1PS0A

Crystal structure of the nadp(h)-dependent cinnamyl alcohol dehydrogenase from saccharomyces cerevisiae
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
360
structure length
360
Chain Sequence
MSYPEKFEGIAIQSHEDWKNPKKTKYDPKPFYDHDIDIKIEACGVCGSDIHCAAGHWGNMKMPLVVGHEIVGKVVKLGPKSNSGLKVGQRVGVGAQVFSCLECDRCKNDNEPYCTKFVTTYSQPYEDGYVSQGGYANYVRVHEHFVVPIPENIPSHLAAPLLCGGLTVYSPLVRNGCGPGKKVGIVGLGGIGSMGTLISKAMGAETYVISRSSRKREDAMKMGADHYIATLEEGDWGEKYFDTFDLIVVCASSLTDIDFNIMPKAMKVGGRIVSISIPEQHEMLSLKPYGLKAVSISYSALGSIKELNQLLKLVSEKDIKIWVETLPVGEAGVHEAFERMEKGDVRYRFTLVGYDKEFSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Apo and Holo Structures of an NADP(H)-dependent Cinnamyl Alcohol Dehydrogenase from Saccharomyces cerevisiae
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
molecule keywords Hypothetical zinc-type alcohol dehydrogenase-like protein in
total genus 100
structure length 360
sequence length 360
ec nomenclature ec 1.1.1.2: Alcohol dehydrogenase (NADP(+)).
pdb deposition date 2003-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ps0A02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1ps0A01
1E1MA 3HG7A 4NU6A 4IS3A 3PDJA 3LC2O 3VZRA 1CJCA 1I01A 3GDFA 3ZDFA 1QLJA 1F8FA 3WQSB 4HFNA 2BHLA 1A9ZA 4M86A 1E3LA 1FDSA 1M76A 2VHWA 4MPDA 4DPLA 2FPPA 5JY6A 4JBIA 1QKIA 3BYZA 2J3HA 1MG0A 1QYDA 1S7CA 4XX0A 1WNTA 2PLAA 1B14A 1H9AA 3ZWWA 2WTBA 5L7YA 3ZW9A 2UDPA 4OQZA 1P44A 3WNQA 5CFZA 5G0UA 4FBGA 1HE5A 3GRPA 3L77A 3VZQA 1IZ9A 5I7FA 3AI2A 4L75A 3I9KA 4ALLA 4TROA 1HDZA 1W6UA 4BNLA 3IKTA 4DRYA 1BMDA 3NAQA 2O2SA 2PY6A 2OL4A 5JAMA 1BSVA 1SMKA 1XHLA 1X14A 3TZKA 4P4NA 1QXSA 3GN2A 1IY8A 1Q0LA 1DC3A 1E1KA 1H6CA 5L7WA 1E92A 2VHXA 5JE8A 4G2NA 4IY1A 3RVDA 3C3XA 2OBYA 1ZSVA 3F46A 3U9LA 3ZNOA 4ZA2A 1EUCA 3A1NA 3W4KA 1N5DA 1V8BA 2PZLA 1X1TA 3PIDA 2QZ9A 4AL4A 3PHIA 4TMFA 4F6CA 3VHRA 2NTJA 4BL5A 3KYDB 1QLHA 1E77A 2X23A 2YQ5A 3PJGA 1PWZA 3QVWA 4J9UE 1UZLA 4IIVA 4R16A 2X5OA 1EE9A 4B8WA 3WGQA 4WE3A 4YRAA 1U5CA 4HX5A 3JQ7A 5JNLA 2EV9A 4N18A 2UUPA 4R9RA 3I3OA 4E30A 4BGVA 1UXIA 2IXBA 2LDBA 2GN9A 1BW9A 2X7HA 4DA9A 3A14A 4QT0A 3ZN2A 4CMKA 1VPDA 4IS2A 2F00A 3VKVA 1T2FA 5H81A 1PEDA 4GBJA 5B37A 3F6YA 1YL6A 4XQ9A 3GAFA 1PJ2A 1M6WA 1HSOA 2NU6A 2YHIA 4MIEA 4K9DA 5K1SA 4ALJA 4CMAA 3L4BA 3GDOA 4YJHA 2RBEA 1EDOA 4ZJUA 4GKVA 3GNTA 1CERA 3VH4A 3Q2KA 4IBOA 3AWDA 1IHYA 3OJ0A 4ZQEA 1QSGA 3OSUA 1I10A 2VZ8A 3PQDA 4XQGA 3NX4A 3AFNA 1VM6A 4GH5A 1DOHA 1BDBA 1KY5A 1YJ8A 5KJ1A 1CIVA 1KVRA 1R37A 3KSZO 5B1YA 3HSKA 1PQWA 3S8MA 1H93A 2ZB7A 1MV8A 2BI7A 1CRWG 3DBRB 3RUDA 3D4PA 1NYTA 3SC6A 2RIRA 1YJQA 3UHAA 5BNIA 1VC2A 2NU7A 3WJ7A 4DYVA 4JXKA 3PWZA 3WXBA 7ADHA 3WOHA 2Z1MA 3RKRA 1V6AA 1YGYA 1XG5A 1EK6A 2RCYA 3PHGA 5F21A 1N7HA 1E3WB 1NM5A 1B0AA 4PLWA 3K5PA 4CLOA 3TF5A 1EUDA 1SEPA 3MJEA 3VC7A 3H9GA 4F46A 1K6IA 5TX7A 5KJFA 4CM5A 3I4CA 3BMCA 1F06A 1D3AA 3RJ5A 2G5CA 4RVUA 2PZKA 1EE2A 2Q50A 3D5QA 4RVFA 2GERA 1B15A 1G6KA 2YV3A 4FJ0A 2NV6A 2C54A 5FWNA 4OO3A 2FSSA 1XQ6A 5I7SA 1PL7A 3RJ9A 4CM1A 3LDHA 3L6EA 3DBLB 4IJVA 1GTMA 2BD0A 1NXQA 2EEZA 3BTVA 3ZWCA 3SJ7A 4JP3A 3RU9A 4DVJA 4D0SA 5ICSA 2VZ0A 4BNIA 3WYCA 4QFCA 1YOVB 2P4HX 1OC2A 1PSDA 4AICA 1QYWA 1BVUA 2HMWA 2R00C 1GR0A 4WUVA 3EZYA 1DAPA 2G82A 2HUNA 1HL3A 2J3JA 4HY3A 4XJTA 5THQA 5L4NA 1E7QA 2PZMA 3ZHXA 1GYQA 1YBAA 9LDBA 2Z95A 1D8AA 2Q99A 1YDEA 5COQA 4KTVE 4IDBA 3HB4X 4NMHA 3WFIA 3WR5A 3ZV3A 4D44A 5KOIA 4YVFA 4GX2A 5HS4A 5AYVA 5GZ6A 4QFDA 2ZQYA 2X9VA 2HSDA 2PKQO 4ND4A 4AFNA 2C0CA 2VNAA 3N7UA 1B2LA 1ADBA 2X1HA 3U3XA 4YAEA 4B8ZA 1Q7CA 3GNQA 4PG7A 2X6TA 4ZVVA 2W8ZA 4CL8A 4E0BA 1NWCA 5IDXA 2DTEA 4GQAA 1JU9A 2VUUA 4YJFB 2GRAA 1A4IA 3U4IA 1ZKMA 4IUYA 4PG5A 4E2XA 1WZEA 2D8AA 3MWDB 3EHEA 4L4RA 3WTBA 3R3SA 4XQCA 4CQMD 4MIYA 4W9NC 3ZNQA 4CMJA 2P5UA 4MO2A 3V1TC 5ER9A 3MJSA 5G4KB 1KYQA 4KWIA 5COAA 4GAEA 1GQYA 5CEFA 3D5TA 4Z3DA 4KDFA 5JSFA 1XU9A 2EW8A 2DTXA 2JCXA 3NTOA 5BSEA 4JCOA 3GN1A 2NWQA 3ZI0A 4DC1A 3FR8A 3O8QB 1K89A 3LLVA 5CDTA 3JD4A 2PA3A 4ND3A 5FI3A 3AI1A 2BFPA 4HP8A 5TLSA 4L4XA 2HK8A 3VPHA 4WLFA 2ZYDA 3FNHA 4WCFB 1M67A 4BQRA 4BMSA 6LDHA 3HJAA 4MKZA 1SBYA 4OM8A 3GMDA 5ER6A 4J49A 5AQ1A 3EZLA 3GNSA 1U2DA 2OP0A 2PKQP 5BNTA 5BSFA 4FC7A 4KUEA 3ADOA 3TZCA 2HDHA 5A9RA 4TVOA 1JKJA 3H5NA 3GDGA 3P2OA 3OIFA 4ZRNA 1PJ3A 2W4QA 3QY9A 1E1NA 1XIVA 3FPLA 2VYNA 1R4MA 1HXHA 1GYPA 2A4KA 2J8ZA 1YB5A 3LF1A 2PD4A 3D3EA 4WOKA 2VRCD 3C24A 4K6FA 1G0OA 2ZJ0A 1VL8A 4ROSA 1E6EA 5AVOA 3RASA 3JV7A 4LGVA 2I76A 2P91A 3RUHA 2JFHA 2EJVA 2Y05A 5L9AA 4B7UA 3KYDA 4CLHA 3FBGA 1T24A 4D3FA 1YQXA 3ZHZA 3ZW8A 4AJ4A 3U5TA 4IZIA 1PS8A 3RUEA 5L53A 3A4VA 1BXKA 3GVPA 3KXDA 2I6TA 2WD7B 3GQVA 2IODA 1HKUA 1V9LA 5HBRA 4EZBA 4RF4A 3AU8A 3DONA 3LK7A 1U28A 5MDHA 1QORA 3H6KA 1ISFA 5K0ZA 3CTMA 1C1XB 1UZMA 4OJNA 1PQPA 3INRA 4XCVA 5EESA 1B26A 2HU2A 2ZKLA 5BSHA 3LF2A 1PWXA 4R1SA 3WQQA 3PYXA 2EG9A 4D3DA 4F45A 3NDRA 3RIHA 3DZJA 5DZSA 1GZ4A 2OHXA 1O9BA 2UVDA 4TRRA 4LK3A 1FJHA 4XQEA 3OJOA 3W6ZA 1MXHA 1DIAA 3I9NA 4CV0A 1VKOA 4RVSA 3WSWA 4RF2A 2AMFA 4XEHA 1DFHA 3PXXA 4MVJA 3V8BA 4RDIA 4RPLA 1P74A 5FEUA 5TT1A 1GQQA 1GEGA 1YL7A 1LRLA 3LLSA 2V6GA 2DPGA 3FCOA 4UVEA 1LC0A 3WLFA 3NT5A 5CDUA 4R5MA 4BNGA 4OL9A 1R4NB 3OQ1A 1N1GA 4BQPA 2HK9A 3GG2A 4NQZA 1I3KA 1IULA 2O23A 3PLNA 2ZYAA 3NUGA 3H3JA 4Y98A 1A9YA 4BB5A 4BNMA 2NVWA 4J0EA 5KIAA 1OAAA 1ONPA 1TLTA 2X9GA 3RUFA 3WTCA 1G1AA 4BNJA 3S2IA 4BUCA 3KM0A 1YO6A 9LDTA 2CNBA 4J0FA 1CDOA 2B5WA 4J91A 4EYEA 2O7SA 4WLVA 3CKYA 4E4YA 4F3YA 3UGKA 2SCUA 2OGUA 4QQRA 4E32A 4BNTA 1T2CA 2DLDA 3VDRA 4XDZA 4LVCA 3CZRA 4A2CA 4E21A 1NWHA 1N7GA 1KS9A 3WGHA 5KTKA 1U5AA 3HADA 5CDSA 5J23A 4D3SA 4DIOA 2FRDA 2PZJA 1PJLA 3QW2A 2UV8A 1R15A 1TVEA 2ZTLA 3DMYA 3ZWYA 4IJWA 2H1SA 3HNPA 4U5QA 4Z9FA 4YR9A 2BGKA 3S1LA 3K31A 3QWHA 4W99A 1I2BA 1HWYA 3AM4A 3E18A 1NNUA 4Q3CA 3CEAA 1N8KA 1U3UA 1W4ZA 4A27A 4MVJD 1LXCA 2HMVA 5C3MA 4CJXA 5DT9A 3GGOA 4FPXA 2DVMA 4H16A 3A28A 3DBVO 3RUIA 1XCBA 1XU7A 2C59A 4Q3DA 3FF4A 4CMEA 3JQGA 2CSUA 4Q3NA 3TSCA 2ZYGA 2NVUA 3IC5A 1CQJA 2Q2WA 3RUCA 1PX0A 2BRUA 4L9RA 5H82A 1IL0A 3F1LA 3LSYA 3F47A 4ONEA 5JY1A 5LDHA 4W82A 4TKMA 1E3SA 4OAQA 2VWHA 1I2ZA 3RQSA 2QHXA 3QJ5A 1R12A 3QVTA 1YBMA 3X2FA 3E82A 4G81A 4Z3KA 1GDHA 1GAEO 3GVXA 2AA3A 3ORFA 4LVUA 2PR2A 3NT2A 3UICA 3VTZA 3GH3A 4P22A 5EQDA 3QV1A 4UUPA 4D42A 1KEPA 5FFFA 3SBOA 3L9XA 2J3KA 4IDCA 2CVZA 1X7DA 2C5EA 4HFMA 2B4QA 3OETA 3ROMA 4XYBA 3DHEA 5A03A 4TRMA 4CM8B 4TQGA 1O5IA 3ONFA 4UEKA 5FYDA 2I99A 1XSEA 3D3WB 3C1OA 4IDEA 3QVOA 1UP7A 3JQFA 4I5FA 3JQDA 1KETA 1J4AA 4RZIA 3U49A 5ADHA 4TRNA 4YA6A 3DAGA 1DC4A 4BGEA 1I0ZA 4I5EA 2HK7A 1QYVA 1LRKA 1EDZA 2X5KO 4Z9XA 4J1TA 4BKOA 1ENOA 2FSVA 3CXRA 4NFYA 2O50A 4U6QA 3JYLA 2W2KB 3F5SA 1DBVO 4NBVA 3WGTA 5JC8A 1AGNA 3ZWVA 2NQTA 5C7OO 4GMFA 1EMDA 4NI5A 2VOEA 1DDOA 3WFJA 1DSSG 2CDBA 5ITVA 3EYWA 1E3IA 4WEQA 4WGGA 4OMUA 1FDTA 3DWFA 3KEQA 2NQ8A 4Q3AA 1ZK4A 2Q1WA 3H5AA 4DXHA 1HDYA 3HHPA 2D5AA 2VYVD 1ULSA 5JDCA 1UXJA 3ABIA 3S2EA 4AJ2A 1Y5RA 4J90A 4XGNA 2H63A 5DCWA 1HDCA 3F1KA 4B3IA 4DMMA 3G0OA 4PFJA 4XYMA 1X7GA 3HDQA 3GHYA 2EGHA 2IE0A 3SVTA 3V5NA 2NUAA 1YQGA 3JQEA 4BB6A 4A5OA 2ZB3A 3CZMA 3OECA 1HDRA 3P7MA 4LMPA 4PCVA 4XA8A 3GVHA 1VSUA 1MP0A 4CM4B 1XYGA 4AJPA 2WD8A 1GZ3A 4L8VA 1SOWA 1SAYA 4YDRA 4BMNA 8LDHA 2P9EA 1I33A 2GZ1A 3MTJA 3JQAA 2NLOA 3E1KA 4LRTB 4IMRA 5JMPA 1JQBA 3SLKA 3TOXA 1EZ4A 1Y7TA 2GLXA 3OEYA 1NFQA 3KLPX 5F5NA 1I32A 5A02A 5EIOA 4EEXA 1QYCA 1RJWA 1VJ0A 1UDCA 3M2TA 5DOZA 3TPCA 1UR5A 1EVYA 1P1KA 1NR1A 1UXGA 4IGFA 4UEOA 3UH1A 4BNKA 4BHTA 4CQMB 1AHHA 3O4RA 3RI3A 1EVZA 4ZU3A 3OICA 2JFFA 3TN7A 4NDNE 1BG6A 4RLSA 4J4HA 2WEKA 2ZJ1A 2OP1A 3I9LA 4OGWA 2PV7A 3LYLA 4WNIA 4FFMA 3MEQA 1YWGO 1HE3A 4PZEA 2EKPA 3P5SA 4ZQFA 4A7PA 4PLZA 1WDMA 4UUNA 3UN1A 4D7AA 2QRLA 1RYEA 2VTDA 4J4BA 5BQFA 1LBEA 1HZZA 2OFPA 3PJFA 2R2GA 1N9GB 3AUUA 4BO8A 3WWZA 3H2ZA 5I8ZA 4RF5A 3ZHYA 1P45A 3T4EA 4E33A 4XGIA 3PI7A 1WMBA 3E5MA 1G0NA 2BLLA 3HDJA 3B20A 3V2HA 4ZQGA 3WG9A 1JDJA 1NR7A 4M55A 1U4OA 2RHRA 1AE1A 3O9ZA 3ITDA 5JBIA 2RH8A 1GU7A 1GL3A 2JCYA 3NJ8A 4GMGA 3RAJA 1R4MB 2OXIA 3M6IA 5C7IO 4PLFA 1K6JA 4PRKA 1UAYA 4DYDA 2VN8A 2POQX 1QRRA 4RVGA 3GGPA 1OC4A 4RJTA 4BKPA 5TJHA 3A9WA 4GI2A 4R68A 4HFJA 3JTMA 1WLYA 1ZMOA 4JBHA 4OOFA 1GPJA 2CDCA 4E2WA 4W9NA 4U0KA 2IYOA 1PQUA 1DRUA 5DULA 3NT4A 4FC6A 5TGDA 5JAZA 4MP8A 4AJIA 1K2WA 5IDYA 3ITKA 2JHFA 1TT5A 1UH5A 5FF9A 1MLDA 2PGDA 1SOVA 3KBOA 4QXMA 4W7IA 5KVVA 3DBHA 3ASVA 3BMOB 2ZTMA 2ZCVA 1FF9A 5A04A 1Z73A 4I8XA 1IHXA 5GMOA 3W1VA 4CMHA 2XPCA 1P9LA 4YAKA 3I23A 1GV0A 2NM0A 3FTNA 1LTHR 4FR5A 1R0LA 2HMSA 3SEFA 3OJFA 3IKVA 2VT3A 4NBUA 1EUZA 3INGA 5G2OA 2IYPA 1UXHA 3HDHA 1UDAA 3S2GA 3WS7A 5T8KA 4XZ3A 3ZGYA 2D5CA 2XF8A 3IJRA 4Y9DA 4K26A 4LMRA 1XLTA 3G1TA 4BNHA 4D0RA 1YONA 1ZZEA 1PR3A 1SZJG 1VL0A 3G1UA 4RF3A 2FHSA 2G76A 3EK2A 2HKIA 4GX0A 2ILTA 4M54A 5BR7A 3LC1O 4YAGA 3GGGA 2FR0A 2V65A 1TA4A 3I83A 4B3HA 5A1TA 2FR1A 1U3TA 1FDUA 3OBBA 1H6AA 4R51A 1WPQA 1BWSA 4MIOA 1JN0A 2PTGA 1YL5A 5A05A 3JCZA 3GVCA 2YHUA 2UYYA 2Z5LA 2E48A 4IXWA 4FJ2A 4XGKA 1HETA 2O48X 3FPCA 3TZHA 4CLRB 4DUPA 2BKAA 3EAGA 2ZIZA 3TQHA 3CINA 3ST7A 1DO8A 3KVOA 3E48A 4CM7A 1VE9A 4UVGA 1CETA 3AUTA 2HLPA 1YQDA 4DC0A 1Z45A 1XA0A 2WYVA 1DLJA 3FR7A 3IUSA 1UP6A 3GPIA 3MJTA 4FJ1A 1F12A 3K8ZA 1T25A 1Z82A 2Q1UA 5G4KA 3KEOA 1EBUA 3DAPA 3SC4A 2BGMA 3ZWAA 4E6PA 3PP8A 2O3RA 2Y1EA 1E5QA 4YTEA 2G1UA 1Q2XA 2PK3A 4WLOA 4OIMA 4NK5A 2YDYA 1FDVA 1NHGA 3S55A 1T2EA 2GASA 5T57A 1DXYA 4UULA 1Z6ZA 3S2FA 3UF0A 1DHTA 5CG2A 4LW8A 1RM0A 4BIIA 3EDMA 4NR0A 4XIYA 4CLDA 4MVJG 1V3TA 1NAIA 5CAEA 5JAQA 5FI5A 1LLQA 3E5RA 3JQ7B 1D1TA 3ETGA 4RORA 1KC1A 1O8CA 4E2ZA 5KVCA 1R0SA 1SCUA 2YUTA 5HWSA 1OZAA 1OOEA 2E49A 3M1AA 4FFPA 5AXAA 4TRJA 1J0XO 1E1LA 1J6UA 3EVNA 1R0KA 1KERA 4WASA 3C8MA 4LSWA 4D45A 1BXGB 4QX6A 3MJVA 3DTYA 3WYBA 3VPSA 5TS3A 1HDOA 2DAPA 2WYWA 3I6IA 1EFLA 3FWZA 2WJPA 5T67A 5JDIC 1A72A 1I3MA 4K6CA 2WE7A 3WLEA 1O6ZA 1SNYA 3DAFA 2DUWA 2X8LA 4YT2A 4ZRMA 3WWYA 3KETA 3HDYA 4BS9A 3H9EO 3L07A 5G0WA 1PZGA 1C0PA 4BO9A 4EI2A 1BHSA 3HN2A 3UFXA 1HYEA 1X13A 3PZBA 1MXFA 3GR6A 1C1DB 3PJEA 2RHCA 3UCFA 4YT5A 3WICA 2O3JA 1KVQA 5CEEA 3DZIA 2RH4A 4DWVA 4PVDA 1Q7GA 3PQFA 3RFXA 3GEGA 5K6AA 3E6AA 1TEHA 4RO0A 1AN9A 4J6FA 5A9SA 1H94A 1WDKA 2HMUA 2GF2A 3PLRA 2QZZA 3D3WA 3IQDB 3NTRA 1LC3A 4FFRA 4B7CA 4IJUA 1B8VA 1FXSA 1DAOA 4Q3EA 3RUAA 4RL6A 4XJSA 4RPHA 5DN9A 2I67A 4A26A 1U8FO 3D1LA 2I3AA 3JQBA 1NTOA 3RWBA 3W4JA 1E6UA 4J7XA 4CR8A 1DLIA 5I7EA 3WJAA 2WE8A 1ULUA 3HZZA 3WQRA 3QWFA 1U9JA 2VUSA 2QRKA 1Y9AA 4ZN6A 1C14A 3PIIA 4ALKA 2X0IA 3PYMA 3OP4A 1DIGA 3RBVA 1HYHA 3LT4A 2V6FA 1PU2A 2A35A 3I9JA 4CMIB 1QV6A 2J5RA 1IZ0A 2Q4BA 3FSRA 4P4GA 4IQGA 3C1TA 4XIJA 2OUIA 4PRLA 1PZHA 5DF1A 4BNYA 3OFSA 2AEJA 2GR9A 1F0YA 2VUTA 1T4DA 1LDEA 2X0NA 4Z0TA 2OOSA 4B79A 1ISGA 3BTUA 1NHWA 2AQIA 4N54A 3TL2A 3ZWXA 1JKFA 4IQ0A 4X54A 1PJSA 5ITWA 2AE2A 3BIOA 5A5FA 3T4XA 4LCEA 4YYZA 4L76A 2HMTA 3DTTA 4AJNA 2HRZA 1E7MA 1PZFA 3AUAA 2TMDA 1RM5A 3D64A 4PLGA 5CP8A 5AXDA 2D59A 4NJOA 3FNGA 4R5HA 3IIEA 3FI9A 1WW8A 1EK5A 4JNKA 2VWPA 3I1JA 4PLYA 1NPDA 3T7EA 4YRDA 2I3GA 3RKUA 1EQ2A 3C1AA 3C7DB 3ADPA 3GG9A 3NGXA 4GLOA 2CD9A 2EKQA 3K96A 5TJ9A 1VJTA 1ZK1A 5F1KA 1JWAB 1KBZA 1Y9EA 1ZSNA 1ZXLA 4NBRA 5IN5A 2EWMA 2VWGA 5JAIA 3RSHA 1HT0A 4XYLA 3PHLA 1H2BA 1PGJA 3D4NA 1Y81A 3OQBA 3OJEA 3GT0A 4U8GA 1DC6A 5JO0A 4XRGA 2FY8A 2Q1SA 5A06A 5K6AC 1LA2A 4L73A 5C5IA 1LSSA 2PFGA 2QQ5A 2B4RO 3AOGA 4ALIA 1OI7A 2YV2A 3VVBA 1NP3A 2JHGA 4OXYA 4KDEA 3DOJA 1VI2A 3JYQA 2D3TA 3DHYA 2B37A 3PTZA 2O3TA 3FRJA 5DP2A 5JXWA 3TDKA 1RYDA 1EFKA 3BTSA 2Y0CA 1DFGA 1YB1A 3ONEA 4KOAA 2X5JO 2YHIB 2C07A 2DKNA 4NFSA 3RC2A 5JDIA 4IPTA 5ILOA 4DREA 4HFRA 2IDZA 3ZU4A 5JCJD 3E9MA 1RPNA 2IZ1A 1T1SA 1A5ZA 3P19A 4IJKA 3OIGA 1LSOA 1PJTA 4II3A 4M87A 4CLEA 5IF3A 3GUYA 3OMLA 2JJYA 2E4AA 3WMXA 4DGSA 1PJCA 3Q2IA 5CEJA 4J4TA 2AQ8A 2Y1GA 4TWRA 2YQ4A 1HDGO 3KSDO 4TZKA 4FD3A 4IDFA 4IZHA 1ZUD1 3F9IA 1YB4A 2HAEA 3VPFA 2X58A 1PJ4A 2IRWA 2QG4A 1VKNA 3NKLA 4JJIA 4JP2A 4KWHA 3F5QA 3BMNA 4IXTA 3F4LA 5KJCA 2E82A 4UVIA 3VPGA 4DMLA 1E3EA 5IXSA 3PFWO 3GMSA 2NVBA 2VNSA 2JAPA 1LDYA 4Z9YA 1GY8A 4L74A 3K92A 4DPMA 5IZ4A 3R1IA 4NIMA 5MGBA 2QIOA 4TZTA 4YAJA 1O94A 3PQEA 3B70A 5C37A 3ETEA 3DBHB 1Y1PA 2DU8A 3D4OA 1HZJA 1IB6A 3AU9A 4W6ZA 5JLAA 1IOLA 4HV4A 4KTTE 4GLLA 4E5MA 1CQIA 1HRDA 4MVJM 3QE3A 1FMCA 4ZD6A 2YW9A 4O5OA 5TNXA 2GZ3A 3HWRA 3UKOA 5GY7A 4DQXA 5CDGA 5JW6A 4GGOA 4OXNA 4PIVA 1D1SA 4GKBA 4ZQHA 3T7CA 4CUZA 4AJJA 4C4OA 1P1FA 3JQCA 1Z7BA 1ZSYA 1NQAO 3H2SA 3ZCXA 4A03A 2WMDA 2Q1TA 4CV2A 3W8EA 3ZNNA 4JJGA 1ISIA 5I9NA 1E7SA 2X22A 3GHHA 5JS6A 2ZTVA 4K28A 1XQ1A 1K0UA 3JYOA 3FNFA 3KYCA 1Z75A 1ZK0A 1UDBA 2VOJA 1KY4A 1MB4A 4WPGA 1C0KA 2EP7A 4NHEA 1ID1A 1Y8QB 2D1YA 2XXBA 5F5LA 1TT7A 2AG8A 5HTOA 5I8WA 1U3VA 1ADCA 4IINA 3ULKA 1R6DA 5KCZA 4RZHA 2PD3A 1P31A 3K6JA 1KVSA 5I7VA 1X0XA 8ADHA 4IGEA 2HRBA 1LLCA 2EP5A 2FR8A 2AG5A 5U1PA 1PGNA 4WLNA 3VZPA 2GN6A 4ZHSA 3BMQB 3NV9A 5L7TA 1C1DA 4RPKA 1N1EA 5CDYA 4EEZA 1L7DA 1MUUA 4NNJA 3JSAA 4J2HA 1XR3A 5A9SB 4GPD1 1R66A 3RBXA 2DUUA 1ONOA 1GQ2A 3ANMA 2GGSA 2Z1NA 3PK0A 3N74A 1HYGA 1SB8A 2CZCA 4JQCA 2PH3A 2B35A 2X0RA 2UAGA 5KKAA 3N58A 4MP3A 5EL0A 3AUSA 3TFOA 2ZB8A 3DBLA 4WNCA 5IZCC 3TRIA 3TZQA 3DZHA 3HQ4O 4E13A 5KJEA 1BGVA 2B36A 1IYZA 2YJZA 3RCBA 5KKCA 1JKIA 2RAFA 1U8XX 2FZEA 2VRCA 2Y0DA 3SXPA 3UUWA 3L6OO 4KQXA 5HRUA 1CWUA 2O4CA 4ND2A 4CUJA 4GWGA 3B1JA 1YOVA 5LC1A 3PPIA 5DCYA 4BO5A 3BTOA 4XR4A 1ZK2A 1LRJA 3FHLA 5KVSA 4KP7A 4E5YA 4G5HA 5IDQA 5IXYA 1VSVA 1A7KA 1ZK3A 4M1QA 3OQ6A 5L3ZA 1ISMA 1GV1A 1LQTA 2PWZA 5THKA 5I9LA 4Z6KA 4QUKA 3RFTA 2GD1O 4KMSA 4WCDA 1SO8A 3ZV5A 3Q3CA 1GUFA 3BAZA 4ND1A 3DMTC 1V35A 2CUKA 2DQ4A 2ZATA 1GCOA 4R54A 3H65A 1N2SA 3BHIA 5HA5A 1DIBA 2W2KA 5AXBA 1GEEA 2OBNA 3QVSA 2DBQA 4PG4A 4RLHA 2IEBA 5EQFA 3GZ4A 2BFMA 2VHZA 3TOZA 3LT0A 2OO5A 2J6IA 2OORA 1HE4A 3ZH2A 1P1JA 4BNXA 4GSKA 1PS0A 1MGOA 2CY0A 3EGOA 3L9WA 4YAIA 4R1UA 5JCJA 3GLQA 3KUXA 1RKXA 2C29D 4EUEA 3WB9A 3QWAA 2WD7A 5I9MA 1DIRA 4DBZA 3TNLA 2YV1A 3WGZA 2VHYA 3ICCA 1QR6A 3IP3A 3NRCA 4BO1A 4Y67A 3DZBA 3VH2A 3HE3A 3QWIA 3EUWA 2W2LD 2XXJA 1KOLA 3C7CB 1MC5A 4FIZA 4RDHA 3FN4A 1GCUA 2NADA 3ZZNA 2HQ1A 3KZVA 3FWNA 1E7YA 3AY7A 2JKVA 2FWMX 4R69A 3DBRA 2C2YA 1RM3A 4CLRA 2O2YA 2R6JA 3JD2A 4Y6SA 2CVQA 3VDQA 4BNUA 4BO7A 2H5LA 5B4UA 4GVLA 4HADA 2Q4EA 5CG1A 2IXAA 4QO7A 3PEFA 1PTJA 1IE3A 1ZIDA 4P38A 4YB8A 1Y8RA 5ES3A 3ASUA 4I1IA 4XR9A 4C7JA 2AEMA 2D4AA 4M89A 4MVJE 5TT0A 1PR9A 3BA1A 3HFSA 4CQMA 4LN1A 2XOXA 1R4NA 2Y1CA 1KEWA 3QSGA 4AJ1A 3KRTA 4EJ6A 1PL6A 2Y0EA 1T26A 3H4VA 2ZK7A 2PGLA 4PG6A 4R01A 1WWKA 4AJEA 1A71A 5L45A 3BMCB 4E5KA 1Q7BA 2C82A 4MKRA 4H7PA 4G65A 4INAA 2YZ7A 2FOIA 1Z7EA 2Q2QA 4LRSB 4BV9A 5EERA 3K73O 4BOYA 5IFLA 1P33A 3PFFA 3NEPX 4DQUA 3MOIA 1F8GA 1I3NA 3IL2A 1HDXA 3QRWA 4CM9D 4CMCA 3JD1A 4J2OA 4CM4A 3L4SO 4YWJA 3F4BA 1VL6A 3PHJA 4AJLA 4BV8A 4OOEA 4GX5A 4ALMA 3WGGA 2HJSA 5TQVA 3UAGA 3LVFO 4YQYA 3W8FA 1X7HA 3UCXA 3MJCA 1KVUA 2Q46A 1E7RA 3OA0A 2HJRA 2W2LA 4FN4A 1C1XA 4IQ8A 1L7EA 5JC1A 1NX6A 1HEUA 2FP4A 2NNLD 3OHSX 4M49A 3V1YA 3ZU2A 4EJMA 4N5NA 5EINA 1VLLA 1PS9A 3U09A 2EGGA 5ILGA 1BTOA 4MP6A 4RPJA 1I30A 4BO6A 2AXQA 3Q11A 5F1PA 5T8KC 4R1NA 4PLPA 5KVQA 2EKLA 4GL4A 2V7PA 4R3WA 3H7AA 3DZFA 2JAHA 3GOHA 2V6MA 3A06A 4XRRA 1Y5MA 3AFMA 4EJ0A 3KYCB 4H15A 4MVJP 1XKQA 1NQOA 3SJUA 2BFAA 4J43A 2ET6A 1TT5B 4A73A 3AM3A 1ZJZA 4N5MA 1U2GA 4WK6A 2A92A 1MX3A 1KIFA 5JO9A 4BGIA 4MVJI 4AG3A 1CF2O 3BMOA 3GAZA 5G0SA 4GX1A 3HUDA 3JQ6A 2GO1A 2CDAA 4MOWA 1LDMA 3JYNA 5G4LA 1FDWA 1UXKA 4MJLA 4PZCA 3NDJA 4NU5A 3G3EA 4E3ZA 3C85A 1BW9B 5LCXA 1GFSA 4NBTA 4YJFA 2CFCA 4HXYA 3KO8A 3E9NA 5B4VA 2OZPA 1RWBA 4FW8A 1WMAA 1YDWA 3CUKA 4NFHA 4OKNA 5CHEA 1LU9A 1MFPA 3IJPA 2LDXA 2CF6A 4CQLA 1JTVA 2J5QA 1EVIA 1NVTA 4D79A 1DJNA 1M6HA 3INTA 4D43A 1LDGA 3ENKA 2EJWA 2OMEA 2G0TA 5F1OA 3V1UA 3D0OA 2GCGA 2PD6A 1ZBQA 4RCVA 4XWYA 3O8QA 4BKUA 3O26A 7MDHA 2GYYA 5ICMA 1DC5A 5IJZA 2DTDA 1OFGA 2B4TO 4F6LA 1SEVA 4CR7A 4P4LA 2AE1A 1BXZA 1UP4A 4JGBA 3C7AA 5T6BA 4C7KA 1DRVA 1LLUA 1U7HA 2ZB4A 3GPDG 5COBA 4WECA 5K9ZA 4OH1A 4YRBA 2NU8A 4YT4A 4WOJA 4CM9A 1T1RA 1EQUA 4B4VA 3WSVA 5ENDA 3JQ8A 3GFBA 1GUZA 2H9IA 4ITUA 5T64A 4ALNA 2FZWA 3PYLA 3FTPA 3TFQA 3HN7A 1X1EA 3CSDA 1B7GO 1DFIA 4DLLA 2V6BA 2C2XA 1O89A 1TI7A 1BRMA 1DEHA 2I66A 2XAAA 5AXCA 5CPBA 1P0FA 3RC1A 1NAHA 4EUFA 1ZEMA 2GNAA 3DEYX 1GYRA 1Y8QA 2WDZA 2GSDA 4OSPA 1AXGA 3V2GA 1T2DA 1H6DA 2Q2VA 4A0SA 1LDBA 2JCVA 1EBFA 1UZNA 3ZWOA 1AXEA 4S1VA 3CPSA 4O6VA 1W8DA 1LDNA 1L1FA 3KB6A 2C20A 1HLDA 2JD2A 1VJ1A 1DPGA 3RD5A 3OJLA 3H9UA 3MOGA 4B4UA 1GADO 4OXKA 3WMWA 4URFA 5JCXA 1Q0QA 4E5NA 2EHDA 4BNVA 1DIHA 2R00A 4K1LA 1F14A 3V2UA 3JYPA 2HO5A 4B4WA 2X9NA 3I4FA 3JQBC 2HCTA 1H9BA 5JFOA 3I52A 2Y1OA 5TRTA 2YFHA 4RVHA 4PLCA 4UVDA 3L4BC 3R6DA 1LNQA 2I9PA 4P8RA 3AY3A 4L4SA 3VAZA 4HBGA 3QA9A 3MTGA 3PWKA 2Y93A 3H5RA 5JDCC 4CLOB 5ENVA 1NBOA 5IDWA 4KUHA 4O1MA 1J49A 3IP1A 2DM6A 4ILKA 3WGOA 4Y8VA 2O7QA 3DC2A 1NQ5A 3SLGA 4NJMB 1PGQA 1MFZA 3GEDA 2O3QA 3DFUA 3OIDA 2VHVA 4A10A 3DQPA 1EVJA 2WWRA 2BMAA 2DC1A 3BHJA 2E37A 2CF5A 4AJHA 3MWEB 1V3VA 4FGWA 2IEDA 5CPFA 4TSKA 3HFGA 4N7RA 3BHMA 4FOSA 4B4OA 4S3MA 1P1RA 4NK4A 2PGJA 3P2YA 2BFOA 4GWKA 3DHNA 4YPOA 4QECA 1X15A 4I5GA 4YJGB 4YEDA 3K2EA 3FNEA 4BO2A 1O95A 3NTQA 1P1HA 4NPCA 5L40A 4WLUA 2DBZA 4UREA 1JVSA 1UUFA 3QLJA 4KQWA 3DR3A 1BXGA 4RVDA 1ZW1A 1IUKA 5DOVA 2VYVA 4O59O 4RQTA 2Q45A 3RFVA 2NTVA 5B12A 4PGFA 4UVHA 4R3NA 1LI4A 2FMUA 3QHAA 1H5QA 3PVZA 2NACA 4D41A 3ON5A 4Z0HO 2X4GA 2A9FA 5DCUA 3W4IA 3ZU5A 1ADFA 5GZ3A 1YH3A 3IOYA 4CMIA 2JD1A 4ZQBA 3VTFA 4BO0A 3DZGA 1GD1O 3Q6IA 4GVXA 3UVEA 1H2HA 4CL3A 2DT5A 3ICPA 1XELA 1C0IA 4MVJH 4DIBA 1S6YA 4O63O 2PNFA 5H83A 3ANNA 1WVGA 5G0VA 6ADHA 3SX2A 1M75A 1ADGA 1P1IA 3H9QA 4RV9A 4I08A 1SB9A 3NDIA 1UAGA 1WDLA 5IAAA 1ZXBA 2WYUA 3WBBA 3RU7A 3ZWMA 1BDMA 3LU1A 1MC4A 4EUHA 2FN7A 2Q3EA 1OMOA 2PH5A 2C7VA 1I24A 5DDIP 3CMCO 4J7CA 3DL2A 3JQGB 4QO8A 1QV7A 2AQKA 2NVUB 3KTDA 3O38A 4YCAA 4TKLA 4CPDA 2X86A 4YJDA 1T2AA 4FGSA 3EMKA 4OQYA 1FK8A 1KEVA 4CODB 4ESOA 4CV1A 1ONNA 2I5PO 1K5HA 4XKJA 5EPOA 2I65A 3I6QA 4NJMA 3JQ9A 4J16A 2EIHA 3WX0A 1I8TA 3WYEA 1LUAA 2DFVA 4M8SA 4J9VA 4JIGA 4UAGA 1DJQA 1P3DA 1IPFA 5C7LO 4IIUA 1TXGA 3JD0A 4BO3A 1JA9A 4FFOA 3M2PA 1ZO8A 2Q49A 2O4UX 4CM8A 3W6UA 3CMMA 1ENPA 3GEMA 3GUCA 1QG6A 2BGLA 1UJMA 1B8PA 2JFGA 3CH6A 1ZCJA 3QIVA 4J1SA 4MKXA 1ARZA 3MCVA 4N5LA 4FB5A 1LSJA 2VQ3A 2F1KA 2GUGA 3AI3A 3KV3O 4Y6RA 4PLVA 3D7LA 3NYWA 1IPEA 3LZ6A 1RM4A 3JQ9C 4FCCA 1B8UA 4BGUA 2ZQZA 4HWKA 2P9CA 1JLLA 4CQLB 1NASA 3G17A 1EEHA 2YDXA 4NZ9A 4QEDA 4R41A 1HE2A 4CM3A 5A5EA 1HLPA 3AK4A 2EXXA 3QWBA 3GA0A 1A7AA 3CE6A 5DBFA 4DPKA 3WGIA 4RQUA 2BF7A 2BH9A 1HSZA 3E8XA 4UUMA 4FS3A 5L4LA 5JYEA 3VOSA 4FOOA 4NBWA 3RC7A 1BVRA 4JJFA 2H6EA 5DBIA 1XWFA 1N9GA 4KZPA 4YBZA 4JROA 4E5PA 4UUOA 2CMDA 3E9QA 4W7HA 3PDUA 1HF3A 4J1NA 2A94A 4NG5A 1ENZA 3KYBA 4DLAA 1NPTO 3NGLA 3HB5X 1D7OA 4JX8A 4DQVA 3IDSA 1YRLA 1K6XA 4ND5A 5KJ6A 4R9SA 3QVXA 4BKQA 1M66A 1F17A 3WGYA 3B1KA 5GZ1A 1JW9B 3PHHA 4RPGA 4QTZA 2W90A 3G79A 4IDAA 3WIEA 3GK3A 5DNAA 3UCEA 1YKFA 3ZNPA 3OH8A 3QP9A 1ZMTA 2AW5A 1M2WA 1O0SA 1SC6A 4Q9NA 5G0TA 4EDFA 1ISJA 2GN4A 2BELA 5A3JA 4CR6A 2P5YA 3ZU3A 3K30A 4IM7A 4BKRA 1PJQA 3Q9UA 3IAHA 2W98A 3VVCA 2JD0A 2QYSA 2YY7A 3H8VA 2O3SA 2WSBA 3ROKA 1CYDA 3ZWNA 3ZWPA 1CEQA 1K3TA 4DIFA 4PLTA 4YXFA 4LSMA 4GSLA 3E03A 1E6WA 2X0JA 3TWOA 2GPTA 3WIDA 1HTBA 4Q3BA 1I2CA 3VZSA 2DBVO 4WJZA 5L95A 4MINA 3AJRA 4EW6A 3OEWA 2D2IA 5KNLA 1A4UA 1PZEA 4OKIA 2VRBA 4ID9A 4HNGA 3COSA 4NH4A 3OM9A 4YJHB 3JQ8B 1VRWA 3Q0EA 1WZIA 4WEOA 5JPIA 3IMFA 3M1LA 3QQPA 3I9OA 3ROQA 2E6UX 3PGXA 3DZKA 5BT9A 4OSOA 4CMBA 2Y67A 3EW7A 1Y6JA 2AQHA 4HKTA 3STHA 4W4TA 5TIIA 1JAXA 4PLHA 1YBVA 2P4QA 3PGJA 3ZHBA 3ENNA 1MA0A 2AEFA 2DBRA 4TVBA 5LDGA 5L51A 3B6ZA 1J5PA 3BMQA 1TB4A 4LISA 5DP1A 4U6SA 2O3UA 4FDAA 3LQFA 1H0KA 1QMGA 3GY0A 1NFRA 4Z0PA 4I5DA 3DO5A 4JN6B 2EERA 5HM8A 4R4JA 4EITA 2QX7A 4OYRA 4XYGA 1P0CA 3OF2A 1D4FA 2YFQA 2JL1A 3K9QO 3U4CA 4GGPA 4YJGA 2YYYA 1ORRA 1LSUA 1YE3A 2PKRA 3BXXA 2GN8A 4O0LA 5BNFA 1ML3A 5KWEA 3X2EA 1DRWA 4JBGA 1MG5A 5AOVA 3U0BA 2NU9A 2Y99A 3ROPA 3AY6A 2P9GA 4AJOA 1XDWA 3DDNA 4Y6PA 2UUOA 1YVEI 3PJDA 2B83A 4AJKA 3UOGA 3IUPA 1A27A 3FBTA 3L0DA 4WKGA 4YACA 1B3BA 3LT1A 1Q1NA 3EVTA 3KLMX 4XDYA 1ENYA 3UW3A 3AW9A 1V0JA 4BNWA 4E31A 3AOEC 1KVTA 1GPDG 2D0IA 2P68A 3GRKA 3LC7O 4YQZA 2WM3A 4B7XA 1X0VA 3U4DA 3VKUA 1QYXA 1LLDA 4MVJF 5IZCA 3LT2A 2NTNA 3JD3A 3RBZA 1ZFNA 4BNNA 5IG2A 3TZ6A 2J5KA 4UEJA 2ZCUA 4J7UA 2QRJA 2EF1A 5TC4A 4CM6A 5F3RA 1AHIA 1JAYA 3R3JA 5JMWA 1YS4A 4MDHA 3NJ4A 4Q39A 1PJBA 1U3WA 3ZWBA 4J1QA 3WDSA 1V3UA 4U0JA 1E0DA 4WCFC 2ZTUA 2TMGA 2G17A 4CMGA 1LX6A 2GZ2A 3GF4A 4LCJA 5U9CA 3TL3A 1B16A 2B0JA 2QW8A 4HNHA 3GVIA 5DBGA 3JQAB 4CLXA 4BO4A 3RC9A 2VTEA 2B69A 3H9JA 3GZNB 3L6DA 1ZH8A 5U4QA 5BSGA 3DMTA 3PWSA 3ANLA 1U4SA 3KHUA 1NPYA 3Q9NA 3F3SA 5B4TA 1H6BA 4ZGWA 2QYTA 3EC7A 2EW2A 3EY4A 1LJ8A 2Y1FA 1I36A 3I5MA 1I5RA 1E3WA 3I9MA 1LQUA 3GC6A 2Y68A 3BZUA 3GFGA 3U62A 1ZEJA 1NVGA 4CUKA 4HUJA 1WXDA 1GUYA 2FPIA 1XEAA 2VYND 4DLBA 1PGPA 1ISHA 4E12A 5EN4A 2IZZA 4DBVO 4EBFA 2AHRA 4BNFA 1P77A 4H3VA 3H3FA 4L0QA 1SPXA 4QSMA 1XGKA 4FQ8A 4BMVA 4PG8A 1KEUA 1NVMB 3R0IA 4XB1A 4DTIA 1C3VA 4FFNA 3JQAD 3U4HA 2C5AA 4B3JA 4ZICA 1PIWA 1AUPA 4OHUA 2Y66A 4E2YA 1I3LA 2DPHA 3DOCA 4PVCA 4D46A 2VCYA 3KOUA 1Z74A 3WBFA 1T4BA 4FFLA 1C0LA 1E5LA 4XD2A 4KUGA 1JWBB 4YT8A 4CMEC 1ZNQO 1GZ6A 3KSUA 4JK3A 4XB2A 1WP4A 2Y1DA 3DOOA 1KC3A 4EGFA 3ONDA 1PGOA 1U7TA 5A3VA 3AM5A 3MJ4A 5T5QA 5A4DA 3CIFA 4WCFA 2BI8A 1OBFO 5EJ2A 3VH3A 3WNVA 1W73A 4I9UA 4I9HA 1QP8A 3RROA 3DFZA 4RGBA 4PN3A 3MZ0A 5TF4A 2NSDA 1NQTA 2VZ9A 2CVOA 5EMHA 3O03A 1B3RA 4IDGA 4DL9A 1DHRA 3DXFA 4AVYA 3Q1LA 5A9TA 2B5VA 1LEHA 1E3JA 3FD8A 2DFDA 1E7WA 3PZRA 1Q0HA 3VH1A 1JVBA 1YXMA 1PL8A 4I9NA 3W8DA 1R16A 3PRJA 4J3FA 3K2BA 4IMPA 5JYDA 1WAMA 1W0CA 2FPGA 5TSDA 2C7GA 5L4SA 4JLWA 2J3IA 4BNZA 3TJRA 4BVAA 3ZV6A 4IDDA 4WLEA 4R1TA 4CV3A 2GDZA 3IS3A 4II2A 4PZDA 4FSHA 3JQFC 3BMNB 2P2SA 3OA2A 3B1FA 5HS6A 2VWQA 3AOEA 3GZNA 3DB2A 1NFFA 3VPXA 5IN4A 1Y8RB 1U1IA 1DB3A 3ETDA 4U7WA 2IZ0A 3ZV4A 2VT2A 4XYEA 1ZJYA 3UXYA 1N92A 3G49A 1ZVMA
chains in the Genus database with same CATH superfamily
1E1MA 1NXOA 3HG7A 1JHUA 2WUVA 4Q4JB 4RV4A 3T41A 3F3KA 4IS3A 1IQ0A 3PDJA 4M0UA 2XMBA 1P4AA 1K8QA 2P2YA 3OZSA 3QXXA 5EEGA 3VZRA 1F8FA 3ZDFA 1EXVA 3P9SA 4OQ4A 3ZGZA 3OCXA 1IPHA 1IWOA 1NJ5A 1P9RA 3LYHA 5PNTA 4EHDA 3X1WA 3W5CA 3OUUA 1M76A 4MQMA 3CRRA 4OQNA 2DJIA 2L42A 2H1IA 1LVUA 5JY6A 1Z7WA 4JBIA 1QKIA 3BYZA 1N32B 2J3HA 1FYXA 3K0AB 4G5QA 4KQHA 1WNTA 4XX0A 2JJMA 2EW1A 2PLAA 5EJGA 2W2VA 2GN2A 2X1LA 3JAWA 1DT3A 1NE7A 1W4AA 3B1VA 3E1GA 4ISBA 5B2FA 2FX2A 4UTOA 2P0EA 2QMYA 2A78A 4KQJA 4M1KA 3WNQA 1SC9A 1UT8A 1E3TA 1I4TD 2QRHA 2CYAA 2QJWA 1SUWA 4KEAA 5D51S 4ZZ3A 3L77A 3AL2A 1GRCA 1H05A 2FYTA 3RT1A 3QSYA 1VSQA 4L75A 4MRRA 5IBQA 4LRXA 4TROA 1MMFB 4YGXB 4MWOA 5HIAA 4D8TA 2O2SA 2DQSA 4X6LA 2VK4A 1SMKA 2P2NA 3AG6A 1ZI9A 3A8TA 3TZKA 2WWXA 4Y9SA 3NCTA 2AVNA 3PA6A 3STUA 3V46A 3R9IA 4JP8A 2NG1A 2PRSA 2QLNA 3VTAA 3ZUPA 3I9V1 1Q0LA 1DC3A 6AT1A 1H6CA 1YZLA 1G291 3HWX1 1E92A 2NPOA 3DC7A 3OFJA 1Z5PA 4HDRB 16PKA 4ENTA 5ES4B 4Z4QA 1ZSVA 5HCIA 1HG0A 4FGJA 4ZA2A 1Z06A 5E4FA 1LB1B 4RFLA 3TSOA 1N5DA 4A82A 1CU1A 1SUIA 1UK7A 1V8BA 2PZLA 1X1TA 3PUHA 3HJUA 3S81A 4H17A 4AL4A 1WM1A 1UFVA 2JFBA 2BW0A 4TMFA 4F6CA 2V3CC 5EJIA 1QLHA 1VRVA 2ZJ4A 2X23A 4TUYA 5LM3A 1JJVA 5FXMA 1LTKA 1NVXQ 1VCIA 1Z0JA 4BTVA 1Z83A 3PJGA 3ZE9A 1UZLA 3N2KA 4LX0A 1SOUA 1FW8A 2WPDA 4L78A 4B8WA 5FV7A 3KVVA 1QPBA 1HMYA 5BWNA 3JQ7A 3X1JA 1EX9A 2O8CB 2L19A 5BQXA 4U7FA 1KE1A 3T9AA 3L43A 2A0WA 3M3HA 2EJBA 4BGVA 1G8HA 1UXIA 2IXBA 1CQIB 5CDFE 3A14A 3A26A 3CNOA 3MINA 1M6YA 3QJGA 4CMKA 1TIPA 1AV7A 4LYAA 1UOQA 4C0AC 1M6WA 4OI4A 4MIEA 3ESQA 3GARA 1E1QD 4LBVA 1YQEA 4LTDA 4PINA 1JFLA 1KK3A 2GKGA 4OATA 4ALJA 3IPCA 3VU9A 4EJSA 4LHZA 4OK3A 3L4BA 1E0SA 2OBXA 4YJHA 1AQ6A 1EFVB 3PS9A 1EDOA 4DG5A 1W2HA 4HLCA 4IICA 2QR3A 1T6XA 4WIAA 4WCVA 5JSZB 1NN5A 2E4ZA 3VH4A 1RYMA 1VDZA 3K05A 4IBOA 4P5EA 4ZQEA 3U1TA 4WOCA 4NMLA 1POXA 1I10A 1VIVA 4XQGA 2AR7A 4MCJA 4RENA 3IPYA 1KZ6A 4D0GA 3IP6A 4GH5A 4RYDA 1KY5A 3RRXA 1YJ8A 5KJ1A 4LKOA 1CIVA 1FJ2A 5IJAA 3S99A 1R37A 3D7SA 2NU8B 5BSWA 3S8MA 1PQWA 2FQQA 5AI9A 3BL5A 4G5OA 1MV8A 2PVPA 1OGYA 3RUDA 3LHIA 3D4PA 2A9JA 3L5OA 1X1AA 4IJQA 1YU9A 4EMUA 2BBTA 4OQQA 2XOEA 2BPOA 2R1UA 3W5HA 4H4CA 1WG8A 3W06A 3F0TA 1FDRA 2QZSA 3WJ7A 4AYWA 4UEQA 4DYVA 2V7GA 3RQIA 4EF4A 2Z6AA 3N86A 1QCCA 1VPEA 3IILA 3WOHA 4LECA 5LWHA 2R11A 3RKRA 3ZXUB 5IJWA 3BVPA 2XGMA 1XG5A 5JROA 2QLMA 1N7HA 4HF7A 4N8DA 4M0MA 5AI5A 4CVNA 3PKJA 1NMZA 4LF9B 4CLOA 1TAQA 4BZWA 4DLSA 4N8EA 4GRDA 4MMZB 4NLLA 1ECFA 1SEPA 1U2RA 1G3RA 2RHHA 1WTCA 3O1IC 4F46A 1NU8A 1PT5A 4FEEA 3NP9A 2FPWA 2JGJA 2H4JA 2Y8EA 2VDVE 2OPBA 3CCBA 5CTJA 4RVUA 3E22B 3PVCA 4YJ3B 4RD3A 1NBME 1CPYA 3GU3A 3V7UA 1AGPA 1LVGA 2FSSA 5TPZD 4U4AA 4QXQA 3IB6A 1X8XA 4RHCA 5GV8A 3WGUA 3G9QA 4TYMA 3FOWA 2V9ZA 3BRCA 3HXPA 2BD0A 4GE0A 1NXQA 3HVUA 3TRKA 2FMKA 4OVKA 1PWYE 1VRCA 3EGCA 1XL1A 2IIPA 4G0PA 4HWPA 1QF6A 3KCQA 4MV9A 1L5NA 4RA9B 4X63A 3ZXIA 5JH7A 1N2BA 3OEHA 3FNIA 4X3PA 1E6LA 3MINB 4U5XA 3UMSA 1TMYA 2PMDA 4OMFG 2HTFA 3OVMA 3OZGA 4PIMA 2VJQA 1VQ1A 3NIGB 4OPMA 4PC3A 4PX9A 5F33A 1KDYA 3U7RA 1YOVB 4B2YA 1PSDA 3N2IA 4AICA 3AY0A 3DD1A 1F20A 3RF7A 1FQWA 1MTOA 4JEIA 1MIOB 2GA9A 1GR0A 4IOKA 1IK6A 1H4TA 1QNLA 4G63A 4F2DA 4JI7B 3L7BA 1R9MA 3R6GA 2HT1A 4DGQA 3ORSA 3PUJA 3I6MA 4PGGA 2WT4A 4TWIA 4YUYA 4KQ6A 5A4IS 1I3OA 1PZNA 2QENA 2BVNA 3N5CA 3PPXA 4KQCA 2PU7A 3SN6A 1YDEA 3I5UA 5COQA 1M6EX 4D57A 1DWPA 1QTIA 4I36A 3UB4A 4IDBA 1NJ8A 5CH8A 1ZH2A 5B1HA 3WFIA 4BQSA 5JANA 4L1KA 5KOIA 1P9NA 3VNVA 3C6ZA 4HAIA 3DVAA 1QU3A 5FR2A 4DIEA 3NWPA 1T0IA 4HH4A 5CJ2A 4WXEA 5GZ6A 2PKQO 3RV3A 4D3XA 1N5RA 1BXRB 2XNJA 3LHDA 2C8LA 4ND4A 2D8MA 3X1DA 4DA6A 5IYZB 1MT3A 4B3RB 1P62B 4KC0A 5G1NA 2X1HA 2FPGB 2PHZA 3A3OA 1KJIA 1Q7TA 4YONB 3S5JA 3TQCA 4BB9A 4DV3B 1CUDA 3EGDB 1OILA 2MSCB 4WERA 5HIKA 1TTQB 3AJ8A 1NONA 1OQAA 3G7NA 3N87A 2PQ0A 3OM0A 3QBDA 2C5SA 4DN6A 1AKUA 4GQAA 2H2IA 2QQFA 3R0JA 1VLZA 2GRAA 3L6RA 3SYLA 3CZ4A 3U4IA 3H16A 4E2XA 4HB2A 4HAZA 4ZFNA 1EDEA 3MWDB 1T3HA 2JLUA 3WTBA 3M6MD 3RTGA 1CW2B 2CC2A 2QLJA 4MIYA 4RX1A 1NW3A 1AURA 2AYXA 2EZ8A 3ZJ5A 2C9OA 4CMJA 1PVOA 2ACWA 1OWLA 2ODTX 2P5UA 2P90A 4KYIB 4MO2A 4XDGA 3EA4A 1ULHA 3MJSA 4R0VA 5ER9A 3V1TC 1UANA 3PR3A 3HR4A 4FYPA 4Q02A 4FEYA 1ISSA 5EUQB 2I22A 5JSFA 2CJWB 3GWGA 1BC5A 2DTXA 2H2AA 3EW9A 3HU1A 2BGIA 1S96A 2XTJA 1ZHHA 1K89A 3MPOA 4MUBA 3IQEA 1P29A 2PL3A 4FFBA 5BYKA 4EB6B 5FL7D 2VDPB 3ND5A 3E9ZA 3VPHA 1QIIA 3TQOA 5D1NA 3DG9A 2HBZA 5ERYA 3A6JA 4BQRA 3H8SA 4BMSA 1Z7GA 2XF2A 4XI9A 4QUHA 1BDJA 5KOHB 5KNBH 2YR0A 3EZ7A 4OM8A 3GMDA 4J49A 3GNSA 3QPWA 2OP0A 4NY1A 4OAPA 4GOOD 3QMMA 3RTAA 1L8OA 1T5SA 5B6JA 3TZCA 4KQ1A 5BNTA 2QG9A 2ZRLA 2D1FA 3ONVA 4HVLA 4TVOA 2QX4A 2I8AA 3TQSA 5B1SA 4JI0B 3TSYA 3H5NA 1PTKA 3AQIA 3GDGA 3KQPA 3AR5A 1ABFA 3O8OB 2Z6VA 3D7KA 3OOYA 2HF7A 4EW1A 2O05A 4R3UC 3F49S 1XIVA 5FLYA 1U0BB 3AIOA 4YGYA 2V5VA 1Y0BA 1GYPA 3CW2A 4KWEA 4XR4A 4BLVA 4BEBA 3D3EA 2A86A 2IXFA 2VRCD 4ND8A 4QWMA 5JRZA 2MSNA 3BQNB 4UTXA 2BUAA 3JV7A 3SZOA 3M81A 1A82A 1UF9A 4JLKA 5DT2A 4OHZA 3VPAA 2JFHA 1FBNA 1PD1A 2WJZB 3LA6A 3V7YA 1Z25A 2VNIA 1UZAA 3KYDA 3OQVA 4TKUA 3OQPA 2HBYA 3QFCA 4AJ4A 3U5TA 1KYTA 4IZIA 4RWZA 2I1WA 3RUEA 3LIPA 1MEJA 5DIZA 3T5PA 2IYFA 4IGIA 1GZHB 4Z51A 3GOQA 1N0UA 2BZ0A 1GTL1 2HZ7A 5I4BA 1Z2OX 3PNSA 4X64B 4BXOB 5ALQA 2HNBA 3KOMA 3S6JA 3GLIB 4QVKA 5MFZA 2MHCA 1QORA 4MPTA 2N46A 1SIWA 1EKXA 4DAEA 1XXHB 3DAOA 4Q0MA 1UZMA 3PE3A 5EESA 3INRA 4F85A 3UYKA 1QK5A 1B26A 3H5VA 5BSHA 2QUKA 4HLUC 4R1SA 2H8GA 3PYXA 4DA0A 3WAJA 4JYAB 1YTLA 3N2NA 1I1NA 3LO5A 3NDRA 4I2NA 1M5UA 2IPNA 4F45A 3DZJA 4ZYVA 2QR2A 3MMZA 2OHXA 3LVQE 4X00A 2ORYA 1AMUA 4QU9A 4CM4A 3HGQA 3OJOA 4DDMA 3DHWC 1DIAA 4CV0A 1NRXA 3WWDA 2A1UB 3ENVA 3FH0A 1RWVA 2AMFA 4UMEA 2R8RA 1IMJA 2EOAA 4Y9RA 2AZTA 4A6EA 1PNQA 4FMCB 1VL2A 1P74A 4KWTA 5FEUA 1XPRA 3FDIA 1GQQA 2G71A 5E9QA 1GEGA 3I58A 3PE4A 3AVWA 3LLSA 4UVEA 3BK1A 3AHCA 1MJHA 4OLBA 4C4SA 1Z6QA 1D7AA 3GGSA 2XLBA 4DA7A 2M2IA 4L5JA 2HD4A 4R5MA 2WWTA 3ZGOA 2JDIA 5CLFA 3QM1A 2VPTA 4MSUA 3HBFA 4PZ0A 2HK9A 1DAFA 3FB4A 2DJ5A 1AIPA 4WACA 2FZ5A 4Q6WA 2G0AA 2YNMC 4NQZA 4S12A 4WXHA 3PLNA 2ASEA 5JSKA 5LFAA 1WRBA 1FXWA 4BB5A 5K0FA 3PL5A 5L8VA 4J0EA 2V5UA 1BH2A 5E3HA 1ONPA 1AQUA 3GRZA 1Q20A 5FLKA 5KIAA 4V2UA 4N0EA 3SPXA 3P20A 4WQMA 3WTCA 5FBKA 1TDJA 4FHDA 1W48A 3KM0A 3S2IA 4BUCA 5JVDA 2IYLD 2B5WA 2HEGA 3R9XB 2O7SA 4WKOA 4WLVA 4F3YA 2Z58A 2VO1A 5JXHA 3UGKA 1SUDA 1HLGA 4QQRA 4LPSA 5HJEA 3EFEA 3HMQA 4BNTA 4H7HA 3LQ2A 1AA9A 1V5WA 2A59A 2HN9A 1HE8B 1PP4A 2OV2A 2QE7D 3EWIA 5DASA 4XDZA 3N8IA 2XX3A 3CZRA 3GLFE 3ILSA 1NWHA 3SJAA 1W85B 1N6RA 3GLUA 2HFKA 3SQDA 5KTKA 3HDGA 5BRNA 3EPLA 2DFNA 2IUEA 3CEPB 5CDSA 2WKQA 1AMNA 1DMSA 3MGBA 4WADA 2XIJA 2Z56A 2B9VA 3H04A 3BPSA 2ZSKA 3O4JA 3K2IA 3RS4A 1R15A 2NO6A 4B31A 1FP6A 1TVEA 1OXXK 2H1SA 1BQ3A 1ZR2A 3DT6A 1MQAA 1MD9A 3S1LA 2REXB 3ED1A 5GJCA 3EYAA 4GIBA 1SHUX 4ECAA 1IRIA 2E18A 3HACA 4KX3A 2JGKA 4LGYA 5K3FB 1D2AA 4G5GA 2C3UA 3NTUA 3PXUA 4D9FA 1O77A 1MEOA 5C3MA 2H1HA 4NCBA 2ZBRA 1P81A 4RAOA 3R7AA 4MZXA 4S0ZA 3ZKWB 5BN3A 2Z9CA 4P3PA 3E23A 1OD6A 4ZCPA 1XD2A 3AUYA 3I01M 3DBVO 3KDPA 4Q1CA 5CTAA 4D3YA 1TA9A 1XU7A 2JLQA 3MMNA 4Q3DA 2NUAB 1RHQA 2ZYGA 1UBTS 1ZNYA 4KU4A 5HCUA 1Z0AA 4L9RA 1E5XA 2AJ8A 1OB2A 3I1YA 2CL7X 2W9XA 1BMTA 2ADOA 4ONEA 3ZBTA 4W82A 5LDHA 4TKMA 1E3SA 5IBRA 1I2ZA 1WXWA 3DBIA 2QHXA 1OXKB 1XTVA 3QJ5A 4EB0A 1D2GA 5L3SB 2F9MA 2JF0A 1PV4A 1VG9B 4HQNA 1YBMA 3W7AA 4AS3A 4W9MC 3S0JA 1XJCA 3KJZA 1L6RA 4IWXA 2P4UA 3BKWA 4WWHA 3ORFA 1E2BA 5E1MA 2O07A 3LQYA 4Z4IA 1V2GA 2AOWA 2I1LA 3UICA 3GH3A 3HKCA 3QV1A 4D42A 4LYEA 4AKHA 1KEPA 1Z4IA 3P1JA 4K8RB 5FFFA 4BNDB 4I5IA 3M4NA 3EZ2A 1O3YA 2H1FA 1R8XA 3Q3GE 4H0CA 4N5DA 4Z1MD 5AVQA 1X7DA 2FFBA 1EVEA 2AOXA 2B4QA 3O84A 4W8HA 3UM9A 3VM6A 4TRMA 3YASA 1JH8A 4J0HA 5EI5A 5GIPE 3NHLA 4UEKA 4IDEA 3KZNA 1SXGA 3C1OA 4ZYZA 3KIPA 1T6BY 2R1TB 1I9GA 1U99A 3EXAA 4MS4B 4BWYA 1SC1A 4D9BA 4P7BA 1SKBA 1BCSA 1NDUA 4OHXA 4AY2A 5AM0A 4DXAA 2BEVA 5FOUA 4TUYF 3V1KA 4D4JA 2GT1A 1QYVA 2RONA 1EDZA 3FMVA 4TVSA 1WZ2A 4UE2A 1ENOA 2FSVA 2I03A 4BKOA 1FYDA 1G2PA 1P5ZB 1V1JA 2O50A 5JLJA 2B61A 3FJ1A 3JYLA 3NAMA 4DMCA 1CC1S 1II0A 1PJZA 2FFAA 2FW1A 2WJWA 3R24A 4NBVA 3H11A 5CMLA 5ALJA 3UAWA 3L2OB 4GOLD 1G7RA 2FUNB 1HM5A 4H0NA 4KIUA 3ZWVA 5C7OO 1NXPA 3IO5A 1JB1A 5G02A 1YUNA 3ECCA 4GMFA 2EBHX 2G28A 2VOEA 1KDOA 2Z98A 3IEPA 5KC9A 2A5YB 5BWMA 2ZRCA 4DSAA 4GNRA 5LD2B 1YI0A 5P21A 3EYWA 4C06A 1VBMA 3C74A 3ILYA 1E3IA 1G8MA 2JKYA 5BSTA 1HL7A 3FCXA 2IW3A 3ESAA 2H9YA 1E2DA 2L0XA 2JJQA 4OMUA 1JG3A 1FDTA 2N3ZA 3AP3A 4XE5A 2GEUA 3ZVLA 1YGPA 1W4CA 3H5AA 3DOFA 1GITA 4DXHA 1PK9A 4B6JA 2D5AA 3M7IA 2VYVD 4KQGA 5JDCA 3ZXSA 2XVXA 3ABIA 1Y5RA 4J90A 4G9EA 3RW9A 3ZZTA 4KPYA 3KXPA 4Q7MB 2X3YA 5DCWA 3F1KA 3NWJA 4B71A 4DMMA 1Z35A 1NL3A 4DSNA 4XYMA 2ZT8A 4YV7A 1J5XA 1RCFA 3U81A 2UVQA 3GHYA 2HLNA 2EGHA 2IE0A 2AJCA 2NUAA 2VBIA 1Z5WA 2JA1A 3P9KA 4BJ3A 4A5OA 4ZYYA 1W9MA 3UTDA 2PYDA 3CZMA 1CUSA 3WNDA 2OCIA 1TQ2A 3MBIA 4F3NA 2X7XA 1XYGA 3CPJB 4KNWA 4R9VA 4HN2A 3WDLA 3CLKA 4DDVA 5K3OA 2G67A 1FRZA 1EGHA 4MEAA 4GSYA 1UMBB 2YZNA 3C87A 3USCS 3OE1A 5EMMA 3DYBA 4YDRA 2PFKA 2Q1YA 3EGDA 1XZCA 4Q34A 5TV2A 4EUSA 2V0GA 4HTFB 4Y0VA 5L3SA 1YMUA 3JQAA 1MBZA 3GBPA 3E1KA 4Y2QA 5DKFA 4F5DA 1MRZA 3G13A 1P80A 3G2IA 2J4FA 1TF2A 2ZJ6A 3CLHA 3IFSA 1YRYE 2LBPA 3H1FA 1NFQA 1D03A 2CV1A 1H2FA 1I32A 1SXJA 4OY3A 2E4UA 3QVLA 3VR5D 2XT0A 1IQUA 3QYAA 3NWOA 4XWGA 4KGDA 5K8CA 1EE1A 1VJ0A 4XVRA 5DOZA 2G9QA 4IRMA 2ZE6A 1UR5A 1EVYA 1F5SA 1HGXA 2WTEA 3GP5A 1NQVA 1T1IA 2HMAA 2Q3BA 4IIYA 4BZPA 1ZCFA 3BAFA 1Z0ZA 2JFFA 3COZA 3OICA 4JBWA 5JOQA 4NDNE 3FMOB 1BG6A 3HFRA 4QOHA 3VH2A 3B2NA 3QITA 4RLSA 2COUA 2HLHA 2ZI4A 2ZJ1A 3G2KA 3OHMA 2J5BA 2YZMA 4OGWA 2XWSA 1KMHB 1P7VA 2FPRA 3EASA 3KP1A 4WNIA 3V8PA 4YRZA 5HYVA 1JG2A 2ZIGA 1SBIA 3JWIA 3ZVKA 3RSGA 1WMSA 3UWPA 4YUAA 3P5SA 3HA2A 1XFAA 1HMPA 1TO1E 4RMGA 5ITZA 1ZOOA 3IR5A 4J4BA 4PZAA 2C42A 2JHCA 2ICAA 3PJFA 2R2GA 1AKMA 4XOUA 1YVRA 3I32A 3H2ZA 2CFRA 3BILA 5I8ZA 2PS1A 1X92A 4EW2A 4UTPA 3IIMA 1P45A 3VMMA 4Z53A 3TLBA 1FEZA 3H11B 3D4LA 4QBFA 3NAZA 4FLFA 2P9BA 1WMBA 3MUNA 2BGRA 4W5WA 1CUEA 2XB4A 1G0NA 1OPRA 1EU1A 1EWRA 3HDJA 4Y3UA 1N5LA 1NYQA 1PKXA 3D8HA 3T7TA 1XAIA 4NNOA 3W3AH 1T9GS 2DERA 3LV8A 1JNXX 4YPVA 1U4OA 3O8OA 4MV7A 3EB9A 5JBIA 1G59A 4V39A 5DNWA 3PPYA 3NJ8A 3RAJA 5C7IO 1NKSA 1KY3A 3MHPA 4WOPA 3G9XA 1WUHS 3AESB 1QRRA 3NHRA 3AF0A 4M0KA 1AD2A 1DWUA 3RRNA 3DVLA 2AS0A 3PXBA 2PXAA 3TLZA 5L3QB 3I1IA 4R68A 4GI2A 5TJHA 3TRFA 2LIVA 2VPWA 4JBHA 3WB0A 5EJ6A 5TEWA 2X2FA 1GPJA 4P0QB 1AK1A 5EZYF 4W9NA 8MHTA 4XWKA 1PQUA 2I54A 4GXQA 1X1QA 2GOYA 5EJFA 5H4GA 3LUFA 3V9AA 4Z99A 3JALA 4RXMA 2PQMA 1V5IA 1W76A 3ITKA 4CN9A 5DYYA 1UH5A 1X86B 1XMQB 1C3EA 1SOVA 4KQEA 4TN1A 5KVVA 5KNBD 1RS0A 4Y2XA 1P72A 2Q6KA 1CZLA 3QNUA 5BQPA 2XBMA 1IHXA 3UMBA 4CMHA 3FCCA 5EMLA 1P9LA 2VG8A 2V7VA 3FPGA 2W93A 1QBKC 4Q66C 4D9NA 1GV0A 3B38A 3QOWA 1E9RA 4FR5A 4UZEA 1FTNA 4ENSA 1R0LA 2HMSA 2HUPA 5KS2A 4MRMB 1JDUA 1QIMA 1VCOA 3V7WA 3OJFA 3OO0A 4PAGA 2VT3A 1YOBA 3RK0A 3HS3A 3QKTA 2O0MA 2IYPA 1UXHA 1TC1A 5KPDA 3E2IA 4KK3A 2C2HA 3OZTA 1JQAA 1KDPA 621PA 1KDTA 3G8YA 2B20A 3AVXA 1N0VC 3HA7A 1CS4C 2XF8A 4GMDA 5CX1A 4IGKA 1G63A 4Y9DA 4LMRA 5HVNA 1NU6A 1XLTA 4L0CA 5EAIA 4BNHA 4D0RA 4KFTA 1XWWA 3STVA 4AMVA 4M9RA 5JZVA 1PR3A 1VL0A 2BE7A 3G1UA 2G76A 3EK2A 2OMKA 4M54A 1DX9A 1XALA 2F8TA 3F6CA 2HF9A 2WY2D 2FR0A 2EDAA 3W2GA 3S1SA 1YE8A 2HM7A 5A3SA 2X0KA 1Y3HA 2BMEA 1Y82A 4MUAA 3A1SA 4PU0A 1R6BX 3M6XA 4Q4HB 4FFVA 1FP7A 4N0MA 2AGVA 2JJ2D 3I2JA 2XW6A 5EP4A 5A05A 2XNCA 3H4TA 1GNSA 1Q12A 1XUOA 1YL5A 2W6MA 3DE2X 3GGJA 2QM0A 2PG3A 3GVCA 3JCZA 4GC9A 4R1LA 1XL0A 2Z5LA 1TQ6A 2CGEA 1RBQA 1WUYA 3HVIA 1B43A 1M2EA 1QHYA 3O3OB 3PUVA 3PQ7A 4FJ2A 4NHOA 3X1MA 1XI2A 5IUJC 1EWQA 2VIIA 5FYQA 1KJNA 1TAUA 1P5FA 2J6BA 3HU5A 1KS2A 3ST7A 4NE2A 5ADUS 1OSNA 3H3XA 3PRKE 3E48A 4YECA 4ZPXA 3HYSA 3U40A 4TN5A 1HG1A 3AUTA 5DEOA 3F7OA 2X8BA 3FGZA 1XA0A 3W2EA 1SUBA 3AR3A 3UMJA 3C1UA 4FDMA 2PRIA 3B7WA 2YJ5A 1QJ4A 3MJTA 4FJ1A 4DJAA 1T25A 1I1HA 1L5HB 2F3SA 2E0IA 3L18A 3F5FA 3KEOA 4RH1A 5FQNA 2IL1A 1XTIA 1MAUA 3P2EA 4NENB 1XVTA 5K99A 1JHRA 3JAKA 1YR6A 2GJ9A 3ZWAA 4JUFA 2OV6A 4R40A 2WP8J 5AJUA 2RGXA 2NPFA 5GTDA 4G0VA 3O95A 4M60A 1Z6XA 2WNIA 4BBPA 1KTIA 4EJFA 2HYIC 1Z28A 4M0PA 4MYCA 4NK5A 5FH9A 3C3WA 1WP9A 3F98A 1HH4A 2GJAA 1FDVA 3WV5A 4O4JA 1WXXA 2BJHA 4F2WA 1DXYA 1P60A 4UULA 1UBCA 2NPIA 5FOTA 4KR2A 1RM0A 1LLFA 4UTZA 3N8NA 5KQSA 4EX6A 4JQYA 1L3IA 4CW7A 5CAEA 5FI5A 2WA1A 2B98A 3WV4A 3E5RA 2FFJA 1B1AA 3MAGA 1D1TA 1E5TA 5IFKA 3ETGA 3KWLA 1KC1A 2PRZA 2ZSIA 2O20A 2Z9BA 3EDOA 1YVUA 4RORA 1R0SA 4E2ZA 3ZKWA 3SZMA 3I3SR 1KQGA 1SBNE 4DG9A 3UAVA 4K7JA 4QUEA 4AS2A 3C8HA 3HBMA 3QKSB 4ODIA 4REQA 4OV6B 3GEHA 4D8VA 5D00A 4ZJYA 2PCJA 4TRJA 5JT1A 3UWMA 3EVNA 3P0HA 1GG2A 2HWWA 1YJBA 1YRAA 3U4QA 1GJRA 1Z4OA 3C8MA 4LSWA 3ZK8A 1BXGB 1FJGB 4QX6A 3OE5A 3MJVA 3DTYA 2WG1A 2WSSA 1OXTA 4F72A 4HEJA 1NBIA 2WYWA 4PXYA 1EFLA 4RHUA 3R5FA 2WJPA 2OE2A 1A72A 3UJ9A 7MHTA 4CRWB 1NF9A 1O6ZA 1SNYA 3W8RA 1UJCA 1X6VA 4ZRMA 2H1OA 2ONCA 4G0WA 3H0KA 4MI6A 3OE4A 1SM4A 2CXTA 1ZRMA 3H9EO 1HOXA 2XIQA 3T9BA 3H0CA 4BWFB 2I6GA 2XYHA 4N0QA 3UFXA 1YS1X 1MXFA 4IHJB 3C6KA 1JLKA 2RHCA 3UCFA 4REOA 3WICA 3G0CA 3ZHOA 1JXOA 3GO4A 1K63A 5CEEA 5KOJB 1WETA 2DB3A 3IAUA 1FXUA 4PVDA 3PQFA 3THRA 4J6FA 3RYCB 1H94A 2HMUA 3PLRA 4W5JA 4JC0A 1Q1ZA 1E18A 4FYHA 3BFVA 3LDUA 3LP5A 3FG9A 4F92B 5HZHA 1LC3A 4JBNA 5LZ5A 4PY2A 4DUGD 1SURA 2FR8C 4LC0A 3RUAA 4DZRA 4RPHA 2I67A 3D1LA 1N6OA 1YAJA 4YALA 2D0DA 3W4JA 3NQ41 2HMYB 2H9AA 4FD2A 4J7XA 1CRLA 1GGFA 3S68A 2FF7A 3MCUA 3WJAA 3C8DA 4DMKA 3QWFA 2BMVA 2VUSA 3QXSA 1OHHD 1DIOB 1ZICA 3A10A 1C14A 2NOAA 3M5DA 2MSKA 4O8ZA 4XW2A 4ALKA 3DE3X 4BECA 3PYMA 3WLIA 1X1BA 2RARA 2L18A 1ZM9A 2XTAA 3EVEA 3I2FA 4OGLA 2YV5A 4WZBB 3F3MA 3U0VA 2A35A 5J40A 3RRYA 2H0RA 2HJ9A 2C83A 3HZHA 3OMXA 2NZWA 4J76A 1U7XA 5BURA 4OKSA 3GBVA 5ETJA 2BV3A 4PRLA 1PZHA 3A3YA 4ZI5A 3OFSA 5HZKA 3TI9A 5CCXA 4HGQA 1F0YA 1A9SA 5IWCA 2OD2A 3L49A 3SQMA 2VUTA 4TL8A 1T4DA 1JPVA 2X0NA 1BH6A 2IXDA 4W5RA 1RKUA 1R6TA 2OOSA 4LHSA 2O2DA 4NBLA 1NHWA 4E5VA 3ZWXA 4FSXA 4OXIA 4HAVA 3A6GA 4IQ0A 1PJSA 4R81A 4GDMA 3IBYA 2P67A 4BX0A 5BMVA 3BIOA 1P39A 1OJ7A 1ZWKA 3GFTA 4YYZA 5IAOA 1D0VA 2ODBA 4MS3A 4X94A 2AR0A 1RC8A 2CEAA 2QUBA 1PZFA 4K6GA 1RM5A 3R3VA 3LJKA 1GVHA 1XMXA 4N82A 4LRQA 3GELA 4XPIA 3HYCA 4GOMD 4NJOA 3FNGA 2DUJA 3MRSA 4I0WB 1JE1A 4QQNA 3FI9A 4TT3D 1L5MA 1LKZA 3W9YA 2VWPA 3O4VA 4PLYA 1N2IA 1K68A 1KO8A 2P2LA 2ZBQA 3RKUA 4WY2A 1N3LA 3NGXA 5DPMA 1CY2A 3C6XA 2ECKA 2UYGA 4GLOA 3GJ6A 4PHFA 3FYHA 2BMDA 1CY7A 4YC7A 2LP4Y 1A5AB 1ZK1A 4YX9A 4DEYA 4FFDA 1K4MA 2EWMA 2VWGA 5JAIA 5K3AA 3RSHA 4XYLA 3PHLA 3KTAA 5FLEX 3Q85A 4UNNA 3U3JA 1XRJA 2J3LA 3WYFA 4AD8A 4DWJA 1PT6A 1Y81A 4E5UA 2RJOA 4CL0A 4D5EA 1Y8ZA 4C7OB 3ENZA 4L9AA 4N03A 1GRQA 1HE1C 3TTUA 4XRGA 3L0CA 5IKEA 4JC5A 2NZXA 4R1QA 2Q1SA 5KOJA 3TB6A 5K6AC 3CZPA 5AWFC 3VUFA 5C5IA 1U8UA 4ACAA 2B4RO 3AOGA 3RVQA 3EHDA 2GCIA 2QI9C 5AJHA 5ALUA 5HX7A 1ZD2P 1QHSA 3K6RA 3LY8A 3O82A 3SXUA 1QP0A 2FPPB 1JEOA 4KDEA 2V1UA 5TDHA 4MTCA 4C4XA 3DHYA 2GVDC 3TXAA 3FRJA 3T7JA 1RYDA 2Q9BA 2YIDA 1Z56C 2GK7A 1RD4A 2Y0CA 4AJ9A 5DSXA 1Y37A 5F7ZA 1ZPDA 3U48A 4NCNA 5JDIA 1T4CA 1L6IA 1TJYA 5CNKA 3STYA 1DINA 4RAQA 3V4FA 2JBWA 2DKOA 3U7QB 2Q5HA 5JCJD 3BORA 1KO5A 3MW8A 3DL4A 4MR7A 1T1SA 4WZBA 3HA3A 3I6BA 1IHDA 3P19A 3MELA 3OIGA 4N6NA 4A91A 1F4VA 3K16A 4F4DA 1QH9A 4PRZA 4YP9A 2JJYA 2WHPA 4FOTA 4DGSA 3HXMA 3A2KA 2AXEA 5AI4A 2AQ8A 2V8BA 2YZ2A 3ZWKA 3IEKA 1DKQA 5EJ7A 1D09A 1QGYA 3KSDO 2Y27A 4O2LA 4COKA 4L15A 3R77A 3GLKA 4N7JA 1SRRA 2Z9DA 4MDEA 4Q9IA 3GJ3A 3EFHA 3PXGA 3E84A 2RDMA 2ODAA 1YB4A 3VPFA 4Y30A 3NKLA 4JJIA 3DW1X 2AR9A 3KKQA 4UEWA 3BB1A 4AIRA 3HDTA 2IHNA 2E82A 4UVIA 3VPGA 3MILA 4TMWA 2PXCA 3EGVA 4HOYA 5IXSA 3GMSA 4J0IA 4YRFA 2VNSA 3HH8A 4Z9YA 4WXPA 2VTBA 2YXDA 3K92A 3KKOA 1OYYA 2COKA 3NBMA 3KV1A 2H1LA 2OLJA 4QKQA 4TZTA 3B70A 4ES6A 3CUYA 2VRNA 3DBHB 1UK8A 1Y1PA 1Z2EA 3BJZA 4N0DA 3R4VA 4F71A 1ICEA 4BZQA 2PVSA 1FS6A 1MX9A 1I5EA 2B2NA 3IBGA 2EJTA 1IOLA 1JSZA 5EWLA 3KAPA 5DJ5A 5K8TA 1N6NA 2QTTA 4IV8A 1QHGA 4U9IS 1SPBS 1L7PA 1WMEA 1FMCA 2OKGA 4O5OA 3ROEA 2H52A 3GLFA 5TNXA 2NAPA 3O94A 1CUGA 2HR1A 3QG1A 5GY7A 4F4HA 4OXNA 2WSSD 1JSLA 5E0OA 3B2EA 3T7CA 3IMKA 3VRHA 4B7AA 2X42A 3T99A 3JQCA 2V8OA 1X2BA 3NKFA 3ETNA 4P4SB 2D7DA 1EX6A 1NUUA 1UKYA 4POAA 4QELA 3RRMA 5BVGA 3W8EA 4P86A 1JSXA 4CXMA 3BBPA 3VSDA 4U7HA 2CJYA 2CNNA 3EG9A 2R6DA 1E7SA 1QC5B 2X22A 5JS6A 4XIFA 3E4CA 1XQ1A 2XQVA 3FNQA 1T8YA 4BMOB 5IVDA 4MRNA 2VHQA 2QU8A 1VMDA 4JUBA 5JALA 4G0XA 2HU7A 2VOJA 3E61A 5SYNA 4YPFA 2FSHA 1KY4A 1TZBA 3ZBPA 5AVWA 4WPGA 3AKZA 4HNAB 4NHEA 2EHJA 3FKSD 3ESZA 1UM9A 1WEKA 2Q5LA 2PAAA 5GGXA 4D56A 4M8NE 1U3VA 3SJCA 3FLEA 3ULKA 3ET4A 2IYVA 1R6DA 4D9JA 5KCZA 4JJ7A 3IT3A 3NHMA 4Q9LA 3ABRB 2ZRDA 4FONA 4L3VA 4F4JA 5A2QA 4G0NA 8ADHA 1E61A 2CLDX 4O2BF 5IW8A 5IT0A 4J3NA 2V5AA 2DMRA 1TYZA 3AHJA 3DEFA 1PGNA 3QNWA 1B8OA 3IOMA 4BEVA 4WLNA 2CCJA 3HZOA 1KXJA 3VZPA 2FDCA 2GCNA 2GN6A 4ZHSA 3NHKA 3T38A 2ATIA 5L7TA 4WZ6A 3QU5A 4IHQA 3H19A 2RHGB 1E9VA 3ZHRA 5CDYA 2II6A 3GFFA 4GP6A 5FPTA 2PKEA 3IHKA 4EG4A 4B73A 1R00A 4ENWA 3N2LA 4TXJA 2OD9A 3WLHA 1R66A 1TKRA 4LDAA 4NS1A 4TV8F 3IAAA 2OO5C 1OAKA 3ND9A 4EL0A 4FHCA 1XMSA 4LIPD 2BE9A 2MR5A 3CB2A 4JKYA 4RD4A 3WB1A 5KTSA 3IQXA 5LQNA 3EPHA 1QV9A 5TY0A 3WWCA 3LA8A 1UBUS 1FYWA 1Y9ZA 5LJLA 3W5SA 3CZQA 3RTEA 1A9QA 1M54A 3AUSA 4FS8A 3DBLA 5F78A 5IZCC 4HHEA 1F60A 2OV4A 1QIGA 4KRGA 1NW9B 4MARA 4E13A 2I6FA 2ZJFA 1L9KA 2XLCA 3LK6A 3RCBA 4ZHQA 3VJMA 3MCZA 1PR6A 3QU9A 1F4LA 3SKYA 1NZDA 3UWOA 1ECPA 2XRYA 4X61A 3CLUD 2Q5QA 4L8WB 4ZOLB 5BW8A 2IQ5A 2R8YA 2VLBA 4KQXA 3UUWA 5K8IA 4G1VA 5IYZF 5CFOA 3IKMB 4FFWA 1GAWA 3C39A 1D8TA 4S1OA 2OCDA 4CUJA 3B1JA 4CF7A 4ABYA 3S1AB 4CETA 2BRUC 4PHTA 1TC2A 4LPKA 5DLDA 1NW8A 4Q9HA 2UZ3A 2XCRB 4G5HA 5IDQA 3UUFA 4BFWA 4EF5A 2UXBB 1M2KA 2NQ2C 2QGZA 1GV1A 3R75A 1NSTA 1B00A 2PWZA 5THKA 3EVFA 1ICIA 3AHDA 1ZM2A 4KMSA 2E1RA 1YS7A 1SO8A 1GTJ1 4WCDA 3Q3CA 1XEWY 3ZIAA 2ZM5A 3TQTA 1JLMA 2FWIA 4IG4A 4UM9D 2CUKA 2UYQA 2DQ4A 3TD2A 5CYOA 3THXB 3KVYA 4WKBA 1UDWA 1Z33A 3H65A 2OENG 2AG0A 3OPYI 4DV2B 3C48A 3ACCA 3N2KB 1INLA 3TNFA 1CUIA 3AHGA 3U2QA 3KXIA 3G7SA 4MUHA 1GEEA 4HZGA 2WIKA 4LMBA 3KE9A 1H5UA 4LV5B 3STWA 3UOWA 2OHOA 5KKNB 1B41A 2IEBA 2RFLA 2ZT6A 5AOCA 2LV8A 5EQFA 3CJRA 5A6SA 4JJKA 3VAYA 4XD7D 2NZUG 3WRYA 4NJEB 1A97A 3C3YA 3UJCA 1B0ZA 4LFAB 4GU5A 1U63A 1PFKA 1WUKS 2RAVA 4L08A 4LY0A 1UJ4A 2FUG6 1LV7A 4J8PA 3Q8MA 4R1UA 1ZVVA 3DW3X 3T3OA 4M7RA 1ZC4A 4MTLA 1O7JA 3A1WA 1IG3A 2Q5OA 3SFTA 1YR2A 4X8HA 2PUJA 3BICA 5IJ9A 1OIXA 4J0DA 4U7TB 4F84A 1TO6A 4UKDA 1DIRA 1H2RS 2FPSA 4ZAYA 2P11A 3GFQA 4MCIA 5AW5A 5AW3A 2H48A 2ZJ8A 3T34A 1ZH4A 3IP3A 3HCRA 3IAS6 3UEOA 4BO1A 4M7PA 4AKGA 3VHLB 1JEEA 1T9DA 3TIXB 2PKYX 4U1RA 2W2LD 1HKHA 2W2QA 4FWBA 5FKJA 3VXKA 3WMEA 2AUTA 1MC5A 3OX4A 1TMKA 5CXSA 3FN4A 5B6PA 4WA8A 2NADA 3G2HA 4MRVA 2IU3A 4EOGA 1MIOA 2P8JA 3AY7A 5FTWA 4RD6A 3EAQA 4R7TA 3F73A 1CV2A 2J6HA 1BOOA 1P7PA 3KKLA 2P9FA 1RMTA 5A0TA 1L8LA 1VIYA 3AR2A 1IG0A 4HQ6A 3FUVA 2CVQA 1F2TB 4JS0A 4Y6SA 1QRSA 1TCUA 4HADA 2Q4EA 3L7IA 2IXAA 2JK1A 1VJRA 1YKGA 1IE3A 2PZFA 3K7EA 3U3KA 5FA8A 2KHZA 1ZDMA 4F3RA 1K92A 1SQGA 4OYYA 4GWLA 4KAJA 3MAJA 1PR9A 1U98A 3I45A 4I50A 5GQSA 4OB8A 3Q41A 4BFZA 4CQMA 2XOXA 3A05A 1IJEA 3VR5A 1R4NA 2R9VA 3QPV