4DM6A

Crystal structure of rarb lbd homodimer in complex with ttnpb
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
240
structure length
240
Chain Sequence
ESYEMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for a molecular allosteric control mechanism of cofactor binding to nuclear receptors.
pubmed doi rcsb
molecule keywords Retinoic acid receptor beta
molecule tags Transcription/protein binding
source organism Homo sapiens
total genus 93
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 4dm6A00
2QTUA 3CS6A 3WT5A 2XYWA 4EM9A 1T65A 3NOAA 1NQ0A 3ADSA 4MG6A 5ICKA 1ZDTA 5ACCA 1U3RA 2QXSA 3ADXA 1NAVA 2H79A 2IOGA 4OJBA 2Q70A 3BC5A 1X7BA 3X1IA 5DKBA 3B5RA 3AZ2A 3ET3A 1UPVA 4N5GA 2B1ZA 5HJPA 1YOWA 4MDDA 5DUEA 4ITFA 3B67A 2ZNPA 2Q3YA 2HB7A 2AX6A 1OT7A 5DI7A 1RDTA 4J5XA 3UUCA 4Q0AC 3L0EA 2YATA 2ZMHA 4OARA 4IA7A 4DM6A 5AZVA 3F7DA 5DV6A 3KMRA 3WWRA 1X76A 1XV9B 3K22A 1ZAFA 1T79A 3R5NA 2G5OA 4TV1A 3VT5A 4OZRE 3WT6A 2ZK6A 5DUGA 5DVVA 2OUZA 4XT9A 2XYXA 2P1VA 4RUOX 2VV2A 2AB2A 2GPVA 5DWJA 5LGAA 1Y9RA 3MNPA 1I37A 4WLBA 3UUAB 1T63A 5DX3A 1N83A 1S0XA 4HEEX 4WHGA 1GWQA 1S9QA 2XKWA 1E3GA 2Q6JA 4PLEA 3R5MA 3ET0A 5DKEA 2AA2A 4PP3A 4DK7A 4ZNSA 5KCEA 4XLDA 5DMFA 2AMAA 1PQ6A 5ETHA 4MG9A 3D6DA 5DXBB 3OOFA 3KMZA 5DU5A 2PIRA 3PRGA 1MV9A 2B50A 2QZOA 1QKNA 5KROA 1A52A 4MG7A 4A4VA 3IPSA 2Q7IA 4ZO1B 2ZASA 4DOSA 4OKTA 2YLQA 2ZMJA 1DKFB 4Q50A 2Q1HA 4FHHA 4IW6A 3RLJA 4BCRA 3CDSA 2PIPL 2ZBSA 2QA8B 3K6PA 5DV8A 1K74D 1M7WA 1IE8A 4REFA 1M13A 1NQ1A 1UPWA 1XLSA 2ZNNA 4ZNHA 2QH6A 2VV4A 3FEJA 4ZI1A 4ZJRA 1YJEA 4XTAA 4OKXA 5DZIA 2FVJA 4IV4A 4K4JA 2ACLA 1OSHA 1R6GA 1G50A 4QE6A 3VRWA 2REWA 5EI1A 4J24A 3OLLA 3T03A 3Q95A 1XNNA 1XAPA 2G0HA 2AA7A 2PITA 2PKLA 1NQ2A 4RWVA 4UDAA 3B0RA 5M96A 3OSAA 5DZ3A 2YJDA 2R40A 3A2HA 4ZN9A 3E00D 3OMOA 3ET1A 4XUMA 5AZTA 4IVYA 5AAVA 3VN2A 4G2HA 4R06A 2Q1VA 1L2IA 2ZXNA 1LV2A 3FALB 4RUPA 2VV3A 5DSHA 3AUQA 5G45A 1FM9A 1PK5A 1T76A 3WFFA 3OKHA 4J5WA 4LNWA 2QABA 4WHFA 1NUOA 2AXAA 1SKXA 2QA6A 2R6YA 3P89A 4R6SA 5KCDA 2W8YA 4MGBB 5JY3A 3KMGA 4RMDA 1SJ0A 3A2IA 2PIUA 1PRGA 1ILGA 2A3IA 4JYHA 4Q13A 4S15A 5DV3A 2Q7LA 3B0WA 4TUZB 2AMBA 4X1FA 3P0UA 4KZMA 4G20A 4G21A 4RE8A 3VT4A 1X7JA 2P54A 1U3SA 1R1KD 2ZNOA 3CTBA 3GYTA 4PVUA 2QSEA 1G1UA 2YLOA 3MNEA 1OVLB 2QNVA 1G2NA 3FUGA 4OEZA 3DZUA 3GN8A 4IWCA 2QW4A 3JZCA 5F9BA 1N46A 3VSOA 5KD9A 5C4UA 3B66A 5DIGA 1NAXA 3HZFA 3WMHA 3HM1A 1XDKB 1XLSE 2J7YA 3VRUA 3ZRAA 3L3XA 3OMKA 5DWIA 1U9EA 5DXQA 5G5WA 3DY6A 2JJ3A 1PDUA 3HODA 5JI0D 1T74A 3V49A 1Z95A 5G46A 5HYRA 4RZFA 3VT8A 5DRJA 5DXGA 3W5PA 2G0GA 1I38A 5GIDA 3IXPA 3UVVB 1XQ3A 3KDUA 5KCTA 3R2AA 2AO6A 4NUFA 3UUDB 2ZK2A 1PCGA 3HQ5A 2OM9A 2P7ZA 2J7XA 4UDDA 3VT9A 2NPAA 2NW4A 3A9EB 4Y29A 4YT1A 4G1ZA 2AAXA 5E1CA 5DXEA 5SYZA 3U9QA 4POJA 3F5CB 1XV9A 4WQPA 2YLYA 1OSVA 4RMCA 2IOKA 5H1EA 3VSPA 4FGYA 4E4KA 5KCUA 3AZ3A 4OC7A 1YYEA 3PO9A 5EITA 4IQRA 3UUAA 5AK2A 1XNXA 5KRKA 3K23A 3WT7A 2HARA 4K7AA 2OAXA 5DYDA 2P15A 5DZHA 3TKCA 4PPSA 4WPFA 5KRAA 2HAMA 4CI5A 3OMPA 1FCYA 5KRIA 3CS4A 3GD2A 3NSQA 2ZK4A 3VJHA 1ZUCA 5DXBA 5GT4A 5HCVA 2I4JA 2B23A 4PRGA 4XUHA 4ZNWA 1KV6A 2ZL9A 4PPPA 2VV1B 2Z4JA 3UU7B 2AX9A 4OH6A 3X36A 4A2JA 4PWLA 3RUTA 1DKFA 2YHDA 1UOMA 4XAOA 4UDCA 5DIEA 2Q6SA 4ITEA 2QA8A 5G43A 1X7EA 1U3QA 2AA6A 3TY0A 5KYJA 5DWLA 2ZXMA 1YOKA 1A28A 4RUJA 2ZFXA 5DRMA 1T73A 3L03A 1Z5XE 2OVHA 1T7TA 1K4WA 1S19A 4NB6A 5DP0A 5E19A 4IA1A 4POHA 3L0LA 4IUIA 4XI3A 5KRFA 3V3QA 4ZNUA 1X78A 2P7GA 5FQVA 4OZTE 5FQRA 3OS8C 5G44A 4K6IA 2NXXE 5L7HA 1YA3A 3DZYD 3AURA 4OK1A 1XJ7A 1T7FA 5E0WA 1XP9A 3OS9A 4REEA 4MG8B 4P6XA 5AWKA 1N4HA 4KZJA 3FALA 1ILHA 4LSJA 2HC4A 5G3JA 3LBDA 3VI8A 3KPZA 3W0YA 3O1EA 5HJSA 3WJ5A 2Q59B 1SR7A 2Q7KA 4FN9A 3KWYA 4OIVA 1LBDA 3OSIA 3KDTA 1FCZA 2GPPA 2Z4BA 1K74A 3TKMA 3G0WA 4R2UA 5KRCA 3DT3A 3OZJA 1FD0A 1BSXA 4MGBA 3W5RA 2BAWA 1IE9A 3VTCA 3L1BA 5KRMA 5APHA 4OFUA 4OILA 5AVIA 1R20D 2ATHA 3W0CA 4UDBA 4NQAB 4OJ4A 1UHLB 4TUZA 5DVCA 3VHVA 4RMEA 3A78A 4M8EA 2I4PA 3DR1A 5DKGA 3ILZA 5AWJA 3KFCA 3VJSA 2ZKCA 3BQDA 2AWHA 3E00A 3R8IA 3WTQA 1OVLA 5DLRA 4IW8A 3VHWA 3VTBA 2OVMA 4L96A 4FHIA 3EYBA 4OZRU 2J14A 3VJTA 1I7GA 3R8AA 1XZXX 5KR9A 2Q8SA 3HVLA 1XDKA 2V0VA 5HZCA 2GL8A 3RY9A 1GWXA 2P4YA 3ADUA 5KCWA 3ADWA 2PIOA 3OMQA 2JFAB 5KCFA 2PIQA 3G8IA 4MGDA 5CJ6A 4KZIA 4ZNVA 1X7RA 2PINA 3OZ0A 5E14A 4XHDA 2QR9A 3A40X 2Q61A 3H0AD 3V4AA 2HVCA 5IZ0A 3UVVA 4OH5A 1M2ZA 1FM6D 2ZMIA 5FQTA 3UUDA 1YY4A 4ONIA 4IA2A 4DK8A 1KKQA 1NQ7A 4OHAA 4DORA 3A9EA 4N73A 2V7CA 2ZNQA 3G9EA 3V9VA 4ZN7A 3F5CA 2ZK5A 4HLWA 3R29A 3OGTA 5DXRA 2Q5SA 3W0AA 1EXXA 3PEQA 4JL4A 2O4JA 2ABIA 4M8HA 1R1KA 4OLMA 3GZ9A 4MGDB 4MGAB 5EC9A 4B7WA 3ERDA 2LBDA 3HLVA 2GWXA 1E3KA 2PIWA 2Q6RA 3B3KA 4PP6A 1H9UA 1GS4A 3HO0A 3VRTA 3ZR7A 4G1DA 1ZGYA 4OEAA 4QE8A 4OGHA 3K8SA 1ZDUA 2ZK1A 4NY9A 3AX8A 5DWEA 4PLDA 3VTDA 4IA3A 3ERTA 2FSZA 2QGTA 3FS1A 3S9SA 1QKTA 1YP0A 2ZVTA 2I4ZA 3L0JA 4PF3A 5DXMA 3OLFA 4J5WC 1NRLA 2VV1A 3AUNA 3FXVA 1RK3A 4ZO1X 3UU7A 4G1YA 3FC6B 3GWSX 3OAPA 4S0SA 4N8RA 5L7GA 3N00A 2OCFA 5DZ1A 3UP3A 2FAIA 3ADVA 4EMAA 5C4TA 5DKSA 2AYRA 3FLIA 5L11A 4PP5A 3NSPA 1Y0XX 1XVPB 3SP6A 5DUHA 4IV2A 4LTWA 3WGPA 1T7RA 2O4RA 3OKIA 1YUCA 2YFEA 1RDTD 3B1MA 2PJLA 1VJBA 2B1VA 3ADTA 3DCTA 1YIMA 4LBDA 2QXMA 5AYGA 4OEYA 3V9TA 5I4VA 2PIXA 2HWRA 4IWFA 1TFCA 5HYKA 1T5ZA 5FQSA 1XP1A 3D5FA 5EHJA 4F9MA 3W0JA 5JJMB 3DCUA 3WJ4A 2YJAB 4E4QA 3KBAA 1NYXA 1XB7A 4OKWA 1P8DA 3SZ1A 5AAUA 2E2RA 5IAWA 4MG8A 5EJVA 5KRJA 5FQPA 5KYAA 3A3ZX 2P1TA 2GTKA 2F4BA 3IPUA 3LMPA 3FEIA 4PXMA 2IHQA 5DK9A 5L7EA 4APUA 3AZ1A 1SQNA 2Q59A 4J26A 1ZH7A 2P7AA 3FURA 3W5QA 3V3EA 4OEDA 3ZRBA 4A4WA 5E15A 5KRHA 4S0TA 4YMQA 5HJPB 2XHSA 1NHZA 5LWPA 2HBHA 3D57A 1R5KA 3CLDA 3CS8A 2VSRA 2GPOA 2YLPA 2QE4A 3PLZA 1Q4XA 2ZY0A 4NIEA 3GWXA 1RKGA 2GIUA 2HWQA 3AN3A 1DB1A 3O1DA 1ZKYA 3UP0A 4WVDA 3E94A 1UHLA 2OZ7A 3VJIA 4TV1B 5DVSA 2O9IA 4OKBA 3RUUA 3ET2A 1NDEA 5C4SA 2HFPA 3DZYA 3CQVA 3BEJA 4QJRA 5GIEA 1XPCA 4JAZA 5E0XA 3W0GA 2G44A 4J5XC 3HC5A 2AX8A 4ZNTA 1YMTA 2I0GA 3PCUA 1MVCA 4ZOMA 1PZLA 1HJ1A 4X1GA 5DX3B 3CWDA 3SP9A 2PIVA 2QMVA 1PQCA 2P1UA 3B65A 3D24A 4S14A 4DM8A 2Q5PA 4RAKA 2R40D 5DIDA 2H77A 4JYGA 5EGVA 2Q7JA 4RZGA 3OOKA 2JFAA 4MG9B 2POGA 3MNOA 2AA5A 1EXAA 1WM0X 5K13A 2QZOB 1QKMA 1S9PA 2HCDA 2Q60A 3QT0A 3L3ZA 4MG7B 5DXKA 2AM9A 1FM9D 3GYUA 2J4AA 3CDPA 4G2IA 1QKUA 4QK4A 1R20A 3CJWA 3IA6A 3W5TA 5A86A 1ERRA 2Q5GA 5DMCA 4E2JA 4YPQA 3VT7A 4P6WA 2AX7A 5B5BA 2PRGA 1FCXA 5IXKA 1S0ZA 1T7MA 1RKHA 2VV4B 4IVWA 4L98A 2NV7A 4IS8A 1KNUA 1XIUA 4MGAA 5AVLA 3X1HA 5APJA 4CSJA 2ACLB 4OJ9A 2BJ4A 3Q95B 3X31A 3B0QA 3M7RA 5DYBA 2HASA 1EREA 1Z5XU 4N1YA 3TX7B 3ZQTA 3RVFA 5DZ0A 3VRVA 3D90A 4JGVA 2R6WA 1XQCA 3IPQA 5AAVB 2XYJA 3W0IA 4JYIA 3DZUD 1L2JA 1Y0SA 3JZBA 4OZTU 3R8DA 3OLSA 4O8FA 3W0HA 2POBA 3H0AA 4YNKA 5KCCA 2ZK0A 5DL4A 1I7IA 1FM6A 3IMYA 3E7CA 3FC6A 4ZJWA 2VSTA 1YINA 1G5YA 1XOWA 1P93A 2PNUA 2BJ4B 2EWPA 2ZXZA 4CI4A 3VHUA 3G8OA 3GBKA 4LNXA 4QL8A 3KYTA 4OIUA 3A2JA 2JF9A 1XVPA 3B0TA 4MGCA 1HG4A 3OSWA 5DY8A 5G42A 3IXPD 5KRLA 5DXPA 2GPUA 1MZNA 2ZK3A 5E7VA 4DMAA 3WFGA 4IU7A 2ZLAA 2ZLCA 2HB8A 3P8XA 1K7LA 2VV0A 4RZEA 3AFRA 5APKA 4RFWA 1PQ9A 3OMMA 5DTVA 4OFRA 5DWGA 5JJMA 2QPYA 2GP7A 3AN4A 1ZEOA 3P88A 4MG5A 4QM0A 3RLLA 3V9YA 1FBYA 3B68A 2NXXA 1TXIA 1XP6A 3PBAA 5GICA 2QGWA 3VT6A 5C4OA 5B41A 2I0JA 3OS8A 1GWRA 1RJKA 3HC6A 4FNEA 3VT3A 4DQMA 3H52A
chains in the Genus database with same CATH superfamily
2QTUA 3CS6A 3WT5A 2XYWA 4EM9A 1T65A 3NOAA 1NQ0A 3ADSA 4MG6A 5ICKA 1ZDTA 5ACCA 1U3RA 2QXSA 3ADXA 1NAVA 2H79A 2IOGA 4OJBA 2Q70A 3BC5A 1X7BA 3X1IA 5DKBA 3B5RA 3AZ2A 3ET3A 1UPVA 4N5GA 2B1ZA 5HJPA 1YOWA 4MDDA 5DUEA 4ITFA 3B67A 2ZNPA 2Q3YA 2HB7A 2AX6A 1OT7A 5DI7A 1RDTA 4J5XA 3UUCA 4Q0AC 3L0EA 2YATA 2ZMHA 4OARA 4IA7A 4DM6A 5AZVA 3F7DA 5DV6A 3KMRA 3WWRA 1X76A 1XV9B 3K22A 1ZAFA 1T79A 3R5NA 2G5OA 4TV1A 3VT5A 4OZRE 3WT6A 2ZK6A 5DUGA 5DVVA 2OUZA 4XT9A 2XYXA 2P1VA 4RUOX 2VV2A 2AB2A 2GPVA 5DWJA 5LGAA 1Y9RA 3MNPA 1I37A 4WLBA 3UUAB 1T63A 5DX3A 1N83A 1S0XA 4HEEX 4WHGA 1GWQA 1S9QA 2XKWA 1E3GA 2Q6JA 4PLEA 3R5MA 3ET0A 5DKEA 2AA2A 4PP3A 4DK7A 4ZNSA 5KCEA 4XLDA 5DMFA 2AMAA 1PQ6A 5ETHA 4MG9A 3D6DA 5DXBB 3OOFA 3KMZA 5DU5A 2PIRA 3PRGA 1MV9A 2B50A 2QZOA 1QKNA 5KROA 1A52A 4MG7A 4A4VA 3IPSA 2Q7IA 4ZO1B 2ZASA 4DOSA 4OKTA 2YLQA 2ZMJA 1DKFB 4Q50A 2Q1HA 4FHHA 4IW6A 3RLJA 4BCRA 3CDSA 2PIPL 2ZBSA 2QA8B 3K6PA 5DV8A 1K74D 1M7WA 1IE8A 4REFA 1M13A 1NQ1A 1UPWA 1XLSA 2ZNNA 4ZNHA 2QH6A 2VV4A 3FEJA 4ZI1A 4ZJRA 1YJEA 4XTAA 4OKXA 5DZIA 2FVJA 4IV4A 4K4JA 2ACLA 1OSHA 1R6GA 1G50A 4QE6A 3VRWA 2REWA 5EI1A 4J24A 3OLLA 3T03A 3Q95A 1XNNA 1XAPA 2G0HA 2AA7A 2PITA 2PKLA 1NQ2A 4RWVA 4UDAA 3B0RA 5M96A 3OSAA 5DZ3A 2YJDA 2R40A 3A2HA 4ZN9A 3E00D 3OMOA 3ET1A 4XUMA 5AZTA 4IVYA 5AAVA 3VN2A 4G2HA 4R06A 2Q1VA 1L2IA 2ZXNA 1LV2A 3FALB 4RUPA 2VV3A 5DSHA 3AUQA 5G45A 1FM9A 1PK5A 1T76A 3WFFA 3OKHA 4J5WA 4LNWA 2QABA 4WHFA 1NUOA 2AXAA 1SKXA 2QA6A 2R6YA 3P89A 4R6SA 5KCDA 2W8YA 4MGBB 5JY3A 3KMGA 4RMDA 1SJ0A 3A2IA 2PIUA 1PRGA 1ILGA 2A3IA 4JYHA 4Q13A 4S15A 5DV3A 2Q7LA 3B0WA 4TUZB 2AMBA 4X1FA 3P0UA 4KZMA 4G20A 4G21A 4RE8A 3VT4A 1X7JA 2P54A 1U3SA 1R1KD 2ZNOA 3CTBA 3GYTA 4PVUA 2QSEA 1G1UA 2YLOA 3MNEA 1OVLB 2QNVA 1G2NA 3FUGA 4OEZA 3DZUA 3GN8A 4IWCA 2QW4A 3JZCA 5F9BA 1N46A 3VSOA 5KD9A 5C4UA 3B66A 5DIGA 1NAXA 3HZFA 3WMHA 3HM1A 1XDKB 1XLSE 2J7YA 3VRUA 3ZRAA 3L3XA 3OMKA 5DWIA 1U9EA 5DXQA 5G5WA 3DY6A 2JJ3A 1PDUA 3HODA 5JI0D 1T74A 3V49A 1Z95A 5G46A 5HYRA 4RZFA 3VT8A 5DRJA 5DXGA 3W5PA 2G0GA 1I38A 5GIDA 3IXPA 3UVVB 1XQ3A 3KDUA 5KCTA 3R2AA 2AO6A 4NUFA 3UUDB 2ZK2A 1PCGA 3HQ5A 2OM9A 2P7ZA 2J7XA 4UDDA 3VT9A 2NPAA 2NW4A 3A9EB 4Y29A 4YT1A 4G1ZA 2AAXA 5E1CA 5DXEA 5SYZA 3U9QA 4POJA 3F5CB 1XV9A 4WQPA 2YLYA 1OSVA 4RMCA 2IOKA 5H1EA 3VSPA 4FGYA 4E4KA 5KCUA 3AZ3A 4OC7A 1YYEA 3PO9A 5EITA 4IQRA 3UUAA 5AK2A 1XNXA 5KRKA 3K23A 3WT7A 2HARA 4K7AA 2OAXA 5DYDA 2P15A 5DZHA 3TKCA 4PPSA 4WPFA 5KRAA 2HAMA 4CI5A 3OMPA 1FCYA 5KRIA 3CS4A 3GD2A 3NSQA 2ZK4A 3VJHA 1ZUCA 5DXBA 5GT4A 5HCVA 2I4JA 2B23A 4PRGA 4XUHA 4ZNWA 1KV6A 2ZL9A 4PPPA 2VV1B 2Z4JA 3UU7B 2AX9A 4OH6A 3X36A 4A2JA 4PWLA 3RUTA 1DKFA 2YHDA 1UOMA 4XAOA 4UDCA 5DIEA 2Q6SA 4ITEA 2QA8A 5G43A 1X7EA 1U3QA 2AA6A 3TY0A 5KYJA 5DWLA 2ZXMA 1YOKA 1A28A 4RUJA 2ZFXA 5DRMA 1T73A 3L03A 1Z5XE 2OVHA 1T7TA 1K4WA 1S19A 4NB6A 5DP0A 5E19A 4IA1A 4POHA 3L0LA 4IUIA 4XI3A 5KRFA 3V3QA 4ZNUA 1X78A 2P7GA 5FQVA 4OZTE 5FQRA 3OS8C 5G44A 4K6IA 2NXXE 5L7HA 1YA3A 3DZYD 3AURA 4OK1A 1XJ7A 1T7FA 5E0WA 1XP9A 3OS9A 4REEA 4MG8B 4P6XA 5AWKA 1N4HA 4KZJA 3FALA 1ILHA 4LSJA 2HC4A 5G3JA 3LBDA 3VI8A 3KPZA 3W0YA 3O1EA 5HJSA 3WJ5A 2Q59B 1SR7A 2Q7KA 4FN9A 3KWYA 4OIVA 1LBDA 3OSIA 3KDTA 1FCZA 2GPPA 2Z4BA 1K74A 3TKMA 3G0WA 4R2UA 5KRCA 3DT3A 3OZJA 1FD0A 1BSXA 4MGBA 3W5RA 2BAWA 1IE9A 3VTCA 3L1BA 5KRMA 5APHA 4OFUA 4OILA 5AVIA 1R20D 2ATHA 3W0CA 4UDBA 4NQAB 4OJ4A 1UHLB 4TUZA 5DVCA 3VHVA 4RMEA 3A78A 4M8EA 2I4PA 3DR1A 5DKGA 3ILZA 5AWJA 3KFCA 3VJSA 2ZKCA 3BQDA 2AWHA 3E00A 3R8IA 3WTQA 1OVLA 5DLRA 4IW8A 3VHWA 3VTBA 2OVMA 4L96A 4FHIA 3EYBA 4OZRU 2J14A 3VJTA 1I7GA 3R8AA 1XZXX 5KR9A 2Q8SA 3HVLA 1XDKA 2V0VA 5HZCA 2GL8A 3RY9A 1GWXA 2P4YA 3ADUA 5KCWA 3ADWA 2PIOA 3OMQA 2JFAB 5KCFA 2PIQA 3G8IA 4MGDA 5CJ6A 4KZIA 4ZNVA 1X7RA 2PINA 3OZ0A 5E14A 4XHDA 2QR9A 3A40X 2Q61A 3H0AD 3V4AA 2HVCA 5IZ0A 3UVVA 4OH5A 1M2ZA 1FM6D 2ZMIA 5FQTA 3UUDA 1YY4A 4ONIA 4IA2A 4DK8A 1KKQA 1NQ7A 4OHAA 4DORA 3A9EA 4N73A 2V7CA 2ZNQA 3G9EA 3V9VA 4ZN7A 3F5CA 2ZK5A 4HLWA 3R29A 3OGTA 5DXRA 2Q5SA 3W0AA 1EXXA 3PEQA 4JL4A 2O4JA 2ABIA 4M8HA 1R1KA 4OLMA 3GZ9A 4MGDB 4MGAB 5EC9A 4B7WA 3ERDA 2LBDA 3HLVA 2GWXA 1E3KA 2PIWA 2Q6RA 3B3KA 4PP6A 1H9UA 1GS4A 3HO0A 3VRTA 3ZR7A 4G1DA 1ZGYA 4OEAA 4QE8A 4OGHA 3K8SA 1ZDUA 2ZK1A 4NY9A 3AX8A 5DWEA 4PLDA 3VTDA 4IA3A 3ERTA 2FSZA 2QGTA 3FS1A 3S9SA 1QKTA 1YP0A 2ZVTA 2I4ZA 3L0JA 4PF3A 5DXMA 3OLFA 4J5WC 1NRLA 2VV1A 3AUNA 3FXVA 1RK3A 4ZO1X 3UU7A 4G1YA 3FC6B 3GWSX 3OAPA 4S0SA 4N8RA 5L7GA 3N00A 2OCFA 5DZ1A 3UP3A 2FAIA 3ADVA 4EMAA 5C4TA 5DKSA 2AYRA 3FLIA 5L11A 4PP5A 3NSPA 1Y0XX 1XVPB 3SP6A 5DUHA 4IV2A 4LTWA 3WGPA 1T7RA 2O4RA 3OKIA 1YUCA 2YFEA 1RDTD 3B1MA 2PJLA 1VJBA 2B1VA 3ADTA 3DCTA 1YIMA 4LBDA 2QXMA 5AYGA 4OEYA 3V9TA 5I4VA 2PIXA 2HWRA 4IWFA 1TFCA 5HYKA 1T5ZA 5FQSA 1XP1A 3D5FA 5EHJA 4F9MA 3W0JA 5JJMB 3DCUA 3WJ4A 2YJAB 4E4QA 3KBAA 1NYXA 1XB7A 4OKWA 1P8DA 3SZ1A 5AAUA 2E2RA 5IAWA 4MG8A 5EJVA 5KRJA 5FQPA 5KYAA 3A3ZX 2P1TA 2GTKA 2F4BA 3IPUA 3LMPA 3FEIA 4PXMA 2IHQA 5DK9A 5L7EA 4APUA 3AZ1A 1SQNA 2Q59A 4J26A 1ZH7A 2P7AA 3FURA 3W5QA 3V3EA 4OEDA 3ZRBA 4A4WA 5E15A 5KRHA 4S0TA 4YMQA 5HJPB 2XHSA 1NHZA 5LWPA 2HBHA 3D57A 1R5KA 3CLDA 3CS8A 2VSRA 2GPOA 2YLPA 2QE4A 3PLZA 1Q4XA 2ZY0A 4NIEA 3GWXA 1RKGA 2GIUA 2HWQA 3AN3A 1DB1A 3O1DA 1ZKYA 3UP0A 4WVDA 3E94A 1UHLA 2OZ7A 3VJIA 4TV1B 5DVSA 2O9IA 4OKBA 3RUUA 3ET2A 1NDEA 5C4SA 2HFPA 3DZYA 3CQVA 3BEJA 4QJRA 5GIEA 1XPCA 4JAZA 5E0XA 3W0GA 2G44A 4J5XC 3HC5A 2AX8A 4ZNTA 1YMTA 2I0GA 3PCUA 1MVCA 4ZOMA 1PZLA 1HJ1A 4X1GA 5DX3B 3CWDA 3SP9A 2PIVA 2QMVA 1PQCA 2P1UA 3B65A 3D24A 4S14A 4DM8A 2Q5PA 4RAKA 2R40D 5DIDA 2H77A 4JYGA 5EGVA 2Q7JA 4RZGA 3OOKA 2JFAA 4MG9B 2POGA 3MNOA 2AA5A 1EXAA 1WM0X 5K13A 2QZOB 1QKMA 1S9PA 2HCDA 2Q60A 3QT0A 3L3ZA 4MG7B 5DXKA 2AM9A 1FM9D 3GYUA 2J4AA 3CDPA 4G2IA 1QKUA 4QK4A 1R20A 3CJWA 3IA6A 3W5TA 5A86A 1ERRA 2Q5GA 5DMCA 4E2JA 4YPQA 3VT7A 4P6WA 2AX7A 5B5BA 2PRGA 1FCXA 5IXKA 1S0ZA 1T7MA 1RKHA 2VV4B 4IVWA 4L98A 2NV7A 4IS8A 1KNUA 1XIUA 4MGAA 5AVLA 3X1HA 5APJA 4CSJA 2ACLB 4OJ9A 2BJ4A 3Q95B 3X31A 3B0QA 3M7RA 5DYBA 2HASA 1EREA 1Z5XU 4N1YA 3TX7B 3ZQTA 3RVFA 5DZ0A 3VRVA 3D90A 4JGVA 2R6WA 1XQCA 3IPQA 5AAVB 2XYJA 3W0IA 4JYIA 3DZUD 1L2JA 1Y0SA 3JZBA 4OZTU 3R8DA 3OLSA 4O8FA 3W0HA 2POBA 3H0AA 4YNKA 5KCCA 2ZK0A 5DL4A 1I7IA 1FM6A 3IMYA 3E7CA 3FC6A 4ZJWA 2VSTA 1YINA 1G5YA 1XOWA 1P93A 2PNUA 2BJ4B 2EWPA 2ZXZA 4CI4A 3VHUA 3G8OA 3GBKA 4LNXA 4QL8A 3KYTA 4OIUA 3A2JA 2JF9A 1XVPA 3B0TA 4MGCA 1HG4A 3OSWA 5DY8A 5G42A 3IXPD 5KRLA 5DXPA 2GPUA 1MZNA 2ZK3A 5E7VA 4DMAA 3WFGA 4IU7A 2ZLAA 2ZLCA 2HB8A 3P8XA 1K7LA 2VV0A 4RZEA 3AFRA 5APKA 4RFWA 1PQ9A 3OMMA 5DTVA 4OFRA 5DWGA 5JJMA 2QPYA 2GP7A 3AN4A 1ZEOA 3P88A 4MG5A 4QM0A 3RLLA 3V9YA 1FBYA 3B68A 2NXXA 1TXIA 1XP6A 3PBAA 5GICA 2QGWA 3VT6A 5C4OA 5B41A 2I0JA 3OS8A 1GWRA 1RJKA 3HC6A 4FNEA 3VT3A 4DQMA 3H52A
chains in the Genus database with same CATH topology
2QTUA 3CS6A 3WT5A 2XYWA 4EM9A 1T65A 3NOAA 1NQ0A 3ADSA 4MG6A 5ICKA 1ZDTA 5ACCA 1U3RA 2QXSA 3ADXA 1NAVA 2H79A 2IOGA 4OJBA 2Q70A 3BC5A 1X7BA 3X1IA 5DKBA 3B5RA 3AZ2A 3ET3A 1UPVA 4N5GA 2B1ZA 5HJPA 1YOWA 4MDDA 5DUEA 4ITFA 3B67A 2ZNPA 2Q3YA 2HB7A 2AX6A 1OT7A 5DI7A 1RDTA 4J5XA 3UUCA 4Q0AC 3L0EA 2YATA 2ZMHA 4OARA 4IA7A 4DM6A 5AZVA 3F7DA 5DV6A 3KMRA 3WWRA 1X76A 1XV9B 3K22A 1ZAFA 1T79A 3R5NA 2G5OA 4TV1A 3VT5A 4OZRE 3WT6A 2ZK6A 5DUGA 5DVVA 2OUZA 4XT9A 2XYXA 2P1VA 4RUOX 2VV2A 2AB2A 2GPVA 5DWJA 5LGAA 1Y9RA 3MNPA 1I37A 4WLBA 3UUAB 1T63A 5DX3A 1N83A 1S0XA 4HEEX 4WHGA 1GWQA 1S9QA 2XKWA 1E3GA 2Q6JA 4PLEA 3R5MA 3ET0A 5DKEA 2AA2A 4PP3A 4DK7A 4ZNSA 5KCEA 4XLDA 5DMFA 2AMAA 1PQ6A 5ETHA 4MG9A 3D6DA 5DXBB 3OOFA 3KMZA 5DU5A 2PIRA 3PRGA 1MV9A 2B50A 2QZOA 1QKNA 5KROA 1A52A 4MG7A 4A4VA 3IPSA 2Q7IA 4ZO1B 2ZASA 4DOSA 4OKTA 2YLQA 2ZMJA 1DKFB 4Q50A 2Q1HA 4FHHA 4IW6A 3RLJA 4BCRA 3CDSA 2PIPL 2ZBSA 2QA8B 3K6PA 5DV8A 1K74D 1M7WA 1IE8A 4REFA 1M13A 1NQ1A 1UPWA 1XLSA 2ZNNA 4ZNHA 2QH6A 2VV4A 3FEJA 4ZI1A 4ZJRA 1YJEA 4XTAA 4OKXA 5DZIA 2FVJA 4IV4A 4K4JA 2ACLA 1OSHA 1R6GA 1G50A 4QE6A 3VRWA 2REWA 5EI1A 4J24A 3OLLA 3T03A 3Q95A 1XNNA 1XAPA 2G0HA 2AA7A 2PITA 2PKLA 1NQ2A 4RWVA 4UDAA 3B0RA 5M96A 3OSAA 5DZ3A 2YJDA 2R40A 3A2HA 4ZN9A 3E00D 3OMOA 3ET1A 4XUMA 5AZTA 4IVYA 5AAVA 3VN2A 4G2HA 4R06A 2Q1VA 1L2IA 2ZXNA 1LV2A 3FALB 4RUPA 2VV3A 5DSHA 3AUQA 5G45A 1FM9A 1PK5A 1T76A 3WFFA 3OKHA 4J5WA 4LNWA 2QABA 4WHFA 1NUOA 2AXAA 1SKXA 2QA6A 2R6YA 3P89A 4R6SA 5KCDA 2W8YA 4MGBB 5JY3A 3KMGA 4RMDA 1SJ0A 3A2IA 2PIUA 1PRGA 1ILGA 2A3IA 4JYHA 4Q13A 4S15A 5DV3A 2Q7LA 3B0WA 4TUZB 2AMBA 4X1FA 3P0UA 4KZMA 4G20A 4G21A 4RE8A 3VT4A 1X7JA 2P54A 1U3SA 1R1KD 2ZNOA 3CTBA 3GYTA 4PVUA 2QSEA 1G1UA 2YLOA 3MNEA 1OVLB 2QNVA 1G2NA 3FUGA 4OEZA 3DZUA 3GN8A 4IWCA 2QW4A 3JZCA 5F9BA 1N46A 3VSOA 5KD9A 5C4UA 3B66A 5DIGA 1NAXA 3HZFA 3WMHA 3HM1A 1XDKB 1XLSE 2J7YA 3VRUA 3ZRAA 3L3XA 3OMKA 5DWIA 1U9EA 5DXQA 5G5WA 3DY6A 2JJ3A 1PDUA 3HODA 5JI0D 1T74A 3V49A 1Z95A 5G46A 5HYRA 4RZFA 3VT8A 5DRJA 5DXGA 3W5PA 2G0GA 1I38A 5GIDA 3IXPA 3UVVB 1XQ3A 3KDUA 5KCTA 3R2AA 2AO6A 4NUFA 3UUDB 2ZK2A 1PCGA 3HQ5A 2OM9A 2P7ZA 2J7XA 4UDDA 3VT9A 2NPAA 2NW4A 3A9EB 4Y29A 4YT1A 4G1ZA 2AAXA 5E1CA 5DXEA 5SYZA 3U9QA 4POJA 3F5CB 1XV9A 4WQPA 2YLYA 1OSVA 4RMCA 2IOKA 5H1EA 3VSPA 4FGYA 4E4KA 5KCUA 3AZ3A 4OC7A 1YYEA 3PO9A 5EITA 4IQRA 3UUAA 5AK2A 1XNXA 5KRKA 3K23A 3WT7A 2HARA 4K7AA 2OAXA 5DYDA 2P15A 5DZHA 3TKCA 4PPSA 4WPFA 5KRAA 2HAMA 4CI5A 3OMPA 1FCYA 5KRIA 3CS4A 3GD2A 3NSQA 2ZK4A 3VJHA 1ZUCA 5DXBA 5GT4A 5HCVA 2I4JA 2B23A 4PRGA 4XUHA 4ZNWA 1KV6A 2ZL9A 4PPPA 2VV1B 2Z4JA 3UU7B 2AX9A 4OH6A 3X36A 4A2JA 4PWLA 3RUTA 1DKFA 2YHDA 1UOMA 4XAOA 4UDCA 5DIEA 2Q6SA 4ITEA 2QA8A 5G43A 1X7EA 1U3QA 2AA6A 3TY0A 5KYJA 5DWLA 2ZXMA 1YOKA 1A28A 4RUJA 2ZFXA 5DRMA 1T73A 3L03A 1Z5XE 2OVHA 1T7TA 1K4WA 1S19A 4NB6A 5DP0A 5E19A 4IA1A 4POHA 3L0LA 4IUIA 4XI3A 5KRFA 3V3QA 4ZNUA 1X78A 2P7GA 5FQVA 4OZTE 5FQRA 3OS8C 5G44A 4K6IA 2NXXE 5L7HA 1YA3A 3DZYD 3AURA 4OK1A 1XJ7A 1T7FA 5E0WA 1XP9A 3OS9A 4REEA 4MG8B 4P6XA 5AWKA 1N4HA 4KZJA 3FALA 1ILHA 4LSJA 2HC4A 5G3JA 3LBDA 3VI8A 3KPZA 3W0YA 3O1EA 5HJSA 3WJ5A 2Q59B 1SR7A 2Q7KA 4FN9A 3KWYA 4OIVA 1LBDA 3OSIA 3KDTA 1FCZA 2GPPA 2Z4BA 1K74A 3TKMA 3G0WA 4R2UA 5KRCA 3DT3A 3OZJA 1FD0A 1BSXA 4MGBA 3W5RA 2BAWA 1IE9A 3VTCA 3L1BA 5KRMA 5APHA 4OFUA 4OILA 5AVIA 1R20D 2ATHA 3W0CA 4UDBA 4NQAB 4OJ4A 1UHLB 4TUZA 5DVCA 3VHVA 4RMEA 3A78A 4M8EA 2I4PA 3DR1A 5DKGA 3ILZA 5AWJA 3KFCA 3VJSA 2ZKCA 3BQDA 2AWHA 3E00A 3R8IA 3WTQA 1OVLA 5DLRA 4IW8A 3VHWA 3VTBA 2OVMA 4L96A 4FHIA 3EYBA 4OZRU 2J14A 3VJTA 1I7GA 3R8AA 1XZXX 5KR9A 2Q8SA 3HVLA 1XDKA 2V0VA 5HZCA 2GL8A 3RY9A 1GWXA 2P4YA 3ADUA 5KCWA 3ADWA 2PIOA 3OMQA 2JFAB 5KCFA 2PIQA 3G8IA 4MGDA 5CJ6A 4KZIA 4ZNVA 1X7RA 2PINA 3OZ0A 5E14A 4XHDA 2QR9A 3A40X 2Q61A 3H0AD 3V4AA 2HVCA 5IZ0A 3UVVA 4OH5A 1M2ZA 1FM6D 2ZMIA 5FQTA 3UUDA 1YY4A 4ONIA 4IA2A 4DK8A 1KKQA 1NQ7A 4OHAA 4DORA 3A9EA 4N73A 2V7CA 2ZNQA 3G9EA 3V9VA 4ZN7A 3F5CA 2ZK5A 4HLWA 3R29A 3OGTA 5DXRA 2Q5SA 3W0AA 1EXXA 3PEQA 4JL4A 2O4JA 2ABIA 4M8HA 1R1KA 4OLMA 3GZ9A 4MGDB 4MGAB 5EC9A 4B7WA 3ERDA 2LBDA 3HLVA 2GWXA 1E3KA 2PIWA 2Q6RA 3B3KA 4PP6A 1H9UA 1GS4A 3HO0A 3VRTA 3ZR7A 4G1DA 1ZGYA 4OEAA 4QE8A 4OGHA 3K8SA 1ZDUA 2ZK1A 4NY9A 3AX8A 5DWEA 4PLDA 3VTDA 4IA3A 3ERTA 2FSZA 2QGTA 3FS1A 3S9SA 1QKTA 1YP0A 2ZVTA 2I4ZA 3L0JA 4PF3A 5DXMA 3OLFA 4J5WC 1NRLA 2VV1A 3AUNA 3FXVA 1RK3A 4ZO1X 3UU7A 4G1YA 3FC6B 3GWSX 3OAPA 4S0SA 4N8RA 5L7GA 3N00A 2OCFA 5DZ1A 3UP3A 2FAIA 3ADVA 4EMAA 5C4TA 5DKSA 2AYRA 3FLIA 5L11A 4PP5A 3NSPA 1Y0XX 1XVPB 3SP6A 5DUHA 4IV2A 4LTWA 3WGPA 1T7RA 2O4RA 3OKIA 1YUCA 2YFEA 1RDTD 3B1MA 2PJLA 1VJBA 2B1VA 3ADTA 3DCTA 1YIMA 4LBDA 2QXMA 5AYGA 4OEYA 3V9TA 5I4VA 2PIXA 2HWRA 4IWFA 1TFCA 5HYKA 1T5ZA 5FQSA 1XP1A 3D5FA 5EHJA 4F9MA 3W0JA 5JJMB 3DCUA 3WJ4A 2YJAB 4E4QA 3KBAA 1NYXA 1XB7A 4OKWA 1P8DA 3SZ1A 5AAUA 2E2RA 5IAWA 4MG8A 5EJVA 5KRJA 5FQPA 5KYAA 3A3ZX 2P1TA 2GTKA 2F4BA 3IPUA 3LMPA 3FEIA 4PXMA 2IHQA 5DK9A 5L7EA 4APUA 3AZ1A 1SQNA 2Q59A 4J26A 1ZH7A 2P7AA 3FURA 3W5QA 3V3EA 4OEDA 3ZRBA 4A4WA 5E15A 5KRHA 4S0TA 4YMQA 5HJPB 2XHSA 1NHZA 5LWPA 2HBHA 3D57A 1R5KA 3CLDA 3CS8A 2VSRA 2GPOA 2YLPA 2QE4A 3PLZA 1Q4XA 2ZY0A 4NIEA 3GWXA 1RKGA 2GIUA 2HWQA 3AN3A 1DB1A 3O1DA 1ZKYA 3UP0A 4WVDA 3E94A 1UHLA 2OZ7A 3VJIA 4TV1B 5DVSA 2O9IA 4OKBA 3RUUA 3ET2A 1NDEA 5C4SA 2HFPA 3DZYA 3CQVA 3BEJA 4QJRA 5GIEA 1XPCA 4JAZA 5E0XA 3W0GA 2G44A 4J5XC 3HC5A 2AX8A 4ZNTA 1YMTA 2I0GA 3PCUA 1MVCA 4ZOMA 1PZLA 1HJ1A 4X1GA 5DX3B 3CWDA 3SP9A 2PIVA 2QMVA 1PQCA 2P1UA 3B65A 3D24A 4S14A 4DM8A 2Q5PA 4RAKA 2R40D 5DIDA 2H77A 4JYGA 5EGVA 2Q7JA 4RZGA 3OOKA 2JFAA 4MG9B 2POGA 3MNOA 2AA5A 1EXAA 1WM0X 5K13A 2QZOB 1QKMA 1S9PA 2HCDA 2Q60A 3QT0A 3L3ZA 4MG7B 5DXKA 2AM9A 1FM9D 3GYUA 2J4AA 3CDPA 4G2IA 1QKUA 4QK4A 1R20A 3CJWA 3IA6A 3W5TA 5A86A 1ERRA 2Q5GA 5DMCA 4E2JA 4YPQA 3VT7A 4P6WA 2AX7A 5B5BA 2PRGA 1FCXA 5IXKA 1S0ZA 1T7MA 1RKHA 2VV4B 4IVWA 4L98A 2NV7A 4IS8A 1KNUA 1XIUA 4MGAA 5AVLA 3X1HA 5APJA 4CSJA 2ACLB 4OJ9A 2BJ4A 3Q95B 3X31A 3B0QA 3M7RA 5DYBA 2HASA 1EREA 1Z5XU 4N1YA 3TX7B 3ZQTA 3RVFA 5DZ0A 3VRVA 3D90A 4JGVA 2R6WA 1XQCA 3IPQA 5AAVB 2XYJA 3W0IA 4JYIA 3DZUD 1L2JA 1Y0SA 3JZBA 4OZTU 3R8DA 3OLSA 4O8FA 3W0HA 2POBA 3H0AA 4YNKA 5KCCA 2ZK0A 5DL4A 1I7IA 1FM6A 3IMYA 3E7CA 3FC6A 4ZJWA 2VSTA 1YINA 1G5YA 1XOWA 1P93A 2PNUA 2BJ4B 2EWPA 2ZXZA 4CI4A 3VHUA 3G8OA 3GBKA 4LNXA 4QL8A 3KYTA 4OIUA 3A2JA 2JF9A 1XVPA 3B0TA 4MGCA 1HG4A 3OSWA 5DY8A 5G42A 3IXPD 5KRLA 5DXPA 2GPUA 1MZNA 2ZK3A 5E7VA 4DMAA 3WFGA 4IU7A 2ZLAA 2ZLCA 2HB8A 3P8XA 1K7LA 2VV0A 4RZEA 3AFRA 5APKA 4RFWA 1PQ9A 3OMMA 5DTVA 4OFRA 5DWGA 5JJMA 2QPYA 2GP7A 3AN4A 1ZEOA 3P88A 4MG5A 4QM0A 3RLLA 3V9YA 1FBYA 3B68A 2NXXA 1TXIA 1XP6A 3PBAA 5GICA 2QGWA 3VT6A 5C4OA 5B41A 2I0JA 3OS8A 1GWRA 1RJKA 3HC6A 4FNEA 3VT3A 4DQMA 3H52A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QTU A;  3CS6 A;  3WT5 A;  2XYW A;  4EM9 A;  1T65 A;  3NOA A;  1NQ0 A;  3ADS A;  4MG6 A;  5ICK A;  1ZDT A;  5ACC A;  1U3R A;  2QXS A;  3ADX A;  1NAV A;  2H79 A;  2IOG A;  4OJB A;  2Q70 A;  3BC5 A;  1X7B A;  3X1I A;  5DKB A;  3B5R A;  3AZ2 A;  3ET3 A;  1UPV A;  4N5G A;  2B1Z A;  5HJP A;  1YOW A;  4MDD A;  5DUE A;  4ITF A;  3B67 A;  2ZNP A;  2Q3Y A;  2HB7 A;  2AX6 A;  1OT7 A;  5DI7 A;  1RDT A;  4J5X A;  3UUC A;  4Q0A C;  3L0E A;  2YAT A;  2ZMH A;  4OAR A;  4IA7 A;  4DM6 A;  5AZV A;  3F7D A;  5DV6 A;  3KMR A;  3WWR A;  1X76 A;  1XV9 B;  3K22 A;  1ZAF A;  1T79 A;  3R5N A;  2G5O A;  4TV1 A;  3VT5 A;  4OZR E;  3WT6 A;  2ZK6 A;  5DUG A;  5DVV A;  2OUZ A;  4XT9 A;  2XYX A;  2P1V A;  4RUO X;  2VV2 A;  2AB2 A;  2GPV A;  5DWJ A;  5LGA A;  1Y9R A;  3MNP A;  1I37 A;  4WLB A;  3UUA B;  1T63 A;  5DX3 A;  1N83 A;  1S0X A;  4HEE X;  4WHG A;  1GWQ A;  1S9Q A;  2XKW A;  1E3G A;  2Q6J A;  4PLE A;  3R5M A;  3ET0 A;  5DKE A;  2AA2 A;  4PP3 A;  4DK7 A;  4ZNS A;  5KCE A;  4XLD A;  5DMF A;  2AMA A;  1PQ6 A;  5ETH A;  4MG9 A;  3D6D A;  5DXB B;  3OOF A;  3KMZ A;  5DU5 A;  2PIR A;  3PRG A;  1MV9 A;  2B50 A;  2QZO A;  1QKN A;  5KRO A;  1A52 A;  4MG7 A;  4A4V A;  3IPS A;  2Q7I A;  4ZO1 B;  2ZAS A;  4DOS A;  4OKT A;  2YLQ A;  2ZMJ A;  1DKF B;  4Q50 A;  2Q1H A;  4FHH A;  4IW6 A;  3RLJ A;  4BCR A;  3CDS A;  2PIP L;  2ZBS A;  2QA8 B;  3K6P A;  5DV8 A;  1K74 D;  1M7W A;  1IE8 A;  4REF A;  1M13 A;  1NQ1 A;  1UPW A;  1XLS A;  2ZNN A;  4ZNH A;  2QH6 A;  2VV4 A;  3FEJ A;  4ZI1 A;  4ZJR A;  1YJE A;  4XTA A;  4OKX A;  5DZI A;  2FVJ A;  4IV4 A;  4K4J A;  2ACL A;  1OSH A;  1R6G A;  1G50 A;  4QE6 A;  3VRW A;  2REW A;  5EI1 A;  4J24 A;  3OLL A;  3T03 A;  3Q95 A;  1XNN A;  1XAP A;  2G0H A;  2AA7 A;  2PIT A;  2PKL A;  1NQ2 A;  4RWV A;  4UDA A;  3B0R A;  5M96 A;  3OSA A;  5DZ3 A;  2YJD A;  2R40 A;  3A2H A;  4ZN9 A;  3E00 D;  3OMO A;  3ET1 A;  4XUM A;  5AZT A;  4IVY A;  5AAV A;  3VN2 A;  4G2H A;  4R06 A;  2Q1V A;  1L2I A;  2ZXN A;  1LV2 A;  3FAL B;  4RUP A;  2VV3 A;  5DSH A;  3AUQ A;  5G45 A;  1FM9 A;  1PK5 A;  1T76 A;  3WFF A;  3OKH A;  4J5W A;  4LNW A;  2QAB A;  4WHF A;  1NUO A;  2AXA A;  1SKX A;  2QA6 A;  2R6Y A;  3P89 A;  4R6S A;  5KCD A;  2W8Y A;  4MGB B;  5JY3 A;  3KMG A;  4RMD A;  1SJ0 A;  3A2I A;  2PIU A;  1PRG A;  1ILG A;  2A3I A;  4JYH A;  4Q13 A;  4S15 A;  5DV3 A;  2Q7L A;  3B0W A;  4TUZ B;  2AMB A;  4X1F A;  3P0U A;  4KZM A;  4G20 A;  4G21 A;  4RE8 A;  3VT4 A;  1X7J A;  2P54 A;  1U3S A;  1R1K D;  2ZNO A;  3CTB A;  3GYT A;  4PVU A;  2QSE A;  1G1U A;  2YLO A;  3MNE A;  1OVL B;  2QNV A;  1G2N A;  3FUG A;  4OEZ A;  3DZU A;  3GN8 A;  4IWC A;  2QW4 A;  3JZC A;  5F9B A;  1N46 A;  3VSO A;  5KD9 A;  5C4U A;  3B66 A;  5DIG A;  1NAX A;  3HZF A;  3WMH A;  3HM1 A;  1XDK B;  1XLS E;  2J7Y A;  3VRU A;  3ZRA A;  3L3X A;  3OMK A;  5DWI A;  1U9E A;  5DXQ A;  5G5W A;  3DY6 A;  2JJ3 A;  1PDU A;  3HOD A;  5JI0 D;  1T74 A;  3V49 A;  1Z95 A;  5G46 A;  5HYR A;  4RZF A;  3VT8 A;  5DRJ A;  5DXG A;  3W5P A;  2G0G A;  1I38 A;  5GID A;  3IXP A;  3UVV B;  1XQ3 A;  3KDU A;  5KCT A;  3R2A A;  2AO6 A;  4NUF A;  3UUD B;  2ZK2 A;  1PCG A;  3HQ5 A;  2OM9 A;  2P7Z A;  2J7X A;  4UDD A;  3VT9 A;  2NPA A;  2NW4 A;  3A9E B;  4Y29 A;  4YT1 A;  4G1Z A;  2AAX A;  5E1C A;  5DXE A;  5SYZ A;  3U9Q A;  4POJ A;  3F5C B;  1XV9 A;  4WQP A;  2YLY A;  1OSV A;  4RMC A;  2IOK A;  5H1E A;  3VSP A;  4FGY A;  4E4K A;  5KCU A;  3AZ3 A;  4OC7 A;  1YYE A;  3PO9 A;  5EIT A;  4IQR A;  3UUA A;  5AK2 A;  1XNX A;  5KRK A;  3K23 A;  3WT7 A;  2HAR A;  4K7A A;  2OAX A;  5DYD A;  2P15 A;  5DZH A;  3TKC A;  4PPS A;  4WPF A;  5KRA A;  2HAM A;  4CI5 A;  3OMP A;  1FCY A;  5KRI A;  3CS4 A;  3GD2 A;  3NSQ A;  2ZK4 A;  3VJH A;  1ZUC A;  5DXB A;  5GT4 A;  5HCV A;  2I4J A;  2B23 A;  4PRG A;  4XUH A;  4ZNW A;  1KV6 A;  2ZL9 A;  4PPP A;  2VV1 B;  2Z4J A;  3UU7 B;  2AX9 A;  4OH6 A;  3X36 A;  4A2J A;  4PWL A;  3RUT A;  1DKF A;  2YHD A;  1UOM A;  4XAO A;  4UDC A;  5DIE A;  2Q6S A;  4ITE A;  2QA8 A;  5G43 A;  1X7E A;  1U3Q A;  2AA6 A;  3TY0 A;  5KYJ A;  5DWL A;  2ZXM A;  1YOK A;  1A28 A;  4RUJ A;  2ZFX A;  5DRM A;  1T73 A;  3L03 A;  1Z5X E;  2OVH A;  1T7T A;  1K4W A;  1S19 A;  4NB6 A;  5DP0 A;  5E19 A;  4IA1 A;  4POH A;  3L0L A;  4IUI A;  4XI3 A;  5KRF A;  3V3Q A;  4ZNU A;  1X78 A;  2P7G A;  5FQV A;  4OZT E;  5FQR A;  3OS8 C;  5G44 A;  4K6I A;  2NXX E;  5L7H A;  1YA3 A;  3DZY D;  3AUR A;  4OK1 A;  1XJ7 A;  1T7F A;  5E0W A;  1XP9 A;  3OS9 A;  4REE A;  4MG8 B;  4P6X A;  5AWK A;  1N4H A;  4KZJ A;  3FAL A;  1ILH A;  4LSJ A;  2HC4 A;  5G3J A;  3LBD A;  3VI8 A;  3KPZ A;  3W0Y A;  3O1E A;  5HJS A;  3WJ5 A;  2Q59 B;  1SR7 A;  2Q7K A;  4FN9 A;  3KWY A;  4OIV A;  1LBD A;  3OSI A;  3KDT A;  1FCZ A;  2GPP A;  2Z4B A;  1K74 A;  3TKM A;  3G0W A;  4R2U A;  5KRC A;  3DT3 A;  3OZJ A;  1FD0 A;  1BSX A;  4MGB A;  3W5R A;  2BAW A;  1IE9 A;  3VTC A;  3L1B A;  5KRM A;  5APH A;  4OFU A;  4OIL A;  5AVI A;  1R20 D;  2ATH A;  3W0C A;  4UDB A;  4NQA B;  4OJ4 A;  1UHL B;  4TUZ A;  5DVC A;  3VHV A;  4RME A;  3A78 A;  4M8E A;  2I4P A;  3DR1 A;  5DKG A;  3ILZ A;  5AWJ A;  3KFC A;  3VJS A;  2ZKC A;  3BQD A;  2AWH A;  3E00 A;  3R8I A;  3WTQ A;  1OVL A;  5DLR A;  4IW8 A;  3VHW A;  3VTB A;  2OVM A;  4L96 A;  4FHI A;  3EYB A;  4OZR U;  2J14 A;  3VJT A;  1I7G A;  3R8A A;  1XZX X;  5KR9 A;  2Q8S A;  3HVL A;  1XDK A;  2V0V A;  5HZC A;  2GL8 A;  3RY9 A;  1GWX A;  2P4Y A;  3ADU A;  5KCW A;  3ADW A;  2PIO A;  3OMQ A;  2JFA B;  5KCF A;  2PIQ A;  3G8I A;  4MGD A;  5CJ6 A;  4KZI A;  4ZNV A;  1X7R A;  2PIN A;  3OZ0 A;  5E14 A;  4XHD A;  2QR9 A;  3A40 X;  2Q61 A;  3H0A D;  3V4A A;  2HVC A;  5IZ0 A;  3UVV A;  4OH5 A;  1M2Z A;  1FM6 D;  2ZMI A;  5FQT A;  3UUD A;  1YY4 A;  4ONI A;  4IA2 A;  4DK8 A;  1KKQ A;  1NQ7 A;  4OHA A;  4DOR A;  3A9E A;  4N73 A;  2V7C A;  2ZNQ A;  3G9E A;  3V9V A;  4ZN7 A;  3F5C A;  2ZK5 A;  4HLW A;  3R29 A;  3OGT A;  5DXR A;  2Q5S A;  3W0A A;  1EXX A;  3PEQ A;  4JL4 A;  2O4J A;  2ABI A;  4M8H A;  1R1K A;  4OLM A;  3GZ9 A;  4MGD B;  4MGA B;  5EC9 A;  4B7W A;  3ERD A;  2LBD A;  3HLV A;  2GWX A;  1E3K A;  2PIW A;  2Q6R A;  3B3K A;  4PP6 A;  1H9U A;  1GS4 A;  3HO0 A;  3VRT A;  3ZR7 A;  4G1D A;  1ZGY A;  4OEA A;  4QE8 A;  4OGH A;  3K8S A;  1ZDU A;  2ZK1 A;  4NY9 A;  3AX8 A;  5DWE A;  4PLD A;  3VTD A;  4IA3 A;  3ERT A;  2FSZ A;  2QGT A;  3FS1 A;  3S9S A;  1QKT A;  1YP0 A;  2ZVT A;  2I4Z A;  3L0J A;  4PF3 A;  5DXM A;  3OLF A;  4J5W C;  1NRL A;  2VV1 A;  3AUN A;  3FXV A;  1RK3 A;  4ZO1 X;  3UU7 A;  4G1Y A;  3FC6 B;  3GWS X;  3OAP A;  4S0S A;  4N8R A;  5L7G A;  3N00 A;  2OCF A;  5DZ1 A;  3UP3 A;  2FAI A;  3ADV A;  4EMA A;  5C4T A;  5DKS A;  2AYR A;  3FLI A;  5L11 A;  4PP5 A;  3NSP A;  1Y0X X;  1XVP B;  3SP6 A;  5DUH A;  4IV2 A;  4LTW A;  3WGP A;  1T7R A;  2O4R A;  3OKI A;  1YUC A;  2YFE A;  1RDT D;  3B1M A;  2PJL A;  1VJB A;  2B1V A;  3ADT A;  3DCT A;  1YIM A;  4LBD A;  2QXM A;  5AYG A;  4OEY A;  3V9T A;  5I4V A;  2PIX A;  2HWR A;  4IWF A;  1TFC A;  5HYK A;  1T5Z A;  5FQS A;  1XP1 A;  3D5F A;  5EHJ A;  4F9M A;  3W0J A;  5JJM B;  3DCU A;  3WJ4 A;  2YJA B;  4E4Q A;  3KBA A;  1NYX A;  1XB7 A;  4OKW A;  1P8D A;  3SZ1 A;  5AAU A;  2E2R A;  5IAW A;  4MG8 A;  5EJV A;  5KRJ A;  5FQP A;  5KYA A;  3A3Z X;  2P1T A;  2GTK A;  2F4B A;  3IPU A;  3LMP A;  3FEI A;  4PXM A;  2IHQ A;  5DK9 A;  5L7E A;  4APU A;  3AZ1 A;  1SQN A;  2Q59 A;  4J26 A;  1ZH7 A;  2P7A A;  3FUR A;  3W5Q A;  3V3E A;  4OED A;  3ZRB A;  4A4W A;  5E15 A;  5KRH A;  4S0T A;  4YMQ A;  5HJP B;  2XHS A;  1NHZ A;  5LWP A;  2HBH A;  3D57 A;  1R5K A;  3CLD A;  3CS8 A;  2VSR A;  2GPO A;  2YLP A;  2QE4 A;  3PLZ A;  1Q4X A;  2ZY0 A;  4NIE A;  3GWX A;  1RKG A;  2GIU A;  2HWQ A;  3AN3 A;  1DB1 A;  3O1D A;  1ZKY A;  3UP0 A;  4WVD A;  3E94 A;  1UHL A;  2OZ7 A;  3VJI A;  4TV1 B;  5DVS A;  2O9I A;  4OKB A;  3RUU A;  3ET2 A;  1NDE A;  5C4S A;  2HFP A;  3DZY A;  3CQV A;  3BEJ A;  4QJR A;  5GIE A;  1XPC A;  4JAZ A;  5E0X A;  3W0G A;  2G44 A;  4J5X C;  3HC5 A;  2AX8 A;  4ZNT A;  1YMT A;  2I0G A;  3PCU A;  1MVC A;  4ZOM A;  1PZL A;  1HJ1 A;  4X1G A;  5DX3 B;  3CWD A;  3SP9 A;  2PIV A;  2QMV A;  1PQC A;  2P1U A;  3B65 A;  3D24 A;  4S14 A;  4DM8 A;  2Q5P A;  4RAK A;  2R40 D;  5DID A;  2H77 A;  4JYG A;  5EGV A;  2Q7J A;  4RZG A;  3OOK A;  2JFA A;  4MG9 B;  2POG A;  3MNO A;  2AA5 A;  1EXA A;  1WM0 X;  5K13 A;  2QZO B;  1QKM A;  1S9P A;  2HCD A;  2Q60 A;  3QT0 A;  3L3Z A;  4MG7 B;  5DXK A;  2AM9 A;  1FM9 D;  3GYU A;  2J4A A;  3CDP A;  4G2I A;  1QKU A;  4QK4 A;  1R20 A;  3CJW A;  3IA6 A;  3W5T A;  5A86 A;  1ERR A;  2Q5G A;  5DMC A;  4E2J A;  4YPQ A;  3VT7 A;  4P6W A;  2AX7 A;  5B5B A;  2PRG A;  1FCX A;  5IXK A;  1S0Z A;  1T7M A;  1RKH A;  2VV4 B;  4IVW A;  4L98 A;  2NV7 A;  4IS8 A;  1KNU A;  1XIU A;  4MGA A;  5AVL A;  3X1H A;  5APJ A;  4CSJ A;  2ACL B;  4OJ9 A;  2BJ4 A;  3Q95 B;  3X31 A;  3B0Q A;  3M7R A;  5DYB A;  2HAS A;  1ERE A;  1Z5X U;  4N1Y A;  3TX7 B;  3ZQT A;  3RVF A;  5DZ0 A;  3VRV A;  3D90 A;  4JGV A;  2R6W A;  1XQC A;  3IPQ A;  5AAV B;  2XYJ A;  3W0I A;  4JYI A;  3DZU D;  1L2J A;  1Y0S A;  3JZB A;  4OZT U;  3R8D A;  3OLS A;  4O8F A;  3W0H A;  2POB A;  3H0A A;  4YNK A;  5KCC A;  2ZK0 A;  5DL4 A;  1I7I A;  1FM6 A;  3IMY A;  3E7C A;  3FC6 A;  4ZJW A;  2VST A;  1YIN A;  1G5Y A;  1XOW A;  1P93 A;  2PNU A;  2BJ4 B;  2EWP A;  2ZXZ A;  4CI4 A;  3VHU A;  3G8O A;  3GBK A;  4LNX A;  4QL8 A;  3KYT A;  4OIU A;  3A2J A;  2JF9 A;  1XVP A;  3B0T A;  4MGC A;  1HG4 A;  3OSW A;  5DY8 A;  5G42 A;  3IXP D;  5KRL A;  5DXP A;  2GPU A;  1MZN A;  2ZK3 A;  5E7V A;  4DMA A;  3WFG A;  4IU7 A;  2ZLA A;  2ZLC A;  2HB8 A;  3P8X A;  1K7L A;  2VV0 A;  4RZE A;  3AFR A;  5APK A;  4RFW A;  1PQ9 A;  3OMM A;  5DTV A;  4OFR A;  5DWG A;  5JJM A;  2QPY A;  2GP7 A;  3AN4 A;  1ZEO A;  3P88 A;  4MG5 A;  4QM0 A;  3RLL A;  3V9Y A;  1FBY A;  3B68 A;  2NXX A;  1TXI A;  1XP6 A;  3PBA A;  5GIC A;  2QGW A;  3VT6 A;  5C4O A;  5B41 A;  2I0J A;  3OS8 A;  1GWR A;  1RJK A;  3HC6 A;  4FNE A;  3VT3 A;  4DQM A;  3H52 A; 
#chains in the Genus database with same CATH topology
 2QTU A;  3CS6 A;  3WT5 A;  2XYW A;  4EM9 A;  1T65 A;  3NOA A;  1NQ0 A;  3ADS A;  4MG6 A;  5ICK A;  1ZDT A;  5ACC A;  1U3R A;  2QXS A;  3ADX A;  1NAV A;  2H79 A;  2IOG A;  4OJB A;  2Q70 A;  3BC5 A;  1X7B A;  3X1I A;  5DKB A;  3B5R A;  3AZ2 A;  3ET3 A;  1UPV A;  4N5G A;  2B1Z A;  5HJP A;  1YOW A;  4MDD A;  5DUE A;  4ITF A;  3B67 A;  2ZNP A;  2Q3Y A;  2HB7 A;  2AX6 A;  1OT7 A;  5DI7 A;  1RDT A;  4J5X A;  3UUC A;  4Q0A C;  3L0E A;  2YAT A;  2ZMH A;  4OAR A;  4IA7 A;  4DM6 A;  5AZV A;  3F7D A;  5DV6 A;  3KMR A;  3WWR A;  1X76 A;  1XV9 B;  3K22 A;  1ZAF A;  1T79 A;  3R5N A;  2G5O A;  4TV1 A;  3VT5 A;  4OZR E;  3WT6 A;  2ZK6 A;  5DUG A;  5DVV A;  2OUZ A;  4XT9 A;  2XYX A;  2P1V A;  4RUO X;  2VV2 A;  2AB2 A;  2GPV A;  5DWJ A;  5LGA A;  1Y9R A;  3MNP A;  1I37 A;  4WLB A;  3UUA B;  1T63 A;  5DX3 A;  1N83 A;  1S0X A;  4HEE X;  4WHG A;  1GWQ A;  1S9Q A;  2XKW A;  1E3G A;  2Q6J A;  4PLE A;  3R5M A;  3ET0 A;  5DKE A;  2AA2 A;  4PP3 A;  4DK7 A;  4ZNS A;  5KCE A;  4XLD A;  5DMF A;  2AMA A;  1PQ6 A;  5ETH A;  4MG9 A;  3D6D A;  5DXB B;  3OOF A;  3KMZ A;  5DU5 A;  2PIR A;  3PRG A;  1MV9 A;  2B50 A;  2QZO A;  1QKN A;  5KRO A;  1A52 A;  4MG7 A;  4A4V A;  3IPS A;  2Q7I A;  4ZO1 B;  2ZAS A;  4DOS A;  4OKT A;  2YLQ A;  2ZMJ A;  1DKF B;  4Q50 A;  2Q1H A;  4FHH A;  4IW6 A;  3RLJ A;  4BCR A;  3CDS A;  2PIP L;  2ZBS A;  2QA8 B;  3K6P A;  5DV8 A;  1K74 D;  1M7W A;  1IE8 A;  4REF A;  1M13 A;  1NQ1 A;  1UPW A;  1XLS A;  2ZNN A;  4ZNH A;  2QH6 A;  2VV4 A;  3FEJ A;  4ZI1 A;  4ZJR A;  1YJE A;  4XTA A;  4OKX A;  5DZI A;  2FVJ A;  4IV4 A;  4K4J A;  2ACL A;  1OSH A;  1R6G A;  1G50 A;  4QE6 A;  3VRW A;  2REW A;  5EI1 A;  4J24 A;  3OLL A;  3T03 A;  3Q95 A;  1XNN A;  1XAP A;  2G0H A;  2AA7 A;  2PIT A;  2PKL A;  1NQ2 A;  4RWV A;  4UDA A;  3B0R A;  5M96 A;  3OSA A;  5DZ3 A;  2YJD A;  2R40 A;  3A2H A;  4ZN9 A;  3E00 D;  3OMO A;  3ET1 A;  4XUM A;  5AZT A;  4IVY A;  5AAV A;  3VN2 A;  4G2H A;  4R06 A;  2Q1V A;  1L2I A;  2ZXN A;  1LV2 A;  3FAL B;  4RUP A;  2VV3 A;  5DSH A;  3AUQ A;  5G45 A;  1FM9 A;  1PK5 A;  1T76 A;  3WFF A;  3OKH A;  4J5W A;  4LNW A;  2QAB A;  4WHF A;  1NUO A;  2AXA A;  1SKX A;  2QA6 A;  2R6Y A;  3P89 A;  4R6S A;  5KCD A;  2W8Y A;  4MGB B;  5JY3 A;  3KMG A;  4RMD A;  1SJ0 A;  3A2I A;  2PIU A;  1PRG A;  1ILG A;  2A3I A;  4JYH A;  4Q13 A;  4S15 A;  5DV3 A;  2Q7L A;  3B0W A;  4TUZ B;  2AMB A;  4X1F A;  3P0U A;  4KZM A;  4G20 A;  4G21 A;  4RE8 A;  3VT4 A;  1X7J A;  2P54 A;  1U3S A;  1R1K D;  2ZNO A;  3CTB A;  3GYT A;  4PVU A;  2QSE A;  1G1U A;  2YLO A;  3MNE A;  1OVL B;  2QNV A;  1G2N A;  3FUG A;  4OEZ A;  3DZU A;  3GN8 A;  4IWC A;  2QW4 A;  3JZC A;  5F9B A;  1N46 A;  3VSO A;  5KD9 A;  5C4U A;  3B66 A;  5DIG A;  1NAX A;  3HZF A;  3WMH A;  3HM1 A;  1XDK B;  1XLS E;  2J7Y A;  3VRU A;  3ZRA A;  3L3X A;  3OMK A;  5DWI A;  1U9E A;  5DXQ A;  5G5W A;  3DY6 A;  2JJ3 A;  1PDU A;  3HOD A;  5JI0 D;  1T74 A;  3V49 A;  1Z95 A;  5G46 A;  5HYR A;  4RZF A;  3VT8 A;  5DRJ A;  5DXG A;  3W5P A;  2G0G A;  1I38 A;  5GID A;  3IXP A;  3UVV B;  1XQ3 A;  3KDU A;  5KCT A;  3R2A A;  2AO6 A;  4NUF A;  3UUD B;  2ZK2 A;  1PCG A;  3HQ5 A;  2OM9 A;  2P7Z A;  2J7X A;  4UDD A;  3VT9 A;  2NPA A;  2NW4 A;  3A9E B;  4Y29 A;  4YT1 A;  4G1Z A;  2AAX A;  5E1C A;  5DXE A;  5SYZ A;  3U9Q A;  4POJ A;  3F5C B;  1XV9 A;  4WQP A;  2YLY A;  1OSV A;  4RMC A;  2IOK A;  5H1E A;  3VSP A;  4FGY A;  4E4K A;  5KCU A;  3AZ3 A;  4OC7 A;  1YYE A;  3PO9 A;  5EIT A;  4IQR A;  3UUA A;  5AK2 A;  1XNX A;  5KRK A;  3K23 A;  3WT7 A;  2HAR A;  4K7A A;  2OAX A;  5DYD A;  2P15 A;  5DZH A;  3TKC A;  4PPS A;  4WPF A;  5KRA A;  2HAM A;  4CI5 A;  3OMP A;  1FCY A;  5KRI A;  3CS4 A;  3GD2 A;  3NSQ A;  2ZK4 A;  3VJH A;  1ZUC A;  5DXB A;  5GT4 A;  5HCV A;  2I4J A;  2B23 A;  4PRG A;  4XUH A;  4ZNW A;  1KV6 A;  2ZL9 A;  4PPP A;  2VV1 B;  2Z4J A;  3UU7 B;  2AX9 A;  4OH6 A;  3X36 A;  4A2J A;  4PWL A;  3RUT A;  1DKF A;  2YHD A;  1UOM A;  4XAO A;  4UDC A;  5DIE A;  2Q6S A;  4ITE A;  2QA8 A;  5G43 A;  1X7E A;  1U3Q A;  2AA6 A;  3TY0 A;  5KYJ A;  5DWL A;  2ZXM A;  1YOK A;  1A28 A;  4RUJ A;  2ZFX A;  5DRM A;  1T73 A;  3L03 A;  1Z5X E;  2OVH A;  1T7T A;  1K4W A;  1S19 A;  4NB6 A;  5DP0 A;  5E19 A;  4IA1 A;  4POH A;  3L0L A;  4IUI A;  4XI3 A;  5KRF A;  3V3Q A;  4ZNU A;  1X78 A;  2P7G A;  5FQV A;  4OZT E;  5FQR A;  3OS8 C;  5G44 A;  4K6I A;  2NXX E;  5L7H A;  1YA3 A;  3DZY D;  3AUR A;  4OK1 A;  1XJ7 A;  1T7F A;  5E0W A;  1XP9 A;  3OS9 A;  4REE A;  4MG8 B;  4P6X A;  5AWK A;  1N4H A;  4KZJ A;  3FAL A;  1ILH A;  4LSJ A;  2HC4 A;  5G3J A;  3LBD A;  3VI8 A;  3KPZ A;  3W0Y A;  3O1E A;  5HJS A;  3WJ5 A;  2Q59 B;  1SR7 A;  2Q7K A;  4FN9 A;  3KWY A;  4OIV A;  1LBD A;  3OSI A;  3KDT A;  1FCZ A;  2GPP A;  2Z4B A;  1K74 A;  3TKM A;  3G0W A;  4R2U A;  5KRC A;  3DT3 A;  3OZJ A;  1FD0 A;  1BSX A;  4MGB A;  3W5R A;  2BAW A;  1IE9 A;  3VTC A;  3L1B A;  5KRM A;  5APH A;  4OFU A;  4OIL A;  5AVI A;  1R20 D;  2ATH A;  3W0C A;  4UDB A;  4NQA B;  4OJ4 A;  1UHL B;  4TUZ A;  5DVC A;  3VHV A;  4RME A;  3A78 A;  4M8E A;  2I4P A;  3DR1 A;  5DKG A;  3ILZ A;  5AWJ A;  3KFC A;  3VJS A;  2ZKC A;  3BQD A;  2AWH A;  3E00 A;  3R8I A;  3WTQ A;  1OVL A;  5DLR A;  4IW8 A;  3VHW A;  3VTB A;  2OVM A;  4L96 A;  4FHI A;  3EYB A;  4OZR U;  2J14 A;  3VJT A;  1I7G A;  3R8A A;  1XZX X;  5KR9 A;  2Q8S A;  3HVL A;  1XDK A;  2V0V A;  5HZC A;  2GL8 A;  3RY9 A;  1GWX A;  2P4Y A;  3ADU A;  5KCW A;  3ADW A;  2PIO A;  3OMQ A;  2JFA B;  5KCF A;  2PIQ A;  3G8I A;  4MGD A;  5CJ6 A;  4KZI A;  4ZNV A;  1X7R A;  2PIN A;  3OZ0 A;  5E14 A;  4XHD A;  2QR9 A;  3A40 X;  2Q61 A;  3H0A D;  3V4A A;  2HVC A;  5IZ0 A;  3UVV A;  4OH5 A;  1M2Z A;  1FM6 D;  2ZMI A;  5FQT A;  3UUD A;  1YY4 A;  4ONI A;  4IA2 A;  4DK8 A;  1KKQ A;  1NQ7 A;  4OHA A;  4DOR A;  3A9E A;  4N73 A;  2V7C A;  2ZNQ A;  3G9E A;  3V9V A;  4ZN7 A;  3F5C A;  2ZK5 A;  4HLW A;  3R29 A;  3OGT A;  5DXR A;  2Q5S A;  3W0A A;  1EXX A;  3PEQ A;  4JL4 A;  2O4J A;  2ABI A;  4M8H A;  1R1K A;  4OLM A;  3GZ9 A;  4MGD B;  4MGA B;  5EC9 A;  4B7W A;  3ERD A;  2LBD A;  3HLV A;  2GWX A;  1E3K A;  2PIW A;  2Q6R A;  3B3K A;  4PP6 A;  1H9U A;  1GS4 A;  3HO0 A;  3VRT A;  3ZR7 A;  4G1D A;  1ZGY A;  4OEA A;  4QE8 A;  4OGH A;  3K8S A;  1ZDU A;  2ZK1 A;  4NY9 A;  3AX8 A;  5DWE A;  4PLD A;  3VTD A;  4IA3 A;  3ERT A;  2FSZ A;  2QGT A;  3FS1 A;  3S9S A;  1QKT A;  1YP0 A;  2ZVT A;  2I4Z A;  3L0J A;  4PF3 A;  5DXM A;  3OLF A;  4J5W C;  1NRL A;  2VV1 A;  3AUN A;  3FXV A;  1RK3 A;  4ZO1 X;  3UU7 A;  4G1Y A;  3FC6 B;  3GWS X;  3OAP A;  4S0S A;  4N8R A;  5L7G A;  3N00 A;  2OCF A;  5DZ1 A;  3UP3 A;  2FAI A;  3ADV A;  4EMA A;  5C4T A;  5DKS A;  2AYR A;  3FLI A;  5L11 A;  4PP5 A;  3NSP A;  1Y0X X;  1XVP B;  3SP6 A;  5DUH A;  4IV2 A;  4LTW A;  3WGP A;  1T7R A;  2O4R A;  3OKI A;  1YUC A;  2YFE A;  1RDT D;  3B1M A;  2PJL A;  1VJB A;  2B1V A;  3ADT A;  3DCT A;  1YIM A;  4LBD A;  2QXM A;  5AYG A;  4OEY A;  3V9T A;  5I4V A;  2PIX A;  2HWR A;  4IWF A;  1TFC A;  5HYK A;  1T5Z A;  5FQS A;  1XP1 A;  3D5F A;  5EHJ A;  4F9M A;  3W0J A;  5JJM B;  3DCU A;  3WJ4 A;  2YJA B;  4E4Q A;  3KBA A;  1NYX A;  1XB7 A;  4OKW A;  1P8D A;  3SZ1 A;  5AAU A;  2E2R A;  5IAW A;  4MG8 A;  5EJV A;  5KRJ A;  5FQP A;  5KYA A;  3A3Z X;  2P1T A;  2GTK A;  2F4B A;  3IPU A;  3LMP A;  3FEI A;  4PXM A;  2IHQ A;  5DK9 A;  5L7E A;  4APU A;  3AZ1 A;  1SQN A;  2Q59 A;  4J26 A;  1ZH7 A;  2P7A A;  3FUR A;  3W5Q A;  3V3E A;  4OED A;  3ZRB A;  4A4W A;  5E15 A;  5KRH A;  4S0T A;  4YMQ A;  5HJP B;  2XHS A;  1NHZ A;  5LWP A;  2HBH A;  3D57 A;  1R5K A;  3CLD A;  3CS8 A;  2VSR A;  2GPO A;  2YLP A;  2QE4 A;  3PLZ A;  1Q4X A;  2ZY0 A;  4NIE A;  3GWX A;  1RKG A;  2GIU A;  2HWQ A;  3AN3 A;  1DB1 A;  3O1D A;  1ZKY A;  3UP0 A;  4WVD A;  3E94 A;  1UHL A;  2OZ7 A;  3VJI A;  4TV1 B;  5DVS A;  2O9I A;  4OKB A;  3RUU A;  3ET2 A;  1NDE A;  5C4S A;  2HFP A;  3DZY A;  3CQV A;  3BEJ A;  4QJR A;  5GIE A;  1XPC A;  4JAZ A;  5E0X A;  3W0G A;  2G44 A;  4J5X C;  3HC5 A;  2AX8 A;  4ZNT A;  1YMT A;  2I0G A;  3PCU A;  1MVC A;  4ZOM A;  1PZL A;  1HJ1 A;  4X1G A;  5DX3 B;  3CWD A;  3SP9 A;  2PIV A;  2QMV A;  1PQC A;  2P1U A;  3B65 A;  3D24 A;  4S14 A;  4DM8 A;  2Q5P A;  4RAK A;  2R40 D;  5DID A;  2H77 A;  4JYG A;  5EGV A;  2Q7J A;  4RZG A;  3OOK A;  2JFA A;  4MG9 B;  2POG A;  3MNO A;  2AA5 A;  1EXA A;  1WM0 X;  5K13 A;  2QZO B;  1QKM A;  1S9P A;  2HCD A;  2Q60 A;  3QT0 A;  3L3Z A;  4MG7 B;  5DXK A;  2AM9 A;  1FM9 D;  3GYU A;  2J4A A;  3CDP A;  4G2I A;  1QKU A;  4QK4 A;  1R20 A;  3CJW A;  3IA6 A;  3W5T A;  5A86 A;  1ERR A;  2Q5G A;  5DMC A;  4E2J A;  4YPQ A;  3VT7 A;  4P6W A;  2AX7 A;  5B5B A;  2PRG A;  1FCX A;  5IXK A;  1S0Z A;  1T7M A;  1RKH A;  2VV4 B;  4IVW A;  4L98 A;  2NV7 A;  4IS8 A;  1KNU A;  1XIU A;  4MGA A;  5AVL A;  3X1H A;  5APJ A;  4CSJ A;  2ACL B;  4OJ9 A;  2BJ4 A;  3Q95 B;  3X31 A;  3B0Q A;  3M7R A;  5DYB A;  2HAS A;  1ERE A;  1Z5X U;  4N1Y A;  3TX7 B;  3ZQT A;  3RVF A;  5DZ0 A;  3VRV A;  3D90 A;  4JGV A;  2R6W A;  1XQC A;  3IPQ A;  5AAV B;  2XYJ A;  3W0I A;  4JYI A;  3DZU D;  1L2J A;  1Y0S A;  3JZB A;  4OZT U;  3R8D A;  3OLS A;  4O8F A;  3W0H A;  2POB A;  3H0A A;  4YNK A;  5KCC A;  2ZK0 A;  5DL4 A;  1I7I A;  1FM6 A;  3IMY A;  3E7C A;  3FC6 A;  4ZJW A;  2VST A;  1YIN A;  1G5Y A;  1XOW A;  1P93 A;  2PNU A;  2BJ4 B;  2EWP A;  2ZXZ A;  4CI4 A;  3VHU A;  3G8O A;  3GBK A;  4LNX A;  4QL8 A;  3KYT A;  4OIU A;  3A2J A;  2JF9 A;  1XVP A;  3B0T A;  4MGC A;  1HG4 A;  3OSW A;  5DY8 A;  5G42 A;  3IXP D;  5KRL A;  5DXP A;  2GPU A;  1MZN A;  2ZK3 A;  5E7V A;  4DMA A;  3WFG A;  4IU7 A;  2ZLA A;  2ZLC A;  2HB8 A;  3P8X A;  1K7L A;  2VV0 A;  4RZE A;  3AFR A;  5APK A;  4RFW A;  1PQ9 A;  3OMM A;  5DTV A;  4OFR A;  5DWG A;  5JJM A;  2QPY A;  2GP7 A;  3AN4 A;  1ZEO A;  3P88 A;  4MG5 A;  4QM0 A;  3RLL A;  3V9Y A;  1FBY A;  3B68 A;  2NXX A;  1TXI A;  1XP6 A;  3PBA A;  5GIC A;  2QGW A;  3VT6 A;  5C4O A;  5B41 A;  2I0J A;  3OS8 A;  1GWR A;  1RJK A;  3HC6 A;  4FNE A;  3VT3 A;  4DQM A;  3H52 A; 
#chains in the Genus database with same CATH homology
 2QTU A;  3CS6 A;  3WT5 A;  2XYW A;  4EM9 A;  1T65 A;  3NOA A;  1NQ0 A;  3ADS A;  4MG6 A;  5ICK A;  1ZDT A;  5ACC A;  1U3R A;  2QXS A;  3ADX A;  1NAV A;  2H79 A;  2IOG A;  4OJB A;  2Q70 A;  3BC5 A;  1X7B A;  3X1I A;  5DKB A;  3B5R A;  3AZ2 A;  3ET3 A;  1UPV A;  4N5G A;  2B1Z A;  5HJP A;  1YOW A;  4MDD A;  5DUE A;  4ITF A;  3B67 A;  2ZNP A;  2Q3Y A;  2HB7 A;  2AX6 A;  1OT7 A;  5DI7 A;  1RDT A;  4J5X A;  3UUC A;  4Q0A C;  3L0E A;  2YAT A;  2ZMH A;  4OAR A;  4IA7 A;  4DM6 A;  5AZV A;  3F7D A;  5DV6 A;  3KMR A;  3WWR A;  1X76 A;  1XV9 B;  3K22 A;  1ZAF A;  1T79 A;  3R5N A;  2G5O A;  4TV1 A;  3VT5 A;  4OZR E;  3WT6 A;  2ZK6 A;  5DUG A;  5DVV A;  2OUZ A;  4XT9 A;  2XYX A;  2P1V A;  4RUO X;  2VV2 A;  2AB2 A;  2GPV A;  5DWJ A;  5LGA A;  1Y9R A;  3MNP A;  1I37 A;  4WLB A;  3UUA B;  1T63 A;  5DX3 A;  1N83 A;  1S0X A;  4HEE X;  4WHG A;  1GWQ A;  1S9Q A;  2XKW A;  1E3G A;  2Q6J A;  4PLE A;  3R5M A;  3ET0 A;  5DKE A;  2AA2 A;  4PP3 A;  4DK7 A;  4ZNS A;  5KCE A;  4XLD A;  5DMF A;  2AMA A;  1PQ6 A;  5ETH A;  4MG9 A;  3D6D A;  5DXB B;  3OOF A;  3KMZ A;  5DU5 A;  2PIR A;  3PRG A;  1MV9 A;  2B50 A;  2QZO A;  1QKN A;  5KRO A;  1A52 A;  4MG7 A;  4A4V A;  3IPS A;  2Q7I A;  4ZO1 B;  2ZAS A;  4DOS A;  4OKT A;  2YLQ A;  2ZMJ A;  1DKF B;  4Q50 A;  2Q1H A;  4FHH A;  4IW6 A;  3RLJ A;  4BCR A;  3CDS A;  2PIP L;  2ZBS A;  2QA8 B;  3K6P A;  5DV8 A;  1K74 D;  1M7W A;  1IE8 A;  4REF A;  1M13 A;  1NQ1 A;  1UPW A;  1XLS A;  2ZNN A;  4ZNH A;  2QH6 A;  2VV4 A;  3FEJ A;  4ZI1 A;  4ZJR A;  1YJE A;  4XTA A;  4OKX A;  5DZI A;  2FVJ A;  4IV4 A;  4K4J A;  2ACL A;  1OSH A;  1R6G A;  1G50 A;  4QE6 A;  3VRW A;  2REW A;  5EI1 A;  4J24 A;  3OLL A;  3T03 A;  3Q95 A;  1XNN A;  1XAP A;  2G0H A;  2AA7 A;  2PIT A;  2PKL A;  1NQ2 A;  4RWV A;  4UDA A;  3B0R A;  5M96 A;  3OSA A;  5DZ3 A;  2YJD A;  2R40 A;  3A2H A;  4ZN9 A;  3E00 D;  3OMO A;  3ET1 A;  4XUM A;  5AZT A;  4IVY A;  5AAV A;  3VN2 A;  4G2H A;  4R06 A;  2Q1V A;  1L2I A;  2ZXN A;  1LV2 A;  3FAL B;  4RUP A;  2VV3 A;  5DSH A;  3AUQ A;  5G45 A;  1FM9 A;  1PK5 A;  1T76 A;  3WFF A;  3OKH A;  4J5W A;  4LNW A;  2QAB A;  4WHF A;  1NUO A;  2AXA A;  1SKX A;  2QA6 A;  2R6Y A;  3P89 A;  4R6S A;  5KCD A;  2W8Y A;  4MGB B;  5JY3 A;  3KMG A;  4RMD A;  1SJ0 A;  3A2I A;  2PIU A;  1PRG A;  1ILG A;  2A3I A;  4JYH A;  4Q13 A;  4S15 A;  5DV3 A;  2Q7L A;  3B0W A;  4TUZ B;  2AMB A;  4X1F A;  3P0U A;  4KZM A;  4G20 A;  4G21 A;  4RE8 A;  3VT4 A;  1X7J A;  2P54 A;  1U3S A;  1R1K D;  2ZNO A;  3CTB A;  3GYT A;  4PVU A;  2QSE A;  1G1U A;  2YLO A;  3MNE A;  1OVL B;  2QNV A;  1G2N A;  3FUG A;  4OEZ A;  3DZU A;  3GN8 A;  4IWC A;  2QW4 A;  3JZC A;  5F9B A;  1N46 A;  3VSO A;  5KD9 A;  5C4U A;  3B66 A;  5DIG A;  1NAX A;  3HZF A;  3WMH A;  3HM1 A;  1XDK B;  1XLS E;  2J7Y A;  3VRU A;  3ZRA A;  3L3X A;  3OMK A;  5DWI A;  1U9E A;  5DXQ A;  5G5W A;  3DY6 A;  2JJ3 A;  1PDU A;  3HOD A;  5JI0 D;  1T74 A;  3V49 A;  1Z95 A;  5G46 A;  5HYR A;  4RZF A;  3VT8 A;  5DRJ A;  5DXG A;  3W5P A;  2G0G A;  1I38 A;  5GID A;  3IXP A;  3UVV B;  1XQ3 A;  3KDU A;  5KCT A;  3R2A A;  2AO6 A;  4NUF A;  3UUD B;  2ZK2 A;  1PCG A;  3HQ5 A;  2OM9 A;  2P7Z A;  2J7X A;  4UDD A;  3VT9 A;  2NPA A;  2NW4 A;  3A9E B;  4Y29 A;  4YT1 A;  4G1Z A;  2AAX A;  5E1C A;  5DXE A;  5SYZ A;  3U9Q A;  4POJ A;  3F5C B;  1XV9 A;  4WQP A;  2YLY A;  1OSV A;  4RMC A;  2IOK A;  5H1E A;  3VSP A;  4FGY A;  4E4K A;  5KCU A;  3AZ3 A;  4OC7 A;  1YYE A;  3PO9 A;  5EIT A;  4IQR A;  3UUA A;  5AK2 A;  1XNX A;  5KRK A;  3K23 A;  3WT7 A;  2HAR A;  4K7A A;  2OAX A;  5DYD A;  2P15 A;  5DZH A;  3TKC A;  4PPS A;  4WPF A;  5KRA A;  2HAM A;  4CI5 A;  3OMP A;  1FCY A;  5KRI A;  3CS4 A;  3GD2 A;  3NSQ A;  2ZK4 A;  3VJH A;  1ZUC A;  5DXB A;  5GT4 A;  5HCV A;  2I4J A;  2B23 A;  4PRG A;  4XUH A;  4ZNW A;  1KV6 A;  2ZL9 A;  4PPP A;  2VV1 B;  2Z4J A;  3UU7 B;  2AX9 A;  4OH6 A;  3X36 A;  4A2J A;  4PWL A;  3RUT A;  1DKF A;  2YHD A;  1UOM A;  4XAO A;  4UDC A;  5DIE A;  2Q6S A;  4ITE A;  2QA8 A;  5G43 A;  1X7E A;  1U3Q A;  2AA6 A;  3TY0 A;  5KYJ A;  5DWL A;  2ZXM A;  1YOK A;  1A28 A;  4RUJ A;  2ZFX A;  5DRM A;  1T73 A;  3L03 A;  1Z5X E;  2OVH A;  1T7T A;  1K4W A;  1S19 A;  4NB6 A;  5DP0 A;  5E19 A;  4IA1 A;  4POH A;  3L0L A;  4IUI A;  4XI3 A;  5KRF A;  3V3Q A;  4ZNU A;  1X78 A;  2P7G A;  5FQV A;  4OZT E;  5FQR A;  3OS8 C;  5G44 A;  4K6I A;  2NXX E;  5L7H A;  1YA3 A;  3DZY D;  3AUR A;  4OK1 A;  1XJ7 A;  1T7F A;  5E0W A;  1XP9 A;  3OS9 A;  4REE A;  4MG8 B;  4P6X A;  5AWK A;  1N4H A;  4KZJ A;  3FAL A;  1ILH A;  4LSJ A;  2HC4 A;  5G3J A;  3LBD A;  3VI8 A;  3KPZ A;  3W0Y A;  3O1E A;  5HJS A;  3WJ5 A;  2Q59 B;  1SR7 A;  2Q7K A;  4FN9 A;  3KWY A;  4OIV A;  1LBD A;  3OSI A;  3KDT A;  1FCZ A;  2GPP A;  2Z4B A;  1K74 A;  3TKM A;  3G0W A;  4R2U A;  5KRC A;  3DT3 A;  3OZJ A;  1FD0 A;  1BSX A;  4MGB A;  3W5R A;  2BAW A;  1IE9 A;  3VTC A;  3L1B A;  5KRM A;  5APH A;  4OFU A;  4OIL A;  5AVI A;  1R20 D;  2ATH A;  3W0C A;  4UDB A;  4NQA B;  4OJ4 A;  1UHL B;  4TUZ A;  5DVC A;  3VHV A;  4RME A;  3A78 A;  4M8E A;  2I4P A;  3DR1 A;  5DKG A;  3ILZ A;  5AWJ A;  3KFC A;  3VJS A;  2ZKC A;  3BQD A;  2AWH A;  3E00 A;  3R8I A;  3WTQ A;  1OVL A;  5DLR A;  4IW8 A;  3VHW A;  3VTB A;  2OVM A;  4L96 A;  4FHI A;  3EYB A;  4OZR U;  2J14 A;  3VJT A;  1I7G A;  3R8A A;  1XZX X;  5KR9 A;  2Q8S A;  3HVL A;  1XDK A;  2V0V A;  5HZC A;  2GL8 A;  3RY9 A;  1GWX A;  2P4Y A;  3ADU A;  5KCW A;  3ADW A;  2PIO A;  3OMQ A;  2JFA B;  5KCF A;  2PIQ A;  3G8I A;  4MGD A;  5CJ6 A;  4KZI A;  4ZNV A;  1X7R A;  2PIN A;  3OZ0 A;  5E14 A;  4XHD A;  2QR9 A;  3A40 X;  2Q61 A;  3H0A D;  3V4A A;  2HVC A;  5IZ0 A;  3UVV A;  4OH5 A;  1M2Z A;  1FM6 D;  2ZMI A;  5FQT A;  3UUD A;  1YY4 A;  4ONI A;  4IA2 A;  4DK8 A;  1KKQ A;  1NQ7 A;  4OHA A;  4DOR A;  3A9E A;  4N73 A;  2V7C A;  2ZNQ A;  3G9E A;  3V9V A;  4ZN7 A;  3F5C A;  2ZK5 A;  4HLW A;  3R29 A;  3OGT A;  5DXR A;  2Q5S A;  3W0A A;  1EXX A;  3PEQ A;  4JL4 A;  2O4J A;  2ABI A;  4M8H A;  1R1K A;  4OLM A;  3GZ9 A;  4MGD B;  4MGA B;  5EC9 A;  4B7W A;  3ERD A;  2LBD A;  3HLV A;  2GWX A;  1E3K A;  2PIW A;  2Q6R A;  3B3K A;  4PP6 A;  1H9U A;  1GS4 A;  3HO0 A;  3VRT A;  3ZR7 A;  4G1D A;  1ZGY A;  4OEA A;  4QE8 A;  4OGH A;  3K8S A;  1ZDU A;  2ZK1 A;  4NY9 A;  3AX8 A;  5DWE A;  4PLD A;  3VTD A;  4IA3 A;  3ERT A;  2FSZ A;  2QGT A;  3FS1 A;  3S9S A;  1QKT A;  1YP0 A;  2ZVT A;  2I4Z A;  3L0J A;  4PF3 A;  5DXM A;  3OLF A;  4J5W C;  1NRL A;  2VV1 A;  3AUN A;  3FXV A;  1RK3 A;  4ZO1 X;  3UU7 A;  4G1Y A;  3FC6 B;  3GWS X;  3OAP A;  4S0S A;  4N8R A;  5L7G A;  3N00 A;  2OCF A;  5DZ1 A;  3UP3 A;  2FAI A;  3ADV A;  4EMA A;  5C4T A;  5DKS A;  2AYR A;  3FLI A;  5L11 A;  4PP5 A;  3NSP A;  1Y0X X;  1XVP B;  3SP6 A;  5DUH A;  4IV2 A;  4LTW A;  3WGP A;  1T7R A;  2O4R A;  3OKI A;  1YUC A;  2YFE A;  1RDT D;  3B1M A;  2PJL A;  1VJB A;  2B1V A;  3ADT A;  3DCT A;  1YIM A;  4LBD A;  2QXM A;  5AYG A;  4OEY A;  3V9T A;  5I4V A;  2PIX A;  2HWR A;  4IWF A;  1TFC A;  5HYK A;  1T5Z A;  5FQS A;  1XP1 A;  3D5F A;  5EHJ A;  4F9M A;  3W0J A;  5JJM B;  3DCU A;  3WJ4 A;  2YJA B;  4E4Q A;  3KBA A;  1NYX A;  1XB7 A;  4OKW A;  1P8D A;  3SZ1 A;  5AAU A;  2E2R A;  5IAW A;  4MG8 A;  5EJV A;  5KRJ A;  5FQP A;  5KYA A;  3A3Z X;  2P1T A;  2GTK A;  2F4B A;  3IPU A;  3LMP A;  3FEI A;  4PXM A;  2IHQ A;  5DK9 A;  5L7E A;  4APU A;  3AZ1 A;  1SQN A;  2Q59 A;  4J26 A;  1ZH7 A;  2P7A A;  3FUR A;  3W5Q A;  3V3E A;  4OED A;  3ZRB A;  4A4W A;  5E15 A;  5KRH A;  4S0T A;  4YMQ A;  5HJP B;  2XHS A;  1NHZ A;  5LWP A;  2HBH A;  3D57 A;  1R5K A;  3CLD A;  3CS8 A;  2VSR A;  2GPO A;  2YLP A;  2QE4 A;  3PLZ A;  1Q4X A;  2ZY0 A;  4NIE A;  3GWX A;  1RKG A;  2GIU A;  2HWQ A;  3AN3 A;  1DB1 A;  3O1D A;  1ZKY A;  3UP0 A;  4WVD A;  3E94 A;  1UHL A;  2OZ7 A;  3VJI A;  4TV1 B;  5DVS A;  2O9I A;  4OKB A;  3RUU A;  3ET2 A;  1NDE A;  5C4S A;  2HFP A;  3DZY A;  3CQV A;  3BEJ A;  4QJR A;  5GIE A;  1XPC A;  4JAZ A;  5E0X A;  3W0G A;  2G44 A;  4J5X C;  3HC5 A;  2AX8 A;  4ZNT A;  1YMT A;  2I0G A;  3PCU A;  1MVC A;  4ZOM A;  1PZL A;  1HJ1 A;  4X1G A;  5DX3 B;  3CWD A;  3SP9 A;  2PIV A;  2QMV A;  1PQC A;  2P1U A;  3B65 A;  3D24 A;  4S14 A;  4DM8 A;  2Q5P A;  4RAK A;  2R40 D;  5DID A;  2H77 A;  4JYG A;  5EGV A;  2Q7J A;  4RZG A;  3OOK A;  2JFA A;  4MG9 B;  2POG A;  3MNO A;  2AA5 A;  1EXA A;  1WM0 X;  5K13 A;  2QZO B;  1QKM A;  1S9P A;  2HCD A;  2Q60 A;  3QT0 A;  3L3Z A;  4MG7 B;  5DXK A;  2AM9 A;  1FM9 D;  3GYU A;  2J4A A;  3CDP A;  4G2I A;  1QKU A;  4QK4 A;  1R20 A;  3CJW A;  3IA6 A;  3W5T A;  5A86 A;  1ERR A;  2Q5G A;  5DMC A;  4E2J A;  4YPQ A;  3VT7 A;  4P6W A;  2AX7 A;  5B5B A;  2PRG A;  1FCX A;  5IXK A;  1S0Z A;  1T7M A;  1RKH A;  2VV4 B;  4IVW A;  4L98 A;  2NV7 A;  4IS8 A;  1KNU A;  1XIU A;  4MGA A;  5AVL A;  3X1H A;  5APJ A;  4CSJ A;  2ACL B;  4OJ9 A;  2BJ4 A;  3Q95 B;  3X31 A;  3B0Q A;  3M7R A;  5DYB A;  2HAS A;  1ERE A;  1Z5X U;  4N1Y A;  3TX7 B;  3ZQT A;  3RVF A;  5DZ0 A;  3VRV A;  3D90 A;  4JGV A;  2R6W A;  1XQC A;  3IPQ A;  5AAV B;  2XYJ A;  3W0I A;  4JYI A;  3DZU D;  1L2J A;  1Y0S A;  3JZB A;  4OZT U;  3R8D A;  3OLS A;  4O8F A;  3W0H A;  2POB A;  3H0A A;  4YNK A;  5KCC A;  2ZK0 A;  5DL4 A;  1I7I A;  1FM6 A;  3IMY A;  3E7C A;  3FC6 A;  4ZJW A;  2VST A;  1YIN A;  1G5Y A;  1XOW A;  1P93 A;  2PNU A;  2BJ4 B;  2EWP A;  2ZXZ A;  4CI4 A;  3VHU A;  3G8O A;  3GBK A;  4LNX A;  4QL8 A;  3KYT A;  4OIU A;  3A2J A;  2JF9 A;  1XVP A;  3B0T A;  4MGC A;  1HG4 A;  3OSW A;  5DY8 A;  5G42 A;  3IXP D;  5KRL A;  5DXP A;  2GPU A;  1MZN A;  2ZK3 A;  5E7V A;  4DMA A;  3WFG A;  4IU7 A;  2ZLA A;  2ZLC A;  2HB8 A;  3P8X A;  1K7L A;  2VV0 A;  4RZE A;  3AFR A;  5APK A;  4RFW A;  1PQ9 A;  3OMM A;  5DTV A;  4OFR A;  5DWG A;  5JJM A;  2QPY A;  2GP7 A;  3AN4 A;  1ZEO A;  3P88 A;  4MG5 A;  4QM0 A;  3RLL A;  3V9Y A;  1FBY A;  3B68 A;  2NXX A;  1TXI A;  1XP6 A;  3PBA A;  5GIC A;  2QGW A;  3VT6 A;  5C4O A;  5B41 A;  2I0J A;  3OS8 A;  1GWR A;  1RJK A;  3HC6 A;  4FNE A;  3VT3 A;  4DQM A;  3H52 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...