1V3UA

Crystal structure of leukotriene b4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase in apo form
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
330
structure length
316
Chain Sequence
FMVKAKSWTLKKPTQSDFELKTVELPPLKNGEVLLEALFLSVDPYMRIASKRLKEGAVMMGQQVARVVESKNSAFPAGSIVLAQSGWTTHFISDGKGLEKLLWPDKLPLSLALGTIGMPGLTAYFGLLEVCGVKGGETVLVSAAAGAVGSVVGQIAKLKGCKVVGAAGSDEKIAYLKQIGFDAAFNYKTVNSLEEALKKASPDGYDCYFDNVGGEFLNTVLSQMKDFGKIAICGAISLPPGPSPESIIYKQLRIEGFIVYRWQGDVREKALRDLMKWVLEGKIQYHEHVTKGFENMPAAFIEMLNGANLGKAVVTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto
publication title Structural basis of leukotriene B4 12-hydroxydehydrogenase/15-Oxo-prostaglandin 13-reductase catalytic mechanism and a possible Src homology 3 domain binding loop
pubmed doi rcsb
source organism Cavia porcellus
total genus 101
structure length 316
sequence length 330
chains with identical sequence B
ec nomenclature ec 1.3.1.48: 15-oxoprostaglandin 13-reductase.
pdb deposition date 2003-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF16884 ADH_N_2 N-terminal domain of oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1v3uA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1v3uA01
2Q99A 2P5UA 2DPGA 4YJFA 4CQMB 3TZKA 1OOEA 5TX7A 2Q2VA 2IE0A 3WMXA 3P2OA 1K6IA 2AQKA 4W9NA 2PA3A 1ZCJA 2PKQP 5A04A 1OC2A 3TPCA 4YBZA 1DSSG 4YRDA 3CSDA 3UAGA 3F1LA 1I3MA 1QYCA 1J0XO 3GZNB 5DULA 4AJKA 1E3SA 2Y1OA 1R0SA 5EL0A 5FFFA 4ALKA 1HYGA 5FWNA 5JS6A 4OXKA 5DCWA 4TRNA 5JE8A 1Z7EA 2JAHA 1H0KA 3GF4A 3ZNOA 2JCXA 4GH5A 4TKLA 3ZI0A 5CFZA 1DC4A 2RHCA 3U62A 2V6FA 1I2BA 4XGKA 4BKPA 4CJXA 1KC3A 5CG2A 4RVHA 4XQGA 4BGVA 2NTJA 4ZJUA 3FNFA 4NBWA 3C7AA 3U49A 4BO5A 2DBQA 4E2YA 3WYBA 3PLRA 1LRLA 4HFMA 5CPBA 4IDDA 1U8FO 3Q0EA 4MVJD 4AJIA 1OBFO 2HMWA 1R4NA 1E6WA 3VH3A 2VCYA 4R3NA 2H9IA 3WGHA 2V6MA 1T2DA 5GZ6A 5KKAA 5A4DA 1MA0A 5LDGA 2ZYAA 5JDCC 3GK3A 1UP7A 4BQPA 3U3XA 1YE3A 1ENOA 3H9GA 4DXHA 4RDHA 5A9TA 1UXHA 2DTDA 5EQDA 5H82A 4NPCA 2YFHA 4X54A 1LDEA 3FRJA 2VWGA 5CDSA 2VOEA 5DBGA 2VZ0A 3I4CA 3RUAA 3AFNA 1I32A 1VKOA 4NK5A 3HJAA 3MOIA 3I9MA 5F3RA 1NXQA 2I9PA 4LMPA 3PJFA 1PS8A 4WKGA 3RKRA 1HE3A 4YEDA 1ONOA 2EP5A 4R51A 3JQGA 3H9QA 3WYEA 3HADA 4A7PA 4XGIA 1KVTA 4R01A 4AJ4A 4NFHA 3CMCO 5JXWA 1HZZA 3MWDB 3U4IA 4ALIA 3Q2IA 4CMBA 1VKNA 4EBFA 5IDQA 3JYLA 5J23A 1SO8A 1PJ3A 4M54A 2VNSA 3KLPX 4HFJA 4TZTA 1F14A 4Z0TA 1B8UA 2OZPA 4GGOA 1KY4A 5CDUA 4ZRMA 2GZ1A 5I7VA 2FMUA 4WLVA 1BRMA 3B20A 2Q1WA 2D8AA 1LRJA 1C1DB 3RUDA 3QQPA 2EERA 1QYDA 2WMDA 2GN4A 3OIFA 1E3IA 2PGLA 4GVXA 1B14A 5DF1A 1PQUA 1EVYA 1VSVA 3RFVA 4EITA 1PZEA 3H65A 3AI1A 1GYQA 2E49A 1SOVA 1ULSA 2I6TA 1GV1A 3V8BA 2GERA 4W7IA 4GLLA 4RL6A 1FK8A 1YBMA 1ZK4A 3DHYA 1I3LA 4E3ZA 3H9UA 1PQWA 4L74A 1RJWA 5H83A 4OXYA 1O9BA 3I83A 3O26A 4ND3A 1N8KA 2WEKA 1U5AA 4BKUA 4DWVA 1MGOA 2UUOA 4MKXA 1BGVA 1DEHA 3UUWA 1XQ1A 3DAGA 3HDQA 4MVJP 5EIOA 2Y05A 3NDIA 4KUHA 4O63O 3TFQA 3WLEA 2VYVA 2ZQYA 3S2IA 4XKJA 2NV6A 3NYWA 4HBGA 2QIOA 4D79A 5A03A 3FI9A 2NU9A 3CMMA 3H2ZA 4D7AA 2GYYA 3WQSB 4HFRA 2AXQA 4DBZA 3E18A 1ADBA 4WK6A 1PU2A 3QY9A 4I9UA 3M6IA 5C7IO 2DUUA 4FJ1A 3NT5A 3KYCB 4PLPA 1ENPA 2OL4A 5IXSA 1L7DA 1E6EA 3G1UA 4L75A 2YJZA 3ZV4A 5K6AC 4BNKA 4CMGA 2ZTUA 1HDXA 4XYLA 3EY4A 4FW8A 5JO9A 3H2SA 4BMNA 1J5PA 3DTTA 1Y8QB 1XCBA 3K9QO 1BW9B 4LCEA 3TN7A 3OA0A 1QV7A 3OQ6A 4M8SA 2VUUA 2ILTA 4DPKA 2PV7A 4KMSA 1TT5B 3OIDA 3BMCA 3PJDA 3G3EA 5A06A 1T2EA 4XDZA 4YJDA 3VZQA 3AWDA 1O0SA 5FI5A 3SC6A 4OHUA 1U28A 4K6CA 2WDZA 3GPIA 5DCUA 4HP8A 4OKIA 4J2HA 1TA4A 5IFLA 3JQ8A 1GU7A 4HUJA 1VE9A 4FR5A 3DXFA 3D3EA 3G49A 4XR4A 3L4BA 1ISGA 5JCJA 3UKOA 1EK6A 1U9JA 3E9QA 1YH3A 4FGSA 4YJGA 1HSZA 3G79A 3JD0A 1HE4A 5KJCA 3L9WA 1QR6A 1GQQA 4EUHA 3QVOA 2BELA 2CF5A 3WSWA 1A9ZA 1E3JA 4PG7A 3PQEA 3PZRA 3GVHA 2O3RA 4IMPA 4QEDA 4CLOA 1NM5A 3F3SA 5EQFA 3LT4A 3W8DA 3IUPA 1BHSA 3GEDA 3GNQA 1XGKA 2JAPA 5G4KA 3NTRA 1DJNA 4E30A 3KYBA 2P2SA 2G0TA 3MJEA 4OQZA 3WDSA 3AU9A 1LDMA 4KWHA 3CKYA 4UUPA 5T8KA 1DC5A 3C3XA 2BGLA 3BHIA 5TIIA 2E48A 4GQAA 3A4VA 3PHJA 1DIAA 2HMTA 2X22A 4N5LA 4R5HA 3QLJA 2VQ3A 1EVIA 2EJVA 3ZU5A 2GRAA 1E7SA 4MVJI 5EERA 5COQA 3ONDA 4TRRA 1GCUA 3PDUA 4OXNA 3I6QA 4YACA 3RUFA 4B4WA 4Z3DA 2IZ1A 5JAMA 3GGGA 1N9GA 1WMAA 2IZZA 2P68A 2QHXA 4GSKA 3ZHZA 1I8TA 3FNHA 2B5WA 5KJ6A 4BGUA 5A3JA 4R54A 4F6LA 1T1SA 2C2XA 4L0QA 2CVZA 3TJRA 4J6FA 4DA9A 3VVBA 2C59A 2I3AA 3S2FA 3KRTA 1SPXA 1RWBA 4AJ2A 2B5VA 1DJQA 1H9AA 1ZXBA 2X9NA 1RPNA 4JX8A 3WGGA 3A06A 2PWZA 2JHGA 1X0XA 2G82A 2VYNA 1HSOA 4TMFA 5GZ3A 4WEOA 5JCJD 5KTKA 2CVOA 1LLDA 2NVUA 4CLXA 1YJQA 3TFOA 2YV1A 4WOKA 4XX0A 5L9AA 3CTMA 4M1QA 2Q46A 4JIGA 2BFMA 3ZW8A 5TNXA 1KIFA 3RC1A 1NQAO 3GEGA 1GDHA 4DQUA 1YXMA 4F6CA 4B8ZA 2TMGA 3WXBA 4AJOA 2PH3A 4CV3A 1SMKA 3DBLA 5CPFA 2BMAA 4IUYA 3KTDA 3UCEA 4MP8A 1P44A 3HG7A 5HA5A 4E5KA 4Y98A 4OGWA 5L95A 3LSYA 2DQ4A 3UVEA 2POQX 4GI2A 3S1LA 5TSDA 1PGOA 4K28A 1V6AA 4IQ0A 2HAEA 5GZ1A 4GX5A 1GPDG 2VTEA 5LDHA 2FPPA 2FOIA 3ITDA 2I5PO 4WLFA 4L9RA 3QVWA 2FR0A 3BMNB 2PD6A 2Y1CA 3JQCA 4OAQA 4YRBA 5HM8A 4OYRA 1Q0LA 1HT0A 1JQBA 3WGIA 1PL7A 5EMHA 4LGVA 1TLTA 3C1AA 2RBEA 1NQOA 4QECA 3E03A 1XSEA 2X0JA 4UREA 4MJLA 2NACA 4M55A 4CQLA 2X9GA 2CZCA 3DBVO 2NTNA 4ZGWA 1E3WB 4IIVA 4F3YA 4R41A 4YAEA 1JKFA 4YCAA 1T4DA 2WTBA 1AXEA 2AG8A 4D3DA 3L6DA 2OHXA 3QWBA 3GFGA 1ZK1A 1LLCA 2DAPA 2P9GA 4UVGA 3D5TA 5A1TA 3ZU4A 1CRWG 2J5RA 4E31A 1V35A 4P4NA 1NVTA 1U1IA 3A28A 1M66A 2X8LA 1W8DA 2VYND 4CMCA 1E1MA 2YW9A 3WGYA 3AUTA 1H6AA 5T5QA 4E5YA 3RU7A 3K2EA 2EKLA 1QLHA 3LC7O 1J49A 3QV1A 1ZJYA 1HDOA 4NU6A 4R1UA 3OJLA 4CR7A 3GOHA 2D2IA 3OJEA 4Q3DA 3AY7A 3GDFA 4WGGA 1HDRA 1FF9A 4KP7A 4ND2A 3KM0A 3LYLA 1LC0A 4ZU3A 3DBRA 3SX2A 3Q6IA 4E5PA 1N92A 4HXYA 4A2CA 4JCOA 5JY6A 2BKAA 2HDHA 3D0OA 3PK0A 2HU2A 3H9EO 4DMLA 1GUFA 1E77A 4A73A 1LDGA 1N5DA 3RC2A 4ID9A 1K0UA 2QRKA 2Y1EA 3PWZA 3JV7A 4R9SA 4MOWA 5A9SB 3H9JA 3ONEA 4RQUA 4BNNA 2X23A 4CMEC 1Z7BA 2NUAA 4L4RA 4AL4A 1FDSA 4P38A 2W90A 3WGZA 5A3VA 3VPHA 5JLAA 1GTMA 1QYXA 4IXWA 3ZWAA 4BB6A 4EJMA 3X2EA 2LDXA 3ZH2A 3AOEC 4R69A 4RPGA 1A7AA 2CUKA 3FF4A 3ZWYA 3KXDA 3RFTA 4L4SA 5TLSA 1GFSA 2BF7A 3FPCA 3GDGA 1UZLA 5F5LA 2OBNA 3AI3A 3Q2KA 3PYXA 3ASVA 4RVFA 3KYDA 5COBA 1NBOA 3LVFO 4KQXA 3JQBC 4CM3A 3U9LA 4DTIA 5L40A 1U4OA 5F1PA 4WUVA 5KJEA 3TOXA 1P1JA 3HDYA 5L3ZA 4PLZA 2GPTA 3P7MA 4JGBA 1D3AA 5CG1A 1P0CA 1E1LA 1XIVA 1HDGO 2WD7A 4MIYA 4GKBA 4W82A 1I3NA 3E1KA 1LQTA 1GZ6A 4TVBA 3K73O 1EK5A 4Y6RA 2ZYDA 2QQ5A 2E4AA 4YJHA 4ZQFA 4MP6A 3PWSA 1H6CA 3I9JA 4J49A 4CV1A 1HTBA 5MGBA 3ADOA 4ZQHA 2PZMA 2ZTLA 3VZPA 2AEMA 3WIEA 1Z82A 1I33A 2J5KA 4IM7A 4IDGA 2Y66A 3AM5A 4XQCA 1ZW1A 3W4KA 1F17A 2YFQA 1SEVA 2XXBA 2CFCA 3NAQA 1E7QA 4YWJA 2CMDA 1IY8A 1MG5A 1LXCA 5EESA 1E3EA 2VHVA 3GLQA 3QRWA 5IF3A 3AFMA 5FYDA 1NFFA 3I9OA 3HDJA 4P22A 1XKQA 1K6XA 4JLWA 4J3FA 4S1VA 4TQGA 5ENVA 1YB4A 1U2GA 4XZ3A 2G1UA 4BNTA 1KEVA 2EF1A 5A05A 4BNHA 4DL9A 4YT4A 4KWIA 4NH4A 1DBVO 1JA9A 1AXGA 4PVDA 4G5HA 2EXXA 4XYEA 3VDQA 4ESOA 4FGWA 4CL3A 4TVOA 1XQ6A 1YL7A 1YOVB 4ZRNA 3W6UA 3V1TC 4ZD6A 1KOLA 3GUCA 4NBRA 3WMWA 4YTEA 4CLRA 3CE6A 2E6UX 4N5MA 2V6GA 4MP3A 1P0FA 3FR8A 3WJAA 2D59A 3WYCA 1UR5A 1VM6A 3RBZA 3VPFA 2O2YA 3ZHYA 3C8MA 2BGMA 1DOHA 3V1YA 1P1KA 3IP1A 1X7HA 4G2NA 2W2KA 3RAJA 4J90A 1ZMOA 2X4GA 2FR8A 3BMOA 2RAFA 4BKQA 1E1NA 5U1PA 4B4VA 2YDXA 4EUEA 3NTOA 1VL0A 5IZCC 3K8ZA 4CLHA 5JDIA 2PKQO 2ZJ1A 4CV2A 3SLKA 4DLAA 3K6JA 3P19A 1EUZA 4ND4A 4YRAA 3UF0A 2Q45A 3MTJA 5TRTA 1C3VA 2P9EA 5TT0A 1C0LA 1XEAA 1LDYA 1G1AA 4HFNA 4Y67A 3GC6A 1UXGA 3DZFA 1HE5A 3RKUA 5DOZA 3VOSA 4YA6A 3KO8A 1F8GA 2EW2A 1LSSA 1XR3A 1ZEJA 2EV9A 2Y1FA 2VNAA 4LW8A 3WGQA 5DN9A 5KJFA 1I3KA 3E9NA 2CSUA 1P31A 1Z75A 3F4LA 3VTFA 3KOUA 1CDOA 3TWOA 1KYQA 2R2GA 4CMIA 1PL8A 3AM4A 4CMAA 1EBFA 1PTJA 4PZCA 3HNPA 4WCFA 3JQ7B 3HFSA 4YAGA 3FNEA 4EZBA 1HL3A 1EFKA 1EZ4A 4Q3NA 3GH3A 3DMYA 4B7CA 5A5EA 3FPLA 1MLDA 1LQUA 1UZNA 4PLWA 1A4UA 1PZFA 3ADPA 3WTBA 4TWRA 5IN5A 4RDIA 1U3WA 5L53A 1JW9B 4URFA 1SNYA 2BD0A 3RIHA 1Y6JA 4E6PA 4Y9DA 2DBRA 1P77A 3OA2A 1OI7A 2HCTA 3BMQB 1Z6ZA 2GZ3A 3QVSA 2Y0EA 3SEFA 3PYLA 3TRIA 5THKA 2HRZA 5BNFA 5KNLA 1U3UA 4RF2A 4BNJA 3KSDO 4HNGA 4OO3A 5DNAA 2C5AA 2OORA 3WIDA 2J8ZA 4D44A 1V9LA 2Q2WA 4U5QA 5CEFA 1NTOA 4RV9A 3KHUA 3DZGA 3WGTA 3C7CB 1VLLA 3DHNA 3MEQA 4BMVA 1TI7A 5C37A 1CERA 4CR6A 2X58A 5JCXA 4ZICA 2HKIA 2X7HA 4PG5A 1Y7TA 2Z1NA 3BHJA 3M1AA 1QXSA 3EUWA 3L4SO 1PS9A 3UXYA 1DO8A 2O50A 5L51A 1V3TA 3DONA 2Y68A 5EPOA 2PKRA 9LDTA 2NQ8A 4OMUA 5KKCA 1D8AA 4LISA 3VPXA 4BNFA 1C0PA 3NGXA 4FN4A 1YB5A 1M67A 4FS3A 1G6KA 1AN9A 3A1NA 1NPTO 2PZLA 3IJRA 2B0JA 3W8FA 3P2YA 3RVDA 3K2BA 4BIIA 2X6TA 2EGGA 4GSLA 4ILKA 3QHAA 4KUGA 4CM8A 3C24A 1RM4A 2J3HA 4GPD1 3WS7A 3ON5A 3DOOA 3F9IA 3OJFA 3WWZA 5K0ZA 4GWKA 4BNYA 5F5NA 2ZATA 2BGKA 3O03A 3GVXA 2H1SA 3GDOA 4H3VA 3GG2A 4XA8A 4PLTA 4UAGA 5IDYA 5L7YA 2JHFA 1H5QA 1A71A 2FP4A 2H6EA 2PFGA 1EFLA 2Q1UA 4D45A 6LDHA 1DFHA 1Y9EA 2OOSA 3EAGA 3IC5A 4LN1A 4CQMA 4GX1A 3P5SA 3ZWNA 1JVBA 1UAYA 1FJHA 5DP2A 1R37A 3JQGB 3PI7A 3PYMA 3Q9UA 4WE3A 4PIVA 1NASA 1QRRA 1ZK2A 1QG6A 4FFRA 4W7HA 4XIJA 3NX4A 3GPDG 2C7VA 4PLYA 2YQ5A 1RM0A 3KVOA 4HKTA 1GZ3A 3ICPA 1DRUA 5I9NA 1WDMA 4OH1A 1CQJA 4CMJA 3IP3A 3OIGA 4RLHA 3BHMA 3FR7A 2GDZA 1Y1PA 3JSAA 2WE8A 4I5FA 4D43A 4UVDA 2YHIA 4DLBA 4IXTA 4DIFA 2I66A 1E7RA 5ILGA 3RUCA 3UGKA 3WSVA 2HMUA 4BO1A 1DIHA 3TZ6A 3Q9NA 5JMWA 2JJYA 1JAXA 4IGEA 3ZV6A 1WMBA 3DMTA 3QIVA 1PX0A 5KJ1A 3WWYA 2AQHA 2HJRA 1P1HA 2R00C 4YT5A 1D1TA 4Z9FA 3NGLA 1ZO8A 4JQCA 4ZA2A 4AJEA 3HQ4O 5IXYA 1M6WA 1XU7A 5L4NA 1Z45A 5L45A 1UUFA 3B70A 2O3UA 4QSMA 4XYMA 5AYVA 1KVSA 4I9NA 4ND5A 5C5IA 2B4RO 1O89A 2VTDA 2DM6A 8LDHA 4FJ0A 3KZVA 4O6VA 1PSDA 3EZYA 4IDBA 5BSGA 4YDRA 4BHTA 3V1UA 3ZWMA 3ULKA 2DFDA 4ND1A 3H6KA 4PLHA 1WPQA 3JYPA 1MX3A 5HS4A 4BL5A 4CQMD 2AE2A 3KSUA 1IOLA 3H5RA 2X86A 5GY7A 4RZIA 4ZVVA 3SLGA 3PWKA 1H2HA 1A7KA 4BO9A 4M49A 4D0RA 4QO8A 3DTYA 2C20A 4YT2A 1I2CA 1ZVMA 3E82A 5CAEA 1F12A 4HY3A 2DUWA 1T1RA 1KEWA 3PVZA 3JQAB 2Y67A 3VPGA 1Q2XA 2GASA 2WYWA 3PIIA 4NMHA 5JYDA 3DWFA 1P1RA 1PL6A 5TC4A 4GLOA 3DHEA 4D46A 2XOXA 1WAMA 3U09A 1HLDA 1LU9A 2YDYA 4R1NA 1NHGA 1EUCA 2HK9A 2Y99A 5GMOA 5KVVA 4FOSA 4BNZA 2Y93A 4I8XA 5THQA 5B1YA 1G0OA 4RLSA 1MXHA 3CEAA 1HZJA 1BXKA 3E5RA 4IZHA 3D1LA 2WE7A 3B6ZA 2FRDA 1CEQA 4J4TA 3RBXA 3JQ8B 4TKMA 1PR3A 2NU6A 2UVDA 2ET6A 3F5QA 2X0IA 5ILOA 3I9LA 1QYVA 3HB5X 3JYNA 4W9NC 1OAAA 4FSHA 3IDSA 1YBVA 1MB4A 2W8ZA 3E48A 2QX7A 4XYBA 4YJGB 2NQTA 4BVAA 1CIVA 1F0YA 3SBOA 3ZDFA 3GGOA 3PJGA 2FY8A 5HS6A 3H8VA 1Y8RA 5T57A 1H94A 3GAZA 1EE2A 2IXAA 4GMGA 1MFPA 1U8XX 1VL6A 4RF4A 3BYZA 4UEKA 3G1TA 2YYYA 2EWMA 3WTCA 3AY3A 3CXRA 1D7OA 3E8XA 4F45A 5KWEA 2NVWA 1R4MA 2W2LD 3QWFA 4NBVA 1XA0A 4H7PA 3MJVA 1OZAA 4JXKA 4N7RA 4AFNA 1YGYA 3C85A 3T7CA 3KYCA 2I99A 3GVPA 1IUKA 4Y6SA 4XRRA 1E3LA 1DFGA 1B15A 2CDBA 2JKVA 4BQRA 5ADHA 1H6DA 2DT5A 3D64A 3HB4X 3NV9A 3H3JA 1F8FA 1TVEA 4IMRA 1Y8QA 3ANNA 1BW9A 1FDVA 1UXIA 4R4JA 5AVOA 3VDRA 5F21A 2YHUA 3JQ6A 5A9RA 5G4LA 1LNQA 1TT5A 3JQ9A 4FPXA 1N9GB 4INAA 4YQYA 4P4GA 4GX0A 4S3MA 5JMPA 1MFZA 3QVXA 3ZCXA 3DBHB 4FFOA 1E7WA 1LDNA 5CDYA 3GUYA 2YV2A 5BT9A 5JAQA 2O3TA 4J2OA 4JJGA 2Q4BA 1E5QA 2Y1GA 4YR9A 5I7SA 3INRA 4CL8A 3ROKA 4BGIA 4XQEA 3VZSA 3L77A 1O95A 5ICMA 3PZBA 3OSUA 4L73A 4MINA 4FQ8A 3VH2A 5HWSA 4CM6A 4AJLA 4W6ZA 5B4TA 3CZRA 2PGJA 4CUJA 2X5KO 3FBTA 2AQ8A 4MO2A 3O38A 3GN1A 2NVUB 3B1JA 1KVQA 3ENNA 5JNLA 3AOEA 5KVSA 1PEDA 4B7UA 3PFFA 4AICA 5KVQA 5JY1A 4EJ6A 3S8MA 4BNIA 2UDPA 5CDGA 3GNSA 4RVSA 5DBIA 3GFBA 4B4UA 3LF1A 1L7EA 2IYOA 1R15A 5AOVA 3E6AA 4LSWA 1M76A 2I3GA 2PH5A 1X1TA 1KVUA 3W4JA 3Q3CA 2O4UX 3RI3A 4E0BA 2OUIA 4CLDA 1Z74A 4YB8A 4EGFA 3WNVA 2Q1TA 4PRKA 3U5TA 2AMFA 4J0FA 3GRPA 3OEYA 1AE1A 1P33A 3GHYA 3H4VA 3L0DA 5AXBA 3UW3A 3AUAA 1Q1NA 4YVFA 1ADGA 1HE2A 2QYSA 1I5RA 4UVEA 4J91A 4R1SA 1TXGA 1ZK3A 1CYDA 1NP3A 5AXCA 4CQLB 2PD3A 4ONEA 3R3JA 4B3JA 1A9YA 3LU1A 4GAEA 4U7WA 1M75A 4NFSA 3ZNNA 1DC6A 2ZB8A 3FWNA 1DPGA 3CZMA 1HXHA 1LBEA 2XF8A 4M89A 4MVJG 3RC7A 3JQFA 2GLXA 1LTHR 4CMKA 4O59O 3FSRA 2UV8A 4BO6A 3O8QA 1ISJA 3DFUA 3AU8A 1VC2A 3ICCA 4K26A 5G2OA 5KIAA 3ZU3A 3GY0A 3PHLA 3Q1LA 4BNLA 4RO0A 1YWGO 2YZ7A 2Q3EA 1DLJA 3WX0A 4EJ0A 4RVGA 4NU5A 4BOYA 1PS0A 4FD3A 2GZ2A 4XD2A 4Z9XA 1E7YA 5IG2A 4CM1A 1ZFNA 2DTEA 2P9CA 3C1TA 1ZK0A 3BIOA 4BMSA 1DLIA 3HE3A 4RPJA 3S55A 3WB9A 4BKRA 1V3UA 4PLFA 2TMDA 2D5AA 3OHSX 5LC1A 2NM0A 2AA3A 5B12A 4I1IA 2PNFA 4L8VA 4XIYA 5G0UA 3EYWA 5U9CA 3KBOA 1I36A 3NT4A 2J3JA 4IQ8A 3DBRB 5TQVA 4JJFA 1AGNA 2A92A 2GF2A 3TL2A 5G0SA 4YAKA 5HRUA 1QMGA 4QXMA 1UH5A 4AJNA 2Q4EA 3VKVA 3FNGA 4J9VA 1ULUA 2PTGA 2ZQZA 3BMNA 3L4BC 4IY1A 4MVJM 3RUIA 3CH6A 3JD3A 4KZPA 3AUSA 1H2BA 1DIBA 3I5MA 4WJZA 3AI2A 5KCZA 1WVGA 5K1SA 2NU7A 4OJNA 2B36A 1E3WA 2JFGA 3QA9A 1SB9A 2FZWA 1HDCA 2V65A 1MXFA 4BNMA 5TGDA 5AXAA 1B8PA 1ISIA 3K30A 1GQYA 3OH8A 5HTOA 3OMLA 1P9LA 3PTZA 1JKIA 3COSA 4J43A 4DUPA 1EVJA 4A03A 2Z1MA 1YDEA 3KYDB 3NDRA 4XGNA 3KB6A 3JYQA 1IZ9A 5JAZA 1SZJG 3A14A 2VHZA 4J0EA 4ROSA 5I8WA 5I9LA 4XDYA 2Y0CA 3RASA 1JU9A 1JN0A 4Z6KA 2VUSA 7ADHA 2EKPA 3MJCA 4I5EA 3KSZO 4KDEA 2CNBA 3ANLA 1PGNA 2J3KA 3DZHA 3RROA 2NSDA 1Q0HA 1J4AA 1Y5RA 3JTMA 2IEBA 4IJKA 4O1MA 4CM9A 1QLJA 1B8VA 1YQDA 3VTZA 5B4UA 4Y8VA 5TT1A 4YJHB 1YO6A 3FWZA 4LK3A 4RGBA 3B1KA 2CD9A 4AVYA 3FTPA 1FMCA 1P1FA 1P3DA 3GGPA 4CUZA 1WP4A 3FCOA 4WLUA 1WXDA 3PRJA 5ES3A 2CY0A 3O9ZA 5C7LO 1M6HA 4QTZA 4HNHA 1XG5A 3ZV5A 4XR9A 3PJEA 4RPKA 4WPGA 2G5CA 4EEXA 1C1XB 4DYVA 3I6IA 4NBUA 3PFWO 1LSOA 3RCBA 4UVHA 4CMHA 3RU9A 4CPDA 1HDZA 4R3WA 4YYZA 1LSUA 3L9XA 2CDAA 3IS3A 4PLGA 4OL9A 1AHHA 2DFVA 4LRSB 4DQXA 1UP6A 3ZW9A 4EEZA 3EDMA 4FBGA 4WLEA 1NR7A 1LX6A 3VPSA 1ZNQO 3D7LA 5JYEA 1GV0A 4GWGA 2JL1A 4RVUA 4CLRB 3VKUA 4A27A 1XHLA 3DR3A 1JTVA 1W6UA 1B3BA 3TQHA 2EIHA 4O0LA 3VAZA 1ZIDA 3ASUA 4FCCA 1LJ8A 1C14A 1Y9AA 3AUUA 3ZNPA 1HYEA 1C0IA 3RBVA 1I01A 1YRLA 1G0NA 3GMDA 3WOHA 3ZV3A 3D3WB 3PP8A 4BO2A 1U3VA 1XYGA 1X1EA 2BHLA 1BXGA 1ENYA 3V5NA 3K96A 4CM9D 4DC1A 4J4BA 4PRLA 1DIGA 3TDKA 2G76A 4FFPA 2BI7A 4N54A 4WNCA 4LRTB 5TJHA 4E12A 1MV8A 2FSVA 4DLLA 1U2DA 4D41A 5TF4A 2FZEA 5JDCA 1N2SA 3R1IA 2C82A 3WQRA 1NNUA 1I2ZA 1B0AA 3BTUA 4KDFA 1ADFA 4Q39A 4DPMA 4PG4A 5C3MA 5H81A 3ST7A 3RQSA 3ZGYA 5DBFA 2PGDA 4NHEA 3EHEA 1ONNA 4KQWA 1NX6A 3WLFA 1DXYA 3V2UA 1RYEA 4WCFB 1NR1A 4C7KA 1MC5A 1HRDA 1UXKA 3F4BA 3AY6A 3VHRA 2DTXA 2VUTA 3D4NA 3HHPA 3PEFA 4L4XA 4UUMA 4RORA 4RCVA 5BR7A 1IYZA 1VI2A 3IQDB 4UUNA 3U4DA 4OOEA 3T7EA 4RZHA 3JQDA 4JP2A 1Q7GA 3IKTA 1ZH8A 4J16A 4WEQA 3MJ4A 1UP4A 4NI5A 4WCDA 2QG4A 2X5JO 4NJMB 1DHTA 1MP0A 1K3TA 3OICA 3IOYA 4WECA 3WG9A 3KEQA 3GVCA 2C07A 1A27A 5DZSA 4PZEA 1EDZA 3MJTA 4E5MA 1V8BA 2ZK7A 1KC1A 1CWUA 3ZWPA 4Q3AA 1ZEMA 2Z95A 2OMEA 4UULA 3INGA 3NUGA 4FOOA 4XQ9A 4RVDA 4BO7A 4IBOA 7MDHA 1IE3A 4J1TA 4B3HA 3BA1A 3NDJA 5MDHA 2D1YA 2LDBA 1KY5A 3LK7A 3LT0A 1SB8A 2GD1O 1EVZA 4YQZA 1V3VA 1YQXA 4OIMA 5JBIA 1IULA 2X0NA 1N1EA 1X15A 2HUNA 4HWKA 4YJFB 1T24A 1S7CA 2GNAA 3ZN2A 4IJVA 2A4KA 3OEWA 2ZCVA 1WNTA 3DB2A 2C5EA 1NWHA 3I4FA 1GUZA 2IEDA 2J5QA 3QVTA 3IUSA 4J7CA 1YL6A 4CM4A 3IMFA 2X5OA 2V6BA 2QZ9A 1Z73A 3TZHA 3ANMA 4MDHA 3ZWOA 4D3FA 1LDBA 2VWQA 4B4OA 3JQ7A 2OGUA 1AHIA 1VRWA 2BFPA 3QP9A 4E2WA 5FEUA 4BV8A 1P1IA 1PZGA 5T64A 3ZU2A 4CM7A 3KUXA 4N18A 4WASA 4RQTA 4XYGA 4CM8B 4E2ZA 1I10A 2ZB3A 2XXJA 4W4TA 2ZCUA 3NJ4A 3JCZA 1E92A 3LC2O 1BSVA 3QE3A 1O94A 2RIRA 4XJTA 3ZZNA 4IIUA 3UOGA 2D5CA 4ALMA 2P4HX 4ALJA 3PPIA 4DIOA 4EYEA 3HSKA 4DIBA 2EP7A 3UICA 1GR0A 4BO4A 1JWBB 1R4NB 1V0JA 1X7DA 3B1FA 5K6AA 4IS2A 2GSDA 4CM5A 2JD1A 4BNGA 3T4EA 4ZHSA 4ZQEA 1ZSYA 4QQRA 1H93A 4WLOA 1LLUA 3K5PA 4QO7A 3GNTA 3M1LA 1ZXLA 3W4IA 4U0JA 3GEMA 1FDUA 4OSOA 4Q3BA 4BO8A 1EE9A 3IL2A 1XELA 3H3FA 1MUUA 2GUGA 3WNQA 4BNWA 1HETA 5F1KA 4XJSA 3CIFA 1PWXA 1K2WA 2HLPA 4E13A 1UXJA 2RH8A 2FWMX 2IXBA 1X7GA 2YHIB 4U6SA 2O3QA 1BVRA 4I5DA 4C7JA 6ADHA 4Z0HO 2IDZA 5BQFA 5JC1A 4FFMA 3PHHA 4A0SA 5BSFA 1E7MA 1XU9A 4I08A 2W4QA 2OXIA 3GZNA 5G0TA 3CUKA 5I8ZA 1GY8A 4OOFA 4F46A 2VT2A 3TF5A 4J4HA 2VHYA 4NFYA 4OM8A 4ALLA 1B3RA 4E5NA 2DBZA 1D1SA 1ONPA 3HN2A 3LF2A 3V2GA 1PJLA 1K89A 1LI4A 1GADO 4K1LA 2C0CA 3WBBA 4IQGA 1YJ8A 1BTOA 4HX5A 4JP3A 1ZZEA 1JDJA 4GGPA 3LT1A 2O4CA 1PQPA 1BG6A 2X1HA 3EK2A 1ISMA 4K9DA 4DGSA 2WYUA 5JDIC 1ISFA 1IZ0A 3SJ7A 1PIWA 1HYHA 3DO5A 3HUDA 4II3A 4GKVA 2E37A 3UHAA 4BS9A 2XAAA 2PLAA 1LEHA 4Q3EA 1I24A 1N7HA 2DBVO 4NG5A 3MTGA 4Z0PA 2WD8A 4R5MA 1R0LA 4GBJA 1NFRA 3MOGA 3PGXA 4MVJF 5DDIP 1GQ2A 2EJWA 1YKFA 2JD2A 3ONFA 1DHRA 4NIMA 3UFXA 1BDMA 2C29D 2GGSA 1NPYA 3DOCA 2W2LA 4WCFC 1W73A 4N5NA 4RPHA 5CEJA 3GR6A 3VVCA 2CDCA 3GMSA 3SVTA 1TEHA 4PLCA 1IHYA 3IAHA 5BNTA 3AK4A 1PR9A 3PHGA 3I9NA 5DP1A 5T6BA 5LCXA 3VH4A 3LC1O 3ROPA 1Q7CA 4PVCA 4KTTE 2B83A 4IZIA 1X14A 3H7AA 1Y5MA 2O3SA 1YONA 2Q50A 1B7GO 1B16A 4AJHA 3JD2A 3WFIA 5IN4A 3N58A 5JC8A 1X0VA 3GG9A 2NADA 4JBHA 3R6DA 1ZSVA 2VT3A 3L07A 4JNKA 1C1DA 2HK7A 5A9SA 3RWBA 4MIOA 1PJTA 1T2FA 4JK3A 1IHXA 4RPLA 2PR2A 3BMCB 2IYPA 5KVCA 2PY6A 5KOIA 2D3TA 4DQVA 2GCGA 1R16A 1Y8RB 4OSPA 2YQ4A 1SOWA 4JJIA 2FPGA 2CF6A 1NQ5A 3W8EA 2FPIA 2QW8A 4D42A 2Q49A 5G0WA 2I67A 4G81A 4NBTA 1BWSA 5DOVA 2BH9A 2I76A 1R4MB 1T2AA 1W0CA 1BXZA 1FDWA 4DVJA 3GA0A 1WZIA 3C7DB 4YAJA 5BSHA 1KVRA 5I7FA 2P91A 1DRWA 1Q0QA 2ZKLA 1SBYA 2VRBA 1KS9A 4TRJA 2NVBA 2ZJ0A 3ETDA 3NT2A 1F06A 2JCYA 3INTA 3IJPA 4CLOB 1GL3A 3U4CA 3UCXA 1Y81A 3X2FA 4DMMA 2Y1DA 1YBAA 1T2CA 1U7HA 3LZ6A 2NWQA 4BV9A 2BRUA 3JQAA 2O23A 5G4KB 1IB6A 4M86A 3LDHA 3STHA 3UN1A 1PGJA 2PZJA 3RJ5A 1PJSA 2P4QA 3AM3A 3MWEB 4G65A 5IZ4A 4Z3KA 3ROQA 4XRGA 2PD4A 4RJTA 4W99A 1VJTA 1H6BA 5EJ2A 1N7GA 3ROMA 2QYTA 3KLMX 3RC9A 3EVTA 3OQBA 5L7TA 1HF3A 1HDYA 3BXXA 3ORFA 4NJOA 3DQPA 2D0IA 4DYDA 2JFHA 1CJCA 1KETA 4IDAA 2V7PA 1VJ1A 4FIZA 2OFPA 1U3TA 4I5GA 2OO5A 2AEJA 3OETA 4NZ9A 3JD4A 3R0IA 1QORA 3JD1A 4JBIA 2VWPA 1ZKMA 2ZB7A 2BI8A 3CINA 2FHSA 3ZWBA 1EBUA 2DU8A 4GMFA 3DZBA 1NHWA 5C7OO 2H63A 1BMDA 3K31A 3OBBA 2VYVD 3D5QA 3K92A 4UEJA 2WYVA 1GYRA 4E33A 1ZMTA 1R12A 1P74A 4D3SA 4CMEA 3H5AA 4OKNA 3HFGA 3GT0A 1EQUA 1NVGA 1T26A 3L6OO 3I52A 2WSBA 3DMTC 1GUYA 3JYOA 4CLEA 2X0RA 1YB1A 2C2YA 4PN3A 1DAPA 4Q9NA 1E6UA 5FF9A 3RD5A 4E4YA 1YS4A 1YVEI 1WWKA 4MVJH 3SC4A 3FHLA 3Q11A 4QUKA 3DBLB 1MG0A 3ENKA 4IGFA 4LSMA 3JQEA 3JQAD 4QFCA 1E1KA 2ZTVA 1CF2O 2GO1A 3ZWWA 1SC6A 4L76A 3ZWVA 2DPHA 3JQBA 3GZ4A 3QWAA 1PJQA 3DBHA 4NNJA 1UDCA 2HJSA 2BFAA 1DIRA 4UUOA 3RUEA 5T67A 1E0DA 1NVMB 4R68A 3NEPX 1JAYA 5DCYA 3DZIA 1DB3A 4R9RA 3ZNQA 2VN8A 4CUKA 4IPTA 1SEPA 1WDKA 4ITUA 2D4AA 1EMDA 4UEOA 4CR8A 1GZ4A 3VH1A 3EMKA 1UDBA 3LLSA 2B4QA 2O48X 3O8QB 1ML3A 3PXXA 1U5CA 4ALNA 3WBFA 2DKNA 2QRLA 1QP8A 1EEHA 1A4IA 3OFSA 4IJUA 4PFJA 4DC0A 4JN6B 3OJ0A 1CQIA 3LLVA 2H5LA 4BO0A 4HV4A 4XB2A 4GVLA 3SXPA 3FD8A 5JAIA 1NPDA 3I3OA 4FC6A 1GEGA 1IPEA 2OP0A 3IIEA 1WW8A 4BO3A 2YUTA 4YAIA 2EW8A 2PZKA 2FSSA 2X9VA 3KETA 3M2TA 4IINA 1LRKA 1R6DA 2J6IA 3U4HA 2IODA 3W6ZA 1QKIA 2NTVA 5JO0A 4QX6A 1ARZA 2BFOA 3WJ7A 5I9MA 1UDAA 4I9HA 2ZYGA 4U0KA 1T25A 1A5ZA 2W98A 3R3SA 3TOZA 5EN4A 4C4OA 5JSFA 3AJRA 2SCUA 1ORRA 1XLTA 1BVUA 4FDAA 4KUEA 4RF3A 5K9ZA 3O4RA 4H15A 2VZ8A 3OJOA 1H9BA 4PCVA 1RYDA 2GN6A 2F00A 3AW9A 2GN9A 3RFXA 1NFQA 1RM5A 2EG9A 1R0KA 1J6UA 4E32A 3RUHA 3I9KA 1HLPA 5JPIA 1VJ0A 3WICA 1HWYA 2ZIZA 2IZ0A 4KTVE 4B8WA 4J1SA 1PZHA 1Q7BA 1ZBQA 2GR9A 1EQ2A 4PGFA 5AXDA 3GAFA 2NNLD 2VZ9A 3TNLA 2RCYA 1KEPA 4E2XA 1PJ4A 5L4LA 1TB4A 1FDTA 4MPDA 1RKXA 2UYYA 3WQQA 3PQDA 3DC2A 4LCJA 4EI2A 2FR1A 4EW6A 3IKVA 4RF5A 1PJCA 1UJMA 4Q3CA 3LT2A 4O5OA 2XPCA 4IS3A 4MKZA 3I23A 1SAYA 1P45A 1PGPA 2B4TO 3PDJA 2A94A 5IZCA 3DAPA 1EDOA 3AOGA 1E5LA 2HRBA 3RJ9A 1YDWA 1YL5A 3GVIA 4CV0A 3PHIA 4WOJA 2YV3A 4ZQGA 1KBZA 2FN7A 4P4LA 5TJ9A 3WFJA 5I7EA 1NAHA 3PGJA 2JCVA 3D4OA 3F5SA 2J3IA 3JQ9C 4BNVA 5HBRA 1YQGA 2ZB4A 5ER6A 5T8KC 4J9UE 2RHRA 3UH1A 3TZQA 2AEFA 2B37A 4AJPA 5CP8A 4MIEA 4YXFA 4MVJE 3DDNA 3FTNA 4U8GA 1CETA 4TROA 4DPLA 4BB5A 3F46A 3T4XA 2I65A 3DZJA 4LVUA 2WD7B 2AHRA 5BNIA 3E5MA 4DRYA 3G17A 5BSEA 4K6FA 3ZWXA 3QWIA 4WLNA 2WWRA 3DFZA 3FN4A 5B37A 4OQYA 1R66A 1DFIA 1MC4A 2O2SA 3TL3A 2PK3A 2AG5A 4IJWA 2P5YA 4XWYA 3QW2A 3CPSA 1WZEA 5ITVA 1UZMA 3DOJA 5IDXA 4TSKA 3ZHBA 1AUPA 1K6JA 1NQTA 2YY7A 5EINA 1ENZA 4AJJA 4B7XA 4BNUA 2B69A 1GAEO 1PJBA 4KOAA 2DC1A 2DLDA 3NRCA 1U4SA 4PG6A 2NU8A 3BTVA 3VZRA 2AW5A 5ICSA 2VOJA 4JBGA 3EGOA 5IJZA 1EUDA 2A35A 4HADA 2IRWA 3TZCA 4NDNE 5F1OA 1U7TA 4GL4A 3NJ8A 2WM3A 2EHDA 3QWHA 5IAAA 4QFDA 2VRCA 4XB1A 2Y0DA 3N74A 4II2A 5IDWA 3UCFA 3EVNA 4WNIA 4XEHA 1PJ2A 1C0KA 4TZKA 1KEUA 1QV6A 1GCOA 1B2LA 2AQIA 4FC7A 4IDEA 3NKLA 4R1TA 2O3JA 4NQZA 1BXGB 3QSGA 4Z9YA 3TSCA 1HKUA 3EZLA 4FB5A 1M2WA 3BTOA 4A26A 3HDHA 4NR0A 3JQFC 2QZZA 4R16A 4J7XA 3H5NA 2DVMA 3G0OA 1DDOA 3VC7A 2JD0A 3F1KA 2W2KB 1LUAA 4FFLA 3M2PA 3BMOB 4IDFA 4LMRA 2EKQA 2Q1SA 4FFNA 1C1XA 3DAFA 4BUCA 3F6YA 1O8CA 1O5IA 3A9WA 2VHXA 5B4VA 3OP4A 3WGOA 3ZHXA 1ZUD1 4EDFA 2HO5A 3QJ5A 2WJPA 4BGEA 2AE1A 5A02A 1ADCA 2OP1A 1UAGA 2VHWA 3BTSA 3ZWCA 1VPDA 4H16A 3LQFA 1B26A 2R6JA 4QT0A 3PLNA 4B79A 4B3IA 5CEEA 2HSDA 5JFOA 1LA2A 3FBGA 4AG3A 3KEOA 4GX2A 5L7WA 4DREA 5L4SA 5ENDA 1LLQA 1VL8A 4A5OA 5JW6A 3PIDA 3S2EA 2UUPA 2BLLA 1IPFA 1GPJA 1GYPA 1SCUA 3EC7A 1L1FA 4D0SA 4XCVA 4CMIB 1WLYA 1VSUA 2Q2QA 5FI3A 3MZ0A 2EEZA 4J1NA 1JWAB 1DC3A 4BNXA 2NLOA 1T4BA 1I0ZA 3GRKA 1YOVA 3E9MA 2HMSA 2OBYA 2QRJA 2VRCD 3D3WA 1GEEA 5G0VA 3OECA 2HQ1A 1JLLA 1O6ZA 8ADHA 3ABIA 1ZSNA 3ETGA 4J7UA 1D4FA 1TT7A 3SJUA 3OM9A 3L6EA 3V2HA 2ZTMA 1ID1A 3PQFA 2O7QA 3F47A 1X13A 1GD1O 1XWFA 3D4PA 3GHHA 1ISHA 4DBVO 5ITWA 5CHEA 4M87A 9LDBA 5A5FA 4YPOA 2R00A 4IDCA 4U6QA 2Z5LA 1BDBA 3I1JA 3WR5A 1WDLA 3W1VA 1LSJA 1S6YA 5COAA 1HEUA 2VWHA 1JKJA 3HWRA 3DZKA 2HMVA 1LC3A 1IL0A 1PWZA 1I30A 2G17A 3HZZA 1N1GA 4CM4B 1QYWA 3GN2A 2EGHA 5DT9A 4UVIA 1NAIA 4NK4A 1DAOA 4YT8A 1NYTA 4A10A 4CODB 1OC4A 3RSHA 4P8RA 1XDWA 3DEYX 4J1QA 2CVQA 2RH4A 3MJSA 3NTQA 2HK8A 1ZJZA 2E82A 4ZQBA 4BKOA 1OMOA 4MVJA 1NWCA 4E21A 1OFGA 4PG8A 3S2GA 1A72A 3ETEA 3MCVA 1JVSA 2A9FA 2B35A 3BAZA 3BZUA 3C1OA 5TS3A 5AQ1A 3U0BA 5CDTA 4NJMA 2C54A 1FXSA 4Y6PA 1W4ZA 1QSGA 1RM3A 2O7SA 4EUFA 3ITKA 1PGQA 1KERA 2GN8A 4PLVA 3OQ1A 4FJ2A 4MKRA 1K5HA 3EW7A 4TRMA 3HN7A 2JFFA 2C7GA 3OF2A 4JROA 5ER9A 4ZN6A 3GQVA 5U4QA 2UAGA 4AJ1A 2F1KA 4PZDA 4LVCA 3N7UA 3DL2A 3KV3O 1DRVA 3BMQA
chains in the Genus database with same CATH superfamily
4IHJF 1W6RA 5H16A 4KXUA 2Q99A 4GZ6A 3W5HA 4CKBA 2PA0A 1DT5A 4YJFA 3I5UA 5CLLA 1QVWA 3BK2A 3L0OA 1BROA 2H4WA 3EZXA 3OZXA 5JJLA 1UMKA 1QWSA 2P6OA 3TLZA 3SKXA 1K6IA 1Z06A 2JS7A 2PA3A 3AFGA 1ZCJA 2BTOA 1JEJA 3TPCA 3KUUA 2F1OA 1M73E 1QCYA 4Y18A 5DU2A 2CWDA 3COPA 4FGJA 3T9DA 5NLLA 1TQDA 1I3MA 1SCNE 4JUCA 1J0XO 1IB0A 5DULA 5FWNA 3JALB 1R0SA 3OZAA 5F52A 4P32A 5FA6A 5JE8A 3SC3A 3KDPA 2JAHA 3E70C 1TCAA 1H0KA 3B9PA 5GQSA 1GTSA 1AUVA 1H22A 2HF2A 4GH5A 1URPA 4XDGA 2RHCA 3EPJA 5C8ZA 1GAQA 2A5JA 1VGVA 3OMXA 4QARA 3EARA 2D1FA 2XUFA 4XQGA 3H2GA 3R9WA 4BGVA 2NTJA 1V5FA 1G6HA 1IBKB 4ZT4A 1SKYE 4BO5A 2CYCA 2DBQA 1ANKA 3WYBA 3L1KA 1SJ9A 3LX8A 5FL7D 3I9V6 1WUHS 4HFMA 5K20A 3DTVA 4JQYA 3EA0A 1OIVA 4YMWA 4NCAA 3Q0EA 1OBFO 3HYSA 1V26A 2INGX 1L5HB 5DLDA 1XX6A 4F86A 3ICOA 4HL6A 1Y34E 3WGHA 4AWXA 2FSFA 5CW1A 4LQDA 5FTJA 5KKAA 4HGZA 2CLHB 4FSXA 4B75A 3QF4B 4TYNA 3HCWA 4KPGA 1PHPA 3LA8A 4HNAB 1DXOA 5EG5A 1NVBA 4RDHA 1N4DA 5A9TA 5A4KA 2DTDA 4G5RA 3L01A 3TD9A 5EIEA 2YFHA 4I55A 1LDEA 4X54A 3WLPA 1VMDA 1U0EA 2VWGA 3QELA 5INTA 2UVPB 3CPJB 4O2AA 5DBGA 3RUAA 1L7VC 1G6OA 3AJ9A 4CQJA 3ROGA 2LE0A 1VKOA 1T8UA 4LE0A 3HJAA 3MOIA 4RIEA 3JRWA 1Y3AA 4F3NA 1NXQA 3F97A 1U0TA 2ZS8A 2P4EA 4JBWA 2BTQB 4JU8A 4OBBA 4MAAA 3RKRA 4DLPA 3K9FC 3EQ9A 1HTWA 3COJA 1XLUA 1KVTA 1WDWB 1ECBA 4TLAA 5E6SA 3ABRB 4K2AA 3QKTA 1ADYA 2R65A 1GXSA 1X86B 1ZNWA 1RACA 3ZCVA 1TLFA 3MTIA 5J23A 1VKNA 3R9XA 1DQPA 2FQYA 1SO8A 4OQPA 1XDZA 2VNSA 3LYAA 3KLPX 3HPRA 2F8SA 4C0WA 4OUKX 3QY0A 5CDUA 3CVVA 2GZ1A 3O90A 3HLTA 4IVRA 2FMUA 4C4XA 1TM5E 3KBBA 3IODA 4REOA 4OG2A 2H2GA 2O9JA 4ZZ1A 2Q1WA 2WA2A 4TX1A 3RUDA 3UMGA 3AHCA 4DDMA 4NPAA 1UEXC 2I6SA 2YWBA 3I62A 4L5YA 1XCPA 2WU4A 3B48A 4EFKA 5A7FA 3ZJ4A 1NUUA 1CUYA 2JIBA 1PWEA 1T8SA 3HWSA 4N0DA 4GVXA 5FIUA 5BPFA 3U6BA 2O1WA 1EVYA 4KMMA 1VSVA 1PZEA 4D97A 3AI1A 1OLUA 1TTQB 3HDTA 4ZYXA 1S1CA 3ACBA 3DTVD 4HDOB 1ULSA 5LYJF 4KLCA 1I7LA 2Q4TA 2QJRA 2CK3A 3GT3A 2RC5A 3EZ6A 1FK8A 3ENWA 4M6WA 2ZFUA 3UMVA 1YBMA 3LHFA 2VPYA 1I1HA 2OBXA 3H9UA 4OREX 2XZOA 1RNLA 2G5GX 3WNBA 3FA2A 3R7AA 2PL5A 3PGKA 3SQNA 3O26A 1AQNA 2WEKA 1U5AA 3V7WA 2UUOA 3UUWA 4Q4JB 1DEHA 2A33A 1MB0A 1DINA 2IIVA 2QYOA 5ALHA 2XVMA 1KYTA 1ELOA 2BEUB 3GELA 4MVJP 2JGDB 4KUHA 5JSQA 2YNMC 3ND8A 2C9DA 2VYVA 2ZQYA 3NW9A 1O08A 5C0OE 4XKJA 4XFDA 4DV6B 2BKXA 3G8DA 1W34A 3NYWA 4KAFA 4XVQA 5E0KB 2IGTA 5EFZA 5B1IA 4C0LA 3OT4A 2W2PA 3DPIA 4LCBA 2QBYA 3IA7A 4DBZA 3O3NB 1JEAA 5BSVA 2F9LA 1XE3A 3GXOA 3ZHVA 2ZSDA 1BHQ1 1YC2A 2AVDA 1C9EA 1EFVB 1X9IA 3LKDA 4LFCB 3T3DA 1KR5A 3IUBA 2OL4A 1SXJB 3E61A 3JVVA 3O4JA 1L7DA 4OJMX 3MQ4A 2YJZA 3GCWA 4MWOA 4LF6B 4ZVNA 2ZTUA 5BW5A 4MV6A 3UBTA 3NNNA 1JXMA 5JO9A 2RGUA 5AJXA 1J5PA 3CO0S 4UJ3A 1AK1A 2W8BB 1X7WB 1JEDA 3OA0A 3D54D 1Q0RA 1QV7A 4TMXA 3OQ6A 2XDQA 5JSKA 2BIFA 3HCNA 3IO3A 4KMSA 3OIDA 4EFNA 1QFSA 3B38A 5I4CA 4QJIA 4L9SA 4CKWB 1W76A 2YYZA 1Z5NA 3AWDA 1O0SA 4KSCA 5D3MB 1W29A 2VFAA 5ICFA 1L5YA 1T0UA 1U28A 1V6CA 4KE8A 4K6CA 4WXHA 2WDZA 5JS1A 4OKIA 3UENA 1Q3HA 4ZU6X 1QYRA 1ZKDA 4XVUA 3JASB 2PVCA 3I37X 2DXIA 1W44A 5BWLA 2GETA 2IYQA 2EJUA 3G49A 4XEUA 4XR4A 3KFLA 2CWWA 3F8SA 3NEYA 4K6KA 4ZALA 4ETIA 1HX7A 1ISGA 4CF7A 3PA6A 5BMOA 2PUDA 4E1VA 2VJBA 4YJGA 1GAWA 4F5DA 3G79A 1HE4A 2B98A 3NUZA 5DGTA 1GN8A 1KP9A 1Q91A 3V2GA 5KJCA 1VKJA 5CNMA 3OZWA 4BFCA 1B41A 1B42A 2BELA 1XJ5A 2CF5A 2HJHA 1E3JA 1U3FA 1ULHA 5EUMA 4DILA 4JI6B 4RTNA 5AJVB 4CLOA 2GTPA 4IMPA 2ASEA 2UZ0A 1JQ5A 2EVWX 3OFVA 2OV4A 4NICA 4MQEB 2ODBA 1QC5B 2YRWA 3IPAA 3AHFA 4TWBA 2ODNA 2ILVA 3VNBA 3DJFA 1V7PC 2P3QA 4KO3S 3PKJA 4UBNA 4X20A 3VR2D 1WY7A 2JIMA 4E30A 5JAUA 3KYBA 5FXMA 1ZW6A 1GSIA 2I9KA 4MYCA 5JNVA 4TS1A 2NG1A 4UUPA 3TQCA 3AVYA 2ZIXA 4O4LA 5JG7A 5DSZA 2P2YA 3D4LA 2RJNA 3A4MA 5FNVB 5AW3A 4R5HA 2HMTA 2X22A 2Q3MA 4URUR 4GI5A 1QWOA 1VL2A 4Q1DA 2GSWA 1GGVA 2WINI 2XKJE 4G5SA 5D3QA 4IH1A 3I6ZA 3IDQA 2O2XA 3PSAA 2XLCA 1N2ZA 1QTRA 5EWMA 1AJEA 1HNNA 1AKYA 3AP2A 4YACA 2FFHA 2CJWA 3BJMA 5HG0A 3HBNA 1HFKA 4ZQIA 5CLGA 4Z3DA 2IZ1A 2VPPA 2JG3A 1C8KA 2CLOB 2I8CA 4TYPA 4QGFA 3GGGA 2FF5A 4HF7A 1N9GA 1ZLXA 2IZZA 3JWEA 5HQ3B 4MMYB 5DI3A 1ZN8A 1ITZA 2D2XA 3NHAA 4TV9B 3DWEX 3Q12A 5A3JA 4L95C 5KJ6A 5KNCH 2I71A 4R54A 5C35A 2C2XA 4PPGA 2XGOA 3BB4A 1I4EB 1TYCA 3SJAA 1N5IA 3UT0A 1QOPB 4HDMB 2GTHA 1CQWA 3S2FA 1NT2A 2ZJOA 3IDZA 1RWBA 3ISTA 1F48A 3GWZA 1KDTA 3UM9A 4URXR 3OURA 1ZXBA 5JXJA 4ZAWA 2QF7A 3DOFA 1TF7A 1T5LA 1WU8A 2D62A 3A06A 2JHGA 1X0XA 5B3JA 4A5SA 3G5LA 1Q44A 4AECA 3RF7A 1Z4JA 5CB4F 3ESDA 4RPIA 4FSDA 3AV0B 3BZWA 1CJUC 2AD5A 2NVUA 2VTBA 1EM8A 4QRIA 2IUUA 4WOKA 2JJ8A 1RBYA 3LHSA 4KXXA 5JNUA 5LSAA 4LZAA 5CXXA 4M1QA 2Q46A 5C53B 1K3UB 4FR2A 3RC1A 2GKGA 2QN3A 1W19A 2C96A 2OFFA 4H35A 3W5AA 1GDHA 4GE0A 2FQXA 4F6CA 1V1RB 2OYSA 1NG9A 4YUAA 2TMGA 3HR8A 1NF9A 1T2UA 3IH5A 3AO0B 4AJOA 5CBKA 5LFAA 1FMFA 5T4BA 2BMAA 1Z12A 1RWWA 3DE2X 4G01B 1FU8A 3MSCA 2IV3A 4Y98A 3AHDA 2ZPUA 3FHCB 1QIDA 2DQ4A 1SBIA 4GI2A 3UVEA 2Q5IA 3S1LA 3ZHCA 3ZXXA 4C4PA 4DDKA 1OFTA 2H48A 4K28A 1Z83A 3EIEA 1N0IA 2ADMA 3U7QA 4AF7A 1GPDG 2L69A 5B3KA 1DG1G 2DE0X 5CH8A 2VBCA 2FOIA 5BRJA 5EQJB 3HXMA 2Q8PA 3GGSA 1ZOLA 2DETA 1I1NA 4KH0A 5DGHA 4C43A 2JIOA 4L8GA 1VI5A 4M9CA 1K7SN 1JNXX 3G0CA 4TMVA 5D5PA 1XDUA 1VLHA 3KC2A 3N2IA 1AK9A 3CJTA 4D4GA 1XSEA 4UREA 1SG6A 4TXNA 2NACA 2P6UA 5F23A 4F72A 2NTNA 1E3WB 3AL3A 3R77A 3O1JC 4J3NA 1CIPA 4B2IA 2WUDA 4YP7A 5AJWA 1WQ3A 1YZNA 2XRMA 3GXBA 5BQXA 1XCJA 3G88A 4LI3X 2B9EA 3CTPA 4JAVC 4HN9A 2BRUC 4F4IA 4RFVA 2MSWA 5CIQA 2H2FA 1XMXA 2W9XA 1FLDA 4H6PA 1H3EA 2OHXA 4DR3B 3A0UA 1KSFX 5H0IA 4V1CA 4UVGA 1LLCA 2DAPA 2PT7A 1NVFA 4E31A 1KJNA 2ZRIA 5KNDH 4I50F 4ARAA 3A28A 3D7MA 4O4LF 2O8FA 1P6QA 2X8LA 4ZIRA 2PLNA 2YW9A 4WZAA 3WGYA 3KLBA 2NPOA 1DMRA 2W6QA 4IILA 1FNCA 5T5QA 1OD6A 3AEZA 4ZDWA 5AI9A 3LC7O 1KSGA 3BORA 4QASA 2A0XA 2MMCA 4AO7A 4R1UA 1NR5A 2RI0A 4IIEA 4DR6B 3GOHA 2WUGA 5BT8A 1SXGA 3N7TA 1UFOA 1LF0A 1TA0A 4KP7A 2YWHA 4ND2A 5ED0A 2RH5A 4YK7A 3T7TA 2OO5C 1YJBA 1I3OA 4ZU3A 3ELUA 3BD9A 4IJ6A 2PUJA 1HRKA 4HXYA 4A2CA 4KHPB 1HT1E 5JY6A 2FMFA 2HDHA 1SGWA 4ED9A 1XFDA 2HHHB 3PK0A 3D3QA 1I2MA 4AROA 3MINA 4YO7A 1ZVQA 3T99A 4DMLA 5HKLA 1NVWQ 1CY6A 4LV6A 4LV5B 1J2JA 2YZGA 5LZ5A 2VXYA 3UHFA 1L7NA 2QAGC 5HR5A 2RIPA 2YRFA 1F2DA 1MZVA 1RFGE 4G4JA 2Y1EA 4OMDA 3AXSA 1U04A 3H9JA 2WIBA 2FUG6 2SNIE 3ONEA 3PXEA 4RK5A 4RQUA 4UBMA 3ZTWA 1Z7BA 4MJ3A 4J75A 2NUAA 5GJCA 1NF2A 3STYA 1KEKA 3K70C 3ONWA 4EVIA 4A2PA 1U0SY 3LRTA 4WAUA 3NYRA 2B4YA 4RZ3A 4ZPXA 4GVPA 3D8UA 4I1RA 2WWVD 5JLAA 2NU8B 1QYXA 3DB1A 2V6JA 4EMUA 1O1YA 2ROQA 1QUEA 4GICA 1X7ZA 4B0OA 3E9ZA 2VDKB 3VPBA 3GO4A 1QGAA 4EB8A 3TRDA 4RSRA 1A7AA 1JHPA 2CUKA 3EMBA 2RGNA 2VF4X 1S2IA 1G9TA 1A4RA 1WUIS 2R1TA 1OX4A 2ZI3A 3D3NA 1RAGA 3KFVA 4BRWA 4EPRA 5TLSA 2BF7A 3DQQA 4AB1A 4OJQA 2YV5A 2JJQA 1UZLA 3KPWA 3OEHA 2OBNA 3MBIA 3SDZA 1A0OA 5J5VA 4YMIA 2ZRLA 4S35A 5IVDA 3C41J 4GYJA 4HAOA 2FPOA 2XLBA 4KQXA 4EGCB 5KTNA 1DTWA 1WXWA 3U9LA 3UXEA 1FFHA 5L40A 1QPZA 2E85A 2R68A 4XX1A 4PSUA 4DQDA 2F43B 1P1JA 1BX1A 2NN3C 3ZXIA 4E03A 4XE5A 3WWCA 5HQJA 4QNMA 1YA8A 1QGDA 3RFFA 4JGBA 1OAOA 3WA6A 3FKJA 1PYDA 2PIAA 5CG1A 1VIVA 4PCLA 4Q66C 1XIVA 5DMHA 1AO3A 3I6MA 1BOOA 1I3NA 4QIHA 3HCPA 1LQTA 1XD2A 2GRUA 3TOSA 3R3YA 4LOLA 2C4UA 3QXGA 1OWMA 1YGPA 3CUWA 3KZCA 3ANYB 2QTCA 1PW5A 4HYEA 4Y6RA 3ZZUA 3THWB 3O4GA 1MJGA 1KIMA 3ZQUA 3I9JA 4YAWA 1BEUB 1T34A 2ZTLA 1CR4A 4N82A 1ORHA 4WTOA 4IFIA 4ZT6A 2ZI6A 2WMNB 3WIEA 4ZCRA 4X1YA 4MDFA 1K92A 1Z3CA 2V98A 2Y66A 3ANSA 1CZRA 3L8DA 1DP4A 2M6SA 3G0GA 1LV7A 1SEVA 4FDMA 1QVAA 2ATCA 2H1HA 1CR1A 3FPHA 4ZYZA 4LTNA 2BGWA 1WUJS 4FZJA 1TVKA 2VHVA 3GLQA 5IF3A 4Q4DA 1EE1A 1NFFA 2VPWA 3HDJA 1N1MA 5IYZA 5IBQA 3TZBA 4S1VA 1U2GA 1UKEA 2G1UA 2FJ0A 3VSCA 3DNPA 1L4BA 2E6KA 3CGGA 3PQ5A 1XEFA 4M0EA 4DZTA 1QR2A 2GKOA 1ZNXA 3NETA 4I4IA 3A7EA 5EHIA 4ZTBA 3CH7A 1QF7A 4UU0A 1XLTC 4X90A 4YUXA 3ME5A 4NH4A 1DBVO 4UOZA 1V5WA 4B7ZA 3Q9LA 1G5FA 1T1EA 2V0NA 3I5AA 1B1CA 3LUBA 4PV7A 5TR9A 3SX4A 1WCIB 4ESOA 4CL3A 5LP6B 4X6UA 1APBA 4GNRA 5DT2A 3NZEA 4ZRNA 3KE8A 3O2SB 2V7XA 3B12A 3V1TC 3OZBA 3D43A 3OEHD 1FLNA 5H4HA 2FF7A 2QPAA 3S1AA 4CLRA 5FEMA 4F9EA 4TKUA 2O54A 2E6UX 3KAPA 3PENA 2B7CA 2V6GA 4MP3A 5SY9A 3IV9A 4NENB 3WJAA 3THXA 4R05A 5EUBA 4QDUA 1SU7A 4R9NA 3T3IA 3DNFA 3I1FA 4M8IA 4YNBA 1RYBA 3N5KA 2H92A 2HREA 1GPWB 3LLUA 3UMBA 3URMA 4J90A 2J09A 5AVRA 2X4GA 3BMOA 2RHBA 1IVNA 1WU7A 2C9ZA 2RAFA 3B2NA 4WA8A 5K0TA 3KQKA 2JI9A 3PHCA 2JLRA 1MW9X 1T5SA 3ZY5A 1UWVA 4Q00A 4MULA 4NNPA 2QP4A 2JH9A 1VL0A 2IDJA 1MQSA 4MHSA 4XD7A 4CLHA 1BCSA 4YMTA 5IZCC 5JH7B 4CV2A 2R6FA 3SLKA 1IXKA 4QOHA 3FYSA 3K6JA 2C99A 7YASA 4CKEA 3E05A 2BEVB 4U1RA 1A88A 2BDEA 3MTJA 5D5HA 5EKTA 1C3VA 2P9EA 2X6RA 5TRTA 3THYB 1FP4B 1G1AA 1FFDA 1C7JA 2RAPA 3CUVA 4L3OA 1UXGA 4NMLA 4A8HA 3DZFA 4DV0B 4RL4A 3RKUA 4TV8A 5DOZA 1JIUA 5K7SA 3KO8A 3K20A 5FUVA 3KIPA 5IRCD 3LGAA 5F98A 3V4PB 2ANCA 3B7GA 4E94A 1WSAA 2FW9A 4WN3A 5SYAA 2EV9A 3FHTA 4RIFA 3CB4A 3IEXA 1US8A 4LW8A 5KYYA 1YS9A 5WRFA 2PLFA 3WGQA 4WOCA 3WOVA 1I3KA 4BC1A 1P31A 5BN5B 3T95A 3L2OB 1CDOA 4EF4A 2R2GA 1PL8A 4GYKA 3HNPA 3UWPA 1EK0A 3SJZA 4EZBA 3IHWA 3ZKWA 3U3KA 1MRNA 2OD9A 1X70A 1CJSA 2WJHA 3HCRA 2I2AA 3DVAA 4V0KA 3AETB 3ND6A 1SQ0A 4G97A 4HYTA 1LQUA 1KFEB 4PAGA 3WTBA 1PZFA 1X8XA 3N53A 4LDZA 5KKNB 3B9RA 5IN5A 5AOAA 3RF6A 3HXTA 3OT1A 1C4WA 1JW9B 1SNYA 4HX9A 2BD0A 2C5GA 1AF4A 4Y9DA 2DBRA 3KVVA 1GCIA 1QH0A 1OI7A 2HCTA 3BMQB 4C7XA 1ICEA 1RWQA 1Z6ZA 1A8UA 2XAUA 3PYLA 3SJCA 4UPEA 2HRZA 4IOJA 2QL5A 2W5UA 1UOQA 1NVXQ 2W2OA 4IUCS 4ZWNA 5HBGA 2C5AA 1T9HA 4M37A 4JOSA 4M7OA 4JSRA 4KV9A 1DAEA 4WJLA 4LJ5A 5EXDA 3MT7A 3MTDA 4KWTA 5CEFA 3AWIA 3TMYA 3KHUA 1PLJA 2HTEA 4C7OA 6NULA 3C7CB 1VLLA 1NVKA 2JBHA 3MF4A 3ICQB 3L5KA 4F2DA 2O7NA 3WGNA 3HKBB 3OTHA 1V3QE 2DEUA 1CERA 3LXMA 2CFRA 1S3GA 1ZH0A 2WJGA 2X58A 3IILA 4CR6A 2HKIA 3AFIA 4LTMA 2OCYC 4MKFA 3CLUD 2VYQA 3OQIB 4XD7D 2AOUB 3TUZC 3N2KB 4RDXA 4L4ZA 3VBCA 1DO8A 1KOFA 4LRYA 2O50A 2I1VB 1V3TA 3JPWA 3DONA 3G9UA 1TZJA 3N75A 5EPOA 1LTQA 9LDTA 3BXPA 2D7JA 4CBVA 4BNFA 5BWNA 2A0YA 2WWGA 1YJAA 3ND7A 4IYJA 1M67A 4X1IB 4BQNA 1BIFA 4CHGA 4TL9A 1AN9A 2OENG 2PZLA 3IJRA 2V74B 4RGQA 1QJ4A 3ET4A 4RGYA 4QFBA 3CLTC 4BIIA 1DKLA 4HI0E 1XNJA 2H2IA 4KUGA 3QHAA 1RM4A 2J0EA 3WS7A 3N9IA 3G6WA 3OJFA 4YCLA 1IJBA 3HXQA 3G5UA 4YMUA 2DJIA 1VXRA 2PDAA 3UPTA 1TKBA 2F2TA 3OY2A 5M7EA 5EEHA 4HAYA 1ACLA 2C2WA 1I6MA 2PXHA 3GG2A 5GJWC 4BFSA 4UAGA 5L7YA 5AJTA 2JHFA 2FP3A 1A71A 5CD9A 2H6EA 3H3XA 4OLFA 1CY0A 3U7IA 1RIIA 1Y9EA 4LN1A 4GX1A 2GLUA 5EE5B 3P5SA 1JVBA 3IQEA 3JW8A 2II6A 1DEXA 1F3LA 1FJHA 3UUEA 4FNAA 2H52A 1I80A 3PI7A 3Q9UA 5FBQB 5KNCD 2PRZA 2HA5A 2B20A 4NCXA 4XWWA 1R2QA 1QRRA 2B7BA 5TY0A 4C08A 4X92A 4JYAB 2ADFA 4FFRA 2ZT7A 4YCSA 1J25A 1XTBA 3W1EA 1UMCB 4QUDA 3OJXA 2I4NA 1I3CA 2YQ5A 5H8WA 4J0JA 3ICPA 1Q0SA 4BP8A 5KYNA 1WDMA 3LYUA 3IP3A 4E1BA 1P19A 2C3MA 3BHMA 2FPUA 2GDZA 2ZUDA 3JSAA 4UU7A 5J4VA 2ZM6B 3C4JA 1ZOSA 4D43A 3WRYC 2B2CA 4DIFA 2I66A 3SOPA 5EMMA 1THTA 5K0GA 2QZ4A 1E7RA 2Y77A 1KFCB 5ILGA 1QMPA 2HMUA 1GRRA 1KAOA 3WL5A 1ISRA 3GW8A 4OQQA 4CT5A 1DL5A 3DNMA 2HHCA 2CNLA 4KN5A 5ALMA 4OIFA 1WXEA 3QJYA 1J9GA 4PWYA 3PFGA 4L78A 2EC5A 1L8OA 4X7RA 5KJ1A 4JLUA 5GVRA 3TCNA 4LECA 4EJSC 2AQHA 2OZLA 5FV4A 4EPVA 1P1HA 5AR1A 2REQA 1Z33A 1OZGA 2AFIA 3W90A 4DLNA 3FMFA 3P9QA 3H86A 4Z7QB 3D8NA 3HQ4O 4MR8A 4MV7A 1K0FA 4LDQA 3RVSA 5BRAA 5JHGB 2GEDA 5L4NA 1UBSB 1VJRA 3O1HB 4EGJA 1TEXA 4MW5A 2GCOB 2UYQA 2Q3FA 2H2AA 4IJMA 2NXWA 3OZSA 2W70A 1N32B 4QSMA 4OLJA 4JFRA 4D4IA 2XYQA 5EZYF 1XZAA 3L79A 1L3CA 1N2JA 4JZYA 2JLZA 4R8LA 4WNAA 3ZR4B 3V1KA 4FJ0A 3SF8A 3EXEB 3EZYA 2MWMA 4JI8B 4MMZB 3MLEA 4BHTA 4M3NA 1K06A 2YYSA 1YI1A 1OFUX 4F2HA 3PJRA 2QM7A 3H6KA 4PLHA 3DE1X 3W5CA 2GZSA 1L5MA 3CLHA 4BPBA 1UJCA 3WK7A 4BP9A 5HRCA 4HRAA 5K1ZA 4HAUA 5GY7A 4ZVVA 3LL4A 5M29A 3FZGA 3FYUB 4GPZA 3SLGA 2YHSA 3AV3A 4UTXA 3O3CA 1ZMXA 1T4CA 1O96B 2PKWA 3B1YA 1N6NA 3AL0C 1WMFA 3RRZA 4NOKA 3VYSB 3RG8A 1PT9A 3WQHA 2W11A 4D74A 5HP4A 5KNDD 2DUWA 4QDJA 4JLOA 1KEWA 2Y67A 5JYDA 1OQAA 3PIIA 1BCRB 3DE4X 5TC4A 1NY6A 3KQQA 3DHEA 4KLRA 2DULA 4R2LA 1HLDA 2YDYA 3HVUA 1NHGA 1R4AA 4XUGB 2E3JA 3OQHA 1D5CA 5GMOA 4FOSA 1MO5A 2BHSA 3AJAA 4D3XA 1SOUA 3TXYA 3EFHA 2PX0A 3FJ1A 3W2HA 3QUCA 3T4UA 1W35A 3BVPA 3E5RA 4IZHA 1KZ9A 3EWNA 5HTKA 1D09A 1FNSA 1VP9A 5ICCA 4TKMA 3TD6A 4X0EA 2JA1A 3EVEA 3ZDXB 2UVDA 2NU6A 1YBFA 3PR2B 3R5HA 4Y6LA 3R9KA 3CLRD 3N8HA 3I9LA 2PS3A 1F4PA 3NKVA 5LIRA 3QFHA 1RBZA 1OH8A 1YDGA 3LWDA 3IDSA 3NCTA 2QX7A 2ZZMA 4U3JB 1ZLYA 4LMAA 4AN1A 3EZ7A 1XNQB 3BGVA 1UQUA 4FMDB 4HG2A 4JDUA 3PJGA 1TF5A 1YRAA 1P62B 4KXQA 2ZXUA 2QN2A 4PTYA 1H94A 5T57A 1DV2A 2DGDA 2WKSA 3SPXA 4UEKA 1E5XA 3BICA 3UOWA 3KL2A 3G1TA 2A3NA 2YYYA 1RRPA 2R5FA 2OQ2A 1QB8A 3TINA 4AMYA 1TRHA 2PM8A 1NI4B 3L46A 5D87A 1D7OA 2AKAB 3E8XA 4QPNA 4WQMA 4ASUA 1G5IA 3EFOB 4B6PA 2IXTA 5KWEA 2W2LD 4F85A 4DLTA 1XA0A 1BWPA 2GARA 1YZHA 3AFHA 3MJVA 4AZ3B 4YP1A 2FRXA 2WWHA 3MW8A 1R00A 4D4KA 4ZMBA 4B3SB 6GPBA 4G0NA 1KO8A 3NPMA 4AFNA 1KAGA 3LXXA 1RQ7A 2IUYA 3T7CA 4KITB 4DBLC 3ED5A 2UU9B 5C34B 4CCYA 5I3ZA 3D4BA 2VQDA 4GGMX 2AS0A 1E3LA 4N7BA 5I9SA 4LYAA 3MMSA 5EZQA 1N0WA 4F04A 1JP7A 1T9DA 5H59A 1H85A 2W48A 3TSZA 5BSKA 1IHPA 4Y9RA 2GN0A 1X1CA 2DT5A 3NV9A 3T06B 3H3JA 5AK5A 2VDPB 5LWHA 3M33A 3MWFA 3VDRA 3TVYA 4C4AA 2ZR8A 1ULBA 1L4MA 2CLMB 3JQ6A 4EG0A 3K71B 5G4LA 1ULTA 2XE8A 3OKCA 1J8QA 4DB2A 1JYSA 3MPOA 1ORWA 1DKMA 1Z5UA 2DH6A 1YR9A 3W79A 3BFPA 1EZ1A 4INAA 3MT0A 4YQYA 4GX0A 3QVXA 3L4KA 1W85B 1E7WA 121PA 5CDYA 8OHMA 5GONA 4NRDA 4A23A 4V0SA 2HXSA 2O3TA 4KKXB 4Q93A 4JJGA 3QX3A 2Q4BA 1OT5A 4ZO4A 1AO0A 2B78A 4G4GA 1G2QA 5LYJA 4YR9A 2J9FB 3INRA 1T1JA 4UARA 4CL8A 4FDUA 1FRVA 5B55A 3H05A 3KB1A 3VZSA 2ZITA 1R5JA 4RX1A 3EISA 2IXFA 3FJOA 3PZBA 2L17A 4MS3B 4QC2A 1F7VA 2I34A 2IYSA 4FQ8A 2Q4OA 4MINA 4EGSA 5B4TA 1GNVA 2VT7A 2CJPA 3IVXA 4MR7A 3I04M 4WFKA 3PC8A 1VFNA 2E4VA 3DEFA 1AH2A 4W9RA 4ZEMA 1FDRA 3B1JA 4MWSA 1YE8A 4LDJA 1QFXA 4AMGA 2RK6A 1PEDA 4FI3C 3PFFA 1B73A 4XTCS 1PDVA 4AICA 5HOEA 2GJ4A 5IT5A 1QRUA 3WGLA 2ZUTA 2AG1A 2E21A 3S8MA 1BE6A 1CUEA 1KGSA 3I01M 4OSEA 5TPWA 1KI3A 2L19A 4RVSA 5DBIA 1TCBA 1FE8A 1ZH6A 3KNZA 1GAJA 1CLEA 4ASUD 2IYOA 2OPHA 1PYOA 2GAAA 3H97A 1HY3A 4WINA 5AOVA 3PEWA 2QZSA 1IIBA 1M76A 3F78A 1ZD2P 4WBNF 4K40A 4PSVA 1WG8A 5HE9A 2XMGA 4BLRA 4N6GA 4G4SP 2P69A 1KXJA 1Y3DE 3ZJ5A 5KOJA 3LKBA 5IUNC 8AT1A 4COKA 1KBOA 2JLBA 2SCUB 4OAPA 2FPPB 2BLNA 2EG5A 2GBLC 3BEOA 3HXKA 2OR3A 4HDKA 3PVSA 3SEZA 2CXQA 2Q1TA 4IHKA 4RKFA 3OEYA 2B1IA 1P33A 1H2YA 1V1MA 3H4VA 2IF0A 1YQQA 2OGSA 5F3WB 2AMJA 3OQJA 1KJQA 2NZ8A 2EDAA 3ID6C 5CX4A 3WL7A 3UHPA 3E53A 2Q6KA 3Q0IA 5KPDA 3SKYA 3MB5A 2JB9A 4BLSA 2DPXA 3F73A 1CYDA 4M1ZA 4CQLB 2VEOA 4UHCA 2OB2A 3ESZA 4ONEA 4WT7A 4TWJA 3RYIA 4A4DA 4B3JA 1EG7A 3RC8A 4OHZA 1TQHA 2PZFA 1XVTA 4W1PA 3TO5A 5CITA 1KQ3A 5K3FB 2RHDA 1HXHA 4MVJG 4M89A 1OX5A 1UJ4A 5A4JA 2QTMA 2XOKA 4NCHA 2O8NA 3HS3A 4XLTA 4XPIA 4YONB 4LPKA 4GKAA 1W9MA 1YB2A 3AU8A 1M6EX 4K26A 2DT8A 3MFYA 4RMNA 2ZULA 5G2OA 1XTZA 2N1MA 3CH5A 1JE0A 3CU5A 3Q1LA 4BNLA 2YW2A 2IXGA 2Q3EA 1MQ9A 3WL4A 2IHJA 3M4JA 4EJ0A 5KMGB 5AW5A 1PS0A 1PZXA 1E7YA 1N6OA 3N5CA 3K16A 3THRA 1H1TA 2CD7A 1J39A 3BE8A 2QZPA 3EG5A 5LXTF 3BIOA 1A1SA 5ALRA 4RETA 2FKAA 4RXMA 5EJIA 1YF3A 1MHTA 2HY7A 1NYQA 1JF8A 3FMOB 3GLSA 2D5AA 1UC5B 1GPH1 1G18A 1P0IA 3KDAA 1QH8B 1C50A 4XIYA 3EYWA 6CHYA 1WUTA 3L8CA 3T1TA 2HRQA 3NT4A 4HO1X 4MPRA 2CDRA 2H1CA 1BS1A 2J3JA 3GBVA 4JBYA 4MEBA 3V1NA 1RADA 2QLJA 4AF6A 1NBMA 3A1VA 4WSOA 4L6AA 1Z2DA 3IP6A 2R6DA 1U28C 1V25A 4FCVA 2A92A 2R87A 3C39A 2C9MA 1JEYA 5GONF 3TL2A 4O2BB 5HRUA 1UDXA 3H0EA 4Q1FA 3T1HB 3N39C 5B7NA 5I7HA 1M8PA 2Q4EA 1V8FA 3FNGA 4PRYA 1ULUA 1V7CA 1HMPA 2PTGA 3GFPA 4OH7A 4RS4A 2ECPA 4IZOA 3AVXA 1XEWY 4MVJM 4L5AA 3CH6A 1WBBA 1T15A 1JFFA 2CMKA 2VHJA 1JDNA 4A6DA 5KQSA 4DUZB 3K0BA 4CDMA 1QBGA 4B2PA 3V4VB 1RXWA 1OXUA 4W8OA 4NBSA 1P7CA 2FZWA 1BN7A 2RK3A 1HDCA 4DCOA 2DSNA 2A9QA 1ZHOA 5TGDA 5AXAA 4F4UA 2E1RA 3U40A 3WMFA 1DIOB 3DKIA 1E8MA 3H5TA 2EWVA 3OH8A 3OMLA 4IMJB 3PTZA 4DUPA 1Q7RA 3AIMA 4BQQA 1Y1LA 3LDUA 3RRYA 1SRQA 1DVRA 1B00A 4I4TA 4N8SA 2O8DA 1IM5A 5KC8A 3KYDB 4P5PA 1ECGA 1IAVA 4PBTA 2V96A 3HWX1 3JYQA 4YDHB 5JAOA 2XNJA 1YS1X 2VHZA 1Z7YA 1EUDB 1VCHA 1RRMA 3QXHA 5DYTA 5BSMA 2DY0A 1E4EB 4I1VA 5CFOA 2Z4TA 2ZRNA 3TZEA 4HAXA 5IF9A 1JLRA 1KY3A 4PPFA 3RASA 4WESB 2NXJA 2C2HA 2Q0SA 1SULA 2Q8QA 2PUBA 4L28A 2ONKA 3ZJVA 2BFFA 1YRBA 3PC3A 1EFPB 1H8EA 2CNBA 3FBWA 4NLLA 3SIRA 3DZHA 2ISCA 5LZ4A 3WHIA 2RG1A 3BOSA 1PR6A 3ERCA 4JB3A 3LHIA 2YWGA 1EXVA 3WMWA 1PNRA 1Z08A 3BFXA 1YQDA 5B4UA 1G5RA 1GUAA 2Q7DA 2VJKA 3IT2A 3T38A 2HOQA 4LK3A 3TM5A 3LBNA 1QH1B 3S1SA 3LO8A 2COUA 3GYBA 5FBWB 3O4FA 1N78A 1KF0A 3QKRA 1P3DA 4YYEA 2UZ1B 3B3JA 1V5IA 3A2KA 5CG2A 1ND6A 1PG2A 2CYBA 2Z5GA 3EUAA 3HJGA 1SU6A 3RVOA 3AHGA 1P5ZB 1YR6A 2KBEA 1UKAA 3FCOA 3H4TA 3PRJA 3Q87B 4D4MA 5ES3A 4GRAA 3VOTA 3D4IA 2CY0A 5B3JC 3EH2A 1LNZA 3NYIA 3O9ZA 5C7LO 1JJVA 4QTZA 3ZV5A 2GA9A 2EAUA 1C3OB 4XR9A 3PJEA 1E2GA 1JE1A 2XX3A 4WPGA 1Y1SA 2I4IA 4FEAA 4DSTA 4MUBA 3ZQ4A 4PSCA 1C1XB 2J3EA 3CT4A 4DMGA 2ZRGA 2R1VA 5JJCA 1JMVA 1E1YA 1K27A 1LSOA 3AZQA 5AJUA 3WQBA 4ER0A 1REQA 4CMHA 4B5KA 1IQRA 3RU9A 1RXIA 2DJ5A 2QVGA 5FUMA 3KQLA 2P67A 1BZYA 4FDLA 1LSUA 1WV0A 4LRXA 4RQAA 4ZQCB 5EXSA 4JI3B 2WNHA 3IS3A 1JT2A 1U0HC 3PV0A 4OL9A 4PLGA 4UUAA 2R7LA 5DXAA 4LRSB 4DQXA 4A15A 2EL9A 2GCNA 3DWIA 3P4XA 4WLEA 2OA0A 3TIGA 3VYTB 4N47A 3NH6A 5JYEA 3QPWA 4MYHA 4S1OA 3WO0A 1DRKA 3OLYA 1PJ8A 2E4YA 3VKGA 1RPAA 3KPJA 3FLAA 4EW1A 3TS1A 3O47A 5IHXA 1A9XB 4Z8XA 3HYCA 1NIJA 3DR3A 5HUJA 1ZJ6A 2FNAA 1B3BA 1I7DA 2EIHA 1O87A 1ZIDA 3LWBA 3ASUA 1UDRA 4PHCA 1HA3A 1YR3A 3P32A 4DCNA 1J8YF 1Q20A 3HCFA 2OV3A 5CU7A 3I2YX 1HYEA 5DWVA 3HO1A 2XNSA 3MELA 3HXOA 1C0IA 4NYMQ 4QTXA 1PVDA 2OK7A 4X41A 1FY2A 2R6CA 3IDFA 1H8ED 2WIAA 4LJSA 3O94A 3WOHA 1SBTA 4OP3A 3ZV3A 1V8PA 4CCAA 4Z2AA 4BO2A 3TNYA 1U3VA 3A6DA 1XYGA 1OU4A 3ONVA 3TLGB 3V5NA 4HDSB 4J4BA 5BW6B 5HZKA 1HE1C 2FFQA 1E0KA 1VCIA 3W2TA 4EPWA 3ZQKA 4C14A 4EKYA 1MTOA 1YMUA 2WHYA 3F7NA 2BI7A 3EXHA 4N54A 3EC2A 4PXSA 3FH0A 2POCA 4UEQA 2WWYA 3MQ2A 3ZU6A 4E12A 1MV8A 1IY1A 2FSVA 4DLLA 4O02B 1VLQA 3WISA 3EPPA 2EFEB 2ZVQX 3MUEA 4DLRA 2FV8A 2XOEA 4DMRA 3LFUA 3R1IA 4AZTA 3S2GA 1G8KA 2C82A 3CCFA 4JX9A 2VNIA 2ZWAA 3L18A 1AG9A 1XVAA 1KFJB 2I2DA 3W2IA 1AQLA 1P7WA 5HJ2A 2W0MA 4IL5A 4C4YA 2BHRA 3S8YA 1F2TB 4PG4A 1L5VA 5H81A 2VP6A 3GX1A 3VO8A 4B3BA 4YBRA 2PGDA 3LX5A 4LA4A 2AN4A 3H16A 2YN0A 4O2BF 4TSRA 2A5DA 3TW8A 4ETWA 5IVHA 3WLFA 1DXYA 4G0WA 3V2UA 2B2NA 1NR1A 1XKLA 1ZRHA 3D5EA 3ES9A 1KMHB 1LI7A 4IQFA 4NS4A 1MC5A 1W47A 3A3KA 3F4BA 2HXGA 4NCKA 2K7ZA 3VHRA 3I73A 2DTXA 1K8XB 3D4NA 3HHPA 2OHJA 2Z9DA 4CF5A 5BWCA 2WWFA 2C8KA 1ORVA 3QBTA 5L3RA 4RCVA 1FUEA 4NZPA 4FHEA 1VI2A 2H2HA 3IQDB 2H06A 2Z9BA 4OOEA 4RZHA 3RW9A 3HBJA 1E9BA 4A6XA 3QG1A 1KK2A 2PZ8A 2YWJA 1NDUA 3DOEA 1U2EA 4QWWA 2X5JO 3NBZC 1P7ZA 1RXCA 1YE5A 4C78A 2QMOA 2W2VA 3CRVA 3FMPB 1Y3HA 4UBLA 1TGYA 1Q1AA 1HOXA 2K2WA 5D84A 1HR0B 2C07A 5LMZA 2WFLB 1NW6A 2P41A 3UT5B 1AA6A 2DZDA 4PZEA 5HFNA 1FEZA 5CGZA 2K4MA 2IHZA 4MW9A 1Z68A 2O5VA 3JVDA 3QXXA 1CWUA 2XD9A 4MV4A 5E95A 1ZEMA 1JR2A 3II6X 2OMEA 4JB8A 4DEVA 2W4MA 3NUGA 2PLRA 3R0XA 2YY6A 4BO7A 3C8DA 7MDHA 4CIAA 4B3HA 3BA1A 1XRRA 5HMMA 5MDHA 2LDBA 1KY5A 3LT0A 3R0ZA 5E3IA 4E1AA 5KYTA 4HDQB 2RGNC 4YQZA 13PKA 1Q0UA 1V3VA 5A6SB 1JA0A 3EZGA 1E32A 2X0NA