1PRGA

Ligand binding domain of the human peroxisome proliferator activated receptor gamma
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
270
structure length
270
Chain Sequence
ESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand binding and co-activator assembly of the peroxisome proliferator-activated receptor-gamma.
pubmed doi rcsb
molecule keywords PROTEIN (PEROXISOME PROLIFERATOR ACTIVATED RECEPTOR GAMMA)
molecule tags Gene regulation
source organism Homo sapiens
total genus 93
structure length 270
sequence length 270
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 1prgA00
5DVCA 3P89A 2IHQA 3AN3A 4PP5A 1MZNA 1RDTD 2Q5PA 3VJIA 4JL4A 3RLJA 4ZNSA 3VTBA 2I0GA 4BCRA 2Q8SA 3W5PA 3A78A 2ZK2A 2J7XA 1T63A 4MGBB 3H52A 5B5BA 3VHUA 5G46A 5DK9A 1RJKA 4ZNVA 3B5RA 4REFA 2P1UA 1QKNA 2GPVA 3OKIA 3RUUA 1M7WA 3ZQTA 4S15A 2XHSA 4ZO1X 5C4OA 4XUHA 3OSAA 5DXRA 5DVVA 5G45A 5G5WA 3CDPA 3BC5A 5KRKA 1YOWA 5DXQA 2HAMA 1N4HA 1KNUA 1R1KD 1BSXA 3W0JA 1TXIA 4N5GA 1R20A 2G5OA 3RUTA 5KRCA 2P54A 4OZRE 1ZDUA 3IPUA 3FC6B 4PVUA 5EI1A 2BAWA 3B0WA 4X1GA 3DCTA 4CI5A 4J5WC 2PITA 2B1ZA 3OS9A 1T5ZA 5ACCA 4IU7A 4M8HA 3KMGA 4Y29A 5SYZA 1GWXA 1NAXA 1ZUCA 2Q6RA 3VJHA 2I4ZA 3CDSA 1QKUA 3PEQA 1KV6A 4HLWA 5GIDA 4ZI1A 4P6XA 4Q0AC 4G21A 2OVHA 1FM6D 2AX7A 2AA2A 4PPSA 2QA6A 1T74A 5DKBA 3V3EA 4OHAA 4POJA 3G9EA 4RWVA 1X78A 1X7JA 2YLOA 3CS4A 1GS4A 3GWXA 1XV9A 3ET2A 3HO0A 4PLDA 5DWGA 4YPQA 1PCGA 2P7ZA 2PIUA 2QPYA 1R5KA 2Q3YA 1MV9A 1T7FA 3F7DA 1SQNA 2NPAA 2VV0A 4WVDA 5FQPA 4OH6A 4IS8A 2GPUA 2Q59A 4MGDA 3FEJA 2ZXMA 3GN8A 1YINA 5AWJA 1K74A 5AWKA 4IA1A 5G42A 4DK7A 3KBAA 4RAKA 3A2JA 2PJLA 5KCCA 3L0JA 2Q61A 4QE6A 2HARA 2EWPA 2GP7A 2YATA 3FURA 2I0JA 4KZIA 3X36A 2QE4A 2HB8A 2ZK5A 2XYJA 3OLLA 3WFFA 2W8YA 3FXVA 2R40D 2GIUA 4B7WA 2AX6A 1XP6A 3W0AA 3VT8A 4ZN9A 5GICA 2QH6A 3H0AA 3N00A 3W5RA 1U3SA 4ITEA 3ADXA 4IWCA 2QGTA 4IVWA 3L0EA 4LBDA 4FHIA 4DOSA 5C4TA 3CTBA 5KR9A 4OEDA 5G44A 1NUOA 3D24A 3OOFA 4ZNTA 4OKBA 2YHDA 1NDEA 5E19A 2P1VA 2P7GA 3V9VA 5AAVB 4K7AA 2HCDA 4FNEA 4MG8B 5KCEA 4OLMA 3FEIA 2YFEA 5JY3A 2J7YA 3LBDA 1XIUA 2ZBSA 4PP6A 4IWFA 3K22A 1IE8A 5DIDA 5FQRA 3VHVA 5DUGA 3AZ2A 1UPVA 1DB1A 3IXPA 2YLPA 2ACLB 3M7RA 5F9BA 2AA7A 3BQDA 3O1DA 3W0GA 2ZKCA 2JFAB 3V3QA 3PRGA 5L7EA 4OZTE 4J5XA 5EITA 2AA5A 4RMDA 2ZNNA 2AM9A 4OK1A 5DXBA 1SR7A 3ADTA 4ZJWA 3OLSA 5JJMB 1Z5XU 4OEZA 2I4JA 4NY9A 1XP9A 3ILZA 3GWSX 4ZJRA 2BJ4B 5KD9A 3FLIA 5DY8A 3F5CB 3OMPA 5IAWA 4RZFA 3PBAA 3CWDA 1EREA 5DIEA 1EXXA 2HB7A 3P88A 2VV2A 4S14A 2P7AA 1XLSA 1ZDTA 3HVLA 4UDBA 5AVIA 5HCVA 1YP0A 1UPWA 2HBHA 1XNXA 3RVFA 3ZRAA 1UHLA 1RKHA 2ABIA 2PKLA 1K4WA 4OKTA 3BEJA 3NSQA 3VRUA 2QA8A 2GWXA 2ZXNA 2AB2A 2VV4B 5KRMA 4Q13A 2Q7IA 3DCUA 5DZ1A 3AFRA 4IA7A 5DRMA 2YJAB 2AAXA 3P0UA 4FGYA 4MGAA 5KRFA 1U3QA 1VJBA 2R6YA 2ZK6A 1XVPB 4XLDA 5DXGA 4YNKA 3CS6A 1A28A 3UUDB 3U9QA 5AZTA 4E4QA 3VSOA 4R06A 2OVMA 1FBYA 1G50A 3ADSA 4LNWA 1XOWA 2O4JA 5C4UA 5LWPA 1T65A 2AA6A 1G2NA 2HWRA 2POGA 2ZXZA 4MG7B 1OT7A 1RKGA 1M2ZA 2ZMIA 4TUZB 1XLSE 4XT9A 1ZEOA 5DUEA 5EGVA 3V9YA 3X31A 3HLVA 5E7VA 3D57A 2GTKA 4R6SA 3WT7A 4OZRU 1I37A 2ZMHA 4DM6A 1IE9A 5KRIA 4IQRA 3MNPA 4ZO1B 1K74D 4OKXA 4XUMA 1GWRA 5KYJA 1NQ1A 1QKTA 3OOKA 1PRGA 3OMQA 5KCWA 1S9PA 3UUCA 4MGBA 3JZBA 3NOAA 2QMVA 4YMQA 3B3KA 3B0QA 4PXMA 4WHFA 5APJA 3V49A 2Q7JA 2NXXA 1NAVA 1YIMA 3GYUA 3ZR7A 1YUCA 1ZGYA 4ZN7A 2VSTA 3ZRBA 4E4KA 5EHJA 4QL8A 4RZGA 3H0AD 4UDCA 3CJWA 4K4JA 1T7TA 5L7GA 5KCFA 2P4YA 1NRLA 5KRHA 2QNVA 5AK2A 4TV1B 3TY0A 3W0HA 3GYTA 3DZUA 3FC6A 1S9QA 3OAPA 1XQCA 2Q6JA 4N8RA 4ZNUA 3AURA 1Q4XA 3VHWA 5HJPB 5KCTA 1YOKA 2ZNQA 3R8DA 2FAIA 3OZJA 5LGAA 2Q7KA 3AUQA 2VSRA 4QM0A 4RMEA 2AWHA 4IA2A 3HZFA 5DKSA 4UDAA 4MG6A 1I7IA 3D90A 1U3RA 1X7RA 3X1IA 4M8EA 3V9TA 5B41A 1K7LA 4ZNWA 2JJ3A 3IXPD 4OEAA 3VJSA 2PIRA 3MNEA 2NXXE 2YLYA 4Q50A 3L0LA 5DVSA 3W0CA 5IXKA 2QTUA 2PIXA 3E00A 3OKHA 1T79A 4MG9B 4TV1A 5L11A 1Y0XX 3PO9A 4HEEX 5KRAA 2J14A 2HWQA 4YT1A 4WLBA 5HJPA 2FVJA 3OS8A 2AMAA 1XB7A 2HFPA 3Q95B 4POHA 5DV8A 2ZY0A 5E14A 5APHA 1PQ6A 3JZCA 4IW8A 4IVYA 5DKGA 3FUGA 2PIPL 4G2HA 4JYIA 2Q7LA 4J5XC 4S0TA 2VV1B 3O1EA 1FM9A 4G20A 4MGCA 4OIUA 3OSIA 1YYEA 2B50A 3FS1A 4IV4A 5HYRA 3HM1A 4P6WA 5AZVA 4MG9A 5DU5A 3TKCA 3FALB 2AMBA 3KYTA 1YJEA 2ZLCA 3VN2A 2ATHA 1SKXA 1XDKB 3QT0A 4OGHA 4PRGA 5L7HA 1Y0SA 3T03A 4OZTU 3R2AA 2PIQA 3KPZA 2J4AA 3OZ0A 5E0WA 5DZ0A 4N73A 4ONIA 2AXAA 3LMPA 2HC4A 2QZOB 2ZL9A 3UUAB 2ZLAA 2G0HA 4OH5A 3IPSA 5KRLA 5DYDA 3A2IA 3DY6A 3ADWA 1T76A 3DT3A 3UVVB 4OJ9A 5DWIA 4K6IA 4RUJA 1KKQA 1FCXA 2AX8A 2VV1A 4N1YA 4APUA 3AX8A 5AAVA 5DWLA 4MG8A 5AYGA 3P8XA 1H9UA 2GPPA 2H79A 2E2RA 4CI4A 1ERRA 1XJ7A 1ZKYA 3MNOA 1YY4A 3NSPA 5AAUA 3IPQA 3KWYA 2HVCA 3FALA 5DZIA 3VRWA 3DZYA 2ZK4A 1P8DA 1N46A 4XHDA 1PQ9A 4RUPA 5DIGA 3KMZA 3ET1A 2ACLA 2Z4JA 1R20D 2OZ7A 3OSWA 1DKFB 1TFCA 3G8IA 5DX3B 2JFAA 3ADVA 4LNXA 2Q6SA 3WT6A 1I7GA 2Q1HA 1XPCA 4KZJA 4PP3A 3VSPA 4FN9A 1HG4A 4NUFA 3UVVA 5JJMA 5FQSA 2REWA 4LTWA 3ET0A 1NQ7A 2A3IA 3ET3A 5DUHA 5GT4A 3X1HA 4WPFA 4OFRA 4PPPA 1M13A 3OLFA 2BJ4A 3GZ9A 3WTQA 2R6WA 1L2IA 1SJ0A 3F5CA 5DSHA 1YMTA 5DMFA 4DM8A 2ZVTA 2OM9A 2V7CA 3D5FA 4MG5A 4REEA 4A4WA 5DKEA 2AX9A 3K23A 3TKMA 5K13A 2Q1VA 2PIVA 5DZ3A 2QXSA 3E94A 3B68A 3DZUD 3HQ5A 3L3XA 1Y9RA 4O8FA 3ERDA 4PLEA 1OSVA 3K6PA 4JYGA 4ZNHA 1X76A 1ZAFA 4OEYA 2OCFA 5C4SA 3VRTA 2IOKA 3SP9A 2VV4A 3V4AA 2AYRA 1ILHA 2I4PA 3VT7A 1WM0X 5ICKA 4DORA 4DK8A 1E3GA 4E2JA 2ZNOA 3WJ4A 3KDUA 3WT5A 1XVPA 4OJ4A 5DYBA 3UU7B 2Q60A 3A3ZX 3RY9A 1G5YA 3UUDA 5HYKA 3AN4A 2QSEA 4NB6A 3E00D 3L03A 1R6GA 3L1BA 5FQTA 4IUIA 4OARA 2PRGA 1S0XA 4RUOX 3G8OA 3CQVA 4L96A 1S0ZA 3VT9A 3R5NA 5DWEA 4MG7A 1NQ0A 4RFWA 2POBA 4TUZA 4RE8A 2YJDA 4OILA 5E15A 1XQ3A 5DL4A 1RK3A 2QR9A 5E0XA 5HZCA 2XYWA 5KROA 1XV9B 3AUNA 2HASA 2PINA 2GPOA 1ZH7A 5M96A 1XZXX 4G1YA 4OIVA 2ZFXA 4X1FA 2XYXA 2P1TA 1YA3A 1FM9D 5DMCA 5DZHA 3VT6A 3VT3A 3R5MA 4XTAA 2F4BA 5DWJA 5DXPA 4XAOA 3UU7A 5JI0D 3HODA 2Q59B 1RDTA 4G2IA 4MGDB 3OGTA 3OS8C 3W5TA 1QKMA 4RMCA 2QXMA 2GL8A 3CLDA 4IV2A 3SP6A 3WGPA 1NHZA 2Z4BA 4J24A 3B65A 3E7CA 5KYAA 2OAXA 5KCDA 1GWQA 3DR1A 3A2HA 2G44A 5EJVA 4DMAA 1G1UA 2QGWA 5DTVA 1E3KA 4FHHA 4J5WA 2ZNPA 3RLLA 1PZLA 2FSZA 3AZ3A 3GBKA 3B66A 1EXAA 2O4RA 3R8IA 1FCYA 4EMAA 5GIEA 4G1ZA 2OUZA 3WWRA 1R1KA 2O9IA 4ZOMA 3VI8A 4DQMA 3A9EB 2ZK0A 3CS8A 1NQ2A 1LV2A 3DZYD 2ZK1A 3VT4A 2Q70A 4WHGA 5DXEA 2IOGA 4LSJA 2PNUA 3IMYA 3B1MA 5APKA 3UP3A 3R8AA 2QABA 2PIOA 3TX7B 1T7RA 4OFUA 5G3JA 3VRVA 1T7MA 4G1DA 3OMOA 3VTCA 5FQVA 5AVLA 1T73A 3AZ1A 5EC9A 3W5QA 4EM9A 3W0IA 5IZ0A 1OVLB 2LBDA 3KDTA 5DXKA 4ITFA 2V0VA 5H1EA 2XKWA 2ZASA 3G0WA 5KCUA 5DLRA 5DI7A 1FM6A 5KRJA 3VT5A 2H77A 1OSHA 3Q95A 4UDDA 1FD0A 5DXBB 4KZMA 4NQAB 3A9EA 2G0GA 2NV7A 4JGVA 4QJRA 3IA6A 1XP1A 3WFGA 2ZMJA 3L3ZA 4OC7A 2B1VA 2PIWA 1ILGA 1I38A 5DV3A 4S0SA 5DP0A 3W0YA 5ETHA 3B0RA 3GD2A 4OJBA 5A86A 3KFCA 5I4VA 5HJSA 3R29A 2QW4A 3A40X 1OVLA 3ERTA 2YLQA 1N83A 4IA3A 2NW4A 1XDKA 2JF9A 4MDDA 4JAZA 3VJTA 3WMHA 1UHLB 3HC6A 3OMMA 2Q5SA 1XNNA 4OKWA 3OMKA 4QK4A 5DXMA 2QZOA 3UUAA 1PK5A 1NYXA 1XAPA 1P93A 2ZK3A 4QE8A 4CSJA 1HJ1A 1X7BA 2R40A 2P15A 2QA8B 4J26A 2AO6A 5DRJA 4JYHA 1L2JA 3K8SA 1X7EA 1Z5XE 3B67A 1PQCA 1U9EA 4MGAB 5G43A 4A4VA 3S9SA 3VTDA 4WQPA 1Z95A 3SZ1A 3EYBA 1S19A 1LBDA 2B23A 4PF3A 4XI3A 3B0TA 1A52A 1PDUA 2Q5GA 2VV3A 4NIEA 4R2UA 4F9MA 4PWLA 3ADUA 5DV6A 5E1CA 4L98A 1MVCA 1DKFA 4RZEA 3KMRA 3PCUA 3PLZA 1FCZA 3UP0A 5DX3A 3WJ5A 4IW6A 1UOMA 3HC5A 5CJ6A 3D6DA 4A2JA
chains in the Genus database with same CATH superfamily
5DVCA 3P89A 2IHQA 3AN3A 4PP5A 1MZNA 1RDTD 2Q5PA 3VJIA 4JL4A 3RLJA 4ZNSA 3VTBA 2I0GA 4BCRA 2Q8SA 3W5PA 3A78A 2ZK2A 2J7XA 1T63A 4MGBB 3H52A 5B5BA 3VHUA 5G46A 5DK9A 1RJKA 4ZNVA 3B5RA 4REFA 2P1UA 1QKNA 2GPVA 3OKIA 3RUUA 1M7WA 3ZQTA 4S15A 2XHSA 4ZO1X 5C4OA 4XUHA 3OSAA 5DXRA 5DVVA 5G45A 5G5WA 3CDPA 3BC5A 5KRKA 1YOWA 5DXQA 2HAMA 1N4HA 1KNUA 1R1KD 1BSXA 3W0JA 1TXIA 4N5GA 1R20A 2G5OA 3RUTA 5KRCA 2P54A 4OZRE 1ZDUA 3IPUA 3FC6B 4PVUA 5EI1A 2BAWA 3B0WA 4X1GA 3DCTA 4CI5A 4J5WC 2PITA 2B1ZA 3OS9A 1T5ZA 5ACCA 4IU7A 4M8HA 3KMGA 4Y29A 5SYZA 1GWXA 1NAXA 1ZUCA 2Q6RA 3VJHA 2I4ZA 3CDSA 1QKUA 3PEQA 1KV6A 4HLWA 5GIDA 4ZI1A 4P6XA 4Q0AC 4G21A 2OVHA 1FM6D 2AX7A 2AA2A 4PPSA 2QA6A 1T74A 5DKBA 3V3EA 4OHAA 4POJA 3G9EA 4RWVA 1X78A 1X7JA 2YLOA 3CS4A 1GS4A 3GWXA 1XV9A 3ET2A 3HO0A 4PLDA 5DWGA 4YPQA 1PCGA 2P7ZA 2PIUA 2QPYA 1R5KA 2Q3YA 1MV9A 1T7FA 3F7DA 1SQNA 2NPAA 2VV0A 4WVDA 5FQPA 4OH6A 4IS8A 2GPUA 2Q59A 4MGDA 3FEJA 2ZXMA 3GN8A 1YINA 5AWJA 1K74A 5AWKA 4IA1A 5G42A 4DK7A 3KBAA 4RAKA 3A2JA 2PJLA 5KCCA 3L0JA 2Q61A 4QE6A 2HARA 2EWPA 2GP7A 2YATA 3FURA 2I0JA 4KZIA 3X36A 2QE4A 2HB8A 2ZK5A 2XYJA 3OLLA 3WFFA 2W8YA 3FXVA 2R40D 2GIUA 4B7WA 2AX6A 1XP6A 3W0AA 3VT8A 4ZN9A 5GICA 2QH6A 3H0AA 3N00A 3W5RA 1U3SA 4ITEA 3ADXA 4IWCA 2QGTA 4IVWA 3L0EA 4LBDA 4FHIA 4DOSA 5C4TA 3CTBA 5KR9A 4OEDA 5G44A 1NUOA 3D24A 3OOFA 4ZNTA 4OKBA 2YHDA 1NDEA 5E19A 2P1VA 2P7GA 3V9VA 5AAVB 4K7AA 2HCDA 4FNEA 4MG8B 5KCEA 4OLMA 3FEIA 2YFEA 5JY3A 2J7YA 3LBDA 1XIUA 2ZBSA 4PP6A 4IWFA 3K22A 1IE8A 5DIDA 5FQRA 3VHVA 5DUGA 3AZ2A 1UPVA 1DB1A 3IXPA 2YLPA 2ACLB 3M7RA 5F9BA 2AA7A 3BQDA 3O1DA 3W0GA 2ZKCA 2JFAB 3V3QA 3PRGA 5L7EA 4OZTE 4J5XA 5EITA 2AA5A 4RMDA 2ZNNA 2AM9A 4OK1A 5DXBA 1SR7A 3ADTA 4ZJWA 3OLSA 5JJMB 1Z5XU 4OEZA 2I4JA 4NY9A 1XP9A 3ILZA 3GWSX 4ZJRA 2BJ4B 5KD9A 3FLIA 5DY8A 3F5CB 3OMPA 5IAWA 4RZFA 3PBAA 3CWDA 1EREA 5DIEA 1EXXA 2HB7A 3P88A 2VV2A 4S14A 2P7AA 1XLSA 1ZDTA 3HVLA 4UDBA 5AVIA 5HCVA 1YP0A 1UPWA 2HBHA 1XNXA 3RVFA 3ZRAA 1UHLA 1RKHA 2ABIA 2PKLA 1K4WA 4OKTA 3BEJA 3NSQA 3VRUA 2QA8A 2GWXA 2ZXNA 2AB2A 2VV4B 5KRMA 4Q13A 2Q7IA 3DCUA 5DZ1A 3AFRA 4IA7A 5DRMA 2YJAB 2AAXA 3P0UA 4FGYA 4MGAA 5KRFA 1U3QA 1VJBA 2R6YA 2ZK6A 1XVPB 4XLDA 5DXGA 4YNKA 3CS6A 1A28A 3UUDB 3U9QA 5AZTA 4E4QA 3VSOA 4R06A 2OVMA 1FBYA 1G50A 3ADSA 4LNWA 1XOWA 2O4JA 5C4UA 5LWPA 1T65A 2AA6A 1G2NA 2HWRA 2POGA 2ZXZA 4MG7B 1OT7A 1RKGA 1M2ZA 2ZMIA 4TUZB 1XLSE 4XT9A 1ZEOA 5DUEA 5EGVA 3V9YA 3X31A 3HLVA 5E7VA 3D57A 2GTKA 4R6SA 3WT7A 4OZRU 1I37A 2ZMHA 4DM6A 1IE9A 5KRIA 4IQRA 3MNPA 4ZO1B 1K74D 4OKXA 4XUMA 1GWRA 5KYJA 1NQ1A 1QKTA 3OOKA 1PRGA 3OMQA 5KCWA 1S9PA 3UUCA 4MGBA 3JZBA 3NOAA 2QMVA 4YMQA 3B3KA 3B0QA 4PXMA 4WHFA 5APJA 3V49A 2Q7JA 2NXXA 1NAVA 1YIMA 3GYUA 3ZR7A 1YUCA 1ZGYA 4ZN7A 2VSTA 3ZRBA 4E4KA 5EHJA 4QL8A 4RZGA 3H0AD 4UDCA 3CJWA 4K4JA 1T7TA 5L7GA 5KCFA 2P4YA 1NRLA 5KRHA 2QNVA 5AK2A 4TV1B 3TY0A 3W0HA 3GYTA 3DZUA 3FC6A 1S9QA 3OAPA 1XQCA 2Q6JA 4N8RA 4ZNUA 3AURA 1Q4XA 3VHWA 5HJPB 5KCTA 1YOKA 2ZNQA 3R8DA 2FAIA 3OZJA 5LGAA 2Q7KA 3AUQA 2VSRA 4QM0A 4RMEA 2AWHA 4IA2A 3HZFA 5DKSA 4UDAA 4MG6A 1I7IA 3D90A 1U3RA 1X7RA 3X1IA 4M8EA 3V9TA 5B41A 1K7LA 4ZNWA 2JJ3A 3IXPD 4OEAA 3VJSA 2PIRA 3MNEA 2NXXE 2YLYA 4Q50A 3L0LA 5DVSA 3W0CA 5IXKA 2QTUA 2PIXA 3E00A 3OKHA 1T79A 4MG9B 4TV1A 5L11A 1Y0XX 3PO9A 4HEEX 5KRAA 2J14A 2HWQA 4YT1A 4WLBA 5HJPA 2FVJA 3OS8A 2AMAA 1XB7A 2HFPA 3Q95B 4POHA 5DV8A 2ZY0A 5E14A 5APHA 1PQ6A 3JZCA 4IW8A 4IVYA 5DKGA 3FUGA 2PIPL 4G2HA 4JYIA 2Q7LA 4J5XC 4S0TA 2VV1B 3O1EA 1FM9A 4G20A 4MGCA 4OIUA 3OSIA 1YYEA 2B50A 3FS1A 4IV4A 5HYRA 3HM1A 4P6WA 5AZVA 4MG9A 5DU5A 3TKCA 3FALB 2AMBA 3KYTA 1YJEA 2ZLCA 3VN2A 2ATHA 1SKXA 1XDKB 3QT0A 4OGHA 4PRGA 5L7HA 1Y0SA 3T03A 4OZTU 3R2AA 2PIQA 3KPZA 2J4AA 3OZ0A 5E0WA 5DZ0A 4N73A 4ONIA 2AXAA 3LMPA 2HC4A 2QZOB 2ZL9A 3UUAB 2ZLAA 2G0HA 4OH5A 3IPSA 5KRLA 5DYDA 3A2IA 3DY6A 3ADWA 1T76A 3DT3A 3UVVB 4OJ9A 5DWIA 4K6IA 4RUJA 1KKQA 1FCXA 2AX8A 2VV1A 4N1YA 4APUA 3AX8A 5AAVA 5DWLA 4MG8A 5AYGA 3P8XA 1H9UA 2GPPA 2H79A 2E2RA 4CI4A 1ERRA 1XJ7A 1ZKYA 3MNOA 1YY4A 3NSPA 5AAUA 3IPQA 3KWYA 2HVCA 3FALA 5DZIA 3VRWA 3DZYA 2ZK4A 1P8DA 1N46A 4XHDA 1PQ9A 4RUPA 5DIGA 3KMZA 3ET1A 2ACLA 2Z4JA 1R20D 2OZ7A 3OSWA 1DKFB 1TFCA 3G8IA 5DX3B 2JFAA 3ADVA 4LNXA 2Q6SA 3WT6A 1I7GA 2Q1HA 1XPCA 4KZJA 4PP3A 3VSPA 4FN9A 1HG4A 4NUFA 3UVVA 5JJMA 5FQSA 2REWA 4LTWA 3ET0A 1NQ7A 2A3IA 3ET3A 5DUHA 5GT4A 3X1HA 4WPFA 4OFRA 4PPPA 1M13A 3OLFA 2BJ4A 3GZ9A 3WTQA 2R6WA 1L2IA 1SJ0A 3F5CA 5DSHA 1YMTA 5DMFA 4DM8A 2ZVTA 2OM9A 2V7CA 3D5FA 4MG5A 4REEA 4A4WA 5DKEA 2AX9A 3K23A 3TKMA 5K13A 2Q1VA 2PIVA 5DZ3A 2QXSA 3E94A 3B68A 3DZUD 3HQ5A 3L3XA 1Y9RA 4O8FA 3ERDA 4PLEA 1OSVA 3K6PA 4JYGA 4ZNHA 1X76A 1ZAFA 4OEYA 2OCFA 5C4SA 3VRTA 2IOKA 3SP9A 2VV4A 3V4AA 2AYRA 1ILHA 2I4PA 3VT7A 1WM0X 5ICKA 4DORA 4DK8A 1E3GA 4E2JA 2ZNOA 3WJ4A 3KDUA 3WT5A 1XVPA 4OJ4A 5DYBA 3UU7B 2Q60A 3A3ZX 3RY9A 1G5YA 3UUDA 5HYKA 3AN4A 2QSEA 4NB6A 3E00D 3L03A 1R6GA 3L1BA 5FQTA 4IUIA 4OARA 2PRGA 1S0XA 4RUOX 3G8OA 3CQVA 4L96A 1S0ZA 3VT9A 3R5NA 5DWEA 4MG7A 1NQ0A 4RFWA 2POBA 4TUZA 4RE8A 2YJDA 4OILA 5E15A 1XQ3A 5DL4A 1RK3A 2QR9A 5E0XA 5HZCA 2XYWA 5KROA 1XV9B 3AUNA 2HASA 2PINA 2GPOA 1ZH7A 5M96A 1XZXX 4G1YA 4OIVA 2ZFXA 4X1FA 2XYXA 2P1TA 1YA3A 1FM9D 5DMCA 5DZHA 3VT6A 3VT3A 3R5MA 4XTAA 2F4BA 5DWJA 5DXPA 4XAOA 3UU7A 5JI0D 3HODA 2Q59B 1RDTA 4G2IA 4MGDB 3OGTA 3OS8C 3W5TA 1QKMA 4RMCA 2QXMA 2GL8A 3CLDA 4IV2A 3SP6A 3WGPA 1NHZA 2Z4BA 4J24A 3B65A 3E7CA 5KYAA 2OAXA 5KCDA 1GWQA 3DR1A 3A2HA 2G44A 5EJVA 4DMAA 1G1UA 2QGWA 5DTVA 1E3KA 4FHHA 4J5WA 2ZNPA 3RLLA 1PZLA 2FSZA 3AZ3A 3GBKA 3B66A 1EXAA 2O4RA 3R8IA 1FCYA 4EMAA 5GIEA 4G1ZA 2OUZA 3WWRA 1R1KA 2O9IA 4ZOMA 3VI8A 4DQMA 3A9EB 2ZK0A 3CS8A 1NQ2A 1LV2A 3DZYD 2ZK1A 3VT4A 2Q70A 4WHGA 5DXEA 2IOGA 4LSJA 2PNUA 3IMYA 3B1MA 5APKA 3UP3A 3R8AA 2QABA 2PIOA 3TX7B 1T7RA 4OFUA 5G3JA 3VRVA 1T7MA 4G1DA 3OMOA 3VTCA 5FQVA 5AVLA 1T73A 3AZ1A 5EC9A 3W5QA 4EM9A 3W0IA 5IZ0A 1OVLB 2LBDA 3KDTA 5DXKA 4ITFA 2V0VA 5H1EA 2XKWA 2ZASA 3G0WA 5KCUA 5DLRA 5DI7A 1FM6A 5KRJA 3VT5A 2H77A 1OSHA 3Q95A 4UDDA 1FD0A 5DXBB 4KZMA 4NQAB 3A9EA 2G0GA 2NV7A 4JGVA 4QJRA 3IA6A 1XP1A 3WFGA 2ZMJA 3L3ZA 4OC7A 2B1VA 2PIWA 1ILGA 1I38A 5DV3A 4S0SA 5DP0A 3W0YA 5ETHA 3B0RA 3GD2A 4OJBA 5A86A 3KFCA 5I4VA 5HJSA 3R29A 2QW4A 3A40X 1OVLA 3ERTA 2YLQA 1N83A 4IA3A 2NW4A 1XDKA 2JF9A 4MDDA 4JAZA 3VJTA 3WMHA 1UHLB 3HC6A 3OMMA 2Q5SA 1XNNA 4OKWA 3OMKA 4QK4A 5DXMA 2QZOA 3UUAA 1PK5A 1NYXA 1XAPA 1P93A 2ZK3A 4QE8A 4CSJA 1HJ1A 1X7BA 2R40A 2P15A 2QA8B 4J26A 2AO6A 5DRJA 4JYHA 1L2JA 3K8SA 1X7EA 1Z5XE 3B67A 1PQCA 1U9EA 4MGAB 5G43A 4A4VA 3S9SA 3VTDA 4WQPA 1Z95A 3SZ1A 3EYBA 1S19A 1LBDA 2B23A 4PF3A 4XI3A 3B0TA 1A52A 1PDUA 2Q5GA 2VV3A 4NIEA 4R2UA 4F9MA 4PWLA 3ADUA 5DV6A 5E1CA 4L98A 1MVCA 1DKFA 4RZEA 3KMRA 3PCUA 3PLZA 1FCZA 3UP0A 5DX3A 3WJ5A 4IW6A 1UOMA 3HC5A 5CJ6A 3D6DA 4A2JA
chains in the Genus database with same CATH topology
5DVCA 3P89A 2IHQA 3AN3A 4PP5A 1MZNA 1RDTD 2Q5PA 3VJIA 4JL4A 3RLJA 4ZNSA 3VTBA 2I0GA 4BCRA 2Q8SA 3W5PA 3A78A 2ZK2A 2J7XA 1T63A 4MGBB 3H52A 5B5BA 3VHUA 5G46A 5DK9A 1RJKA 4ZNVA 3B5RA 4REFA 2P1UA 1QKNA 2GPVA 3OKIA 3RUUA 1M7WA 3ZQTA 4S15A 2XHSA 4ZO1X 5C4OA 4XUHA 3OSAA 5DXRA 5DVVA 5G45A 5G5WA 3CDPA 3BC5A 5KRKA 1YOWA 5DXQA 2HAMA 1N4HA 1KNUA 1R1KD 1BSXA 3W0JA 1TXIA 4N5GA 1R20A 2G5OA 3RUTA 5KRCA 2P54A 4OZRE 1ZDUA 3IPUA 3FC6B 4PVUA 5EI1A 2BAWA 3B0WA 4X1GA 3DCTA 4CI5A 4J5WC 2PITA 2B1ZA 3OS9A 1T5ZA 5ACCA 4IU7A 4M8HA 3KMGA 4Y29A 5SYZA 1GWXA 1NAXA 1ZUCA 2Q6RA 3VJHA 2I4ZA 3CDSA 1QKUA 3PEQA 1KV6A 4HLWA 5GIDA 4ZI1A 4P6XA 4Q0AC 4G21A 2OVHA 1FM6D 2AX7A 2AA2A 4PPSA 2QA6A 1T74A 5DKBA 3V3EA 4OHAA 4POJA 3G9EA 4RWVA 1X78A 1X7JA 2YLOA 3CS4A 1GS4A 3GWXA 1XV9A 3ET2A 3HO0A 4PLDA 5DWGA 4YPQA 1PCGA 2P7ZA 2PIUA 2QPYA 1R5KA 2Q3YA 1MV9A 1T7FA 3F7DA 1SQNA 2NPAA 2VV0A 4WVDA 5FQPA 4OH6A 4IS8A 2GPUA 2Q59A 4MGDA 3FEJA 2ZXMA 3GN8A 1YINA 5AWJA 1K74A 5AWKA 4IA1A 5G42A 4DK7A 3KBAA 4RAKA 3A2JA 2PJLA 5KCCA 3L0JA 2Q61A 4QE6A 2HARA 2EWPA 2GP7A 2YATA 3FURA 2I0JA 4KZIA 3X36A 2QE4A 2HB8A 2ZK5A 2XYJA 3OLLA 3WFFA 2W8YA 3FXVA 2R40D 2GIUA 4B7WA 2AX6A 1XP6A 3W0AA 3VT8A 4ZN9A 5GICA 2QH6A 3H0AA 3N00A 3W5RA 1U3SA 4ITEA 3ADXA 4IWCA 2QGTA 4IVWA 3L0EA 4LBDA 4FHIA 4DOSA 5C4TA 3CTBA 5KR9A 4OEDA 5G44A 1NUOA 3D24A 3OOFA 4ZNTA 4OKBA 2YHDA 1NDEA 5E19A 2P1VA 2P7GA 3V9VA 5AAVB 4K7AA 2HCDA 4FNEA 4MG8B 5KCEA 4OLMA 3FEIA 2YFEA 5JY3A 2J7YA 3LBDA 1XIUA 2ZBSA 4PP6A 4IWFA 3K22A 1IE8A 5DIDA 5FQRA 3VHVA 5DUGA 3AZ2A 1UPVA 1DB1A 3IXPA 2YLPA 2ACLB 3M7RA 5F9BA 2AA7A 3BQDA 3O1DA 3W0GA 2ZKCA 2JFAB 3V3QA 3PRGA 5L7EA 4OZTE 4J5XA 5EITA 2AA5A 4RMDA 2ZNNA 2AM9A 4OK1A 5DXBA 1SR7A 3ADTA 4ZJWA 3OLSA 5JJMB 1Z5XU 4OEZA 2I4JA 4NY9A 1XP9A 3ILZA 3GWSX 4ZJRA 2BJ4B 5KD9A 3FLIA 5DY8A 3F5CB 3OMPA 5IAWA 4RZFA 3PBAA 3CWDA 1EREA 5DIEA 1EXXA 2HB7A 3P88A 2VV2A 4S14A 2P7AA 1XLSA 1ZDTA 3HVLA 4UDBA 5AVIA 5HCVA 1YP0A 1UPWA 2HBHA 1XNXA 3RVFA 3ZRAA 1UHLA 1RKHA 2ABIA 2PKLA 1K4WA 4OKTA 3BEJA 3NSQA 3VRUA 2QA8A 2GWXA 2ZXNA 2AB2A 2VV4B 5KRMA 4Q13A 2Q7IA 3DCUA 5DZ1A 3AFRA 4IA7A 5DRMA 2YJAB 2AAXA 3P0UA 4FGYA 4MGAA 5KRFA 1U3QA 1VJBA 2R6YA 2ZK6A 1XVPB 4XLDA 5DXGA 4YNKA 3CS6A 1A28A 3UUDB 3U9QA 5AZTA 4E4QA 3VSOA 4R06A 2OVMA 1FBYA 1G50A 3ADSA 4LNWA 1XOWA 2O4JA 5C4UA 5LWPA 1T65A 2AA6A 1G2NA 2HWRA 2POGA 2ZXZA 4MG7B 1OT7A 1RKGA 1M2ZA 2ZMIA 4TUZB 1XLSE 4XT9A 1ZEOA 5DUEA 5EGVA 3V9YA 3X31A 3HLVA 5E7VA 3D57A 2GTKA 4R6SA 3WT7A 4OZRU 1I37A 2ZMHA 4DM6A 1IE9A 5KRIA 4IQRA 3MNPA 4ZO1B 1K74D 4OKXA 4XUMA 1GWRA 5KYJA 1NQ1A 1QKTA 3OOKA 1PRGA 3OMQA 5KCWA 1S9PA 3UUCA 4MGBA 3JZBA 3NOAA 2QMVA 4YMQA 3B3KA 3B0QA 4PXMA 4WHFA 5APJA 3V49A 2Q7JA 2NXXA 1NAVA 1YIMA 3GYUA 3ZR7A 1YUCA 1ZGYA 4ZN7A 2VSTA 3ZRBA 4E4KA 5EHJA 4QL8A 4RZGA 3H0AD 4UDCA 3CJWA 4K4JA 1T7TA 5L7GA 5KCFA 2P4YA 1NRLA 5KRHA 2QNVA 5AK2A 4TV1B 3TY0A 3W0HA 3GYTA 3DZUA 3FC6A 1S9QA 3OAPA 1XQCA 2Q6JA 4N8RA 4ZNUA 3AURA 1Q4XA 3VHWA 5HJPB 5KCTA 1YOKA 2ZNQA 3R8DA 2FAIA 3OZJA 5LGAA 2Q7KA 3AUQA 2VSRA 4QM0A 4RMEA 2AWHA 4IA2A 3HZFA 5DKSA 4UDAA 4MG6A 1I7IA 3D90A 1U3RA 1X7RA 3X1IA 4M8EA 3V9TA 5B41A 1K7LA 4ZNWA 2JJ3A 3IXPD 4OEAA 3VJSA 2PIRA 3MNEA 2NXXE 2YLYA 4Q50A 3L0LA 5DVSA 3W0CA 5IXKA 2QTUA 2PIXA 3E00A 3OKHA 1T79A 4MG9B 4TV1A 5L11A 1Y0XX 3PO9A 4HEEX 5KRAA 2J14A 2HWQA 4YT1A 4WLBA 5HJPA 2FVJA 3OS8A 2AMAA 1XB7A 2HFPA 3Q95B 4POHA 5DV8A 2ZY0A 5E14A 5APHA 1PQ6A 3JZCA 4IW8A 4IVYA 5DKGA 3FUGA 2PIPL 4G2HA 4JYIA 2Q7LA 4J5XC 4S0TA 2VV1B 3O1EA 1FM9A 4G20A 4MGCA 4OIUA 3OSIA 1YYEA 2B50A 3FS1A 4IV4A 5HYRA 3HM1A 4P6WA 5AZVA 4MG9A 5DU5A 3TKCA 3FALB 2AMBA 3KYTA 1YJEA 2ZLCA 3VN2A 2ATHA 1SKXA 1XDKB 3QT0A 4OGHA 4PRGA 5L7HA 1Y0SA 3T03A 4OZTU 3R2AA 2PIQA 3KPZA 2J4AA 3OZ0A 5E0WA 5DZ0A 4N73A 4ONIA 2AXAA 3LMPA 2HC4A 2QZOB 2ZL9A 3UUAB 2ZLAA 2G0HA 4OH5A 3IPSA 5KRLA 5DYDA 3A2IA 3DY6A 3ADWA 1T76A 3DT3A 3UVVB 4OJ9A 5DWIA 4K6IA 4RUJA 1KKQA 1FCXA 2AX8A 2VV1A 4N1YA 4APUA 3AX8A 5AAVA 5DWLA 4MG8A 5AYGA 3P8XA 1H9UA 2GPPA 2H79A 2E2RA 4CI4A 1ERRA 1XJ7A 1ZKYA 3MNOA 1YY4A 3NSPA 5AAUA 3IPQA 3KWYA 2HVCA 3FALA 5DZIA 3VRWA 3DZYA 2ZK4A 1P8DA 1N46A 4XHDA 1PQ9A 4RUPA 5DIGA 3KMZA 3ET1A 2ACLA 2Z4JA 1R20D 2OZ7A 3OSWA 1DKFB 1TFCA 3G8IA 5DX3B 2JFAA 3ADVA 4LNXA 2Q6SA 3WT6A 1I7GA 2Q1HA 1XPCA 4KZJA 4PP3A 3VSPA 4FN9A 1HG4A 4NUFA 3UVVA 5JJMA 5FQSA 2REWA 4LTWA 3ET0A 1NQ7A 2A3IA 3ET3A 5DUHA 5GT4A 3X1HA 4WPFA 4OFRA 4PPPA 1M13A 3OLFA 2BJ4A 3GZ9A 3WTQA 2R6WA 1L2IA 1SJ0A 3F5CA 5DSHA 1YMTA 5DMFA 4DM8A 2ZVTA 2OM9A 2V7CA 3D5FA 4MG5A 4REEA 4A4WA 5DKEA 2AX9A 3K23A 3TKMA 5K13A 2Q1VA 2PIVA 5DZ3A 2QXSA 3E94A 3B68A 3DZUD 3HQ5A 3L3XA 1Y9RA 4O8FA 3ERDA 4PLEA 1OSVA 3K6PA 4JYGA 4ZNHA 1X76A 1ZAFA 4OEYA 2OCFA 5C4SA 3VRTA 2IOKA 3SP9A 2VV4A 3V4AA 2AYRA 1ILHA 2I4PA 3VT7A 1WM0X 5ICKA 4DORA 4DK8A 1E3GA 4E2JA 2ZNOA 3WJ4A 3KDUA 3WT5A 1XVPA 4OJ4A 5DYBA 3UU7B 2Q60A 3A3ZX 3RY9A 1G5YA 3UUDA 5HYKA 3AN4A 2QSEA 4NB6A 3E00D 3L03A 1R6GA 3L1BA 5FQTA 4IUIA 4OARA 2PRGA 1S0XA 4RUOX 3G8OA 3CQVA 4L96A 1S0ZA 3VT9A 3R5NA 5DWEA 4MG7A 1NQ0A 4RFWA 2POBA 4TUZA 4RE8A 2YJDA 4OILA 5E15A 1XQ3A 5DL4A 1RK3A 2QR9A 5E0XA 5HZCA 2XYWA 5KROA 1XV9B 3AUNA 2HASA 2PINA 2GPOA 1ZH7A 5M96A 1XZXX 4G1YA 4OIVA 2ZFXA 4X1FA 2XYXA 2P1TA 1YA3A 1FM9D 5DMCA 5DZHA 3VT6A 3VT3A 3R5MA 4XTAA 2F4BA 5DWJA 5DXPA 4XAOA 3UU7A 5JI0D 3HODA 2Q59B 1RDTA 4G2IA 4MGDB 3OGTA 3OS8C 3W5TA 1QKMA 4RMCA 2QXMA 2GL8A 3CLDA 4IV2A 3SP6A 3WGPA 1NHZA 2Z4BA 4J24A 3B65A 3E7CA 5KYAA 2OAXA 5KCDA 1GWQA 3DR1A 3A2HA 2G44A 5EJVA 4DMAA 1G1UA 2QGWA 5DTVA 1E3KA 4FHHA 4J5WA 2ZNPA 3RLLA 1PZLA 2FSZA 3AZ3A 3GBKA 3B66A 1EXAA 2O4RA 3R8IA 1FCYA 4EMAA 5GIEA 4G1ZA 2OUZA 3WWRA 1R1KA 2O9IA 4ZOMA 3VI8A 4DQMA 3A9EB 2ZK0A 3CS8A 1NQ2A 1LV2A 3DZYD 2ZK1A 3VT4A 2Q70A 4WHGA 5DXEA 2IOGA 4LSJA 2PNUA 3IMYA 3B1MA 5APKA 3UP3A 3R8AA 2QABA 2PIOA 3TX7B 1T7RA 4OFUA 5G3JA 3VRVA 1T7MA 4G1DA 3OMOA 3VTCA 5FQVA 5AVLA 1T73A 3AZ1A 5EC9A 3W5QA 4EM9A 3W0IA 5IZ0A 1OVLB 2LBDA 3KDTA 5DXKA 4ITFA 2V0VA 5H1EA 2XKWA 2ZASA 3G0WA 5KCUA 5DLRA 5DI7A 1FM6A 5KRJA 3VT5A 2H77A 1OSHA 3Q95A 4UDDA 1FD0A 5DXBB 4KZMA 4NQAB 3A9EA 2G0GA 2NV7A 4JGVA 4QJRA 3IA6A 1XP1A 3WFGA 2ZMJA 3L3ZA 4OC7A 2B1VA 2PIWA 1ILGA 1I38A 5DV3A 4S0SA 5DP0A 3W0YA 5ETHA 3B0RA 3GD2A 4OJBA 5A86A 3KFCA 5I4VA 5HJSA 3R29A 2QW4A 3A40X 1OVLA 3ERTA 2YLQA 1N83A 4IA3A 2NW4A 1XDKA 2JF9A 4MDDA 4JAZA 3VJTA 3WMHA 1UHLB 3HC6A 3OMMA 2Q5SA 1XNNA 4OKWA 3OMKA 4QK4A 5DXMA 2QZOA 3UUAA 1PK5A 1NYXA 1XAPA 1P93A 2ZK3A 4QE8A 4CSJA 1HJ1A 1X7BA 2R40A 2P15A 2QA8B 4J26A 2AO6A 5DRJA 4JYHA 1L2JA 3K8SA 1X7EA 1Z5XE 3B67A 1PQCA 1U9EA 4MGAB 5G43A 4A4VA 3S9SA 3VTDA 4WQPA 1Z95A 3SZ1A 3EYBA 1S19A 1LBDA 2B23A 4PF3A 4XI3A 3B0TA 1A52A 1PDUA 2Q5GA 2VV3A 4NIEA 4R2UA 4F9MA 4PWLA 3ADUA 5DV6A 5E1CA 4L98A 1MVCA 1DKFA 4RZEA 3KMRA 3PCUA 3PLZA 1FCZA 3UP0A 5DX3A 3WJ5A 4IW6A 1UOMA 3HC5A 5CJ6A 3D6DA 4A2JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DVC A;  3P89 A;  2IHQ A;  3AN3 A;  4PP5 A;  1MZN A;  1RDT D;  2Q5P A;  3VJI A;  4JL4 A;  3RLJ A;  4ZNS A;  3VTB A;  2I0G A;  4BCR A;  2Q8S A;  3W5P A;  3A78 A;  2ZK2 A;  2J7X A;  1T63 A;  4MGB B;  3H52 A;  5B5B A;  3VHU A;  5G46 A;  5DK9 A;  1RJK A;  4ZNV A;  3B5R A;  4REF A;  2P1U A;  1QKN A;  2GPV A;  3OKI A;  3RUU A;  1M7W A;  3ZQT A;  4S15 A;  2XHS A;  4ZO1 X;  5C4O A;  4XUH A;  3OSA A;  5DXR A;  5DVV A;  5G45 A;  5G5W A;  3CDP A;  3BC5 A;  5KRK A;  1YOW A;  5DXQ A;  2HAM A;  1N4H A;  1KNU A;  1R1K D;  1BSX A;  3W0J A;  1TXI A;  4N5G A;  1R20 A;  2G5O A;  3RUT A;  5KRC A;  2P54 A;  4OZR E;  1ZDU A;  3IPU A;  3FC6 B;  4PVU A;  5EI1 A;  2BAW A;  3B0W A;  4X1G A;  3DCT A;  4CI5 A;  4J5W C;  2PIT A;  2B1Z A;  3OS9 A;  1T5Z A;  5ACC A;  4IU7 A;  4M8H A;  3KMG A;  4Y29 A;  5SYZ A;  1GWX A;  1NAX A;  1ZUC A;  2Q6R A;  3VJH A;  2I4Z A;  3CDS A;  1QKU A;  3PEQ A;  1KV6 A;  4HLW A;  5GID A;  4ZI1 A;  4P6X A;  4Q0A C;  4G21 A;  2OVH A;  1FM6 D;  2AX7 A;  2AA2 A;  4PPS A;  2QA6 A;  1T74 A;  5DKB A;  3V3E A;  4OHA A;  4POJ A;  3G9E A;  4RWV A;  1X78 A;  1X7J A;  2YLO A;  3CS4 A;  1GS4 A;  3GWX A;  1XV9 A;  3ET2 A;  3HO0 A;  4PLD A;  5DWG A;  4YPQ A;  1PCG A;  2P7Z A;  2PIU A;  2QPY A;  1R5K A;  2Q3Y A;  1MV9 A;  1T7F A;  3F7D A;  1SQN A;  2NPA A;  2VV0 A;  4WVD A;  5FQP A;  4OH6 A;  4IS8 A;  2GPU A;  2Q59 A;  4MGD A;  3FEJ A;  2ZXM A;  3GN8 A;  1YIN A;  5AWJ A;  1K74 A;  5AWK A;  4IA1 A;  5G42 A;  4DK7 A;  3KBA A;  4RAK A;  3A2J A;  2PJL A;  5KCC A;  3L0J A;  2Q61 A;  4QE6 A;  2HAR A;  2EWP A;  2GP7 A;  2YAT A;  3FUR A;  2I0J A;  4KZI A;  3X36 A;  2QE4 A;  2HB8 A;  2ZK5 A;  2XYJ A;  3OLL A;  3WFF A;  2W8Y A;  3FXV A;  2R40 D;  2GIU A;  4B7W A;  2AX6 A;  1XP6 A;  3W0A A;  3VT8 A;  4ZN9 A;  5GIC A;  2QH6 A;  3H0A A;  3N00 A;  3W5R A;  1U3S A;  4ITE A;  3ADX A;  4IWC A;  2QGT A;  4IVW A;  3L0E A;  4LBD A;  4FHI A;  4DOS A;  5C4T A;  3CTB A;  5KR9 A;  4OED A;  5G44 A;  1NUO A;  3D24 A;  3OOF A;  4ZNT A;  4OKB A;  2YHD A;  1NDE A;  5E19 A;  2P1V A;  2P7G A;  3V9V A;  5AAV B;  4K7A A;  2HCD A;  4FNE A;  4MG8 B;  5KCE A;  4OLM A;  3FEI A;  2YFE A;  5JY3 A;  2J7Y A;  3LBD A;  1XIU A;  2ZBS A;  4PP6 A;  4IWF A;  3K22 A;  1IE8 A;  5DID A;  5FQR A;  3VHV A;  5DUG A;  3AZ2 A;  1UPV A;  1DB1 A;  3IXP A;  2YLP A;  2ACL B;  3M7R A;  5F9B A;  2AA7 A;  3BQD A;  3O1D A;  3W0G A;  2ZKC A;  2JFA B;  3V3Q A;  3PRG A;  5L7E A;  4OZT E;  4J5X A;  5EIT A;  2AA5 A;  4RMD A;  2ZNN A;  2AM9 A;  4OK1 A;  5DXB A;  1SR7 A;  3ADT A;  4ZJW A;  3OLS A;  5JJM B;  1Z5X U;  4OEZ A;  2I4J A;  4NY9 A;  1XP9 A;  3ILZ A;  3GWS X;  4ZJR A;  2BJ4 B;  5KD9 A;  3FLI A;  5DY8 A;  3F5C B;  3OMP A;  5IAW A;  4RZF A;  3PBA A;  3CWD A;  1ERE A;  5DIE A;  1EXX A;  2HB7 A;  3P88 A;  2VV2 A;  4S14 A;  2P7A A;  1XLS A;  1ZDT A;  3HVL A;  4UDB A;  5AVI A;  5HCV A;  1YP0 A;  1UPW A;  2HBH A;  1XNX A;  3RVF A;  3ZRA A;  1UHL A;  1RKH A;  2ABI A;  2PKL A;  1K4W A;  4OKT A;  3BEJ A;  3NSQ A;  3VRU A;  2QA8 A;  2GWX A;  2ZXN A;  2AB2 A;  2VV4 B;  5KRM A;  4Q13 A;  2Q7I A;  3DCU A;  5DZ1 A;  3AFR A;  4IA7 A;  5DRM A;  2YJA B;  2AAX A;  3P0U A;  4FGY A;  4MGA A;  5KRF A;  1U3Q A;  1VJB A;  2R6Y A;  2ZK6 A;  1XVP B;  4XLD A;  5DXG A;  4YNK A;  3CS6 A;  1A28 A;  3UUD B;  3U9Q A;  5AZT A;  4E4Q A;  3VSO A;  4R06 A;  2OVM A;  1FBY A;  1G50 A;  3ADS A;  4LNW A;  1XOW A;  2O4J A;  5C4U A;  5LWP A;  1T65 A;  2AA6 A;  1G2N A;  2HWR A;  2POG A;  2ZXZ A;  4MG7 B;  1OT7 A;  1RKG A;  1M2Z A;  2ZMI A;  4TUZ B;  1XLS E;  4XT9 A;  1ZEO A;  5DUE A;  5EGV A;  3V9Y A;  3X31 A;  3HLV A;  5E7V A;  3D57 A;  2GTK A;  4R6S A;  3WT7 A;  4OZR U;  1I37 A;  2ZMH A;  4DM6 A;  1IE9 A;  5KRI A;  4IQR A;  3MNP A;  4ZO1 B;  1K74 D;  4OKX A;  4XUM A;  1GWR A;  5KYJ A;  1NQ1 A;  1QKT A;  3OOK A;  1PRG A;  3OMQ A;  5KCW A;  1S9P A;  3UUC A;  4MGB A;  3JZB A;  3NOA A;  2QMV A;  4YMQ A;  3B3K A;  3B0Q A;  4PXM A;  4WHF A;  5APJ A;  3V49 A;  2Q7J A;  2NXX A;  1NAV A;  1YIM A;  3GYU A;  3ZR7 A;  1YUC A;  1ZGY A;  4ZN7 A;  2VST A;  3ZRB A;  4E4K A;  5EHJ A;  4QL8 A;  4RZG A;  3H0A D;  4UDC A;  3CJW A;  4K4J A;  1T7T A;  5L7G A;  5KCF A;  2P4Y A;  1NRL A;  5KRH A;  2QNV A;  5AK2 A;  4TV1 B;  3TY0 A;  3W0H A;  3GYT A;  3DZU A;  3FC6 A;  1S9Q A;  3OAP A;  1XQC A;  2Q6J A;  4N8R A;  4ZNU A;  3AUR A;  1Q4X A;  3VHW A;  5HJP B;  5KCT A;  1YOK A;  2ZNQ A;  3R8D A;  2FAI A;  3OZJ A;  5LGA A;  2Q7K A;  3AUQ A;  2VSR A;  4QM0 A;  4RME A;  2AWH A;  4IA2 A;  3HZF A;  5DKS A;  4UDA A;  4MG6 A;  1I7I A;  3D90 A;  1U3R A;  1X7R A;  3X1I A;  4M8E A;  3V9T A;  5B41 A;  1K7L A;  4ZNW A;  2JJ3 A;  3IXP D;  4OEA A;  3VJS A;  2PIR A;  3MNE A;  2NXX E;  2YLY A;  4Q50 A;  3L0L A;  5DVS A;  3W0C A;  5IXK A;  2QTU A;  2PIX A;  3E00 A;  3OKH A;  1T79 A;  4MG9 B;  4TV1 A;  5L11 A;  1Y0X X;  3PO9 A;  4HEE X;  5KRA A;  2J14 A;  2HWQ A;  4YT1 A;  4WLB A;  5HJP A;  2FVJ A;  3OS8 A;  2AMA A;  1XB7 A;  2HFP A;  3Q95 B;  4POH A;  5DV8 A;  2ZY0 A;  5E14 A;  5APH A;  1PQ6 A;  3JZC A;  4IW8 A;  4IVY A;  5DKG A;  3FUG A;  2PIP L;  4G2H A;  4JYI A;  2Q7L A;  4J5X C;  4S0T A;  2VV1 B;  3O1E A;  1FM9 A;  4G20 A;  4MGC A;  4OIU A;  3OSI A;  1YYE A;  2B50 A;  3FS1 A;  4IV4 A;  5HYR A;  3HM1 A;  4P6W A;  5AZV A;  4MG9 A;  5DU5 A;  3TKC A;  3FAL B;  2AMB A;  3KYT A;  1YJE A;  2ZLC A;  3VN2 A;  2ATH A;  1SKX A;  1XDK B;  3QT0 A;  4OGH A;  4PRG A;  5L7H A;  1Y0S A;  3T03 A;  4OZT U;  3R2A A;  2PIQ A;  3KPZ A;  2J4A A;  3OZ0 A;  5E0W A;  5DZ0 A;  4N73 A;  4ONI A;  2AXA A;  3LMP A;  2HC4 A;  2QZO B;  2ZL9 A;  3UUA B;  2ZLA A;  2G0H A;  4OH5 A;  3IPS A;  5KRL A;  5DYD A;  3A2I A;  3DY6 A;  3ADW A;  1T76 A;  3DT3 A;  3UVV B;  4OJ9 A;  5DWI A;  4K6I A;  4RUJ A;  1KKQ A;  1FCX A;  2AX8 A;  2VV1 A;  4N1Y A;  4APU A;  3AX8 A;  5AAV A;  5DWL A;  4MG8 A;  5AYG A;  3P8X A;  1H9U A;  2GPP A;  2H79 A;  2E2R A;  4CI4 A;  1ERR A;  1XJ7 A;  1ZKY A;  3MNO A;  1YY4 A;  3NSP A;  5AAU A;  3IPQ A;  3KWY A;  2HVC A;  3FAL A;  5DZI A;  3VRW A;  3DZY A;  2ZK4 A;  1P8D A;  1N46 A;  4XHD A;  1PQ9 A;  4RUP A;  5DIG A;  3KMZ A;  3ET1 A;  2ACL A;  2Z4J A;  1R20 D;  2OZ7 A;  3OSW A;  1DKF B;  1TFC A;  3G8I A;  5DX3 B;  2JFA A;  3ADV A;  4LNX A;  2Q6S A;  3WT6 A;  1I7G A;  2Q1H A;  1XPC A;  4KZJ A;  4PP3 A;  3VSP A;  4FN9 A;  1HG4 A;  4NUF A;  3UVV A;  5JJM A;  5FQS A;  2REW A;  4LTW A;  3ET0 A;  1NQ7 A;  2A3I A;  3ET3 A;  5DUH A;  5GT4 A;  3X1H A;  4WPF A;  4OFR A;  4PPP A;  1M13 A;  3OLF A;  2BJ4 A;  3GZ9 A;  3WTQ A;  2R6W A;  1L2I A;  1SJ0 A;  3F5C A;  5DSH A;  1YMT A;  5DMF A;  4DM8 A;  2ZVT A;  2OM9 A;  2V7C A;  3D5F A;  4MG5 A;  4REE A;  4A4W A;  5DKE A;  2AX9 A;  3K23 A;  3TKM A;  5K13 A;  2Q1V A;  2PIV A;  5DZ3 A;  2QXS A;  3E94 A;  3B68 A;  3DZU D;  3HQ5 A;  3L3X A;  1Y9R A;  4O8F A;  3ERD A;  4PLE A;  1OSV A;  3K6P A;  4JYG A;  4ZNH A;  1X76 A;  1ZAF A;  4OEY A;  2OCF A;  5C4S A;  3VRT A;  2IOK A;  3SP9 A;  2VV4 A;  3V4A A;  2AYR A;  1ILH A;  2I4P A;  3VT7 A;  1WM0 X;  5ICK A;  4DOR A;  4DK8 A;  1E3G A;  4E2J A;  2ZNO A;  3WJ4 A;  3KDU A;  3WT5 A;  1XVP A;  4OJ4 A;  5DYB A;  3UU7 B;  2Q60 A;  3A3Z X;  3RY9 A;  1G5Y A;  3UUD A;  5HYK A;  3AN4 A;  2QSE A;  4NB6 A;  3E00 D;  3L03 A;  1R6G A;  3L1B A;  5FQT A;  4IUI A;  4OAR A;  2PRG A;  1S0X A;  4RUO X;  3G8O A;  3CQV A;  4L96 A;  1S0Z A;  3VT9 A;  3R5N A;  5DWE A;  4MG7 A;  1NQ0 A;  4RFW A;  2POB A;  4TUZ A;  4RE8 A;  2YJD A;  4OIL A;  5E15 A;  1XQ3 A;  5DL4 A;  1RK3 A;  2QR9 A;  5E0X A;  5HZC A;  2XYW A;  5KRO A;  1XV9 B;  3AUN A;  2HAS A;  2PIN A;  2GPO A;  1ZH7 A;  5M96 A;  1XZX X;  4G1Y A;  4OIV A;  2ZFX A;  4X1F A;  2XYX A;  2P1T A;  1YA3 A;  1FM9 D;  5DMC A;  5DZH A;  3VT6 A;  3VT3 A;  3R5M A;  4XTA A;  2F4B A;  5DWJ A;  5DXP A;  4XAO A;  3UU7 A;  5JI0 D;  3HOD A;  2Q59 B;  1RDT A;  4G2I A;  4MGD B;  3OGT A;  3OS8 C;  3W5T A;  1QKM A;  4RMC A;  2QXM A;  2GL8 A;  3CLD A;  4IV2 A;  3SP6 A;  3WGP A;  1NHZ A;  2Z4B A;  4J24 A;  3B65 A;  3E7C A;  5KYA A;  2OAX A;  5KCD A;  1GWQ A;  3DR1 A;  3A2H A;  2G44 A;  5EJV A;  4DMA A;  1G1U A;  2QGW A;  5DTV A;  1E3K A;  4FHH A;  4J5W A;  2ZNP A;  3RLL A;  1PZL A;  2FSZ A;  3AZ3 A;  3GBK A;  3B66 A;  1EXA A;  2O4R A;  3R8I A;  1FCY A;  4EMA A;  5GIE A;  4G1Z A;  2OUZ A;  3WWR A;  1R1K A;  2O9I A;  4ZOM A;  3VI8 A;  4DQM A;  3A9E B;  2ZK0 A;  3CS8 A;  1NQ2 A;  1LV2 A;  3DZY D;  2ZK1 A;  3VT4 A;  2Q70 A;  4WHG A;  5DXE A;  2IOG A;  4LSJ A;  2PNU A;  3IMY A;  3B1M A;  5APK A;  3UP3 A;  3R8A A;  2QAB A;  2PIO A;  3TX7 B;  1T7R A;  4OFU A;  5G3J A;  3VRV A;  1T7M A;  4G1D A;  3OMO A;  3VTC A;  5FQV A;  5AVL A;  1T73 A;  3AZ1 A;  5EC9 A;  3W5Q A;  4EM9 A;  3W0I A;  5IZ0 A;  1OVL B;  2LBD A;  3KDT A;  5DXK A;  4ITF A;  2V0V A;  5H1E A;  2XKW A;  2ZAS A;  3G0W A;  5KCU A;  5DLR A;  5DI7 A;  1FM6 A;  5KRJ A;  3VT5 A;  2H77 A;  1OSH A;  3Q95 A;  4UDD A;  1FD0 A;  5DXB B;  4KZM A;  4NQA B;  3A9E A;  2G0G A;  2NV7 A;  4JGV A;  4QJR A;  3IA6 A;  1XP1 A;  3WFG A;  2ZMJ A;  3L3Z A;  4OC7 A;  2B1V A;  2PIW A;  1ILG A;  1I38 A;  5DV3 A;  4S0S A;  5DP0 A;  3W0Y A;  5ETH A;  3B0R A;  3GD2 A;  4OJB A;  5A86 A;  3KFC A;  5I4V A;  5HJS A;  3R29 A;  2QW4 A;  3A40 X;  1OVL A;  3ERT A;  2YLQ A;  1N83 A;  4IA3 A;  2NW4 A;  1XDK A;  2JF9 A;  4MDD A;  4JAZ A;  3VJT A;  3WMH A;  1UHL B;  3HC6 A;  3OMM A;  2Q5S A;  1XNN A;  4OKW A;  3OMK A;  4QK4 A;  5DXM A;  2QZO A;  3UUA A;  1PK5 A;  1NYX A;  1XAP A;  1P93 A;  2ZK3 A;  4QE8 A;  4CSJ A;  1HJ1 A;  1X7B A;  2R40 A;  2P15 A;  2QA8 B;  4J26 A;  2AO6 A;  5DRJ A;  4JYH A;  1L2J A;  3K8S A;  1X7E A;  1Z5X E;  3B67 A;  1PQC A;  1U9E A;  4MGA B;  5G43 A;  4A4V A;  3S9S A;  3VTD A;  4WQP A;  1Z95 A;  3SZ1 A;  3EYB A;  1S19 A;  1LBD A;  2B23 A;  4PF3 A;  4XI3 A;  3B0T A;  1A52 A;  1PDU A;  2Q5G A;  2VV3 A;  4NIE A;  4R2U A;  4F9M A;  4PWL A;  3ADU A;  5DV6 A;  5E1C A;  4L98 A;  1MVC A;  1DKF A;  4RZE A;  3KMR A;  3PCU A;  3PLZ A;  1FCZ A;  3UP0 A;  5DX3 A;  3WJ5 A;  4IW6 A;  1UOM A;  3HC5 A;  5CJ6 A;  3D6D A;  4A2J A; 
#chains in the Genus database with same CATH topology
 5DVC A;  3P89 A;  2IHQ A;  3AN3 A;  4PP5 A;  1MZN A;  1RDT D;  2Q5P A;  3VJI A;  4JL4 A;  3RLJ A;  4ZNS A;  3VTB A;  2I0G A;  4BCR A;  2Q8S A;  3W5P A;  3A78 A;  2ZK2 A;  2J7X A;  1T63 A;  4MGB B;  3H52 A;  5B5B A;  3VHU A;  5G46 A;  5DK9 A;  1RJK A;  4ZNV A;  3B5R A;  4REF A;  2P1U A;  1QKN A;  2GPV A;  3OKI A;  3RUU A;  1M7W A;  3ZQT A;  4S15 A;  2XHS A;  4ZO1 X;  5C4O A;  4XUH A;  3OSA A;  5DXR A;  5DVV A;  5G45 A;  5G5W A;  3CDP A;  3BC5 A;  5KRK A;  1YOW A;  5DXQ A;  2HAM A;  1N4H A;  1KNU A;  1R1K D;  1BSX A;  3W0J A;  1TXI A;  4N5G A;  1R20 A;  2G5O A;  3RUT A;  5KRC A;  2P54 A;  4OZR E;  1ZDU A;  3IPU A;  3FC6 B;  4PVU A;  5EI1 A;  2BAW A;  3B0W A;  4X1G A;  3DCT A;  4CI5 A;  4J5W C;  2PIT A;  2B1Z A;  3OS9 A;  1T5Z A;  5ACC A;  4IU7 A;  4M8H A;  3KMG A;  4Y29 A;  5SYZ A;  1GWX A;  1NAX A;  1ZUC A;  2Q6R A;  3VJH A;  2I4Z A;  3CDS A;  1QKU A;  3PEQ A;  1KV6 A;  4HLW A;  5GID A;  4ZI1 A;  4P6X A;  4Q0A C;  4G21 A;  2OVH A;  1FM6 D;  2AX7 A;  2AA2 A;  4PPS A;  2QA6 A;  1T74 A;  5DKB A;  3V3E A;  4OHA A;  4POJ A;  3G9E A;  4RWV A;  1X78 A;  1X7J A;  2YLO A;  3CS4 A;  1GS4 A;  3GWX A;  1XV9 A;  3ET2 A;  3HO0 A;  4PLD A;  5DWG A;  4YPQ A;  1PCG A;  2P7Z A;  2PIU A;  2QPY A;  1R5K A;  2Q3Y A;  1MV9 A;  1T7F A;  3F7D A;  1SQN A;  2NPA A;  2VV0 A;  4WVD A;  5FQP A;  4OH6 A;  4IS8 A;  2GPU A;  2Q59 A;  4MGD A;  3FEJ A;  2ZXM A;  3GN8 A;  1YIN A;  5AWJ A;  1K74 A;  5AWK A;  4IA1 A;  5G42 A;  4DK7 A;  3KBA A;  4RAK A;  3A2J A;  2PJL A;  5KCC A;  3L0J A;  2Q61 A;  4QE6 A;  2HAR A;  2EWP A;  2GP7 A;  2YAT A;  3FUR A;  2I0J A;  4KZI A;  3X36 A;  2QE4 A;  2HB8 A;  2ZK5 A;  2XYJ A;  3OLL A;  3WFF A;  2W8Y A;  3FXV A;  2R40 D;  2GIU A;  4B7W A;  2AX6 A;  1XP6 A;  3W0A A;  3VT8 A;  4ZN9 A;  5GIC A;  2QH6 A;  3H0A A;  3N00 A;  3W5R A;  1U3S A;  4ITE A;  3ADX A;  4IWC A;  2QGT A;  4IVW A;  3L0E A;  4LBD A;  4FHI A;  4DOS A;  5C4T A;  3CTB A;  5KR9 A;  4OED A;  5G44 A;  1NUO A;  3D24 A;  3OOF A;  4ZNT A;  4OKB A;  2YHD A;  1NDE A;  5E19 A;  2P1V A;  2P7G A;  3V9V A;  5AAV B;  4K7A A;  2HCD A;  4FNE A;  4MG8 B;  5KCE A;  4OLM A;  3FEI A;  2YFE A;  5JY3 A;  2J7Y A;  3LBD A;  1XIU A;  2ZBS A;  4PP6 A;  4IWF A;  3K22 A;  1IE8 A;  5DID A;  5FQR A;  3VHV A;  5DUG A;  3AZ2 A;  1UPV A;  1DB1 A;  3IXP A;  2YLP A;  2ACL B;  3M7R A;  5F9B A;  2AA7 A;  3BQD A;  3O1D A;  3W0G A;  2ZKC A;  2JFA B;  3V3Q A;  3PRG A;  5L7E A;  4OZT E;  4J5X A;  5EIT A;  2AA5 A;  4RMD A;  2ZNN A;  2AM9 A;  4OK1 A;  5DXB A;  1SR7 A;  3ADT A;  4ZJW A;  3OLS A;  5JJM B;  1Z5X U;  4OEZ A;  2I4J A;  4NY9 A;  1XP9 A;  3ILZ A;  3GWS X;  4ZJR A;  2BJ4 B;  5KD9 A;  3FLI A;  5DY8 A;  3F5C B;  3OMP A;  5IAW A;  4RZF A;  3PBA A;  3CWD A;  1ERE A;  5DIE A;  1EXX A;  2HB7 A;  3P88 A;  2VV2 A;  4S14 A;  2P7A A;  1XLS A;  1ZDT A;  3HVL A;  4UDB A;  5AVI A;  5HCV A;  1YP0 A;  1UPW A;  2HBH A;  1XNX A;  3RVF A;  3ZRA A;  1UHL A;  1RKH A;  2ABI A;  2PKL A;  1K4W A;  4OKT A;  3BEJ A;  3NSQ A;  3VRU A;  2QA8 A;  2GWX A;  2ZXN A;  2AB2 A;  2VV4 B;  5KRM A;  4Q13 A;  2Q7I A;  3DCU A;  5DZ1 A;  3AFR A;  4IA7 A;  5DRM A;  2YJA B;  2AAX A;  3P0U A;  4FGY A;  4MGA A;  5KRF A;  1U3Q A;  1VJB A;  2R6Y A;  2ZK6 A;  1XVP B;  4XLD A;  5DXG A;  4YNK A;  3CS6 A;  1A28 A;  3UUD B;  3U9Q A;  5AZT A;  4E4Q A;  3VSO A;  4R06 A;  2OVM A;  1FBY A;  1G50 A;  3ADS A;  4LNW A;  1XOW A;  2O4J A;  5C4U A;  5LWP A;  1T65 A;  2AA6 A;  1G2N A;  2HWR A;  2POG A;  2ZXZ A;  4MG7 B;  1OT7 A;  1RKG A;  1M2Z A;  2ZMI A;  4TUZ B;  1XLS E;  4XT9 A;  1ZEO A;  5DUE A;  5EGV A;  3V9Y A;  3X31 A;  3HLV A;  5E7V A;  3D57 A;  2GTK A;  4R6S A;  3WT7 A;  4OZR U;  1I37 A;  2ZMH A;  4DM6 A;  1IE9 A;  5KRI A;  4IQR A;  3MNP A;  4ZO1 B;  1K74 D;  4OKX A;  4XUM A;  1GWR A;  5KYJ A;  1NQ1 A;  1QKT A;  3OOK A;  1PRG A;  3OMQ A;  5KCW A;  1S9P A;  3UUC A;  4MGB A;  3JZB A;  3NOA A;  2QMV A;  4YMQ A;  3B3K A;  3B0Q A;  4PXM A;  4WHF A;  5APJ A;  3V49 A;  2Q7J A;  2NXX A;  1NAV A;  1YIM A;  3GYU A;  3ZR7 A;  1YUC A;  1ZGY A;  4ZN7 A;  2VST A;  3ZRB A;  4E4K A;  5EHJ A;  4QL8 A;  4RZG A;  3H0A D;  4UDC A;  3CJW A;  4K4J A;  1T7T A;  5L7G A;  5KCF A;  2P4Y A;  1NRL A;  5KRH A;  2QNV A;  5AK2 A;  4TV1 B;  3TY0 A;  3W0H A;  3GYT A;  3DZU A;  3FC6 A;  1S9Q A;  3OAP A;  1XQC A;  2Q6J A;  4N8R A;  4ZNU A;  3AUR A;  1Q4X A;  3VHW A;  5HJP B;  5KCT A;  1YOK A;  2ZNQ A;  3R8D A;  2FAI A;  3OZJ A;  5LGA A;  2Q7K A;  3AUQ A;  2VSR A;  4QM0 A;  4RME A;  2AWH A;  4IA2 A;  3HZF A;  5DKS A;  4UDA A;  4MG6 A;  1I7I A;  3D90 A;  1U3R A;  1X7R A;  3X1I A;  4M8E A;  3V9T A;  5B41 A;  1K7L A;  4ZNW A;  2JJ3 A;  3IXP D;  4OEA A;  3VJS A;  2PIR A;  3MNE A;  2NXX E;  2YLY A;  4Q50 A;  3L0L A;  5DVS A;  3W0C A;  5IXK A;  2QTU A;  2PIX A;  3E00 A;  3OKH A;  1T79 A;  4MG9 B;  4TV1 A;  5L11 A;  1Y0X X;  3PO9 A;  4HEE X;  5KRA A;  2J14 A;  2HWQ A;  4YT1 A;  4WLB A;  5HJP A;  2FVJ A;  3OS8 A;  2AMA A;  1XB7 A;  2HFP A;  3Q95 B;  4POH A;  5DV8 A;  2ZY0 A;  5E14 A;  5APH A;  1PQ6 A;  3JZC A;  4IW8 A;  4IVY A;  5DKG A;  3FUG A;  2PIP L;  4G2H A;  4JYI A;  2Q7L A;  4J5X C;  4S0T A;  2VV1 B;  3O1E A;  1FM9 A;  4G20 A;  4MGC A;  4OIU A;  3OSI A;  1YYE A;  2B50 A;  3FS1 A;  4IV4 A;  5HYR A;  3HM1 A;  4P6W A;  5AZV A;  4MG9 A;  5DU5 A;  3TKC A;  3FAL B;  2AMB A;  3KYT A;  1YJE A;  2ZLC A;  3VN2 A;  2ATH A;  1SKX A;  1XDK B;  3QT0 A;  4OGH A;  4PRG A;  5L7H A;  1Y0S A;  3T03 A;  4OZT U;  3R2A A;  2PIQ A;  3KPZ A;  2J4A A;  3OZ0 A;  5E0W A;  5DZ0 A;  4N73 A;  4ONI A;  2AXA A;  3LMP A;  2HC4 A;  2QZO B;  2ZL9 A;  3UUA B;  2ZLA A;  2G0H A;  4OH5 A;  3IPS A;  5KRL A;  5DYD A;  3A2I A;  3DY6 A;  3ADW A;  1T76 A;  3DT3 A;  3UVV B;  4OJ9 A;  5DWI A;  4K6I A;  4RUJ A;  1KKQ A;  1FCX A;  2AX8 A;  2VV1 A;  4N1Y A;  4APU A;  3AX8 A;  5AAV A;  5DWL A;  4MG8 A;  5AYG A;  3P8X A;  1H9U A;  2GPP A;  2H79 A;  2E2R A;  4CI4 A;  1ERR A;  1XJ7 A;  1ZKY A;  3MNO A;  1YY4 A;  3NSP A;  5AAU A;  3IPQ A;  3KWY A;  2HVC A;  3FAL A;  5DZI A;  3VRW A;  3DZY A;  2ZK4 A;  1P8D A;  1N46 A;  4XHD A;  1PQ9 A;  4RUP A;  5DIG A;  3KMZ A;  3ET1 A;  2ACL A;  2Z4J A;  1R20 D;  2OZ7 A;  3OSW A;  1DKF B;  1TFC A;  3G8I A;  5DX3 B;  2JFA A;  3ADV A;  4LNX A;  2Q6S A;  3WT6 A;  1I7G A;  2Q1H A;  1XPC A;  4KZJ A;  4PP3 A;  3VSP A;  4FN9 A;  1HG4 A;  4NUF A;  3UVV A;  5JJM A;  5FQS A;  2REW A;  4LTW A;  3ET0 A;  1NQ7 A;  2A3I A;  3ET3 A;  5DUH A;  5GT4 A;  3X1H A;  4WPF A;  4OFR A;  4PPP A;  1M13 A;  3OLF A;  2BJ4 A;  3GZ9 A;  3WTQ A;  2R6W A;  1L2I A;  1SJ0 A;  3F5C A;  5DSH A;  1YMT A;  5DMF A;  4DM8 A;  2ZVT A;  2OM9 A;  2V7C A;  3D5F A;  4MG5 A;  4REE A;  4A4W A;  5DKE A;  2AX9 A;  3K23 A;  3TKM A;  5K13 A;  2Q1V A;  2PIV A;  5DZ3 A;  2QXS A;  3E94 A;  3B68 A;  3DZU D;  3HQ5 A;  3L3X A;  1Y9R A;  4O8F A;  3ERD A;  4PLE A;  1OSV A;  3K6P A;  4JYG A;  4ZNH A;  1X76 A;  1ZAF A;  4OEY A;  2OCF A;  5C4S A;  3VRT A;  2IOK A;  3SP9 A;  2VV4 A;  3V4A A;  2AYR A;  1ILH A;  2I4P A;  3VT7 A;  1WM0 X;  5ICK A;  4DOR A;  4DK8 A;  1E3G A;  4E2J A;  2ZNO A;  3WJ4 A;  3KDU A;  3WT5 A;  1XVP A;  4OJ4 A;  5DYB A;  3UU7 B;  2Q60 A;  3A3Z X;  3RY9 A;  1G5Y A;  3UUD A;  5HYK A;  3AN4 A;  2QSE A;  4NB6 A;  3E00 D;  3L03 A;  1R6G A;  3L1B A;  5FQT A;  4IUI A;  4OAR A;  2PRG A;  1S0X A;  4RUO X;  3G8O A;  3CQV A;  4L96 A;  1S0Z A;  3VT9 A;  3R5N A;  5DWE A;  4MG7 A;  1NQ0 A;  4RFW A;  2POB A;  4TUZ A;  4RE8 A;  2YJD A;  4OIL A;  5E15 A;  1XQ3 A;  5DL4 A;  1RK3 A;  2QR9 A;  5E0X A;  5HZC A;  2XYW A;  5KRO A;  1XV9 B;  3AUN A;  2HAS A;  2PIN A;  2GPO A;  1ZH7 A;  5M96 A;  1XZX X;  4G1Y A;  4OIV A;  2ZFX A;  4X1F A;  2XYX A;  2P1T A;  1YA3 A;  1FM9 D;  5DMC A;  5DZH A;  3VT6 A;  3VT3 A;  3R5M A;  4XTA A;  2F4B A;  5DWJ A;  5DXP A;  4XAO A;  3UU7 A;  5JI0 D;  3HOD A;  2Q59 B;  1RDT A;  4G2I A;  4MGD B;  3OGT A;  3OS8 C;  3W5T A;  1QKM A;  4RMC A;  2QXM A;  2GL8 A;  3CLD A;  4IV2 A;  3SP6 A;  3WGP A;  1NHZ A;  2Z4B A;  4J24 A;  3B65 A;  3E7C A;  5KYA A;  2OAX A;  5KCD A;  1GWQ A;  3DR1 A;  3A2H A;  2G44 A;  5EJV A;  4DMA A;  1G1U A;  2QGW A;  5DTV A;  1E3K A;  4FHH A;  4J5W A;  2ZNP A;  3RLL A;  1PZL A;  2FSZ A;  3AZ3 A;  3GBK A;  3B66 A;  1EXA A;  2O4R A;  3R8I A;  1FCY A;  4EMA A;  5GIE A;  4G1Z A;  2OUZ A;  3WWR A;  1R1K A;  2O9I A;  4ZOM A;  3VI8 A;  4DQM A;  3A9E B;  2ZK0 A;  3CS8 A;  1NQ2 A;  1LV2 A;  3DZY D;  2ZK1 A;  3VT4 A;  2Q70 A;  4WHG A;  5DXE A;  2IOG A;  4LSJ A;  2PNU A;  3IMY A;  3B1M A;  5APK A;  3UP3 A;  3R8A A;  2QAB A;  2PIO A;  3TX7 B;  1T7R A;  4OFU A;  5G3J A;  3VRV A;  1T7M A;  4G1D A;  3OMO A;  3VTC A;  5FQV A;  5AVL A;  1T73 A;  3AZ1 A;  5EC9 A;  3W5Q A;  4EM9 A;  3W0I A;  5IZ0 A;  1OVL B;  2LBD A;  3KDT A;  5DXK A;  4ITF A;  2V0V A;  5H1E A;  2XKW A;  2ZAS A;  3G0W A;  5KCU A;  5DLR A;  5DI7 A;  1FM6 A;  5KRJ A;  3VT5 A;  2H77 A;  1OSH A;  3Q95 A;  4UDD A;  1FD0 A;  5DXB B;  4KZM A;  4NQA B;  3A9E A;  2G0G A;  2NV7 A;  4JGV A;  4QJR A;  3IA6 A;  1XP1 A;  3WFG A;  2ZMJ A;  3L3Z A;  4OC7 A;  2B1V A;  2PIW A;  1ILG A;  1I38 A;  5DV3 A;  4S0S A;  5DP0 A;  3W0Y A;  5ETH A;  3B0R A;  3GD2 A;  4OJB A;  5A86 A;  3KFC A;  5I4V A;  5HJS A;  3R29 A;  2QW4 A;  3A40 X;  1OVL A;  3ERT A;  2YLQ A;  1N83 A;  4IA3 A;  2NW4 A;  1XDK A;  2JF9 A;  4MDD A;  4JAZ A;  3VJT A;  3WMH A;  1UHL B;  3HC6 A;  3OMM A;  2Q5S A;  1XNN A;  4OKW A;  3OMK A;  4QK4 A;  5DXM A;  2QZO A;  3UUA A;  1PK5 A;  1NYX A;  1XAP A;  1P93 A;  2ZK3 A;  4QE8 A;  4CSJ A;  1HJ1 A;  1X7B A;  2R40 A;  2P15 A;  2QA8 B;  4J26 A;  2AO6 A;  5DRJ A;  4JYH A;  1L2J A;  3K8S A;  1X7E A;  1Z5X E;  3B67 A;  1PQC A;  1U9E A;  4MGA B;  5G43 A;  4A4V A;  3S9S A;  3VTD A;  4WQP A;  1Z95 A;  3SZ1 A;  3EYB A;  1S19 A;  1LBD A;  2B23 A;  4PF3 A;  4XI3 A;  3B0T A;  1A52 A;  1PDU A;  2Q5G A;  2VV3 A;  4NIE A;  4R2U A;  4F9M A;  4PWL A;  3ADU A;  5DV6 A;  5E1C A;  4L98 A;  1MVC A;  1DKF A;  4RZE A;  3KMR A;  3PCU A;  3PLZ A;  1FCZ A;  3UP0 A;  5DX3 A;  3WJ5 A;  4IW6 A;  1UOM A;  3HC5 A;  5CJ6 A;  3D6D A;  4A2J A; 
#chains in the Genus database with same CATH homology
 5DVC A;  3P89 A;  2IHQ A;  3AN3 A;  4PP5 A;  1MZN A;  1RDT D;  2Q5P A;  3VJI A;  4JL4 A;  3RLJ A;  4ZNS A;  3VTB A;  2I0G A;  4BCR A;  2Q8S A;  3W5P A;  3A78 A;  2ZK2 A;  2J7X A;  1T63 A;  4MGB B;  3H52 A;  5B5B A;  3VHU A;  5G46 A;  5DK9 A;  1RJK A;  4ZNV A;  3B5R A;  4REF A;  2P1U A;  1QKN A;  2GPV A;  3OKI A;  3RUU A;  1M7W A;  3ZQT A;  4S15 A;  2XHS A;  4ZO1 X;  5C4O A;  4XUH A;  3OSA A;  5DXR A;  5DVV A;  5G45 A;  5G5W A;  3CDP A;  3BC5 A;  5KRK A;  1YOW A;  5DXQ A;  2HAM A;  1N4H A;  1KNU A;  1R1K D;  1BSX A;  3W0J A;  1TXI A;  4N5G A;  1R20 A;  2G5O A;  3RUT A;  5KRC A;  2P54 A;  4OZR E;  1ZDU A;  3IPU A;  3FC6 B;  4PVU A;  5EI1 A;  2BAW A;  3B0W A;  4X1G A;  3DCT A;  4CI5 A;  4J5W C;  2PIT A;  2B1Z A;  3OS9 A;  1T5Z A;  5ACC A;  4IU7 A;  4M8H A;  3KMG A;  4Y29 A;  5SYZ A;  1GWX A;  1NAX A;  1ZUC A;  2Q6R A;  3VJH A;  2I4Z A;  3CDS A;  1QKU A;  3PEQ A;  1KV6 A;  4HLW A;  5GID A;  4ZI1 A;  4P6X A;  4Q0A C;  4G21 A;  2OVH A;  1FM6 D;  2AX7 A;  2AA2 A;  4PPS A;  2QA6 A;  1T74 A;  5DKB A;  3V3E A;  4OHA A;  4POJ A;  3G9E A;  4RWV A;  1X78 A;  1X7J A;  2YLO A;  3CS4 A;  1GS4 A;  3GWX A;  1XV9 A;  3ET2 A;  3HO0 A;  4PLD A;  5DWG A;  4YPQ A;  1PCG A;  2P7Z A;  2PIU A;  2QPY A;  1R5K A;  2Q3Y A;  1MV9 A;  1T7F A;  3F7D A;  1SQN A;  2NPA A;  2VV0 A;  4WVD A;  5FQP A;  4OH6 A;  4IS8 A;  2GPU A;  2Q59 A;  4MGD A;  3FEJ A;  2ZXM A;  3GN8 A;  1YIN A;  5AWJ A;  1K74 A;  5AWK A;  4IA1 A;  5G42 A;  4DK7 A;  3KBA A;  4RAK A;  3A2J A;  2PJL A;  5KCC A;  3L0J A;  2Q61 A;  4QE6 A;  2HAR A;  2EWP A;  2GP7 A;  2YAT A;  3FUR A;  2I0J A;  4KZI A;  3X36 A;  2QE4 A;  2HB8 A;  2ZK5 A;  2XYJ A;  3OLL A;  3WFF A;  2W8Y A;  3FXV A;  2R40 D;  2GIU A;  4B7W A;  2AX6 A;  1XP6 A;  3W0A A;  3VT8 A;  4ZN9 A;  5GIC A;  2QH6 A;  3H0A A;  3N00 A;  3W5R A;  1U3S A;  4ITE A;  3ADX A;  4IWC A;  2QGT A;  4IVW A;  3L0E A;  4LBD A;  4FHI A;  4DOS A;  5C4T A;  3CTB A;  5KR9 A;  4OED A;  5G44 A;  1NUO A;  3D24 A;  3OOF A;  4ZNT A;  4OKB A;  2YHD A;  1NDE A;  5E19 A;  2P1V A;  2P7G A;  3V9V A;  5AAV B;  4K7A A;  2HCD A;  4FNE A;  4MG8 B;  5KCE A;  4OLM A;  3FEI A;  2YFE A;  5JY3 A;  2J7Y A;  3LBD A;  1XIU A;  2ZBS A;  4PP6 A;  4IWF A;  3K22 A;  1IE8 A;  5DID A;  5FQR A;  3VHV A;  5DUG A;  3AZ2 A;  1UPV A;  1DB1 A;  3IXP A;  2YLP A;  2ACL B;  3M7R A;  5F9B A;  2AA7 A;  3BQD A;  3O1D A;  3W0G A;  2ZKC A;  2JFA B;  3V3Q A;  3PRG A;  5L7E A;  4OZT E;  4J5X A;  5EIT A;  2AA5 A;  4RMD A;  2ZNN A;  2AM9 A;  4OK1 A;  5DXB A;  1SR7 A;  3ADT A;  4ZJW A;  3OLS A;  5JJM B;  1Z5X U;  4OEZ A;  2I4J A;  4NY9 A;  1XP9 A;  3ILZ A;  3GWS X;  4ZJR A;  2BJ4 B;  5KD9 A;  3FLI A;  5DY8 A;  3F5C B;  3OMP A;  5IAW A;  4RZF A;  3PBA A;  3CWD A;  1ERE A;  5DIE A;  1EXX A;  2HB7 A;  3P88 A;  2VV2 A;  4S14 A;  2P7A A;  1XLS A;  1ZDT A;  3HVL A;  4UDB A;  5AVI A;  5HCV A;  1YP0 A;  1UPW A;  2HBH A;  1XNX A;  3RVF A;  3ZRA A;  1UHL A;  1RKH A;  2ABI A;  2PKL A;  1K4W A;  4OKT A;  3BEJ A;  3NSQ A;  3VRU A;  2QA8 A;  2GWX A;  2ZXN A;  2AB2 A;  2VV4 B;  5KRM A;  4Q13 A;  2Q7I A;  3DCU A;  5DZ1 A;  3AFR A;  4IA7 A;  5DRM A;  2YJA B;  2AAX A;  3P0U A;  4FGY A;  4MGA A;  5KRF A;  1U3Q A;  1VJB A;  2R6Y A;  2ZK6 A;  1XVP B;  4XLD A;  5DXG A;  4YNK A;  3CS6 A;  1A28 A;  3UUD B;  3U9Q A;  5AZT A;  4E4Q A;  3VSO A;  4R06 A;  2OVM A;  1FBY A;  1G50 A;  3ADS A;  4LNW A;  1XOW A;  2O4J A;  5C4U A;  5LWP A;  1T65 A;  2AA6 A;  1G2N A;  2HWR A;  2POG A;  2ZXZ A;  4MG7 B;  1OT7 A;  1RKG A;  1M2Z A;  2ZMI A;  4TUZ B;  1XLS E;  4XT9 A;  1ZEO A;  5DUE A;  5EGV A;  3V9Y A;  3X31 A;  3HLV A;  5E7V A;  3D57 A;  2GTK A;  4R6S A;  3WT7 A;  4OZR U;  1I37 A;  2ZMH A;  4DM6 A;  1IE9 A;  5KRI A;  4IQR A;  3MNP A;  4ZO1 B;  1K74 D;  4OKX A;  4XUM A;  1GWR A;  5KYJ A;  1NQ1 A;  1QKT A;  3OOK A;  1PRG A;  3OMQ A;  5KCW A;  1S9P A;  3UUC A;  4MGB A;  3JZB A;  3NOA A;  2QMV A;  4YMQ A;  3B3K A;  3B0Q A;  4PXM A;  4WHF A;  5APJ A;  3V49 A;  2Q7J A;  2NXX A;  1NAV A;  1YIM A;  3GYU A;  3ZR7 A;  1YUC A;  1ZGY A;  4ZN7 A;  2VST A;  3ZRB A;  4E4K A;  5EHJ A;  4QL8 A;  4RZG A;  3H0A D;  4UDC A;  3CJW A;  4K4J A;  1T7T A;  5L7G A;  5KCF A;  2P4Y A;  1NRL A;  5KRH A;  2QNV A;  5AK2 A;  4TV1 B;  3TY0 A;  3W0H A;  3GYT A;  3DZU A;  3FC6 A;  1S9Q A;  3OAP A;  1XQC A;  2Q6J A;  4N8R A;  4ZNU A;  3AUR A;  1Q4X A;  3VHW A;  5HJP B;  5KCT A;  1YOK A;  2ZNQ A;  3R8D A;  2FAI A;  3OZJ A;  5LGA A;  2Q7K A;  3AUQ A;  2VSR A;  4QM0 A;  4RME A;  2AWH A;  4IA2 A;  3HZF A;  5DKS A;  4UDA A;  4MG6 A;  1I7I A;  3D90 A;  1U3R A;  1X7R A;  3X1I A;  4M8E A;  3V9T A;  5B41 A;  1K7L A;  4ZNW A;  2JJ3 A;  3IXP D;  4OEA A;  3VJS A;  2PIR A;  3MNE A;  2NXX E;  2YLY A;  4Q50 A;  3L0L A;  5DVS A;  3W0C A;  5IXK A;  2QTU A;  2PIX A;  3E00 A;  3OKH A;  1T79 A;  4MG9 B;  4TV1 A;  5L11 A;  1Y0X X;  3PO9 A;  4HEE X;  5KRA A;  2J14 A;  2HWQ A;  4YT1 A;  4WLB A;  5HJP A;  2FVJ A;  3OS8 A;  2AMA A;  1XB7 A;  2HFP A;  3Q95 B;  4POH A;  5DV8 A;  2ZY0 A;  5E14 A;  5APH A;  1PQ6 A;  3JZC A;  4IW8 A;  4IVY A;  5DKG A;  3FUG A;  2PIP L;  4G2H A;  4JYI A;  2Q7L A;  4J5X C;  4S0T A;  2VV1 B;  3O1E A;  1FM9 A;  4G20 A;  4MGC A;  4OIU A;  3OSI A;  1YYE A;  2B50 A;  3FS1 A;  4IV4 A;  5HYR A;  3HM1 A;  4P6W A;  5AZV A;  4MG9 A;  5DU5 A;  3TKC A;  3FAL B;  2AMB A;  3KYT A;  1YJE A;  2ZLC A;  3VN2 A;  2ATH A;  1SKX A;  1XDK B;  3QT0 A;  4OGH A;  4PRG A;  5L7H A;  1Y0S A;  3T03 A;  4OZT U;  3R2A A;  2PIQ A;  3KPZ A;  2J4A A;  3OZ0 A;  5E0W A;  5DZ0 A;  4N73 A;  4ONI A;  2AXA A;  3LMP A;  2HC4 A;  2QZO B;  2ZL9 A;  3UUA B;  2ZLA A;  2G0H A;  4OH5 A;  3IPS A;  5KRL A;  5DYD A;  3A2I A;  3DY6 A;  3ADW A;  1T76 A;  3DT3 A;  3UVV B;  4OJ9 A;  5DWI A;  4K6I A;  4RUJ A;  1KKQ A;  1FCX A;  2AX8 A;  2VV1 A;  4N1Y A;  4APU A;  3AX8 A;  5AAV A;  5DWL A;  4MG8 A;  5AYG A;  3P8X A;  1H9U A;  2GPP A;  2H79 A;  2E2R A;  4CI4 A;  1ERR A;  1XJ7 A;  1ZKY A;  3MNO A;  1YY4 A;  3NSP A;  5AAU A;  3IPQ A;  3KWY A;  2HVC A;  3FAL A;  5DZI A;  3VRW A;  3DZY A;  2ZK4 A;  1P8D A;  1N46 A;  4XHD A;  1PQ9 A;  4RUP A;  5DIG A;  3KMZ A;  3ET1 A;  2ACL A;  2Z4J A;  1R20 D;  2OZ7 A;  3OSW A;  1DKF B;  1TFC A;  3G8I A;  5DX3 B;  2JFA A;  3ADV A;  4LNX A;  2Q6S A;  3WT6 A;  1I7G A;  2Q1H A;  1XPC A;  4KZJ A;  4PP3 A;  3VSP A;  4FN9 A;  1HG4 A;  4NUF A;  3UVV A;  5JJM A;  5FQS A;  2REW A;  4LTW A;  3ET0 A;  1NQ7 A;  2A3I A;  3ET3 A;  5DUH A;  5GT4 A;  3X1H A;  4WPF A;  4OFR A;  4PPP A;  1M13 A;  3OLF A;  2BJ4 A;  3GZ9 A;  3WTQ A;  2R6W A;  1L2I A;  1SJ0 A;  3F5C A;  5DSH A;  1YMT A;  5DMF A;  4DM8 A;  2ZVT A;  2OM9 A;  2V7C A;  3D5F A;  4MG5 A;  4REE A;  4A4W A;  5DKE A;  2AX9 A;  3K23 A;  3TKM A;  5K13 A;  2Q1V A;  2PIV A;  5DZ3 A;  2QXS A;  3E94 A;  3B68 A;  3DZU D;  3HQ5 A;  3L3X A;  1Y9R A;  4O8F A;  3ERD A;  4PLE A;  1OSV A;  3K6P A;  4JYG A;  4ZNH A;  1X76 A;  1ZAF A;  4OEY A;  2OCF A;  5C4S A;  3VRT A;  2IOK A;  3SP9 A;  2VV4 A;  3V4A A;  2AYR A;  1ILH A;  2I4P A;  3VT7 A;  1WM0 X;  5ICK A;  4DOR A;  4DK8 A;  1E3G A;  4E2J A;  2ZNO A;  3WJ4 A;  3KDU A;  3WT5 A;  1XVP A;  4OJ4 A;  5DYB A;  3UU7 B;  2Q60 A;  3A3Z X;  3RY9 A;  1G5Y A;  3UUD A;  5HYK A;  3AN4 A;  2QSE A;  4NB6 A;  3E00 D;  3L03 A;  1R6G A;  3L1B A;  5FQT A;  4IUI A;  4OAR A;  2PRG A;  1S0X A;  4RUO X;  3G8O A;  3CQV A;  4L96 A;  1S0Z A;  3VT9 A;  3R5N A;  5DWE A;  4MG7 A;  1NQ0 A;  4RFW A;  2POB A;  4TUZ A;  4RE8 A;  2YJD A;  4OIL A;  5E15 A;  1XQ3 A;  5DL4 A;  1RK3 A;  2QR9 A;  5E0X A;  5HZC A;  2XYW A;  5KRO A;  1XV9 B;  3AUN A;  2HAS A;  2PIN A;  2GPO A;  1ZH7 A;  5M96 A;  1XZX X;  4G1Y A;  4OIV A;  2ZFX A;  4X1F A;  2XYX A;  2P1T A;  1YA3 A;  1FM9 D;  5DMC A;  5DZH A;  3VT6 A;  3VT3 A;  3R5M A;  4XTA A;  2F4B A;  5DWJ A;  5DXP A;  4XAO A;  3UU7 A;  5JI0 D;  3HOD A;  2Q59 B;  1RDT A;  4G2I A;  4MGD B;  3OGT A;  3OS8 C;  3W5T A;  1QKM A;  4RMC A;  2QXM A;  2GL8 A;  3CLD A;  4IV2 A;  3SP6 A;  3WGP A;  1NHZ A;  2Z4B A;  4J24 A;  3B65 A;  3E7C A;  5KYA A;  2OAX A;  5KCD A;  1GWQ A;  3DR1 A;  3A2H A;  2G44 A;  5EJV A;  4DMA A;  1G1U A;  2QGW A;  5DTV A;  1E3K A;  4FHH A;  4J5W A;  2ZNP A;  3RLL A;  1PZL A;  2FSZ A;  3AZ3 A;  3GBK A;  3B66 A;  1EXA A;  2O4R A;  3R8I A;  1FCY A;  4EMA A;  5GIE A;  4G1Z A;  2OUZ A;  3WWR A;  1R1K A;  2O9I A;  4ZOM A;  3VI8 A;  4DQM A;  3A9E B;  2ZK0 A;  3CS8 A;  1NQ2 A;  1LV2 A;  3DZY D;  2ZK1 A;  3VT4 A;  2Q70 A;  4WHG A;  5DXE A;  2IOG A;  4LSJ A;  2PNU A;  3IMY A;  3B1M A;  5APK A;  3UP3 A;  3R8A A;  2QAB A;  2PIO A;  3TX7 B;  1T7R A;  4OFU A;  5G3J A;  3VRV A;  1T7M A;  4G1D A;  3OMO A;  3VTC A;  5FQV A;  5AVL A;  1T73 A;  3AZ1 A;  5EC9 A;  3W5Q A;  4EM9 A;  3W0I A;  5IZ0 A;  1OVL B;  2LBD A;  3KDT A;  5DXK A;  4ITF A;  2V0V A;  5H1E A;  2XKW A;  2ZAS A;  3G0W A;  5KCU A;  5DLR A;  5DI7 A;  1FM6 A;  5KRJ A;  3VT5 A;  2H77 A;  1OSH A;  3Q95 A;  4UDD A;  1FD0 A;  5DXB B;  4KZM A;  4NQA B;  3A9E A;  2G0G A;  2NV7 A;  4JGV A;  4QJR A;  3IA6 A;  1XP1 A;  3WFG A;  2ZMJ A;  3L3Z A;  4OC7 A;  2B1V A;  2PIW A;  1ILG A;  1I38 A;  5DV3 A;  4S0S A;  5DP0 A;  3W0Y A;  5ETH A;  3B0R A;  3GD2 A;  4OJB A;  5A86 A;  3KFC A;  5I4V A;  5HJS A;  3R29 A;  2QW4 A;  3A40 X;  1OVL A;  3ERT A;  2YLQ A;  1N83 A;  4IA3 A;  2NW4 A;  1XDK A;  2JF9 A;  4MDD A;  4JAZ A;  3VJT A;  3WMH A;  1UHL B;  3HC6 A;  3OMM A;  2Q5S A;  1XNN A;  4OKW A;  3OMK A;  4QK4 A;  5DXM A;  2QZO A;  3UUA A;  1PK5 A;  1NYX A;  1XAP A;  1P93 A;  2ZK3 A;  4QE8 A;  4CSJ A;  1HJ1 A;  1X7B A;  2R40 A;  2P15 A;  2QA8 B;  4J26 A;  2AO6 A;  5DRJ A;  4JYH A;  1L2J A;  3K8S A;  1X7E A;  1Z5X E;  3B67 A;  1PQC A;  1U9E A;  4MGA B;  5G43 A;  4A4V A;  3S9S A;  3VTD A;  4WQP A;  1Z95 A;  3SZ1 A;  3EYB A;  1S19 A;  1LBD A;  2B23 A;  4PF3 A;  4XI3 A;  3B0T A;  1A52 A;  1PDU A;  2Q5G A;  2VV3 A;  4NIE A;  4R2U A;  4F9M A;  4PWL A;  3ADU A;  5DV6 A;  5E1C A;  4L98 A;  1MVC A;  1DKF A;  4RZE A;  3KMR A;  3PCU A;  3PLZ A;  1FCZ A;  3UP0 A;  5DX3 A;  3WJ5 A;  4IW6 A;  1UOM A;  3HC5 A;  5CJ6 A;  3D6D A;  4A2J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...