1E3KA

Human progesteron receptor ligand binding domain in complex with the ligand metribolone (r1881)
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
251
structure length
251
Chain Sequence
QLIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLYFAPDLILNEQRMKESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEGLRSQTQFEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAAQLPKILAGMVKPLLFHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural evidence for ligand specificity in the binding domain of the human androgen receptor. Implications for pathogenic gene mutations.
pubmed doi rcsb
molecule keywords PROGESTERONE RECEPTOR
molecule tags Human progesterone receptor
source organism Homo sapiens
total genus 90
structure length 251
sequence length 251
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 1e3kA00
1YMTA 5DKSA 2QGWA 2VV1A 1S0ZA 5HJPA 1HG4A 4RMCA 2QH6A 1XJ7A 2Z4JA 3OMPA 3R2AA 5DXPA 5AZTA 3GWXA 4OC7A 3AFRA 1YY4A 2YHDA 5DKGA 5JI0D 5KR9A 2P7AA 1YUCA 3VJHA 4OK1A 3VTBA 5ICKA 2ZY0A 2AO6A 4OEZA 2FSZA 3OZ0A 4Y29A 5FQPA 3W0GA 2PIQA 3WJ5A 5DXBA 4APUA 3AZ3A 1XQCA 1ILGA 4PP6A 5DXEA 5JJMA 5KRHA 2NV7A 2XKWA 3FLIA 5KCEA 5KRJA 2VSTA 5DWLA 3LMPA 3UUAA 2PIVA 3GZ9A 1ERRA 2R40D 1XB7A 3ADVA 3VJIA 1QKMA 3G9EA 5DWEA 3VT3A 3VSPA 3MNOA 4S15A 5KYAA 3BQDA 1T7MA 2ZK4A 3ADWA 3X31A 2NW4A 3ILZA 4RMEA 2OUZA 2QE4A 2QPYA 3H52A 4MGDA 4POHA 5DXRA 4IS8A 4YT1A 4LNWA 1N46A 1I7IA 1PCGA 3GYUA 1DB1A 4PVUA 3BC5A 4M8EA 2YFEA 3KWYA 4R2UA 2R40A 2ATHA 5APKA 2PINA 2QZOB 3OMKA 3PCUA 4TUZB 5GT4A 4MG8B 5AWKA 3CLDA 5DY8A 5G46A 4JYGA 2ZNPA 3OMQA 1UPVA 4R06A 3VI8A 3X36A 2V7CA 5DK9A 5DYDA 2F4BA 2HASA 3EYBA 3A9EA 4CI5A 3ET0A 1G2NA 3BEJA 4Q50A 3K23A 4IWCA 3JZBA 1MV9A 3VT9A 5DIEA 1UHLA 4OILA 3F5CA 2AA6A 2HWRA 5IXKA 1K74D 1LBDA 3VRVA 3B5RA 5E0XA 3VRTA 3FALB 3AURA 3E7CA 4A2JA 5HYKA 1R1KD 4ITEA 1K7LA 5GIEA 3OS9A 3OLSA 4DOSA 3PRGA 4DM8A 5C4UA 4MDDA 2GTKA 1MZNA 2ZK0A 3OSAA 3VT7A 2R6WA 3ERDA 4J5WA 5IZ0A 1NRLA 4FNEA 4JYHA 4RZGA 4IW8A 3L3XA 4X1FA 5AVLA 3L03A 3V9TA 2AXAA 4MGBB 4MG7A 2J14A 4LSJA 3W5TA 3DY6A 3VHUA 1K74A 4DMAA 4MG8A 3FEIA 1UPWA 4QK4A 1X76A 1NQ0A 3FEJA 1R1KA 1Z95A 4Q0AC 4XI3A 1XDKA 4ZNVA 5E14A 2P1VA 4QJRA 2I4JA 4PP3A 2P4YA 4ZNWA 3VN2A 3CQVA 5ETHA 1ZEOA 3VJSA 2AA5A 2HAMA 4XLDA 4BCRA 4LNXA 2ABIA 3DCUA 4RMDA 4OHAA 1FD0A 4QL8A 4OKXA 2ZLCA 1S9PA 3GN8A 2GPOA 2POGA 2VV1B 5B41A 5HJPB 4XUHA 1R5KA 5SYZA 2FAIA 4MGAA 3AZ2A 4R6SA 3ZRAA 4OJ4A 3E00D 3PEQA 4IW6A 4M8HA 3OLLA 5E0WA 2ZFXA 4ZO1B 5AWJA 1L2JA 2AB2A 5DZIA 5E1CA 1T7TA 4QE8A 3SP9A 1NAXA 5DXBB 3RUUA 2QR9A 4JYIA 1FCZA 3UVVA 4Q13A 3V3QA 4DM6A 4DORA 4NB6A 5JJMB 1R6GA 2AYRA 1E3KA 4X1GA 5LGAA 2QSEA 5DIGA 3RLLA 3UUAB 4XUMA 3KMRA 1X7EA 3L1BA 1IE8A 3H0AD 5HZCA 5LWPA 2P7ZA 4OEDA 2ACLB 2PIXA 2AX6A 3KYTA 3E00A 2QTUA 4IA7A 1XVPA 3B66A 4S14A 1ZUCA 3AN4A 5C4SA 3A2JA 3WTQA 4NY9A 2OCFA 2YLPA 1WM0X 3ADTA 1RKHA 4RUOX 1MVCA 4MGDB 1T73A 3IPUA 3OSIA 4G1DA 4OH5A 3RUTA 3KDUA 4MG9A 3OAPA 2Q7KA 4G20A 4JGVA 3DZYD 3IXPD 3OGTA 1EXXA 4KZMA 5ACCA 3H0AA 3OKHA 2HC4A 4REEA 2VV3A 4FHHA 1T5ZA 1ZKYA 2AAXA 4MG6A 1RDTD 4IU7A 3RVFA 3PLZA 3LBDA 4DQMA 2GP7A 5DP0A 2NXXA 2ZNNA 4ZI1A 4IQRA 2IOKA 3A9EB 1ZH7A 2G0HA 4OIUA 2GIUA 2PIRA 5EC9A 3AX8A 5G45A 3DZUD 3TKMA 3UUCA 4POJA 5APJA 1T74A 3P89A 5AZVA 4OKBA 3DZYA 1FCYA 2ZXZA 3IXPA 2G44A 1UHLB 2Q7LA 3F5CB 3JZCA 5IAWA 2ACLA 4B7WA 2ZL9A 5KRMA 3NOAA 1U3QA 4OIVA 1XOWA 4OFUA 1QKUA 1RDTA 5DV3A 1NUOA 5KCTA 3KPZA 5I4VA 5F9BA 1YA3A 3UUDA 1K4WA 5E7VA 5DXKA 2AX8A 3OS8A 2XYJA 4RWVA 3KFCA 2GL8A 5DZHA 2YJAB 3B0RA 2BAWA 2Q6JA 5KRAA 4IVWA 3VHVA 5KROA 2HB8A 2J4AA 3OMMA 3AUNA 2AMAA 4RFWA 3DZUA 1XP9A 2ZK5A 3L0EA 5HYRA 3HM1A 5E15A 3ZQTA 1XNNA 2P1UA 4MG7B 2AWHA 5DKEA 4O8FA 2ZNOA 1SJ0A 5DTVA 3DCTA 3B68A 2JF9A 4P6WA 4PP5A 3B67A 4IA2A 5DUGA 3X1IA 3OLFA 1XLSA 4L96A 2P1TA 4OZRU 1XDKB 4N73A 5DVVA 2OVMA 4PRGA 4QE6A 2Q60A 5KRFA 1T7FA 3WWRA 2QA8B 1IE9A 1XV9B 3IA6A 3W0JA 3OSWA 5E19A 2J7YA 2AA7A 1T63A 2PKLA 1OVLA 1PZLA 4MGCA 3R8AA 2P15A 4NUFA 3VTDA 3WT7A 1GWQA 2HCDA 2Q5GA 3AN3A 3CDSA 4OZRE 2ZBSA 2HB7A 3MNEA 3FC6B 2IHQA 2Q6RA 1YOKA 4MGAB 3VSOA 5KRCA 1XZXX 4XT9A 3W0CA 2YLQA 3ADSA 3CS6A 4A4WA 4ZJRA 5B5BA 3W5PA 5KCCA 3KDTA 1S9QA 2B50A 2Q61A 2ZXNA 3R5MA 3D5FA 5DWGA 2Q8SA 5AVIA 4ZOMA 3VJTA 5KRKA 4ZNHA 3UVVB 4G1ZA 3VT6A 5DXMA 3M7RA 4OGHA 1Y0SA 5L7GA 2ZNQA 3P88A 4UDAA 5DMCA 3A2HA 1Y0XX 4LBDA 1T65A 1RJKA 1S0XA 2A3IA 1M7WA 1M13A 1U3RA 4YPQA 3SP6A 4K7AA 1XVPB 4TV1A 3HODA 4YNKA 2QA8A 1XV9A 2BJ4A 1QKNA 1Y9RA 4ZN9A 3UU7B 2HWQA 4OJ9A 3D90A 5EGVA 5DV6A 4MG9B 5DZ3A 2EWPA 3DR1A 2QXMA 3O1EA 4NIEA 5JY3A 4E2JA 4EMAA 5DU5A 1KNUA 3FC6A 4HEEX 4WLBA 1UOMA 2Q1HA 1ZDUA 5HCVA 1ZAFA 5DVSA 4UDDA 4ZN7A 2VV2A 1ZDTA 2IOGA 4OFRA 4WPFA 3K6PA 5L11A 1TXIA 2J7XA 3WMHA 1X7JA 2JFAA 3A78A 4WHFA 4J5XA 1EREA 3D24A 4PF3A 3T03A 3TY0A 5DZ0A 2Q7JA 5EJVA 2QW4A 2ZKCA 4WVDA 2H77A 3IMYA 1EXAA 2AX9A 3CS4A 4PWLA 4UDBA 2NPAA 1YYEA 3ET3A 4N8RA 1T79A 2P7GA 3W5QA 3B0QA 3S9SA 2QXSA 1I38A 4DK7A 2E2RA 3GYTA 4CI4A 1N83A 3WGPA 4OEYA 2PIWA 5FQRA 5G43A 2JJ3A 3F7DA 3KMZA 1H9UA 1VJBA 3V49A 1G1UA 1PQ6A 3P8XA 4OEAA 4S0TA 2PJLA 5DX3A 5FQVA 4PPPA 1NHZA 3CWDA 3Q95A 3UU7A 1PRGA 2Q5SA 3V9YA 1X7BA 4RZEA 1G50A 4XTAA 3V3EA 1XP1A 3UP3A 4G2HA 4J5WC 1SQNA 3VT8A 3ET2A 1XNXA 2YLYA 4ZJWA 3NSPA 3OOFA 2ZXMA 3ADUA 2ZK3A 3O1DA 3X1HA 2OZ7A 4OJBA 2Q59B 5EI1A 1M2ZA 2XYWA 4ITFA 3IPSA 1KKQA 3FURA 4HLWA 2ZMIA 3W0AA 3CTBA 3G8OA 5C4TA 3HO0A 5AYGA 2OM9A 2PIOA 1N4HA 3D57A 4DK8A 4ZNTA 1OT7A 3B65A 1OSVA 2B1ZA 1OVLB 2XYXA 1YIMA 2Q7IA 2G0GA 3CS8A 2OVHA 3HZFA 4IA1A 3KMGA 5CJ6A 4ZNSA 3G0WA 5FQTA 5KRIA 4JAZA 3PO9A 5DWIA 1BSXA 1PDUA 2YATA 1YINA 3U9QA 5C4OA 1NQ2A 4FN9A 4J5XC 1E3GA 1XP6A 2VSRA 3KBAA 4ONIA 3VHWA 2QNVA 4IA3A 3OKIA 3R8DA 3A3ZX 2HBHA 4IWFA 3L0JA 4G2IA 4UDCA 5DSHA 2NXXE 2AM9A 2AX7A 2I0GA 4LTWA 4IVYA 4MG5A 2I4PA 4L98A 2Q59A 1TFCA 1XPCA 1HJ1A 5DIDA 5DWJA 2HVCA 2Q70A 3A2IA 3AZ1A 5DXGA 3SZ1A 3WT6A 4TV1B 1DKFA 3R29A 4S0SA 1T76A 1QKTA 2VV4A 5EHJA 1GWRA 2QGTA 3FXVA 5G44A 2QMVA 4XHDA 2BJ4B 4F9MA 5KRLA 1NQ7A 3IPQA 3ZR7A 4FGYA 3L3ZA 1YP0A 2R6YA 1A28A 3RLJA 1KV6A 4REFA 2ZK1A 1PQCA 4K4JA 5KCDA 4OKTA 4G1YA 4RUPA 4PPSA 3G8IA 5FQSA 3TX7B 4IV4A 3VRUA 2LBDA 1U3SA 2B1VA 3GD2A 2ZK2A 3GBKA 1GWXA 1RKGA 2JFAB 1T7RA 1GS4A 2HARA 2ZASA 1YOWA 3HC6A 2I0JA 1P93A 2Q3YA 3VT4A 4J26A 1XLSE 3ERTA 5L7EA 2I4ZA 1FM9D 2OAXA 3GWSX 3R5NA 5DXQA 2H79A 2Q5PA 4OH6A 5DRJA 1XQ3A 4E4QA 2GPPA 4PLDA 5APHA 2O9IA 2FVJA 5A86A 1NAVA 1FBYA 2V0VA 3V9VA 1FM6D 2GPUA 3MNPA 2ZLAA 2Z4BA 1P8DA 1G5YA 5DVCA 2ZMJA 2PIPL 2REWA 4XAOA 3NSQA 2P54A 4PLEA 2ZMHA 3CJWA 1I37A 3ADXA 4G21A 4ZNUA 2GPVA 5DX3B 3L0LA 5G42A 4YMQA 3B0WA 2W8YA 3Q95B 3WJ4A 2Q1VA 3HLVA 3OS8C 3N00A 5GICA 1SKXA 5KD9A 5KYJA 1FM9A 1X7RA 1NQ1A 2ZK6A 3HVLA 3FS1A 4PXMA 3HC5A 3RY9A 3W0IA 3DT3A 4P6XA 5DUHA 2QABA 5DKBA 1FM6A 3D6DA 3OOKA 2QZOA 4TUZA 5GIDA 2GWXA 5AAVB 2POBA 3CDPA 5EITA 3R8IA 5KCFA 5KCWA 1PK5A 4FHIA 5DUEA 4NQAB 4OZTU 4RZFA 3K22A 3HQ5A 4A4VA 5DYBA 1ILHA 3W5RA 3UP0A 5AAUA 2PITA 1S19A 5AK2A 3UUDB 2PNUA 3E94A 5DLRA 4WQPA 4KZIA 4K6IA 4EM9A 5K13A 1ZGYA 1RK3A 1A52A 2QA6A 4KZJA 3VT5A 2PIUA 3WT5A 2XHSA 2ZVTA 4OZTE 1Q4XA 3FALA 2YLOA 3ZRBA 1PQ9A 3W0YA 5HJSA 1NYXA 4CSJA 1Z5XU 3WFGA 5M96A 4WHGA 3WFFA 4N5GA 4QM0A 3V4AA 4IUIA 4RUJA 2O4RA 4RE8A 3W0HA 3TKCA 1I7GA 1R20D 5H1EA 2VV0A 5DRMA 2Q6SA 3ET1A 4N1YA 4ZO1X 4E4KA 1L2IA 3B3KA 4MGBA 3VTCA 1SR7A 3B1MA 3K8SA 1Z5XE 2AA2A 2AMBA 4OARA 1XAPA 5DI7A 4IV2A 3VRWA 1LV2A 5AAVA 1U9EA 1NDEA 1FCXA 1X78A 2B23A 2PRGA 1DKFB 2O4JA 4RAKA 3QT0A 1XIUA 5G3JA 5DV8A 2VV4B 4J24A 4JL4A 5DZ1A 5L7HA 1OSHA 3B0TA 5G5WA 1YJEA 3P0UA 2YJDA 1R20A 2G5OA 3FUGA 4OLMA 2HFPA 3AUQA 5DL4A 3OZJA 5DMFA 3A40X 3OMOA 3PBAA 4OKWA 5KCUA
chains in the Genus database with same CATH superfamily
1YMTA 5DKSA 2QGWA 2VV1A 1S0ZA 5HJPA 1HG4A 4RMCA 2QH6A 1XJ7A 2Z4JA 3OMPA 3R2AA 5DXPA 5AZTA 3GWXA 4OC7A 3AFRA 1YY4A 2YHDA 5DKGA 5JI0D 5KR9A 2P7AA 1YUCA 3VJHA 4OK1A 3VTBA 5ICKA 2ZY0A 2AO6A 4OEZA 2FSZA 3OZ0A 4Y29A 5FQPA 3W0GA 2PIQA 3WJ5A 5DXBA 4APUA 3AZ3A 1XQCA 1ILGA 4PP6A 5DXEA 5JJMA 5KRHA 2NV7A 2XKWA 3FLIA 5KCEA 5KRJA 2VSTA 5DWLA 3LMPA 3UUAA 2PIVA 3GZ9A 1ERRA 2R40D 1XB7A 3ADVA 3VJIA 1QKMA 3G9EA 5DWEA 3VT3A 3VSPA 3MNOA 4S15A 5KYAA 3BQDA 1T7MA 2ZK4A 3ADWA 3X31A 2NW4A 3ILZA 4RMEA 2OUZA 2QE4A 2QPYA 3H52A 4MGDA 4POHA 5DXRA 4IS8A 4YT1A 4LNWA 1N46A 1I7IA 1PCGA 3GYUA 1DB1A 4PVUA 3BC5A 4M8EA 2YFEA 3KWYA 4R2UA 2R40A 2ATHA 5APKA 2PINA 2QZOB 3OMKA 3PCUA 4TUZB 5GT4A 4MG8B 5AWKA 3CLDA 5DY8A 5G46A 4JYGA 2ZNPA 3OMQA 1UPVA 4R06A 3VI8A 3X36A 2V7CA 5DK9A 5DYDA 2F4BA 2HASA 3EYBA 3A9EA 4CI5A 3ET0A 1G2NA 3BEJA 4Q50A 3K23A 4IWCA 3JZBA 1MV9A 3VT9A 5DIEA 1UHLA 4OILA 3F5CA 2AA6A 2HWRA 5IXKA 1K74D 1LBDA 3VRVA 3B5RA 5E0XA 3VRTA 3FALB 3AURA 3E7CA 4A2JA 5HYKA 1R1KD 4ITEA 1K7LA 5GIEA 3OS9A 3OLSA 4DOSA 3PRGA 4DM8A 5C4UA 4MDDA 2GTKA 1MZNA 2ZK0A 3OSAA 3VT7A 2R6WA 3ERDA 4J5WA 5IZ0A 1NRLA 4FNEA 4JYHA 4RZGA 4IW8A 3L3XA 4X1FA 5AVLA 3L03A 3V9TA 2AXAA 4MGBB 4MG7A 2J14A 4LSJA 3W5TA 3DY6A 3VHUA 1K74A 4DMAA 4MG8A 3FEIA 1UPWA 4QK4A 1X76A 1NQ0A 3FEJA 1R1KA 1Z95A 4Q0AC 4XI3A 1XDKA 4ZNVA 5E14A 2P1VA 4QJRA 2I4JA 4PP3A 2P4YA 4ZNWA 3VN2A 3CQVA 5ETHA 1ZEOA 3VJSA 2AA5A 2HAMA 4XLDA 4BCRA 4LNXA 2ABIA 3DCUA 4RMDA 4OHAA 1FD0A 4QL8A 4OKXA 2ZLCA 1S9PA 3GN8A 2GPOA 2POGA 2VV1B 5B41A 5HJPB 4XUHA 1R5KA 5SYZA 2FAIA 4MGAA 3AZ2A 4R6SA 3ZRAA 4OJ4A 3E00D 3PEQA 4IW6A 4M8HA 3OLLA 5E0WA 2ZFXA 4ZO1B 5AWJA 1L2JA 2AB2A 5DZIA 5E1CA 1T7TA 4QE8A 3SP9A 1NAXA 5DXBB 3RUUA 2QR9A 4JYIA 1FCZA 3UVVA 4Q13A 3V3QA 4DM6A 4DORA 4NB6A 5JJMB 1R6GA 2AYRA 1E3KA 4X1GA 5LGAA 2QSEA 5DIGA 3RLLA 3UUAB 4XUMA 3KMRA 1X7EA 3L1BA 1IE8A 3H0AD 5HZCA 5LWPA 2P7ZA 4OEDA 2ACLB 2PIXA 2AX6A 3KYTA 3E00A 2QTUA 4IA7A 1XVPA 3B66A 4S14A 1ZUCA 3AN4A 5C4SA 3A2JA 3WTQA 4NY9A 2OCFA 2YLPA 1WM0X 3ADTA 1RKHA 4RUOX 1MVCA 4MGDB 1T73A 3IPUA 3OSIA 4G1DA 4OH5A 3RUTA 3KDUA 4MG9A 3OAPA 2Q7KA 4G20A 4JGVA 3DZYD 3IXPD 3OGTA 1EXXA 4KZMA 5ACCA 3H0AA 3OKHA 2HC4A 4REEA 2VV3A 4FHHA 1T5ZA 1ZKYA 2AAXA 4MG6A 1RDTD 4IU7A 3RVFA 3PLZA 3LBDA 4DQMA 2GP7A 5DP0A 2NXXA 2ZNNA 4ZI1A 4IQRA 2IOKA 3A9EB 1ZH7A 2G0HA 4OIUA 2GIUA 2PIRA 5EC9A 3AX8A 5G45A 3DZUD 3TKMA 3UUCA 4POJA 5APJA 1T74A 3P89A 5AZVA 4OKBA 3DZYA 1FCYA 2ZXZA 3IXPA 2G44A 1UHLB 2Q7LA 3F5CB 3JZCA 5IAWA 2ACLA 4B7WA 2ZL9A 5KRMA 3NOAA 1U3QA 4OIVA 1XOWA 4OFUA 1QKUA 1RDTA 5DV3A 1NUOA 5KCTA 3KPZA 5I4VA 5F9BA 1YA3A 3UUDA 1K4WA 5E7VA 5DXKA 2AX8A 3OS8A 2XYJA 4RWVA 3KFCA 2GL8A 5DZHA 2YJAB 3B0RA 2BAWA 2Q6JA 5KRAA 4IVWA 3VHVA 5KROA 2HB8A 2J4AA 3OMMA 3AUNA 2AMAA 4RFWA 3DZUA 1XP9A 2ZK5A 3L0EA 5HYRA 3HM1A 5E15A 3ZQTA 1XNNA 2P1UA 4MG7B 2AWHA 5DKEA 4O8FA 2ZNOA 1SJ0A 5DTVA 3DCTA 3B68A 2JF9A 4P6WA 4PP5A 3B67A 4IA2A 5DUGA 3X1IA 3OLFA 1XLSA 4L96A 2P1TA 4OZRU 1XDKB 4N73A 5DVVA 2OVMA 4PRGA 4QE6A 2Q60A 5KRFA 1T7FA 3WWRA 2QA8B 1IE9A 1XV9B 3IA6A 3W0JA 3OSWA 5E19A 2J7YA 2AA7A 1T63A 2PKLA 1OVLA 1PZLA 4MGCA 3R8AA 2P15A 4NUFA 3VTDA 3WT7A 1GWQA 2HCDA 2Q5GA 3AN3A 3CDSA 4OZRE 2ZBSA 2HB7A 3MNEA 3FC6B 2IHQA 2Q6RA 1YOKA 4MGAB 3VSOA 5KRCA 1XZXX 4XT9A 3W0CA 2YLQA 3ADSA 3CS6A 4A4WA 4ZJRA 5B5BA 3W5PA 5KCCA 3KDTA 1S9QA 2B50A 2Q61A 2ZXNA 3R5MA 3D5FA 5DWGA 2Q8SA 5AVIA 4ZOMA 3VJTA 5KRKA 4ZNHA 3UVVB 4G1ZA 3VT6A 5DXMA 3M7RA 4OGHA 1Y0SA 5L7GA 2ZNQA 3P88A 4UDAA 5DMCA 3A2HA 1Y0XX 4LBDA 1T65A 1RJKA 1S0XA 2A3IA 1M7WA 1M13A 1U3RA 4YPQA 3SP6A 4K7AA 1XVPB 4TV1A 3HODA 4YNKA 2QA8A 1XV9A 2BJ4A 1QKNA 1Y9RA 4ZN9A 3UU7B 2HWQA 4OJ9A 3D90A 5EGVA 5DV6A 4MG9B 5DZ3A 2EWPA 3DR1A 2QXMA 3O1EA 4NIEA 5JY3A 4E2JA 4EMAA 5DU5A 1KNUA 3FC6A 4HEEX 4WLBA 1UOMA 2Q1HA 1ZDUA 5HCVA 1ZAFA 5DVSA 4UDDA 4ZN7A 2VV2A 1ZDTA 2IOGA 4OFRA 4WPFA 3K6PA 5L11A 1TXIA 2J7XA 3WMHA 1X7JA 2JFAA 3A78A 4WHFA 4J5XA 1EREA 3D24A 4PF3A 3T03A 3TY0A 5DZ0A 2Q7JA 5EJVA 2QW4A 2ZKCA 4WVDA 2H77A 3IMYA 1EXAA 2AX9A 3CS4A 4PWLA 4UDBA 2NPAA 1YYEA 3ET3A 4N8RA 1T79A 2P7GA 3W5QA 3B0QA 3S9SA 2QXSA 1I38A 4DK7A 2E2RA 3GYTA 4CI4A 1N83A 3WGPA 4OEYA 2PIWA 5FQRA 5G43A 2JJ3A 3F7DA 3KMZA 1H9UA 1VJBA 3V49A 1G1UA 1PQ6A 3P8XA 4OEAA 4S0TA 2PJLA 5DX3A 5FQVA 4PPPA 1NHZA 3CWDA 3Q95A 3UU7A 1PRGA 2Q5SA 3V9YA 1X7BA 4RZEA 1G50A 4XTAA 3V3EA 1XP1A 3UP3A 4G2HA 4J5WC 1SQNA 3VT8A 3ET2A 1XNXA 2YLYA 4ZJWA 3NSPA 3OOFA 2ZXMA 3ADUA 2ZK3A 3O1DA 3X1HA 2OZ7A 4OJBA 2Q59B 5EI1A 1M2ZA 2XYWA 4ITFA 3IPSA 1KKQA 3FURA 4HLWA 2ZMIA 3W0AA 3CTBA 3G8OA 5C4TA 3HO0A 5AYGA 2OM9A 2PIOA 1N4HA 3D57A 4DK8A 4ZNTA 1OT7A 3B65A 1OSVA 2B1ZA 1OVLB 2XYXA 1YIMA 2Q7IA 2G0GA 3CS8A 2OVHA 3HZFA 4IA1A 3KMGA 5CJ6A 4ZNSA 3G0WA 5FQTA 5KRIA 4JAZA 3PO9A 5DWIA 1BSXA 1PDUA 2YATA 1YINA 3U9QA 5C4OA 1NQ2A 4FN9A 4J5XC 1E3GA 1XP6A 2VSRA 3KBAA 4ONIA 3VHWA 2QNVA 4IA3A 3OKIA 3R8DA 3A3ZX 2HBHA 4IWFA 3L0JA 4G2IA 4UDCA 5DSHA 2NXXE 2AM9A 2AX7A 2I0GA 4LTWA 4IVYA 4MG5A 2I4PA 4L98A 2Q59A 1TFCA 1XPCA 1HJ1A 5DIDA 5DWJA 2HVCA 2Q70A 3A2IA 3AZ1A 5DXGA 3SZ1A 3WT6A 4TV1B 1DKFA 3R29A 4S0SA 1T76A 1QKTA 2VV4A 5EHJA 1GWRA 2QGTA 3FXVA 5G44A 2QMVA 4XHDA 2BJ4B 4F9MA 5KRLA 1NQ7A 3IPQA 3ZR7A 4FGYA 3L3ZA 1YP0A 2R6YA 1A28A 3RLJA 1KV6A 4REFA 2ZK1A 1PQCA 4K4JA 5KCDA 4OKTA 4G1YA 4RUPA 4PPSA 3G8IA 5FQSA 3TX7B 4IV4A 3VRUA 2LBDA 1U3SA 2B1VA 3GD2A 2ZK2A 3GBKA 1GWXA 1RKGA 2JFAB 1T7RA 1GS4A 2HARA 2ZASA 1YOWA 3HC6A 2I0JA 1P93A 2Q3YA 3VT4A 4J26A 1XLSE 3ERTA 5L7EA 2I4ZA 1FM9D 2OAXA 3GWSX 3R5NA 5DXQA 2H79A 2Q5PA 4OH6A 5DRJA 1XQ3A 4E4QA 2GPPA 4PLDA 5APHA 2O9IA 2FVJA 5A86A 1NAVA 1FBYA 2V0VA 3V9VA 1FM6D 2GPUA 3MNPA 2ZLAA 2Z4BA 1P8DA 1G5YA 5DVCA 2ZMJA 2PIPL 2REWA 4XAOA 3NSQA 2P54A 4PLEA 2ZMHA 3CJWA 1I37A 3ADXA 4G21A 4ZNUA 2GPVA 5DX3B 3L0LA 5G42A 4YMQA 3B0WA 2W8YA 3Q95B 3WJ4A 2Q1VA 3HLVA 3OS8C 3N00A 5GICA 1SKXA 5KD9A 5KYJA 1FM9A 1X7RA 1NQ1A 2ZK6A 3HVLA 3FS1A 4PXMA 3HC5A 3RY9A 3W0IA 3DT3A 4P6XA 5DUHA 2QABA 5DKBA 1FM6A 3D6DA 3OOKA 2QZOA 4TUZA 5GIDA 2GWXA 5AAVB 2POBA 3CDPA 5EITA 3R8IA 5KCFA 5KCWA 1PK5A 4FHIA 5DUEA 4NQAB 4OZTU 4RZFA 3K22A 3HQ5A 4A4VA 5DYBA 1ILHA 3W5RA 3UP0A 5AAUA 2PITA 1S19A 5AK2A 3UUDB 2PNUA 3E94A 5DLRA 4WQPA 4KZIA 4K6IA 4EM9A 5K13A 1ZGYA 1RK3A 1A52A 2QA6A 4KZJA 3VT5A 2PIUA 3WT5A 2XHSA 2ZVTA 4OZTE 1Q4XA 3FALA 2YLOA 3ZRBA 1PQ9A 3W0YA 5HJSA 1NYXA 4CSJA 1Z5XU 3WFGA 5M96A 4WHGA 3WFFA 4N5GA 4QM0A 3V4AA 4IUIA 4RUJA 2O4RA 4RE8A 3W0HA 3TKCA 1I7GA 1R20D 5H1EA 2VV0A 5DRMA 2Q6SA 3ET1A 4N1YA 4ZO1X 4E4KA 1L2IA 3B3KA 4MGBA 3VTCA 1SR7A 3B1MA 3K8SA 1Z5XE 2AA2A 2AMBA 4OARA 1XAPA 5DI7A 4IV2A 3VRWA 1LV2A 5AAVA 1U9EA 1NDEA 1FCXA 1X78A 2B23A 2PRGA 1DKFB 2O4JA 4RAKA 3QT0A 1XIUA 5G3JA 5DV8A 2VV4B 4J24A 4JL4A 5DZ1A 5L7HA 1OSHA 3B0TA 5G5WA 1YJEA 3P0UA 2YJDA 1R20A 2G5OA 3FUGA 4OLMA 2HFPA 3AUQA 5DL4A 3OZJA 5DMFA 3A40X 3OMOA 3PBAA 4OKWA 5KCUA
chains in the Genus database with same CATH topology
1YMTA 5DKSA 2QGWA 2VV1A 1S0ZA 5HJPA 1HG4A 4RMCA 2QH6A 1XJ7A 2Z4JA 3OMPA 3R2AA 5DXPA 5AZTA 3GWXA 4OC7A 3AFRA 1YY4A 2YHDA 5DKGA 5JI0D 5KR9A 2P7AA 1YUCA 3VJHA 4OK1A 3VTBA 5ICKA 2ZY0A 2AO6A 4OEZA 2FSZA 3OZ0A 4Y29A 5FQPA 3W0GA 2PIQA 3WJ5A 5DXBA 4APUA 3AZ3A 1XQCA 1ILGA 4PP6A 5DXEA 5JJMA 5KRHA 2NV7A 2XKWA 3FLIA 5KCEA 5KRJA 2VSTA 5DWLA 3LMPA 3UUAA 2PIVA 3GZ9A 1ERRA 2R40D 1XB7A 3ADVA 3VJIA 1QKMA 3G9EA 5DWEA 3VT3A 3VSPA 3MNOA 4S15A 5KYAA 3BQDA 1T7MA 2ZK4A 3ADWA 3X31A 2NW4A 3ILZA 4RMEA 2OUZA 2QE4A 2QPYA 3H52A 4MGDA 4POHA 5DXRA 4IS8A 4YT1A 4LNWA 1N46A 1I7IA 1PCGA 3GYUA 1DB1A 4PVUA 3BC5A 4M8EA 2YFEA 3KWYA 4R2UA 2R40A 2ATHA 5APKA 2PINA 2QZOB 3OMKA 3PCUA 4TUZB 5GT4A 4MG8B 5AWKA 3CLDA 5DY8A 5G46A 4JYGA 2ZNPA 3OMQA 1UPVA 4R06A 3VI8A 3X36A 2V7CA 5DK9A 5DYDA 2F4BA 2HASA 3EYBA 3A9EA 4CI5A 3ET0A 1G2NA 3BEJA 4Q50A 3K23A 4IWCA 3JZBA 1MV9A 3VT9A 5DIEA 1UHLA 4OILA 3F5CA 2AA6A 2HWRA 5IXKA 1K74D 1LBDA 3VRVA 3B5RA 5E0XA 3VRTA 3FALB 3AURA 3E7CA 4A2JA 5HYKA 1R1KD 4ITEA 1K7LA 5GIEA 3OS9A 3OLSA 4DOSA 3PRGA 4DM8A 5C4UA 4MDDA 2GTKA 1MZNA 2ZK0A 3OSAA 3VT7A 2R6WA 3ERDA 4J5WA 5IZ0A 1NRLA 4FNEA 4JYHA 4RZGA 4IW8A 3L3XA 4X1FA 5AVLA 3L03A 3V9TA 2AXAA 4MGBB 4MG7A 2J14A 4LSJA 3W5TA 3DY6A 3VHUA 1K74A 4DMAA 4MG8A 3FEIA 1UPWA 4QK4A 1X76A 1NQ0A 3FEJA 1R1KA 1Z95A 4Q0AC 4XI3A 1XDKA 4ZNVA 5E14A 2P1VA 4QJRA 2I4JA 4PP3A 2P4YA 4ZNWA 3VN2A 3CQVA 5ETHA 1ZEOA 3VJSA 2AA5A 2HAMA 4XLDA 4BCRA 4LNXA 2ABIA 3DCUA 4RMDA 4OHAA 1FD0A 4QL8A 4OKXA 2ZLCA 1S9PA 3GN8A 2GPOA 2POGA 2VV1B 5B41A 5HJPB 4XUHA 1R5KA 5SYZA 2FAIA 4MGAA 3AZ2A 4R6SA 3ZRAA 4OJ4A 3E00D 3PEQA 4IW6A 4M8HA 3OLLA 5E0WA 2ZFXA 4ZO1B 5AWJA 1L2JA 2AB2A 5DZIA 5E1CA 1T7TA 4QE8A 3SP9A 1NAXA 5DXBB 3RUUA 2QR9A 4JYIA 1FCZA 3UVVA 4Q13A 3V3QA 4DM6A 4DORA 4NB6A 5JJMB 1R6GA 2AYRA 1E3KA 4X1GA 5LGAA 2QSEA 5DIGA 3RLLA 3UUAB 4XUMA 3KMRA 1X7EA 3L1BA 1IE8A 3H0AD 5HZCA 5LWPA 2P7ZA 4OEDA 2ACLB 2PIXA 2AX6A 3KYTA 3E00A 2QTUA 4IA7A 1XVPA 3B66A 4S14A 1ZUCA 3AN4A 5C4SA 3A2JA 3WTQA 4NY9A 2OCFA 2YLPA 1WM0X 3ADTA 1RKHA 4RUOX 1MVCA 4MGDB 1T73A 3IPUA 3OSIA 4G1DA 4OH5A 3RUTA 3KDUA 4MG9A 3OAPA 2Q7KA 4G20A 4JGVA 3DZYD 3IXPD 3OGTA 1EXXA 4KZMA 5ACCA 3H0AA 3OKHA 2HC4A 4REEA 2VV3A 4FHHA 1T5ZA 1ZKYA 2AAXA 4MG6A 1RDTD 4IU7A 3RVFA 3PLZA 3LBDA 4DQMA 2GP7A 5DP0A 2NXXA 2ZNNA 4ZI1A 4IQRA 2IOKA 3A9EB 1ZH7A 2G0HA 4OIUA 2GIUA 2PIRA 5EC9A 3AX8A 5G45A 3DZUD 3TKMA 3UUCA 4POJA 5APJA 1T74A 3P89A 5AZVA 4OKBA 3DZYA 1FCYA 2ZXZA 3IXPA 2G44A 1UHLB 2Q7LA 3F5CB 3JZCA 5IAWA 2ACLA 4B7WA 2ZL9A 5KRMA 3NOAA 1U3QA 4OIVA 1XOWA 4OFUA 1QKUA 1RDTA 5DV3A 1NUOA 5KCTA 3KPZA 5I4VA 5F9BA 1YA3A 3UUDA 1K4WA 5E7VA 5DXKA 2AX8A 3OS8A 2XYJA 4RWVA 3KFCA 2GL8A 5DZHA 2YJAB 3B0RA 2BAWA 2Q6JA 5KRAA 4IVWA 3VHVA 5KROA 2HB8A 2J4AA 3OMMA 3AUNA 2AMAA 4RFWA 3DZUA 1XP9A 2ZK5A 3L0EA 5HYRA 3HM1A 5E15A 3ZQTA 1XNNA 2P1UA 4MG7B 2AWHA 5DKEA 4O8FA 2ZNOA 1SJ0A 5DTVA 3DCTA 3B68A 2JF9A 4P6WA 4PP5A 3B67A 4IA2A 5DUGA 3X1IA 3OLFA 1XLSA 4L96A 2P1TA 4OZRU 1XDKB 4N73A 5DVVA 2OVMA 4PRGA 4QE6A 2Q60A 5KRFA 1T7FA 3WWRA 2QA8B 1IE9A 1XV9B 3IA6A 3W0JA 3OSWA 5E19A 2J7YA 2AA7A 1T63A 2PKLA 1OVLA 1PZLA 4MGCA 3R8AA 2P15A 4NUFA 3VTDA 3WT7A 1GWQA 2HCDA 2Q5GA 3AN3A 3CDSA 4OZRE 2ZBSA 2HB7A 3MNEA 3FC6B 2IHQA 2Q6RA 1YOKA 4MGAB 3VSOA 5KRCA 1XZXX 4XT9A 3W0CA 2YLQA 3ADSA 3CS6A 4A4WA 4ZJRA 5B5BA 3W5PA 5KCCA 3KDTA 1S9QA 2B50A 2Q61A 2ZXNA 3R5MA 3D5FA 5DWGA 2Q8SA 5AVIA 4ZOMA 3VJTA 5KRKA 4ZNHA 3UVVB 4G1ZA 3VT6A 5DXMA 3M7RA 4OGHA 1Y0SA 5L7GA 2ZNQA 3P88A 4UDAA 5DMCA 3A2HA 1Y0XX 4LBDA 1T65A 1RJKA 1S0XA 2A3IA 1M7WA 1M13A 1U3RA 4YPQA 3SP6A 4K7AA 1XVPB 4TV1A 3HODA 4YNKA 2QA8A 1XV9A 2BJ4A 1QKNA 1Y9RA 4ZN9A 3UU7B 2HWQA 4OJ9A 3D90A 5EGVA 5DV6A 4MG9B 5DZ3A 2EWPA 3DR1A 2QXMA 3O1EA 4NIEA 5JY3A 4E2JA 4EMAA 5DU5A 1KNUA 3FC6A 4HEEX 4WLBA 1UOMA 2Q1HA 1ZDUA 5HCVA 1ZAFA 5DVSA 4UDDA 4ZN7A 2VV2A 1ZDTA 2IOGA 4OFRA 4WPFA 3K6PA 5L11A 1TXIA 2J7XA 3WMHA 1X7JA 2JFAA 3A78A 4WHFA 4J5XA 1EREA 3D24A 4PF3A 3T03A 3TY0A 5DZ0A 2Q7JA 5EJVA 2QW4A 2ZKCA 4WVDA 2H77A 3IMYA 1EXAA 2AX9A 3CS4A 4PWLA 4UDBA 2NPAA 1YYEA 3ET3A 4N8RA 1T79A 2P7GA 3W5QA 3B0QA 3S9SA 2QXSA 1I38A 4DK7A 2E2RA 3GYTA 4CI4A 1N83A 3WGPA 4OEYA 2PIWA 5FQRA 5G43A 2JJ3A 3F7DA 3KMZA 1H9UA 1VJBA 3V49A 1G1UA 1PQ6A 3P8XA 4OEAA 4S0TA 2PJLA 5DX3A 5FQVA 4PPPA 1NHZA 3CWDA 3Q95A 3UU7A 1PRGA 2Q5SA 3V9YA 1X7BA 4RZEA 1G50A 4XTAA 3V3EA 1XP1A 3UP3A 4G2HA 4J5WC 1SQNA 3VT8A 3ET2A 1XNXA 2YLYA 4ZJWA 3NSPA 3OOFA 2ZXMA 3ADUA 2ZK3A 3O1DA 3X1HA 2OZ7A 4OJBA 2Q59B 5EI1A 1M2ZA 2XYWA 4ITFA 3IPSA 1KKQA 3FURA 4HLWA 2ZMIA 3W0AA 3CTBA 3G8OA 5C4TA 3HO0A 5AYGA 2OM9A 2PIOA 1N4HA 3D57A 4DK8A 4ZNTA 1OT7A 3B65A 1OSVA 2B1ZA 1OVLB 2XYXA 1YIMA 2Q7IA 2G0GA 3CS8A 2OVHA 3HZFA 4IA1A 3KMGA 5CJ6A 4ZNSA 3G0WA 5FQTA 5KRIA 4JAZA 3PO9A 5DWIA 1BSXA 1PDUA 2YATA 1YINA 3U9QA 5C4OA 1NQ2A 4FN9A 4J5XC 1E3GA 1XP6A 2VSRA 3KBAA 4ONIA 3VHWA 2QNVA 4IA3A 3OKIA 3R8DA 3A3ZX 2HBHA 4IWFA 3L0JA 4G2IA 4UDCA 5DSHA 2NXXE 2AM9A 2AX7A 2I0GA 4LTWA 4IVYA 4MG5A 2I4PA 4L98A 2Q59A 1TFCA 1XPCA 1HJ1A 5DIDA 5DWJA 2HVCA 2Q70A 3A2IA 3AZ1A 5DXGA 3SZ1A 3WT6A 4TV1B 1DKFA 3R29A 4S0SA 1T76A 1QKTA 2VV4A 5EHJA 1GWRA 2QGTA 3FXVA 5G44A 2QMVA 4XHDA 2BJ4B 4F9MA 5KRLA 1NQ7A 3IPQA 3ZR7A 4FGYA 3L3ZA 1YP0A 2R6YA 1A28A 3RLJA 1KV6A 4REFA 2ZK1A 1PQCA 4K4JA 5KCDA 4OKTA 4G1YA 4RUPA 4PPSA 3G8IA 5FQSA 3TX7B 4IV4A 3VRUA 2LBDA 1U3SA 2B1VA 3GD2A 2ZK2A 3GBKA 1GWXA 1RKGA 2JFAB 1T7RA 1GS4A 2HARA 2ZASA 1YOWA 3HC6A 2I0JA 1P93A 2Q3YA 3VT4A 4J26A 1XLSE 3ERTA 5L7EA 2I4ZA 1FM9D 2OAXA 3GWSX 3R5NA 5DXQA 2H79A 2Q5PA 4OH6A 5DRJA 1XQ3A 4E4QA 2GPPA 4PLDA 5APHA 2O9IA 2FVJA 5A86A 1NAVA 1FBYA 2V0VA 3V9VA 1FM6D 2GPUA 3MNPA 2ZLAA 2Z4BA 1P8DA 1G5YA 5DVCA 2ZMJA 2PIPL 2REWA 4XAOA 3NSQA 2P54A 4PLEA 2ZMHA 3CJWA 1I37A 3ADXA 4G21A 4ZNUA 2GPVA 5DX3B 3L0LA 5G42A 4YMQA 3B0WA 2W8YA 3Q95B 3WJ4A 2Q1VA 3HLVA 3OS8C 3N00A 5GICA 1SKXA 5KD9A 5KYJA 1FM9A 1X7RA 1NQ1A 2ZK6A 3HVLA 3FS1A 4PXMA 3HC5A 3RY9A 3W0IA 3DT3A 4P6XA 5DUHA 2QABA 5DKBA 1FM6A 3D6DA 3OOKA 2QZOA 4TUZA 5GIDA 2GWXA 5AAVB 2POBA 3CDPA 5EITA 3R8IA 5KCFA 5KCWA 1PK5A 4FHIA 5DUEA 4NQAB 4OZTU 4RZFA 3K22A 3HQ5A 4A4VA 5DYBA 1ILHA 3W5RA 3UP0A 5AAUA 2PITA 1S19A 5AK2A 3UUDB 2PNUA 3E94A 5DLRA 4WQPA 4KZIA 4K6IA 4EM9A 5K13A 1ZGYA 1RK3A 1A52A 2QA6A 4KZJA 3VT5A 2PIUA 3WT5A 2XHSA 2ZVTA 4OZTE 1Q4XA 3FALA 2YLOA 3ZRBA 1PQ9A 3W0YA 5HJSA 1NYXA 4CSJA 1Z5XU 3WFGA 5M96A 4WHGA 3WFFA 4N5GA 4QM0A 3V4AA 4IUIA 4RUJA 2O4RA 4RE8A 3W0HA 3TKCA 1I7GA 1R20D 5H1EA 2VV0A 5DRMA 2Q6SA 3ET1A 4N1YA 4ZO1X 4E4KA 1L2IA 3B3KA 4MGBA 3VTCA 1SR7A 3B1MA 3K8SA 1Z5XE 2AA2A 2AMBA 4OARA 1XAPA 5DI7A 4IV2A 3VRWA 1LV2A 5AAVA 1U9EA 1NDEA 1FCXA 1X78A 2B23A 2PRGA 1DKFB 2O4JA 4RAKA 3QT0A 1XIUA 5G3JA 5DV8A 2VV4B 4J24A 4JL4A 5DZ1A 5L7HA 1OSHA 3B0TA 5G5WA 1YJEA 3P0UA 2YJDA 1R20A 2G5OA 3FUGA 4OLMA 2HFPA 3AUQA 5DL4A 3OZJA 5DMFA 3A40X 3OMOA 3PBAA 4OKWA 5KCUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YMT A;  5DKS A;  2QGW A;  2VV1 A;  1S0Z A;  5HJP A;  1HG4 A;  4RMC A;  2QH6 A;  1XJ7 A;  2Z4J A;  3OMP A;  3R2A A;  5DXP A;  5AZT A;  3GWX A;  4OC7 A;  3AFR A;  1YY4 A;  2YHD A;  5DKG A;  5JI0 D;  5KR9 A;  2P7A A;  1YUC A;  3VJH A;  4OK1 A;  3VTB A;  5ICK A;  2ZY0 A;  2AO6 A;  4OEZ A;  2FSZ A;  3OZ0 A;  4Y29 A;  5FQP A;  3W0G A;  2PIQ A;  3WJ5 A;  5DXB A;  4APU A;  3AZ3 A;  1XQC A;  1ILG A;  4PP6 A;  5DXE A;  5JJM A;  5KRH A;  2NV7 A;  2XKW A;  3FLI A;  5KCE A;  5KRJ A;  2VST A;  5DWL A;  3LMP A;  3UUA A;  2PIV A;  3GZ9 A;  1ERR A;  2R40 D;  1XB7 A;  3ADV A;  3VJI A;  1QKM A;  3G9E A;  5DWE A;  3VT3 A;  3VSP A;  3MNO A;  4S15 A;  5KYA A;  3BQD A;  1T7M A;  2ZK4 A;  3ADW A;  3X31 A;  2NW4 A;  3ILZ A;  4RME A;  2OUZ A;  2QE4 A;  2QPY A;  3H52 A;  4MGD A;  4POH A;  5DXR A;  4IS8 A;  4YT1 A;  4LNW A;  1N46 A;  1I7I A;  1PCG A;  3GYU A;  1DB1 A;  4PVU A;  3BC5 A;  4M8E A;  2YFE A;  3KWY A;  4R2U A;  2R40 A;  2ATH A;  5APK A;  2PIN A;  2QZO B;  3OMK A;  3PCU A;  4TUZ B;  5GT4 A;  4MG8 B;  5AWK A;  3CLD A;  5DY8 A;  5G46 A;  4JYG A;  2ZNP A;  3OMQ A;  1UPV A;  4R06 A;  3VI8 A;  3X36 A;  2V7C A;  5DK9 A;  5DYD A;  2F4B A;  2HAS A;  3EYB A;  3A9E A;  4CI5 A;  3ET0 A;  1G2N A;  3BEJ A;  4Q50 A;  3K23 A;  4IWC A;  3JZB A;  1MV9 A;  3VT9 A;  5DIE A;  1UHL A;  4OIL A;  3F5C A;  2AA6 A;  2HWR A;  5IXK A;  1K74 D;  1LBD A;  3VRV A;  3B5R A;  5E0X A;  3VRT A;  3FAL B;  3AUR A;  3E7C A;  4A2J A;  5HYK A;  1R1K D;  4ITE A;  1K7L A;  5GIE A;  3OS9 A;  3OLS A;  4DOS A;  3PRG A;  4DM8 A;  5C4U A;  4MDD A;  2GTK A;  1MZN A;  2ZK0 A;  3OSA A;  3VT7 A;  2R6W A;  3ERD A;  4J5W A;  5IZ0 A;  1NRL A;  4FNE A;  4JYH A;  4RZG A;  4IW8 A;  3L3X A;  4X1F A;  5AVL A;  3L03 A;  3V9T A;  2AXA A;  4MGB B;  4MG7 A;  2J14 A;  4LSJ A;  3W5T A;  3DY6 A;  3VHU A;  1K74 A;  4DMA A;  4MG8 A;  3FEI A;  1UPW A;  4QK4 A;  1X76 A;  1NQ0 A;  3FEJ A;  1R1K A;  1Z95 A;  4Q0A C;  4XI3 A;  1XDK A;  4ZNV A;  5E14 A;  2P1V A;  4QJR A;  2I4J A;  4PP3 A;  2P4Y A;  4ZNW A;  3VN2 A;  3CQV A;  5ETH A;  1ZEO A;  3VJS A;  2AA5 A;  2HAM A;  4XLD A;  4BCR A;  4LNX A;  2ABI A;  3DCU A;  4RMD A;  4OHA A;  1FD0 A;  4QL8 A;  4OKX A;  2ZLC A;  1S9P A;  3GN8 A;  2GPO A;  2POG A;  2VV1 B;  5B41 A;  5HJP B;  4XUH A;  1R5K A;  5SYZ A;  2FAI A;  4MGA A;  3AZ2 A;  4R6S A;  3ZRA A;  4OJ4 A;  3E00 D;  3PEQ A;  4IW6 A;  4M8H A;  3OLL A;  5E0W A;  2ZFX A;  4ZO1 B;  5AWJ A;  1L2J A;  2AB2 A;  5DZI A;  5E1C A;  1T7T A;  4QE8 A;  3SP9 A;  1NAX A;  5DXB B;  3RUU A;  2QR9 A;  4JYI A;  1FCZ A;  3UVV A;  4Q13 A;  3V3Q A;  4DM6 A;  4DOR A;  4NB6 A;  5JJM B;  1R6G A;  2AYR A;  1E3K A;  4X1G A;  5LGA A;  2QSE A;  5DIG A;  3RLL A;  3UUA B;  4XUM A;  3KMR A;  1X7E A;  3L1B A;  1IE8 A;  3H0A D;  5HZC A;  5LWP A;  2P7Z A;  4OED A;  2ACL B;  2PIX A;  2AX6 A;  3KYT A;  3E00 A;  2QTU A;  4IA7 A;  1XVP A;  3B66 A;  4S14 A;  1ZUC A;  3AN4 A;  5C4S A;  3A2J A;  3WTQ A;  4NY9 A;  2OCF A;  2YLP A;  1WM0 X;  3ADT A;  1RKH A;  4RUO X;  1MVC A;  4MGD B;  1T73 A;  3IPU A;  3OSI A;  4G1D A;  4OH5 A;  3RUT A;  3KDU A;  4MG9 A;  3OAP A;  2Q7K A;  4G20 A;  4JGV A;  3DZY D;  3IXP D;  3OGT A;  1EXX A;  4KZM A;  5ACC A;  3H0A A;  3OKH A;  2HC4 A;  4REE A;  2VV3 A;  4FHH A;  1T5Z A;  1ZKY A;  2AAX A;  4MG6 A;  1RDT D;  4IU7 A;  3RVF A;  3PLZ A;  3LBD A;  4DQM A;  2GP7 A;  5DP0 A;  2NXX A;  2ZNN A;  4ZI1 A;  4IQR A;  2IOK A;  3A9E B;  1ZH7 A;  2G0H A;  4OIU A;  2GIU A;  2PIR A;  5EC9 A;  3AX8 A;  5G45 A;  3DZU D;  3TKM A;  3UUC A;  4POJ A;  5APJ A;  1T74 A;  3P89 A;  5AZV A;  4OKB A;  3DZY A;  1FCY A;  2ZXZ A;  3IXP A;  2G44 A;  1UHL B;  2Q7L A;  3F5C B;  3JZC A;  5IAW A;  2ACL A;  4B7W A;  2ZL9 A;  5KRM A;  3NOA A;  1U3Q A;  4OIV A;  1XOW A;  4OFU A;  1QKU A;  1RDT A;  5DV3 A;  1NUO A;  5KCT A;  3KPZ A;  5I4V A;  5F9B A;  1YA3 A;  3UUD A;  1K4W A;  5E7V A;  5DXK A;  2AX8 A;  3OS8 A;  2XYJ A;  4RWV A;  3KFC A;  2GL8 A;  5DZH A;  2YJA B;  3B0R A;  2BAW A;  2Q6J A;  5KRA A;  4IVW A;  3VHV A;  5KRO A;  2HB8 A;  2J4A A;  3OMM A;  3AUN A;  2AMA A;  4RFW A;  3DZU A;  1XP9 A;  2ZK5 A;  3L0E A;  5HYR A;  3HM1 A;  5E15 A;  3ZQT A;  1XNN A;  2P1U A;  4MG7 B;  2AWH A;  5DKE A;  4O8F A;  2ZNO A;  1SJ0 A;  5DTV A;  3DCT A;  3B68 A;  2JF9 A;  4P6W A;  4PP5 A;  3B67 A;  4IA2 A;  5DUG A;  3X1I A;  3OLF A;  1XLS A;  4L96 A;  2P1T A;  4OZR U;  1XDK B;  4N73 A;  5DVV A;  2OVM A;  4PRG A;  4QE6 A;  2Q60 A;  5KRF A;  1T7F A;  3WWR A;  2QA8 B;  1IE9 A;  1XV9 B;  3IA6 A;  3W0J A;  3OSW A;  5E19 A;  2J7Y A;  2AA7 A;  1T63 A;  2PKL A;  1OVL A;  1PZL A;  4MGC A;  3R8A A;  2P15 A;  4NUF A;  3VTD A;  3WT7 A;  1GWQ A;  2HCD A;  2Q5G A;  3AN3 A;  3CDS A;  4OZR E;  2ZBS A;  2HB7 A;  3MNE A;  3FC6 B;  2IHQ A;  2Q6R A;  1YOK A;  4MGA B;  3VSO A;  5KRC A;  1XZX X;  4XT9 A;  3W0C A;  2YLQ A;  3ADS A;  3CS6 A;  4A4W A;  4ZJR A;  5B5B A;  3W5P A;  5KCC A;  3KDT A;  1S9Q A;  2B50 A;  2Q61 A;  2ZXN A;  3R5M A;  3D5F A;  5DWG A;  2Q8S A;  5AVI A;  4ZOM A;  3VJT A;  5KRK A;  4ZNH A;  3UVV B;  4G1Z A;  3VT6 A;  5DXM A;  3M7R A;  4OGH A;  1Y0S A;  5L7G A;  2ZNQ A;  3P88 A;  4UDA A;  5DMC A;  3A2H A;  1Y0X X;  4LBD A;  1T65 A;  1RJK A;  1S0X A;  2A3I A;  1M7W A;  1M13 A;  1U3R A;  4YPQ A;  3SP6 A;  4K7A A;  1XVP B;  4TV1 A;  3HOD A;  4YNK A;  2QA8 A;  1XV9 A;  2BJ4 A;  1QKN A;  1Y9R A;  4ZN9 A;  3UU7 B;  2HWQ A;  4OJ9 A;  3D90 A;  5EGV A;  5DV6 A;  4MG9 B;  5DZ3 A;  2EWP A;  3DR1 A;  2QXM A;  3O1E A;  4NIE A;  5JY3 A;  4E2J A;  4EMA A;  5DU5 A;  1KNU A;  3FC6 A;  4HEE X;  4WLB A;  1UOM A;  2Q1H A;  1ZDU A;  5HCV A;  1ZAF A;  5DVS A;  4UDD A;  4ZN7 A;  2VV2 A;  1ZDT A;  2IOG A;  4OFR A;  4WPF A;  3K6P A;  5L11 A;  1TXI A;  2J7X A;  3WMH A;  1X7J A;  2JFA A;  3A78 A;  4WHF A;  4J5X A;  1ERE A;  3D24 A;  4PF3 A;  3T03 A;  3TY0 A;  5DZ0 A;  2Q7J A;  5EJV A;  2QW4 A;  2ZKC A;  4WVD A;  2H77 A;  3IMY A;  1EXA A;  2AX9 A;  3CS4 A;  4PWL A;  4UDB A;  2NPA A;  1YYE A;  3ET3 A;  4N8R A;  1T79 A;  2P7G A;  3W5Q A;  3B0Q A;  3S9S A;  2QXS A;  1I38 A;  4DK7 A;  2E2R A;  3GYT A;  4CI4 A;  1N83 A;  3WGP A;  4OEY A;  2PIW A;  5FQR A;  5G43 A;  2JJ3 A;  3F7D A;  3KMZ A;  1H9U A;  1VJB A;  3V49 A;  1G1U A;  1PQ6 A;  3P8X A;  4OEA A;  4S0T A;  2PJL A;  5DX3 A;  5FQV A;  4PPP A;  1NHZ A;  3CWD A;  3Q95 A;  3UU7 A;  1PRG A;  2Q5S A;  3V9Y A;  1X7B A;  4RZE A;  1G50 A;  4XTA A;  3V3E A;  1XP1 A;  3UP3 A;  4G2H A;  4J5W C;  1SQN A;  3VT8 A;  3ET2 A;  1XNX A;  2YLY A;  4ZJW A;  3NSP A;  3OOF A;  2ZXM A;  3ADU A;  2ZK3 A;  3O1D A;  3X1H A;  2OZ7 A;  4OJB A;  2Q59 B;  5EI1 A;  1M2Z A;  2XYW A;  4ITF A;  3IPS A;  1KKQ A;  3FUR A;  4HLW A;  2ZMI A;  3W0A A;  3CTB A;  3G8O A;  5C4T A;  3HO0 A;  5AYG A;  2OM9 A;  2PIO A;  1N4H A;  3D57 A;  4DK8 A;  4ZNT A;  1OT7 A;  3B65 A;  1OSV A;  2B1Z A;  1OVL B;  2XYX A;  1YIM A;  2Q7I A;  2G0G A;  3CS8 A;  2OVH A;  3HZF A;  4IA1 A;  3KMG A;  5CJ6 A;  4ZNS A;  3G0W A;  5FQT A;  5KRI A;  4JAZ A;  3PO9 A;  5DWI A;  1BSX A;  1PDU A;  2YAT A;  1YIN A;  3U9Q A;  5C4O A;  1NQ2 A;  4FN9 A;  4J5X C;  1E3G A;  1XP6 A;  2VSR A;  3KBA A;  4ONI A;  3VHW A;  2QNV A;  4IA3 A;  3OKI A;  3R8D A;  3A3Z X;  2HBH A;  4IWF A;  3L0J A;  4G2I A;  4UDC A;  5DSH A;  2NXX E;  2AM9 A;  2AX7 A;  2I0G A;  4LTW A;  4IVY A;  4MG5 A;  2I4P A;  4L98 A;  2Q59 A;  1TFC A;  1XPC A;  1HJ1 A;  5DID A;  5DWJ A;  2HVC A;  2Q70 A;  3A2I A;  3AZ1 A;  5DXG A;  3SZ1 A;  3WT6 A;  4TV1 B;  1DKF A;  3R29 A;  4S0S A;  1T76 A;  1QKT A;  2VV4 A;  5EHJ A;  1GWR A;  2QGT A;  3FXV A;  5G44 A;  2QMV A;  4XHD A;  2BJ4 B;  4F9M A;  5KRL A;  1NQ7 A;  3IPQ A;  3ZR7 A;  4FGY A;  3L3Z A;  1YP0 A;  2R6Y A;  1A28 A;  3RLJ A;  1KV6 A;  4REF A;  2ZK1 A;  1PQC A;  4K4J A;  5KCD A;  4OKT A;  4G1Y A;  4RUP A;  4PPS A;  3G8I A;  5FQS A;  3TX7 B;  4IV4 A;  3VRU A;  2LBD A;  1U3S A;  2B1V A;  3GD2 A;  2ZK2 A;  3GBK A;  1GWX A;  1RKG A;  2JFA B;  1T7R A;  1GS4 A;  2HAR A;  2ZAS A;  1YOW A;  3HC6 A;  2I0J A;  1P93 A;  2Q3Y A;  3VT4 A;  4J26 A;  1XLS E;  3ERT A;  5L7E A;  2I4Z A;  1FM9 D;  2OAX A;  3GWS X;  3R5N A;  5DXQ A;  2H79 A;  2Q5P A;  4OH6 A;  5DRJ A;  1XQ3 A;  4E4Q A;  2GPP A;  4PLD A;  5APH A;  2O9I A;  2FVJ A;  5A86 A;  1NAV A;  1FBY A;  2V0V A;  3V9V A;  1FM6 D;  2GPU A;  3MNP A;  2ZLA A;  2Z4B A;  1P8D A;  1G5Y A;  5DVC A;  2ZMJ A;  2PIP L;  2REW A;  4XAO A;  3NSQ A;  2P54 A;  4PLE A;  2ZMH A;  3CJW A;  1I37 A;  3ADX A;  4G21 A;  4ZNU A;  2GPV A;  5DX3 B;  3L0L A;  5G42 A;  4YMQ A;  3B0W A;  2W8Y A;  3Q95 B;  3WJ4 A;  2Q1V A;  3HLV A;  3OS8 C;  3N00 A;  5GIC A;  1SKX A;  5KD9 A;  5KYJ A;  1FM9 A;  1X7R A;  1NQ1 A;  2ZK6 A;  3HVL A;  3FS1 A;  4PXM A;  3HC5 A;  3RY9 A;  3W0I A;  3DT3 A;  4P6X A;  5DUH A;  2QAB A;  5DKB A;  1FM6 A;  3D6D A;  3OOK A;  2QZO A;  4TUZ A;  5GID A;  2GWX A;  5AAV B;  2POB A;  3CDP A;  5EIT A;  3R8I A;  5KCF A;  5KCW A;  1PK5 A;  4FHI A;  5DUE A;  4NQA B;  4OZT U;  4RZF A;  3K22 A;  3HQ5 A;  4A4V A;  5DYB A;  1ILH A;  3W5R A;  3UP0 A;  5AAU A;  2PIT A;  1S19 A;  5AK2 A;  3UUD B;  2PNU A;  3E94 A;  5DLR A;  4WQP A;  4KZI A;  4K6I A;  4EM9 A;  5K13 A;  1ZGY A;  1RK3 A;  1A52 A;  2QA6 A;  4KZJ A;  3VT5 A;  2PIU A;  3WT5 A;  2XHS A;  2ZVT A;  4OZT E;  1Q4X A;  3FAL A;  2YLO A;  3ZRB A;  1PQ9 A;  3W0Y A;  5HJS A;  1NYX A;  4CSJ A;  1Z5X U;  3WFG A;  5M96 A;  4WHG A;  3WFF A;  4N5G A;  4QM0 A;  3V4A A;  4IUI A;  4RUJ A;  2O4R A;  4RE8 A;  3W0H A;  3TKC A;  1I7G A;  1R20 D;  5H1E A;  2VV0 A;  5DRM A;  2Q6S A;  3ET1 A;  4N1Y A;  4ZO1 X;  4E4K A;  1L2I A;  3B3K A;  4MGB A;  3VTC A;  1SR7 A;  3B1M A;  3K8S A;  1Z5X E;  2AA2 A;  2AMB A;  4OAR A;  1XAP A;  5DI7 A;  4IV2 A;  3VRW A;  1LV2 A;  5AAV A;  1U9E A;  1NDE A;  1FCX A;  1X78 A;  2B23 A;  2PRG A;  1DKF B;  2O4J A;  4RAK A;  3QT0 A;  1XIU A;  5G3J A;  5DV8 A;  2VV4 B;  4J24 A;  4JL4 A;  5DZ1 A;  5L7H A;  1OSH A;  3B0T A;  5G5W A;  1YJE A;  3P0U A;  2YJD A;  1R20 A;  2G5O A;  3FUG A;  4OLM A;  2HFP A;  3AUQ A;  5DL4 A;  3OZJ A;  5DMF A;  3A40 X;  3OMO A;  3PBA A;  4OKW A;  5KCU A; 
#chains in the Genus database with same CATH topology
 1YMT A;  5DKS A;  2QGW A;  2VV1 A;  1S0Z A;  5HJP A;  1HG4 A;  4RMC A;  2QH6 A;  1XJ7 A;  2Z4J A;  3OMP A;  3R2A A;  5DXP A;  5AZT A;  3GWX A;  4OC7 A;  3AFR A;  1YY4 A;  2YHD A;  5DKG A;  5JI0 D;  5KR9 A;  2P7A A;  1YUC A;  3VJH A;  4OK1 A;  3VTB A;  5ICK A;  2ZY0 A;  2AO6 A;  4OEZ A;  2FSZ A;  3OZ0 A;  4Y29 A;  5FQP A;  3W0G A;  2PIQ A;  3WJ5 A;  5DXB A;  4APU A;  3AZ3 A;  1XQC A;  1ILG A;  4PP6 A;  5DXE A;  5JJM A;  5KRH A;  2NV7 A;  2XKW A;  3FLI A;  5KCE A;  5KRJ A;  2VST A;  5DWL A;  3LMP A;  3UUA A;  2PIV A;  3GZ9 A;  1ERR A;  2R40 D;  1XB7 A;  3ADV A;  3VJI A;  1QKM A;  3G9E A;  5DWE A;  3VT3 A;  3VSP A;  3MNO A;  4S15 A;  5KYA A;  3BQD A;  1T7M A;  2ZK4 A;  3ADW A;  3X31 A;  2NW4 A;  3ILZ A;  4RME A;  2OUZ A;  2QE4 A;  2QPY A;  3H52 A;  4MGD A;  4POH A;  5DXR A;  4IS8 A;  4YT1 A;  4LNW A;  1N46 A;  1I7I A;  1PCG A;  3GYU A;  1DB1 A;  4PVU A;  3BC5 A;  4M8E A;  2YFE A;  3KWY A;  4R2U A;  2R40 A;  2ATH A;  5APK A;  2PIN A;  2QZO B;  3OMK A;  3PCU A;  4TUZ B;  5GT4 A;  4MG8 B;  5AWK A;  3CLD A;  5DY8 A;  5G46 A;  4JYG A;  2ZNP A;  3OMQ A;  1UPV A;  4R06 A;  3VI8 A;  3X36 A;  2V7C A;  5DK9 A;  5DYD A;  2F4B A;  2HAS A;  3EYB A;  3A9E A;  4CI5 A;  3ET0 A;  1G2N A;  3BEJ A;  4Q50 A;  3K23 A;  4IWC A;  3JZB A;  1MV9 A;  3VT9 A;  5DIE A;  1UHL A;  4OIL A;  3F5C A;  2AA6 A;  2HWR A;  5IXK A;  1K74 D;  1LBD A;  3VRV A;  3B5R A;  5E0X A;  3VRT A;  3FAL B;  3AUR A;  3E7C A;  4A2J A;  5HYK A;  1R1K D;  4ITE A;  1K7L A;  5GIE A;  3OS9 A;  3OLS A;  4DOS A;  3PRG A;  4DM8 A;  5C4U A;  4MDD A;  2GTK A;  1MZN A;  2ZK0 A;  3OSA A;  3VT7 A;  2R6W A;  3ERD A;  4J5W A;  5IZ0 A;  1NRL A;  4FNE A;  4JYH A;  4RZG A;  4IW8 A;  3L3X A;  4X1F A;  5AVL A;  3L03 A;  3V9T A;  2AXA A;  4MGB B;  4MG7 A;  2J14 A;  4LSJ A;  3W5T A;  3DY6 A;  3VHU A;  1K74 A;  4DMA A;  4MG8 A;  3FEI A;  1UPW A;  4QK4 A;  1X76 A;  1NQ0 A;  3FEJ A;  1R1K A;  1Z95 A;  4Q0A C;  4XI3 A;  1XDK A;  4ZNV A;  5E14 A;  2P1V A;  4QJR A;  2I4J A;  4PP3 A;  2P4Y A;  4ZNW A;  3VN2 A;  3CQV A;  5ETH A;  1ZEO A;  3VJS A;  2AA5 A;  2HAM A;  4XLD A;  4BCR A;  4LNX A;  2ABI A;  3DCU A;  4RMD A;  4OHA A;  1FD0 A;  4QL8 A;  4OKX A;  2ZLC A;  1S9P A;  3GN8 A;  2GPO A;  2POG A;  2VV1 B;  5B41 A;  5HJP B;  4XUH A;  1R5K A;  5SYZ A;  2FAI A;  4MGA A;  3AZ2 A;  4R6S A;  3ZRA A;  4OJ4 A;  3E00 D;  3PEQ A;  4IW6 A;  4M8H A;  3OLL A;  5E0W A;  2ZFX A;  4ZO1 B;  5AWJ A;  1L2J A;  2AB2 A;  5DZI A;  5E1C A;  1T7T A;  4QE8 A;  3SP9 A;  1NAX A;  5DXB B;  3RUU A;  2QR9 A;  4JYI A;  1FCZ A;  3UVV A;  4Q13 A;  3V3Q A;  4DM6 A;  4DOR A;  4NB6 A;  5JJM B;  1R6G A;  2AYR A;  1E3K A;  4X1G A;  5LGA A;  2QSE A;  5DIG A;  3RLL A;  3UUA B;  4XUM A;  3KMR A;  1X7E A;  3L1B A;  1IE8 A;  3H0A D;  5HZC A;  5LWP A;  2P7Z A;  4OED A;  2ACL B;  2PIX A;  2AX6 A;  3KYT A;  3E00 A;  2QTU A;  4IA7 A;  1XVP A;  3B66 A;  4S14 A;  1ZUC A;  3AN4 A;  5C4S A;  3A2J A;  3WTQ A;  4NY9 A;  2OCF A;  2YLP A;  1WM0 X;  3ADT A;  1RKH A;  4RUO X;  1MVC A;  4MGD B;  1T73 A;  3IPU A;  3OSI A;  4G1D A;  4OH5 A;  3RUT A;  3KDU A;  4MG9 A;  3OAP A;  2Q7K A;  4G20 A;  4JGV A;  3DZY D;  3IXP D;  3OGT A;  1EXX A;  4KZM A;  5ACC A;  3H0A A;  3OKH A;  2HC4 A;  4REE A;  2VV3 A;  4FHH A;  1T5Z A;  1ZKY A;  2AAX A;  4MG6 A;  1RDT D;  4IU7 A;  3RVF A;  3PLZ A;  3LBD A;  4DQM A;  2GP7 A;  5DP0 A;  2NXX A;  2ZNN A;  4ZI1 A;  4IQR A;  2IOK A;  3A9E B;  1ZH7 A;  2G0H A;  4OIU A;  2GIU A;  2PIR A;  5EC9 A;  3AX8 A;  5G45 A;  3DZU D;  3TKM A;  3UUC A;  4POJ A;  5APJ A;  1T74 A;  3P89 A;  5AZV A;  4OKB A;  3DZY A;  1FCY A;  2ZXZ A;  3IXP A;  2G44 A;  1UHL B;  2Q7L A;  3F5C B;  3JZC A;  5IAW A;  2ACL A;  4B7W A;  2ZL9 A;  5KRM A;  3NOA A;  1U3Q A;  4OIV A;  1XOW A;  4OFU A;  1QKU A;  1RDT A;  5DV3 A;  1NUO A;  5KCT A;  3KPZ A;  5I4V A;  5F9B A;  1YA3 A;  3UUD A;  1K4W A;  5E7V A;  5DXK A;  2AX8 A;  3OS8 A;  2XYJ A;  4RWV A;  3KFC A;  2GL8 A;  5DZH A;  2YJA B;  3B0R A;  2BAW A;  2Q6J A;  5KRA A;  4IVW A;  3VHV A;  5KRO A;  2HB8 A;  2J4A A;  3OMM A;  3AUN A;  2AMA A;  4RFW A;  3DZU A;  1XP9 A;  2ZK5 A;  3L0E A;  5HYR A;  3HM1 A;  5E15 A;  3ZQT A;  1XNN A;  2P1U A;  4MG7 B;  2AWH A;  5DKE A;  4O8F A;  2ZNO A;  1SJ0 A;  5DTV A;  3DCT A;  3B68 A;  2JF9 A;  4P6W A;  4PP5 A;  3B67 A;  4IA2 A;  5DUG A;  3X1I A;  3OLF A;  1XLS A;  4L96 A;  2P1T A;  4OZR U;  1XDK B;  4N73 A;  5DVV A;  2OVM A;  4PRG A;  4QE6 A;  2Q60 A;  5KRF A;  1T7F A;  3WWR A;  2QA8 B;  1IE9 A;  1XV9 B;  3IA6 A;  3W0J A;  3OSW A;  5E19 A;  2J7Y A;  2AA7 A;  1T63 A;  2PKL A;  1OVL A;  1PZL A;  4MGC A;  3R8A A;  2P15 A;  4NUF A;  3VTD A;  3WT7 A;  1GWQ A;  2HCD A;  2Q5G A;  3AN3 A;  3CDS A;  4OZR E;  2ZBS A;  2HB7 A;  3MNE A;  3FC6 B;  2IHQ A;  2Q6R A;  1YOK A;  4MGA B;  3VSO A;  5KRC A;  1XZX X;  4XT9 A;  3W0C A;  2YLQ A;  3ADS A;  3CS6 A;  4A4W A;  4ZJR A;  5B5B A;  3W5P A;  5KCC A;  3KDT A;  1S9Q A;  2B50 A;  2Q61 A;  2ZXN A;  3R5M A;  3D5F A;  5DWG A;  2Q8S A;  5AVI A;  4ZOM A;  3VJT A;  5KRK A;  4ZNH A;  3UVV B;  4G1Z A;  3VT6 A;  5DXM A;  3M7R A;  4OGH A;  1Y0S A;  5L7G A;  2ZNQ A;  3P88 A;  4UDA A;  5DMC A;  3A2H A;  1Y0X X;  4LBD A;  1T65 A;  1RJK A;  1S0X A;  2A3I A;  1M7W A;  1M13 A;  1U3R A;  4YPQ A;  3SP6 A;  4K7A A;  1XVP B;  4TV1 A;  3HOD A;  4YNK A;  2QA8 A;  1XV9 A;  2BJ4 A;  1QKN A;  1Y9R A;  4ZN9 A;  3UU7 B;  2HWQ A;  4OJ9 A;  3D90 A;  5EGV A;  5DV6 A;  4MG9 B;  5DZ3 A;  2EWP A;  3DR1 A;  2QXM A;  3O1E A;  4NIE A;  5JY3 A;  4E2J A;  4EMA A;  5DU5 A;  1KNU A;  3FC6 A;  4HEE X;  4WLB A;  1UOM A;  2Q1H A;  1ZDU A;  5HCV A;  1ZAF A;  5DVS A;  4UDD A;  4ZN7 A;  2VV2 A;  1ZDT A;  2IOG A;  4OFR A;  4WPF A;  3K6P A;  5L11 A;  1TXI A;  2J7X A;  3WMH A;  1X7J A;  2JFA A;  3A78 A;  4WHF A;  4J5X A;  1ERE A;  3D24 A;  4PF3 A;  3T03 A;  3TY0 A;  5DZ0 A;  2Q7J A;  5EJV A;  2QW4 A;  2ZKC A;  4WVD A;  2H77 A;  3IMY A;  1EXA A;  2AX9 A;  3CS4 A;  4PWL A;  4UDB A;  2NPA A;  1YYE A;  3ET3 A;  4N8R A;  1T79 A;  2P7G A;  3W5Q A;  3B0Q A;  3S9S A;  2QXS A;  1I38 A;  4DK7 A;  2E2R A;  3GYT A;  4CI4 A;  1N83 A;  3WGP A;  4OEY A;  2PIW A;  5FQR A;  5G43 A;  2JJ3 A;  3F7D A;  3KMZ A;  1H9U A;  1VJB A;  3V49 A;  1G1U A;  1PQ6 A;  3P8X A;  4OEA A;  4S0T A;  2PJL A;  5DX3 A;  5FQV A;  4PPP A;  1NHZ A;  3CWD A;  3Q95 A;  3UU7 A;  1PRG A;  2Q5S A;  3V9Y A;  1X7B A;  4RZE A;  1G50 A;  4XTA A;  3V3E A;  1XP1 A;  3UP3 A;  4G2H A;  4J5W C;  1SQN A;  3VT8 A;  3ET2 A;  1XNX A;  2YLY A;  4ZJW A;  3NSP A;  3OOF A;  2ZXM A;  3ADU A;  2ZK3 A;  3O1D A;  3X1H A;  2OZ7 A;  4OJB A;  2Q59 B;  5EI1 A;  1M2Z A;  2XYW A;  4ITF A;  3IPS A;  1KKQ A;  3FUR A;  4HLW A;  2ZMI A;  3W0A A;  3CTB A;  3G8O A;  5C4T A;  3HO0 A;  5AYG A;  2OM9 A;  2PIO A;  1N4H A;  3D57 A;  4DK8 A;  4ZNT A;  1OT7 A;  3B65 A;  1OSV A;  2B1Z A;  1OVL B;  2XYX A;  1YIM A;  2Q7I A;  2G0G A;  3CS8 A;  2OVH A;  3HZF A;  4IA1 A;  3KMG A;  5CJ6 A;  4ZNS A;  3G0W A;  5FQT A;  5KRI A;  4JAZ A;  3PO9 A;  5DWI A;  1BSX A;  1PDU A;  2YAT A;  1YIN A;  3U9Q A;  5C4O A;  1NQ2 A;  4FN9 A;  4J5X C;  1E3G A;  1XP6 A;  2VSR A;  3KBA A;  4ONI A;  3VHW A;  2QNV A;  4IA3 A;  3OKI A;  3R8D A;  3A3Z X;  2HBH A;  4IWF A;  3L0J A;  4G2I A;  4UDC A;  5DSH A;  2NXX E;  2AM9 A;  2AX7 A;  2I0G A;  4LTW A;  4IVY A;  4MG5 A;  2I4P A;  4L98 A;  2Q59 A;  1TFC A;  1XPC A;  1HJ1 A;  5DID A;  5DWJ A;  2HVC A;  2Q70 A;  3A2I A;  3AZ1 A;  5DXG A;  3SZ1 A;  3WT6 A;  4TV1 B;  1DKF A;  3R29 A;  4S0S A;  1T76 A;  1QKT A;  2VV4 A;  5EHJ A;  1GWR A;  2QGT A;  3FXV A;  5G44 A;  2QMV A;  4XHD A;  2BJ4 B;  4F9M A;  5KRL A;  1NQ7 A;  3IPQ A;  3ZR7 A;  4FGY A;  3L3Z A;  1YP0 A;  2R6Y A;  1A28 A;  3RLJ A;  1KV6 A;  4REF A;  2ZK1 A;  1PQC A;  4K4J A;  5KCD A;  4OKT A;  4G1Y A;  4RUP A;  4PPS A;  3G8I A;  5FQS A;  3TX7 B;  4IV4 A;  3VRU A;  2LBD A;  1U3S A;  2B1V A;  3GD2 A;  2ZK2 A;  3GBK A;  1GWX A;  1RKG A;  2JFA B;  1T7R A;  1GS4 A;  2HAR A;  2ZAS A;  1YOW A;  3HC6 A;  2I0J A;  1P93 A;  2Q3Y A;  3VT4 A;  4J26 A;  1XLS E;  3ERT A;  5L7E A;  2I4Z A;  1FM9 D;  2OAX A;  3GWS X;  3R5N A;  5DXQ A;  2H79 A;  2Q5P A;  4OH6 A;  5DRJ A;  1XQ3 A;  4E4Q A;  2GPP A;  4PLD A;  5APH A;  2O9I A;  2FVJ A;  5A86 A;  1NAV A;  1FBY A;  2V0V A;  3V9V A;  1FM6 D;  2GPU A;  3MNP A;  2ZLA A;  2Z4B A;  1P8D A;  1G5Y A;  5DVC A;  2ZMJ A;  2PIP L;  2REW A;  4XAO A;  3NSQ A;  2P54 A;  4PLE A;  2ZMH A;  3CJW A;  1I37 A;  3ADX A;  4G21 A;  4ZNU A;  2GPV A;  5DX3 B;  3L0L A;  5G42 A;  4YMQ A;  3B0W A;  2W8Y A;  3Q95 B;  3WJ4 A;  2Q1V A;  3HLV A;  3OS8 C;  3N00 A;  5GIC A;  1SKX A;  5KD9 A;  5KYJ A;  1FM9 A;  1X7R A;  1NQ1 A;  2ZK6 A;  3HVL A;  3FS1 A;  4PXM A;  3HC5 A;  3RY9 A;  3W0I A;  3DT3 A;  4P6X A;  5DUH A;  2QAB A;  5DKB A;  1FM6 A;  3D6D A;  3OOK A;  2QZO A;  4TUZ A;  5GID A;  2GWX A;  5AAV B;  2POB A;  3CDP A;  5EIT A;  3R8I A;  5KCF A;  5KCW A;  1PK5 A;  4FHI A;  5DUE A;  4NQA B;  4OZT U;  4RZF A;  3K22 A;  3HQ5 A;  4A4V A;  5DYB A;  1ILH A;  3W5R A;  3UP0 A;  5AAU A;  2PIT A;  1S19 A;  5AK2 A;  3UUD B;  2PNU A;  3E94 A;  5DLR A;  4WQP A;  4KZI A;  4K6I A;  4EM9 A;  5K13 A;  1ZGY A;  1RK3 A;  1A52 A;  2QA6 A;  4KZJ A;  3VT5 A;  2PIU A;  3WT5 A;  2XHS A;  2ZVT A;  4OZT E;  1Q4X A;  3FAL A;  2YLO A;  3ZRB A;  1PQ9 A;  3W0Y A;  5HJS A;  1NYX A;  4CSJ A;  1Z5X U;  3WFG A;  5M96 A;  4WHG A;  3WFF A;  4N5G A;  4QM0 A;  3V4A A;  4IUI A;  4RUJ A;  2O4R A;  4RE8 A;  3W0H A;  3TKC A;  1I7G A;  1R20 D;  5H1E A;  2VV0 A;  5DRM A;  2Q6S A;  3ET1 A;  4N1Y A;  4ZO1 X;  4E4K A;  1L2I A;  3B3K A;  4MGB A;  3VTC A;  1SR7 A;  3B1M A;  3K8S A;  1Z5X E;  2AA2 A;  2AMB A;  4OAR A;  1XAP A;  5DI7 A;  4IV2 A;  3VRW A;  1LV2 A;  5AAV A;  1U9E A;  1NDE A;  1FCX A;  1X78 A;  2B23 A;  2PRG A;  1DKF B;  2O4J A;  4RAK A;  3QT0 A;  1XIU A;  5G3J A;  5DV8 A;  2VV4 B;  4J24 A;  4JL4 A;  5DZ1 A;  5L7H A;  1OSH A;  3B0T A;  5G5W A;  1YJE A;  3P0U A;  2YJD A;  1R20 A;  2G5O A;  3FUG A;  4OLM A;  2HFP A;  3AUQ A;  5DL4 A;  3OZJ A;  5DMF A;  3A40 X;  3OMO A;  3PBA A;  4OKW A;  5KCU A; 
#chains in the Genus database with same CATH homology
 1YMT A;  5DKS A;  2QGW A;  2VV1 A;  1S0Z A;  5HJP A;  1HG4 A;  4RMC A;  2QH6 A;  1XJ7 A;  2Z4J A;  3OMP A;  3R2A A;  5DXP A;  5AZT A;  3GWX A;  4OC7 A;  3AFR A;  1YY4 A;  2YHD A;  5DKG A;  5JI0 D;  5KR9 A;  2P7A A;  1YUC A;  3VJH A;  4OK1 A;  3VTB A;  5ICK A;  2ZY0 A;  2AO6 A;  4OEZ A;  2FSZ A;  3OZ0 A;  4Y29 A;  5FQP A;  3W0G A;  2PIQ A;  3WJ5 A;  5DXB A;  4APU A;  3AZ3 A;  1XQC A;  1ILG A;  4PP6 A;  5DXE A;  5JJM A;  5KRH A;  2NV7 A;  2XKW A;  3FLI A;  5KCE A;  5KRJ A;  2VST A;  5DWL A;  3LMP A;  3UUA A;  2PIV A;  3GZ9 A;  1ERR A;  2R40 D;  1XB7 A;  3ADV A;  3VJI A;  1QKM A;  3G9E A;  5DWE A;  3VT3 A;  3VSP A;  3MNO A;  4S15 A;  5KYA A;  3BQD A;  1T7M A;  2ZK4 A;  3ADW A;  3X31 A;  2NW4 A;  3ILZ A;  4RME A;  2OUZ A;  2QE4 A;  2QPY A;  3H52 A;  4MGD A;  4POH A;  5DXR A;  4IS8 A;  4YT1 A;  4LNW A;  1N46 A;  1I7I A;  1PCG A;  3GYU A;  1DB1 A;  4PVU A;  3BC5 A;  4M8E A;  2YFE A;  3KWY A;  4R2U A;  2R40 A;  2ATH A;  5APK A;  2PIN A;  2QZO B;  3OMK A;  3PCU A;  4TUZ B;  5GT4 A;  4MG8 B;  5AWK A;  3CLD A;  5DY8 A;  5G46 A;  4JYG A;  2ZNP A;  3OMQ A;  1UPV A;  4R06 A;  3VI8 A;  3X36 A;  2V7C A;  5DK9 A;  5DYD A;  2F4B A;  2HAS A;  3EYB A;  3A9E A;  4CI5 A;  3ET0 A;  1G2N A;  3BEJ A;  4Q50 A;  3K23 A;  4IWC A;  3JZB A;  1MV9 A;  3VT9 A;  5DIE A;  1UHL A;  4OIL A;  3F5C A;  2AA6 A;  2HWR A;  5IXK A;  1K74 D;  1LBD A;  3VRV A;  3B5R A;  5E0X A;  3VRT A;  3FAL B;  3AUR A;  3E7C A;  4A2J A;  5HYK A;  1R1K D;  4ITE A;  1K7L A;  5GIE A;  3OS9 A;  3OLS A;  4DOS A;  3PRG A;  4DM8 A;  5C4U A;  4MDD A;  2GTK A;  1MZN A;  2ZK0 A;  3OSA A;  3VT7 A;  2R6W A;  3ERD A;  4J5W A;  5IZ0 A;  1NRL A;  4FNE A;  4JYH A;  4RZG A;  4IW8 A;  3L3X A;  4X1F A;  5AVL A;  3L03 A;  3V9T A;  2AXA A;  4MGB B;  4MG7 A;  2J14 A;  4LSJ A;  3W5T A;  3DY6 A;  3VHU A;  1K74 A;  4DMA A;  4MG8 A;  3FEI A;  1UPW A;  4QK4 A;  1X76 A;  1NQ0 A;  3FEJ A;  1R1K A;  1Z95 A;  4Q0A C;  4XI3 A;  1XDK A;  4ZNV A;  5E14 A;  2P1V A;  4QJR A;  2I4J A;  4PP3 A;  2P4Y A;  4ZNW A;  3VN2 A;  3CQV A;  5ETH A;  1ZEO A;  3VJS A;  2AA5 A;  2HAM A;  4XLD A;  4BCR A;  4LNX A;  2ABI A;  3DCU A;  4RMD A;  4OHA A;  1FD0 A;  4QL8 A;  4OKX A;  2ZLC A;  1S9P A;  3GN8 A;  2GPO A;  2POG A;  2VV1 B;  5B41 A;  5HJP B;  4XUH A;  1R5K A;  5SYZ A;  2FAI A;  4MGA A;  3AZ2 A;  4R6S A;  3ZRA A;  4OJ4 A;  3E00 D;  3PEQ A;  4IW6 A;  4M8H A;  3OLL A;  5E0W A;  2ZFX A;  4ZO1 B;  5AWJ A;  1L2J A;  2AB2 A;  5DZI A;  5E1C A;  1T7T A;  4QE8 A;  3SP9 A;  1NAX A;  5DXB B;  3RUU A;  2QR9 A;  4JYI A;  1FCZ A;  3UVV A;  4Q13 A;  3V3Q A;  4DM6 A;  4DOR A;  4NB6 A;  5JJM B;  1R6G A;  2AYR A;  1E3K A;  4X1G A;  5LGA A;  2QSE A;  5DIG A;  3RLL A;  3UUA B;  4XUM A;  3KMR A;  1X7E A;  3L1B A;  1IE8 A;  3H0A D;  5HZC A;  5LWP A;  2P7Z A;  4OED A;  2ACL B;  2PIX A;  2AX6 A;  3KYT A;  3E00 A;  2QTU A;  4IA7 A;  1XVP A;  3B66 A;  4S14 A;  1ZUC A;  3AN4 A;  5C4S A;  3A2J A;  3WTQ A;  4NY9 A;  2OCF A;  2YLP A;  1WM0 X;  3ADT A;  1RKH A;  4RUO X;  1MVC A;  4MGD B;  1T73 A;  3IPU A;  3OSI A;  4G1D A;  4OH5 A;  3RUT A;  3KDU A;  4MG9 A;  3OAP A;  2Q7K A;  4G20 A;  4JGV A;  3DZY D;  3IXP D;  3OGT A;  1EXX A;  4KZM A;  5ACC A;  3H0A A;  3OKH A;  2HC4 A;  4REE A;  2VV3 A;  4FHH A;  1T5Z A;  1ZKY A;  2AAX A;  4MG6 A;  1RDT D;  4IU7 A;  3RVF A;  3PLZ A;  3LBD A;  4DQM A;  2GP7 A;  5DP0 A;  2NXX A;  2ZNN A;  4ZI1 A;  4IQR A;  2IOK A;  3A9E B;  1ZH7 A;  2G0H A;  4OIU A;  2GIU A;  2PIR A;  5EC9 A;  3AX8 A;  5G45 A;  3DZU D;  3TKM A;  3UUC A;  4POJ A;  5APJ A;  1T74 A;  3P89 A;  5AZV A;  4OKB A;  3DZY A;  1FCY A;  2ZXZ A;  3IXP A;  2G44 A;  1UHL B;  2Q7L A;  3F5C B;  3JZC A;  5IAW A;  2ACL A;  4B7W A;  2ZL9 A;  5KRM A;  3NOA A;  1U3Q A;  4OIV A;  1XOW A;  4OFU A;  1QKU A;  1RDT A;  5DV3 A;  1NUO A;  5KCT A;  3KPZ A;  5I4V A;  5F9B A;  1YA3 A;  3UUD A;  1K4W A;  5E7V A;  5DXK A;  2AX8 A;  3OS8 A;  2XYJ A;  4RWV A;  3KFC A;  2GL8 A;  5DZH A;  2YJA B;  3B0R A;  2BAW A;  2Q6J A;  5KRA A;  4IVW A;  3VHV A;  5KRO A;  2HB8 A;  2J4A A;  3OMM A;  3AUN A;  2AMA A;  4RFW A;  3DZU A;  1XP9 A;  2ZK5 A;  3L0E A;  5HYR A;  3HM1 A;  5E15 A;  3ZQT A;  1XNN A;  2P1U A;  4MG7 B;  2AWH A;  5DKE A;  4O8F A;  2ZNO A;  1SJ0 A;  5DTV A;  3DCT A;  3B68 A;  2JF9 A;  4P6W A;  4PP5 A;  3B67 A;  4IA2 A;  5DUG A;  3X1I A;  3OLF A;  1XLS A;  4L96 A;  2P1T A;  4OZR U;  1XDK B;  4N73 A;  5DVV A;  2OVM A;  4PRG A;  4QE6 A;  2Q60 A;  5KRF A;  1T7F A;  3WWR A;  2QA8 B;  1IE9 A;  1XV9 B;  3IA6 A;  3W0J A;  3OSW A;  5E19 A;  2J7Y A;  2AA7 A;  1T63 A;  2PKL A;  1OVL A;  1PZL A;  4MGC A;  3R8A A;  2P15 A;  4NUF A;  3VTD A;  3WT7 A;  1GWQ A;  2HCD A;  2Q5G A;  3AN3 A;  3CDS A;  4OZR E;  2ZBS A;  2HB7 A;  3MNE A;  3FC6 B;  2IHQ A;  2Q6R A;  1YOK A;  4MGA B;  3VSO A;  5KRC A;  1XZX X;  4XT9 A;  3W0C A;  2YLQ A;  3ADS A;  3CS6 A;  4A4W A;  4ZJR A;  5B5B A;  3W5P A;  5KCC A;  3KDT A;  1S9Q A;  2B50 A;  2Q61 A;  2ZXN A;  3R5M A;  3D5F A;  5DWG A;  2Q8S A;  5AVI A;  4ZOM A;  3VJT A;  5KRK A;  4ZNH A;  3UVV B;  4G1Z A;  3VT6 A;  5DXM A;  3M7R A;  4OGH A;  1Y0S A;  5L7G A;  2ZNQ A;  3P88 A;  4UDA A;  5DMC A;  3A2H A;  1Y0X X;  4LBD A;  1T65 A;  1RJK A;  1S0X A;  2A3I A;  1M7W A;  1M13 A;  1U3R A;  4YPQ A;  3SP6 A;  4K7A A;  1XVP B;  4TV1 A;  3HOD A;  4YNK A;  2QA8 A;  1XV9 A;  2BJ4 A;  1QKN A;  1Y9R A;  4ZN9 A;  3UU7 B;  2HWQ A;  4OJ9 A;  3D90 A;  5EGV A;  5DV6 A;  4MG9 B;  5DZ3 A;  2EWP A;  3DR1 A;  2QXM A;  3O1E A;  4NIE A;  5JY3 A;  4E2J A;  4EMA A;  5DU5 A;  1KNU A;  3FC6 A;  4HEE X;  4WLB A;  1UOM A;  2Q1H A;  1ZDU A;  5HCV A;  1ZAF A;  5DVS A;  4UDD A;  4ZN7 A;  2VV2 A;  1ZDT A;  2IOG A;  4OFR A;  4WPF A;  3K6P A;  5L11 A;  1TXI A;  2J7X A;  3WMH A;  1X7J A;  2JFA A;  3A78 A;  4WHF A;  4J5X A;  1ERE A;  3D24 A;  4PF3 A;  3T03 A;  3TY0 A;  5DZ0 A;  2Q7J A;  5EJV A;  2QW4 A;  2ZKC A;  4WVD A;  2H77 A;  3IMY A;  1EXA A;  2AX9 A;  3CS4 A;  4PWL A;  4UDB A;  2NPA A;  1YYE A;  3ET3 A;  4N8R A;  1T79 A;  2P7G A;  3W5Q A;  3B0Q A;  3S9S A;  2QXS A;  1I38 A;  4DK7 A;  2E2R A;  3GYT A;  4CI4 A;  1N83 A;  3WGP A;  4OEY A;  2PIW A;  5FQR A;  5G43 A;  2JJ3 A;  3F7D A;  3KMZ A;  1H9U A;  1VJB A;  3V49 A;  1G1U A;  1PQ6 A;  3P8X A;  4OEA A;  4S0T A;  2PJL A;  5DX3 A;  5FQV A;  4PPP A;  1NHZ A;  3CWD A;  3Q95 A;  3UU7 A;  1PRG A;  2Q5S A;  3V9Y A;  1X7B A;  4RZE A;  1G50 A;  4XTA A;  3V3E A;  1XP1 A;  3UP3 A;  4G2H A;  4J5W C;  1SQN A;  3VT8 A;  3ET2 A;  1XNX A;  2YLY A;  4ZJW A;  3NSP A;  3OOF A;  2ZXM A;  3ADU A;  2ZK3 A;  3O1D A;  3X1H A;  2OZ7 A;  4OJB A;  2Q59 B;  5EI1 A;  1M2Z A;  2XYW A;  4ITF A;  3IPS A;  1KKQ A;  3FUR A;  4HLW A;  2ZMI A;  3W0A A;  3CTB A;  3G8O A;  5C4T A;  3HO0 A;  5AYG A;  2OM9 A;  2PIO A;  1N4H A;  3D57 A;  4DK8 A;  4ZNT A;  1OT7 A;  3B65 A;  1OSV A;  2B1Z A;  1OVL B;  2XYX A;  1YIM A;  2Q7I A;  2G0G A;  3CS8 A;  2OVH A;  3HZF A;  4IA1 A;  3KMG A;  5CJ6 A;  4ZNS A;  3G0W A;  5FQT A;  5KRI A;  4JAZ A;  3PO9 A;  5DWI A;  1BSX A;  1PDU A;  2YAT A;  1YIN A;  3U9Q A;  5C4O A;  1NQ2 A;  4FN9 A;  4J5X C;  1E3G A;  1XP6 A;  2VSR A;  3KBA A;  4ONI A;  3VHW A;  2QNV A;  4IA3 A;  3OKI A;  3R8D A;  3A3Z X;  2HBH A;  4IWF A;  3L0J A;  4G2I A;  4UDC A;  5DSH A;  2NXX E;  2AM9 A;  2AX7 A;  2I0G A;  4LTW A;  4IVY A;  4MG5 A;  2I4P A;  4L98 A;  2Q59 A;  1TFC A;  1XPC A;  1HJ1 A;  5DID A;  5DWJ A;  2HVC A;  2Q70 A;  3A2I A;  3AZ1 A;  5DXG A;  3SZ1 A;  3WT6 A;  4TV1 B;  1DKF A;  3R29 A;  4S0S A;  1T76 A;  1QKT A;  2VV4 A;  5EHJ A;  1GWR A;  2QGT A;  3FXV A;  5G44 A;  2QMV A;  4XHD A;  2BJ4 B;  4F9M A;  5KRL A;  1NQ7 A;  3IPQ A;  3ZR7 A;  4FGY A;  3L3Z A;  1YP0 A;  2R6Y A;  1A28 A;  3RLJ A;  1KV6 A;  4REF A;  2ZK1 A;  1PQC A;  4K4J A;  5KCD A;  4OKT A;  4G1Y A;  4RUP A;  4PPS A;  3G8I A;  5FQS A;  3TX7 B;  4IV4 A;  3VRU A;  2LBD A;  1U3S A;  2B1V A;  3GD2 A;  2ZK2 A;  3GBK A;  1GWX A;  1RKG A;  2JFA B;  1T7R A;  1GS4 A;  2HAR A;  2ZAS A;  1YOW A;  3HC6 A;  2I0J A;  1P93 A;  2Q3Y A;  3VT4 A;  4J26 A;  1XLS E;  3ERT A;  5L7E A;  2I4Z A;  1FM9 D;  2OAX A;  3GWS X;  3R5N A;  5DXQ A;  2H79 A;  2Q5P A;  4OH6 A;  5DRJ A;  1XQ3 A;  4E4Q A;  2GPP A;  4PLD A;  5APH A;  2O9I A;  2FVJ A;  5A86 A;  1NAV A;  1FBY A;  2V0V A;  3V9V A;  1FM6 D;  2GPU A;  3MNP A;  2ZLA A;  2Z4B A;  1P8D A;  1G5Y A;  5DVC A;  2ZMJ A;  2PIP L;  2REW A;  4XAO A;  3NSQ A;  2P54 A;  4PLE A;  2ZMH A;  3CJW A;  1I37 A;  3ADX A;  4G21 A;  4ZNU A;  2GPV A;  5DX3 B;  3L0L A;  5G42 A;  4YMQ A;  3B0W A;  2W8Y A;  3Q95 B;  3WJ4 A;  2Q1V A;  3HLV A;  3OS8 C;  3N00 A;  5GIC A;  1SKX A;  5KD9 A;  5KYJ A;  1FM9 A;  1X7R A;  1NQ1 A;  2ZK6 A;  3HVL A;  3FS1 A;  4PXM A;  3HC5 A;  3RY9 A;  3W0I A;  3DT3 A;  4P6X A;  5DUH A;  2QAB A;  5DKB A;  1FM6 A;  3D6D A;  3OOK A;  2QZO A;  4TUZ A;  5GID A;  2GWX A;  5AAV B;  2POB A;  3CDP A;  5EIT A;  3R8I A;  5KCF A;  5KCW A;  1PK5 A;  4FHI A;  5DUE A;  4NQA B;  4OZT U;  4RZF A;  3K22 A;  3HQ5 A;  4A4V A;  5DYB A;  1ILH A;  3W5R A;  3UP0 A;  5AAU A;  2PIT A;  1S19 A;  5AK2 A;  3UUD B;  2PNU A;  3E94 A;  5DLR A;  4WQP A;  4KZI A;  4K6I A;  4EM9 A;  5K13 A;  1ZGY A;  1RK3 A;  1A52 A;  2QA6 A;  4KZJ A;  3VT5 A;  2PIU A;  3WT5 A;  2XHS A;  2ZVT A;  4OZT E;  1Q4X A;  3FAL A;  2YLO A;  3ZRB A;  1PQ9 A;  3W0Y A;  5HJS A;  1NYX A;  4CSJ A;  1Z5X U;  3WFG A;  5M96 A;  4WHG A;  3WFF A;  4N5G A;  4QM0 A;  3V4A A;  4IUI A;  4RUJ A;  2O4R A;  4RE8 A;  3W0H A;  3TKC A;  1I7G A;  1R20 D;  5H1E A;  2VV0 A;  5DRM A;  2Q6S A;  3ET1 A;  4N1Y A;  4ZO1 X;  4E4K A;  1L2I A;  3B3K A;  4MGB A;  3VTC A;  1SR7 A;  3B1M A;  3K8S A;  1Z5X E;  2AA2 A;  2AMB A;  4OAR A;  1XAP A;  5DI7 A;  4IV2 A;  3VRW A;  1LV2 A;  5AAV A;  1U9E A;  1NDE A;  1FCX A;  1X78 A;  2B23 A;  2PRG A;  1DKF B;  2O4J A;  4RAK A;  3QT0 A;  1XIU A;  5G3J A;  5DV8 A;  2VV4 B;  4J24 A;  4JL4 A;  5DZ1 A;  5L7H A;  1OSH A;  3B0T A;  5G5W A;  1YJE A;  3P0U A;  2YJD A;  1R20 A;  2G5O A;  3FUG A;  4OLM A;  2HFP A;  3AUQ A;  5DL4 A;  3OZJ A;  5DMF A;  3A40 X;  3OMO A;  3PBA A;  4OKW A;  5KCU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...