4TUZA

Crystal structure of hera-lbd (y537s) in complex with alpha-zearalenol
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
245
structure length
235
Chain Sequence
SLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLEAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKKNVVPLSDLLLEMLDAHRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A structural perspective on nuclear receptors as targets of environmental compounds.
pubmed doi rcsb
molecule keywords Estrogen receptor
molecule tags Nuclear protein
source organism Homo sapiens
total genus 89
structure length 235
sequence length 245
ec nomenclature
pdb deposition date 2014-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 4tuzA00
4OC7A 3D5FA 5DI7A 1G5YA 3L3ZA 5E0WA 4OEDA 4OKXA 1ZH7A 3CLDA 5L7EA 3W0HA 5KCWA 2Q6SA 1OVLA 2OVHA 4O8FA 2Q60A 5DV8A 4TV1A 5DTVA 1T65A 1S0XA 2P1UA 2ZK1A 5HYRA 5LWPA 1X76A 1RDTD 3W5QA 2PITA 3L0JA 3FXVA 4J5WC 5K13A 3G0WA 1FM6A 2PIUA 4MG7B 5DVVA 5E0XA 2QXSA 5C4OA 4OJ9A 4DOSA 2YFEA 2I0JA 2VV3A 5B5BA 2O4RA 1S19A 1EXAA 1T7RA 1XQ3A 2BJ4A 3DT3A 4OHAA 1KNUA 2B1ZA 1K7LA 4ZN7A 4NB6A 4OIVA 1XOWA 5L7GA 3AZ3A 2PIQA 3VJHA 2ABIA 4YMQA 4G2HA 5DY8A 2Q8SA 3A2HA 1EXXA 4QM0A 1T79A 4S15A 3CTBA 4UDAA 4RMDA 2G0GA 4MGBA 2AWHA 4F9MA 2HVCA 2OAXA 4QK4A 4RUPA 4UDDA 4JYHA 4OEAA 4WVDA 3ZQTA 5HZCA 5JJMA 4NQAB 2Q7IA 2VV4A 3V9YA 2LBDA 1S9PA 5DYDA 4E4QA 1FCXA 4Q0AC 3OLLA 5G46A 1NUOA 5SYZA 5KCFA 1WM0X 5G5WA 1XDKA 4WHFA 1QKUA 1RK3A 4G2IA 4RFWA 2QGWA 1I38A 3CQVA 5E15A 3B68A 5E1CA 2PIOA 2Q61A 4OZTU 3VJSA 5AVIA 3W0IA 2Z4JA 2OUZA 2Q1VA 3FLIA 2ZMIA 3WWRA 4WQPA 1PQCA 1OSHA 4JYIA 4ZNSA 3ADSA 5DKGA 2I4JA 3KWYA 4HEEX 3HODA 2ZNPA 2VSTA 3VT4A 4KZMA 4DK8A 4PPPA 5DZIA 4JL4A 2G44A 4K7AA 4PP3A 2GPUA 2YJAB 5AAUA 3H52A 3A9EB 5C4UA 3X1IA 4N8RA 3VHUA 3OLFA 1ZDUA 3NOAA 3VTCA 2OVMA 3VT5A 5DZ3A 2PINA 4X1FA 1ZGYA 2QH6A 3B66A 4IUIA 4A4WA 3OS9A 1X7RA 3P89A 1XP9A 3FALA 4OK1A 3PBAA 4OKTA 5AZTA 1Q4XA 1T73A 3VI8A 3VRTA 3EYBA 3VT7A 1H9UA 3B5RA 5HJPA 3OAPA 3KDUA 5E14A 3AZ1A 4IVYA 3DZUD 5G44A 1UOMA 2VV2A 3ERDA 1G50A 1A52A 1HG4A 2V0VA 5DMFA 5I4VA 3F5CB 3GWXA 3VJIA 4OZRE 3D24A 1XIUA 5DWJA 2AXAA 4LTWA 2P7GA 5C4TA 2R6YA 3WFGA 4ZNVA 1NQ0A 5G42A 5DLRA 1PQ9A 5DP0A 1Y0SA 2AA6A 2PKLA 2ZXNA 2HARA 4OH5A 3KPZA 1E3GA 1SJ0A 2QE4A 4PP6A 3R5NA 1E3KA 4S14A 3R8DA 3W0JA 1EREA 3WT5A 4CSJA 4R2UA 5FQVA 2Q6RA 1ZDTA 3W5TA 3MNEA 2HAMA 2HB7A 3G8OA 3OS8C 5AVLA 3IPSA 5DRJA 5FQTA 4IQRA 5G3JA 2B50A 4MG9B 3M7RA 1A28A 3W0CA 1KKQA 3DZYA 5F9BA 4K4JA 3UUAB 1X7JA 5EHJA 3QT0A 3KMZA 3UUAA 2ZNOA 1NQ7A 2QA8A 3BC5A 1U3SA 2ZVTA 4RWVA 2ZNNA 5DUGA 2OZ7A 2YLQA 4RZGA 3V9VA 2FAIA 2P7AA 3CS8A 2P7ZA 1YMTA 3P0UA 2XKWA 3H0AD 1NDEA 1YINA 3O1DA 3OMPA 4J5WA 4OZRU 1NAXA 3X36A 3UVVA 3GYTA 3TY0A 1FCYA 3HC6A 4HLWA 2ZK4A 5DRMA 2W8YA 4IA1A 3ADUA 5KYJA 1OT7A 2VV1A 5GIDA 1XVPB 2QGTA 3K6PA 1XVPA 4XLDA 3VN2A 1BSXA 3ADVA 4PP5A 4YPQA 3WTQA 5DL4A 1S0ZA 4IWFA 2PRGA 4Y29A 2POGA 5DXPA 1OVLB 3L0LA 3RVFA 1IE8A 4TV1B 3B67A 2XHSA 2AB2A 3X31A 2AO6A 1XNNA 3Q95A 5HCVA 4PVUA 4LNWA 4QJRA 4KZJA 3K22A 2ZK3A 5KROA 2PIPL 2ZL9A 3FC6A 3AFRA 3ET3A 1XQCA 4IA2A 4LBDA 4X1GA 1QKNA 3ET2A 4PXMA 1RKGA 5DWIA 5DXMA 2Z4BA 2VV0A 5JI0D 2BJ4B 3GWSX 4PLEA 1NAVA 1MV9A 1I7IA 2ZXMA 2GTKA 5DUHA 3VTDA 2AM9A 4OEYA 3HM1A 5KRIA 1XV9A 1Z95A 2YLOA 3PCUA 1N83A 3IXPD 2OM9A 2P54A 4MGBB 4MG8A 1XJ7A 5JJMB 2VSRA 2E2RA 4IV2A 2QW4A 2VV4B 1RDTA 2ZK0A 4G1YA 4QE8A 5DZ0A 4ZNUA 1RKHA 5G43A 3OKIA 1X7BA 1FM9A 1ZKYA 2EWPA 1R20D 1T76A 4REFA 2GP7A 5DIDA 5FQSA 5KYAA 3GN8A 4JAZA 4EMAA 1K4WA 5IZ0A 3W5RA 5KRHA 1XDKB 3KMRA 3OMOA 5DVCA 3CWDA 3E00D 3AZ2A 3GBKA 5IXKA 3GD2A 4UDCA 3RUTA 5ACCA 5JY3A 1GWXA 5B41A 5DWGA 1M13A 3UUCA 5DZ1A 4XI3A 4RZEA 1M2ZA 1T63A 4NY9A 4OIUA 3L0EA 2AAXA 2ZNQA 4FHIA 2JF9A 1YJEA 2PJLA 5DXQA 5KRLA 1FBYA 4L98A 4Q50A 2I4PA 4EM9A 4S0TA 3D90A 1Z5XE 2GIUA 2IOGA 4OILA 4ZI1A 3VSOA 3WT7A 5KCCA 3K23A 4PF3A 2FSZA 4MGDB 1XZXX 4MGDA 5DWEA 4OJBA 5H1EA 2HASA 2ZXZA 3GYUA 4J24A 4DK7A 3FALB 3OLSA 4OJ4A 2JFAA 3FURA 1R1KA 5DK9A 3OS8A 5KRJA 1SR7A 3OGTA 4CI4A 3GZ9A 4MG5A 4OKWA 4ZNTA 5HJPB 1ZUCA 4WPFA 4M8HA 2R40D 1NYXA 2ACLA 1L2JA 5ICKA 3OMQA 1YUCA 4DMAA 5DX3A 3FUGA 5EITA 4NIEA 4A4VA 4XTAA 1K74A 3FS1A 1UPVA 3R2AA 1PQ6A 3RUUA 3SZ1A 3VHWA 3JZCA 5M96A 3ADXA 3R8IA 5KCDA 2ZBSA 4PPSA 2O4JA 1GWQA 3WGPA 1R5KA 1XAPA 2P15A 1LV2A 1M7WA 3B0WA 1PRGA 4N5GA 5KRFA 2Q6JA 4RUJA 3VJTA 3A40X 4YNKA 5APJA 3B65A 3T03A 2QA6A 5DXKA 1DKFA 3V3QA 1Z5XU 2GPPA 3VRWA 3HZFA 3R29A 5HJSA 5L7HA 3DCTA 1T7TA 3DZUA 4N1YA 3V4AA 4REEA 2H77A 5A86A 5IAWA 3DZYD 3HLVA 2AX7A 1XP6A 4ZNWA 1S9QA 2PIXA 3OOKA 4OEZA 5EC9A 2QA8B 3LBDA 4IVWA 3WFFA 2HFPA 3B0RA 3NSQA 2B23A 1X78A 2J7YA 3IA6A 5GICA 2B1VA 1XP1A 5DXRA 3P88A 3FEJA 5AYGA 2BAWA 2AMAA 2AX8A 2IHQA 2OCFA 1YA3A 2R6WA 2H79A 3B1MA 5FQRA 1X7EA 3UVVB 4POHA 5DUEA 3BQDA 1GS4A 4QE6A 3HO0A 3HC5A 3VHVA 1R6GA 2Q59B 4MGCA 5KRMA 3R8AA 2Q59A 1NQ2A 4POJA 1YOWA 2VV1B 2NV7A 1T5ZA 4OGHA 4R6SA 3DY6A 2P1TA 3OOFA 1I7GA 5FQPA 5ETHA 3PRGA 1XPCA 4FHHA 3IPUA 4ITFA 5DIGA 4ZJWA 5G45A 3E7CA 5AWJA 5DXGA 3IMYA 4E4KA 5AZVA 3RLLA 5KD9A 1N4HA 4DORA 3CDPA 4OARA 4OFUA 5LGAA 3TKMA 5KRCA 3WJ4A 5APHA 3G9EA 5DVSA 3S9SA 1VJBA 2QTUA 3OZJA 3Q95B 2I4ZA 4JGVA 4P6WA 2YHDA 3V49A 3IPQA 4MG6A 2GL8A 2F4BA 4XAOA 3UUDB 5KR9A 1NRLA 2HWQA 3MNOA 3UUDA 3VT3A 2YLYA 4RZFA 3UP0A 5DYBA 2A3IA 3FC6B 2AA2A 3PO9A 3SP9A 4MDDA 5KRAA 1YOKA 5E19A 1ZAFA 2HCDA 3A2IA 5DKSA 3B3KA 1FM6D 3CS4A 2GPVA 2ZLCA 3CJWA 4JYGA 4MGAA 4IU7A 5DSHA 4DQMA 2ZK2A 3VT8A 2QABA 3ET1A 3KBAA 3RLJA 3W0GA 4N73A 1XV9B 5DV6A 3KFCA 3WMHA 2AA7A 1UPWA 2Q1HA 3AURA 1FCZA 4MG8B 4M8EA 3VRVA 1NQ1A 3UU7B 4IW6A 3ERTA 3L3XA 1XB7A 5KRKA 3UU7A 3RY9A 2ZK6A 1OSVA 2ZMHA 4E2JA 4ZO1X 4RAKA 2P1VA 4B7WA 3MNPA 3L03A 4OZTE 5GIEA 4ITEA 3N00A 4J5XC 4KZIA 4RUOX 1PCGA 1FM9D 1U3QA 2JJ3A 1L2IA 3KYTA 4MG7A 5DKEA 4IWCA 2XYWA 2AX9A 4XUMA 5APKA 3A2JA 3DCUA 4YT1A 4XUHA 4G21A 1UHLB 2REWA 3OSAA 5DXEA 1P8DA 1NHZA 1TXIA 1UHLA 2PNUA 3AN3A 3W5PA 1QKMA 3IXPA 2NXXE 3OMMA 3WT6A 5L11A 3WJ5A 2QR9A 1YIMA 3KDTA 2QZOB 5DKBA 2NW4A 4P6XA 2Q5GA 3TKCA 4BCRA 3AX8A 1ERRA 2QZOA 1T7FA 2YLPA 1N46A 2POBA 4Q13A 3V3EA 2QXMA 1Y0XX 4DM6A 4OH6A 5DIEA 1RJKA 1XNXA 4FN9A 1R20A 3OSIA 5DU5A 4RMCA 3VSPA 5DMCA 2ZASA 3A78A 3E00A 3R5MA 2J4AA 2J7XA 1HJ1A 2JFAB 2NPAA 1I37A 2ZKCA 2Q70A 4LNXA 1R1KD 5C4SA 2YJDA 4WHGA 3VT6A 3VT9A 2ACLB 2Q7KA 1XLSA 5DX3B 4CI5A 2V7CA 1FD0A 4WLBA 4R06A 3KMGA 4NUFA 1TFCA 2AMBA 1PZLA 3TX7B 1K74D 3ADTA 4OFRA 2IOKA 4IW8A 2PIRA 3ADWA 3CDSA 1MVCA 3ZR7A 5EI1A 4FGYA 1LBDA 1PDUA 2G5OA 4OLMA 3VRUA 3A9EA 3ILZA 4PWLA 2HBHA 3K8SA 1U9EA 1Y9RA 1QKTA 4XT9A 5EGVA 3W0AA 3B0TA 4PRGA 3AN4A 5DV3A 3BEJA 2HWRA 1T7MA 1ZEOA 4G20A 5DXBB 1DKFB 5AWKA 2GPOA 3PEQA 4ZO1B 5KCUA 5KCEA 5DXBA 3LMPA 5AAVB 4RMEA 3X1HA 2R40A 5AAVA 2HB8A 1DB1A 2QMVA 4ONIA 2FVJA 2G0HA 3F7DA 2ZFXA 1MZNA 3F5CA 4RE8A 3D6DA 3HQ5A 2ZY0A 4S0SA 4OKBA 2Q5SA 4ZJRA 4IA7A 3O1EA 4IA3A 2ZMJA 5GT4A 2AYRA 3E94A 3OMKA 2YATA 3AUNA 3W0YA 4A2JA 4K6IA 3G8IA 3ET0A 4ZOMA 2QSEA 5DZHA 1YP0A 1G1UA 1T74A 4FNEA 5EJVA 2PIWA 5DWLA 4L96A 3ZRAA 3D57A 4TUZB 4J26A 2ZLAA 4IS8A 4UDBA 5AK2A 1XLSE 3SP6A 4TUZA 1ILGA 2XYXA 3U9QA 1YY4A 4MG9A 4ZNHA 2J14A 4XHDA 3VTBA 2P4YA 3P8XA 1SQNA 3FEIA 3CS6A 1GWRA 2QNVA 3B0QA 2Q5PA 2QPYA 5E7VA 2NXXA 2Q7JA 4IV4A 1SKXA 1U3RA 4APUA 2I0GA 1P93A 2PIVA 2AX6A 2O9IA 5CJ6A 5HYKA 2HC4A 3UP3A 2ZK5A 4PLDA 2XYJA 2GWXA 3H0AA 4G1DA 1ILHA 3V9TA 4QL8A 3AUQA 4J5XA 3DR1A 3HVLA 4ZN9A 5KCTA 1KV6A 2AA5A 2Q3YA 2Q7LA 4MGAB 4DM8A 1G2NA 3L1BA 3OSWA 4G1ZA 3A3ZX 3JZBA 3OZ0A 1YYEA 2ATHA 4LSJA 3OKHA 1IE9A 3PLZA 3ZRBA 3NSPA 1PK5A
chains in the Genus database with same CATH superfamily
4OC7A 3D5FA 5DI7A 1G5YA 3L3ZA 5E0WA 4OEDA 4OKXA 1ZH7A 3CLDA 5L7EA 3W0HA 5KCWA 2Q6SA 1OVLA 2OVHA 4O8FA 2Q60A 5DV8A 4TV1A 5DTVA 1T65A 1S0XA 2P1UA 2ZK1A 5HYRA 5LWPA 1X76A 1RDTD 3W5QA 2PITA 3L0JA 3FXVA 4J5WC 5K13A 3G0WA 1FM6A 2PIUA 4MG7B 5DVVA 5E0XA 2QXSA 5C4OA 4OJ9A 4DOSA 2YFEA 2I0JA 2VV3A 5B5BA 2O4RA 1S19A 1EXAA 1T7RA 1XQ3A 2BJ4A 3DT3A 4OHAA 1KNUA 2B1ZA 1K7LA 4ZN7A 4NB6A 4OIVA 1XOWA 5L7GA 3AZ3A 2PIQA 3VJHA 2ABIA 4YMQA 4G2HA 5DY8A 2Q8SA 3A2HA 1EXXA 4QM0A 1T79A 4S15A 3CTBA 4UDAA 4RMDA 2G0GA 4MGBA 2AWHA 4F9MA 2HVCA 2OAXA 4QK4A 4RUPA 4UDDA 4JYHA 4OEAA 4WVDA 3ZQTA 5HZCA 5JJMA 4NQAB 2Q7IA 2VV4A 3V9YA 2LBDA 1S9PA 5DYDA 4E4QA 1FCXA 4Q0AC 3OLLA 5G46A 1NUOA 5SYZA 5KCFA 1WM0X 5G5WA 1XDKA 4WHFA 1QKUA 1RK3A 4G2IA 4RFWA 2QGWA 1I38A 3CQVA 5E15A 3B68A 5E1CA 2PIOA 2Q61A 4OZTU 3VJSA 5AVIA 3W0IA 2Z4JA 2OUZA 2Q1VA 3FLIA 2ZMIA 3WWRA 4WQPA 1PQCA 1OSHA 4JYIA 4ZNSA 3ADSA 5DKGA 2I4JA 3KWYA 4HEEX 3HODA 2ZNPA 2VSTA 3VT4A 4KZMA 4DK8A 4PPPA 5DZIA 4JL4A 2G44A 4K7AA 4PP3A 2GPUA 2YJAB 5AAUA 3H52A 3A9EB 5C4UA 3X1IA 4N8RA 3VHUA 3OLFA 1ZDUA 3NOAA 3VTCA 2OVMA 3VT5A 5DZ3A 2PINA 4X1FA 1ZGYA 2QH6A 3B66A 4IUIA 4A4WA 3OS9A 1X7RA 3P89A 1XP9A 3FALA 4OK1A 3PBAA 4OKTA 5AZTA 1Q4XA 1T73A 3VI8A 3VRTA 3EYBA 3VT7A 1H9UA 3B5RA 5HJPA 3OAPA 3KDUA 5E14A 3AZ1A 4IVYA 3DZUD 5G44A 1UOMA 2VV2A 3ERDA 1G50A 1A52A 1HG4A 2V0VA 5DMFA 5I4VA 3F5CB 3GWXA 3VJIA 4OZRE 3D24A 1XIUA 5DWJA 2AXAA 4LTWA 2P7GA 5C4TA 2R6YA 3WFGA 4ZNVA 1NQ0A 5G42A 5DLRA 1PQ9A 5DP0A 1Y0SA 2AA6A 2PKLA 2ZXNA 2HARA 4OH5A 3KPZA 1E3GA 1SJ0A 2QE4A 4PP6A 3R5NA 1E3KA 4S14A 3R8DA 3W0JA 1EREA 3WT5A 4CSJA 4R2UA 5FQVA 2Q6RA 1ZDTA 3W5TA 3MNEA 2HAMA 2HB7A 3G8OA 3OS8C 5AVLA 3IPSA 5DRJA 5FQTA 4IQRA 5G3JA 2B50A 4MG9B 3M7RA 1A28A 3W0CA 1KKQA 3DZYA 5F9BA 4K4JA 3UUAB 1X7JA 5EHJA 3QT0A 3KMZA 3UUAA 2ZNOA 1NQ7A 2QA8A 3BC5A 1U3SA 2ZVTA 4RWVA 2ZNNA 5DUGA 2OZ7A 2YLQA 4RZGA 3V9VA 2FAIA 2P7AA 3CS8A 2P7ZA 1YMTA 3P0UA 2XKWA 3H0AD 1NDEA 1YINA 3O1DA 3OMPA 4J5WA 4OZRU 1NAXA 3X36A 3UVVA 3GYTA 3TY0A 1FCYA 3HC6A 4HLWA 2ZK4A 5DRMA 2W8YA 4IA1A 3ADUA 5KYJA 1OT7A 2VV1A 5GIDA 1XVPB 2QGTA 3K6PA 1XVPA 4XLDA 3VN2A 1BSXA 3ADVA 4PP5A 4YPQA 3WTQA 5DL4A 1S0ZA 4IWFA 2PRGA 4Y29A 2POGA 5DXPA 1OVLB 3L0LA 3RVFA 1IE8A 4TV1B 3B67A 2XHSA 2AB2A 3X31A 2AO6A 1XNNA 3Q95A 5HCVA 4PVUA 4LNWA 4QJRA 4KZJA 3K22A 2ZK3A 5KROA 2PIPL 2ZL9A 3FC6A 3AFRA 3ET3A 1XQCA 4IA2A 4LBDA 4X1GA 1QKNA 3ET2A 4PXMA 1RKGA 5DWIA 5DXMA 2Z4BA 2VV0A 5JI0D 2BJ4B 3GWSX 4PLEA 1NAVA 1MV9A 1I7IA 2ZXMA 2GTKA 5DUHA 3VTDA 2AM9A 4OEYA 3HM1A 5KRIA 1XV9A 1Z95A 2YLOA 3PCUA 1N83A 3IXPD 2OM9A 2P54A 4MGBB 4MG8A 1XJ7A 5JJMB 2VSRA 2E2RA 4IV2A 2QW4A 2VV4B 1RDTA 2ZK0A 4G1YA 4QE8A 5DZ0A 4ZNUA 1RKHA 5G43A 3OKIA 1X7BA 1FM9A 1ZKYA 2EWPA 1R20D 1T76A 4REFA 2GP7A 5DIDA 5FQSA 5KYAA 3GN8A 4JAZA 4EMAA 1K4WA 5IZ0A 3W5RA 5KRHA 1XDKB 3KMRA 3OMOA 5DVCA 3CWDA 3E00D 3AZ2A 3GBKA 5IXKA 3GD2A 4UDCA 3RUTA 5ACCA 5JY3A 1GWXA 5B41A 5DWGA 1M13A 3UUCA 5DZ1A 4XI3A 4RZEA 1M2ZA 1T63A 4NY9A 4OIUA 3L0EA 2AAXA 2ZNQA 4FHIA 2JF9A 1YJEA 2PJLA 5DXQA 5KRLA 1FBYA 4L98A 4Q50A 2I4PA 4EM9A 4S0TA 3D90A 1Z5XE 2GIUA 2IOGA 4OILA 4ZI1A 3VSOA 3WT7A 5KCCA 3K23A 4PF3A 2FSZA 4MGDB 1XZXX 4MGDA 5DWEA 4OJBA 5H1EA 2HASA 2ZXZA 3GYUA 4J24A 4DK7A 3FALB 3OLSA 4OJ4A 2JFAA 3FURA 1R1KA 5DK9A 3OS8A 5KRJA 1SR7A 3OGTA 4CI4A 3GZ9A 4MG5A 4OKWA 4ZNTA 5HJPB 1ZUCA 4WPFA 4M8HA 2R40D 1NYXA 2ACLA 1L2JA 5ICKA 3OMQA 1YUCA 4DMAA 5DX3A 3FUGA 5EITA 4NIEA 4A4VA 4XTAA 1K74A 3FS1A 1UPVA 3R2AA 1PQ6A 3RUUA 3SZ1A 3VHWA 3JZCA 5M96A 3ADXA 3R8IA 5KCDA 2ZBSA 4PPSA 2O4JA 1GWQA 3WGPA 1R5KA 1XAPA 2P15A 1LV2A 1M7WA 3B0WA 1PRGA 4N5GA 5KRFA 2Q6JA 4RUJA 3VJTA 3A40X 4YNKA 5APJA 3B65A 3T03A 2QA6A 5DXKA 1DKFA 3V3QA 1Z5XU 2GPPA 3VRWA 3HZFA 3R29A 5HJSA 5L7HA 3DCTA 1T7TA 3DZUA 4N1YA 3V4AA 4REEA 2H77A 5A86A 5IAWA 3DZYD 3HLVA 2AX7A 1XP6A 4ZNWA 1S9QA 2PIXA 3OOKA 4OEZA 5EC9A 2QA8B 3LBDA 4IVWA 3WFFA 2HFPA 3B0RA 3NSQA 2B23A 1X78A 2J7YA 3IA6A 5GICA 2B1VA 1XP1A 5DXRA 3P88A 3FEJA 5AYGA 2BAWA 2AMAA 2AX8A 2IHQA 2OCFA 1YA3A 2R6WA 2H79A 3B1MA 5FQRA 1X7EA 3UVVB 4POHA 5DUEA 3BQDA 1GS4A 4QE6A 3HO0A 3HC5A 3VHVA 1R6GA 2Q59B 4MGCA 5KRMA 3R8AA 2Q59A 1NQ2A 4POJA 1YOWA 2VV1B 2NV7A 1T5ZA 4OGHA 4R6SA 3DY6A 2P1TA 3OOFA 1I7GA 5FQPA 5ETHA 3PRGA 1XPCA 4FHHA 3IPUA 4ITFA 5DIGA 4ZJWA 5G45A 3E7CA 5AWJA 5DXGA 3IMYA 4E4KA 5AZVA 3RLLA 5KD9A 1N4HA 4DORA 3CDPA 4OARA 4OFUA 5LGAA 3TKMA 5KRCA 3WJ4A 5APHA 3G9EA 5DVSA 3S9SA 1VJBA 2QTUA 3OZJA 3Q95B 2I4ZA 4JGVA 4P6WA 2YHDA 3V49A 3IPQA 4MG6A 2GL8A 2F4BA 4XAOA 3UUDB 5KR9A 1NRLA 2HWQA 3MNOA 3UUDA 3VT3A 2YLYA 4RZFA 3UP0A 5DYBA 2A3IA 3FC6B 2AA2A 3PO9A 3SP9A 4MDDA 5KRAA 1YOKA 5E19A 1ZAFA 2HCDA 3A2IA 5DKSA 3B3KA 1FM6D 3CS4A 2GPVA 2ZLCA 3CJWA 4JYGA 4MGAA 4IU7A 5DSHA 4DQMA 2ZK2A 3VT8A 2QABA 3ET1A 3KBAA 3RLJA 3W0GA 4N73A 1XV9B 5DV6A 3KFCA 3WMHA 2AA7A 1UPWA 2Q1HA 3AURA 1FCZA 4MG8B 4M8EA 3VRVA 1NQ1A 3UU7B 4IW6A 3ERTA 3L3XA 1XB7A 5KRKA 3UU7A 3RY9A 2ZK6A 1OSVA 2ZMHA 4E2JA 4ZO1X 4RAKA 2P1VA 4B7WA 3MNPA 3L03A 4OZTE 5GIEA 4ITEA 3N00A 4J5XC 4KZIA 4RUOX 1PCGA 1FM9D 1U3QA 2JJ3A 1L2IA 3KYTA 4MG7A 5DKEA 4IWCA 2XYWA 2AX9A 4XUMA 5APKA 3A2JA 3DCUA 4YT1A 4XUHA 4G21A 1UHLB 2REWA 3OSAA 5DXEA 1P8DA 1NHZA 1TXIA 1UHLA 2PNUA 3AN3A 3W5PA 1QKMA 3IXPA 2NXXE 3OMMA 3WT6A 5L11A 3WJ5A 2QR9A 1YIMA 3KDTA 2QZOB 5DKBA 2NW4A 4P6XA 2Q5GA 3TKCA 4BCRA 3AX8A 1ERRA 2QZOA 1T7FA 2YLPA 1N46A 2POBA 4Q13A 3V3EA 2QXMA 1Y0XX 4DM6A 4OH6A 5DIEA 1RJKA 1XNXA 4FN9A 1R20A 3OSIA 5DU5A 4RMCA 3VSPA 5DMCA 2ZASA 3A78A 3E00A 3R5MA 2J4AA 2J7XA 1HJ1A 2JFAB 2NPAA 1I37A 2ZKCA 2Q70A 4LNXA 1R1KD 5C4SA 2YJDA 4WHGA 3VT6A 3VT9A 2ACLB 2Q7KA 1XLSA 5DX3B 4CI5A 2V7CA 1FD0A 4WLBA 4R06A 3KMGA 4NUFA 1TFCA 2AMBA 1PZLA 3TX7B 1K74D 3ADTA 4OFRA 2IOKA 4IW8A 2PIRA 3ADWA 3CDSA 1MVCA 3ZR7A 5EI1A 4FGYA 1LBDA 1PDUA 2G5OA 4OLMA 3VRUA 3A9EA 3ILZA 4PWLA 2HBHA 3K8SA 1U9EA 1Y9RA 1QKTA 4XT9A 5EGVA 3W0AA 3B0TA 4PRGA 3AN4A 5DV3A 3BEJA 2HWRA 1T7MA 1ZEOA 4G20A 5DXBB 1DKFB 5AWKA 2GPOA 3PEQA 4ZO1B 5KCUA 5KCEA 5DXBA 3LMPA 5AAVB 4RMEA 3X1HA 2R40A 5AAVA 2HB8A 1DB1A 2QMVA 4ONIA 2FVJA 2G0HA 3F7DA 2ZFXA 1MZNA 3F5CA 4RE8A 3D6DA 3HQ5A 2ZY0A 4S0SA 4OKBA 2Q5SA 4ZJRA 4IA7A 3O1EA 4IA3A 2ZMJA 5GT4A 2AYRA 3E94A 3OMKA 2YATA 3AUNA 3W0YA 4A2JA 4K6IA 3G8IA 3ET0A 4ZOMA 2QSEA 5DZHA 1YP0A 1G1UA 1T74A 4FNEA 5EJVA 2PIWA 5DWLA 4L96A 3ZRAA 3D57A 4TUZB 4J26A 2ZLAA 4IS8A 4UDBA 5AK2A 1XLSE 3SP6A 4TUZA 1ILGA 2XYXA 3U9QA 1YY4A 4MG9A 4ZNHA 2J14A 4XHDA 3VTBA 2P4YA 3P8XA 1SQNA 3FEIA 3CS6A 1GWRA 2QNVA 3B0QA 2Q5PA 2QPYA 5E7VA 2NXXA 2Q7JA 4IV4A 1SKXA 1U3RA 4APUA 2I0GA 1P93A 2PIVA 2AX6A 2O9IA 5CJ6A 5HYKA 2HC4A 3UP3A 2ZK5A 4PLDA 2XYJA 2GWXA 3H0AA 4G1DA 1ILHA 3V9TA 4QL8A 3AUQA 4J5XA 3DR1A 3HVLA 4ZN9A 5KCTA 1KV6A 2AA5A 2Q3YA 2Q7LA 4MGAB 4DM8A 1G2NA 3L1BA 3OSWA 4G1ZA 3A3ZX 3JZBA 3OZ0A 1YYEA 2ATHA 4LSJA 3OKHA 1IE9A 3PLZA 3ZRBA 3NSPA 1PK5A
chains in the Genus database with same CATH topology
4OC7A 3D5FA 5DI7A 1G5YA 3L3ZA 5E0WA 4OEDA 4OKXA 1ZH7A 3CLDA 5L7EA 3W0HA 5KCWA 2Q6SA 1OVLA 2OVHA 4O8FA 2Q60A 5DV8A 4TV1A 5DTVA 1T65A 1S0XA 2P1UA 2ZK1A 5HYRA 5LWPA 1X76A 1RDTD 3W5QA 2PITA 3L0JA 3FXVA 4J5WC 5K13A 3G0WA 1FM6A 2PIUA 4MG7B 5DVVA 5E0XA 2QXSA 5C4OA 4OJ9A 4DOSA 2YFEA 2I0JA 2VV3A 5B5BA 2O4RA 1S19A 1EXAA 1T7RA 1XQ3A 2BJ4A 3DT3A 4OHAA 1KNUA 2B1ZA 1K7LA 4ZN7A 4NB6A 4OIVA 1XOWA 5L7GA 3AZ3A 2PIQA 3VJHA 2ABIA 4YMQA 4G2HA 5DY8A 2Q8SA 3A2HA 1EXXA 4QM0A 1T79A 4S15A 3CTBA 4UDAA 4RMDA 2G0GA 4MGBA 2AWHA 4F9MA 2HVCA 2OAXA 4QK4A 4RUPA 4UDDA 4JYHA 4OEAA 4WVDA 3ZQTA 5HZCA 5JJMA 4NQAB 2Q7IA 2VV4A 3V9YA 2LBDA 1S9PA 5DYDA 4E4QA 1FCXA 4Q0AC 3OLLA 5G46A 1NUOA 5SYZA 5KCFA 1WM0X 5G5WA 1XDKA 4WHFA 1QKUA 1RK3A 4G2IA 4RFWA 2QGWA 1I38A 3CQVA 5E15A 3B68A 5E1CA 2PIOA 2Q61A 4OZTU 3VJSA 5AVIA 3W0IA 2Z4JA 2OUZA 2Q1VA 3FLIA 2ZMIA 3WWRA 4WQPA 1PQCA 1OSHA 4JYIA 4ZNSA 3ADSA 5DKGA 2I4JA 3KWYA 4HEEX 3HODA 2ZNPA 2VSTA 3VT4A 4KZMA 4DK8A 4PPPA 5DZIA 4JL4A 2G44A 4K7AA 4PP3A 2GPUA 2YJAB 5AAUA 3H52A 3A9EB 5C4UA 3X1IA 4N8RA 3VHUA 3OLFA 1ZDUA 3NOAA 3VTCA 2OVMA 3VT5A 5DZ3A 2PINA 4X1FA 1ZGYA 2QH6A 3B66A 4IUIA 4A4WA 3OS9A 1X7RA 3P89A 1XP9A 3FALA 4OK1A 3PBAA 4OKTA 5AZTA 1Q4XA 1T73A 3VI8A 3VRTA 3EYBA 3VT7A 1H9UA 3B5RA 5HJPA 3OAPA 3KDUA 5E14A 3AZ1A 4IVYA 3DZUD 5G44A 1UOMA 2VV2A 3ERDA 1G50A 1A52A 1HG4A 2V0VA 5DMFA 5I4VA 3F5CB 3GWXA 3VJIA 4OZRE 3D24A 1XIUA 5DWJA 2AXAA 4LTWA 2P7GA 5C4TA 2R6YA 3WFGA 4ZNVA 1NQ0A 5G42A 5DLRA 1PQ9A 5DP0A 1Y0SA 2AA6A 2PKLA 2ZXNA 2HARA 4OH5A 3KPZA 1E3GA 1SJ0A 2QE4A 4PP6A 3R5NA 1E3KA 4S14A 3R8DA 3W0JA 1EREA 3WT5A 4CSJA 4R2UA 5FQVA 2Q6RA 1ZDTA 3W5TA 3MNEA 2HAMA 2HB7A 3G8OA 3OS8C 5AVLA 3IPSA 5DRJA 5FQTA 4IQRA 5G3JA 2B50A 4MG9B 3M7RA 1A28A 3W0CA 1KKQA 3DZYA 5F9BA 4K4JA 3UUAB 1X7JA 5EHJA 3QT0A 3KMZA 3UUAA 2ZNOA 1NQ7A 2QA8A 3BC5A 1U3SA 2ZVTA 4RWVA 2ZNNA 5DUGA 2OZ7A 2YLQA 4RZGA 3V9VA 2FAIA 2P7AA 3CS8A 2P7ZA 1YMTA 3P0UA 2XKWA 3H0AD 1NDEA 1YINA 3O1DA 3OMPA 4J5WA 4OZRU 1NAXA 3X36A 3UVVA 3GYTA 3TY0A 1FCYA 3HC6A 4HLWA 2ZK4A 5DRMA 2W8YA 4IA1A 3ADUA 5KYJA 1OT7A 2VV1A 5GIDA 1XVPB 2QGTA 3K6PA 1XVPA 4XLDA 3VN2A 1BSXA 3ADVA 4PP5A 4YPQA 3WTQA 5DL4A 1S0ZA 4IWFA 2PRGA 4Y29A 2POGA 5DXPA 1OVLB 3L0LA 3RVFA 1IE8A 4TV1B 3B67A 2XHSA 2AB2A 3X31A 2AO6A 1XNNA 3Q95A 5HCVA 4PVUA 4LNWA 4QJRA 4KZJA 3K22A 2ZK3A 5KROA 2PIPL 2ZL9A 3FC6A 3AFRA 3ET3A 1XQCA 4IA2A 4LBDA 4X1GA 1QKNA 3ET2A 4PXMA 1RKGA 5DWIA 5DXMA 2Z4BA 2VV0A 5JI0D 2BJ4B 3GWSX 4PLEA 1NAVA 1MV9A 1I7IA 2ZXMA 2GTKA 5DUHA 3VTDA 2AM9A 4OEYA 3HM1A 5KRIA 1XV9A 1Z95A 2YLOA 3PCUA 1N83A 3IXPD 2OM9A 2P54A 4MGBB 4MG8A 1XJ7A 5JJMB 2VSRA 2E2RA 4IV2A 2QW4A 2VV4B 1RDTA 2ZK0A 4G1YA 4QE8A 5DZ0A 4ZNUA 1RKHA 5G43A 3OKIA 1X7BA 1FM9A 1ZKYA 2EWPA 1R20D 1T76A 4REFA 2GP7A 5DIDA 5FQSA 5KYAA 3GN8A 4JAZA 4EMAA 1K4WA 5IZ0A 3W5RA 5KRHA 1XDKB 3KMRA 3OMOA 5DVCA 3CWDA 3E00D 3AZ2A 3GBKA 5IXKA 3GD2A 4UDCA 3RUTA 5ACCA 5JY3A 1GWXA 5B41A 5DWGA 1M13A 3UUCA 5DZ1A 4XI3A 4RZEA 1M2ZA 1T63A 4NY9A 4OIUA 3L0EA 2AAXA 2ZNQA 4FHIA 2JF9A 1YJEA 2PJLA 5DXQA 5KRLA 1FBYA 4L98A 4Q50A 2I4PA 4EM9A 4S0TA 3D90A 1Z5XE 2GIUA 2IOGA 4OILA 4ZI1A 3VSOA 3WT7A 5KCCA 3K23A 4PF3A 2FSZA 4MGDB 1XZXX 4MGDA 5DWEA 4OJBA 5H1EA 2HASA 2ZXZA 3GYUA 4J24A 4DK7A 3FALB 3OLSA 4OJ4A 2JFAA 3FURA 1R1KA 5DK9A 3OS8A 5KRJA 1SR7A 3OGTA 4CI4A 3GZ9A 4MG5A 4OKWA 4ZNTA 5HJPB 1ZUCA 4WPFA 4M8HA 2R40D 1NYXA 2ACLA 1L2JA 5ICKA 3OMQA 1YUCA 4DMAA 5DX3A 3FUGA 5EITA 4NIEA 4A4VA 4XTAA 1K74A 3FS1A 1UPVA 3R2AA 1PQ6A 3RUUA 3SZ1A 3VHWA 3JZCA 5M96A 3ADXA 3R8IA 5KCDA 2ZBSA 4PPSA 2O4JA 1GWQA 3WGPA 1R5KA 1XAPA 2P15A 1LV2A 1M7WA 3B0WA 1PRGA 4N5GA 5KRFA 2Q6JA 4RUJA 3VJTA 3A40X 4YNKA 5APJA 3B65A 3T03A 2QA6A 5DXKA 1DKFA 3V3QA 1Z5XU 2GPPA 3VRWA 3HZFA 3R29A 5HJSA 5L7HA 3DCTA 1T7TA 3DZUA 4N1YA 3V4AA 4REEA 2H77A 5A86A 5IAWA 3DZYD 3HLVA 2AX7A 1XP6A 4ZNWA 1S9QA 2PIXA 3OOKA 4OEZA 5EC9A 2QA8B 3LBDA 4IVWA 3WFFA 2HFPA 3B0RA 3NSQA 2B23A 1X78A 2J7YA 3IA6A 5GICA 2B1VA 1XP1A 5DXRA 3P88A 3FEJA 5AYGA 2BAWA 2AMAA 2AX8A 2IHQA 2OCFA 1YA3A 2R6WA 2H79A 3B1MA 5FQRA 1X7EA 3UVVB 4POHA 5DUEA 3BQDA 1GS4A 4QE6A 3HO0A 3HC5A 3VHVA 1R6GA 2Q59B 4MGCA 5KRMA 3R8AA 2Q59A 1NQ2A 4POJA 1YOWA 2VV1B 2NV7A 1T5ZA 4OGHA 4R6SA 3DY6A 2P1TA 3OOFA 1I7GA 5FQPA 5ETHA 3PRGA 1XPCA 4FHHA 3IPUA 4ITFA 5DIGA 4ZJWA 5G45A 3E7CA 5AWJA 5DXGA 3IMYA 4E4KA 5AZVA 3RLLA 5KD9A 1N4HA 4DORA 3CDPA 4OARA 4OFUA 5LGAA 3TKMA 5KRCA 3WJ4A 5APHA 3G9EA 5DVSA 3S9SA 1VJBA 2QTUA 3OZJA 3Q95B 2I4ZA 4JGVA 4P6WA 2YHDA 3V49A 3IPQA 4MG6A 2GL8A 2F4BA 4XAOA 3UUDB 5KR9A 1NRLA 2HWQA 3MNOA 3UUDA 3VT3A 2YLYA 4RZFA 3UP0A 5DYBA 2A3IA 3FC6B 2AA2A 3PO9A 3SP9A 4MDDA 5KRAA 1YOKA 5E19A 1ZAFA 2HCDA 3A2IA 5DKSA 3B3KA 1FM6D 3CS4A 2GPVA 2ZLCA 3CJWA 4JYGA 4MGAA 4IU7A 5DSHA 4DQMA 2ZK2A 3VT8A 2QABA 3ET1A 3KBAA 3RLJA 3W0GA 4N73A 1XV9B 5DV6A 3KFCA 3WMHA 2AA7A 1UPWA 2Q1HA 3AURA 1FCZA 4MG8B 4M8EA 3VRVA 1NQ1A 3UU7B 4IW6A 3ERTA 3L3XA 1XB7A 5KRKA 3UU7A 3RY9A 2ZK6A 1OSVA 2ZMHA 4E2JA 4ZO1X 4RAKA 2P1VA 4B7WA 3MNPA 3L03A 4OZTE 5GIEA 4ITEA 3N00A 4J5XC 4KZIA 4RUOX 1PCGA 1FM9D 1U3QA 2JJ3A 1L2IA 3KYTA 4MG7A 5DKEA 4IWCA 2XYWA 2AX9A 4XUMA 5APKA 3A2JA 3DCUA 4YT1A 4XUHA 4G21A 1UHLB 2REWA 3OSAA 5DXEA 1P8DA 1NHZA 1TXIA 1UHLA 2PNUA 3AN3A 3W5PA 1QKMA 3IXPA 2NXXE 3OMMA 3WT6A 5L11A 3WJ5A 2QR9A 1YIMA 3KDTA 2QZOB 5DKBA 2NW4A 4P6XA 2Q5GA 3TKCA 4BCRA 3AX8A 1ERRA 2QZOA 1T7FA 2YLPA 1N46A 2POBA 4Q13A 3V3EA 2QXMA 1Y0XX 4DM6A 4OH6A 5DIEA 1RJKA 1XNXA 4FN9A 1R20A 3OSIA 5DU5A 4RMCA 3VSPA 5DMCA 2ZASA 3A78A 3E00A 3R5MA 2J4AA 2J7XA 1HJ1A 2JFAB 2NPAA 1I37A 2ZKCA 2Q70A 4LNXA 1R1KD 5C4SA 2YJDA 4WHGA 3VT6A 3VT9A 2ACLB 2Q7KA 1XLSA 5DX3B 4CI5A 2V7CA 1FD0A 4WLBA 4R06A 3KMGA 4NUFA 1TFCA 2AMBA 1PZLA 3TX7B 1K74D 3ADTA 4OFRA 2IOKA 4IW8A 2PIRA 3ADWA 3CDSA 1MVCA 3ZR7A 5EI1A 4FGYA 1LBDA 1PDUA 2G5OA 4OLMA 3VRUA 3A9EA 3ILZA 4PWLA 2HBHA 3K8SA 1U9EA 1Y9RA 1QKTA 4XT9A 5EGVA 3W0AA 3B0TA 4PRGA 3AN4A 5DV3A 3BEJA 2HWRA 1T7MA 1ZEOA 4G20A 5DXBB 1DKFB 5AWKA 2GPOA 3PEQA 4ZO1B 5KCUA 5KCEA 5DXBA 3LMPA 5AAVB 4RMEA 3X1HA 2R40A 5AAVA 2HB8A 1DB1A 2QMVA 4ONIA 2FVJA 2G0HA 3F7DA 2ZFXA 1MZNA 3F5CA 4RE8A 3D6DA 3HQ5A 2ZY0A 4S0SA 4OKBA 2Q5SA 4ZJRA 4IA7A 3O1EA 4IA3A 2ZMJA 5GT4A 2AYRA 3E94A 3OMKA 2YATA 3AUNA 3W0YA 4A2JA 4K6IA 3G8IA 3ET0A 4ZOMA 2QSEA 5DZHA 1YP0A 1G1UA 1T74A 4FNEA 5EJVA 2PIWA 5DWLA 4L96A 3ZRAA 3D57A 4TUZB 4J26A 2ZLAA 4IS8A 4UDBA 5AK2A 1XLSE 3SP6A 4TUZA 1ILGA 2XYXA 3U9QA 1YY4A 4MG9A 4ZNHA 2J14A 4XHDA 3VTBA 2P4YA 3P8XA 1SQNA 3FEIA 3CS6A 1GWRA 2QNVA 3B0QA 2Q5PA 2QPYA 5E7VA 2NXXA 2Q7JA 4IV4A 1SKXA 1U3RA 4APUA 2I0GA 1P93A 2PIVA 2AX6A 2O9IA 5CJ6A 5HYKA 2HC4A 3UP3A 2ZK5A 4PLDA 2XYJA 2GWXA 3H0AA 4G1DA 1ILHA 3V9TA 4QL8A 3AUQA 4J5XA 3DR1A 3HVLA 4ZN9A 5KCTA 1KV6A 2AA5A 2Q3YA 2Q7LA 4MGAB 4DM8A 1G2NA 3L1BA 3OSWA 4G1ZA 3A3ZX 3JZBA 3OZ0A 1YYEA 2ATHA 4LSJA 3OKHA 1IE9A 3PLZA 3ZRBA 3NSPA 1PK5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OC7 A;  3D5F A;  5DI7 A;  1G5Y A;  3L3Z A;  5E0W A;  4OED A;  4OKX A;  1ZH7 A;  3CLD A;  5L7E A;  3W0H A;  5KCW A;  2Q6S A;  1OVL A;  2OVH A;  4O8F A;  2Q60 A;  5DV8 A;  4TV1 A;  5DTV A;  1T65 A;  1S0X A;  2P1U A;  2ZK1 A;  5HYR A;  5LWP A;  1X76 A;  1RDT D;  3W5Q A;  2PIT A;  3L0J A;  3FXV A;  4J5W C;  5K13 A;  3G0W A;  1FM6 A;  2PIU A;  4MG7 B;  5DVV A;  5E0X A;  2QXS A;  5C4O A;  4OJ9 A;  4DOS A;  2YFE A;  2I0J A;  2VV3 A;  5B5B A;  2O4R A;  1S19 A;  1EXA A;  1T7R A;  1XQ3 A;  2BJ4 A;  3DT3 A;  4OHA A;  1KNU A;  2B1Z A;  1K7L A;  4ZN7 A;  4NB6 A;  4OIV A;  1XOW A;  5L7G A;  3AZ3 A;  2PIQ A;  3VJH A;  2ABI A;  4YMQ A;  4G2H A;  5DY8 A;  2Q8S A;  3A2H A;  1EXX A;  4QM0 A;  1T79 A;  4S15 A;  3CTB A;  4UDA A;  4RMD A;  2G0G A;  4MGB A;  2AWH A;  4F9M A;  2HVC A;  2OAX A;  4QK4 A;  4RUP A;  4UDD A;  4JYH A;  4OEA A;  4WVD A;  3ZQT A;  5HZC A;  5JJM A;  4NQA B;  2Q7I A;  2VV4 A;  3V9Y A;  2LBD A;  1S9P A;  5DYD A;  4E4Q A;  1FCX A;  4Q0A C;  3OLL A;  5G46 A;  1NUO A;  5SYZ A;  5KCF A;  1WM0 X;  5G5W A;  1XDK A;  4WHF A;  1QKU A;  1RK3 A;  4G2I A;  4RFW A;  2QGW A;  1I38 A;  3CQV A;  5E15 A;  3B68 A;  5E1C A;  2PIO A;  2Q61 A;  4OZT U;  3VJS A;  5AVI A;  3W0I A;  2Z4J A;  2OUZ A;  2Q1V A;  3FLI A;  2ZMI A;  3WWR A;  4WQP A;  1PQC A;  1OSH A;  4JYI A;  4ZNS A;  3ADS A;  5DKG A;  2I4J A;  3KWY A;  4HEE X;  3HOD A;  2ZNP A;  2VST A;  3VT4 A;  4KZM A;  4DK8 A;  4PPP A;  5DZI A;  4JL4 A;  2G44 A;  4K7A A;  4PP3 A;  2GPU A;  2YJA B;  5AAU A;  3H52 A;  3A9E B;  5C4U A;  3X1I A;  4N8R A;  3VHU A;  3OLF A;  1ZDU A;  3NOA A;  3VTC A;  2OVM A;  3VT5 A;  5DZ3 A;  2PIN A;  4X1F A;  1ZGY A;  2QH6 A;  3B66 A;  4IUI A;  4A4W A;  3OS9 A;  1X7R A;  3P89 A;  1XP9 A;  3FAL A;  4OK1 A;  3PBA A;  4OKT A;  5AZT A;  1Q4X A;  1T73 A;  3VI8 A;  3VRT A;  3EYB A;  3VT7 A;  1H9U A;  3B5R A;  5HJP A;  3OAP A;  3KDU A;  5E14 A;  3AZ1 A;  4IVY A;  3DZU D;  5G44 A;  1UOM A;  2VV2 A;  3ERD A;  1G50 A;  1A52 A;  1HG4 A;  2V0V A;  5DMF A;  5I4V A;  3F5C B;  3GWX A;  3VJI A;  4OZR E;  3D24 A;  1XIU A;  5DWJ A;  2AXA A;  4LTW A;  2P7G A;  5C4T A;  2R6Y A;  3WFG A;  4ZNV A;  1NQ0 A;  5G42 A;  5DLR A;  1PQ9 A;  5DP0 A;  1Y0S A;  2AA6 A;  2PKL A;  2ZXN A;  2HAR A;  4OH5 A;  3KPZ A;  1E3G A;  1SJ0 A;  2QE4 A;  4PP6 A;  3R5N A;  1E3K A;  4S14 A;  3R8D A;  3W0J A;  1ERE A;  3WT5 A;  4CSJ A;  4R2U A;  5FQV A;  2Q6R A;  1ZDT A;  3W5T A;  3MNE A;  2HAM A;  2HB7 A;  3G8O A;  3OS8 C;  5AVL A;  3IPS A;  5DRJ A;  5FQT A;  4IQR A;  5G3J A;  2B50 A;  4MG9 B;  3M7R A;  1A28 A;  3W0C A;  1KKQ A;  3DZY A;  5F9B A;  4K4J A;  3UUA B;  1X7J A;  5EHJ A;  3QT0 A;  3KMZ A;  3UUA A;  2ZNO A;  1NQ7 A;  2QA8 A;  3BC5 A;  1U3S A;  2ZVT A;  4RWV A;  2ZNN A;  5DUG A;  2OZ7 A;  2YLQ A;  4RZG A;  3V9V A;  2FAI A;  2P7A A;  3CS8 A;  2P7Z A;  1YMT A;  3P0U A;  2XKW A;  3H0A D;  1NDE A;  1YIN A;  3O1D A;  3OMP A;  4J5W A;  4OZR U;  1NAX A;  3X36 A;  3UVV A;  3GYT A;  3TY0 A;  1FCY A;  3HC6 A;  4HLW A;  2ZK4 A;  5DRM A;  2W8Y A;  4IA1 A;  3ADU A;  5KYJ A;  1OT7 A;  2VV1 A;  5GID A;  1XVP B;  2QGT A;  3K6P A;  1XVP A;  4XLD A;  3VN2 A;  1BSX A;  3ADV A;  4PP5 A;  4YPQ A;  3WTQ A;  5DL4 A;  1S0Z A;  4IWF A;  2PRG A;  4Y29 A;  2POG A;  5DXP A;  1OVL B;  3L0L A;  3RVF A;  1IE8 A;  4TV1 B;  3B67 A;  2XHS A;  2AB2 A;  3X31 A;  2AO6 A;  1XNN A;  3Q95 A;  5HCV A;  4PVU A;  4LNW A;  4QJR A;  4KZJ A;  3K22 A;  2ZK3 A;  5KRO A;  2PIP L;  2ZL9 A;  3FC6 A;  3AFR A;  3ET3 A;  1XQC A;  4IA2 A;  4LBD A;  4X1G A;  1QKN A;  3ET2 A;  4PXM A;  1RKG A;  5DWI A;  5DXM A;  2Z4B A;  2VV0 A;  5JI0 D;  2BJ4 B;  3GWS X;  4PLE A;  1NAV A;  1MV9 A;  1I7I A;  2ZXM A;  2GTK A;  5DUH A;  3VTD A;  2AM9 A;  4OEY A;  3HM1 A;  5KRI A;  1XV9 A;  1Z95 A;  2YLO A;  3PCU A;  1N83 A;  3IXP D;  2OM9 A;  2P54 A;  4MGB B;  4MG8 A;  1XJ7 A;  5JJM B;  2VSR A;  2E2R A;  4IV2 A;  2QW4 A;  2VV4 B;  1RDT A;  2ZK0 A;  4G1Y A;  4QE8 A;  5DZ0 A;  4ZNU A;  1RKH A;  5G43 A;  3OKI A;  1X7B A;  1FM9 A;  1ZKY A;  2EWP A;  1R20 D;  1T76 A;  4REF A;  2GP7 A;  5DID A;  5FQS A;  5KYA A;  3GN8 A;  4JAZ A;  4EMA A;  1K4W A;  5IZ0 A;  3W5R A;  5KRH A;  1XDK B;  3KMR A;  3OMO A;  5DVC A;  3CWD A;  3E00 D;  3AZ2 A;  3GBK A;  5IXK A;  3GD2 A;  4UDC A;  3RUT A;  5ACC A;  5JY3 A;  1GWX A;  5B41 A;  5DWG A;  1M13 A;  3UUC A;  5DZ1 A;  4XI3 A;  4RZE A;  1M2Z A;  1T63 A;  4NY9 A;  4OIU A;  3L0E A;  2AAX A;  2ZNQ A;  4FHI A;  2JF9 A;  1YJE A;  2PJL A;  5DXQ A;  5KRL A;  1FBY A;  4L98 A;  4Q50 A;  2I4P A;  4EM9 A;  4S0T A;  3D90 A;  1Z5X E;  2GIU A;  2IOG A;  4OIL A;  4ZI1 A;  3VSO A;  3WT7 A;  5KCC A;  3K23 A;  4PF3 A;  2FSZ A;  4MGD B;  1XZX X;  4MGD A;  5DWE A;  4OJB A;  5H1E A;  2HAS A;  2ZXZ A;  3GYU A;  4J24 A;  4DK7 A;  3FAL B;  3OLS A;  4OJ4 A;  2JFA A;  3FUR A;  1R1K A;  5DK9 A;  3OS8 A;  5KRJ A;  1SR7 A;  3OGT A;  4CI4 A;  3GZ9 A;  4MG5 A;  4OKW A;  4ZNT A;  5HJP B;  1ZUC A;  4WPF A;  4M8H A;  2R40 D;  1NYX A;  2ACL A;  1L2J A;  5ICK A;  3OMQ A;  1YUC A;  4DMA A;  5DX3 A;  3FUG A;  5EIT A;  4NIE A;  4A4V A;  4XTA A;  1K74 A;  3FS1 A;  1UPV A;  3R2A A;  1PQ6 A;  3RUU A;  3SZ1 A;  3VHW A;  3JZC A;  5M96 A;  3ADX A;  3R8I A;  5KCD A;  2ZBS A;  4PPS A;  2O4J A;  1GWQ A;  3WGP A;  1R5K A;  1XAP A;  2P15 A;  1LV2 A;  1M7W A;  3B0W A;  1PRG A;  4N5G A;  5KRF A;  2Q6J A;  4RUJ A;  3VJT A;  3A40 X;  4YNK A;  5APJ A;  3B65 A;  3T03 A;  2QA6 A;  5DXK A;  1DKF A;  3V3Q A;  1Z5X U;  2GPP A;  3VRW A;  3HZF A;  3R29 A;  5HJS A;  5L7H A;  3DCT A;  1T7T A;  3DZU A;  4N1Y A;  3V4A A;  4REE A;  2H77 A;  5A86 A;  5IAW A;  3DZY D;  3HLV A;  2AX7 A;  1XP6 A;  4ZNW A;  1S9Q A;  2PIX A;  3OOK A;  4OEZ A;  5EC9 A;  2QA8 B;  3LBD A;  4IVW A;  3WFF A;  2HFP A;  3B0R A;  3NSQ A;  2B23 A;  1X78 A;  2J7Y A;  3IA6 A;  5GIC A;  2B1V A;  1XP1 A;  5DXR A;  3P88 A;  3FEJ A;  5AYG A;  2BAW A;  2AMA A;  2AX8 A;  2IHQ A;  2OCF A;  1YA3 A;  2R6W A;  2H79 A;  3B1M A;  5FQR A;  1X7E A;  3UVV B;  4POH A;  5DUE A;  3BQD A;  1GS4 A;  4QE6 A;  3HO0 A;  3HC5 A;  3VHV A;  1R6G A;  2Q59 B;  4MGC A;  5KRM A;  3R8A A;  2Q59 A;  1NQ2 A;  4POJ A;  1YOW A;  2VV1 B;  2NV7 A;  1T5Z A;  4OGH A;  4R6S A;  3DY6 A;  2P1T A;  3OOF A;  1I7G A;  5FQP A;  5ETH A;  3PRG A;  1XPC A;  4FHH A;  3IPU A;  4ITF A;  5DIG A;  4ZJW A;  5G45 A;  3E7C A;  5AWJ A;  5DXG A;  3IMY A;  4E4K A;  5AZV A;  3RLL A;  5KD9 A;  1N4H A;  4DOR A;  3CDP A;  4OAR A;  4OFU A;  5LGA A;  3TKM A;  5KRC A;  3WJ4 A;  5APH A;  3G9E A;  5DVS A;  3S9S A;  1VJB A;  2QTU A;  3OZJ A;  3Q95 B;  2I4Z A;  4JGV A;  4P6W A;  2YHD A;  3V49 A;  3IPQ A;  4MG6 A;  2GL8 A;  2F4B A;  4XAO A;  3UUD B;  5KR9 A;  1NRL A;  2HWQ A;  3MNO A;  3UUD A;  3VT3 A;  2YLY A;  4RZF A;  3UP0 A;  5DYB A;  2A3I A;  3FC6 B;  2AA2 A;  3PO9 A;  3SP9 A;  4MDD A;  5KRA A;  1YOK A;  5E19 A;  1ZAF A;  2HCD A;  3A2I A;  5DKS A;  3B3K A;  1FM6 D;  3CS4 A;  2GPV A;  2ZLC A;  3CJW A;  4JYG A;  4MGA A;  4IU7 A;  5DSH A;  4DQM A;  2ZK2 A;  3VT8 A;  2QAB A;  3ET1 A;  3KBA A;  3RLJ A;  3W0G A;  4N73 A;  1XV9 B;  5DV6 A;  3KFC A;  3WMH A;  2AA7 A;  1UPW A;  2Q1H A;  3AUR A;  1FCZ A;  4MG8 B;  4M8E A;  3VRV A;  1NQ1 A;  3UU7 B;  4IW6 A;  3ERT A;  3L3X A;  1XB7 A;  5KRK A;  3UU7 A;  3RY9 A;  2ZK6 A;  1OSV A;  2ZMH A;  4E2J A;  4ZO1 X;  4RAK A;  2P1V A;  4B7W A;  3MNP A;  3L03 A;  4OZT E;  5GIE A;  4ITE A;  3N00 A;  4J5X C;  4KZI A;  4RUO X;  1PCG A;  1FM9 D;  1U3Q A;  2JJ3 A;  1L2I A;  3KYT A;  4MG7 A;  5DKE A;  4IWC A;  2XYW A;  2AX9 A;  4XUM A;  5APK A;  3A2J A;  3DCU A;  4YT1 A;  4XUH A;  4G21 A;  1UHL B;  2REW A;  3OSA A;  5DXE A;  1P8D A;  1NHZ A;  1TXI A;  1UHL A;  2PNU A;  3AN3 A;  3W5P A;  1QKM A;  3IXP A;  2NXX E;  3OMM A;  3WT6 A;  5L11 A;  3WJ5 A;  2QR9 A;  1YIM A;  3KDT A;  2QZO B;  5DKB A;  2NW4 A;  4P6X A;  2Q5G A;  3TKC A;  4BCR A;  3AX8 A;  1ERR A;  2QZO A;  1T7F A;  2YLP A;  1N46 A;  2POB A;  4Q13 A;  3V3E A;  2QXM A;  1Y0X X;  4DM6 A;  4OH6 A;  5DIE A;  1RJK A;  1XNX A;  4FN9 A;  1R20 A;  3OSI A;  5DU5 A;  4RMC A;  3VSP A;  5DMC A;  2ZAS A;  3A78 A;  3E00 A;  3R5M A;  2J4A A;  2J7X A;  1HJ1 A;  2JFA B;  2NPA A;  1I37 A;  2ZKC A;  2Q70 A;  4LNX A;  1R1K D;  5C4S A;  2YJD A;  4WHG A;  3VT6 A;  3VT9 A;  2ACL B;  2Q7K A;  1XLS A;  5DX3 B;  4CI5 A;  2V7C A;  1FD0 A;  4WLB A;  4R06 A;  3KMG A;  4NUF A;  1TFC A;  2AMB A;  1PZL A;  3TX7 B;  1K74 D;  3ADT A;  4OFR A;  2IOK A;  4IW8 A;  2PIR A;  3ADW A;  3CDS A;  1MVC A;  3ZR7 A;  5EI1 A;  4FGY A;  1LBD A;  1PDU A;  2G5O A;  4OLM A;  3VRU A;  3A9E A;  3ILZ A;  4PWL A;  2HBH A;  3K8S A;  1U9E A;  1Y9R A;  1QKT A;  4XT9 A;  5EGV A;  3W0A A;  3B0T A;  4PRG A;  3AN4 A;  5DV3 A;  3BEJ A;  2HWR A;  1T7M A;  1ZEO A;  4G20 A;  5DXB B;  1DKF B;  5AWK A;  2GPO A;  3PEQ A;  4ZO1 B;  5KCU A;  5KCE A;  5DXB A;  3LMP A;  5AAV B;  4RME A;  3X1H A;  2R40 A;  5AAV A;  2HB8 A;  1DB1 A;  2QMV A;  4ONI A;  2FVJ A;  2G0H A;  3F7D A;  2ZFX A;  1MZN A;  3F5C A;  4RE8 A;  3D6D A;  3HQ5 A;  2ZY0 A;  4S0S A;  4OKB A;  2Q5S A;  4ZJR A;  4IA7 A;  3O1E A;  4IA3 A;  2ZMJ A;  5GT4 A;  2AYR A;  3E94 A;  3OMK A;  2YAT A;  3AUN A;  3W0Y A;  4A2J A;  4K6I A;  3G8I A;  3ET0 A;  4ZOM A;  2QSE A;  5DZH A;  1YP0 A;  1G1U A;  1T74 A;  4FNE A;  5EJV A;  2PIW A;  5DWL A;  4L96 A;  3ZRA A;  3D57 A;  4TUZ B;  4J26 A;  2ZLA A;  4IS8 A;  4UDB A;  5AK2 A;  1XLS E;  3SP6 A;  4TUZ A;  1ILG A;  2XYX A;  3U9Q A;  1YY4 A;  4MG9 A;  4ZNH A;  2J14 A;  4XHD A;  3VTB A;  2P4Y A;  3P8X A;  1SQN A;  3FEI A;  3CS6 A;  1GWR A;  2QNV A;  3B0Q A;  2Q5P A;  2QPY A;  5E7V A;  2NXX A;  2Q7J A;  4IV4 A;  1SKX A;  1U3R A;  4APU A;  2I0G A;  1P93 A;  2PIV A;  2AX6 A;  2O9I A;  5CJ6 A;  5HYK A;  2HC4 A;  3UP3 A;  2ZK5 A;  4PLD A;  2XYJ A;  2GWX A;  3H0A A;  4G1D A;  1ILH A;  3V9T A;  4QL8 A;  3AUQ A;  4J5X A;  3DR1 A;  3HVL A;  4ZN9 A;  5KCT A;  1KV6 A;  2AA5 A;  2Q3Y A;  2Q7L A;  4MGA B;  4DM8 A;  1G2N A;  3L1B A;  3OSW A;  4G1Z A;  3A3Z X;  3JZB A;  3OZ0 A;  1YYE A;  2ATH A;  4LSJ A;  3OKH A;  1IE9 A;  3PLZ A;  3ZRB A;  3NSP A;  1PK5 A; 
#chains in the Genus database with same CATH topology
 4OC7 A;  3D5F A;  5DI7 A;  1G5Y A;  3L3Z A;  5E0W A;  4OED A;  4OKX A;  1ZH7 A;  3CLD A;  5L7E A;  3W0H A;  5KCW A;  2Q6S A;  1OVL A;  2OVH A;  4O8F A;  2Q60 A;  5DV8 A;  4TV1 A;  5DTV A;  1T65 A;  1S0X A;  2P1U A;  2ZK1 A;  5HYR A;  5LWP A;  1X76 A;  1RDT D;  3W5Q A;  2PIT A;  3L0J A;  3FXV A;  4J5W C;  5K13 A;  3G0W A;  1FM6 A;  2PIU A;  4MG7 B;  5DVV A;  5E0X A;  2QXS A;  5C4O A;  4OJ9 A;  4DOS A;  2YFE A;  2I0J A;  2VV3 A;  5B5B A;  2O4R A;  1S19 A;  1EXA A;  1T7R A;  1XQ3 A;  2BJ4 A;  3DT3 A;  4OHA A;  1KNU A;  2B1Z A;  1K7L A;  4ZN7 A;  4NB6 A;  4OIV A;  1XOW A;  5L7G A;  3AZ3 A;  2PIQ A;  3VJH A;  2ABI A;  4YMQ A;  4G2H A;  5DY8 A;  2Q8S A;  3A2H A;  1EXX A;  4QM0 A;  1T79 A;  4S15 A;  3CTB A;  4UDA A;  4RMD A;  2G0G A;  4MGB A;  2AWH A;  4F9M A;  2HVC A;  2OAX A;  4QK4 A;  4RUP A;  4UDD A;  4JYH A;  4OEA A;  4WVD A;  3ZQT A;  5HZC A;  5JJM A;  4NQA B;  2Q7I A;  2VV4 A;  3V9Y A;  2LBD A;  1S9P A;  5DYD A;  4E4Q A;  1FCX A;  4Q0A C;  3OLL A;  5G46 A;  1NUO A;  5SYZ A;  5KCF A;  1WM0 X;  5G5W A;  1XDK A;  4WHF A;  1QKU A;  1RK3 A;  4G2I A;  4RFW A;  2QGW A;  1I38 A;  3CQV A;  5E15 A;  3B68 A;  5E1C A;  2PIO A;  2Q61 A;  4OZT U;  3VJS A;  5AVI A;  3W0I A;  2Z4J A;  2OUZ A;  2Q1V A;  3FLI A;  2ZMI A;  3WWR A;  4WQP A;  1PQC A;  1OSH A;  4JYI A;  4ZNS A;  3ADS A;  5DKG A;  2I4J A;  3KWY A;  4HEE X;  3HOD A;  2ZNP A;  2VST A;  3VT4 A;  4KZM A;  4DK8 A;  4PPP A;  5DZI A;  4JL4 A;  2G44 A;  4K7A A;  4PP3 A;  2GPU A;  2YJA B;  5AAU A;  3H52 A;  3A9E B;  5C4U A;  3X1I A;  4N8R A;  3VHU A;  3OLF A;  1ZDU A;  3NOA A;  3VTC A;  2OVM A;  3VT5 A;  5DZ3 A;  2PIN A;  4X1F A;  1ZGY A;  2QH6 A;  3B66 A;  4IUI A;  4A4W A;  3OS9 A;  1X7R A;  3P89 A;  1XP9 A;  3FAL A;  4OK1 A;  3PBA A;  4OKT A;  5AZT A;  1Q4X A;  1T73 A;  3VI8 A;  3VRT A;  3EYB A;  3VT7 A;  1H9U A;  3B5R A;  5HJP A;  3OAP A;  3KDU A;  5E14 A;  3AZ1 A;  4IVY A;  3DZU D;  5G44 A;  1UOM A;  2VV2 A;  3ERD A;  1G50 A;  1A52 A;  1HG4 A;  2V0V A;  5DMF A;  5I4V A;  3F5C B;  3GWX A;  3VJI A;  4OZR E;  3D24 A;  1XIU A;  5DWJ A;  2AXA A;  4LTW A;  2P7G A;  5C4T A;  2R6Y A;  3WFG A;  4ZNV A;  1NQ0 A;  5G42 A;  5DLR A;  1PQ9 A;  5DP0 A;  1Y0S A;  2AA6 A;  2PKL A;  2ZXN A;  2HAR A;  4OH5 A;  3KPZ A;  1E3G A;  1SJ0 A;  2QE4 A;  4PP6 A;  3R5N A;  1E3K A;  4S14 A;  3R8D A;  3W0J A;  1ERE A;  3WT5 A;  4CSJ A;  4R2U A;  5FQV A;  2Q6R A;  1ZDT A;  3W5T A;  3MNE A;  2HAM A;  2HB7 A;  3G8O A;  3OS8 C;  5AVL A;  3IPS A;  5DRJ A;  5FQT A;  4IQR A;  5G3J A;  2B50 A;  4MG9 B;  3M7R A;  1A28 A;  3W0C A;  1KKQ A;  3DZY A;  5F9B A;  4K4J A;  3UUA B;  1X7J A;  5EHJ A;  3QT0 A;  3KMZ A;  3UUA A;  2ZNO A;  1NQ7 A;  2QA8 A;  3BC5 A;  1U3S A;  2ZVT A;  4RWV A;  2ZNN A;  5DUG A;  2OZ7 A;  2YLQ A;  4RZG A;  3V9V A;  2FAI A;  2P7A A;  3CS8 A;  2P7Z A;  1YMT A;  3P0U A;  2XKW A;  3H0A D;  1NDE A;  1YIN A;  3O1D A;  3OMP A;  4J5W A;  4OZR U;  1NAX A;  3X36 A;  3UVV A;  3GYT A;  3TY0 A;  1FCY A;  3HC6 A;  4HLW A;  2ZK4 A;  5DRM A;  2W8Y A;  4IA1 A;  3ADU A;  5KYJ A;  1OT7 A;  2VV1 A;  5GID A;  1XVP B;  2QGT A;  3K6P A;  1XVP A;  4XLD A;  3VN2 A;  1BSX A;  3ADV A;  4PP5 A;  4YPQ A;  3WTQ A;  5DL4 A;  1S0Z A;  4IWF A;  2PRG A;  4Y29 A;  2POG A;  5DXP A;  1OVL B;  3L0L A;  3RVF A;  1IE8 A;  4TV1 B;  3B67 A;  2XHS A;  2AB2 A;  3X31 A;  2AO6 A;  1XNN A;  3Q95 A;  5HCV A;  4PVU A;  4LNW A;  4QJR A;  4KZJ A;  3K22 A;  2ZK3 A;  5KRO A;  2PIP L;  2ZL9 A;  3FC6 A;  3AFR A;  3ET3 A;  1XQC A;  4IA2 A;  4LBD A;  4X1G A;  1QKN A;  3ET2 A;  4PXM A;  1RKG A;  5DWI A;  5DXM A;  2Z4B A;  2VV0 A;  5JI0 D;  2BJ4 B;  3GWS X;  4PLE A;  1NAV A;  1MV9 A;  1I7I A;  2ZXM A;  2GTK A;  5DUH A;  3VTD A;  2AM9 A;  4OEY A;  3HM1 A;  5KRI A;  1XV9 A;  1Z95 A;  2YLO A;  3PCU A;  1N83 A;  3IXP D;  2OM9 A;  2P54 A;  4MGB B;  4MG8 A;  1XJ7 A;  5JJM B;  2VSR A;  2E2R A;  4IV2 A;  2QW4 A;  2VV4 B;  1RDT A;  2ZK0 A;  4G1Y A;  4QE8 A;  5DZ0 A;  4ZNU A;  1RKH A;  5G43 A;  3OKI A;  1X7B A;  1FM9 A;  1ZKY A;  2EWP A;  1R20 D;  1T76 A;  4REF A;  2GP7 A;  5DID A;  5FQS A;  5KYA A;  3GN8 A;  4JAZ A;  4EMA A;  1K4W A;  5IZ0 A;  3W5R A;  5KRH A;  1XDK B;  3KMR A;  3OMO A;  5DVC A;  3CWD A;  3E00 D;  3AZ2 A;  3GBK A;  5IXK A;  3GD2 A;  4UDC A;  3RUT A;  5ACC A;  5JY3 A;  1GWX A;  5B41 A;  5DWG A;  1M13 A;  3UUC A;  5DZ1 A;  4XI3 A;  4RZE A;  1M2Z A;  1T63 A;  4NY9 A;  4OIU A;  3L0E A;  2AAX A;  2ZNQ A;  4FHI A;  2JF9 A;  1YJE A;  2PJL A;  5DXQ A;  5KRL A;  1FBY A;  4L98 A;  4Q50 A;  2I4P A;  4EM9 A;  4S0T A;  3D90 A;  1Z5X E;  2GIU A;  2IOG A;  4OIL A;  4ZI1 A;  3VSO A;  3WT7 A;  5KCC A;  3K23 A;  4PF3 A;  2FSZ A;  4MGD B;  1XZX X;  4MGD A;  5DWE A;  4OJB A;  5H1E A;  2HAS A;  2ZXZ A;  3GYU A;  4J24 A;  4DK7 A;  3FAL B;  3OLS A;  4OJ4 A;  2JFA A;  3FUR A;  1R1K A;  5DK9 A;  3OS8 A;  5KRJ A;  1SR7 A;  3OGT A;  4CI4 A;  3GZ9 A;  4MG5 A;  4OKW A;  4ZNT A;  5HJP B;  1ZUC A;  4WPF A;  4M8H A;  2R40 D;  1NYX A;  2ACL A;  1L2J A;  5ICK A;  3OMQ A;  1YUC A;  4DMA A;  5DX3 A;  3FUG A;  5EIT A;  4NIE A;  4A4V A;  4XTA A;  1K74 A;  3FS1 A;  1UPV A;  3R2A A;  1PQ6 A;  3RUU A;  3SZ1 A;  3VHW A;  3JZC A;  5M96 A;  3ADX A;  3R8I A;  5KCD A;  2ZBS A;  4PPS A;  2O4J A;  1GWQ A;  3WGP A;  1R5K A;  1XAP A;  2P15 A;  1LV2 A;  1M7W A;  3B0W A;  1PRG A;  4N5G A;  5KRF A;  2Q6J A;  4RUJ A;  3VJT A;  3A40 X;  4YNK A;  5APJ A;  3B65 A;  3T03 A;  2QA6 A;  5DXK A;  1DKF A;  3V3Q A;  1Z5X U;  2GPP A;  3VRW A;  3HZF A;  3R29 A;  5HJS A;  5L7H A;  3DCT A;  1T7T A;  3DZU A;  4N1Y A;  3V4A A;  4REE A;  2H77 A;  5A86 A;  5IAW A;  3DZY D;  3HLV A;  2AX7 A;  1XP6 A;  4ZNW A;  1S9Q A;  2PIX A;  3OOK A;  4OEZ A;  5EC9 A;  2QA8 B;  3LBD A;  4IVW A;  3WFF A;  2HFP A;  3B0R A;  3NSQ A;  2B23 A;  1X78 A;  2J7Y A;  3IA6 A;  5GIC A;  2B1V A;  1XP1 A;  5DXR A;  3P88 A;  3FEJ A;  5AYG A;  2BAW A;  2AMA A;  2AX8 A;  2IHQ A;  2OCF A;  1YA3 A;  2R6W A;  2H79 A;  3B1M A;  5FQR A;  1X7E A;  3UVV B;  4POH A;  5DUE A;  3BQD A;  1GS4 A;  4QE6 A;  3HO0 A;  3HC5 A;  3VHV A;  1R6G A;  2Q59 B;  4MGC A;  5KRM A;  3R8A A;  2Q59 A;  1NQ2 A;  4POJ A;  1YOW A;  2VV1 B;  2NV7 A;  1T5Z A;  4OGH A;  4R6S A;  3DY6 A;  2P1T A;  3OOF A;  1I7G A;  5FQP A;  5ETH A;  3PRG A;  1XPC A;  4FHH A;  3IPU A;  4ITF A;  5DIG A;  4ZJW A;  5G45 A;  3E7C A;  5AWJ A;  5DXG A;  3IMY A;  4E4K A;  5AZV A;  3RLL A;  5KD9 A;  1N4H A;  4DOR A;  3CDP A;  4OAR A;  4OFU A;  5LGA A;  3TKM A;  5KRC A;  3WJ4 A;  5APH A;  3G9E A;  5DVS A;  3S9S A;  1VJB A;  2QTU A;  3OZJ A;  3Q95 B;  2I4Z A;  4JGV A;  4P6W A;  2YHD A;  3V49 A;  3IPQ A;  4MG6 A;  2GL8 A;  2F4B A;  4XAO A;  3UUD B;  5KR9 A;  1NRL A;  2HWQ A;  3MNO A;  3UUD A;  3VT3 A;  2YLY A;  4RZF A;  3UP0 A;  5DYB A;  2A3I A;  3FC6 B;  2AA2 A;  3PO9 A;  3SP9 A;  4MDD A;  5KRA A;  1YOK A;  5E19 A;  1ZAF A;  2HCD A;  3A2I A;  5DKS A;  3B3K A;  1FM6 D;  3CS4 A;  2GPV A;  2ZLC A;  3CJW A;  4JYG A;  4MGA A;  4IU7 A;  5DSH A;  4DQM A;  2ZK2 A;  3VT8 A;  2QAB A;  3ET1 A;  3KBA A;  3RLJ A;  3W0G A;  4N73 A;  1XV9 B;  5DV6 A;  3KFC A;  3WMH A;  2AA7 A;  1UPW A;  2Q1H A;  3AUR A;  1FCZ A;  4MG8 B;  4M8E A;  3VRV A;  1NQ1 A;  3UU7 B;  4IW6 A;  3ERT A;  3L3X A;  1XB7 A;  5KRK A;  3UU7 A;  3RY9 A;  2ZK6 A;  1OSV A;  2ZMH A;  4E2J A;  4ZO1 X;  4RAK A;  2P1V A;  4B7W A;  3MNP A;  3L03 A;  4OZT E;  5GIE A;  4ITE A;  3N00 A;  4J5X C;  4KZI A;  4RUO X;  1PCG A;  1FM9 D;  1U3Q A;  2JJ3 A;  1L2I A;  3KYT A;  4MG7 A;  5DKE A;  4IWC A;  2XYW A;  2AX9 A;  4XUM A;  5APK A;  3A2J A;  3DCU A;  4YT1 A;  4XUH A;  4G21 A;  1UHL B;  2REW A;  3OSA A;  5DXE A;  1P8D A;  1NHZ A;  1TXI A;  1UHL A;  2PNU A;  3AN3 A;  3W5P A;  1QKM A;  3IXP A;  2NXX E;  3OMM A;  3WT6 A;  5L11 A;  3WJ5 A;  2QR9 A;  1YIM A;  3KDT A;  2QZO B;  5DKB A;  2NW4 A;  4P6X A;  2Q5G A;  3TKC A;  4BCR A;  3AX8 A;  1ERR A;  2QZO A;  1T7F A;  2YLP A;  1N46 A;  2POB A;  4Q13 A;  3V3E A;  2QXM A;  1Y0X X;  4DM6 A;  4OH6 A;  5DIE A;  1RJK A;  1XNX A;  4FN9 A;  1R20 A;  3OSI A;  5DU5 A;  4RMC A;  3VSP A;  5DMC A;  2ZAS A;  3A78 A;  3E00 A;  3R5M A;  2J4A A;  2J7X A;  1HJ1 A;  2JFA B;  2NPA A;  1I37 A;  2ZKC A;  2Q70 A;  4LNX A;  1R1K D;  5C4S A;  2YJD A;  4WHG A;  3VT6 A;  3VT9 A;  2ACL B;  2Q7K A;  1XLS A;  5DX3 B;  4CI5 A;  2V7C A;  1FD0 A;  4WLB A;  4R06 A;  3KMG A;  4NUF A;  1TFC A;  2AMB A;  1PZL A;  3TX7 B;  1K74 D;  3ADT A;  4OFR A;  2IOK A;  4IW8 A;  2PIR A;  3ADW A;  3CDS A;  1MVC A;  3ZR7 A;  5EI1 A;  4FGY A;  1LBD A;  1PDU A;  2G5O A;  4OLM A;  3VRU A;  3A9E A;  3ILZ A;  4PWL A;  2HBH A;  3K8S A;  1U9E A;  1Y9R A;  1QKT A;  4XT9 A;  5EGV A;  3W0A A;  3B0T A;  4PRG A;  3AN4 A;  5DV3 A;  3BEJ A;  2HWR A;  1T7M A;  1ZEO A;  4G20 A;  5DXB B;  1DKF B;  5AWK A;  2GPO A;  3PEQ A;  4ZO1 B;  5KCU A;  5KCE A;  5DXB A;  3LMP A;  5AAV B;  4RME A;  3X1H A;  2R40 A;  5AAV A;  2HB8 A;  1DB1 A;  2QMV A;  4ONI A;  2FVJ A;  2G0H A;  3F7D A;  2ZFX A;  1MZN A;  3F5C A;  4RE8 A;  3D6D A;  3HQ5 A;  2ZY0 A;  4S0S A;  4OKB A;  2Q5S A;  4ZJR A;  4IA7 A;  3O1E A;  4IA3 A;  2ZMJ A;  5GT4 A;  2AYR A;  3E94 A;  3OMK A;  2YAT A;  3AUN A;  3W0Y A;  4A2J A;  4K6I A;  3G8I A;  3ET0 A;  4ZOM A;  2QSE A;  5DZH A;  1YP0 A;  1G1U A;  1T74 A;  4FNE A;  5EJV A;  2PIW A;  5DWL A;  4L96 A;  3ZRA A;  3D57 A;  4TUZ B;  4J26 A;  2ZLA A;  4IS8 A;  4UDB A;  5AK2 A;  1XLS E;  3SP6 A;  4TUZ A;  1ILG A;  2XYX A;  3U9Q A;  1YY4 A;  4MG9 A;  4ZNH A;  2J14 A;  4XHD A;  3VTB A;  2P4Y A;  3P8X A;  1SQN A;  3FEI A;  3CS6 A;  1GWR A;  2QNV A;  3B0Q A;  2Q5P A;  2QPY A;  5E7V A;  2NXX A;  2Q7J A;  4IV4 A;  1SKX A;  1U3R A;  4APU A;  2I0G A;  1P93 A;  2PIV A;  2AX6 A;  2O9I A;  5CJ6 A;  5HYK A;  2HC4 A;  3UP3 A;  2ZK5 A;  4PLD A;  2XYJ A;  2GWX A;  3H0A A;  4G1D A;  1ILH A;  3V9T A;  4QL8 A;  3AUQ A;  4J5X A;  3DR1 A;  3HVL A;  4ZN9 A;  5KCT A;  1KV6 A;  2AA5 A;  2Q3Y A;  2Q7L A;  4MGA B;  4DM8 A;  1G2N A;  3L1B A;  3OSW A;  4G1Z A;  3A3Z X;  3JZB A;  3OZ0 A;  1YYE A;  2ATH A;  4LSJ A;  3OKH A;  1IE9 A;  3PLZ A;  3ZRB A;  3NSP A;  1PK5 A; 
#chains in the Genus database with same CATH homology
 4OC7 A;  3D5F A;  5DI7 A;  1G5Y A;  3L3Z A;  5E0W A;  4OED A;  4OKX A;  1ZH7 A;  3CLD A;  5L7E A;  3W0H A;  5KCW A;  2Q6S A;  1OVL A;  2OVH A;  4O8F A;  2Q60 A;  5DV8 A;  4TV1 A;  5DTV A;  1T65 A;  1S0X A;  2P1U A;  2ZK1 A;  5HYR A;  5LWP A;  1X76 A;  1RDT D;  3W5Q A;  2PIT A;  3L0J A;  3FXV A;  4J5W C;  5K13 A;  3G0W A;  1FM6 A;  2PIU A;  4MG7 B;  5DVV A;  5E0X A;  2QXS A;  5C4O A;  4OJ9 A;  4DOS A;  2YFE A;  2I0J A;  2VV3 A;  5B5B A;  2O4R A;  1S19 A;  1EXA A;  1T7R A;  1XQ3 A;  2BJ4 A;  3DT3 A;  4OHA A;  1KNU A;  2B1Z A;  1K7L A;  4ZN7 A;  4NB6 A;  4OIV A;  1XOW A;  5L7G A;  3AZ3 A;  2PIQ A;  3VJH A;  2ABI A;  4YMQ A;  4G2H A;  5DY8 A;  2Q8S A;  3A2H A;  1EXX A;  4QM0 A;  1T79 A;  4S15 A;  3CTB A;  4UDA A;  4RMD A;  2G0G A;  4MGB A;  2AWH A;  4F9M A;  2HVC A;  2OAX A;  4QK4 A;  4RUP A;  4UDD A;  4JYH A;  4OEA A;  4WVD A;  3ZQT A;  5HZC A;  5JJM A;  4NQA B;  2Q7I A;  2VV4 A;  3V9Y A;  2LBD A;  1S9P A;  5DYD A;  4E4Q A;  1FCX A;  4Q0A C;  3OLL A;  5G46 A;  1NUO A;  5SYZ A;  5KCF A;  1WM0 X;  5G5W A;  1XDK A;  4WHF A;  1QKU A;  1RK3 A;  4G2I A;  4RFW A;  2QGW A;  1I38 A;  3CQV A;  5E15 A;  3B68 A;  5E1C A;  2PIO A;  2Q61 A;  4OZT U;  3VJS A;  5AVI A;  3W0I A;  2Z4J A;  2OUZ A;  2Q1V A;  3FLI A;  2ZMI A;  3WWR A;  4WQP A;  1PQC A;  1OSH A;  4JYI A;  4ZNS A;  3ADS A;  5DKG A;  2I4J A;  3KWY A;  4HEE X;  3HOD A;  2ZNP A;  2VST A;  3VT4 A;  4KZM A;  4DK8 A;  4PPP A;  5DZI A;  4JL4 A;  2G44 A;  4K7A A;  4PP3 A;  2GPU A;  2YJA B;  5AAU A;  3H52 A;  3A9E B;  5C4U A;  3X1I A;  4N8R A;  3VHU A;  3OLF A;  1ZDU A;  3NOA A;  3VTC A;  2OVM A;  3VT5 A;  5DZ3 A;  2PIN A;  4X1F A;  1ZGY A;  2QH6 A;  3B66 A;  4IUI A;  4A4W A;  3OS9 A;  1X7R A;  3P89 A;  1XP9 A;  3FAL A;  4OK1 A;  3PBA A;  4OKT A;  5AZT A;  1Q4X A;  1T73 A;  3VI8 A;  3VRT A;  3EYB A;  3VT7 A;  1H9U A;  3B5R A;  5HJP A;  3OAP A;  3KDU A;  5E14 A;  3AZ1 A;  4IVY A;  3DZU D;  5G44 A;  1UOM A;  2VV2 A;  3ERD A;  1G50 A;  1A52 A;  1HG4 A;  2V0V A;  5DMF A;  5I4V A;  3F5C B;  3GWX A;  3VJI A;  4OZR E;  3D24 A;  1XIU A;  5DWJ A;  2AXA A;  4LTW A;  2P7G A;  5C4T A;  2R6Y A;  3WFG A;  4ZNV A;  1NQ0 A;  5G42 A;  5DLR A;  1PQ9 A;  5DP0 A;  1Y0S A;  2AA6 A;  2PKL A;  2ZXN A;  2HAR A;  4OH5 A;  3KPZ A;  1E3G A;  1SJ0 A;  2QE4 A;  4PP6 A;  3R5N A;  1E3K A;  4S14 A;  3R8D A;  3W0J A;  1ERE A;  3WT5 A;  4CSJ A;  4R2U A;  5FQV A;  2Q6R A;  1ZDT A;  3W5T A;  3MNE A;  2HAM A;  2HB7 A;  3G8O A;  3OS8 C;  5AVL A;  3IPS A;  5DRJ A;  5FQT A;  4IQR A;  5G3J A;  2B50 A;  4MG9 B;  3M7R A;  1A28 A;  3W0C A;  1KKQ A;  3DZY A;  5F9B A;  4K4J A;  3UUA B;  1X7J A;  5EHJ A;  3QT0 A;  3KMZ A;  3UUA A;  2ZNO A;  1NQ7 A;  2QA8 A;  3BC5 A;  1U3S A;  2ZVT A;  4RWV A;  2ZNN A;  5DUG A;  2OZ7 A;  2YLQ A;  4RZG A;  3V9V A;  2FAI A;  2P7A A;  3CS8 A;  2P7Z A;  1YMT A;  3P0U A;  2XKW A;  3H0A D;  1NDE A;  1YIN A;  3O1D A;  3OMP A;  4J5W A;  4OZR U;  1NAX A;  3X36 A;  3UVV A;  3GYT A;  3TY0 A;  1FCY A;  3HC6 A;  4HLW A;  2ZK4 A;  5DRM A;  2W8Y A;  4IA1 A;  3ADU A;  5KYJ A;  1OT7 A;  2VV1 A;  5GID A;  1XVP B;  2QGT A;  3K6P A;  1XVP A;  4XLD A;  3VN2 A;  1BSX A;  3ADV A;  4PP5 A;  4YPQ A;  3WTQ A;  5DL4 A;  1S0Z A;  4IWF A;  2PRG A;  4Y29 A;  2POG A;  5DXP A;  1OVL B;  3L0L A;  3RVF A;  1IE8 A;  4TV1 B;  3B67 A;  2XHS A;  2AB2 A;  3X31 A;  2AO6 A;  1XNN A;  3Q95 A;  5HCV A;  4PVU A;  4LNW A;  4QJR A;  4KZJ A;  3K22 A;  2ZK3 A;  5KRO A;  2PIP L;  2ZL9 A;  3FC6 A;  3AFR A;  3ET3 A;  1XQC A;  4IA2 A;  4LBD A;  4X1G A;  1QKN A;  3ET2 A;  4PXM A;  1RKG A;  5DWI A;  5DXM A;  2Z4B A;  2VV0 A;  5JI0 D;  2BJ4 B;  3GWS X;  4PLE A;  1NAV A;  1MV9 A;  1I7I A;  2ZXM A;  2GTK A;  5DUH A;  3VTD A;  2AM9 A;  4OEY A;  3HM1 A;  5KRI A;  1XV9 A;  1Z95 A;  2YLO A;  3PCU A;  1N83 A;  3IXP D;  2OM9 A;  2P54 A;  4MGB B;  4MG8 A;  1XJ7 A;  5JJM B;  2VSR A;  2E2R A;  4IV2 A;  2QW4 A;  2VV4 B;  1RDT A;  2ZK0 A;  4G1Y A;  4QE8 A;  5DZ0 A;  4ZNU A;  1RKH A;  5G43 A;  3OKI A;  1X7B A;  1FM9 A;  1ZKY A;  2EWP A;  1R20 D;  1T76 A;  4REF A;  2GP7 A;  5DID A;  5FQS A;  5KYA A;  3GN8 A;  4JAZ A;  4EMA A;  1K4W A;  5IZ0 A;  3W5R A;  5KRH A;  1XDK B;  3KMR A;  3OMO A;  5DVC A;  3CWD A;  3E00 D;  3AZ2 A;  3GBK A;  5IXK A;  3GD2 A;  4UDC A;  3RUT A;  5ACC A;  5JY3 A;  1GWX A;  5B41 A;  5DWG A;  1M13 A;  3UUC A;  5DZ1 A;  4XI3 A;  4RZE A;  1M2Z A;  1T63 A;  4NY9 A;  4OIU A;  3L0E A;  2AAX A;  2ZNQ A;  4FHI A;  2JF9 A;  1YJE A;  2PJL A;  5DXQ A;  5KRL A;  1FBY A;  4L98 A;  4Q50 A;  2I4P A;  4EM9 A;  4S0T A;  3D90 A;  1Z5X E;  2GIU A;  2IOG A;  4OIL A;  4ZI1 A;  3VSO A;  3WT7 A;  5KCC A;  3K23 A;  4PF3 A;  2FSZ A;  4MGD B;  1XZX X;  4MGD A;  5DWE A;  4OJB A;  5H1E A;  2HAS A;  2ZXZ A;  3GYU A;  4J24 A;  4DK7 A;  3FAL B;  3OLS A;  4OJ4 A;  2JFA A;  3FUR A;  1R1K A;  5DK9 A;  3OS8 A;  5KRJ A;  1SR7 A;  3OGT A;  4CI4 A;  3GZ9 A;  4MG5 A;  4OKW A;  4ZNT A;  5HJP B;  1ZUC A;  4WPF A;  4M8H A;  2R40 D;  1NYX A;  2ACL A;  1L2J A;  5ICK A;  3OMQ A;  1YUC A;  4DMA A;  5DX3 A;  3FUG A;  5EIT A;  4NIE A;  4A4V A;  4XTA A;  1K74 A;  3FS1 A;  1UPV A;  3R2A A;  1PQ6 A;  3RUU A;  3SZ1 A;  3VHW A;  3JZC A;  5M96 A;  3ADX A;  3R8I A;  5KCD A;  2ZBS A;  4PPS A;  2O4J A;  1GWQ A;  3WGP A;  1R5K A;  1XAP A;  2P15 A;  1LV2 A;  1M7W A;  3B0W A;  1PRG A;  4N5G A;  5KRF A;  2Q6J A;  4RUJ A;  3VJT A;  3A40 X;  4YNK A;  5APJ A;  3B65 A;  3T03 A;  2QA6 A;  5DXK A;  1DKF A;  3V3Q A;  1Z5X U;  2GPP A;  3VRW A;  3HZF A;  3R29 A;  5HJS A;  5L7H A;  3DCT A;  1T7T A;  3DZU A;  4N1Y A;  3V4A A;  4REE A;  2H77 A;  5A86 A;  5IAW A;  3DZY D;  3HLV A;  2AX7 A;  1XP6 A;  4ZNW A;  1S9Q A;  2PIX A;  3OOK A;  4OEZ A;  5EC9 A;  2QA8 B;  3LBD A;  4IVW A;  3WFF A;  2HFP A;  3B0R A;  3NSQ A;  2B23 A;  1X78 A;  2J7Y A;  3IA6 A;  5GIC A;  2B1V A;  1XP1 A;  5DXR A;  3P88 A;  3FEJ A;  5AYG A;  2BAW A;  2AMA A;  2AX8 A;  2IHQ A;  2OCF A;  1YA3 A;  2R6W A;  2H79 A;  3B1M A;  5FQR A;  1X7E A;  3UVV B;  4POH A;  5DUE A;  3BQD A;  1GS4 A;  4QE6 A;  3HO0 A;  3HC5 A;  3VHV A;  1R6G A;  2Q59 B;  4MGC A;  5KRM A;  3R8A A;  2Q59 A;  1NQ2 A;  4POJ A;  1YOW A;  2VV1 B;  2NV7 A;  1T5Z A;  4OGH A;  4R6S A;  3DY6 A;  2P1T A;  3OOF A;  1I7G A;  5FQP A;  5ETH A;  3PRG A;  1XPC A;  4FHH A;  3IPU A;  4ITF A;  5DIG A;  4ZJW A;  5G45 A;  3E7C A;  5AWJ A;  5DXG A;  3IMY A;  4E4K A;  5AZV A;  3RLL A;  5KD9 A;  1N4H A;  4DOR A;  3CDP A;  4OAR A;  4OFU A;  5LGA A;  3TKM A;  5KRC A;  3WJ4 A;  5APH A;  3G9E A;  5DVS A;  3S9S A;  1VJB A;  2QTU A;  3OZJ A;  3Q95 B;  2I4Z A;  4JGV A;  4P6W A;  2YHD A;  3V49 A;  3IPQ A;  4MG6 A;  2GL8 A;  2F4B A;  4XAO A;  3UUD B;  5KR9 A;  1NRL A;  2HWQ A;  3MNO A;  3UUD A;  3VT3 A;  2YLY A;  4RZF A;  3UP0 A;  5DYB A;  2A3I A;  3FC6 B;  2AA2 A;  3PO9 A;  3SP9 A;  4MDD A;  5KRA A;  1YOK A;  5E19 A;  1ZAF A;  2HCD A;  3A2I A;  5DKS A;  3B3K A;  1FM6 D;  3CS4 A;  2GPV A;  2ZLC A;  3CJW A;  4JYG A;  4MGA A;  4IU7 A;  5DSH A;  4DQM A;  2ZK2 A;  3VT8 A;  2QAB A;  3ET1 A;  3KBA A;  3RLJ A;  3W0G A;  4N73 A;  1XV9 B;  5DV6 A;  3KFC A;  3WMH A;  2AA7 A;  1UPW A;  2Q1H A;  3AUR A;  1FCZ A;  4MG8 B;  4M8E A;  3VRV A;  1NQ1 A;  3UU7 B;  4IW6 A;  3ERT A;  3L3X A;  1XB7 A;  5KRK A;  3UU7 A;  3RY9 A;  2ZK6 A;  1OSV A;  2ZMH A;  4E2J A;  4ZO1 X;  4RAK A;  2P1V A;  4B7W A;  3MNP A;  3L03 A;  4OZT E;  5GIE A;  4ITE A;  3N00 A;  4J5X C;  4KZI A;  4RUO X;  1PCG A;  1FM9 D;  1U3Q A;  2JJ3 A;  1L2I A;  3KYT A;  4MG7 A;  5DKE A;  4IWC A;  2XYW A;  2AX9 A;  4XUM A;  5APK A;  3A2J A;  3DCU A;  4YT1 A;  4XUH A;  4G21 A;  1UHL B;  2REW A;  3OSA A;  5DXE A;  1P8D A;  1NHZ A;  1TXI A;  1UHL A;  2PNU A;  3AN3 A;  3W5P A;  1QKM A;  3IXP A;  2NXX E;  3OMM A;  3WT6 A;  5L11 A;  3WJ5 A;  2QR9 A;  1YIM A;  3KDT A;  2QZO B;  5DKB A;  2NW4 A;  4P6X A;  2Q5G A;  3TKC A;  4BCR A;  3AX8 A;  1ERR A;  2QZO A;  1T7F A;  2YLP A;  1N46 A;  2POB A;  4Q13 A;  3V3E A;  2QXM A;  1Y0X X;  4DM6 A;  4OH6 A;  5DIE A;  1RJK A;  1XNX A;  4FN9 A;  1R20 A;  3OSI A;  5DU5 A;  4RMC A;  3VSP A;  5DMC A;  2ZAS A;  3A78 A;  3E00 A;  3R5M A;  2J4A A;  2J7X A;  1HJ1 A;  2JFA B;  2NPA A;  1I37 A;  2ZKC A;  2Q70 A;  4LNX A;  1R1K D;  5C4S A;  2YJD A;  4WHG A;  3VT6 A;  3VT9 A;  2ACL B;  2Q7K A;  1XLS A;  5DX3 B;  4CI5 A;  2V7C A;  1FD0 A;  4WLB A;  4R06 A;  3KMG A;  4NUF A;  1TFC A;  2AMB A;  1PZL A;  3TX7 B;  1K74 D;  3ADT A;  4OFR A;  2IOK A;  4IW8 A;  2PIR A;  3ADW A;  3CDS A;  1MVC A;  3ZR7 A;  5EI1 A;  4FGY A;  1LBD A;  1PDU A;  2G5O A;  4OLM A;  3VRU A;  3A9E A;  3ILZ A;  4PWL A;  2HBH A;  3K8S A;  1U9E A;  1Y9R A;  1QKT A;  4XT9 A;  5EGV A;  3W0A A;  3B0T A;  4PRG A;  3AN4 A;  5DV3 A;  3BEJ A;  2HWR A;  1T7M A;  1ZEO A;  4G20 A;  5DXB B;  1DKF B;  5AWK A;  2GPO A;  3PEQ A;  4ZO1 B;  5KCU A;  5KCE A;  5DXB A;  3LMP A;  5AAV B;  4RME A;  3X1H A;  2R40 A;  5AAV A;  2HB8 A;  1DB1 A;  2QMV A;  4ONI A;  2FVJ A;  2G0H A;  3F7D A;  2ZFX A;  1MZN A;  3F5C A;  4RE8 A;  3D6D A;  3HQ5 A;  2ZY0 A;  4S0S A;  4OKB A;  2Q5S A;  4ZJR A;  4IA7 A;  3O1E A;  4IA3 A;  2ZMJ A;  5GT4 A;  2AYR A;  3E94 A;  3OMK A;  2YAT A;  3AUN A;  3W0Y A;  4A2J A;  4K6I A;  3G8I A;  3ET0 A;  4ZOM A;  2QSE A;  5DZH A;  1YP0 A;  1G1U A;  1T74 A;  4FNE A;  5EJV A;  2PIW A;  5DWL A;  4L96 A;  3ZRA A;  3D57 A;  4TUZ B;  4J26 A;  2ZLA A;  4IS8 A;  4UDB A;  5AK2 A;  1XLS E;  3SP6 A;  4TUZ A;  1ILG A;  2XYX A;  3U9Q A;  1YY4 A;  4MG9 A;  4ZNH A;  2J14 A;  4XHD A;  3VTB A;  2P4Y A;  3P8X A;  1SQN A;  3FEI A;  3CS6 A;  1GWR A;  2QNV A;  3B0Q A;  2Q5P A;  2QPY A;  5E7V A;  2NXX A;  2Q7J A;  4IV4 A;  1SKX A;  1U3R A;  4APU A;  2I0G A;  1P93 A;  2PIV A;  2AX6 A;  2O9I A;  5CJ6 A;  5HYK A;  2HC4 A;  3UP3 A;  2ZK5 A;  4PLD A;  2XYJ A;  2GWX A;  3H0A A;  4G1D A;  1ILH A;  3V9T A;  4QL8 A;  3AUQ A;  4J5X A;  3DR1 A;  3HVL A;  4ZN9 A;  5KCT A;  1KV6 A;  2AA5 A;  2Q3Y A;  2Q7L A;  4MGA B;  4DM8 A;  1G2N A;  3L1B A;  3OSW A;  4G1Z A;  3A3Z X;  3JZB A;  3OZ0 A;  1YYE A;  2ATH A;  4LSJ A;  3OKH A;  1IE9 A;  3PLZ A;  3ZRB A;  3NSP A;  1PK5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...