5K1SA

Crystal structure of aibc
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
358
structure length
358
Chain Sequence
HHHHHAENLYFQGHMKAVVLRSFGEAGNLKMETMPMPRPGRGEVLLRVHACGVCYHDVINRRGNLPRTSVPAILGHEAAGEVIEVGPDTPGWKTGDRAATLQRMSCGDCALCRSGRNSLCKTDNRFFGEELPGGYAQFMVAPVGGLGRVPASLPWNEAATVCCTTGTAVHTVRTRGKVRAGETVLITGASGGVGLSSVQLARLDGARVIAVTSSEAKVQALKEAGADEVIVSRGLDFASDVRKRTQGAGVDVAVEIVGSATFDQTLKSMAPGGRVVVVGNLESGMVQLNPGLVIVKELEILGAYATTQAELDEALRLTATGGVRQFVTDAVPLAEAAKAHFRLENREVAGRLVLVPPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Oxidoreductase, zinc-binding dehydrogenase family
publication title Crystal structure of AibC, a reductase involved in alternative de novo isovaleryl coenzyme A biosynthesis in Myxococcus xanthus.
pubmed doi rcsb
source organism Myxococcus xanthus (strain dk 1622)
total genus 104
structure length 358
sequence length 358
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 5k1sA00
1AXGA 4NG5A 1QV7A 4W9NA 1QV6A 1MA0A 1Y9AA 1M6WA 3JYNA 2DPHA 1AXEA 2CDBA 2DQ4A 1E3LA 2CDCA 3QJ5A 1M6HA 5DOZA 5FI5A 5DP1A 1PEDA 1V3UA 1JVBA 3KRTA 1AGNA 3HUDA 4B7CA 1H2BA 1KEVA 1A71A 4L0QA 4EYEA 1N8KA 1N92A 3PI7A 4WGGA 2VWQA 4UEOA 1PS0A 4W82A 5H83A 3FBGA 3S2GA 3WLFA 4A27A 2OXIA 5CDSA 4GI2A 1PL8A 4RVUA 2ZB3A 3GFBA 1YKFA 1GU7A 1MGOA 1E3JA 1LLUA 4CPDA 2EJVA 3S2EA 3TQHA 2W98A 3WIEA 4Z6KA 3WLEA 5ADHA 2OHXA 1BXZA 1QLJA 3JYLA 1CDOA 2ZB4A 3B6ZA 1E3EA 1GYRA 3OQ6A 1HDXA 1LDEA 2D8AA 3JV7A 2W4QA 1QORA 1VJ1A 1HETA 4A2CA 4DLAA 3FPCA 1WLYA 1ADCA 3WIDA 1PL7A 1YQXA 1TEHA 1GUFA 1HDZA 2J8ZA 4NH4A 4RQTA 5TNXA 1U3UA 3COSA 3UKOA 3WICA 4A10A 4HFMA 5KCZA 5H82A 2DFVA 4UEJA 3TWOA 2VNAA 2B5VA 3GQVA 1A72A 3PIIA 1P1RA 2VCYA 2VWGA 1TT7A 3GMSA 3HZZA 3S2FA 1V3TA 4DUPA 5CDUA 2B83A 4ILKA 2EERA 1HT0A 6ADHA 3QE3A 1Q1NA 3I4CA 1R37A 5KJ1A 1NTOA 4DVJA 8ADHA 4JBGA 1HF3A 1EE2A 4EEXA 2H6EA 5FI3A 1O8CA 2J3IA 1MP0A 1DEHA 1HSOA 1PIWA 5K1SA 1PL6A 1H0KA 1JQBA 3S1LA 1ADGA 1HDYA 4HFJA 1HEUA 5KJ6A 2C0CA 3GOHA 5DOVA 4EJ6A 2VZ8A 3WNQA 1P0CA 2VN8A 2X7HA 5CDTA 5A4DA 1IYZA 4EEZA 4W9NC 1HLDA 1HTBA 4IDEA 4OH1A 4A0SA 4XD2A 1YB5A 1BTOA 3IP1A 4DWVA 3QWAA 4GL4A 1D1SA 1UUFA 2EIHA 2NVBA 2VZ9A 3NX4A 2ZB7A 4IDAA 4C4OA 1NVGA 1P0FA 2OUIA 4JLWA 5A3JA 5CDGA 7ADHA 5KJEA 4MKRA 4WASA 2J3HA 2DM6A 2FZWA 4J6FA 4EJMA 1D1TA 3FPLA 2WEKA 4GKVA 1U3VA 1ZSVA 4IDCA 2Y05A 1N9GA 4IDDA 4NFSA 3S2IA 1U3TA 2CF5A 4W6ZA 4B7XA 1Y9EA 5ENVA 3FTNA 1MG0A 1VJ0A 2ZB8A 1IZ0A 4UEKA 4WE3A 3MEQA 4RVSA 2X1HA 2CF6A 5A3VA 2VWHA 3M6IA 4NFHA 1YQDA 1QLHA 4JXKA 4JBIA 4DL9A 5DP2A 4RQUA 2FZEA 4DXHA 2B5WA 1O89A 2XAAA 3B70A 3IUPA 1ZSYA 1V3VA 5KIAA 1ADBA 1HSZA 1LDYA 1RJWA 4OAQA 4HFNA 1MC5A 2OBYA 4IDFA 3UOGA 2JHGA 3QWBA 3FSRA 5KJCA 4JBHA 4IDBA 1N9GB 3GAZA 3SLKA 5H81A 4DLBA 5KJFA 1ADFA 2VWPA 1E3IA 3BTOA 4W99A 1YE3A 2CDAA 1KOLA 2CD9A 1XA0A 1JU9A 4JJIA 1U3WA 2JHFA 1F8FA 2J3KA 2J3JA
chains in the Genus database with same CATH superfamily
1AXGA 4NG5A 1QV7A 4W9NA 1QV6A 1MA0A 1Y9AA 1M6WA 3JYNA 2DPHA 1AXEA 2CDBA 2DQ4A 1E3LA 2CDCA 3QJ5A 1M6HA 5DOZA 5FI5A 5DP1A 1PEDA 1V3UA 1JVBA 3KRTA 1AGNA 3HUDA 4B7CA 1H2BA 1KEVA 1A71A 4L0QA 4EYEA 1N8KA 1N92A 3PI7A 4WGGA 2VWQA 4UEOA 1PS0A 4W82A 5H83A 3FBGA 3S2GA 3WLFA 4A27A 2OXIA 5CDSA 4GI2A 1PL8A 4RVUA 2ZB3A 3GFBA 1YKFA 1GU7A 1MGOA 1E3JA 1LLUA 4CPDA 2EJVA 3S2EA 3TQHA 2W98A 3WIEA 4Z6KA 3WLEA 5ADHA 2OHXA 1BXZA 1QLJA 3JYLA 1CDOA 2ZB4A 3B6ZA 1E3EA 1GYRA 3OQ6A 1HDXA 1LDEA 2D8AA 3JV7A 2W4QA 1QORA 1VJ1A 1HETA 4A2CA 4DLAA 3FPCA 1WLYA 1ADCA 3WIDA 1PL7A 1YQXA 1TEHA 1GUFA 1HDZA 2J8ZA 4NH4A 4RQTA 5TNXA 1U3UA 3COSA 3UKOA 3WICA 4A10A 4HFMA 5KCZA 5H82A 2DFVA 4UEJA 3TWOA 2VNAA 2B5VA 3GQVA 1A72A 3PIIA 1P1RA 2VCYA 2VWGA 1TT7A 3GMSA 3HZZA 3S2FA 1V3TA 4DUPA 5CDUA 2B83A 4ILKA 2EERA 1HT0A 6ADHA 3QE3A 1Q1NA 3I4CA 1R37A 5KJ1A 1NTOA 4DVJA 8ADHA 4JBGA 1HF3A 1EE2A 4EEXA 2H6EA 5FI3A 1O8CA 2J3IA 1MP0A 1DEHA 1HSOA 1PIWA 5K1SA 1PL6A 1H0KA 1JQBA 3S1LA 1ADGA 1HDYA 4HFJA 1HEUA 5KJ6A 2C0CA 3GOHA 5DOVA 4EJ6A 2VZ8A 3WNQA 1P0CA 2VN8A 2X7HA 5CDTA 5A4DA 1IYZA 4EEZA 4W9NC 1HLDA 1HTBA 4IDEA 4OH1A 4A0SA 4XD2A 1YB5A 1BTOA 3IP1A 4DWVA 3QWAA 4GL4A 1D1SA 1UUFA 2EIHA 2NVBA 2VZ9A 3NX4A 2ZB7A 4IDAA 4C4OA 1NVGA 1P0FA 2OUIA 4JLWA 5A3JA 5CDGA 7ADHA 5KJEA 4MKRA 4WASA 2J3HA 2DM6A 2FZWA 4J6FA 4EJMA 1D1TA 3FPLA 2WEKA 4GKVA 1U3VA 1ZSVA 4IDCA 2Y05A 1N9GA 4IDDA 4NFSA 3S2IA 1U3TA 2CF5A 4W6ZA 4B7XA 1Y9EA 5ENVA 3FTNA 1MG0A 1VJ0A 2ZB8A 1IZ0A 4UEKA 4WE3A 3MEQA 4RVSA 2X1HA 2CF6A 5A3VA 2VWHA 3M6IA 4NFHA 1YQDA 1QLHA 4JXKA 4JBIA 4DL9A 5DP2A 4RQUA 2FZEA 4DXHA 2B5WA 1O89A 2XAAA 3B70A 3IUPA 1ZSYA 1V3VA 5KIAA 1ADBA 1HSZA 1LDYA 1RJWA 4OAQA 4HFNA 1MC5A 2OBYA 4IDFA 3UOGA 2JHGA 3QWBA 3FSRA 5KJCA 4JBHA 4IDBA 1N9GB 3GAZA 3SLKA 5H81A 4DLBA 5KJFA 1ADFA 2VWPA 1E3IA 3BTOA 4W99A 1YE3A 2CDAA 1KOLA 2CD9A 1XA0A 1JU9A 4JJIA 1U3WA 2JHFA 1F8FA 2J3KA 2J3JA
chains in the Genus database with same CATH topology
1AXGA 4NG5A 1QV7A 4W9NA 1QV6A 1MA0A 1Y9AA 1M6WA 3JYNA 2DPHA 1AXEA 2CDBA 2DQ4A 1E3LA 2CDCA 3QJ5A 1M6HA 5DOZA 5FI5A 5DP1A 1PEDA 1V3UA 1JVBA 3KRTA 1AGNA 3HUDA 4B7CA 1H2BA 1KEVA 1A71A 4L0QA 4EYEA 1N8KA 1N92A 3PI7A 4WGGA 2VWQA 4UEOA 1PS0A 4W82A 5H83A 3FBGA 3S2GA 3WLFA 4A27A 2OXIA 5CDSA 4GI2A 1PL8A 4RVUA 2ZB3A 3GFBA 1YKFA 1GU7A 1MGOA 1E3JA 1LLUA 4CPDA 2EJVA 3S2EA 3TQHA 2W98A 3WIEA 4Z6KA 3WLEA 5ADHA 2OHXA 1BXZA 1QLJA 3JYLA 1CDOA 2ZB4A 3B6ZA 1E3EA 1GYRA 3OQ6A 1HDXA 1LDEA 2D8AA 3JV7A 2W4QA 1QORA 1VJ1A 1HETA 4A2CA 4DLAA 3FPCA 1WLYA 1ADCA 3WIDA 1PL7A 1YQXA 1TEHA 1GUFA 1HDZA 2J8ZA 4NH4A 4RQTA 5TNXA 1U3UA 3COSA 3UKOA 3WICA 4A10A 4HFMA 5KCZA 5H82A 2DFVA 4UEJA 3TWOA 2VNAA 2B5VA 3GQVA 1A72A 3PIIA 1P1RA 2VCYA 2VWGA 1TT7A 3GMSA 3HZZA 3S2FA 1V3TA 4DUPA 5CDUA 2B83A 4ILKA 2EERA 1HT0A 6ADHA 3QE3A 1Q1NA 3I4CA 1R37A 5KJ1A 1NTOA 4DVJA 8ADHA 4JBGA 1HF3A 1EE2A 4EEXA 2H6EA 5FI3A 1O8CA 2J3IA 1MP0A 1DEHA 1HSOA 1PIWA 5K1SA 1PL6A 1H0KA 1JQBA 3S1LA 1ADGA 1HDYA 4HFJA 1HEUA 5KJ6A 2C0CA 3GOHA 5DOVA 4EJ6A 2VZ8A 3WNQA 1P0CA 2VN8A 2X7HA 5CDTA 5A4DA 1IYZA 4EEZA 4W9NC 1HLDA 1HTBA 4IDEA 4OH1A 4A0SA 4XD2A 1YB5A 1BTOA 3IP1A 4DWVA 3QWAA 4GL4A 1D1SA 1UUFA 2EIHA 2NVBA 2VZ9A 3NX4A 2ZB7A 4IDAA 4C4OA 1NVGA 1P0FA 2OUIA 4JLWA 5A3JA 5CDGA 7ADHA 5KJEA 4MKRA 4WASA 2J3HA 2DM6A 2FZWA 4J6FA 4EJMA 1D1TA 3FPLA 2WEKA 4GKVA 1U3VA 1ZSVA 4IDCA 2Y05A 1N9GA 4IDDA 4NFSA 3S2IA 1U3TA 2CF5A 4W6ZA 4B7XA 1Y9EA 5ENVA 3FTNA 1MG0A 1VJ0A 2ZB8A 1IZ0A 4UEKA 4WE3A 3MEQA 4RVSA 2X1HA 2CF6A 5A3VA 2VWHA 3M6IA 4NFHA 1YQDA 1QLHA 4JXKA 4JBIA 4DL9A 5DP2A 4RQUA 2FZEA 4DXHA 2B5WA 1O89A 2XAAA 3B70A 3IUPA 1ZSYA 1V3VA 5KIAA 1ADBA 1HSZA 1LDYA 1RJWA 4OAQA 4HFNA 1MC5A 2OBYA 4IDFA 3UOGA 2JHGA 3QWBA 3FSRA 5KJCA 4JBHA 4IDBA 1N9GB 3GAZA 3SLKA 5H81A 4DLBA 5KJFA 1ADFA 2VWPA 1E3IA 3BTOA 4W99A 1YE3A 2CDAA 1KOLA 2CD9A 1XA0A 1JU9A 4JJIA 1U3WA 2JHFA 1F8FA 2J3KA 2J3JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AXG A;  4NG5 A;  1QV7 A;  4W9N A;  1QV6 A;  1MA0 A;  1Y9A A;  1M6W A;  3JYN A;  2DPH A;  1AXE A;  2CDB A;  2DQ4 A;  1E3L A;  2CDC A;  3QJ5 A;  1M6H A;  5DOZ A;  5FI5 A;  5DP1 A;  1PED A;  1V3U A;  1JVB A;  3KRT A;  1AGN A;  3HUD A;  4B7C A;  1H2B A;  1KEV A;  1A71 A;  4L0Q A;  4EYE A;  1N8K A;  1N92 A;  3PI7 A;  4WGG A;  2VWQ A;  4UEO A;  1PS0 A;  4W82 A;  5H83 A;  3FBG A;  3S2G A;  3WLF A;  4A27 A;  2OXI A;  5CDS A;  4GI2 A;  1PL8 A;  4RVU A;  2ZB3 A;  3GFB A;  1YKF A;  1GU7 A;  1MGO A;  1E3J A;  1LLU A;  4CPD A;  2EJV A;  3S2E A;  3TQH A;  2W98 A;  3WIE A;  4Z6K A;  3WLE A;  5ADH A;  2OHX A;  1BXZ A;  1QLJ A;  3JYL A;  1CDO A;  2ZB4 A;  3B6Z A;  1E3E A;  1GYR A;  3OQ6 A;  1HDX A;  1LDE A;  2D8A A;  3JV7 A;  2W4Q A;  1QOR A;  1VJ1 A;  1HET A;  4A2C A;  4DLA A;  3FPC A;  1WLY A;  1ADC A;  3WID A;  1PL7 A;  1YQX A;  1TEH A;  1GUF A;  1HDZ A;  2J8Z A;  4NH4 A;  4RQT A;  5TNX A;  1U3U A;  3COS A;  3UKO A;  3WIC A;  4A10 A;  4HFM A;  5KCZ A;  5H82 A;  2DFV A;  4UEJ A;  3TWO A;  2VNA A;  2B5V A;  3GQV A;  1A72 A;  3PII A;  1P1R A;  2VCY A;  2VWG A;  1TT7 A;  3GMS A;  3HZZ A;  3S2F A;  1V3T A;  4DUP A;  5CDU A;  2B83 A;  4ILK A;  2EER A;  1HT0 A;  6ADH A;  3QE3 A;  1Q1N A;  3I4C A;  1R37 A;  5KJ1 A;  1NTO A;  4DVJ A;  8ADH A;  4JBG A;  1HF3 A;  1EE2 A;  4EEX A;  2H6E A;  5FI3 A;  1O8C A;  2J3I A;  1MP0 A;  1DEH A;  1HSO A;  1PIW A;  5K1S A;  1PL6 A;  1H0K A;  1JQB A;  3S1L A;  1ADG A;  1HDY A;  4HFJ A;  1HEU A;  5KJ6 A;  2C0C A;  3GOH A;  5DOV A;  4EJ6 A;  2VZ8 A;  3WNQ A;  1P0C A;  2VN8 A;  2X7H A;  5CDT A;  5A4D A;  1IYZ A;  4EEZ A;  4W9N C;  1HLD A;  1HTB A;  4IDE A;  4OH1 A;  4A0S A;  4XD2 A;  1YB5 A;  1BTO A;  3IP1 A;  4DWV A;  3QWA A;  4GL4 A;  1D1S A;  1UUF A;  2EIH A;  2NVB A;  2VZ9 A;  3NX4 A;  2ZB7 A;  4IDA A;  4C4O A;  1NVG A;  1P0F A;  2OUI A;  4JLW A;  5A3J A;  5CDG A;  7ADH A;  5KJE A;  4MKR A;  4WAS A;  2J3H A;  2DM6 A;  2FZW A;  4J6F A;  4EJM A;  1D1T A;  3FPL A;  2WEK A;  4GKV A;  1U3V A;  1ZSV A;  4IDC A;  2Y05 A;  1N9G A;  4IDD A;  4NFS A;  3S2I A;  1U3T A;  2CF5 A;  4W6Z A;  4B7X A;  1Y9E A;  5ENV A;  3FTN A;  1MG0 A;  1VJ0 A;  2ZB8 A;  1IZ0 A;  4UEK A;  4WE3 A;  3MEQ A;  4RVS A;  2X1H A;  2CF6 A;  5A3V A;  2VWH A;  3M6I A;  4NFH A;  1YQD A;  1QLH A;  4JXK A;  4JBI A;  4DL9 A;  5DP2 A;  4RQU A;  2FZE A;  4DXH A;  2B5W A;  1O89 A;  2XAA A;  3B70 A;  3IUP A;  1ZSY A;  1V3V A;  5KIA A;  1ADB A;  1HSZ A;  1LDY A;  1RJW A;  4OAQ A;  4HFN A;  1MC5 A;  2OBY A;  4IDF A;  3UOG A;  2JHG A;  3QWB A;  3FSR A;  5KJC A;  4JBH A;  4IDB A;  1N9G B;  3GAZ A;  3SLK A;  5H81 A;  4DLB A;  5KJF A;  1ADF A;  2VWP A;  1E3I A;  3BTO A;  4W99 A;  1YE3 A;  2CDA A;  1KOL A;  2CD9 A;  1XA0 A;  1JU9 A;  4JJI A;  1U3W A;  2JHF A;  1F8F A;  2J3K A;  2J3J A; 
#chains in the Genus database with same CATH topology
 1AXG A;  4NG5 A;  1QV7 A;  4W9N A;  1QV6 A;  1MA0 A;  1Y9A A;  1M6W A;  3JYN A;  2DPH A;  1AXE A;  2CDB A;  2DQ4 A;  1E3L A;  2CDC A;  3QJ5 A;  1M6H A;  5DOZ A;  5FI5 A;  5DP1 A;  1PED A;  1V3U A;  1JVB A;  3KRT A;  1AGN A;  3HUD A;  4B7C A;  1H2B A;  1KEV A;  1A71 A;  4L0Q A;  4EYE A;  1N8K A;  1N92 A;  3PI7 A;  4WGG A;  2VWQ A;  4UEO A;  1PS0 A;  4W82 A;  5H83 A;  3FBG A;  3S2G A;  3WLF A;  4A27 A;  2OXI A;  5CDS A;  4GI2 A;  1PL8 A;  4RVU A;  2ZB3 A;  3GFB A;  1YKF A;  1GU7 A;  1MGO A;  1E3J A;  1LLU A;  4CPD A;  2EJV A;  3S2E A;  3TQH A;  2W98 A;  3WIE A;  4Z6K A;  3WLE A;  5ADH A;  2OHX A;  1BXZ A;  1QLJ A;  3JYL A;  1CDO A;  2ZB4 A;  3B6Z A;  1E3E A;  1GYR A;  3OQ6 A;  1HDX A;  1LDE A;  2D8A A;  3JV7 A;  2W4Q A;  1QOR A;  1VJ1 A;  1HET A;  4A2C A;  4DLA A;  3FPC A;  1WLY A;  1ADC A;  3WID A;  1PL7 A;  1YQX A;  1TEH A;  1GUF A;  1HDZ A;  2J8Z A;  4NH4 A;  4RQT A;  5TNX A;  1U3U A;  3COS A;  3UKO A;  3WIC A;  4A10 A;  4HFM A;  5KCZ A;  5H82 A;  2DFV A;  4UEJ A;  3TWO A;  2VNA A;  2B5V A;  3GQV A;  1A72 A;  3PII A;  1P1R A;  2VCY A;  2VWG A;  1TT7 A;  3GMS A;  3HZZ A;  3S2F A;  1V3T A;  4DUP A;  5CDU A;  2B83 A;  4ILK A;  2EER A;  1HT0 A;  6ADH A;  3QE3 A;  1Q1N A;  3I4C A;  1R37 A;  5KJ1 A;  1NTO A;  4DVJ A;  8ADH A;  4JBG A;  1HF3 A;  1EE2 A;  4EEX A;  2H6E A;  5FI3 A;  1O8C A;  2J3I A;  1MP0 A;  1DEH A;  1HSO A;  1PIW A;  5K1S A;  1PL6 A;  1H0K A;  1JQB A;  3S1L A;  1ADG A;  1HDY A;  4HFJ A;  1HEU A;  5KJ6 A;  2C0C A;  3GOH A;  5DOV A;  4EJ6 A;  2VZ8 A;  3WNQ A;  1P0C A;  2VN8 A;  2X7H A;  5CDT A;  5A4D A;  1IYZ A;  4EEZ A;  4W9N C;  1HLD A;  1HTB A;  4IDE A;  4OH1 A;  4A0S A;  4XD2 A;  1YB5 A;  1BTO A;  3IP1 A;  4DWV A;  3QWA A;  4GL4 A;  1D1S A;  1UUF A;  2EIH A;  2NVB A;  2VZ9 A;  3NX4 A;  2ZB7 A;  4IDA A;  4C4O A;  1NVG A;  1P0F A;  2OUI A;  4JLW A;  5A3J A;  5CDG A;  7ADH A;  5KJE A;  4MKR A;  4WAS A;  2J3H A;  2DM6 A;  2FZW A;  4J6F A;  4EJM A;  1D1T A;  3FPL A;  2WEK A;  4GKV A;  1U3V A;  1ZSV A;  4IDC A;  2Y05 A;  1N9G A;  4IDD A;  4NFS A;  3S2I A;  1U3T A;  2CF5 A;  4W6Z A;  4B7X A;  1Y9E A;  5ENV A;  3FTN A;  1MG0 A;  1VJ0 A;  2ZB8 A;  1IZ0 A;  4UEK A;  4WE3 A;  3MEQ A;  4RVS A;  2X1H A;  2CF6 A;  5A3V A;  2VWH A;  3M6I A;  4NFH A;  1YQD A;  1QLH A;  4JXK A;  4JBI A;  4DL9 A;  5DP2 A;  4RQU A;  2FZE A;  4DXH A;  2B5W A;  1O89 A;  2XAA A;  3B70 A;  3IUP A;  1ZSY A;  1V3V A;  5KIA A;  1ADB A;  1HSZ A;  1LDY A;  1RJW A;  4OAQ A;  4HFN A;  1MC5 A;  2OBY A;  4IDF A;  3UOG A;  2JHG A;  3QWB A;  3FSR A;  5KJC A;  4JBH A;  4IDB A;  1N9G B;  3GAZ A;  3SLK A;  5H81 A;  4DLB A;  5KJF A;  1ADF A;  2VWP A;  1E3I A;  3BTO A;  4W99 A;  1YE3 A;  2CDA A;  1KOL A;  2CD9 A;  1XA0 A;  1JU9 A;  4JJI A;  1U3W A;  2JHF A;  1F8F A;  2J3K A;  2J3J A; 
#chains in the Genus database with same CATH homology
 1AXG A;  4NG5 A;  1QV7 A;  4W9N A;  1QV6 A;  1MA0 A;  1Y9A A;  1M6W A;  3JYN A;  2DPH A;  1AXE A;  2CDB A;  2DQ4 A;  1E3L A;  2CDC A;  3QJ5 A;  1M6H A;  5DOZ A;  5FI5 A;  5DP1 A;  1PED A;  1V3U A;  1JVB A;  3KRT A;  1AGN A;  3HUD A;  4B7C A;  1H2B A;  1KEV A;  1A71 A;  4L0Q A;  4EYE A;  1N8K A;  1N92 A;  3PI7 A;  4WGG A;  2VWQ A;  4UEO A;  1PS0 A;  4W82 A;  5H83 A;  3FBG A;  3S2G A;  3WLF A;  4A27 A;  2OXI A;  5CDS A;  4GI2 A;  1PL8 A;  4RVU A;  2ZB3 A;  3GFB A;  1YKF A;  1GU7 A;  1MGO A;  1E3J A;  1LLU A;  4CPD A;  2EJV A;  3S2E A;  3TQH A;  2W98 A;  3WIE A;  4Z6K A;  3WLE A;  5ADH A;  2OHX A;  1BXZ A;  1QLJ A;  3JYL A;  1CDO A;  2ZB4 A;  3B6Z A;  1E3E A;  1GYR A;  3OQ6 A;  1HDX A;  1LDE A;  2D8A A;  3JV7 A;  2W4Q A;  1QOR A;  1VJ1 A;  1HET A;  4A2C A;  4DLA A;  3FPC A;  1WLY A;  1ADC A;  3WID A;  1PL7 A;  1YQX A;  1TEH A;  1GUF A;  1HDZ A;  2J8Z A;  4NH4 A;  4RQT A;  5TNX A;  1U3U A;  3COS A;  3UKO A;  3WIC A;  4A10 A;  4HFM A;  5KCZ A;  5H82 A;  2DFV A;  4UEJ A;  3TWO A;  2VNA A;  2B5V A;  3GQV A;  1A72 A;  3PII A;  1P1R A;  2VCY A;  2VWG A;  1TT7 A;  3GMS A;  3HZZ A;  3S2F A;  1V3T A;  4DUP A;  5CDU A;  2B83 A;  4ILK A;  2EER A;  1HT0 A;  6ADH A;  3QE3 A;  1Q1N A;  3I4C A;  1R37 A;  5KJ1 A;  1NTO A;  4DVJ A;  8ADH A;  4JBG A;  1HF3 A;  1EE2 A;  4EEX A;  2H6E A;  5FI3 A;  1O8C A;  2J3I A;  1MP0 A;  1DEH A;  1HSO A;  1PIW A;  5K1S A;  1PL6 A;  1H0K A;  1JQB A;  3S1L A;  1ADG A;  1HDY A;  4HFJ A;  1HEU A;  5KJ6 A;  2C0C A;  3GOH A;  5DOV A;  4EJ6 A;  2VZ8 A;  3WNQ A;  1P0C A;  2VN8 A;  2X7H A;  5CDT A;  5A4D A;  1IYZ A;  4EEZ A;  4W9N C;  1HLD A;  1HTB A;  4IDE A;  4OH1 A;  4A0S A;  4XD2 A;  1YB5 A;  1BTO A;  3IP1 A;  4DWV A;  3QWA A;  4GL4 A;  1D1S A;  1UUF A;  2EIH A;  2NVB A;  2VZ9 A;  3NX4 A;  2ZB7 A;  4IDA A;  4C4O A;  1NVG A;  1P0F A;  2OUI A;  4JLW A;  5A3J A;  5CDG A;  7ADH A;  5KJE A;  4MKR A;  4WAS A;  2J3H A;  2DM6 A;  2FZW A;  4J6F A;  4EJM A;  1D1T A;  3FPL A;  2WEK A;  4GKV A;  1U3V A;  1ZSV A;  4IDC A;  2Y05 A;  1N9G A;  4IDD A;  4NFS A;  3S2I A;  1U3T A;  2CF5 A;  4W6Z A;  4B7X A;  1Y9E A;  5ENV A;  3FTN A;  1MG0 A;  1VJ0 A;  2ZB8 A;  1IZ0 A;  4UEK A;  4WE3 A;  3MEQ A;  4RVS A;  2X1H A;  2CF6 A;  5A3V A;  2VWH A;  3M6I A;  4NFH A;  1YQD A;  1QLH A;  4JXK A;  4JBI A;  4DL9 A;  5DP2 A;  4RQU A;  2FZE A;  4DXH A;  2B5W A;  1O89 A;  2XAA A;  3B70 A;  3IUP A;  1ZSY A;  1V3V A;  5KIA A;  1ADB A;  1HSZ A;  1LDY A;  1RJW A;  4OAQ A;  4HFN A;  1MC5 A;  2OBY A;  4IDF A;  3UOG A;  2JHG A;  3QWB A;  3FSR A;  5KJC A;  4JBH A;  4IDB A;  1N9G B;  3GAZ A;  3SLK A;  5H81 A;  4DLB A;  5KJF A;  1ADF A;  2VWP A;  1E3I A;  3BTO A;  4W99 A;  1YE3 A;  2CDA A;  1KOL A;  2CD9 A;  1XA0 A;  1JU9 A;  4JJI A;  1U3W A;  2JHF A;  1F8F A;  2J3K A;  2J3J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...