 4DMLA 3BMCA 2WEKA 4BQPA 5IXSA 2C59A 1DJNA 1JQBA 3ZW9A 2J3JA 2Y0EA 3V5NA 2IYOA 4Q3CA 4YCAA 1EVIA 2BHLA 2DAPA 4CM8B 2ZJ0A 5L9AA 5TT1A 1QSGA 4R5MA 4LCJA 3H2SA 3MZ0A 2DTEA 1MX3A 3BMNB 1V9LA 3DMTC 4HNGA 2BGLA 3SBOA 1KC1A 2CF6A 3QV1A 3NTOA 3GPDG 3A14A 1DIRA 4L73A 1PQWA 4RQUA 1QR6A 4E2YA 2O3UA 2DPHA 4FFLA 4E5PA 3DMTA 1W73A 3ZU4A 3LT4A 2WDZA 1BRMA 3H9QA 4U6SA 1X13A 2OBYA 3RBZA 1LDYA 3JSAA 4HP8A 2ZTLA 4QT0A 3N7UA 4ND1A 5C7IO 4I1IA 4AJPA 4RF5A 2JAPA 1IZ0A 5CDYA 1F0YA 3HG7A 4GH5A 3E5RA 3DZKA 1ULUA 3WYCA 3TWOA 4U8GA 1A72A 5CEEA 3PWKA 4XR4A 2H63A 4L4XA 2D59A 5K0ZA 2UV8A 1CQIA 3ON5A 1ZMOA 4W7HA 3OJLA 1Z73A 1KVUA 2NQ8A 2X6TA 3H6KA 2DT5A 2O50A 3RFVA 4L9RA 2AQ8A 4ZJUA 3G3EA 4L74A 4WLVA 2WD7A 4EBFA 1DLJA 3G1TA 2D5CA 1E7SA 2PGDA 4E3ZA 4RVGA 4DQXA 2Q2WA 1TB4A 4E2WA 1OAAA 3BMQB 3VPHA 5IN4A 4JROA 5BNFA 3JQAB 3EYWA 1IL0A 1YXMA 3JYNA 3S8MA 3T7EA 4GWKA 1X0VA 3MCVA 4TSKA 1EMDA 4PZDA 3U4IA 3LF1A 2NU7A 2CZCA 1GR0A 1Q0QA 1YB4A 3D4NA 3WLEA 3RFTA 1RYEA 2BLLA 4KOAA 3NX4A 1E5QA 1C1XA 4XWYA 3RUCA 4BHTA 2GN9A 1TT7A 3R3JA 2PH3A 4XCVA 2NVUA 2JCXA 4PG5A 3U4CA 1WDKA 2EEZA 3SLKA 2BKAA 3CMMA 3ENKA 1HT0A 4ZU3A 2PNFA 4A27A 4ZHSA 4WEOA 4S3MA 2X1HA 4CPDA 9LDBA 1PJSA 5TNXA 2BGMA 4XGNA 1UXJA 3CIFA 3MTJA 1QP8A 2ZATA 3GVIA 1EUCA 2PA3A 3OA2A 4PIVA 1U3TA 2CSUA 1E0DA 4BKRA 1A4UA 4LSWA 3ADOA 1H93A 4CM1A 3OIFA 4BMNA 4OO3A 1UAYA 4JNKA 3IKVA 1NPDA 3KXDA 4G81A 4BNJA 5CHEA 3EUWA 2AA3A 4PZCA 1JN0A 5DBFA 1EQUA 4E21A 8ADHA 2RBEA 1EDOA 2EP5A 3I23A 4GLOA 4ONEA 4QX6A 1Q1NA 1ZSYA 4OIMA 3C3XA 1I3KA 4J90A 2ZJ1A 3NEPX 2Q1SA 1GV0A 2E48A 4FGWA 4DBVO 5TRTA 1NWHA 2I5PO 5DBGA 4YAKA 1B2LA 3OMLA 1PGJA 3OEYA 1OBFO 1FK8A 3U62A 4DTIA 5KWEA 2PZMA 2I3GA 2Y66A 4R16A 2G17A 1HYGA 3DL2A 4GKVA 4Y6RA 2ZB4A 3NYWA 1YDEA 2PZLA 3E82A 1EE9A 1WW8A 1XKQA 3WIDA 3HN7A 4MJLA 1PTJA 2WD8A 3COSA 1FF9A 1CIVA 2D3TA 3PFFA 4YYZA 4BKUA 1ZEJA 3KO8A 1KY4A 4JIGA 4Y98A 2ET6A 3ZCXA 4PGFA 4A7PA 1ZK0A 3LVFO 2C20A 2FPIA 3RAJA 1B3RA 1Q7BA 4ROSA 1DIGA 3INRA 4RDIA 4XYEA 2H1SA 2RIRA 5IAAA 2VNSA 4CR7A 2VYVA 4CM3A 2EGHA 3TOZA 3E9QA 3AU9A 1RM5A 2GN6A 1ISJA 4RDHA 1M66A 4RLHA 1RKXA 4BNWA 3WG9A 4XA8A 1LRJA 4W82A 1DFIA 2BFOA 5KTKA 3WLFA 2ZQZA 2X0IA 2Y1CA 3C1AA 5T64A 1AHHA 3U9LA 5BSGA 3KZVA 3U5TA 4D0SA 4QFDA 1HE2A 3JYPA 3DFUA 1HTBA 2WYUA 5JO9A 3RC1A 2DBRA 3JD3A 1KETA 4ZQHA 1PJBA 1ISFA 5EIOA 2OFPA 3NDRA 4UULA 4WOKA 3ONEA 1R4NB 1YBMA 4M1QA 4OJNA 1XIVA 3KRTA 1E1MA 4WCFB 3QWFA 2ZTVA 3M2PA 1L7EA 1CERA 3ZH2A 3ZWAA 3NDJA 4GKBA 4ALIA 5TSDA 1HZJA 1YONA 4MIEA 4BKPA 2OHXA 3GAZA 3GPIA 1KEWA 2Y68A 5FFFA 1LC3A 3OECA 4GVLA 1C3VA 1P44A 5IDQA 2Z5LA 5FI5A 3GEMA 5B1YA 1ZK4A 4URFA 5HWSA 1SB9A 3TZCA 4G2NA 1JDJA 3E6AA 4M54A 5TQVA 1XG5A 5B4UA 2AG5A 2JHFA 5T8KC 4Q3EA 2IZ1A 3HUDA 1R12A 1NAIA 1PS9A 2EKLA 4TZKA 4UUOA 4OSOA 1YL5A 3DO5A 2J5KA 1ZW1A 1K6JA 1UUFA 5T8KA 4D45A 2OL4A 3MJTA 4J4HA 3FPLA 5F1KA 4RF2A 4MPDA 1DLIA 4ZRNA 4GX5A 4MVJE 3JD0A 2X4GA 3M1AA 2G5CA 2EKQA 3OFSA 1ZK2A 2D1YA 1WDLA 4ZQGA 2FSVA 1PGQA 3D3EA 1F17A 1T2EA 3CKYA 1H2HA 5I9MA 1SCUA 4YWJA 2BD0A 3PVZA 3ZDFA 2OBNA 5HS6A 4HBGA 5ER9A 4YAJA 2FSSA 2YQ5A 4UVIA 1I33A 4AJHA 4CMCA 4GWGA 3PTZA 4LCEA 2P5YA 4DYVA 3ZHBA 3BTVA 3TNLA 3AY7A 3V1TC 5CPFA 4BKQA 1VSUA 4ZD6A 2VHXA 3HB4X 3UXYA 4ZQEA 2IXAA 3AW9A 2W90A 4GAEA 4N18A 4E12A 3JQ7A 3EVNA 4RPGA 1Y8RB 2UVDA 2FZEA 1ARZA 4GVXA 4XYLA 4CUZA 3UFXA 3F47A 2EF1A 3QHAA 4YBZA 4B7XA 4ALMA 5L53A 4A03A 1FMCA 4PN3A 3DBLA 1AUPA 4AJKA 3DAGA 1U5CA 2QW8A 1P45A 3JQEA 3JQCA 1X1EA 1DEHA 3NT4A 4KWHA 4NBUA 4OL9A 4TKLA 3UUWA 4CV3A 3E5MA 3RKRA 5A03A 1TI7A 4HADA 4DQVA 3TJRA 3IDSA 4EEXA 3QP9A 1YOVB 4E2ZA 1ZBQA 4MP3A 2ZB7A 3UCEA 4LVUA 1YQGA 4LVCA 2CFCA 3QA9A 3AUSA 3GY0A 2YUTA 1QYVA 1V3VA 1XA0A 1IOLA 2O2YA 4GLLA 3LF2A 1XHLA 1SEPA 2HK9A 3FBTA 2OXIA 4NZ9A 3OQ1A 1Y1PA 2Y0DA 1ZUD1 4BO1A 2J3IA 1LDMA 2D0IA 3TN7A 1NPTO 4YJHB 1DBVO 2UDPA 4DWVA 4Q3NA 1O89A 3OSUA 3PDUA 5A9TA 3SLGA 1WMBA 4YRBA 3M2TA 5G4KB 3EAGA 2O4UX 4PFJA 3ROQA 2J3HA 4FQ8A 5AXDA 4XQ9A 3WWYA 1N92A 3DBHA 4ND5A 5IZCC 2EJVA 4IGFA 2E6UX 1D4FA 2FMUA 1KVTA 4R54A 4IS3A 3QWIA 5IZCA 2GZ2A 2Q49A 2VHWA 2Q2VA 3AY3A 4IPTA 5JSFA 3RU7A 3NTQA 2ZTUA 3T7CA 3ZW8A 4J0EA 1HE5A 1UZMA 1LRLA 3AI2A 4PG7A 4XJSA 5L4LA 2YV1A 4PVCA 4IQGA 3OIGA 3JQ8A 3PHIA 3TZ6A 1R66A 3RUAA 1ZXBA 3KUXA 3LQFA 2FR8A 1P3DA 5TT0A 1M76A 3JQ6A 5IDYA 4I9NA 3M1LA 2BFPA 3KLPX 4AJJA 6LDHA 1O0SA 4GX2A 3HN2A 1LX6A 1QRRA 2HCTA 2VHZA 4IQ0A 5I9LA 1SOWA 1PJ3A 1DC6A 1L7DA 4CLEA 1ZK3A 5JO0A 1LBEA 2VWGA 5C7LO 4UUMA 2VYND 4UVHA 4CM4A 3MJSA 4ZGWA 1Y6JA 4XYBA 4JJIA 4BO8A 5TGDA 4U0KA 3VDRA 2GZ3A 3EZYA 3NAQA 5CEFA 1BGVA 5MDHA 2Q4EA 1N1GA 2ZQYA 2OUIA 5ADHA 5EINA 4OMUA 4JXKA 1JLLA 1E7RA 2I65A 3H5NA 1G0NA 2J5QA 2G1UA 2YFQA 1YO6A 3F5SA 3GN1A 3I9NA 2FR1A 3RUHA 1JU9A 3NTRA 1ZIDA 1JVBA 5AOVA 2A4KA 4XD2A 3DBRB 1LDBA 4XX0A 1B14A 3RC9A 3MTGA 1ML3A 4HFNA 4R1UA 1GV1A 1UR5A 3WNVA 4J1NA 4D7AA 4RV9A 3W8DA 3KYBA 3A28A 3QVXA 4YPOA 2GERA 3AM3A 3O26A 2JJYA 1N9GA 1A71A 3SVTA 3ADPA 2NU9A 3SJ7A 3I3OA 1E3EA 2X8LA 2BRUA 4PCVA 3S2GA 1XEAA 4J2OA 3ZWMA 2FHSA 4GX1A 5LDGA 3Q2KA 4KQWA 5ITVA 4XR9A 2Y67A 2IODA 3GLQA 4NU5A 2G76A 1LI4A 3OQ6A 1NTOA 4H7PA 4IGEA 3HZZA 3GVHA 2V6BA 3H9EO 1YS4A 2W4QA 1ZJYA 4BNIA 4RORA 5KJEA 3VPXA 1R4MA 5DDIP 1ZCJA 5L51A 1EZ4A 1R0KA 3L0DA 4LGVA 2XPCA 1DXYA 1GCUA 3ZWNA 4BGEA 5EESA 5EPOA 2CD9A 3GRKA 1T2CA 4WNCA 3WSVA 2Q50A 3TQHA 3AUUA 3VH4A 1F8GA 3KTDA 4QO8A 3GGGA 1E1NA 4TRRA 2XF8A 3PGXA 5KCZA 2PV7A 5EN4A 4NH4A 3ZN2A 2W2KA 4ZICA 4JK3A 5ITWA 5JAIA 3QVTA 3S1LA 3S2EA 2WWRA 2YHUA 1B7GO 4RGBA 5EMHA 2JFHA 1ADGA 4DL9A 5J23A 1BSVA 4CV1A 5JAZA 4RF3A 2X23A 2DC1A 1ZZEA 1QLHA 4KTTE 4BNNA 3O03A 1BVRA 1LLDA 2PD6A 3L4SO 3PPIA 1YL7A 1X7HA 2AEFA 2YFHA 5F3RA 3L9XA 1T2AA 1A9YA 1VJ1A 2NWQA 5G0TA 3JCZA 5F5NA 1LQUA 1NR7A 2O3QA 4DC0A 3PK0A 3DTYA 4NJMA 4HFMA 1NQTA 5JDIC 3ANMA 2DBZA 2IEDA 4ZQBA 4CL8A 3VAZA 2DQ4A 5JDIA 2SCUA 4IXTA 5G0SA 2X9GA 3W6ZA 3P7MA 4XB1A 4BOYA 1QLJA 2VUUA 4CM9D 1UAGA 1DRWA 4N5MA 4CQLB 1YL6A 3QRWA 3K2BA 4DPKA 1GYQA 1GPDG 3OJ0A 2PWZA 3HQ4O 3Q2IA 5TIIA 3PP8A 3RBVA 5U4QA 3Q6IA 3DR3A 1P9LA 1Z74A 2B5WA 2QZ9A 4RPJA 1I01A 1BW9A 4XB2A 5B37A 2H6EA 2VZ9A 1DPGA 3JQFC 1H9AA 1V6AA 4EGFA 4IMPA 2NSDA 1YKFA 2O48X 3JQFA 4CLDA 1DHTA 1IHXA 2FRDA 3PYLA 1IPFA 2DTXA 3B70A 3DAFA 4RVUA 1U8FO 5JLAA 4DXHA 1GADO 2FY8A 4WGGA 2VN8A 4AFNA 1V35A 4BB5A 4XGKA 5FF9A 3BMOA 1Y9AA 5KVVA 3HNPA 3G17A 2H9IA 3AM5A 4R9RA 3RQSA 3I4CA 4L0QA 4J7UA 1IYZA 4YJGB 2PGJA 1NHGA 4OYRA 3GNTA 1UZNA 3DOOA 3RCBA 3ZWBA 1WLYA 3WDSA 4IDCA 3RUFA 4E0BA 1PS8A 4BNKA 2AE2A 3F5QA 1VLLA 5A3VA 2NV6A 4B7UA 5K1SA 3RD5A 4J9UE 1PJCA 4RPHA 1U7HA 4NJOA 3EW7A 1D1SA 5TJ9A 1Z82A 3GK3A 1BXZA 1GZ4A 4XGIA 1M67A 2IZ0A 1DIHA 4CLOA 4NK5A 1MC5A 3GDFA 1NHWA 3FNFA 3Q9UA 1DIBA 2Z1MA 5EQDA 3TDKA 5H81A 2Q1UA 3IC5A 3ZZNA 4DC1A 1FDVA 3KYDB 5G0WA 2C0CA 2C7VA 3U49A 4Z9FA 4MVJM 1TEHA 2QZZA 3CZMA 1ENYA 1YBAA 3LLVA 3PQDA 2O7SA 3PJEA 4FIZA 1GUFA 5I9NA 1E1KA 5L40A 5KNLA 5JY6A 1VL6A 2B35A 2FN7A 1EVYA 4C7JA 1NNUA 2AEMA 3SXPA 3DZGA 4P4GA 1DC4A 4D43A 1WP4A 3CE6A 5IG2A 5JYEA 6ADHA 4FDAA 2HMUA 2FPGA 3IMFA 5THQA 1HDYA 3LC1O 1N7GA 4RVHA 1NVMB 1LSJA 1YJQA 2YY7A 2BI7A 1DFHA 2HMWA 3H5RA 3PXXA 4R41A 5T5QA 4EW6A 4PRLA 1BXGB 2JCYA 1ISMA 3UN1A 3GNSA 1QV6A 1NX6A 3RI3A 3PHGA 4IIVA 2J3KA 5C3MA 2O3TA 1E7YA 2I3AA 4MKRA 2O7QA 5CFZA 2W2LA 1SBYA 3ANNA 3ZGYA 1LLQA 5ILGA 3TRIA 5CDTA 2X0NA 2FR0A 2JD2A 1HLDA 1TT5B 2EV9A 3LLSA 4CM6A 3L07A 4FB5A 1WPQA 1N2SA 4NHEA 4PLFA 1LC0A 1IE3A 1ISHA 4HXYA 3ASVA 2WM3A 3S2FA 1IHYA 1PWZA 4IBOA 3O38A 4CM8A 1DIAA 1TVEA 2JFFA 3NGXA 4YRDA 5L45A 3D1LA 4J1SA 5U1PA 4BO3A 4CMHA 3FI9A 3RROA 1U9JA 2PLAA 3BMNA 4MO2A 1D7OA 1KOLA 4Z0PA 3D4OA 3GVPA 1J49A 3FN4A 3HFGA 5HTOA 1C1DB 2XXBA 5CEJA 3ZWOA 2VTDA 4UUPA 1YQDA 2HAEA 3W6UA 3WICA 4LISA 5KJFA 2NTNA 1ZEMA 4RPKA 3WTCA 4IDAA 1WZEA 4JBHA 4W6ZA 3VPFA 1SEVA 4Q39A 2I66A 5KVQA 5KOIA 4D0RA 3EGOA 4YB8A 5A1TA 5LDHA 3V2UA 4BNYA 3UCXA 4WK6A 4BGIA 2R00C 2P5UA 1N1EA 2NU6A 1GEEA 2P91A 1D8AA 1H6CA 3EDMA 1FDSA 4BNHA 1A7KA 1MFPA 2R00A 1T1SA 3BXXA 3CMCO 4YAGA 3DONA 1P1RA 2I99A 3L77A 3PYXA 5DP2A 2EKPA 4HFRA 1RPNA 3OETA 1ISGA 1YVEI 1T4BA 4YT4A 3ITKA 3DZIA 1UXHA 4TVOA 4PLZA 3OJOA 1H2BA 1I2BA 1PWXA 1VJ0A 3FWZA 2GNAA 2HMSA 3BMQA 5JYDA 3JQAA 1B3BA 1MG5A 4YDRA 3KOUA 4GGOA 4CM9A 4UVEA 1OOEA 1CEQA 4J43A 4BNZA 1LLCA 2Y1EA 4OM8A 3OP4A 1B8UA 4QSMA 3WGYA 4YR9A 1W0CA 3KYCB 3WYBA 3VC7A 4CQMD 1G0OA 1HDGO 2NUAA 4WUVA 1YDWA 4XQGA 3DZHA 2C5EA 2VCYA 3UAGA 3WSWA 1YGYA 3GA0A 2GDZA 3BTUA 3GZ4A 4MKZA 1KC3A 4FFMA 4BO6A 2P9CA 5GMOA 4EJMA 4UEJA 3CEAA 5DF1A 4EUFA 3F46A 1SAYA 1A9ZA 3CUKA 4Z0HO 3PWZA 4R69A 1GAEO 4YQZA 1UH5A 3BA1A 1QYCA 4Y6PA 5LCXA 5A06A 4CMEC 4JGBA 4J1TA 2FPPA 1ISIA 4O5OA 2GD1O 3K92A 5H82A 5L7TA 4CMEA 2P4HX 5JC1A 4CMBA 4O63O 2X7HA 4M86A 4MOWA 2DFVA 1P1JA 3HE3A 5KJCA 1T26A 2O3JA 3PLNA 3GFGA 2CVQA 3R1IA 2B83A 2VT2A 5KKAA 4JCOA 3MJEA 2PKQP 2AQKA 4IDBA 5KIAA 1Q7GA 4IDFA 5TX7A 3FPCA 3WS7A 1Y7TA 5C7OO 3TZKA 5IFLA 3OBBA 1JAYA 2D8AA 2DTDA 1XU7A 3DZFA 1GL3A 1O5IA 2Q45A 4XRGA 3C24A 1KYQA 5CDUA 7MDHA 1DRUA 1F14A 1UP7A 2UUPA 1Q0LA 4OKIA 2HMVA 1PQPA 1MP0A 4WECA 3I5MA 4K6CA 4M87A 2XXJA 4YQYA 1EBUA 3WJAA 1VKOA 3ZNPA 3HFSA 3FD8A 4Z6KA 3ENNA 1ADCA 4Z9YA 4TRJA 1X0XA 3CINA 3E8XA 4UEOA 1NPYA 4IY1A 4NDNE 3KB6A 2YZ7A 4OXYA 4BKOA 4U5QA 4QFCA 2YW9A 5F5LA 3F4LA 3INTA 4X54A 1Q7CA 3LT2A 1P77A 1K0UA 3ZWXA 3UCFA 1HSOA 1RYDA 3IJRA 3IL2A 2CDAA 3FBGA 5I7VA 3JYQA 1YE3A 3ZI0A 2VRCD 2PZJA 4M55A 1OC2A 1X14A 3ONFA 1SO8A 3NDIA 3G0OA 2GUGA 4OQYA 4Q3AA 2X86A 3LZ6A 3IS3A 2J8ZA 3RBXA 3ULKA 3HB5X 2EG9A 3OIDA 3ABIA 3HHPA 2VNAA 4CLRB 1BTOA 5CP8A 4WEQA 4E6PA 1Y8QB 4DRYA 3CTMA 2C2XA 3DDNA 2UAGA 3G1UA 4WCFC 4YT5A 1PS0A 1ID1A 5COQA 1R4NA 1A7AA 1LA2A 5T67A 3WB9A 1PZHA 3MJ4A 3QJ5A 2V6FA 5JPIA 4AJ2A 4WCFA 3VKVA 2B36A 2GYYA 3E18A 1MG0A 1DSSG 4YA6A 4BNMA 2ZTMA 1FDUA 1FDWA 4W99A 1PZEA 1CWUA 4QO7A 3H9JA 1PL6A 1IB6A 1XGKA 3KLMX 4Y6SA 5FYDA 1B0AA 5I8WA 3BIOA 2IZZA 2EHDA 1EEHA 1TLTA 3AI3A 3TL2A 2VHVA 3KEOA 4B79A 1HSZA 5A9SB 2R6JA 1UP6A 1GU7A 1I3NA 2C07A 4NG5A 3C7DB 1LUAA 3MOGA 4BQRA 2WMDA 3KEQA 2Y05A 2FZWA 3E03A 3GG9A 2VRBA 1T25A 4O1MA 4A5OA 3ITDA 1EUZA 4UAGA 1SZJG 4QEDA 2YDXA 3VH3A 1VRWA 4CV0A 2PD3A 2VWQA 4FFPA 2AW5A 3NJ4A 4DYDA 1MXHA 2IRWA 1J5PA 1NYTA 2X5JO 1R6DA 4W9NC 4NMHA 1IULA 1IPEA 1P1FA 2HKIA 3JYLA 4WLEA 2CMDA 5ICSA 4W9NA 4LRTB 4MINA 2JAHA 4CQMB 4E30A 2NTJA 3JQGB 1H6AA 2AQHA 4A10A 4B4VA 5IN5A 1ZNQO 3HDJA 3E9NA 3ZHZA 1X15A 1NM5A 4YAIA 4GX0A 5ES3A 3AFNA 1E7WA 3V8BA 4L4SA 3PHHA 3D3WB 4J91A 4PLCA 3VKUA 3VZRA 4O6VA 2Q1TA 2AXQA 2YYYA 5I7EA 5ENDA 3Q0EA 1Y8RA 4MVJP 4GMFA 1J6UA 3B6ZA 4A2CA 3AU8A 2VWHA 4GSLA 5EL0A 4BO2A 4FCCA 2A94A 2P4QA 3RIHA 2QRJA 3QW2A 3H7AA 5C37A 3LC7O 4FOOA 3DFZA 3JQBC 2PTGA 5JW6A 3JQDA 4NNJA 1XU9A 5A3JA 3FNHA 4OH1A 3JQBA 1TXGA 1I32A 3ETDA 4U6QA 1YOVA 2D4AA 4UVGA 5JAQA 3TSCA 3F6YA 2X0JA 4DLAA 1NQ5A 3EK2A 4QXMA 2VQ3A 2BH9A 3KSZO 2V65A 2W98A 3VH2A 2QIOA 4L76A 1A4IA 4IXWA 5L3ZA 2R2GA 2E4AA 2Y93A 3AUAA 3ZU3A 2LDBA 5MGBA 1Q0HA 5JCXA 4ZA2A 1Y9EA 4FFNA 4CJXA 5JNLA 1Q2XA 3FNGA 2GASA 1NQOA 2NTVA 4WOJA 3DC2A 3F9IA 1QMGA 2DLDA 4Y67A 4YT8A 4RVDA 4YJHA 1I10A 1O9BA 1KEUA 3K5PA 1E6UA 5L7WA 3P2OA 3PZRA 5G4KA 4ZVVA 4ALKA 2FP4A 4FBGA 1T1RA 1K2WA 4MP8A 4XDYA 3FR7A 3CPSA 4GPD1 1QYWA 1HL3A 2Y1FA 3I1JA 3ZWCA 1PX0A 4WLUA 3O8QB 4BNFA 3ZWYA 3BHJA 3QWAA 2DM6A 3K2EA 2RH8A 1PR3A 1PIWA 3OA0A 4G5HA 3H2ZA 3VDQA 1GQYA 3ETEA 4KUGA 2EXXA 4E32A 3N74A 5DULA 4EJ6A 4Q9NA 3U4DA 1MFZA 4YEDA 3BTSA 4QUKA 2X0RA 1M6WA 3TZQA 1K3TA 3AWDA 1BHSA 1E7MA 1NR1A 3FHLA 1GD1O 3U4HA 1I36A 1U4SA 2VRCA 3GZNB 1Z7EA 1KY5A 4D79A 4PLVA 1AXGA 5A5FA 4J1QA 4BNGA 4R5HA 4RCVA 3UH1A 1X1TA 3PI7A 3GC6A 3K8ZA 4TRMA 3UW3A 4I5DA 2DUUA 1YJ8A 1U2DA 4OOEA 3WGQA 4MP6A 1NVGA 4ALLA 1LSSA 1MA0A 1ENPA 1QG6A 1ZXLA 3JQ9C 4OGWA 2X9VA 2G0TA 2DKNA 5CDSA 3DBRA 1U2GA 3IJPA 3G49A 2FOIA 3DB2A 5DN9A 2CDBA 4EI2A 3LU1A 3JQ9A 4EEZA 4K1LA 2Y1OA 1MGOA 1PJQA 2GSDA 2C7GA 2OOSA 1SNYA 3A1NA 1F8FA 1GQ2A 3T4XA 5G0UA 1B16A 2I6TA 2QQ5A 1HDRA 3O4RA 2A35A 3CXRA 4HKTA 3MEQA 5HS4A 3WBFA 2EW2A 8LDHA 3IP3A 3JD1A 5AVOA 3MWEB 5K6AC 4R1NA 2OORA 4BMSA 2ZYGA 3DHEA 2NACA 5K6AA 1SMKA 3JV7A 4D3SA 1UDBA 4N5LA 1W8DA 3TZHA 2HDHA 1IY8A 4H16A 2WE7A 3VZSA 2B5VA 1OZAA 2DVMA 5H83A 4BO4A 5AXCA 2C54A 4E31A 2WSBA 1I24A 4I5FA 5GY7A 4HV4A 4FW8A 3NT5A 3UICA 5JFOA 3KVOA 4IJVA 1GZ3A 2QYSA 1P33A 1DOHA 3GDGA 4R3NA 5CDGA 2VTEA 2YHIB 1E3WB 1UDCA 1M2WA 4IJKA 2AEJA 1S6YA 3UVEA 1UXIA 4IZHA 1K6XA 3ZV3A 1XWFA 4AG3A 5ICMA 4KZPA 4R01A 4KQXA 1HE3A 1T24A 1Y5RA 3KBOA 2RH4A 3GG2A 2IDZA 3RUDA 3P19A 4R1TA 4OAQA 3DOJA 2Y1DA 5B4TA 4ND2A 1EVJA 4A26A 1DB3A 1UXGA 3QVOA 5ILOA 1UDAA 1KVQA 1QYDA 3GEDA 1NFRA 2VUSA 3DXFA 3MJCA 3HWRA 1U5AA 4CQLA 3ZNQA 1T2DA 3RWBA 1WAMA 5F21A 1AN9A 1ONPA 1T4DA 3VH1A 3BTOA 3V2HA 4DQUA 3R6DA 2JCVA 4WJZA 5JC8A 3VTZA 4M89A 5G2OA 4BO9A 2YJZA 3H65A 1GQQA 4J4TA 4WNIA 5GZ3A 4CMIB 3PJGA 5BSEA 4AICA 1U3VA 4WLOA 3ZU2A 3VPGA 1WXDA 5JE8A 4J0FA 3K9QO 5A5EA 3H9UA 1J0XO 3ROMA 2I76A 3CH6A 3FR8A 4I9HA 3ZU5A 3FSRA 1EDZA 3B1JA 4O59O 4B3HA 2GCGA 2NU8A 4Z3KA 1KVRA 2DBQA 3STHA 4A0SA 3GUCA 3W8FA 2DBVO 4K6FA 4PZEA 4XQEA 3Q11A 5BNTA 1N5DA 1HE4A 1V3TA 1ZK1A 2C5AA 1I2CA 1E3JA 4YJGA 4BO7A 3OM9A 1E92A 1X7DA 3H4VA 4II2A 1TA4A 4YRAA 3PIIA 4J49A 1LLUA 3GAFA 4ITUA 1YRLA 3ROKA 4XEHA 4EJ0A 1KEPA 4BNTA 4NFSA 1GEGA 1N8KA 5L4SA 5AQ1A 1PGNA 2JD0A 3ORFA 2PZKA 3A9WA 4GBJA 1EVZA 1KERA 1XDWA 4RZHA 5F1OA 4KDFA 5G0VA 4FSHA 1HXHA 2HK7A 3AOGA 2Q46A 3QY9A 4Q3DA 4R51A 2CY0A 1DC3A 2B0JA 4CR6A 4FFRA 5IDWA 3EHEA 4OKNA 4TROA 1UJMA 1PJ4A 2WJPA 1RWBA 4YJFA 3TFOA 3BHIA 1KEVA 4R68A 5AXBA 3V1YA 1YH3A 2NLOA 2J5RA 1BDMA 2VZ8A 1EE2A 2VYNA 4TQGA 4BIIA 4BNLA 4HUJA 3KYDA 4PVDA 2ZCUA 5U9CA 2TMDA 1AE1A 4R9SA 4JLWA 4AL4A 4OSPA 1MXFA 4TZTA 3R3SA 5COAA 3NUGA 1IZ9A 5L7YA 3QIVA 2HJRA 1O6ZA 4OXNA 2QRLA 2CNBA 2GN8A 4BV9A 5IZ4A 2DPGA 2NVBA 3OQBA 1U3UA 1U1IA 2P68A 2BELA 4W7IA 2RHRA 1BXGA 3C1OA 3UOGA 3WJ7A 4FFOA 4BGUA 5BQFA 5BSHA 1CQJA 1E5LA 2HMTA 4IQ8A 1KIFA 1LNQA 2O2SA 3WFIA 4NR0A 5DOZA 1LEHA 1D3AA 4FGSA 4LN1A 3IUSA 3KHUA 3CSDA 5DOVA 1TT5A 1U28A 2HO5A 3NV9A 4JP2A 4BMVA 3D5TA 3F3SA 1DAPA 1BMDA 1Z7BA 5BT9A 3UKOA 4F6LA 1ENZA 4FJ1A 1VM6A 4F46A 1RM3A 4LMPA 4B4OA 3ICPA 4O0LA 4F45A 5I7SA 1DJQA 1LTHR 4MVJG 3ZWVA 3QWHA 1H9BA 1EFLA 1E3IA 2GN4A 4D44A 4FD3A 3BMCB 4R3WA 3E48A 3WQQA 3LC2O 3ZHYA 3BHMA 4U0JA 1C1DA 3MWDB 4LMRA 1HWYA 1VPDA 1WZIA 1P1IA 4QTZA 3VVCA 5IXYA 4KUEA 1JKJA 3ONDA 1LDNA 1ZMTA 2BI8A 3JYOA 1QV7A 3LDHA 2Y99A 1HDZA 5JCJD 1NWCA 3FTNA 1X7GA 3H9GA 3P5SA 4P38A 4E33A 2A9FA 2O3SA 1GUYA 1PU2A 2GLXA 1C0IA 1B8VA 3BYZA 1MB4A 4GGPA 3VHRA 1BXKA 3F4BA 4J3FA 1C0KA 3JD2A 2AE1A 1WVGA 3PJDA 1ADFA 4UVDA 1WDMA 1J4AA 1WWKA 3TL3A 4AJLA 3OICA 3BZUA 1GDHA 2WE8A 3K73O 4EZBA 4RJTA 3U09A 5L4NA 2EJWA 4HX5A 4DVJA 1E77A 1YBVA 2C29D 1OI7A 3MOIA 1VKNA 4F3YA 1KBZA 4CLXA 4AJNA 2RHCA 3Q3CA 4RZIA 3PQEA 5EJ2A 2RCYA 4CMJA 4HFJA 3IQDB 2WD7B 1CJCA 3KETA 3GHYA 2DU8A 2P9GA 5FWNA 1LSUA 1VSVA 2A92A 1EBFA 3KYCA 3RVDA 1Z75A 3U3XA 4MDHA 1B26A 1FJHA 1ONOA 4AVYA 3KV3O 1E6WA 1ORRA 3A4VA 4IM7A 3B1FA 1ONNA 4XZ3A 4BO0A 4AJOA 1VJTA 3A06A 1HZZA 3H3JA 2I9PA 4Z3DA 3IKTA 2PGLA 5EERA 1H6DA 3QSGA 3WGZA 2W8ZA 1ZO8A 4P4LA 3SJUA 3OJEA 3WQSB 1GFSA 1CDOA 3Q9NA 1GUZA 4B8WA 2IEBA 2Z1NA 1NVTA 1PZFA 1VI2A 1I5RA 1C1XB 4B3IA 1JWAB 3DOCA 2VZ0A 3I6QA 1VL0A 4EITA 1NBOA 2NVUB 4KDEA 4NFYA 2EERA 5LC1A 2ZYAA 2P9EA 2XAAA 2Q1WA 3OF2A 3ASUA 3FCOA 3W8EA 4NBRA 3MJVA 4JJFA 4B4UA 4UREA 1G6KA 4HNHA 3U0BA 3K30A 1KS9A 5C5IA 3I52A 3IAHA 4TKMA 4PG8A 1LJ8A 3GNQA 1ZJZA 3KSDO 4XJTA 4IJUA 4GQAA 1DFGA 3F1KA 4ALJA 3PDJA 4CODB 1PL7A 2QG4A 1I30A 1O95A 1DRVA 4MVJH 3L4BC 4RF4A 5BR7A 2DFDA 4K9DA 4IIUA 1MUUA 3L4BA 5B4VA 1DDOA 1C0PA 1EK6A 4DIOA 1JKIA 1P31A 3I4FA 4JJGA 1WNTA 5DZSA 3ZHXA 1K89A 4PG4A 5CG1A 4INAA 1PGPA 4D3DA 4QQRA 1MC4A 5CG2A 4RVFA 1T2FA 4TMFA 3AY6A 4HY3A 5HA5A 2E49A 5KVSA 3UGKA 2X9NA 4B7CA 5CAEA 3CZRA 1ZH8A 2OP1A 4AJEA 2IE0A 4FC6A 3N58A 4IUYA 3HADA 4FC7A 4ND4A 1UP4A 2EGGA 2GPTA 1E3LA 2VOJA 4XKJA 2AG8A 3L9WA 1LQTA 3OJFA 3RU9A 3GT0A 3W4KA 4Y8VA 1DO8A 4XIJA 1QXSA 3EY4A 3WWZA 1PR9A 4I5EA 1R37A 4PG6A 3WMWA 1AHIA 4P8RA 2PKQO 4CLRA 4N5NA 4B3JA 1PJLA 4XIYA 1Y8QA 5TJHA 1GCOA 1XQ6A 3DZJA 4I8XA 2WYWA 2GZ1A 4R4JA 3SEFA 3WIEA 4EYEA 1GTMA 3I6IA 4NBTA 2HJSA 4CMKA 3ST7A 1NQAO 4PLWA 1QKIA 4BS9A 5A9RA 1EQ2A 3D5QA 4EUEA 4RVSA 2EW8A 4XRRA 1CF2O 3WGHA 3ETGA 5A02A 5HRUA 1PL8A 1N7HA 4WPGA 1LDEA 1SPXA 2JD1A 1XSEA 1W4ZA 2F1KA 3C8MA 1A27A 4R1SA 3ZV4A 3Q1LA 2OZPA 4J16A 3PIDA 4DIBA 3GRPA 5F1PA 5JCJA 5IJZA 3GN2A 3AM4A 2POQX 1YQXA 5A9SA 4DLLA 3ZV6A 7ADHA 3GUYA 4AJIA 1SB8A 1PEDA 2BF7A 5T57A 4D46A 3DWFA 3HJAA 3PWSA 2J6IA 2NM0A 4FJ2A 4Q3BA 1R16A 1JA9A 1ZVMA 3F1LA 3FTPA 4DBZA 3WNQA 2NADA 4DUPA 1H5QA 3S2IA 1SC6A 2C2YA 4YVFA 1FXSA 4J9VA 2EP7A 5EQFA 4LK3A 2E37A 1I8TA 3GVCA 3VZPA 3QVWA 4TVBA 3TF5A 3OEWA 1EFKA 4MVJF 2QYTA 3TOXA 4JBGA 3K31A 3QWBA 4PLPA 5DCYA 4OXKA 1V0JA 5TC4A 1ADBA 2ZIZA 2PH5A 3NRCA 4NFHA 3BAZA 2EIHA 1XCBA 4PLHA 4CQMA 3ROPA 4NBWA 3GGOA 2B37A 4RO0A 3JQGA 1HDCA 3H3FA 3O9ZA 1P1KA 1K6IA 1PJTA 1F12A 4WASA 2C82A 3DHNA 1B8PA 3FWNA 3D3WA 4TRNA 4OQZA 4DMMA 9LDTA 3DMYA 3D64A 3G79A 3ZV5A 3C7AA 4JQCA 2V6MA 4ILKA 3RC7A 3UHAA 3PZBA 5L95A 5IF3A 2YQ4A 1HLPA 1YB1A 4S1VA 2LDXA 3VOSA 5TS3A 4LRSB 4JX8A 4ESOA 2NVWA 3JQ7B 3IIEA 2AQIA 3RFXA 4ID9A 1M6HA 1Y81A 4B4WA 2IYPA 4P22A 2HK8A 2VHYA 2B4TO 4Y9DA 5DNAA 4II3A 3JD4A 3V2GA 4NPCA 1YB5A 2OP0A 3DBLB 4RPLA 1GYRA 2F00A 3GVXA 3K96A 4NK4A 3M6IA 1FDTA 1V8BA 3QVSA 4BUCA 4L4RA 5A04A 4D41A 5JMWA 2VOEA 2X22A 3W4JA 2GO1A 2ZB8A 4E2XA 3X2FA 1CRWG 1JTVA 1KVSA 4BVAA 5T6BA 2B69A 4HWKA 3I9OA 4XYMA 4P4NA 1E3SA 4CM7A 2D5AA 1EK5A 3WGGA 3IP1A 4GL4A 4YAEA 4BNVA 3D7LA 1DC5A 1OFGA 5A4DA 3GMSA 4PLYA 4CMGA 2ZKLA 2D2IA 3QE3A 2X5OA 5B12A 4FPXA 1O94A 2X58A 2Q4BA 1DHRA 5GZ1A 3O8QA 3AK4A 3DQPA 2V7PA 3L6DA 4RL6A 5BNIA 1MLDA 2NQTA 4ZRMA 3B20A 1I3LA 3ZNOA 3GDOA 1R0SA 4RQTA 4E5KA 4KP7A 1LXCA 1AXEA 1M75A 3OHSX 1R0LA 3DBHB 3VPSA 4FR5A 3W1VA 3DZBA 4IDDA 3SX2A 3QLJA 4C7KA 4ND3A 2B4RO 1P0FA 4CL3A 2ZB3A 2JHGA 3NGLA 4XYGA 2VUTA 4OOFA 4WLNA 4WE3A 2I67A 4PLGA 1PSDA 2UUOA 2UYYA 2HRZA 3GZNA 1OMOA 3JQ8B 4JP3A 3PLRA 5DCUA 4J6FA 5DT9A 5KVCA 2ZK7A 1OC4A 4MVJD 5JS6A 5A05A 5HM8A 3GGPA 4J4BA 1O8CA 2IXBA 2HU2A 4PRKA 2E82A 3KM0A 3PFWO 4ZQFA 3AUTA 3GEGA 2BFAA 3GOHA 1QYXA 1C0LA 3AI1A 1E7QA 3LK7A 3PGJA 3WOHA 4IMRA 4IDGA 1EUDA 3VTFA 4CM4B 5G4LA 1ZSNA 1Z45A 4DGSA 3H8VA 3JTMA 4FN4A 3AFMA 4F6CA 3IOYA 4A73A 3UF0A 2BGKA 1VC2A 2HLPA 2EWMA 3NT2A 4U7WA 4Z9XA 1C14A 4N7RA 3ANLA 4FOSA 2Z95A 5JBIA 1JWBB 1BDBA 1NXQA 5DCWA 4NIMA 2QX7A 1XELA 5KKCA 4YXFA 1HRDA 2PR2A 4ALNA 3HSKA 3VZQA 4GMGA 4BV8A 1NFQA 3K6JA 5ENVA 3WMXA 4B8ZA 1N9GB 2PY6A 4E4YA 4RLSA 2YV3A 3GH3A 2DUWA 3GQVA 3TPCA 2CVOA 2H5LA 2Y1GA 4MKXA 4E5NA 1LSOA 2AHRA 3PYMA 4YACA 2HRBA 2W2LD 3ICCA 4ZN6A 4CMAA 2PKRA 2FWMX 2AMFA 4J2HA 3WGIA 3NKLA 4OHUA 3DEYX 1XQ1A 5JDCC 4JBIA 3GF4A 4AJ1A 2CF5A 1R4MB 3GHHA 3FNEA 3HDYA 1V3UA 1U3WA 5JDCA 1B15A 4DA9A 5DP1A 4M8SA 4TWRA 1GY8A 1I2ZA 2PFGA 1E1LA 3E1KA 2HSDA 4DPMA 1RM0A 2GF2A 3C7CB 1HYEA 4GI2A 3FF4A 3I9KA 2YHIA 5DBIA 4Z0TA 3DHYA 1ZSVA 1E3WA 1A5ZA 4XQCA 1HDXA 4KTVE 2W2KB 1L1FA 5COBA 5CPBA 3INGA 3LYLA 3FRJA 5KJ1A 2ZCVA 4FJ0A 4BB6A 2PD4A 4CUKA 3EZLA 1AGNA 2CUKA 1CETA 2O23A 3DAPA 4KWIA 3WR5A 4UEKA 3S55A 2YDYA 1D1TA 4E5YA 1G1AA 3SC6A
chains in the Genus database with same CATH superfamily
4CN8A 5FTNA 5CVEA 3D1JA 2F3UA 4EF4A 1LU9A 1SVLA 2QENA 4NFLA 3I83A 2FW7A 4WCDA 3WXMA 3VSBA 1PGOA 1BKYA 3SNKA 4G4IA 2Y27A 1SKUA 2HO4A 4KUHA 3Q41A 1PZXA 1XJ5A 2C3UA 2FG5A 2HV8A 4D2IA 2QRKA 3ZNNA 1K7FB 1K2VN 4K28A 1JG3A 1MAHA 4D3FA 1DUIA 3Q0IA 3GR6A 3LWZA 4V1CB 1QTNA 5BV1A 4M0LA 1QHNA 1Z0FA 1PJ2A 1JAXA 1E94E 3WQRA 1XLTC 2IOFA 1SKYB 2O06A 2YOGA 3FYUA 4E6EA 1KNQA 2QRNA 4WACA 4ISBA 4CR8A 3ADDA 1N7IA 5HM8A 1V4BA 1YRAA 3SC4A 4RK4A 3WYDA 3JQAD 2OCGA 1YI8A 4DIFA 3R0IA 1Z8DA 2OLEA 1UDRA 1GYPA 3P0JA 3HV2A 1Z6YA 2RAPA 4UMDA 2I62A 1DQYA 1Y5LA 1G2PA 4MTLA 2P2GA 2A9QA 4P5PA 1EZZA 1Q7RA 5DTIA 4UDNA 5ARDA 3S6JA 2PSEA 1Y48E 4UAJA 2JEYA 5AQEA 4AJ9A 1QP7A 1LDGA 1REQB 2QZ4A 3DBVO 2B4QA 5J4YA 4G5SA 2HA5A 2X9LA 4AF7A 3ZCQA 4DNXA 2CDCA 1KO1A 2Q5FA 2WB2A 2OFXA 3V7WA 4BFXA 1ULAA 1WP9A 2GGSA 2OO5A 4G86A 2I78A 2FPKA 5EKTA 2OMEA 2GK3A 3BULA 4K9QA 4QECA 3VAAA 1KO7A 3B1KA 2P2SA 1H94A 2PX2A 1DAOA 1TDJA 4FYKA 1DAFA 1AURA 3N2GA 4LYDA 1HTWA 2ZIFA 4HPWA 4JVNA 3MF4A 4QE3A 1Z5ZA 2WUVA 3SG0A 3UV6A 2AI3A 4LXGA 4MRPA 2Q5CA 3KT3A 1ATZA 1RQNA 1ZKMA 4QBGB 3JWEA 5H0IA 5T4HA 3WFJA 4WOBA 3U56A 2ZBVA 5JXJA 1VKHA 2DQZA 4FYYA 2WFLA 3EGCA 3NFRA 3EXAA 4M88A 4HDRA 1RTTA 1Z37A 1ZRNA 3PRJA 4U2FA 4JR2A 4ZI3A 4FKMA 3FMVA 3KKNA 1M2HA 3PE6A 4WZ6A 2QPAA 1WIWA 3NATA 1RM4A 1Y5IA 3OUUA 1N2XA 4UBNA 1UWVA 2XYVA 3WGOA 1HI9A 2HF8A 2ZIGA 1GGVA 2CJYA 2HQ1A 4GE0A 4YV1A 4KPEC 3T4EA 2OV1A 3ODPA 5H02A 1SG0A 4MVXA 3WXBA 3KKMA 2VWPA 4KK3A 1DT5A 2C0QA 4XB6B 4MICA 1G2QA 3I45A 4LXQA 5H16A 4HWPA 1DJMA 1U4OA 1YDFA 2H31A 3GROA 1NZDA 3SD7A 1UXKA 1C4XA 1NX9A 1F06A 3W5DA 2X5KO 1ODCA 3C85A 5DV9A 4UPEA 4V0NA 4JB3A 3OU2A 1WEHA 2CLSA 3LT1A 3RASA 4B09A 4H3KB 4CTNA 2Y9MB 2EX1A 3DT6A 3NJ8A 1OXKB 3OQHA 4LJSA 2DCUA 4N3CA 2QHXA 4OMDA 2G63A 5LUBA 4NCAA 2Y0CA 3OQPA 1NY6A 2DMRA 1YASA 1C8BA 3L04A 2OZLB 4JHXA 4NQZA 4WN9A 3X1WA 1NLMA 1Y34E 4CU5A 1IOWA 1KI7A 3GO4A 3HM9A 2C5LA 3CPEA 5L3SA 2A5FA 4PZUA 3F90A 1KI6A 2GQ0A 1CUXA 3VKHA 4W1PA 4B83A 5KB3A 3PX3A 4AMVA 2HDNB 3H9BA 4FNAA 5IWAB 2JKVA 2ZSIA 3D4PA 2VDOB 2I1VB 4JT9A 4BO5A 1RADA 1XYGA 4TYYA 1C9KA 4AMZA 2PUBA 3LCCA 4PNEA 2Z2ZA 3EMKA 1KPIA 2R6R1 4EHJA 2GNPA 3E5HA 4MW9A 1ZFNA 1HETA 2R7AA 5ALNA 5AM3A 5JCPA 4PSAA 4H15A 1I3MA 4E13A 4FD2A 1WKVA 1A77A 1G7CA 3L1JA 1VE1A 2YVUA 3MMXA 3PHLA 5AI5A 1LVGA 1YHZA 4JMPA 3B60A 4MIYA 2IYUA 3VO8A 3Q4GA 7AT1A 4PRYA 4FYWA 1NASA 1EFAA 1IM2A 1R15A 1B0PA 1MQAA 5BN5A 3INYA 5CDFA 4F06A 2ILTA 1SOVA 1W5SA 2FFQA 4M1KA 3VVBA 3X1JA 2KS6A 4TYQA 4BMPB 1TO6A 4ZDJA 2V96A 5I7RA 3AR7A 2BEWB 4XLZA 3N75A 2C59A 2F3RA 3SEQA 4TS3A 2VQFB 4U2BA 4HX9A 2H1VA 4FI3F 2WZCA 2IIVA 2X40A 3M5WA 4G41A 2HI0A 2IYOA 5HFJA 1CB7A 4YCAA 1R64A 4KXUA 3T5MA 2BHLA 3A1EA 4PM4A 3LPCA 5DXJA 3JATA 4ZCMA 5JCOC 1KI1A 5JZMA 2DTEA 2IY7A 2JEZA 3BMNB 1GKLA 2BGLA 3LCRA 3SBOA 2XBUA 3TYXA 3NTOA 4GBED 3GPDG 3GH1A 3OPYA 4LXUA 1PQWA 5B1DA 1QR6A 4IVNA 5ALIA 3RHTA 1B74A 4BZQA 3UBTA 1UPUA 4BNDA 1NIJA 2WDZA 1EHYA 3A1UA 4X60A 4BJ3A 3MQ4A 5ITZA 4U6SA 4XPIB 2W83A 3A2LA 2X5NA 4HP8A 5JASA 4HEA1 3V8RA 1MX1A 2PX3A 3FYSA 2NV0A 1L4NA 2WVJA 4JLDA 4RF5A 1RI1A 3OFNA 4D3XA 2O14A 2JJ1A 1TQ8A 3DZKA 1E2QA 1ZJ6A 2Q3MA 3TWOA 1A72A 5CEEA 2FSIA 1A9XA 1J42A 3VHQA 4F85A 2DWQA 4Y2UA 4MZDA 1S8OA 4B6RA 4OHRA 3UJ9A 1ID8A 1GKYA 3L84A 4EX6A 1U7UA 2IIQA 3MWYW 1Z73A 4W7HA 2NQ8A 3H6KA 2O50A 4TLDA 1R8SA 4KQIA 1ZRSA 3EXEA 3S2YA 3VU3A 4B3CA 2AJBA 2IE8A 4ZJUA 1VIAA 2RGNA 1R50A 4K9PA 3VU8A 1X77A 4EA7A 2QBYA 2B3TA 2VDNB 4PFQA 5DGDA 2C4UA 1SHUX 4OXXA 2J0VA 3QOYA 2PUAA 1JHVA 4IUBS 4E2WA 3VPHA 1IC6A 2ZYHA 3C7TA 2JVJA 3OCYA 5BNFA 3JQAB 3K94A 2RC5A 3KFLA 3TLEA 3TMYA 5JNSA 3GCGA 3JYNA 4DR1B 2CFRA 2JFXA 3UAOA 1UXOA 3PDCA 3WMFA 1TFUA 3KWFA 1X0VA 3GJTA 1JDNA 1B00A 2BHSA 4EMUA 1EMDA 3PNYA 2IY8A 2X0DA 2H3EA 4EGFA 4RM2A 4Z5XA 3DE7X 1Q0QA 4CF6A 1OILA 3RFTA 1RYEA 2BLLA 3ZQKA 1TK3A 3N2KA 1SQ5A 2NUAB 3RUCA 3SWWA 5C8YA 1VSBA 3UUGA 3ZVNA 1FP4A 1R9MA 2BBSA 3AERB 3MTQA 4XCVA 4W8GA 2Q6VA 3UG6A 2JCXA 2YN0A 4XVHA 4BQFA 1JYEA 4E08A 1WDKA 2EEZA 3SLKA 4ZHQF 3QJYA 4TMXA 3SMVA 2FWIA 2UZAA 2HQSA 1IDN1 3K0HA 4B46A 4BJ5A 3RJTA 2RG1A 3ZIUA 1FW6A 1W19A 1R8XA 1ZJ4A 2A5LA 4GZ3A 2DFLA 2QRGA 4ZZ0A 9LDBA 5T7BA 1QFSA 1RRCA 1O0CA 1USIA 3CIFA 2RIPA 1NL3A 1QP8A 4URUR 2Q9UA 2FFBA 1QRTA 4YMIA 3RTDA 5KWSA 3L2OB 5HJ2A 1A4UA 4LSWA 2VVTA 4CM1A 4PSUA 3SZ3A 2YWRA 2IYQA 3LM8A 4BMNA 1SUWA 1H1DA 1YDGA 2FN3A 4JNKA 4DDMA 1NPDA 1U81A 1MX9A 1QHGA 4JI1B 4BNJA 2PUVA 4GI1A 3WZ2A 3PHBE 5BUCA 2NO0A 1Y8ZA 1JDTA 2ZRIA 2IC5A 2WKWA 4PZCA 1E66A 5ALRA 1KDTA 5JIBA 1EQUA 2QW0X 1AS2A 1ULBA 5EZYA 1QV9A 2EP5A 1RI2A 1VQ1A 3PD7A 4GLOA 4IMIB 3LHDA 3RS5A 3I61A 3QUBA 5D86A 4D9EA 4CEJB 3WE7A 3WWCA 4IG9A 4J90A 5KYNA 1UBMS 2RI1A 2C3MA 1K4MA 1G38A 2R85A 1NWHA 3KXLA 2HA2A 2HCJB 4B43A 1NOJA 3OEYA 1OBFO 1FK8A 4PQEA 5JWHA 4C7VA 4K0RA 3MM4A 3Q12A 2R8BA 2L19A 4Q15A 5I48A 4OX9B 2VI5A 4Y6RA 2PZLA 1XNGA 2WWHA 2QL5A 4TLAA 1K8XB 2NXJA 2OE2A 3TLKA 9ATCA 2C2MA 3HN7A 5CM2Z 3K09A 2RHOA 3ABOB 5D85A 5DT2A 5J4KA 1PTJA 2NT3A 3PV0A 4GIBA 2WD8A 1EFTA 3BCRA 4B7AA 3COSA 2D3TA 4GM0A 5CJ2A 1WXXA 1XMIA 2QMOA 3DMNA 1VIDA 3EQ8A 4BKUA 1RAFA 5LU9A 2NYAA 4EZEA 1T5LA 1TIPA 1KY4A 3KO8A 4JIGA 1AK2A 1U2PA 4Y98A 3UMSA 3UMCA 1SZDA 4Z1OA 5EJGA 4A7PA 3RS9A 1SBZA 1ZK0A 2UZ4A 3R74A 2BMDA 4AT1A 4UQOA 2BUBA 4BZXA 3USES 1FUIA 5EXSA 5B58C 3DA8A 4ROSA 4HDSA 4QG7A 1II8B 3INRA 4IJ5A 1Y82A 4E4RA 3WDLA 1WV0A 4BC1A 1DQSA 4BX8A 1EM6A 1DQNA 2VNSA 2YHSA 4LRUA 4CR7A 1XJ0A 3VNAA 3KEFA 3PENA 4LF6B 2P9HA 3L92A 3PFGA 1YQEA 3AFOA 3TPFA 2CV0A 2JASA 4G0UA 3VC1A 2AG1A 3NHFA 1RM5A 1YRBA 5AKXA 3CGWA 1XYVA 2GN6A 1P39A 1CT9A 3T5DA 1G3QA 1MNQA 2YMMA 4H0NA 1Z4PX 4DIUA 4KIWA 3GBSA 1DJOA 2QLFA 4XA8A 1NUQA 4F4UA 1DFIA 4HCJA 3BAFA 5KTKA 2YWHA 1MTOA 2ZQZA 4NTZA 1M7HA 2WJGA 1IEQA 3N2ZB 3U9LA 4RCYA 4KIFA 4YRZA 3CIOA 1FU4A 4UD2A 1MC8A 2PU7A 3TUZC 4GWLA 2NO9A 3ENZA 1LTKA 2PMKA 1BX3A 3LPNA 5CJPA 4MR8B 4PU0A 2DBRA 4ZOAA 2K4MA 1ZIXA 1KETA 1HLGA 2I7VA 4ZQHA 3AMVA 5EIOA 2BEVB 1HL7A 2VDUE 4OFZA 2SNIE 3JARA 2A78A 2I55A 1ZRMA 3K15A 3SR4A 2DQKA 2BDUA 3O82A 3HLKA 2GAAA 4M1QA 1E1MA 4PAWA 4XE5A 1TJ4A 5FTKA 2D6FA 1UT6A 4ZCLA 2R6FA 2CB0A 5A3RA 2ZTVA 1WABA 5CFMA 3OZTA 1BH2A 4DYHA 5HKBA 3KPJA 1HZJA 5T3UA 2C42A 2OHXA 5ALTA 4RD1A 3GPIA 3LY9A 5MFPA 3B1VA 2W11A 4X1IA 1A7UA 5SYMA 1C3VA 4B2IA 3BGSA 3NNNA 5AOAA 3NZEA 1P75A 3KYIB 3QKRB 3FH0A 3GEMA 4DLXA 5AW1A 3RREA 4EB6B 1QNLA 3E8SA 3TQRA 1LQ2A 1SB9A 3DE3X 1BE8A 4LPKA 5D5PA 3WLPA 3KJQA 3GP5A 3PEWA 2AR9A 1OXXK 4E09A 4DR5B 5T8KC 4QPNA 3WMGA 3PPWA 1NJGA 1YL5A 2W71A 3R3XA 4JLOA 3LQRA 3QTBA 2J5KA 1ZW1A 4YPFA 4YRNA 4WTOA 2ZQ5A 3GUHA 3V00A 1FW8A 1YHNA 1NQWA 3RIXA 1WCYA 1DLIA 4P7JA 4C0LA 2GEJA 4ZEXA 4GX5A 3HB1A 1GZ7A 3ZHCA 5JCZA 3FZGA 4XUEA 1Q7EA 2X4GA 4CL2A 5EJ6A 3RT7A 4ZQGA 4AG5A 1F17A 4Z8YA 1GG8A 1BMQA 3OZBA 4YWJA 2WIAA 4DXAA 5EP4A 3ZDFA 3PVZA 1JB9A 2Q8PA 4FHCA 4J03A 4HBGA 1W9MA 2G6TA 2QJWA 1V2GA 1U5BA 3HA2A 3VPAA 4ND7A 2FSSA 3EXFA 3K8QA 3NOQA 4TMVA 3BJMA 2ODWA 2W6JA 1XVIA 1QUEA 2IJGX 2P5YA 4EHNA 1UJ5A 3ERCA 5A5DA 1D6SA 3BE8A 1ZM3A 3LS2A 4PGMA 4WIAA 3BIFA 3TNLA 4PY2A 4MRSA 2SKDA 4H3SA 4F5ZA 4OHBA 3AY0A 4TT8A 3WZMA 2IXAA 4HUTA 1WOMA 4LHVA 2X0FA 2EAUA 1HK7A 4KE8A 1JNYA 2J3EA 1OAKA 3UBMA 1Z5OA 1R0XA 1MEEA 4RPGA 5ALOA 3R7WB 4MGYR 2JPDA 4XVUA 4CUZA 2H1IA 2HU5A 2GKGA 1VE7A 2C2ZA 4RQAA 3UFXA 1AQJA 5MF6A 2FA9A 4YBZA 5FP0A 4ALMA 1FMCA 1XZCA 1PAUA 1H0RA 1QRSA 1NV9A 1G3RA 3B5EA 2ENWA 4AJKA 4G24A 4UBKA 5JXGA 1P45A 1T9HA 2QXUA 4HAYA 4N9WA 4OL9A 2QE7A 3UUWA 1QG0A 4MGHA 5A03A 4HS4A 4P3XA 4HADA 2ZM5A 4HDMB 3E5NA 2GCPA 2AZDA 4U7JA 4EEXA 1GL7A 1RCFA 1DPFA 1U8CB 2XE6A 3I6ZA 3QEMA 3WLTA 3C98A 3UCEA 1XMSA 3I9V6 1L5MA 1RDFA 4GOKA 4HX2A 1FSZA 1X1DA 1Y1TA 2WM9B 2CJWB 2CFCA 4GEKA 4LVUA 3B1WA 4KX5A 2BE7A 2AEEA 3DEFA 4P3YA 5K6TA 3GLGB 4BKQA 1Y1LA 3GY0A 4F5EA 1XA0A 2XB6A 3QPDA 1IOLA 3C87A 3TKYA 2BBTA 1VLZA 3V80A 4LMAA 4U4AA 2ONCA 4GLLA 3LF2A 1GNVA 1P1BA 4BIMA 1VOTA 3VR4H 3R09A 3A6EA 3CTPA 4NZ9A 1E2GA 1OB5A 5TEWA 3D0KA 4E46A 1CR6A 1U7WA 2Y0DA 1YAHA 4YMGA 2DF8A 1LDMA 3X43A 1L4EA 5AI8A 5ESRA 3GL9A 1KP3A 2QUAA 1ICIA 3JZFA 3U16A 1FP6A 1O89A 3CEJA 3KVNA 3OSUA 4ASUA 2JIDA 2ZI5A 5IUKC 3RSFA 3SLGA 1WMBA 2ZWIA 1AUVA 3TW8A 4YRBA 3LGXA 1VHTA 4KFRA 1CC1S 3O8BA 5AXDA 3K53A 4FEGA 2IHVA 1Y1RA 2ZIUB 5HZHA 3PR1A 3JRNA 2R7LA 2JZCA 3U7GA 1V95A 2BEJA 2P9FA 3E1GA 3NOOA 1WS6A 5FBRB 2ZUSA 2QD1A 5P8WA 1QGOA 2X1LA 2B92A 5IZCA 4PWYA 4ENQA 2IXDA 4QASA 2ZTHA 3ZW8A 1UQTA 3AIKA 4J0EA 2JDIA 3HBNA 1UZMA 2GBFA 1LRLA 1O1YA 1KDOA 1W1WA 3AI2A 4XJSA 3WB2A 2YV1A 4BZPA 1LB1B 4PVCA 3OIGA 4ID3A 2YNMD 5EE1A 4INZA 2IS1A 3ECCA 4OV6B 4PQRA 3NBQA 2FR8A 1P3DA 1NJ5A 4Z3OA 2QE6A 4I9NA 4CZ2A 1PUXA 1YVUA 3AF1A 2EHJA 2O59A 4MV8A 1O0SA 3DTVB 1TMGE 1SXIA 4GX2A 1JG6A 2OV6A 1AKRA 1PJ3A 2GK6A 4GHWA 4FDTA 5D3MB 3UO8B 2PA0A 3BG5A 3GLKA 1SVSA 4JL5A 3V42A 2V55B 4UUMA 3N0WA 2VRNA 3B2EA 2WU8A 4MCAA 1OY1A 3L41A 3GDHA 3KUCA 4XYBA 1MJFA 1WB4A 3IV6A 4ZCPA 3G85A 5J2UB 4BO8A 5FUWA 1UOOA 1J99A 2GZ3A 4OAPA 2INGX 1EUQA 5MDHA 1ELOA 2GM5A 1YJAA 1HEYA 5DI3B 2BUCA 2MHCA 1MMFB 2ZUVA 4II7A 5TS2A 3W3AH 2DOKA 4OMUA 5BYKA 2BSQA 1E7RA 2BUAA 2O1XA 1G0NA 2PMEA 5CRIA 1JZSA 1M33A 2YFQA 1YO6A 4Y1RB 3I9NA 2XB4A 4XVCA 3EIHA 2GDJA 3IIKA 3O3OB 4B81A 1SY7A 1VE3A 4PIMA 4PCLA 1XXHB 2A4KA 3DBRB 2I4MA 4R8MA 3BRWD 3VOAA 2B8EA 5PNTA 3KOYA 1T4MA 1BROA 2CHFA 2NAPA 3HR7A 1GV1A 3RC9A 2XD4A 1NBMD 1WSAA 1RI5A 2GEFA 1KJJA 1ISRA 2WV7A 3EGXA 4J1NA 3T3EA 4RTPA 3AM3A 1N9GA 2JA2A 4NWIA 5EJEA 5AJZA 2O52A 3A2KA 4FE3A 4UAUA 2FJPA 3THSA 3SJ7A 1QIGA 1E3EA 2BRUA 2COUA 2YZMA 3LSTA 4ARVA 3FSJX 1FTNA 1N25A 2EJBA 4HLDA 2IODA 1YR8A 2OD9A 4KMMA 3PGLA 1KYZA 1LI4A 4H7PA 4LXIA 3A4LA 5GJVC 3WNBA 5ED0A 3REQA 4D0NA 5KU1A 4IGEA 1TC1A 3D8TA 2FSGA 2VL7A 2V6BA 3QQ5A 2K2WA 1CUSA 1OAOC 1E18A 5LOVB 2CE2X 5KTRA 3VPXA 4NBSA 2AN1A 5BMVA 2OQVA 1R0KA 1SK8A 3ROEA 4N12A 4ZEMA 4LGVA 1GCUA 2XVZA 3F6BX 2GAIA 4MR7B 3D8UA 3KFXA 5KUTA 4HH1A 4AMYA 1MAWA 2P0EA 2ISSD 1N6OA 2CLCX 3I04A 3IMEA 1V1JA 1Q17A 1UFQA 2W22A 3DTNA 3VGJA 4EB8A 4AO8A 2B8NA 4TRRA 2XF8A 3PGXA 4YRRA 5IT4A 2PV7A 1DOAA 3ZD7A 1EZ1A 2W2KA 3FMIA 5G1OA 3ZDZB 5ITWA 4HGOA 3QVTA 2AKYA 4L4ZA 2IPMA 3S1LA 3S2EA 1EK1A 1T9BA 1B7GO 3CRVA 1RWMA 3NBKA 2JFHA 4M76B 3T3HA 3DW1X 1BSVA 1BA2A 3FAKA 4CV1A 3M34A 1U7ZA 4FYJA 3KQVA 3RGWS 3IEPA 1M2OB 4QHTA 3RYHB 5DJ5A 3VPDA 4A91A 1QLHA 3OLVA 1IBCA 3O03A 1NR5A 3MG9A 4FFDA 1OSNA 2VP5A 1T5TA 2AEFA 4ZALA 5DISB 2XYRA 1R0BA 4RKRA 3DPSA 3LP5A 1T2AA 3SIPA 1AG9A 3M5PA 2RAVA 2EX4A 4KYUA 5IVKA 1WHSB 3CURA 3K70B 3ZX5A 1A5SB 1LQUA 3NBYC 3ZEAA 2O3QA 4JJAA 5EMMA 3FFTA 2EZUA 3PK0A 1JHOA 1NQTA 2NO5A 3VXKA 1N33B 1T3HA 2JAWA 3EOAI 4ER3A 2DBZA 2C00A 4IO0A 1QIFA 4NOKA 1QGUA 3N7AA 3ZY2A 5JDIA 2OQRA 3ZLJA 4MYSA 2JC3A 4IXTA 2XLCA 2XRYA 4C5CA 4RV4A 3VX4A 5HK9A 2Q8NA 2XQGA 3VJMA 3G2NA 2Q6TA 4QZVA 3P45A 4JU9A 1YL6A 3LQ4A 4R3UC 1G20E 3T9AA 3WLMA 2X7XA 3ZR4B 4TV8A 5CR9A 1GYQA 2AYXA 1WRBA 3RR2A 4E1VA 3OJ0A 5CVVA 3IRVA 4TYWA 4DA8A 5JTTA 2WJIA 3HKBB 3Q3EA 3NS7A 3PP8A 4EYSA 4Q66C 3WL4A 3Q6IA 3DR3A 3EJ6A 1IQPA 2AS0A 3MB5A 3NXSA 1AZLA 4Q7EA 3T7IA 3A6PC 1E9CA 1Z4NA 1FTYA 2H6EA 2HWUA 3QIAA 1HNWB 2EEPA 2YIJA 3A3PA 5CB4A 4V39A 3QKSA 2QUBA 1T35A 3AINA 2HNBA 1F2UB 1L5QA 5AKHA 4C2UA 3DDOA 2Q3JA 4B5KA 1GSOA 1GRCA 1U0OC 2VBCA 4AUKA 1IHXA 1IPFA 2GD2A 4IIBA 3JAMA 1KRWA 2JGRA 5IAEA 3DAFA 2V45A 2IKSA 4ZARA 1CJBA 2JGJA 4ZO8A 5HIKA 4M37A 2FY8A 5LJLA 2VN8A 1V35A 2VJMB 3FLAA 4IP0A 4XGKA 4Y6QA 5A0VA 4O4JA 1B6SA 1P0MA 1E9EA 1USVA 2YV5A 3G17A 4JEIA 1L5VA 3I4CA 4PBRA 4R0VA 2JFNA 3LBFA 4H7IA 1XCGB 1EM8B 4YJGB 5DGIA 1RBMA 2NZUG 5HVNA 3SQLA 4NP6A 5EQTA 4P53A 4EQZA 1Y89A 621PA 5DHUA 4BJ1A 1KMHA 3G5LA 1E2NA 1WLYA 1K75A 4L8FA 3ZWBA 4E0BA 4JXZA 1PS8A 4N47A 3QFTA 4MRMB 2AE2A 3LDUA 1LPPA 1PBTA 1QZXA 4JUDX 4GPIB 1K6MA 2C4VA 2CYBA 4WX2B 3RD5A 4AG6A 4TV9F 2GJSA 4B7UA 1L7MA 1PE0A 1YB2A 1V9CA 1VA5A 3ISVA 4RPHA 4C7OA 1QHHB 2DFPA 3R8FA 3T3OA 1D1SA 3L46A 4WINA 2AJDA 4KPFC 1O95D 3ND5A 1BXZA 1GZ4A 1VCMA 1XT6A 4WBSA 2AN5A 1SBHA 2O2CA 2WUEA 4BXOA 1TAUA 5CYFA 3Q9UA 4I3FA 3DULA 1DIBA 2Z1MA 3BD6A 3EXHB 2A14A 4FZJA 2Q1UA 1FLDA 3OE1A 5B3AA 3V33A 2XTJA 3DDWA 3KYDB 4G63A 1BC5A 2R3SA 2C0CA 2C7VA 3MMPA 4J3JA 4Y2GA 5FT9A 1OXMA 1TEHA 2CZQA 3K9GA 3O95A 5KQSA 4A0HA 1BJKA 3OWXA 4EVQA 1ENYA 2AI1A 2VSQA 2XHZA 4EARA 1N75A 2PEYA 3HN6A 4EEKA 4EYQA 3OKAA 1VL6A 2HLDD 3J80A 1VPLA 3DZGA 4P4GA 4D43A 1BN7A 1SWVA 2RH5A 5A2GA 3IRUA 5THQA 5DSZA 4G0PA 1A8SA 3VPBA 4BWGA 1KMIY 2A57A 2YBEA 2ZVQX 4R1MA 5T5QA 1A3CA 2H7VA 3PXXA 3Q9LA 4LWZA 4EW6A 5KOHA 1F51E 2C2OA 1OZHA 2FPWA 1ZH2A 3PHGA 4M0KA 5LZ5A 1W2WB 3TJMA 5JCOA 1NUUA 1HMPA 1DAKA 2NVOA 3GARA 2L0XA 4HYEA 3SN6A 2X3UA 4DR4B 3ZGYA 1U0EA 3O4VA 1LLQA 2VZEA 1K7EB 2ZSHA 1QFMA 2I1LA 2JD2A 4DAEA 5LSAA 1DEKA 3N6VA 4MYDA 4NCHA 1GA4A 4Q0MA 4NHEA 2RKBA 2N47A 4ZDKA 4PLFA 1LC0A 1NT4A 3HKCB 1ISHA 1UQUA 4HXYA 4C6RA 3LQQA 3S2FA 1PWZA 1ILWA 5DNEA 4ED9A 3VM6A 3AJAA 3RJMA 4IFTA 2REBA 3NGXA 3D1LA 4CMHA 2EFDB 5CFRA 1KIAA 3RROA 2ZULA 1EWKA 4MO2A 3WO0A 3ZWKA 3DUWA 3NALA 2O8CB 2Z30A 1RTKA 1ZCBA 5DGXA 3AEZA 3F3MA 3D4OA 4V0KA 2FVYA 2AJTA 5MN4A 3D3NA 1I0LA 1E62A 4KE6A 1FDIA 1KJNA 4RD2A 4UUPA 3VJKA 4D8WA 4KPYA 1D2RA 1X19A 1YQDA 4GUDA 5LZ8A 4IWXA 3WICA 3EZ2A 3HDGA 4MMYB 1EEXB 1N1MA 1KF0A 3O47A 3MLAA 3CV3A 4IDAA 4KVGA 5CCDA 1G4AE 1SEVA 5KOIA 1YUNA 1YQUA 2HEGA 4F12A 1D2AA 1JQ3A 2LPMA 4D0RA 4K46A 5LDHA 2WZQA 3HNOA 1ESZA 1JEQA 2QB5A 3LUDA 1XALA 4BNYA 5KC8A 1TVMA 4IHKA 3ZY4A 2I4TA 2OLJA 2YVKA 2FF7A 4B74A 1H6CA 2HJGA 2PAAA 4AZ0A 1K3UB 3U3OA 1MFPA 2R00A 3E9DA 2E9SA 5B2EA 1DUVG 2I99A 3PYXA 2OLKA 4RTSA 5B3KA 2F3PA 4RCZA 2EKPA 4D6XA 5IUNC 2WAMA 1DKNA 1T4BA 1FFGA 1VE6A 3FMFA 4Z54A 3VPCA 3ITKA 1FYFA 4YJ2B 5JD4A 3U0VA 1BCSA 3QF4B 5A71A 4U2EA 4F4HA 1H2BA 3FWZA 1CY2A 5LQCA 3BMQA 5AP9A 4Z7OB 1V7ZA 4CM9A 4D8VA 1ZISA 3KOUA 4HLNA 4UVEA 2OPHA 1OOEA 2ZRFA 4EPTA 4PRZA 4A0RA 5J2UF 3ZD8A 3S81A 4IIYA 2HRDA 5EHIA 1JIQA 3HXPA 1XTKA 3BD8A 5DYNA 1B8UA 4WKBA 1QG4A 4UHFA 3G8YA 2H3HA 4LJ6A 3WGYA 2ZI7A 3GYGA 4MRNA 4U7TB 3VC7A 2XW6A 3CVWA 2CDNA 3C6BA 4EUSA 4DJ5X 4W8OA 3HCBA 1F3LA 2ILVA 2N3ZA 1N1DA 1AMNA 4O1IA 3F4KA 2VK8A 3WLKX 4XQGA 1NQVA 4QJBA 1GCGA 5G0WA 4XWWA 1QC5B 4ZVPA 3UAGA 2ADMA 2I2CA 3DWGA 1XJQA 3WSWA 1CY1A 1YGYA 3DZCA 2GDZA 3GA0A 3IP7A 2RKWA 3FRIA 3WQBA 4P36A 4FFMA 2X14A 4D4GA 3PQ3A 4QYIB 2H7CA 3WLAA 3BBPA 4ZGGA 2I71A 2R6DA 5IANA 3DD5A 4MA5A 4UEJA 1RP7A 4EJMA 5K3EA 1MQ8B 1SAYA 2EZ8A 3QYPA 2HQBA 4QRDA 4R69A 4XFKA 1GPLA 3IVXA 1NI5A 3IP6A 2Q7DA 4G8BA 4YDHB 1KOJA 4YQZA 1UH5A 4G4SP 4GM4A 5LCXA 1UPAA 5KWIA 4ZT7A 1TJ5A 4KN6A 1WE2A 5C18A 3RFUA 4LXXA 2GD1O 4NESA 4EO4A 1CRPA 5I45A 5JHHB 4YXWD 4MQEB 1BEEA 2WOOA 2JLYA 4Z49A 3LKBA 1EB8A 2PX8A 4UZEA 16PKA 4Y2JA 1KE2A 3RKSA 4DR2B 3KZKA 2UXBB 1T26A 2O3JA 4Z9AA 3S7TA 3UT5B 4J0IA 2ADFA 2VT2A 5KKAA 3PCXA 3OU7A 3KQPA 3V1MA 1FSSA 2AQKA 2BGNA 4RIHA 4AC9A 1XPOA 3UMBA 5TX7A 5FCDA 1U8TA 4GR5A 4FDMA 4M8KA 4HEJA 4UJ5A 2B5OA 3OBBA 3QE0A 5IFLA 1Q0UA 2D8AA 3P96A 5T6MA 1P6XA 4KFUA 3D8RA 5H9VA 3WHPA 2CLIB 2Z8ZA 3K09C 1KYQA 4IFEA 1G60A 1NLYA 1QQTA 4UW9A 1DRUA 2IGTA 2J59A 4FLEA 1L4GA 3F7TA 5I9SA 3VR4A 4MRRA 4A2WA 1C8KA 4DLBA 1ETHA 1UP7A 4BV3A 2UUPA 4OKIA 3WVNA 1PQPA 1EFRA 2O05A 4QDXA 5J63A 3I5MA 3SX0A 3IURA 1SQGA 4AROA 2YTZA 2XXJA 2R66A 4YQYA 3EPHA 3FPJA 3VTKA 4LXTA 1VKOA 1SD5A 3BK1A 3HFSA 3IQEA 3OKCA 3CVVA 2VBFA 4G3XA 5E4YA 4YP6A 5HBGA 5IH3A 1CEXA 1ZD9A 1NPYA 3SYRA 1SXJD 1I1OA 2CL6X 2A7QA 1C1YA 1Z6GA 4ARUA 3CUEF 3EGEA 3G5MA 4BKOA 2QU7A 1KEEA 1PFGA 3INTA 1Z5UA 4LZAA 1P62B 3T3NA 1K0UA 4BBJA 4XFDA 4LZZA 3MFQA 1HSOA 2IOHA 2WA2A 3OEEA 1DXQA 4C0AC 2C1XA 5T4FA 3IL2A 4POAA 3FBGA 5H3HA 3MGKA 5I7VA 4I1UA 1XCLA 2JI9A 3I62A 3EVEA 3U7JA 3RVMA 3GLHB 4M55A 3I30X 5F5XA 3ONFA 3TE6A 3ZZMA 4OK3A 4KLAA 2AFHE 2WMNB 1BD3A 2NG1A 3FPSA 3NDIA 2REOA 1M6NA 4K6GA 4E7PA 4OQYA 3LZ6A 2J3QA 4O2BA 4AN4A 1M0EA 1J97A 1H4TA 2I3ZA 3D6NB 3KD2A 3OIDA 2D2EA 4M1WA 4BCDA 3PQ8A 4K3VA 2VNAA 4CLRB 2JJQA 3EMDA 4KHZA 2P7HA 4QWMA 3OJCA 4RGVA 4QQ8A 5F7ZA 2XZLA 1GNQA 3BXGA 4E6PA 2OHJA 1CS0A 1OZGA 2YN4A 3OPNA 4DRYA 4RTNA 3GLIB 3DDNA 3CWCA 5DFAA 3THWA 4WCFC 3G1UA 2O8VA 3IPAA 3AF0A 1ID1A 4BQOA 4NV3A 1H23A 1A7AA 2OGWA 1MW9X 2V98A 3WB9A 4BVBA 5JG7A 1P7PA 5JPIA 4F96A 3VKVA 2B36A 2GYYA 2OVFA 3UUEA 2WBLC 5TGTA 3L8ZA 3FE2A 4YK7A 5M04A 5EP1A 3MAGA 1NKTA 1FDUA 4U9HS 1H69A 2FQWA 5AKEA 1U8UA 2QAJA 3LOQA 4WZAB 2XE4A 4WZBB 1ECGA 4WBXC 2H8GA 3SIRA 1CJUC 5AUQA 1QAMA 1VYUA 3I39X 1IB6A 5E8RA 1FJGB 5FYDA 3G2MA 1Q16A 3RVJA 3BWVA 4EWLA 1N78A 4F5DA 3KQYA 4IDPA 4HQ0A 1JE1A 1NF8A 3RSGA 2BTOA 2O07A 3MCTA 1HSZA 4UBMA 2PO7A 3LTNC 3GP8A 1UP6A 1I3NA 4NCBA 2D1FA 3I1YA 1X3LA 4NG5A 1SVUA 2R44A 2IV7A 3THYA 4DDUA 4L0DA 3AVVA 2GF9A 1NF2A 2WMDA 1Z6TA 4UKDA 4A6EA 5IBQA 1FP1D 2FZWA 3DHVA 4CTJA 3O8OA 2VSFA 1CCWA 5EJFA 2CHUA 1T25A 4WXMA 1SUCA 4L5IA 3EX7C 1QZUA 4K88A 2BH2A 4MULA 3WB1A 3EPRA 1EUZA 4UAGA 5B58T 3VSDA 4QEDA 1TD9A 2JGDB 2HDOA 3FJ1A 4DLNA 1HBJA 2H1CA 4IF4A 1KAHA 1N3BA 4CU2A 1ZLYA 3LKZA 2HHAA 2VDLB 4CV0A 2PD3A 2R86A 3TLYA 1RRFA 4FFPA 3OT5A 2Q62A 4DYDA 4TM8A 2IRWA 3B85A 1J8DA 1QIDA 3KDAA 1DG1G 1BDIA 2HA3A 1FZQA 4L5CA 5ADVA 4NMHA 1IZ8A 2HKIA 1SU7A 3JYLA 5IT0A 4X41A 3HA7A 3IQFA 5E4JA 5J5CA 1EDBA 1XZDA 2ZJAA 3X0DA 4RA6B 3DLIA 4MINA 3AILA 4A8HA 3HRKA 1BWRA 3JQGB 2AQHA 2YIVX 2FQYA 2AT1A 2X6QA 1ZNQO 8OHMA 3E9NA 1KS2A 4L78A 1NM5A 3SE7A 3ZHZA 3AFNA 1IXRC 4KRXA 1QH1B 4MUGA 2C83A 2RE8A 2WKQA 1S3GA 4L4SA 3V8BA 3PHHA 1T5OA 1WKBA 1GDDA 1N8TA 3M6LA 1GQRA 4FINA 1QE3A 2PVSA 2J0EA 2Q1TA 1Y9JA 2AXQA 3MINB 3PFNA 4HJRA 5ENDA 3ZJVA 1OKKA 3W90A 3WRYA 1P0PA 1Y8RA 2AOWA 1U6IA 3DGEC 1QDUA 4PGAA 4BWYA 3ZGOA 4U9IS 2QM7A 4Q9KA 1XAIA 2VF2A 1Q12A 3RIHA 2AK3A 2QRJA 5IH7A 3QW2A 1ZDMA 1YRQA 5E38A 4Q4AB 1KR2A 1QH9A 3A25A 3LC7O 3WAJA 4A15A 4U7PB 3BGVA 3NQ41 3DSRA 2BR3A 1DINA 5D1NA 3FNHA 5BVHB 5D3QA 4FUTA 4MV4A 3PX7A 1EFVA 4ZYLA 2W5UA 1TF7A 4KQCA 2D4AA 3FG9A 3G2HA 4KEAA 4RK6A 4U02A 5JAQA 3TSCA 1CU1A 3IAS1 3VYSB 4ECAA 3BSWA 4DLAA 3BRQA 3EK2A 2HHCA 2VQ3A 2BH9A 3HY6A 3K8YA 1MEJA 3VH2A 1AJEA 2KMLA 3EH2A 5SY6A 3HP4A 3QEJA 3OCVA 4IXWA 4JAVC 4LOIA 2Y93A 1MZVA 1UKCA 1Q0HA 5JCXA 3EVBA 1KZHA 1Y9EA 2HWKA 4FFNA 1QHYA 1Z18A 2BE9A 2IBSA 4TTJA 1E3DA 4WOJA 3HVIA 3AQIA 2CVHA 1FQJA 3NWJA 2DLDA 3UC9A 5MHTA 3O9VA 3T9FA 4BGDA 3GZTB 4RVDA 4YJHA 1OH5A 4DV3B 4BVHA 4OXIA 1TUEA 4FCWA 4C0QC 2ACWA 1SD2A 1U1FA 2HIHA 1L7VC 1TVKB 4HZUA 1SOAA 1E6UA 1KHTA 2R8YA 3MBKA 3N6RA 3Q7SA 3CKLA 4KXVA 1AQUA 1K2WA 4MP8A 3G2OA 3H18A 2G9NA 3B13B 1HL3A 2Y1FA 1JJVA 3ICVA 4IKEA 4OGFA 3RVLA 2HEIA 1PX0A 1TUIA 3TLGA 3NYRA 1WEKA 2BWJA 3N2NA 4ZU1X 1JYFA 4OHOA 2CHGA 2DFTA 1JAHA 4N5DA 4DR3B 3ZWYA 3BHJA 4YUZA 1GQYA 2SECE 3FWPA 5K3SA 3ETEA 2NO7A 5J59A 5KPDA 2CEAA 1IONA 2EXXA 2UYQA 1L9KA 2C99A 3N74A 4TL6A 4UNPA 5AHXA 4LI3X 4DANA 1MJHA 1AH2A 5CCBA 2OILA 2PQ0A 4Q9NA 4YJ2F 3U4DA 4NU8X 4WK4B 4KREA 2AUTA 1MFZA 3RIYA 5CA0B 3BTSA 5JSQA 3I73A 1K8QA 4OJKA 2FPSA 1OPRA 4AWXA 1Q6ZA 4ESEA 5LPNA 5HOQA 1NR1A 1GGNA 1S1CA 1T0JB 1A9SA 1O4VA 4RD6A 5D5HA 2VRCA 2FU5C 3T7AA 3VV3A 4GNRA 1VLHA 1T9DA 4R7ZA 4TX1A 2KLBA 2BM1A 5LMNB 1U7DA 1KRHA 4Q4HA 4ZV7A 5B53A 4NQRA 4D79A 4JXXA 1WQ4A 4ZCTA 5DCLA 2QD2A 3IQZA 2Q5JA 5E9JA 3KOXA 5A5FA 4BNGA 1U63A 4JLBA 1CUEA 4KN8A 1A0OA 1CBUA 4XIIA 1SUFA 1RBYA 2IYSA 2JARA 3EEIA 3NFYA 4I5DA 4KQ6A 1XP5A 3GLRA 3FFXA 1U2DA 4OOEA 3UXHA 4BE4A 4URHA 2ZPAA 4LZLA 1UKAA 4MP6A 4Y1FA 3T38A 4ALLA 4D4MA 4B0OA 4BJ6A 3HL0A 4DCGA 1ZG3A 4MS3B 1ZXLA 1SXGA 1L8AA 4PF1A