2ZNQA

Human ppar delta ligand binding domain in complex with a synthetic agonist tipp401
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
268
structure length
262
Chain Sequence
DLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Adaptability and selectivity of human peroxisome proliferator-activated receptor (PPAR) pan agonists revealed from crystal structures
pubmed doi rcsb
molecule keywords Peroxisome proliferator-activated receptor delta
molecule tags Transcription
source organism Homo sapiens
total genus 100
structure length 262
sequence length 268
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 2znqA00
3VSOA 1I38A 3A9EA 3A2HA 2VV4B 1OT7A 5B41A 1XDKA 1N4HA 2YLQA 4XT9A 2P4YA 5M96A 3A78A 1K4WA 1XPCA 5DRMA 3WTQA 4RUJA 2YLOA 4ZNUA 2QNVA 5FQRA 1S9PA 2FVJA 2Q5PA 1RDTD 3OLLA 2HVCA 3FEJA 2V7CA 5G5WA 5KCUA 3B67A 2ZNQA 4WHGA 1NQ2A 4OC7A 4OFUA 3A40X 1SR7A 4QM0A 4NUFA 2NXXA 5E7VA 3VJSA 3GD2A 3LMPA 3RY9A 1QKUA 1ZUCA 4MG7A 2Q5SA 4OJBA 2ZK6A 4ZN9A 1XNNA 3VT6A 3VTCA 3F7DA 1NAVA 4S15A 1U9EA 2G0HA 3M7RA 1XVPA 5DZIA 2AX9A 1L2JA 1T63A 2PITA 3OSIA 3OMKA 1Q4XA 4JYHA 4OH5A 1ZKYA 3HODA 4WQPA 1GWXA 3VT4A 5JJMA 4X1GA 2B23A 4REEA 4IWFA 3F5CA 3VRVA 3OAPA 4IVWA 2P54A 3B0QA 2AMBA 4IU7A 4MGAA 2IOKA 1T7RA 3S9SA 4UDDA 5DVCA 3R2AA 3VT9A 3B0WA 4MG6A 1T65A 4DORA 5GT4A 1YY4A 2ZK1A 1H9UA 3D6DA 2ZK0A 2AM9A 4FNEA 3RVFA 4KZMA 3VT3A 2QA6A 1FM9A 2HBHA 2POGA 2ZK3A 4MGBA 5DZ0A 4RMDA 1N83A 2GPOA 3HO0A 4IW8A 3VSPA 2VV1A 1X7BA 5DX3B 4B7WA 2GPPA 1YUCA 5JI0D 3AFRA 2QMVA 5DIGA 1DKFB 3B0RA 3WJ4A 4A4VA 1R5KA 2OVHA 3DR1A 3OLSA 2ABIA 4PPPA 1YIMA 3ADSA 4OFRA 5K13A 3L0LA 1GWQA 1YA3A 4Y29A 5AAVA 2OM9A 5EITA 5AVLA 3OSAA 2ZK4A 3R8IA 3TX7B 3B68A 1ZH7A 1TFCA 4OKTA 1BSXA 2ZKCA 2Q6SA 2J7YA 2YLPA 2ZNNA 4OHAA 5KRJA 2ZFXA 2QA8B 2VSRA 4MGCA 5C4TA 3VTBA 2ZXMA 4G2HA 2AX6A 2PRGA 4RMEA 5DYBA 2AA5A 2ZMHA 3L0EA 3IPQA 4PWLA 2LBDA 2XKWA 1X7RA 5DUGA 2GTKA 3H52A 1OVLB 4X1FA 5DXPA 4IA7A 3R5NA 1YINA 3CS8A 3GYTA 1XJ7A 3A9EB 3NSQA 5KYJA 2P7GA 2HWQA 4OZTE 1K74A 2PIPL 3IPSA 2GIUA 3DT3A 3OMQA 3MNEA 5DXGA 1XDKB 4KZJA 3KYTA 3D57A 2Q7LA 4PVUA 3ET3A 3WT7A 3DZUA 3OZ0A 3ADTA 5EGVA 1HJ1A 1UOMA 2Q7JA 3W5RA 5IZ0A 1FM9D 1G50A 4PXMA 2QXSA 3PLZA 5DV8A 4Q0AC 4K4JA 5AWKA 1S0ZA 2QZOA 1XLSE 4G1ZA 1FD0A 2AX7A 3GWXA 4UDBA 5DVVA 5G46A 2AMAA 1XAPA 4TUZA 2G5OA 2V0VA 3IPUA 2Q7IA 1T5ZA 3UP0A 2PIXA 2HC4A 3OGTA 5DWEA 4IS8A 4ONIA 5L7HA 2J14A 1RKGA 4ZOMA 5GIEA 1VJBA 3H0AA 3K8SA 1YYEA 4G1DA 4MG7B 4HEEX 2IHQA 1YJEA 1E3GA 4E4QA 2R6WA 3DY6A 3PRGA 4M8EA 3RUTA 3VHWA 1ZEOA 1EXXA 3KDUA 3G9EA 1KNUA 2JFAA 2JJ3A 3UVVA 4OZTU 1XVPB 2I4ZA 1E3KA 5AWJA 2P15A 3GYUA 5FQTA 2ZK5A 2ZVTA 3NOAA 4RMCA 4A4WA 5JJMB 5KRMA 3FS1A 5FQSA 5APJA 3V9VA 3E00A 2NW4A 4J5XA 1RJKA 1ZDUA 3D24A 3F5CB 2AA7A 2Q6JA 4NB6A 5HYRA 1SQNA 1K74D 2PIRA 3OMOA 5DMCA 4MGAB 4OEDA 3AX8A 3FURA 3HC6A 3CS6A 4DK7A 4OGHA 3UU7A 3WMHA 5F9BA 5DXEA 2ZL9A 2AWHA 4PRGA 3OS8A 5DUHA 3AZ3A 3L1BA 1EREA 3DZUD 2OCFA 4NY9A 3MNOA 5G44A 5DXMA 2YHDA 1N46A 3TKMA 5DK9A 5DXBA 3VRTA 3WT6A 1FCZA 2HARA 2AYRA 4M8HA 4MGBB 4IUIA 4OJ9A 5ACCA 2BAWA 5DXRA 1ILHA 1T7TA 2VV1B 2HASA 1XLSA 1IE8A 2HB8A 4L98A 2Q7KA 4LNXA 5AYGA 1PZLA 2PNUA 5APKA 2VV0A 5JY3A 5KRFA 3KBAA 1I37A 5DIDA 3CDSA 2QSEA 4IQRA 3SZ1A 2QGWA 2B1ZA 1M2ZA 1NQ0A 2XYJA 3H0AD 3MNPA 2B50A 4MG8A 1UHLA 5AAVB 4L96A 4REFA 1S9QA 2YJAB 2HB7A 4NQAB 2BJ4A 2EWPA 5IXKA 3X31A 3HZFA 3VN2A 4HLWA 3ZRBA 3FEIA 3P89A 1UPWA 1YMTA 1DB1A 3B5RA 2REWA 4OZRU 4WVDA 3UUCA 5I4VA 3OMPA 2O9IA 3LBDA 4MGDA 4ZO1X 2I4PA 1NRLA 1G5YA 2POBA 4S0TA 4PLEA 1XV9A 3OOKA 3B1MA 3AUQA 3E00D 4ZNSA 3VT5A 3V49A 4LNWA 4LTWA 1T7FA 2Q6RA 3AUNA 4ITEA 2Q5GA 2ACLA 1S19A 4LSJA 4XLDA 4F9MA 3DCUA 1YOWA 2PINA 2AXAA 2P7ZA 2ZMJA 1QKTA 5DKEA 4WHFA 1M13A 5E15A 4ZJRA 3WGPA 1PCGA 4DMAA 4IW6A 3VRUA 3VJHA 3ET2A 1ZDTA 5DKGA 3U9QA 5KCFA 1R1KA 3AN4A 4P6XA 5DWGA 4IA2A 1NAXA 3UUDA 5KCEA 2G44A 5KRIA 4QJRA 2GWXA 2VV3A 3G8IA 5HJSA 4WPFA 2QZOB 1R20A 1GWRA 4JYIA 4DOSA 4OKBA 2OVMA 3KWYA 2ZNPA 5B5BA 4TUZB 4S14A 4J5XC 3OS9A 3CLDA 4OKWA 4E2JA 3GN8A 4Q50A 1NYXA 3ZRAA 1NQ1A 1XB7A 4OIVA 3HC5A 2R40D 1XOWA 3WT5A 2QW4A 1PRGA 2ZLCA 3OS8C 3W0YA 3R8AA 1Z5XE 3HQ5A 1XNXA 4N5GA 5AAUA 1UPVA 2JFAB 3UVVB 1LBDA 3FC6A 5HCVA 3DZYD 3PCUA 1FCXA 3IXPD 4IWCA 3VTDA 2YLYA 1SJ0A 1U3RA 2ATHA 1ZGYA 5G42A 1A52A 5KD9A 2YATA 4FHHA 2AB2A 3KFCA 4JAZA 5EHJA 3RLJA 3K23A 4WLBA 5E14A 5DL4A 1MVCA 4ZO1B 4IVYA 2F4BA 2PIWA 1I7GA 2NPAA 3KMZA 4N73A 4QL8A 3W0GA 1RK3A 2AAXA 1KKQA 3SP9A 2Q59A 1M7WA 4OEZA 3O1DA 1XP1A 4J26A 4CSJA 3UU7B 3FLIA 4ZNHA 4ZNTA 5AZVA 4RUPA 3ADUA 3W0JA 4K7AA 3V4AA 1K7LA 5KCCA 4FN9A 5C4SA 4PLDA 5DXKA 1R1KD 5DXBB 1Y0SA 2ZMIA 3VJIA 1OSHA 3KDTA 3B66A 3PEQA 1T74A 2Z4JA 2ZNOA 1PK5A 5DRJA 5KROA 1NDEA 1R20D 3CQVA 1ILGA 1YOKA 1Z5XU 3OSWA 3JZBA 3PBAA 3OZJA 5EC9A 5AVIA 3G8OA 4YMQA 1T73A 3P8XA 1X76A 5L7GA 3IA6A 2OAXA 4R06A 5IAWA 1A28A 1G2NA 4OEYA 4DK8A 3ERDA 3A3ZX 4UDAA 1Y9RA 5DKSA 3VRWA 3W5TA 1U3QA 4TV1A 4IV2A 5AZTA 4MG8B 1HG4A 1UHLB 3GZ9A 4P6WA 4UDCA 5C4UA 4OJ4A 4R2UA 4XUMA 5G45A 2AA2A 2P1VA 3V3EA 2H79A 2BJ4B 3L3XA 2G0GA 3OLFA 4BCRA 3OMMA 4PP3A 4K6IA 5KRLA 1FBYA 2GPUA 5DV6A 4OK1A 5E0WA 3VI8A 3R5MA 1LV2A 1MZNA 4XAOA 5DSHA 4OZRE 4RUOX 4EMAA 3CDPA 5KCTA 1WM0X 4N1YA 4N8RA 4MGDB 3VJTA 4CI5A 3D5FA 2Q8SA 3HLVA 1XV9B 3N00A 5KCWA 3L3ZA 3D90A 2AO6A 3ZR7A 2PIVA 2R6YA 4G2IA 3K6PA 4ZN7A 1T7MA 3RUUA 4RE8A 2ACLB 1U3SA 5DZHA 1IE9A 3ADVA 4KZIA 3V9YA 3B65A 4J24A 5DV3A 5HJPA 2NV7A 3E94A 1NUOA 5L7EA 1OSVA 4ZJWA 2W8YA 3X1IA 3UUAA 3WFGA 3R29A 3GWSX 4OILA 5GICA 3VT7A 4CI4A 5DY8A 4QK4A 3ERTA 5LWPA 1RKHA 3Q95A 4OEAA 3UUDB 2IOGA 4YPQA 1G1UA 3GBKA 5E1CA 2Q61A 1ERRA 2O4RA 5DWLA 4DM6A 1P93A 5DP0A 2PIQA 2R40A 3ADXA 3AURA 4PP6A 3O1EA 4OARA 5CJ6A 2P1UA 3A2IA 3FALA 4QE6A 2GL8A 3WFFA 3CS4A 3IMYA 4MG9A 5DZ3A 3X1HA 1YP0A 3DZYA 4ITFA 3DCTA 3IXPA 5DIEA 4POJA 3PO9A 1FM6D 1XZXX 3NSPA 1P8DA 1FCYA 3V9TA 5APHA 5KCDA 3BC5A 3EYBA 4XHDA 3RLLA 3OKIA 4YT1A 1XQCA 1ZAFA 2Q60A 4IA3A 5A86A 3G0WA 2Q3YA 5DTVA 5ICKA 2YJDA 2QH6A 2J4AA 2ZASA 2QABA 2VV4A 3FC6B 3CWDA 5DWIA 2Q70A 1Z95A 3W5PA 3P0UA 3ILZA 4IV4A 4IA1A 5G43A 3JZCA 2HAMA 3BEJA 5H1EA 5DLRA 4YNKA 4RFWA 5DZ1A 5GIDA 2H77A 3B0TA 3W0HA 2Q1HA 4XUHA 5KYAA 5FQVA 2AX8A 1X78A 2PJLA 4E4KA 5DU5A 4PF3A 2QPYA 5G3JA 4ZNVA 2Q59B 1PQCA 3A2JA 2ZY0A 4J5WA 4NIEA 4MG5A 5AK2A 3L03A 1X7JA 2VV2A 3T03A 5DXQA 2PIOA 5DKBA 4PP5A 5DWJA 5DYDA 5E19A 5HZCA 4G21A 5DMFA 5KRCA 3V3QA 1TXIA 4XI3A 5SYZA 2PKLA 4G20A 1Y0XX 1QKMA 4POHA 4QE8A 4OIUA 2QXMA 2OUZA 4FGYA 4XTAA 3VT8A 2ZBSA 2OZ7A 4FHIA 2Z4BA 3UP3A 2QR9A 2XYWA 4PPSA 5L11A 3W0IA 2I0JA 3AZ2A 4LBDA 5DI7A 4JYGA 3TY0A 3WWRA 3W0AA 2J7XA 4TV1B 2ZK2A 1PDUA 3HM1A 5KRAA 4S0SA 1GS4A 3TKCA 4R6SA 4DM8A 1L2IA 2Q1VA 1T79A 4RWVA 5KRHA 2VSTA 3K22A 5LGAA 2I0GA 1X7EA 2HFPA 3L0JA 5EJVA 3CJWA 1KV6A 3FXVA 1S0XA 1SKXA 1XQ3A 4JGVA 1T76A 2P1TA 1XP6A 3KMGA 1QKNA 5HYKA 3HVLA 5FQPA 2QTUA 1I7IA 4OKXA 5DUEA 2XHSA 3ET1A 3W5QA 4RZFA 2FSZA 2P7AA 2ZXNA 4O8FA 4OLMA 2AA6A 3P88A 3R8DA 4EM9A 2ZXZA 3OKHA 4G1YA 3B3KA 2B1VA 4MDDA 4RZEA 3W0CA 2I4JA 4ZI1A 2YFEA 3WJ5A 5DX3A 3ET0A 3KPZA 1RDTA 5DVSA 5HJPB 5EI1A 1MV9A 2QE4A 4DQMA 3VHVA 2FAIA 4Q13A 1NQ7A 1DKFA 4RAKA 5KR9A 3UUAB 3CTBA 2HWRA 3FUGA 3QT0A 1R6GA 4A2JA 2NXXE 2ZLAA 3Q95B 3ZQTA 3KMRA 2GP7A 4RZGA 2QGTA 3ADWA 4ZNWA 2HCDA 1FM6A 1NHZA 1EXAA 3BQDA 5KRKA 2GPVA 2PIUA 1XIUA 3AZ1A 1PQ6A 5E0XA 5C4OA 2QA8A 4JL4A 4APUA 1XP9A 1PQ9A 3FALB 2O4JA 3VHUA 4MG9B 3OOFA 2E2RA 4J5WC 5ETHA 2A3IA 2JF9A 3X36A 3E7CA 4OH6A 3AN3A 3SP6A 1OVLA 2XYXA
chains in the Genus database with same CATH superfamily
3VSOA 1I38A 3A9EA 3A2HA 2VV4B 1OT7A 5B41A 1XDKA 1N4HA 2YLQA 4XT9A 2P4YA 5M96A 3A78A 1K4WA 1XPCA 5DRMA 3WTQA 4RUJA 2YLOA 4ZNUA 2QNVA 5FQRA 1S9PA 2FVJA 2Q5PA 1RDTD 3OLLA 2HVCA 3FEJA 2V7CA 5G5WA 5KCUA 3B67A 2ZNQA 4WHGA 1NQ2A 4OC7A 4OFUA 3A40X 1SR7A 4QM0A 4NUFA 2NXXA 5E7VA 3VJSA 3GD2A 3LMPA 3RY9A 1QKUA 1ZUCA 4MG7A 2Q5SA 4OJBA 2ZK6A 4ZN9A 1XNNA 3VT6A 3VTCA 3F7DA 1NAVA 4S15A 1U9EA 2G0HA 3M7RA 1XVPA 5DZIA 2AX9A 1L2JA 1T63A 2PITA 3OSIA 3OMKA 1Q4XA 4JYHA 4OH5A 1ZKYA 3HODA 4WQPA 1GWXA 3VT4A 5JJMA 4X1GA 2B23A 4REEA 4IWFA 3F5CA 3VRVA 3OAPA 4IVWA 2P54A 3B0QA 2AMBA 4IU7A 4MGAA 2IOKA 1T7RA 3S9SA 4UDDA 5DVCA 3R2AA 3VT9A 3B0WA 4MG6A 1T65A 4DORA 5GT4A 1YY4A 2ZK1A 1H9UA 3D6DA 2ZK0A 2AM9A 4FNEA 3RVFA 4KZMA 3VT3A 2QA6A 1FM9A 2HBHA 2POGA 2ZK3A 4MGBA 5DZ0A 4RMDA 1N83A 2GPOA 3HO0A 4IW8A 3VSPA 2VV1A 1X7BA 5DX3B 4B7WA 2GPPA 1YUCA 5JI0D 3AFRA 2QMVA 5DIGA 1DKFB 3B0RA 3WJ4A 4A4VA 1R5KA 2OVHA 3DR1A 3OLSA 2ABIA 4PPPA 1YIMA 3ADSA 4OFRA 5K13A 3L0LA 1GWQA 1YA3A 4Y29A 5AAVA 2OM9A 5EITA 5AVLA 3OSAA 2ZK4A 3R8IA 3TX7B 3B68A 1ZH7A 1TFCA 4OKTA 1BSXA 2ZKCA 2Q6SA 2J7YA 2YLPA 2ZNNA 4OHAA 5KRJA 2ZFXA 2QA8B 2VSRA 4MGCA 5C4TA 3VTBA 2ZXMA 4G2HA 2AX6A 2PRGA 4RMEA 5DYBA 2AA5A 2ZMHA 3L0EA 3IPQA 4PWLA 2LBDA 2XKWA 1X7RA 5DUGA 2GTKA 3H52A 1OVLB 4X1FA 5DXPA 4IA7A 3R5NA 1YINA 3CS8A 3GYTA 1XJ7A 3A9EB 3NSQA 5KYJA 2P7GA 2HWQA 4OZTE 1K74A 2PIPL 3IPSA 2GIUA 3DT3A 3OMQA 3MNEA 5DXGA 1XDKB 4KZJA 3KYTA 3D57A 2Q7LA 4PVUA 3ET3A 3WT7A 3DZUA 3OZ0A 3ADTA 5EGVA 1HJ1A 1UOMA 2Q7JA 3W5RA 5IZ0A 1FM9D 1G50A 4PXMA 2QXSA 3PLZA 5DV8A 4Q0AC 4K4JA 5AWKA 1S0ZA 2QZOA 1XLSE 4G1ZA 1FD0A 2AX7A 3GWXA 4UDBA 5DVVA 5G46A 2AMAA 1XAPA 4TUZA 2G5OA 2V0VA 3IPUA 2Q7IA 1T5ZA 3UP0A 2PIXA 2HC4A 3OGTA 5DWEA 4IS8A 4ONIA 5L7HA 2J14A 1RKGA 4ZOMA 5GIEA 1VJBA 3H0AA 3K8SA 1YYEA 4G1DA 4MG7B 4HEEX 2IHQA 1YJEA 1E3GA 4E4QA 2R6WA 3DY6A 3PRGA 4M8EA 3RUTA 3VHWA 1ZEOA 1EXXA 3KDUA 3G9EA 1KNUA 2JFAA 2JJ3A 3UVVA 4OZTU 1XVPB 2I4ZA 1E3KA 5AWJA 2P15A 3GYUA 5FQTA 2ZK5A 2ZVTA 3NOAA 4RMCA 4A4WA 5JJMB 5KRMA 3FS1A 5FQSA 5APJA 3V9VA 3E00A 2NW4A 4J5XA 1RJKA 1ZDUA 3D24A 3F5CB 2AA7A 2Q6JA 4NB6A 5HYRA 1SQNA 1K74D 2PIRA 3OMOA 5DMCA 4MGAB 4OEDA 3AX8A 3FURA 3HC6A 3CS6A 4DK7A 4OGHA 3UU7A 3WMHA 5F9BA 5DXEA 2ZL9A 2AWHA 4PRGA 3OS8A 5DUHA 3AZ3A 3L1BA 1EREA 3DZUD 2OCFA 4NY9A 3MNOA 5G44A 5DXMA 2YHDA 1N46A 3TKMA 5DK9A 5DXBA 3VRTA 3WT6A 1FCZA 2HARA 2AYRA 4M8HA 4MGBB 4IUIA 4OJ9A 5ACCA 2BAWA 5DXRA 1ILHA 1T7TA 2VV1B 2HASA 1XLSA 1IE8A 2HB8A 4L98A 2Q7KA 4LNXA 5AYGA 1PZLA 2PNUA 5APKA 2VV0A 5JY3A 5KRFA 3KBAA 1I37A 5DIDA 3CDSA 2QSEA 4IQRA 3SZ1A 2QGWA 2B1ZA 1M2ZA 1NQ0A 2XYJA 3H0AD 3MNPA 2B50A 4MG8A 1UHLA 5AAVB 4L96A 4REFA 1S9QA 2YJAB 2HB7A 4NQAB 2BJ4A 2EWPA 5IXKA 3X31A 3HZFA 3VN2A 4HLWA 3ZRBA 3FEIA 3P89A 1UPWA 1YMTA 1DB1A 3B5RA 2REWA 4OZRU 4WVDA 3UUCA 5I4VA 3OMPA 2O9IA 3LBDA 4MGDA 4ZO1X 2I4PA 1NRLA 1G5YA 2POBA 4S0TA 4PLEA 1XV9A 3OOKA 3B1MA 3AUQA 3E00D 4ZNSA 3VT5A 3V49A 4LNWA 4LTWA 1T7FA 2Q6RA 3AUNA 4ITEA 2Q5GA 2ACLA 1S19A 4LSJA 4XLDA 4F9MA 3DCUA 1YOWA 2PINA 2AXAA 2P7ZA 2ZMJA 1QKTA 5DKEA 4WHFA 1M13A 5E15A 4ZJRA 3WGPA 1PCGA 4DMAA 4IW6A 3VRUA 3VJHA 3ET2A 1ZDTA 5DKGA 3U9QA 5KCFA 1R1KA 3AN4A 4P6XA 5DWGA 4IA2A 1NAXA 3UUDA 5KCEA 2G44A 5KRIA 4QJRA 2GWXA 2VV3A 3G8IA 5HJSA 4WPFA 2QZOB 1R20A 1GWRA 4JYIA 4DOSA 4OKBA 2OVMA 3KWYA 2ZNPA 5B5BA 4TUZB 4S14A 4J5XC 3OS9A 3CLDA 4OKWA 4E2JA 3GN8A 4Q50A 1NYXA 3ZRAA 1NQ1A 1XB7A 4OIVA 3HC5A 2R40D 1XOWA 3WT5A 2QW4A 1PRGA 2ZLCA 3OS8C 3W0YA 3R8AA 1Z5XE 3HQ5A 1XNXA 4N5GA 5AAUA 1UPVA 2JFAB 3UVVB 1LBDA 3FC6A 5HCVA 3DZYD 3PCUA 1FCXA 3IXPD 4IWCA 3VTDA 2YLYA 1SJ0A 1U3RA 2ATHA 1ZGYA 5G42A 1A52A 5KD9A 2YATA 4FHHA 2AB2A 3KFCA 4JAZA 5EHJA 3RLJA 3K23A 4WLBA 5E14A 5DL4A 1MVCA 4ZO1B 4IVYA 2F4BA 2PIWA 1I7GA 2NPAA 3KMZA 4N73A 4QL8A 3W0GA 1RK3A 2AAXA 1KKQA 3SP9A 2Q59A 1M7WA 4OEZA 3O1DA 1XP1A 4J26A 4CSJA 3UU7B 3FLIA 4ZNHA 4ZNTA 5AZVA 4RUPA 3ADUA 3W0JA 4K7AA 3V4AA 1K7LA 5KCCA 4FN9A 5C4SA 4PLDA 5DXKA 1R1KD 5DXBB 1Y0SA 2ZMIA 3VJIA 1OSHA 3KDTA 3B66A 3PEQA 1T74A 2Z4JA 2ZNOA 1PK5A 5DRJA 5KROA 1NDEA 1R20D 3CQVA 1ILGA 1YOKA 1Z5XU 3OSWA 3JZBA 3PBAA 3OZJA 5EC9A 5AVIA 3G8OA 4YMQA 1T73A 3P8XA 1X76A 5L7GA 3IA6A 2OAXA 4R06A 5IAWA 1A28A 1G2NA 4OEYA 4DK8A 3ERDA 3A3ZX 4UDAA 1Y9RA 5DKSA 3VRWA 3W5TA 1U3QA 4TV1A 4IV2A 5AZTA 4MG8B 1HG4A 1UHLB 3GZ9A 4P6WA 4UDCA 5C4UA 4OJ4A 4R2UA 4XUMA 5G45A 2AA2A 2P1VA 3V3EA 2H79A 2BJ4B 3L3XA 2G0GA 3OLFA 4BCRA 3OMMA 4PP3A 4K6IA 5KRLA 1FBYA 2GPUA 5DV6A 4OK1A 5E0WA 3VI8A 3R5MA 1LV2A 1MZNA 4XAOA 5DSHA 4OZRE 4RUOX 4EMAA 3CDPA 5KCTA 1WM0X 4N1YA 4N8RA 4MGDB 3VJTA 4CI5A 3D5FA 2Q8SA 3HLVA 1XV9B 3N00A 5KCWA 3L3ZA 3D90A 2AO6A 3ZR7A 2PIVA 2R6YA 4G2IA 3K6PA 4ZN7A 1T7MA 3RUUA 4RE8A 2ACLB 1U3SA 5DZHA 1IE9A 3ADVA 4KZIA 3V9YA 3B65A 4J24A 5DV3A 5HJPA 2NV7A 3E94A 1NUOA 5L7EA 1OSVA 4ZJWA 2W8YA 3X1IA 3UUAA 3WFGA 3R29A 3GWSX 4OILA 5GICA 3VT7A 4CI4A 5DY8A 4QK4A 3ERTA 5LWPA 1RKHA 3Q95A 4OEAA 3UUDB 2IOGA 4YPQA 1G1UA 3GBKA 5E1CA 2Q61A 1ERRA 2O4RA 5DWLA 4DM6A 1P93A 5DP0A 2PIQA 2R40A 3ADXA 3AURA 4PP6A 3O1EA 4OARA 5CJ6A 2P1UA 3A2IA 3FALA 4QE6A 2GL8A 3WFFA 3CS4A 3IMYA 4MG9A 5DZ3A 3X1HA 1YP0A 3DZYA 4ITFA 3DCTA 3IXPA 5DIEA 4POJA 3PO9A 1FM6D 1XZXX 3NSPA 1P8DA 1FCYA 3V9TA 5APHA 5KCDA 3BC5A 3EYBA 4XHDA 3RLLA 3OKIA 4YT1A 1XQCA 1ZAFA 2Q60A 4IA3A 5A86A 3G0WA 2Q3YA 5DTVA 5ICKA 2YJDA 2QH6A 2J4AA 2ZASA 2QABA 2VV4A 3FC6B 3CWDA 5DWIA 2Q70A 1Z95A 3W5PA 3P0UA 3ILZA 4IV4A 4IA1A 5G43A 3JZCA 2HAMA 3BEJA 5H1EA 5DLRA 4YNKA 4RFWA 5DZ1A 5GIDA 2H77A 3B0TA 3W0HA 2Q1HA 4XUHA 5KYAA 5FQVA 2AX8A 1X78A 2PJLA 4E4KA 5DU5A 4PF3A 2QPYA 5G3JA 4ZNVA 2Q59B 1PQCA 3A2JA 2ZY0A 4J5WA 4NIEA 4MG5A 5AK2A 3L03A 1X7JA 2VV2A 3T03A 5DXQA 2PIOA 5DKBA 4PP5A 5DWJA 5DYDA 5E19A 5HZCA 4G21A 5DMFA 5KRCA 3V3QA 1TXIA 4XI3A 5SYZA 2PKLA 4G20A 1Y0XX 1QKMA 4POHA 4QE8A 4OIUA 2QXMA 2OUZA 4FGYA 4XTAA 3VT8A 2ZBSA 2OZ7A 4FHIA 2Z4BA 3UP3A 2QR9A 2XYWA 4PPSA 5L11A 3W0IA 2I0JA 3AZ2A 4LBDA 5DI7A 4JYGA 3TY0A 3WWRA 3W0AA 2J7XA 4TV1B 2ZK2A 1PDUA 3HM1A 5KRAA 4S0SA 1GS4A 3TKCA 4R6SA 4DM8A 1L2IA 2Q1VA 1T79A 4RWVA 5KRHA 2VSTA 3K22A 5LGAA 2I0GA 1X7EA 2HFPA 3L0JA 5EJVA 3CJWA 1KV6A 3FXVA 1S0XA 1SKXA 1XQ3A 4JGVA 1T76A 2P1TA 1XP6A 3KMGA 1QKNA 5HYKA 3HVLA 5FQPA 2QTUA 1I7IA 4OKXA 5DUEA 2XHSA 3ET1A 3W5QA 4RZFA 2FSZA 2P7AA 2ZXNA 4O8FA 4OLMA 2AA6A 3P88A 3R8DA 4EM9A 2ZXZA 3OKHA 4G1YA 3B3KA 2B1VA 4MDDA 4RZEA 3W0CA 2I4JA 4ZI1A 2YFEA 3WJ5A 5DX3A 3ET0A 3KPZA 1RDTA 5DVSA 5HJPB 5EI1A 1MV9A 2QE4A 4DQMA 3VHVA 2FAIA 4Q13A 1NQ7A 1DKFA 4RAKA 5KR9A 3UUAB 3CTBA 2HWRA 3FUGA 3QT0A 1R6GA 4A2JA 2NXXE 2ZLAA 3Q95B 3ZQTA 3KMRA 2GP7A 4RZGA 2QGTA 3ADWA 4ZNWA 2HCDA 1FM6A 1NHZA 1EXAA 3BQDA 5KRKA 2GPVA 2PIUA 1XIUA 3AZ1A 1PQ6A 5E0XA 5C4OA 2QA8A 4JL4A 4APUA 1XP9A 1PQ9A 3FALB 2O4JA 3VHUA 4MG9B 3OOFA 2E2RA 4J5WC 5ETHA 2A3IA 2JF9A 3X36A 3E7CA 4OH6A 3AN3A 3SP6A 1OVLA 2XYXA
chains in the Genus database with same CATH topology
3VSOA 1I38A 3A9EA 3A2HA 2VV4B 1OT7A 5B41A 1XDKA 1N4HA 2YLQA 4XT9A 2P4YA 5M96A 3A78A 1K4WA 1XPCA 5DRMA 3WTQA 4RUJA 2YLOA 4ZNUA 2QNVA 5FQRA 1S9PA 2FVJA 2Q5PA 1RDTD 3OLLA 2HVCA 3FEJA 2V7CA 5G5WA 5KCUA 3B67A 2ZNQA 4WHGA 1NQ2A 4OC7A 4OFUA 3A40X 1SR7A 4QM0A 4NUFA 2NXXA 5E7VA 3VJSA 3GD2A 3LMPA 3RY9A 1QKUA 1ZUCA 4MG7A 2Q5SA 4OJBA 2ZK6A 4ZN9A 1XNNA 3VT6A 3VTCA 3F7DA 1NAVA 4S15A 1U9EA 2G0HA 3M7RA 1XVPA 5DZIA 2AX9A 1L2JA 1T63A 2PITA 3OSIA 3OMKA 1Q4XA 4JYHA 4OH5A 1ZKYA 3HODA 4WQPA 1GWXA 3VT4A 5JJMA 4X1GA 2B23A 4REEA 4IWFA 3F5CA 3VRVA 3OAPA 4IVWA 2P54A 3B0QA 2AMBA 4IU7A 4MGAA 2IOKA 1T7RA 3S9SA 4UDDA 5DVCA 3R2AA 3VT9A 3B0WA 4MG6A 1T65A 4DORA 5GT4A 1YY4A 2ZK1A 1H9UA 3D6DA 2ZK0A 2AM9A 4FNEA 3RVFA 4KZMA 3VT3A 2QA6A 1FM9A 2HBHA 2POGA 2ZK3A 4MGBA 5DZ0A 4RMDA 1N83A 2GPOA 3HO0A 4IW8A 3VSPA 2VV1A 1X7BA 5DX3B 4B7WA 2GPPA 1YUCA 5JI0D 3AFRA 2QMVA 5DIGA 1DKFB 3B0RA 3WJ4A 4A4VA 1R5KA 2OVHA 3DR1A 3OLSA 2ABIA 4PPPA 1YIMA 3ADSA 4OFRA 5K13A 3L0LA 1GWQA 1YA3A 4Y29A 5AAVA 2OM9A 5EITA 5AVLA 3OSAA 2ZK4A 3R8IA 3TX7B 3B68A 1ZH7A 1TFCA 4OKTA 1BSXA 2ZKCA 2Q6SA 2J7YA 2YLPA 2ZNNA 4OHAA 5KRJA 2ZFXA 2QA8B 2VSRA 4MGCA 5C4TA 3VTBA 2ZXMA 4G2HA 2AX6A 2PRGA 4RMEA 5DYBA 2AA5A 2ZMHA 3L0EA 3IPQA 4PWLA 2LBDA 2XKWA 1X7RA 5DUGA 2GTKA 3H52A 1OVLB 4X1FA 5DXPA 4IA7A 3R5NA 1YINA 3CS8A 3GYTA 1XJ7A 3A9EB 3NSQA 5KYJA 2P7GA 2HWQA 4OZTE 1K74A 2PIPL 3IPSA 2GIUA 3DT3A 3OMQA 3MNEA 5DXGA 1XDKB 4KZJA 3KYTA 3D57A 2Q7LA 4PVUA 3ET3A 3WT7A 3DZUA 3OZ0A 3ADTA 5EGVA 1HJ1A 1UOMA 2Q7JA 3W5RA 5IZ0A 1FM9D 1G50A 4PXMA 2QXSA 3PLZA 5DV8A 4Q0AC 4K4JA 5AWKA 1S0ZA 2QZOA 1XLSE 4G1ZA 1FD0A 2AX7A 3GWXA 4UDBA 5DVVA 5G46A 2AMAA 1XAPA 4TUZA 2G5OA 2V0VA 3IPUA 2Q7IA 1T5ZA 3UP0A 2PIXA 2HC4A 3OGTA 5DWEA 4IS8A 4ONIA 5L7HA 2J14A 1RKGA 4ZOMA 5GIEA 1VJBA 3H0AA 3K8SA 1YYEA 4G1DA 4MG7B 4HEEX 2IHQA 1YJEA 1E3GA 4E4QA 2R6WA 3DY6A 3PRGA 4M8EA 3RUTA 3VHWA 1ZEOA 1EXXA 3KDUA 3G9EA 1KNUA 2JFAA 2JJ3A 3UVVA 4OZTU 1XVPB 2I4ZA 1E3KA 5AWJA 2P15A 3GYUA 5FQTA 2ZK5A 2ZVTA 3NOAA 4RMCA 4A4WA 5JJMB 5KRMA 3FS1A 5FQSA 5APJA 3V9VA 3E00A 2NW4A 4J5XA 1RJKA 1ZDUA 3D24A 3F5CB 2AA7A 2Q6JA 4NB6A 5HYRA 1SQNA 1K74D 2PIRA 3OMOA 5DMCA 4MGAB 4OEDA 3AX8A 3FURA 3HC6A 3CS6A 4DK7A 4OGHA 3UU7A 3WMHA 5F9BA 5DXEA 2ZL9A 2AWHA 4PRGA 3OS8A 5DUHA 3AZ3A 3L1BA 1EREA 3DZUD 2OCFA 4NY9A 3MNOA 5G44A 5DXMA 2YHDA 1N46A 3TKMA 5DK9A 5DXBA 3VRTA 3WT6A 1FCZA 2HARA 2AYRA 4M8HA 4MGBB 4IUIA 4OJ9A 5ACCA 2BAWA 5DXRA 1ILHA 1T7TA 2VV1B 2HASA 1XLSA 1IE8A 2HB8A 4L98A 2Q7KA 4LNXA 5AYGA 1PZLA 2PNUA 5APKA 2VV0A 5JY3A 5KRFA 3KBAA 1I37A 5DIDA 3CDSA 2QSEA 4IQRA 3SZ1A 2QGWA 2B1ZA 1M2ZA 1NQ0A 2XYJA 3H0AD 3MNPA 2B50A 4MG8A 1UHLA 5AAVB 4L96A 4REFA 1S9QA 2YJAB 2HB7A 4NQAB 2BJ4A 2EWPA 5IXKA 3X31A 3HZFA 3VN2A 4HLWA 3ZRBA 3FEIA 3P89A 1UPWA 1YMTA 1DB1A 3B5RA 2REWA 4OZRU 4WVDA 3UUCA 5I4VA 3OMPA 2O9IA 3LBDA 4MGDA 4ZO1X 2I4PA 1NRLA 1G5YA 2POBA 4S0TA 4PLEA 1XV9A 3OOKA 3B1MA 3AUQA 3E00D 4ZNSA 3VT5A 3V49A 4LNWA 4LTWA 1T7FA 2Q6RA 3AUNA 4ITEA 2Q5GA 2ACLA 1S19A 4LSJA 4XLDA 4F9MA 3DCUA 1YOWA 2PINA 2AXAA 2P7ZA 2ZMJA 1QKTA 5DKEA 4WHFA 1M13A 5E15A 4ZJRA 3WGPA 1PCGA 4DMAA 4IW6A 3VRUA 3VJHA 3ET2A 1ZDTA 5DKGA 3U9QA 5KCFA 1R1KA 3AN4A 4P6XA 5DWGA 4IA2A 1NAXA 3UUDA 5KCEA 2G44A 5KRIA 4QJRA 2GWXA 2VV3A 3G8IA 5HJSA 4WPFA 2QZOB 1R20A 1GWRA 4JYIA 4DOSA 4OKBA 2OVMA 3KWYA 2ZNPA 5B5BA 4TUZB 4S14A 4J5XC 3OS9A 3CLDA 4OKWA 4E2JA 3GN8A 4Q50A 1NYXA 3ZRAA 1NQ1A 1XB7A 4OIVA 3HC5A 2R40D 1XOWA 3WT5A 2QW4A 1PRGA 2ZLCA 3OS8C 3W0YA 3R8AA 1Z5XE 3HQ5A 1XNXA 4N5GA 5AAUA 1UPVA 2JFAB 3UVVB 1LBDA 3FC6A 5HCVA 3DZYD 3PCUA 1FCXA 3IXPD 4IWCA 3VTDA 2YLYA 1SJ0A 1U3RA 2ATHA 1ZGYA 5G42A 1A52A 5KD9A 2YATA 4FHHA 2AB2A 3KFCA 4JAZA 5EHJA 3RLJA 3K23A 4WLBA 5E14A 5DL4A 1MVCA 4ZO1B 4IVYA 2F4BA 2PIWA 1I7GA 2NPAA 3KMZA 4N73A 4QL8A 3W0GA 1RK3A 2AAXA 1KKQA 3SP9A 2Q59A 1M7WA 4OEZA 3O1DA 1XP1A 4J26A 4CSJA 3UU7B 3FLIA 4ZNHA 4ZNTA 5AZVA 4RUPA 3ADUA 3W0JA 4K7AA 3V4AA 1K7LA 5KCCA 4FN9A 5C4SA 4PLDA 5DXKA 1R1KD 5DXBB 1Y0SA 2ZMIA 3VJIA 1OSHA 3KDTA 3B66A 3PEQA 1T74A 2Z4JA 2ZNOA 1PK5A 5DRJA 5KROA 1NDEA 1R20D 3CQVA 1ILGA 1YOKA 1Z5XU 3OSWA 3JZBA 3PBAA 3OZJA 5EC9A 5AVIA 3G8OA 4YMQA 1T73A 3P8XA 1X76A 5L7GA 3IA6A 2OAXA 4R06A 5IAWA 1A28A 1G2NA 4OEYA 4DK8A 3ERDA 3A3ZX 4UDAA 1Y9RA 5DKSA 3VRWA 3W5TA 1U3QA 4TV1A 4IV2A 5AZTA 4MG8B 1HG4A 1UHLB 3GZ9A 4P6WA 4UDCA 5C4UA 4OJ4A 4R2UA 4XUMA 5G45A 2AA2A 2P1VA 3V3EA 2H79A 2BJ4B 3L3XA 2G0GA 3OLFA 4BCRA 3OMMA 4PP3A 4K6IA 5KRLA 1FBYA 2GPUA 5DV6A 4OK1A 5E0WA 3VI8A 3R5MA 1LV2A 1MZNA 4XAOA 5DSHA 4OZRE 4RUOX 4EMAA 3CDPA 5KCTA 1WM0X 4N1YA 4N8RA 4MGDB 3VJTA 4CI5A 3D5FA 2Q8SA 3HLVA 1XV9B 3N00A 5KCWA 3L3ZA 3D90A 2AO6A 3ZR7A 2PIVA 2R6YA 4G2IA 3K6PA 4ZN7A 1T7MA 3RUUA 4RE8A 2ACLB 1U3SA 5DZHA 1IE9A 3ADVA 4KZIA 3V9YA 3B65A 4J24A 5DV3A 5HJPA 2NV7A 3E94A 1NUOA 5L7EA 1OSVA 4ZJWA 2W8YA 3X1IA 3UUAA 3WFGA 3R29A 3GWSX 4OILA 5GICA 3VT7A 4CI4A 5DY8A 4QK4A 3ERTA 5LWPA 1RKHA 3Q95A 4OEAA 3UUDB 2IOGA 4YPQA 1G1UA 3GBKA 5E1CA 2Q61A 1ERRA 2O4RA 5DWLA 4DM6A 1P93A 5DP0A 2PIQA 2R40A 3ADXA 3AURA 4PP6A 3O1EA 4OARA 5CJ6A 2P1UA 3A2IA 3FALA 4QE6A 2GL8A 3WFFA 3CS4A 3IMYA 4MG9A 5DZ3A 3X1HA 1YP0A 3DZYA 4ITFA 3DCTA 3IXPA 5DIEA 4POJA 3PO9A 1FM6D 1XZXX 3NSPA 1P8DA 1FCYA 3V9TA 5APHA 5KCDA 3BC5A 3EYBA 4XHDA 3RLLA 3OKIA 4YT1A 1XQCA 1ZAFA 2Q60A 4IA3A 5A86A 3G0WA 2Q3YA 5DTVA 5ICKA 2YJDA 2QH6A 2J4AA 2ZASA 2QABA 2VV4A 3FC6B 3CWDA 5DWIA 2Q70A 1Z95A 3W5PA 3P0UA 3ILZA 4IV4A 4IA1A 5G43A 3JZCA 2HAMA 3BEJA 5H1EA 5DLRA 4YNKA 4RFWA 5DZ1A 5GIDA 2H77A 3B0TA 3W0HA 2Q1HA 4XUHA 5KYAA 5FQVA 2AX8A 1X78A 2PJLA 4E4KA 5DU5A 4PF3A 2QPYA 5G3JA 4ZNVA 2Q59B 1PQCA 3A2JA 2ZY0A 4J5WA 4NIEA 4MG5A 5AK2A 3L03A 1X7JA 2VV2A 3T03A 5DXQA 2PIOA 5DKBA 4PP5A 5DWJA 5DYDA 5E19A 5HZCA 4G21A 5DMFA 5KRCA 3V3QA 1TXIA 4XI3A 5SYZA 2PKLA 4G20A 1Y0XX 1QKMA 4POHA 4QE8A 4OIUA 2QXMA 2OUZA 4FGYA 4XTAA 3VT8A 2ZBSA 2OZ7A 4FHIA 2Z4BA 3UP3A 2QR9A 2XYWA 4PPSA 5L11A 3W0IA 2I0JA 3AZ2A 4LBDA 5DI7A 4JYGA 3TY0A 3WWRA 3W0AA 2J7XA 4TV1B 2ZK2A 1PDUA 3HM1A 5KRAA 4S0SA 1GS4A 3TKCA 4R6SA 4DM8A 1L2IA 2Q1VA 1T79A 4RWVA 5KRHA 2VSTA 3K22A 5LGAA 2I0GA 1X7EA 2HFPA 3L0JA 5EJVA 3CJWA 1KV6A 3FXVA 1S0XA 1SKXA 1XQ3A 4JGVA 1T76A 2P1TA 1XP6A 3KMGA 1QKNA 5HYKA 3HVLA 5FQPA 2QTUA 1I7IA 4OKXA 5DUEA 2XHSA 3ET1A 3W5QA 4RZFA 2FSZA 2P7AA 2ZXNA 4O8FA 4OLMA 2AA6A 3P88A 3R8DA 4EM9A 2ZXZA 3OKHA 4G1YA 3B3KA 2B1VA 4MDDA 4RZEA 3W0CA 2I4JA 4ZI1A 2YFEA 3WJ5A 5DX3A 3ET0A 3KPZA 1RDTA 5DVSA 5HJPB 5EI1A 1MV9A 2QE4A 4DQMA 3VHVA 2FAIA 4Q13A 1NQ7A 1DKFA 4RAKA 5KR9A 3UUAB 3CTBA 2HWRA 3FUGA 3QT0A 1R6GA 4A2JA 2NXXE 2ZLAA 3Q95B 3ZQTA 3KMRA 2GP7A 4RZGA 2QGTA 3ADWA 4ZNWA 2HCDA 1FM6A 1NHZA 1EXAA 3BQDA 5KRKA 2GPVA 2PIUA 1XIUA 3AZ1A 1PQ6A 5E0XA 5C4OA 2QA8A 4JL4A 4APUA 1XP9A 1PQ9A 3FALB 2O4JA 3VHUA 4MG9B 3OOFA 2E2RA 4J5WC 5ETHA 2A3IA 2JF9A 3X36A 3E7CA 4OH6A 3AN3A 3SP6A 1OVLA 2XYXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VSO A;  1I38 A;  3A9E A;  3A2H A;  2VV4 B;  1OT7 A;  5B41 A;  1XDK A;  1N4H A;  2YLQ A;  4XT9 A;  2P4Y A;  5M96 A;  3A78 A;  1K4W A;  1XPC A;  5DRM A;  3WTQ A;  4RUJ A;  2YLO A;  4ZNU A;  2QNV A;  5FQR A;  1S9P A;  2FVJ A;  2Q5P A;  1RDT D;  3OLL A;  2HVC A;  3FEJ A;  2V7C A;  5G5W A;  5KCU A;  3B67 A;  2ZNQ A;  4WHG A;  1NQ2 A;  4OC7 A;  4OFU A;  3A40 X;  1SR7 A;  4QM0 A;  4NUF A;  2NXX A;  5E7V A;  3VJS A;  3GD2 A;  3LMP A;  3RY9 A;  1QKU A;  1ZUC A;  4MG7 A;  2Q5S A;  4OJB A;  2ZK6 A;  4ZN9 A;  1XNN A;  3VT6 A;  3VTC A;  3F7D A;  1NAV A;  4S15 A;  1U9E A;  2G0H A;  3M7R A;  1XVP A;  5DZI A;  2AX9 A;  1L2J A;  1T63 A;  2PIT A;  3OSI A;  3OMK A;  1Q4X A;  4JYH A;  4OH5 A;  1ZKY A;  3HOD A;  4WQP A;  1GWX A;  3VT4 A;  5JJM A;  4X1G A;  2B23 A;  4REE A;  4IWF A;  3F5C A;  3VRV A;  3OAP A;  4IVW A;  2P54 A;  3B0Q A;  2AMB A;  4IU7 A;  4MGA A;  2IOK A;  1T7R A;  3S9S A;  4UDD A;  5DVC A;  3R2A A;  3VT9 A;  3B0W A;  4MG6 A;  1T65 A;  4DOR A;  5GT4 A;  1YY4 A;  2ZK1 A;  1H9U A;  3D6D A;  2ZK0 A;  2AM9 A;  4FNE A;  3RVF A;  4KZM A;  3VT3 A;  2QA6 A;  1FM9 A;  2HBH A;  2POG A;  2ZK3 A;  4MGB A;  5DZ0 A;  4RMD A;  1N83 A;  2GPO A;  3HO0 A;  4IW8 A;  3VSP A;  2VV1 A;  1X7B A;  5DX3 B;  4B7W A;  2GPP A;  1YUC A;  5JI0 D;  3AFR A;  2QMV A;  5DIG A;  1DKF B;  3B0R A;  3WJ4 A;  4A4V A;  1R5K A;  2OVH A;  3DR1 A;  3OLS A;  2ABI A;  4PPP A;  1YIM A;  3ADS A;  4OFR A;  5K13 A;  3L0L A;  1GWQ A;  1YA3 A;  4Y29 A;  5AAV A;  2OM9 A;  5EIT A;  5AVL A;  3OSA A;  2ZK4 A;  3R8I A;  3TX7 B;  3B68 A;  1ZH7 A;  1TFC A;  4OKT A;  1BSX A;  2ZKC A;  2Q6S A;  2J7Y A;  2YLP A;  2ZNN A;  4OHA A;  5KRJ A;  2ZFX A;  2QA8 B;  2VSR A;  4MGC A;  5C4T A;  3VTB A;  2ZXM A;  4G2H A;  2AX6 A;  2PRG A;  4RME A;  5DYB A;  2AA5 A;  2ZMH A;  3L0E A;  3IPQ A;  4PWL A;  2LBD A;  2XKW A;  1X7R A;  5DUG A;  2GTK A;  3H52 A;  1OVL B;  4X1F A;  5DXP A;  4IA7 A;  3R5N A;  1YIN A;  3CS8 A;  3GYT A;  1XJ7 A;  3A9E B;  3NSQ A;  5KYJ A;  2P7G A;  2HWQ A;  4OZT E;  1K74 A;  2PIP L;  3IPS A;  2GIU A;  3DT3 A;  3OMQ A;  3MNE A;  5DXG A;  1XDK B;  4KZJ A;  3KYT A;  3D57 A;  2Q7L A;  4PVU A;  3ET3 A;  3WT7 A;  3DZU A;  3OZ0 A;  3ADT A;  5EGV A;  1HJ1 A;  1UOM A;  2Q7J A;  3W5R A;  5IZ0 A;  1FM9 D;  1G50 A;  4PXM A;  2QXS A;  3PLZ A;  5DV8 A;  4Q0A C;  4K4J A;  5AWK A;  1S0Z A;  2QZO A;  1XLS E;  4G1Z A;  1FD0 A;  2AX7 A;  3GWX A;  4UDB A;  5DVV A;  5G46 A;  2AMA A;  1XAP A;  4TUZ A;  2G5O A;  2V0V A;  3IPU A;  2Q7I A;  1T5Z A;  3UP0 A;  2PIX A;  2HC4 A;  3OGT A;  5DWE A;  4IS8 A;  4ONI A;  5L7H A;  2J14 A;  1RKG A;  4ZOM A;  5GIE A;  1VJB A;  3H0A A;  3K8S A;  1YYE A;  4G1D A;  4MG7 B;  4HEE X;  2IHQ A;  1YJE A;  1E3G A;  4E4Q A;  2R6W A;  3DY6 A;  3PRG A;  4M8E A;  3RUT A;  3VHW A;  1ZEO A;  1EXX A;  3KDU A;  3G9E A;  1KNU A;  2JFA A;  2JJ3 A;  3UVV A;  4OZT U;  1XVP B;  2I4Z A;  1E3K A;  5AWJ A;  2P15 A;  3GYU A;  5FQT A;  2ZK5 A;  2ZVT A;  3NOA A;  4RMC A;  4A4W A;  5JJM B;  5KRM A;  3FS1 A;  5FQS A;  5APJ A;  3V9V A;  3E00 A;  2NW4 A;  4J5X A;  1RJK A;  1ZDU A;  3D24 A;  3F5C B;  2AA7 A;  2Q6J A;  4NB6 A;  5HYR A;  1SQN A;  1K74 D;  2PIR A;  3OMO A;  5DMC A;  4MGA B;  4OED A;  3AX8 A;  3FUR A;  3HC6 A;  3CS6 A;  4DK7 A;  4OGH A;  3UU7 A;  3WMH A;  5F9B A;  5DXE A;  2ZL9 A;  2AWH A;  4PRG A;  3OS8 A;  5DUH A;  3AZ3 A;  3L1B A;  1ERE A;  3DZU D;  2OCF A;  4NY9 A;  3MNO A;  5G44 A;  5DXM A;  2YHD A;  1N46 A;  3TKM A;  5DK9 A;  5DXB A;  3VRT A;  3WT6 A;  1FCZ A;  2HAR A;  2AYR A;  4M8H A;  4MGB B;  4IUI A;  4OJ9 A;  5ACC A;  2BAW A;  5DXR A;  1ILH A;  1T7T A;  2VV1 B;  2HAS A;  1XLS A;  1IE8 A;  2HB8 A;  4L98 A;  2Q7K A;  4LNX A;  5AYG A;  1PZL A;  2PNU A;  5APK A;  2VV0 A;  5JY3 A;  5KRF A;  3KBA A;  1I37 A;  5DID A;  3CDS A;  2QSE A;  4IQR A;  3SZ1 A;  2QGW A;  2B1Z A;  1M2Z A;  1NQ0 A;  2XYJ A;  3H0A D;  3MNP A;  2B50 A;  4MG8 A;  1UHL A;  5AAV B;  4L96 A;  4REF A;  1S9Q A;  2YJA B;  2HB7 A;  4NQA B;  2BJ4 A;  2EWP A;  5IXK A;  3X31 A;  3HZF A;  3VN2 A;  4HLW A;  3ZRB A;  3FEI A;  3P89 A;  1UPW A;  1YMT A;  1DB1 A;  3B5R A;  2REW A;  4OZR U;  4WVD A;  3UUC A;  5I4V A;  3OMP A;  2O9I A;  3LBD A;  4MGD A;  4ZO1 X;  2I4P A;  1NRL A;  1G5Y A;  2POB A;  4S0T A;  4PLE A;  1XV9 A;  3OOK A;  3B1M A;  3AUQ A;  3E00 D;  4ZNS A;  3VT5 A;  3V49 A;  4LNW A;  4LTW A;  1T7F A;  2Q6R A;  3AUN A;  4ITE A;  2Q5G A;  2ACL A;  1S19 A;  4LSJ A;  4XLD A;  4F9M A;  3DCU A;  1YOW A;  2PIN A;  2AXA A;  2P7Z A;  2ZMJ A;  1QKT A;  5DKE A;  4WHF A;  1M13 A;  5E15 A;  4ZJR A;  3WGP A;  1PCG A;  4DMA A;  4IW6 A;  3VRU A;  3VJH A;  3ET2 A;  1ZDT A;  5DKG A;  3U9Q A;  5KCF A;  1R1K A;  3AN4 A;  4P6X A;  5DWG A;  4IA2 A;  1NAX A;  3UUD A;  5KCE A;  2G44 A;  5KRI A;  4QJR A;  2GWX A;  2VV3 A;  3G8I A;  5HJS A;  4WPF A;  2QZO B;  1R20 A;  1GWR A;  4JYI A;  4DOS A;  4OKB A;  2OVM A;  3KWY A;  2ZNP A;  5B5B A;  4TUZ B;  4S14 A;  4J5X C;  3OS9 A;  3CLD A;  4OKW A;  4E2J A;  3GN8 A;  4Q50 A;  1NYX A;  3ZRA A;  1NQ1 A;  1XB7 A;  4OIV A;  3HC5 A;  2R40 D;  1XOW A;  3WT5 A;  2QW4 A;  1PRG A;  2ZLC A;  3OS8 C;  3W0Y A;  3R8A A;  1Z5X E;  3HQ5 A;  1XNX A;  4N5G A;  5AAU A;  1UPV A;  2JFA B;  3UVV B;  1LBD A;  3FC6 A;  5HCV A;  3DZY D;  3PCU A;  1FCX A;  3IXP D;  4IWC A;  3VTD A;  2YLY A;  1SJ0 A;  1U3R A;  2ATH A;  1ZGY A;  5G42 A;  1A52 A;  5KD9 A;  2YAT A;  4FHH A;  2AB2 A;  3KFC A;  4JAZ A;  5EHJ A;  3RLJ A;  3K23 A;  4WLB A;  5E14 A;  5DL4 A;  1MVC A;  4ZO1 B;  4IVY A;  2F4B A;  2PIW A;  1I7G A;  2NPA A;  3KMZ A;  4N73 A;  4QL8 A;  3W0G A;  1RK3 A;  2AAX A;  1KKQ A;  3SP9 A;  2Q59 A;  1M7W A;  4OEZ A;  3O1D A;  1XP1 A;  4J26 A;  4CSJ A;  3UU7 B;  3FLI A;  4ZNH A;  4ZNT A;  5AZV A;  4RUP A;  3ADU A;  3W0J A;  4K7A A;  3V4A A;  1K7L A;  5KCC A;  4FN9 A;  5C4S A;  4PLD A;  5DXK A;  1R1K D;  5DXB B;  1Y0S A;  2ZMI A;  3VJI A;  1OSH A;  3KDT A;  3B66 A;  3PEQ A;  1T74 A;  2Z4J A;  2ZNO A;  1PK5 A;  5DRJ A;  5KRO A;  1NDE A;  1R20 D;  3CQV A;  1ILG A;  1YOK A;  1Z5X U;  3OSW A;  3JZB A;  3PBA A;  3OZJ A;  5EC9 A;  5AVI A;  3G8O A;  4YMQ A;  1T73 A;  3P8X A;  1X76 A;  5L7G A;  3IA6 A;  2OAX A;  4R06 A;  5IAW A;  1A28 A;  1G2N A;  4OEY A;  4DK8 A;  3ERD A;  3A3Z X;  4UDA A;  1Y9R A;  5DKS A;  3VRW A;  3W5T A;  1U3Q A;  4TV1 A;  4IV2 A;  5AZT A;  4MG8 B;  1HG4 A;  1UHL B;  3GZ9 A;  4P6W A;  4UDC A;  5C4U A;  4OJ4 A;  4R2U A;  4XUM A;  5G45 A;  2AA2 A;  2P1V A;  3V3E A;  2H79 A;  2BJ4 B;  3L3X A;  2G0G A;  3OLF A;  4BCR A;  3OMM A;  4PP3 A;  4K6I A;  5KRL A;  1FBY A;  2GPU A;  5DV6 A;  4OK1 A;  5E0W A;  3VI8 A;  3R5M A;  1LV2 A;  1MZN A;  4XAO A;  5DSH A;  4OZR E;  4RUO X;  4EMA A;  3CDP A;  5KCT A;  1WM0 X;  4N1Y A;  4N8R A;  4MGD B;  3VJT A;  4CI5 A;  3D5F A;  2Q8S A;  3HLV A;  1XV9 B;  3N00 A;  5KCW A;  3L3Z A;  3D90 A;  2AO6 A;  3ZR7 A;  2PIV A;  2R6Y A;  4G2I A;  3K6P A;  4ZN7 A;  1T7M A;  3RUU A;  4RE8 A;  2ACL B;  1U3S A;  5DZH A;  1IE9 A;  3ADV A;  4KZI A;  3V9Y A;  3B65 A;  4J24 A;  5DV3 A;  5HJP A;  2NV7 A;  3E94 A;  1NUO A;  5L7E A;  1OSV A;  4ZJW A;  2W8Y A;  3X1I A;  3UUA A;  3WFG A;  3R29 A;  3GWS X;  4OIL A;  5GIC A;  3VT7 A;  4CI4 A;  5DY8 A;  4QK4 A;  3ERT A;  5LWP A;  1RKH A;  3Q95 A;  4OEA A;  3UUD B;  2IOG A;  4YPQ A;  1G1U A;  3GBK A;  5E1C A;  2Q61 A;  1ERR A;  2O4R A;  5DWL A;  4DM6 A;  1P93 A;  5DP0 A;  2PIQ A;  2R40 A;  3ADX A;  3AUR A;  4PP6 A;  3O1E A;  4OAR A;  5CJ6 A;  2P1U A;  3A2I A;  3FAL A;  4QE6 A;  2GL8 A;  3WFF A;  3CS4 A;  3IMY A;  4MG9 A;  5DZ3 A;  3X1H A;  1YP0 A;  3DZY A;  4ITF A;  3DCT A;  3IXP A;  5DIE A;  4POJ A;  3PO9 A;  1FM6 D;  1XZX X;  3NSP A;  1P8D A;  1FCY A;  3V9T A;  5APH A;  5KCD A;  3BC5 A;  3EYB A;  4XHD A;  3RLL A;  3OKI A;  4YT1 A;  1XQC A;  1ZAF A;  2Q60 A;  4IA3 A;  5A86 A;  3G0W A;  2Q3Y A;  5DTV A;  5ICK A;  2YJD A;  2QH6 A;  2J4A A;  2ZAS A;  2QAB A;  2VV4 A;  3FC6 B;  3CWD A;  5DWI A;  2Q70 A;  1Z95 A;  3W5P A;  3P0U A;  3ILZ A;  4IV4 A;  4IA1 A;  5G43 A;  3JZC A;  2HAM A;  3BEJ A;  5H1E A;  5DLR A;  4YNK A;  4RFW A;  5DZ1 A;  5GID A;  2H77 A;  3B0T A;  3W0H A;  2Q1H A;  4XUH A;  5KYA A;  5FQV A;  2AX8 A;  1X78 A;  2PJL A;  4E4K A;  5DU5 A;  4PF3 A;  2QPY A;  5G3J A;  4ZNV A;  2Q59 B;  1PQC A;  3A2J A;  2ZY0 A;  4J5W A;  4NIE A;  4MG5 A;  5AK2 A;  3L03 A;  1X7J A;  2VV2 A;  3T03 A;  5DXQ A;  2PIO A;  5DKB A;  4PP5 A;  5DWJ A;  5DYD A;  5E19 A;  5HZC A;  4G21 A;  5DMF A;  5KRC A;  3V3Q A;  1TXI A;  4XI3 A;  5SYZ A;  2PKL A;  4G20 A;  1Y0X X;  1QKM A;  4POH A;  4QE8 A;  4OIU A;  2QXM A;  2OUZ A;  4FGY A;  4XTA A;  3VT8 A;  2ZBS A;  2OZ7 A;  4FHI A;  2Z4B A;  3UP3 A;  2QR9 A;  2XYW A;  4PPS A;  5L11 A;  3W0I A;  2I0J A;  3AZ2 A;  4LBD A;  5DI7 A;  4JYG A;  3TY0 A;  3WWR A;  3W0A A;  2J7X A;  4TV1 B;  2ZK2 A;  1PDU A;  3HM1 A;  5KRA A;  4S0S A;  1GS4 A;  3TKC A;  4R6S A;  4DM8 A;  1L2I A;  2Q1V A;  1T79 A;  4RWV A;  5KRH A;  2VST A;  3K22 A;  5LGA A;  2I0G A;  1X7E A;  2HFP A;  3L0J A;  5EJV A;  3CJW A;  1KV6 A;  3FXV A;  1S0X A;  1SKX A;  1XQ3 A;  4JGV A;  1T76 A;  2P1T A;  1XP6 A;  3KMG A;  1QKN A;  5HYK A;  3HVL A;  5FQP A;  2QTU A;  1I7I A;  4OKX A;  5DUE A;  2XHS A;  3ET1 A;  3W5Q A;  4RZF A;  2FSZ A;  2P7A A;  2ZXN A;  4O8F A;  4OLM A;  2AA6 A;  3P88 A;  3R8D A;  4EM9 A;  2ZXZ A;  3OKH A;  4G1Y A;  3B3K A;  2B1V A;  4MDD A;  4RZE A;  3W0C A;  2I4J A;  4ZI1 A;  2YFE A;  3WJ5 A;  5DX3 A;  3ET0 A;  3KPZ A;  1RDT A;  5DVS A;  5HJP B;  5EI1 A;  1MV9 A;  2QE4 A;  4DQM A;  3VHV A;  2FAI A;  4Q13 A;  1NQ7 A;  1DKF A;  4RAK A;  5KR9 A;  3UUA B;  3CTB A;  2HWR A;  3FUG A;  3QT0 A;  1R6G A;  4A2J A;  2NXX E;  2ZLA A;  3Q95 B;  3ZQT A;  3KMR A;  2GP7 A;  4RZG A;  2QGT A;  3ADW A;  4ZNW A;  2HCD A;  1FM6 A;  1NHZ A;  1EXA A;  3BQD A;  5KRK A;  2GPV A;  2PIU A;  1XIU A;  3AZ1 A;  1PQ6 A;  5E0X A;  5C4O A;  2QA8 A;  4JL4 A;  4APU A;  1XP9 A;  1PQ9 A;  3FAL B;  2O4J A;  3VHU A;  4MG9 B;  3OOF A;  2E2R A;  4J5W C;  5ETH A;  2A3I A;  2JF9 A;  3X36 A;  3E7C A;  4OH6 A;  3AN3 A;  3SP6 A;  1OVL A;  2XYX A; 
#chains in the Genus database with same CATH topology
 3VSO A;  1I38 A;  3A9E A;  3A2H A;  2VV4 B;  1OT7 A;  5B41 A;  1XDK A;  1N4H A;  2YLQ A;  4XT9 A;  2P4Y A;  5M96 A;  3A78 A;  1K4W A;  1XPC A;  5DRM A;  3WTQ A;  4RUJ A;  2YLO A;  4ZNU A;  2QNV A;  5FQR A;  1S9P A;  2FVJ A;  2Q5P A;  1RDT D;  3OLL A;  2HVC A;  3FEJ A;  2V7C A;  5G5W A;  5KCU A;  3B67 A;  2ZNQ A;  4WHG A;  1NQ2 A;  4OC7 A;  4OFU A;  3A40 X;  1SR7 A;  4QM0 A;  4NUF A;  2NXX A;  5E7V A;  3VJS A;  3GD2 A;  3LMP A;  3RY9 A;  1QKU A;  1ZUC A;  4MG7 A;  2Q5S A;  4OJB A;  2ZK6 A;  4ZN9 A;  1XNN A;  3VT6 A;  3VTC A;  3F7D A;  1NAV A;  4S15 A;  1U9E A;  2G0H A;  3M7R A;  1XVP A;  5DZI A;  2AX9 A;  1L2J A;  1T63 A;  2PIT A;  3OSI A;  3OMK A;  1Q4X A;  4JYH A;  4OH5 A;  1ZKY A;  3HOD A;  4WQP A;  1GWX A;  3VT4 A;  5JJM A;  4X1G A;  2B23 A;  4REE A;  4IWF A;  3F5C A;  3VRV A;  3OAP A;  4IVW A;  2P54 A;  3B0Q A;  2AMB A;  4IU7 A;  4MGA A;  2IOK A;  1T7R A;  3S9S A;  4UDD A;  5DVC A;  3R2A A;  3VT9 A;  3B0W A;  4MG6 A;  1T65 A;  4DOR A;  5GT4 A;  1YY4 A;  2ZK1 A;  1H9U A;  3D6D A;  2ZK0 A;  2AM9 A;  4FNE A;  3RVF A;  4KZM A;  3VT3 A;  2QA6 A;  1FM9 A;  2HBH A;  2POG A;  2ZK3 A;  4MGB A;  5DZ0 A;  4RMD A;  1N83 A;  2GPO A;  3HO0 A;  4IW8 A;  3VSP A;  2VV1 A;  1X7B A;  5DX3 B;  4B7W A;  2GPP A;  1YUC A;  5JI0 D;  3AFR A;  2QMV A;  5DIG A;  1DKF B;  3B0R A;  3WJ4 A;  4A4V A;  1R5K A;  2OVH A;  3DR1 A;  3OLS A;  2ABI A;  4PPP A;  1YIM A;  3ADS A;  4OFR A;  5K13 A;  3L0L A;  1GWQ A;  1YA3 A;  4Y29 A;  5AAV A;  2OM9 A;  5EIT A;  5AVL A;  3OSA A;  2ZK4 A;  3R8I A;  3TX7 B;  3B68 A;  1ZH7 A;  1TFC A;  4OKT A;  1BSX A;  2ZKC A;  2Q6S A;  2J7Y A;  2YLP A;  2ZNN A;  4OHA A;  5KRJ A;  2ZFX A;  2QA8 B;  2VSR A;  4MGC A;  5C4T A;  3VTB A;  2ZXM A;  4G2H A;  2AX6 A;  2PRG A;  4RME A;  5DYB A;  2AA5 A;  2ZMH A;  3L0E A;  3IPQ A;  4PWL A;  2LBD A;  2XKW A;  1X7R A;  5DUG A;  2GTK A;  3H52 A;  1OVL B;  4X1F A;  5DXP A;  4IA7 A;  3R5N A;  1YIN A;  3CS8 A;  3GYT A;  1XJ7 A;  3A9E B;  3NSQ A;  5KYJ A;  2P7G A;  2HWQ A;  4OZT E;  1K74 A;  2PIP L;  3IPS A;  2GIU A;  3DT3 A;  3OMQ A;  3MNE A;  5DXG A;  1XDK B;  4KZJ A;  3KYT A;  3D57 A;  2Q7L A;  4PVU A;  3ET3 A;  3WT7 A;  3DZU A;  3OZ0 A;  3ADT A;  5EGV A;  1HJ1 A;  1UOM A;  2Q7J A;  3W5R A;  5IZ0 A;  1FM9 D;  1G50 A;  4PXM A;  2QXS A;  3PLZ A;  5DV8 A;  4Q0A C;  4K4J A;  5AWK A;  1S0Z A;  2QZO A;  1XLS E;  4G1Z A;  1FD0 A;  2AX7 A;  3GWX A;  4UDB A;  5DVV A;  5G46 A;  2AMA A;  1XAP A;  4TUZ A;  2G5O A;  2V0V A;  3IPU A;  2Q7I A;  1T5Z A;  3UP0 A;  2PIX A;  2HC4 A;  3OGT A;  5DWE A;  4IS8 A;  4ONI A;  5L7H A;  2J14 A;  1RKG A;  4ZOM A;  5GIE A;  1VJB A;  3H0A A;  3K8S A;  1YYE A;  4G1D A;  4MG7 B;  4HEE X;  2IHQ A;  1YJE A;  1E3G A;  4E4Q A;  2R6W A;  3DY6 A;  3PRG A;  4M8E A;  3RUT A;  3VHW A;  1ZEO A;  1EXX A;  3KDU A;  3G9E A;  1KNU A;  2JFA A;  2JJ3 A;  3UVV A;  4OZT U;  1XVP B;  2I4Z A;  1E3K A;  5AWJ A;  2P15 A;  3GYU A;  5FQT A;  2ZK5 A;  2ZVT A;  3NOA A;  4RMC A;  4A4W A;  5JJM B;  5KRM A;  3FS1 A;  5FQS A;  5APJ A;  3V9V A;  3E00 A;  2NW4 A;  4J5X A;  1RJK A;  1ZDU A;  3D24 A;  3F5C B;  2AA7 A;  2Q6J A;  4NB6 A;  5HYR A;  1SQN A;  1K74 D;  2PIR A;  3OMO A;  5DMC A;  4MGA B;  4OED A;  3AX8 A;  3FUR A;  3HC6 A;  3CS6 A;  4DK7 A;  4OGH A;  3UU7 A;  3WMH A;  5F9B A;  5DXE A;  2ZL9 A;  2AWH A;  4PRG A;  3OS8 A;  5DUH A;  3AZ3 A;  3L1B A;  1ERE A;  3DZU D;  2OCF A;  4NY9 A;  3MNO A;  5G44 A;  5DXM A;  2YHD A;  1N46 A;  3TKM A;  5DK9 A;  5DXB A;  3VRT A;  3WT6 A;  1FCZ A;  2HAR A;  2AYR A;  4M8H A;  4MGB B;  4IUI A;  4OJ9 A;  5ACC A;  2BAW A;  5DXR A;  1ILH A;  1T7T A;  2VV1 B;  2HAS A;  1XLS A;  1IE8 A;  2HB8 A;  4L98 A;  2Q7K A;  4LNX A;  5AYG A;  1PZL A;  2PNU A;  5APK A;  2VV0 A;  5JY3 A;  5KRF A;  3KBA A;  1I37 A;  5DID A;  3CDS A;  2QSE A;  4IQR A;  3SZ1 A;  2QGW A;  2B1Z A;  1M2Z A;  1NQ0 A;  2XYJ A;  3H0A D;  3MNP A;  2B50 A;  4MG8 A;  1UHL A;  5AAV B;  4L96 A;  4REF A;  1S9Q A;  2YJA B;  2HB7 A;  4NQA B;  2BJ4 A;  2EWP A;  5IXK A;  3X31 A;  3HZF A;  3VN2 A;  4HLW A;  3ZRB A;  3FEI A;  3P89 A;  1UPW A;  1YMT A;  1DB1 A;  3B5R A;  2REW A;  4OZR U;  4WVD A;  3UUC A;  5I4V A;  3OMP A;  2O9I A;  3LBD A;  4MGD A;  4ZO1 X;  2I4P A;  1NRL A;  1G5Y A;  2POB A;  4S0T A;  4PLE A;  1XV9 A;  3OOK A;  3B1M A;  3AUQ A;  3E00 D;  4ZNS A;  3VT5 A;  3V49 A;  4LNW A;  4LTW A;  1T7F A;  2Q6R A;  3AUN A;  4ITE A;  2Q5G A;  2ACL A;  1S19 A;  4LSJ A;  4XLD A;  4F9M A;  3DCU A;  1YOW A;  2PIN A;  2AXA A;  2P7Z A;  2ZMJ A;  1QKT A;  5DKE A;  4WHF A;  1M13 A;  5E15 A;  4ZJR A;  3WGP A;  1PCG A;  4DMA A;  4IW6 A;  3VRU A;  3VJH A;  3ET2 A;  1ZDT A;  5DKG A;  3U9Q A;  5KCF A;  1R1K A;  3AN4 A;  4P6X A;  5DWG A;  4IA2 A;  1NAX A;  3UUD A;  5KCE A;  2G44 A;  5KRI A;  4QJR A;  2GWX A;  2VV3 A;  3G8I A;  5HJS A;  4WPF A;  2QZO B;  1R20 A;  1GWR A;  4JYI A;  4DOS A;  4OKB A;  2OVM A;  3KWY A;  2ZNP A;  5B5B A;  4TUZ B;  4S14 A;  4J5X C;  3OS9 A;  3CLD A;  4OKW A;  4E2J A;  3GN8 A;  4Q50 A;  1NYX A;  3ZRA A;  1NQ1 A;  1XB7 A;  4OIV A;  3HC5 A;  2R40 D;  1XOW A;  3WT5 A;  2QW4 A;  1PRG A;  2ZLC A;  3OS8 C;  3W0Y A;  3R8A A;  1Z5X E;  3HQ5 A;  1XNX A;  4N5G A;  5AAU A;  1UPV A;  2JFA B;  3UVV B;  1LBD A;  3FC6 A;  5HCV A;  3DZY D;  3PCU A;  1FCX A;  3IXP D;  4IWC A;  3VTD A;  2YLY A;  1SJ0 A;  1U3R A;  2ATH A;  1ZGY A;  5G42 A;  1A52 A;  5KD9 A;  2YAT A;  4FHH A;  2AB2 A;  3KFC A;  4JAZ A;  5EHJ A;  3RLJ A;  3K23 A;  4WLB A;  5E14 A;  5DL4 A;  1MVC A;  4ZO1 B;  4IVY A;  2F4B A;  2PIW A;  1I7G A;  2NPA A;  3KMZ A;  4N73 A;  4QL8 A;  3W0G A;  1RK3 A;  2AAX A;  1KKQ A;  3SP9 A;  2Q59 A;  1M7W A;  4OEZ A;  3O1D A;  1XP1 A;  4J26 A;  4CSJ A;  3UU7 B;  3FLI A;  4ZNH A;  4ZNT A;  5AZV A;  4RUP A;  3ADU A;  3W0J A;  4K7A A;  3V4A A;  1K7L A;  5KCC A;  4FN9 A;  5C4S A;  4PLD A;  5DXK A;  1R1K D;  5DXB B;  1Y0S A;  2ZMI A;  3VJI A;  1OSH A;  3KDT A;  3B66 A;  3PEQ A;  1T74 A;  2Z4J A;  2ZNO A;  1PK5 A;  5DRJ A;  5KRO A;  1NDE A;  1R20 D;  3CQV A;  1ILG A;  1YOK A;  1Z5X U;  3OSW A;  3JZB A;  3PBA A;  3OZJ A;  5EC9 A;  5AVI A;  3G8O A;  4YMQ A;  1T73 A;  3P8X A;  1X76 A;  5L7G A;  3IA6 A;  2OAX A;  4R06 A;  5IAW A;  1A28 A;  1G2N A;  4OEY A;  4DK8 A;  3ERD A;  3A3Z X;  4UDA A;  1Y9R A;  5DKS A;  3VRW A;  3W5T A;  1U3Q A;  4TV1 A;  4IV2 A;  5AZT A;  4MG8 B;  1HG4 A;  1UHL B;  3GZ9 A;  4P6W A;  4UDC A;  5C4U A;  4OJ4 A;  4R2U A;  4XUM A;  5G45 A;  2AA2 A;  2P1V A;  3V3E A;  2H79 A;  2BJ4 B;  3L3X A;  2G0G A;  3OLF A;  4BCR A;  3OMM A;  4PP3 A;  4K6I A;  5KRL A;  1FBY A;  2GPU A;  5DV6 A;  4OK1 A;  5E0W A;  3VI8 A;  3R5M A;  1LV2 A;  1MZN A;  4XAO A;  5DSH A;  4OZR E;  4RUO X;  4EMA A;  3CDP A;  5KCT A;  1WM0 X;  4N1Y A;  4N8R A;  4MGD B;  3VJT A;  4CI5 A;  3D5F A;  2Q8S A;  3HLV A;  1XV9 B;  3N00 A;  5KCW A;  3L3Z A;  3D90 A;  2AO6 A;  3ZR7 A;  2PIV A;  2R6Y A;  4G2I A;  3K6P A;  4ZN7 A;  1T7M A;  3RUU A;  4RE8 A;  2ACL B;  1U3S A;  5DZH A;  1IE9 A;  3ADV A;  4KZI A;  3V9Y A;  3B65 A;  4J24 A;  5DV3 A;  5HJP A;  2NV7 A;  3E94 A;  1NUO A;  5L7E A;  1OSV A;  4ZJW A;  2W8Y A;  3X1I A;  3UUA A;  3WFG A;  3R29 A;  3GWS X;  4OIL A;  5GIC A;  3VT7 A;  4CI4 A;  5DY8 A;  4QK4 A;  3ERT A;  5LWP A;  1RKH A;  3Q95 A;  4OEA A;  3UUD B;  2IOG A;  4YPQ A;  1G1U A;  3GBK A;  5E1C A;  2Q61 A;  1ERR A;  2O4R A;  5DWL A;  4DM6 A;  1P93 A;  5DP0 A;  2PIQ A;  2R40 A;  3ADX A;  3AUR A;  4PP6 A;  3O1E A;  4OAR A;  5CJ6 A;  2P1U A;  3A2I A;  3FAL A;  4QE6 A;  2GL8 A;  3WFF A;  3CS4 A;  3IMY A;  4MG9 A;  5DZ3 A;  3X1H A;  1YP0 A;  3DZY A;  4ITF A;  3DCT A;  3IXP A;  5DIE A;  4POJ A;  3PO9 A;  1FM6 D;  1XZX X;  3NSP A;  1P8D A;  1FCY A;  3V9T A;  5APH A;  5KCD A;  3BC5 A;  3EYB A;  4XHD A;  3RLL A;  3OKI A;  4YT1 A;  1XQC A;  1ZAF A;  2Q60 A;  4IA3 A;  5A86 A;  3G0W A;  2Q3Y A;  5DTV A;  5ICK A;  2YJD A;  2QH6 A;  2J4A A;  2ZAS A;  2QAB A;  2VV4 A;  3FC6 B;  3CWD A;  5DWI A;  2Q70 A;  1Z95 A;  3W5P A;  3P0U A;  3ILZ A;  4IV4 A;  4IA1 A;  5G43 A;  3JZC A;  2HAM A;  3BEJ A;  5H1E A;  5DLR A;  4YNK A;  4RFW A;  5DZ1 A;  5GID A;  2H77 A;  3B0T A;  3W0H A;  2Q1H A;  4XUH A;  5KYA A;  5FQV A;  2AX8 A;  1X78 A;  2PJL A;  4E4K A;  5DU5 A;  4PF3 A;  2QPY A;  5G3J A;  4ZNV A;  2Q59 B;  1PQC A;  3A2J A;  2ZY0 A;  4J5W A;  4NIE A;  4MG5 A;  5AK2 A;  3L03 A;  1X7J A;  2VV2 A;  3T03 A;  5DXQ A;  2PIO A;  5DKB A;  4PP5 A;  5DWJ A;  5DYD A;  5E19 A;  5HZC A;  4G21 A;  5DMF A;  5KRC A;  3V3Q A;  1TXI A;  4XI3 A;  5SYZ A;  2PKL A;  4G20 A;  1Y0X X;  1QKM A;  4POH A;  4QE8 A;  4OIU A;  2QXM A;  2OUZ A;  4FGY A;  4XTA A;  3VT8 A;  2ZBS A;  2OZ7 A;  4FHI A;  2Z4B A;  3UP3 A;  2QR9 A;  2XYW A;  4PPS A;  5L11 A;  3W0I A;  2I0J A;  3AZ2 A;  4LBD A;  5DI7 A;  4JYG A;  3TY0 A;  3WWR A;  3W0A A;  2J7X A;  4TV1 B;  2ZK2 A;  1PDU A;  3HM1 A;  5KRA A;  4S0S A;  1GS4 A;  3TKC A;  4R6S A;  4DM8 A;  1L2I A;  2Q1V A;  1T79 A;  4RWV A;  5KRH A;  2VST A;  3K22 A;  5LGA A;  2I0G A;  1X7E A;  2HFP A;  3L0J A;  5EJV A;  3CJW A;  1KV6 A;  3FXV A;  1S0X A;  1SKX A;  1XQ3 A;  4JGV A;  1T76 A;  2P1T A;  1XP6 A;  3KMG A;  1QKN A;  5HYK A;  3HVL A;  5FQP A;  2QTU A;  1I7I A;  4OKX A;  5DUE A;  2XHS A;  3ET1 A;  3W5Q A;  4RZF A;  2FSZ A;  2P7A A;  2ZXN A;  4O8F A;  4OLM A;  2AA6 A;  3P88 A;  3R8D A;  4EM9 A;  2ZXZ A;  3OKH A;  4G1Y A;  3B3K A;  2B1V A;  4MDD A;  4RZE A;  3W0C A;  2I4J A;  4ZI1 A;  2YFE A;  3WJ5 A;  5DX3 A;  3ET0 A;  3KPZ A;  1RDT A;  5DVS A;  5HJP B;  5EI1 A;  1MV9 A;  2QE4 A;  4DQM A;  3VHV A;  2FAI A;  4Q13 A;  1NQ7 A;  1DKF A;  4RAK A;  5KR9 A;  3UUA B;  3CTB A;  2HWR A;  3FUG A;  3QT0 A;  1R6G A;  4A2J A;  2NXX E;  2ZLA A;  3Q95 B;  3ZQT A;  3KMR A;  2GP7 A;  4RZG A;  2QGT A;  3ADW A;  4ZNW A;  2HCD A;  1FM6 A;  1NHZ A;  1EXA A;  3BQD A;  5KRK A;  2GPV A;  2PIU A;  1XIU A;  3AZ1 A;  1PQ6 A;  5E0X A;  5C4O A;  2QA8 A;  4JL4 A;  4APU A;  1XP9 A;  1PQ9 A;  3FAL B;  2O4J A;  3VHU A;  4MG9 B;  3OOF A;  2E2R A;  4J5W C;  5ETH A;  2A3I A;  2JF9 A;  3X36 A;  3E7C A;  4OH6 A;  3AN3 A;  3SP6 A;  1OVL A;  2XYX A; 
#chains in the Genus database with same CATH homology
 3VSO A;  1I38 A;  3A9E A;  3A2H A;  2VV4 B;  1OT7 A;  5B41 A;  1XDK A;  1N4H A;  2YLQ A;  4XT9 A;  2P4Y A;  5M96 A;  3A78 A;  1K4W A;  1XPC A;  5DRM A;  3WTQ A;  4RUJ A;  2YLO A;  4ZNU A;  2QNV A;  5FQR A;  1S9P A;  2FVJ A;  2Q5P A;  1RDT D;  3OLL A;  2HVC A;  3FEJ A;  2V7C A;  5G5W A;  5KCU A;  3B67 A;  2ZNQ A;  4WHG A;  1NQ2 A;  4OC7 A;  4OFU A;  3A40 X;  1SR7 A;  4QM0 A;  4NUF A;  2NXX A;  5E7V A;  3VJS A;  3GD2 A;  3LMP A;  3RY9 A;  1QKU A;  1ZUC A;  4MG7 A;  2Q5S A;  4OJB A;  2ZK6 A;  4ZN9 A;  1XNN A;  3VT6 A;  3VTC A;  3F7D A;  1NAV A;  4S15 A;  1U9E A;  2G0H A;  3M7R A;  1XVP A;  5DZI A;  2AX9 A;  1L2J A;  1T63 A;  2PIT A;  3OSI A;  3OMK A;  1Q4X A;  4JYH A;  4OH5 A;  1ZKY A;  3HOD A;  4WQP A;  1GWX A;  3VT4 A;  5JJM A;  4X1G A;  2B23 A;  4REE A;  4IWF A;  3F5C A;  3VRV A;  3OAP A;  4IVW A;  2P54 A;  3B0Q A;  2AMB A;  4IU7 A;  4MGA A;  2IOK A;  1T7R A;  3S9S A;  4UDD A;  5DVC A;  3R2A A;  3VT9 A;  3B0W A;  4MG6 A;  1T65 A;  4DOR A;  5GT4 A;  1YY4 A;  2ZK1 A;  1H9U A;  3D6D A;  2ZK0 A;  2AM9 A;  4FNE A;  3RVF A;  4KZM A;  3VT3 A;  2QA6 A;  1FM9 A;  2HBH A;  2POG A;  2ZK3 A;  4MGB A;  5DZ0 A;  4RMD A;  1N83 A;  2GPO A;  3HO0 A;  4IW8 A;  3VSP A;  2VV1 A;  1X7B A;  5DX3 B;  4B7W A;  2GPP A;  1YUC A;  5JI0 D;  3AFR A;  2QMV A;  5DIG A;  1DKF B;  3B0R A;  3WJ4 A;  4A4V A;  1R5K A;  2OVH A;  3DR1 A;  3OLS A;  2ABI A;  4PPP A;  1YIM A;  3ADS A;  4OFR A;  5K13 A;  3L0L A;  1GWQ A;  1YA3 A;  4Y29 A;  5AAV A;  2OM9 A;  5EIT A;  5AVL A;  3OSA A;  2ZK4 A;  3R8I A;  3TX7 B;  3B68 A;  1ZH7 A;  1TFC A;  4OKT A;  1BSX A;  2ZKC A;  2Q6S A;  2J7Y A;  2YLP A;  2ZNN A;  4OHA A;  5KRJ A;  2ZFX A;  2QA8 B;  2VSR A;  4MGC A;  5C4T A;  3VTB A;  2ZXM A;  4G2H A;  2AX6 A;  2PRG A;  4RME A;  5DYB A;  2AA5 A;  2ZMH A;  3L0E A;  3IPQ A;  4PWL A;  2LBD A;  2XKW A;  1X7R A;  5DUG A;  2GTK A;  3H52 A;  1OVL B;  4X1F A;  5DXP A;  4IA7 A;  3R5N A;  1YIN A;  3CS8 A;  3GYT A;  1XJ7 A;  3A9E B;  3NSQ A;  5KYJ A;  2P7G A;  2HWQ A;  4OZT E;  1K74 A;  2PIP L;  3IPS A;  2GIU A;  3DT3 A;  3OMQ A;  3MNE A;  5DXG A;  1XDK B;  4KZJ A;  3KYT A;  3D57 A;  2Q7L A;  4PVU A;  3ET3 A;  3WT7 A;  3DZU A;  3OZ0 A;  3ADT A;  5EGV A;  1HJ1 A;  1UOM A;  2Q7J A;  3W5R A;  5IZ0 A;  1FM9 D;  1G50 A;  4PXM A;  2QXS A;  3PLZ A;  5DV8 A;  4Q0A C;  4K4J A;  5AWK A;  1S0Z A;  2QZO A;  1XLS E;  4G1Z A;  1FD0 A;  2AX7 A;  3GWX A;  4UDB A;  5DVV A;  5G46 A;  2AMA A;  1XAP A;  4TUZ A;  2G5O A;  2V0V A;  3IPU A;  2Q7I A;  1T5Z A;  3UP0 A;  2PIX A;  2HC4 A;  3OGT A;  5DWE A;  4IS8 A;  4ONI A;  5L7H A;  2J14 A;  1RKG A;  4ZOM A;  5GIE A;  1VJB A;  3H0A A;  3K8S A;  1YYE A;  4G1D A;  4MG7 B;  4HEE X;  2IHQ A;  1YJE A;  1E3G A;  4E4Q A;  2R6W A;  3DY6 A;  3PRG A;  4M8E A;  3RUT A;  3VHW A;  1ZEO A;  1EXX A;  3KDU A;  3G9E A;  1KNU A;  2JFA A;  2JJ3 A;  3UVV A;  4OZT U;  1XVP B;  2I4Z A;  1E3K A;  5AWJ A;  2P15 A;  3GYU A;  5FQT A;  2ZK5 A;  2ZVT A;  3NOA A;  4RMC A;  4A4W A;  5JJM B;  5KRM A;  3FS1 A;  5FQS A;  5APJ A;  3V9V A;  3E00 A;  2NW4 A;  4J5X A;  1RJK A;  1ZDU A;  3D24 A;  3F5C B;  2AA7 A;  2Q6J A;  4NB6 A;  5HYR A;  1SQN A;  1K74 D;  2PIR A;  3OMO A;  5DMC A;  4MGA B;  4OED A;  3AX8 A;  3FUR A;  3HC6 A;  3CS6 A;  4DK7 A;  4OGH A;  3UU7 A;  3WMH A;  5F9B A;  5DXE A;  2ZL9 A;  2AWH A;  4PRG A;  3OS8 A;  5DUH A;  3AZ3 A;  3L1B A;  1ERE A;  3DZU D;  2OCF A;  4NY9 A;  3MNO A;  5G44 A;  5DXM A;  2YHD A;  1N46 A;  3TKM A;  5DK9 A;  5DXB A;  3VRT A;  3WT6 A;  1FCZ A;  2HAR A;  2AYR A;  4M8H A;  4MGB B;  4IUI A;  4OJ9 A;  5ACC A;  2BAW A;  5DXR A;  1ILH A;  1T7T A;  2VV1 B;  2HAS A;  1XLS A;  1IE8 A;  2HB8 A;  4L98 A;  2Q7K A;  4LNX A;  5AYG A;  1PZL A;  2PNU A;  5APK A;  2VV0 A;  5JY3 A;  5KRF A;  3KBA A;  1I37 A;  5DID A;  3CDS A;  2QSE A;  4IQR A;  3SZ1 A;  2QGW A;  2B1Z A;  1M2Z A;  1NQ0 A;  2XYJ A;  3H0A D;  3MNP A;  2B50 A;  4MG8 A;  1UHL A;  5AAV B;  4L96 A;  4REF A;  1S9Q A;  2YJA B;  2HB7 A;  4NQA B;  2BJ4 A;  2EWP A;  5IXK A;  3X31 A;  3HZF A;  3VN2 A;  4HLW A;  3ZRB A;  3FEI A;  3P89 A;  1UPW A;  1YMT A;  1DB1 A;  3B5R A;  2REW A;  4OZR U;  4WVD A;  3UUC A;  5I4V A;  3OMP A;  2O9I A;  3LBD A;  4MGD A;  4ZO1 X;  2I4P A;  1NRL A;  1G5Y A;  2POB A;  4S0T A;  4PLE A;  1XV9 A;  3OOK A;  3B1M A;  3AUQ A;  3E00 D;  4ZNS A;  3VT5 A;  3V49 A;  4LNW A;  4LTW A;  1T7F A;  2Q6R A;  3AUN A;  4ITE A;  2Q5G A;  2ACL A;  1S19 A;  4LSJ A;  4XLD A;  4F9M A;  3DCU A;  1YOW A;  2PIN A;  2AXA A;  2P7Z A;  2ZMJ A;  1QKT A;  5DKE A;  4WHF A;  1M13 A;  5E15 A;  4ZJR A;  3WGP A;  1PCG A;  4DMA A;  4IW6 A;  3VRU A;  3VJH A;  3ET2 A;  1ZDT A;  5DKG A;  3U9Q A;  5KCF A;  1R1K A;  3AN4 A;  4P6X A;  5DWG A;  4IA2 A;  1NAX A;  3UUD A;  5KCE A;  2G44 A;  5KRI A;  4QJR A;  2GWX A;  2VV3 A;  3G8I A;  5HJS A;  4WPF A;  2QZO B;  1R20 A;  1GWR A;  4JYI A;  4DOS A;  4OKB A;  2OVM A;  3KWY A;  2ZNP A;  5B5B A;  4TUZ B;  4S14 A;  4J5X C;  3OS9 A;  3CLD A;  4OKW A;  4E2J A;  3GN8 A;  4Q50 A;  1NYX A;  3ZRA A;  1NQ1 A;  1XB7 A;  4OIV A;  3HC5 A;  2R40 D;  1XOW A;  3WT5 A;  2QW4 A;  1PRG A;  2ZLC A;  3OS8 C;  3W0Y A;  3R8A A;  1Z5X E;  3HQ5 A;  1XNX A;  4N5G A;  5AAU A;  1UPV A;  2JFA B;  3UVV B;  1LBD A;  3FC6 A;  5HCV A;  3DZY D;  3PCU A;  1FCX A;  3IXP D;  4IWC A;  3VTD A;  2YLY A;  1SJ0 A;  1U3R A;  2ATH A;  1ZGY A;  5G42 A;  1A52 A;  5KD9 A;  2YAT A;  4FHH A;  2AB2 A;  3KFC A;  4JAZ A;  5EHJ A;  3RLJ A;  3K23 A;  4WLB A;  5E14 A;  5DL4 A;  1MVC A;  4ZO1 B;  4IVY A;  2F4B A;  2PIW A;  1I7G A;  2NPA A;  3KMZ A;  4N73 A;  4QL8 A;  3W0G A;  1RK3 A;  2AAX A;  1KKQ A;  3SP9 A;  2Q59 A;  1M7W A;  4OEZ A;  3O1D A;  1XP1 A;  4J26 A;  4CSJ A;  3UU7 B;  3FLI A;  4ZNH A;  4ZNT A;  5AZV A;  4RUP A;  3ADU A;  3W0J A;  4K7A A;  3V4A A;  1K7L A;  5KCC A;  4FN9 A;  5C4S A;  4PLD A;  5DXK A;  1R1K D;  5DXB B;  1Y0S A;  2ZMI A;  3VJI A;  1OSH A;  3KDT A;  3B66 A;  3PEQ A;  1T74 A;  2Z4J A;  2ZNO A;  1PK5 A;  5DRJ A;  5KRO A;  1NDE A;  1R20 D;  3CQV A;  1ILG A;  1YOK A;  1Z5X U;  3OSW A;  3JZB A;  3PBA A;  3OZJ A;  5EC9 A;  5AVI A;  3G8O A;  4YMQ A;  1T73 A;  3P8X A;  1X76 A;  5L7G A;  3IA6 A;  2OAX A;  4R06 A;  5IAW A;  1A28 A;  1G2N A;  4OEY A;  4DK8 A;  3ERD A;  3A3Z X;  4UDA A;  1Y9R A;  5DKS A;  3VRW A;  3W5T A;  1U3Q A;  4TV1 A;  4IV2 A;  5AZT A;  4MG8 B;  1HG4 A;  1UHL B;  3GZ9 A;  4P6W A;  4UDC A;  5C4U A;  4OJ4 A;  4R2U A;  4XUM A;  5G45 A;  2AA2 A;  2P1V A;  3V3E A;  2H79 A;  2BJ4 B;  3L3X A;  2G0G A;  3OLF A;  4BCR A;  3OMM A;  4PP3 A;  4K6I A;  5KRL A;  1FBY A;  2GPU A;  5DV6 A;  4OK1 A;  5E0W A;  3VI8 A;  3R5M A;  1LV2 A;  1MZN A;  4XAO A;  5DSH A;  4OZR E;  4RUO X;  4EMA A;  3CDP A;  5KCT A;  1WM0 X;  4N1Y A;  4N8R A;  4MGD B;  3VJT A;  4CI5 A;  3D5F A;  2Q8S A;  3HLV A;  1XV9 B;  3N00 A;  5KCW A;  3L3Z A;  3D90 A;  2AO6 A;  3ZR7 A;  2PIV A;  2R6Y A;  4G2I A;  3K6P A;  4ZN7 A;  1T7M A;  3RUU A;  4RE8 A;  2ACL B;  1U3S A;  5DZH A;  1IE9 A;  3ADV A;  4KZI A;  3V9Y A;  3B65 A;  4J24 A;  5DV3 A;  5HJP A;  2NV7 A;  3E94 A;  1NUO A;  5L7E A;  1OSV A;  4ZJW A;  2W8Y A;  3X1I A;  3UUA A;  3WFG A;  3R29 A;  3GWS X;  4OIL A;  5GIC A;  3VT7 A;  4CI4 A;  5DY8 A;  4QK4 A;  3ERT A;  5LWP A;  1RKH A;  3Q95 A;  4OEA A;  3UUD B;  2IOG A;  4YPQ A;  1G1U A;  3GBK A;  5E1C A;  2Q61 A;  1ERR A;  2O4R A;  5DWL A;  4DM6 A;  1P93 A;  5DP0 A;  2PIQ A;  2R40 A;  3ADX A;  3AUR A;  4PP6 A;  3O1E A;  4OAR A;  5CJ6 A;  2P1U A;  3A2I A;  3FAL A;  4QE6 A;  2GL8 A;  3WFF A;  3CS4 A;  3IMY A;  4MG9 A;  5DZ3 A;  3X1H A;  1YP0 A;  3DZY A;  4ITF A;  3DCT A;  3IXP A;  5DIE A;  4POJ A;  3PO9 A;  1FM6 D;  1XZX X;  3NSP A;  1P8D A;  1FCY A;  3V9T A;  5APH A;  5KCD A;  3BC5 A;  3EYB A;  4XHD A;  3RLL A;  3OKI A;  4YT1 A;  1XQC A;  1ZAF A;  2Q60 A;  4IA3 A;  5A86 A;  3G0W A;  2Q3Y A;  5DTV A;  5ICK A;  2YJD A;  2QH6 A;  2J4A A;  2ZAS A;  2QAB A;  2VV4 A;  3FC6 B;  3CWD A;  5DWI A;  2Q70 A;  1Z95 A;  3W5P A;  3P0U A;  3ILZ A;  4IV4 A;  4IA1 A;  5G43 A;  3JZC A;  2HAM A;  3BEJ A;  5H1E A;  5DLR A;  4YNK A;  4RFW A;  5DZ1 A;  5GID A;  2H77 A;  3B0T A;  3W0H A;  2Q1H A;  4XUH A;  5KYA A;  5FQV A;  2AX8 A;  1X78 A;  2PJL A;  4E4K A;  5DU5 A;  4PF3 A;  2QPY A;  5G3J A;  4ZNV A;  2Q59 B;  1PQC A;  3A2J A;  2ZY0 A;  4J5W A;  4NIE A;  4MG5 A;  5AK2 A;  3L03 A;  1X7J A;  2VV2 A;  3T03 A;  5DXQ A;  2PIO A;  5DKB A;  4PP5 A;  5DWJ A;  5DYD A;  5E19 A;  5HZC A;  4G21 A;  5DMF A;  5KRC A;  3V3Q A;  1TXI A;  4XI3 A;  5SYZ A;  2PKL A;  4G20 A;  1Y0X X;  1QKM A;  4POH A;  4QE8 A;  4OIU A;  2QXM A;  2OUZ A;  4FGY A;  4XTA A;  3VT8 A;  2ZBS A;  2OZ7 A;  4FHI A;  2Z4B A;  3UP3 A;  2QR9 A;  2XYW A;  4PPS A;  5L11 A;  3W0I A;  2I0J A;  3AZ2 A;  4LBD A;  5DI7 A;  4JYG A;  3TY0 A;  3WWR A;  3W0A A;  2J7X A;  4TV1 B;  2ZK2 A;  1PDU A;  3HM1 A;  5KRA A;  4S0S A;  1GS4 A;  3TKC A;  4R6S A;  4DM8 A;  1L2I A;  2Q1V A;  1T79 A;  4RWV A;  5KRH A;  2VST A;  3K22 A;  5LGA A;  2I0G A;  1X7E A;  2HFP A;  3L0J A;  5EJV A;  3CJW A;  1KV6 A;  3FXV A;  1S0X A;  1SKX A;  1XQ3 A;  4JGV A;  1T76 A;  2P1T A;  1XP6 A;  3KMG A;  1QKN A;  5HYK A;  3HVL A;  5FQP A;  2QTU A;  1I7I A;  4OKX A;  5DUE A;  2XHS A;  3ET1 A;  3W5Q A;  4RZF A;  2FSZ A;  2P7A A;  2ZXN A;  4O8F A;  4OLM A;  2AA6 A;  3P88 A;  3R8D A;  4EM9 A;  2ZXZ A;  3OKH A;  4G1Y A;  3B3K A;  2B1V A;  4MDD A;  4RZE A;  3W0C A;  2I4J A;  4ZI1 A;  2YFE A;  3WJ5 A;  5DX3 A;  3ET0 A;  3KPZ A;  1RDT A;  5DVS A;  5HJP B;  5EI1 A;  1MV9 A;  2QE4 A;  4DQM A;  3VHV A;  2FAI A;  4Q13 A;  1NQ7 A;  1DKF A;  4RAK A;  5KR9 A;  3UUA B;  3CTB A;  2HWR A;  3FUG A;  3QT0 A;  1R6G A;  4A2J A;  2NXX E;  2ZLA A;  3Q95 B;  3ZQT A;  3KMR A;  2GP7 A;  4RZG A;  2QGT A;  3ADW A;  4ZNW A;  2HCD A;  1FM6 A;  1NHZ A;  1EXA A;  3BQD A;  5KRK A;  2GPV A;  2PIU A;  1XIU A;  3AZ1 A;  1PQ6 A;  5E0X A;  5C4O A;  2QA8 A;  4JL4 A;  4APU A;  1XP9 A;  1PQ9 A;  3FAL B;  2O4J A;  3VHU A;  4MG9 B;  3OOF A;  2E2R A;  4J5W C;  5ETH A;  2A3I A;  2JF9 A;  3X36 A;  3E7C A;  4OH6 A;  3AN3 A;  3SP6 A;  1OVL A;  2XYX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...