5B41A

Crystal structure of vdr-lbd complexed with 2-methylidene-19-nor-1a,25-dihydroxyvitamin d3
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
251
structure length
239
Chain Sequence
KLSEEQQHIIAILLDAHHKTYDPTYADFRDFRPPVRMPLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTSDDQIVLLKSSAIEVIMLRSNQSFTMDDMSWDCGSQDYKYDVTDVSKAGHTLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAKLVEAIQDRLSNTLQTYIRCRHPPPGSHQLYAKMIQKLADLRSLNEEHSKQYRSLSFQPENSMKLTPLVLEVFGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Apo- and Antagonist-Binding Structures of Vitamin D Receptor Ligand-Binding Domain Revealed by Hybrid Approach Combining Small-Angle X-ray Scattering and Molecular Dynamics
pubmed doi rcsb
molecule keywords Vitamin D3 receptor
molecule tags Transcription
source organism Rattus norvegicus
total genus 99
structure length 239
sequence length 251
ec nomenclature
pdb deposition date 2016-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 5b41A00
4ITFA 4WLBA 5H1EA 5KRIA 5KCWA 4Q13A 4G20A 4OZRE 2J14A 2ZL9A 5F9BA 2ZFXA 4S0SA 3V49A 3K23A 3RLLA 3FALA 4FGYA 3HVLA 3R8IA 2HB7A 1YJEA 4IUIA 3E7CA 5E0XA 1XAPA 3E94A 2I4ZA 3KYTA 1U9EA 5I4VA 4OC7A 3WFGA 1NAVA 4NIEA 4RMCA 3ERTA 3CLDA 5DRMA 3KMRA 1S0XA 2QSEA 4IVWA 1T65A 3IPQA 1T74A 2YLPA 2I0GA 5DLRA 2HWQA 2G0HA 4DQMA 1T7FA 4S14A 4FHIA 4KZJA 2AX6A 3WTQA 5HCVA 3VHUA 1ZUCA 5DZHA 3ZRBA 5DRJA 2YHDA 4ITEA 3WJ4A 1PCGA 2QA8A 1S9QA 3SP9A 3W0IA 4RZFA 1FM9A 1X76A 3GYUA 4NB6A 4XHDA 5JY3A 1R1KA 2ZXNA 3FURA 3DY6A 3L0EA 3ZQTA 1E3GA 3AFRA 5DWEA 3V9YA 3A40X 5SYZA 2ZK6A 4MGAB 1EXXA 4ZNHA 2GL8A 3P89A 2EWPA 4REEA 4TV1A 3RLJA 2HB8A 5JJMA 4HLWA 4G1DA 5DVVA 3V9TA 3W0YA 1PDUA 1ERRA 1U3SA 2HAMA 4ZNSA 5KRAA 1KNUA 1XV9A 2OVHA 3IA6A 5LGAA 1L2JA 3FXVA 2AX9A 4PP3A 1DKFA 3WT5A 3ZR7A 1GS4A 3N00A 3OGTA 4WHGA 2QR9A 3OLSA 3FC6A 2ATHA 2O9IA 4G2IA 5DUHA 3TX7B 2P15A 1NAXA 2HWRA 3PO9A 2IOGA 4LNXA 5E0WA 3OOKA 1ZGYA 2OCFA 1XNXA 3UP3A 1ILGA 3MNPA 1SKXA 4UDCA 2Q59A 1NRLA 3AZ3A 3G8IA 5DK9A 3A78A 1A28A 3CWDA 5ICKA 3P0UA 3BEJA 4UDAA 2O4JA 2ZK3A 3FLIA 3L03A 4RUPA 3KBAA 4LNWA 4RZGA 3CQVA 3G9EA 2Z4JA 2ZK2A 3OZJA 4X1GA 3B0RA 4YPQA 2NW4A 2PITA 1OVLA 1R5KA 1S9PA 5HYRA 1T7TA 5C4TA 4IS8A 1ZDTA 3HZFA 4S0TA 3WT6A 4R6SA 2B1VA 2PNUA 1WM0X 2IOKA 1YOKA 4DORA 3FEJA 4WPFA 5KCUA 5L7EA 3W5PA 4P6XA 1ZH7A 2JFAA 3O1EA 4OFRA 1T7RA 2GPPA 1NQ2A 2VV3A 2Q5GA 4ONIA 1LBDA 4S15A 1S0ZA 3OLFA 1T63A 2OVMA 3FUGA 4IVYA 4PPPA 4WVDA 4LTWA 5E1CA 2Q60A 2POBA 2P1TA 3BQDA 3F5CB 4PWLA 3W5RA 5G46A 1SJ0A 2Q7KA 2QPYA 5AAUA 4O8FA 5DP0A 4CSJA 1XP6A 2GWXA 3AUQA 2AX7A 4E4KA 4RUOX 3ZRAA 2PJLA 4QJRA 2E2RA 4RWVA 2ZNQA 3TKMA 5M96A 2QA8B 4XT9A 1YP0A 4ZNVA 2OAXA 3R5NA 3P8XA 3KMZA 1T7MA 3UUAA 1GWRA 1XLSA 2BAWA 2AX8A 1YOWA 2AO6A 4QM0A 2YATA 4XI3A 1Y9RA 4YNKA 4ZNWA 4IQRA 5DIDA 4JGVA 4IV2A 2R6YA 4MGBA 4OGHA 3W0JA 3IPUA 5GIDA 1PRGA 2ZLAA 2HVCA 1EXAA 2JJ3A 2V7CA 1FM6A 3ADWA 4TV1B 3V3EA 4RMDA 2HCDA 5JJMB 2ZASA 3OS8A 2QGTA 3L0LA 4PRGA 2G44A 3V4AA 2QH6A 4OIUA 5B41A 1U3QA 1XLSE 1XV9B 2HASA 1XNNA 3WMHA 3VJSA 1FM9D 1Z5XU 3AN3A 4WHFA 1DKFB 5KCFA 3RUTA 5G42A 1UPWA 3VT9A 3B5RA 3VSOA 4ZI1A 1OSVA 3ET3A 4J5WA 1XP9A 1XQCA 1PQ6A 2G0GA 3FC6B 4OJBA 1OSHA 5AZVA 3ADSA 4Y29A 2ZMIA 5EITA 1K7LA 3GWSX 5E7VA 3VJTA 4R2UA 3X1HA 5KRLA 1ZEOA 2Q59B 4RE8A 4OLMA 1N46A 3R29A 4G21A 3X31A 3CDPA 2PIOA 3DR1A 3KDTA 5DKGA 2FSZA 2ZK4A 3B0WA 3VT4A 2Q6RA 4ZJWA 2R40D 1FCYA 2J4AA 4DM8A 3DT3A 2GTKA 5DVCA 1PQCA 3PRGA 1NQ0A 1OVLB 4DOSA 3ERDA 3UUDA 5KYJA 1I7IA 2HC4A 4MG8B 5APHA 2HFPA 4FNEA 5KRCA 1X7BA 3F5CA 4QE8A 2PIUA 3DZYA 1RKGA 2VV4B 4EMAA 3A2HA 1QKUA 4EM9A 3K22A 3IPSA 2JFAB 3OSIA 4OEDA 2QE4A 3DZUA 2PRGA 4OKXA 1FCXA 3GWXA 3OMPA 2OZ7A 5CJ6A 1GWXA 4OH5A 1NDEA 3TY0A 5IAWA 3A3ZX 2Q1HA 5DKEA 3H52A 4OKTA 1QKMA 4IWFA 1L2IA 2P7ZA 2VV1A 4LBDA 1R20A 5DXQA 5KD9A 3TKCA 4NQAB 4A2JA 5KR9A 4XUMA 3JZBA 4HEEX 3VRVA 2J7XA 1X78A 4ZNUA 3W0CA 2GP7A 1Y0XX 3EYBA 1UOMA 3OSWA 1QKNA 4OKWA 4XAOA 3UUAB 3A9EA 3ET0A 3WJ5A 3OLLA 5C4SA 5DV6A 4UDDA 2YFEA 3DCTA 3KMGA 3AZ1A 4MGBB 2QTUA 1A52A 1UPVA 2A3IA 2JF9A 4NY9A 4IA1A 2REWA 5ETHA 4JAZA 3SP6A 2Q1VA 4OEYA 4ZN7A 1NHZA 1Q4XA 4MGDA 2VSRA 5EC9A 5AVLA 1KV6A 1GWQA 2FAIA 1G2NA 2ZNNA 1K4WA 3IXPD 3OSAA 4FHHA 5B5BA 1X7EA 1K74D 3B1MA 3GN8A 5EI1A 3H0AA 5AAVB 2VV0A 3E00A 3VJHA 4M8HA 5L7HA 3UVVA 2G5OA 2QMVA 2Q7IA 3R5MA 1I7GA 1XVPB 5HJSA 3D6DA 4NUFA 3SZ1A 3GD2A 3OKHA 3VRWA 2ZLCA 3CDSA 3HM1A 1MVCA 1X7JA 3NOAA 4OZTU 5DUGA 4J24A 2P7GA 5AZTA 1IE8A 4OJ4A 4OH6A 3FEIA 2AB2A 1RJKA 4MG7A 5G3JA 5JI0D 4MG8A 2ACLA 1Y0SA 2ZMJA 5DX3A 2VV4A 4ZJRA 3L3ZA 3CS8A 4OK1A 3T03A 4E4QA 4Q0AC 1SQNA 2AXAA 2H79A 2VV2A 5L11A 1T76A 2GIUA 2B23A 3UUDB 3AX8A 1MV9A 3W0AA 5ACCA 4QL8A 1PK5A 3B65A 5DSHA 2P7AA 1U3RA 4BCRA 3F7DA 2AAXA 4G1YA 5DZ1A 5DWLA 3HQ5A 5DXMA 5FQRA 2XHSA 3AZ2A 4PVUA 3WFFA 3W5QA 2ZXZA 2ZK5A 3D5FA 3R2AA 2Q3YA 2QGWA 5DMCA 1UHLA 5E19A 2Z4BA 4N73A 4MG5A 5DXPA 4JL4A 4TUZA 2VV1B 2LBDA 3KFCA 2J7YA 1TXIA 1SR7A 3JZCA 2YJDA 3OKIA 4J5XC 4PF3A 4QK4A 4REFA 2NPAA 1RDTA 2AA6A 2YLOA 2GPVA 2I4JA 3ET2A 2QABA 3ADXA 4MGCA 5DUEA 5FQSA 5A86A 1XZXX 1DB1A 4IV4A 2W8YA 4PXMA 3DZUD 2I0JA 3A9EB 3P88A 1HG4A 1PQ9A 4K4JA 4OZRU 4UDBA 4RZEA 1XIUA 5KROA 3NSQA 5AVIA 5AAVA 4PLEA 1R1KD 4OKBA 2VSTA 1NYXA 3LBDA 1S19A 1XVPA 4POJA 4X1FA 1R20D 4IA7A 4G1ZA 4MGDB 5DYBA 4RAKA 3X1IA 1FCZA 3O1DA 1YYEA 1ZKYA 4ZNTA 2QXMA 2ZK1A 5HYKA 2ZKCA 1N4HA 1E3KA 2P4YA 3OMKA 4OARA 5DZ0A 2R6WA 3L0JA 3UVVB 3GZ9A 4MG9B 3WGPA 3AURA 4KZIA 1P93A 5AWJA 2ZVTA 4DMAA 1I38A 4RUJA 3OAPA 5DI7A 5EJVA 4PLDA 3B67A 4JYHA 2ZNPA 2ZMHA 5FQVA 3VSPA 5DWIA 3MNOA 5DKBA 2AMAA 2PIXA 3NSPA 3W0HA 4ZO1X 3D57A 5DZ3A 3PLZA 2Q5PA 5DXBA 4A4WA 4OILA 5KRJA 4MG7B 3OMQA 4IA2A 3VRUA 2ACLB 3CTBA 4E2JA 5DX3B 2OM9A 2OUZA 2Q8SA 1NQ7A 2BJ4A 3H0AD 4OEZA 3OMOA 4IU7A 2QXSA 5KRMA 3LMPA 2QA6A 2QNVA 1YA3A 3B3KA 5DV8A 1HJ1A 4FN9A 4XLDA 5FQTA 5G45A 4PPSA 3RUUA 3HC6A 3X36A 1X7RA 1YIMA 5DXEA 3VI8A 3VRTA 4DK8A 2AA2A 1T5ZA 3WT7A 3VT6A 1M2ZA 2AWHA 5HJPA 5L7GA 3GYTA 5DXRA 5KRKA 4WQPA 4QE6A 5C4UA 3L1BA 1VJBA 1I37A 4CI4A 1Z5XE 2FVJA 1N83A 4XUHA 4DK7A 3D24A 3AN4A 3GBKA 3BC5A 1FBYA 4XTAA 1UHLB 4ZO1B 1XB7A 4IW6A 4TUZB 2GPUA 2YJAB 2XYXA 2AA5A 3V3QA 2PIVA 3VN2A 4R06A 1G1UA 4APUA 4M8EA 3S9SA 4MDDA 3RVFA 5APJA 2AMBA 4KZMA 5KCTA 2QW4A 2ZK0A 1T73A 3HODA 4N1YA 5DU5A 3VT7A 1NUOA 2B1ZA 4JYIA 5APKA 5DVSA 3Q95A 2QZOA 3VTDA 1YUCA 5G43A 2AM9A 4LSJA 4OEAA 4MG9A 3W5TA 3OZ0A 2PIPL 1RKHA 1EREA 1NQ1A 2HARA 1XP1A 5DIEA 1RDTD 5AWKA 2PIWA 3RY9A 1PZLA 1XDKA 3AUNA 5FQPA 1KKQA 1FM6D 3UU7B 4CI5A 5LWPA 2R40A 5KCDA 3D90A 2YLYA 5KRFA 3B68A 2P1UA 5DWGA 1IE9A 1XJ7A 3V9VA 4ZOMA 3VT5A 4IA3A 1G50A 4G2HA 5DIGA 3FS1A 5KYAA 5DMFA 4L98A 2ZXMA 4J26A 2Q6JA 4RMEA 1XOWA 2ZBSA 3ADTA 5DXBB 3WWRA 3PCUA 5GICA 2Q61A 2ABIA 3OS8C 5KRHA 2BJ4B 2PKLA 3B66A 5DXGA 2I4PA 2NV7A 3VT8A 4L96A 3VTBA 4OFUA 4OJ9A 2Q5SA 3PEQA 1FD0A 3A2IA 2HBHA 3G8OA 3K8SA 5DV3A 3VT3A 5IZ0A 5HJPB 3R8AA 1YY4A 4J5WC 1H9UA 3ADUA 3DCUA 4P6WA 4YMQA 2YLQA 1ILHA 5G44A 3FALB 4ZN9A 3OMMA 3M7RA 3HLVA 2B50A 5GIEA 4A4VA 5HZCA 3UP0A 5DTVA 2GPOA 1YMTA 2Q7JA 2V0VA 2AYRA 3UUCA 1XQ3A 2P54A 2XKWA 3B0QA 1LV2A 1MZNA 3K6PA 5E14A 5IXKA 3DZYD 2O4RA 2XYJA 4MG6A 2POGA 3MNEA 3B0TA 4OZTE 3ET1A 2NXXA 5GT4A 1BSXA 1XPCA 1ZDUA 4N8RA 5E15A 3CS4A 3IXPA 5G5WA 3KWYA 4MGAA 1K74A 1OT7A 4PP5A 4YT1A 3A2JA 3R8DA 2Q7LA 1M13A 5KCEA 3VTCA 3HC5A 4K7AA 4DM6A 5C4OA 3G0WA 3KPZA 1G5YA 2H77A 2PINA 1M7WA 3ADVA 5DKSA 1QKTA 3Q95B 2QZOB 5EGVA 3U9QA 3VHVA 1R6GA 2Q6SA 3UU7A 4N5GA 1YINA 2IHQA 3QT0A 5DXKA 2NXXE 1P8DA 1T79A 4PP6A 2ZY0A 5DL4A 5EHJA 3VHWA 3W0GA 2AA7A 5KCCA 2XYWA 5AYGA 4F9MA 5DY8A 4IWCA 2ZNOA 3L3XA 3OS9A 4K6IA 5AK2A 5DYDA 3CJWA 1ZAFA 3VJIA 2F4BA 3KDUA 3PBAA 4Q50A 4JYGA 4IW8A 1XDKB 4POHA 1RK3A 3OOFA 3HO0A 2PIQA 2PIRA 5DZIA 4B7WA 2Q70A 3CS6A 4OHAA 3ILZA 2P1VA 5DWJA 1TFCA 3E00D 4OIVA 5K13A 4J5XA 3IMYA 4RFWA 1Z95A
chains in the Genus database with same CATH superfamily
4ITFA 4WLBA 5H1EA 5KRIA 5KCWA 4Q13A 4G20A 4OZRE 2J14A 2ZL9A 5F9BA 2ZFXA 4S0SA 3V49A 3K23A 3RLLA 3FALA 4FGYA 3HVLA 3R8IA 2HB7A 1YJEA 4IUIA 3E7CA 5E0XA 1XAPA 3E94A 2I4ZA 3KYTA 1U9EA 5I4VA 4OC7A 3WFGA 1NAVA 4NIEA 4RMCA 3ERTA 3CLDA 5DRMA 3KMRA 1S0XA 2QSEA 4IVWA 1T65A 3IPQA 1T74A 2YLPA 2I0GA 5DLRA 2HWQA 2G0HA 4DQMA 1T7FA 4S14A 4FHIA 4KZJA 2AX6A 3WTQA 5HCVA 3VHUA 1ZUCA 5DZHA 3ZRBA 5DRJA 2YHDA 4ITEA 3WJ4A 1PCGA 2QA8A 1S9QA 3SP9A 3W0IA 4RZFA 1FM9A 1X76A 3GYUA 4NB6A 4XHDA 5JY3A 1R1KA 2ZXNA 3FURA 3DY6A 3L0EA 3ZQTA 1E3GA 3AFRA 5DWEA 3V9YA 3A40X 5SYZA 2ZK6A 4MGAB 1EXXA 4ZNHA 2GL8A 3P89A 2EWPA 4REEA 4TV1A 3RLJA 2HB8A 5JJMA 4HLWA 4G1DA 5DVVA 3V9TA 3W0YA 1PDUA 1ERRA 1U3SA 2HAMA 4ZNSA 5KRAA 1KNUA 1XV9A 2OVHA 3IA6A 5LGAA 1L2JA 3FXVA 2AX9A 4PP3A 1DKFA 3WT5A 3ZR7A 1GS4A 3N00A 3OGTA 4WHGA 2QR9A 3OLSA 3FC6A 2ATHA 2O9IA 4G2IA 5DUHA 3TX7B 2P15A 1NAXA 2HWRA 3PO9A 2IOGA 4LNXA 5E0WA 3OOKA 1ZGYA 2OCFA 1XNXA 3UP3A 1ILGA 3MNPA 1SKXA 4UDCA 2Q59A 1NRLA 3AZ3A 3G8IA 5DK9A 3A78A 1A28A 3CWDA 5ICKA 3P0UA 3BEJA 4UDAA 2O4JA 2ZK3A 3FLIA 3L03A 4RUPA 3KBAA 4LNWA 4RZGA 3CQVA 3G9EA 2Z4JA 2ZK2A 3OZJA 4X1GA 3B0RA 4YPQA 2NW4A 2PITA 1OVLA 1R5KA 1S9PA 5HYRA 1T7TA 5C4TA 4IS8A 1ZDTA 3HZFA 4S0TA 3WT6A 4R6SA 2B1VA 2PNUA 1WM0X 2IOKA 1YOKA 4DORA 3FEJA 4WPFA 5KCUA 5L7EA 3W5PA 4P6XA 1ZH7A 2JFAA 3O1EA 4OFRA 1T7RA 2GPPA 1NQ2A 2VV3A 2Q5GA 4ONIA 1LBDA 4S15A 1S0ZA 3OLFA 1T63A 2OVMA 3FUGA 4IVYA 4PPPA 4WVDA 4LTWA 5E1CA 2Q60A 2POBA 2P1TA 3BQDA 3F5CB 4PWLA 3W5RA 5G46A 1SJ0A 2Q7KA 2QPYA 5AAUA 4O8FA 5DP0A 4CSJA 1XP6A 2GWXA 3AUQA 2AX7A 4E4KA 4RUOX 3ZRAA 2PJLA 4QJRA 2E2RA 4RWVA 2ZNQA 3TKMA 5M96A 2QA8B 4XT9A 1YP0A 4ZNVA 2OAXA 3R5NA 3P8XA 3KMZA 1T7MA 3UUAA 1GWRA 1XLSA 2BAWA 2AX8A 1YOWA 2AO6A 4QM0A 2YATA 4XI3A 1Y9RA 4YNKA 4ZNWA 4IQRA 5DIDA 4JGVA 4IV2A 2R6YA 4MGBA 4OGHA 3W0JA 3IPUA 5GIDA 1PRGA 2ZLAA 2HVCA 1EXAA 2JJ3A 2V7CA 1FM6A 3ADWA 4TV1B 3V3EA 4RMDA 2HCDA 5JJMB 2ZASA 3OS8A 2QGTA 3L0LA 4PRGA 2G44A 3V4AA 2QH6A 4OIUA 5B41A 1U3QA 1XLSE 1XV9B 2HASA 1XNNA 3WMHA 3VJSA 1FM9D 1Z5XU 3AN3A 4WHFA 1DKFB 5KCFA 3RUTA 5G42A 1UPWA 3VT9A 3B5RA 3VSOA 4ZI1A 1OSVA 3ET3A 4J5WA 1XP9A 1XQCA 1PQ6A 2G0GA 3FC6B 4OJBA 1OSHA 5AZVA 3ADSA 4Y29A 2ZMIA 5EITA 1K7LA 3GWSX 5E7VA 3VJTA 4R2UA 3X1HA 5KRLA 1ZEOA 2Q59B 4RE8A 4OLMA 1N46A 3R29A 4G21A 3X31A 3CDPA 2PIOA 3DR1A 3KDTA 5DKGA 2FSZA 2ZK4A 3B0WA 3VT4A 2Q6RA 4ZJWA 2R40D 1FCYA 2J4AA 4DM8A 3DT3A 2GTKA 5DVCA 1PQCA 3PRGA 1NQ0A 1OVLB 4DOSA 3ERDA 3UUDA 5KYJA 1I7IA 2HC4A 4MG8B 5APHA 2HFPA 4FNEA 5KRCA 1X7BA 3F5CA 4QE8A 2PIUA 3DZYA 1RKGA 2VV4B 4EMAA 3A2HA 1QKUA 4EM9A 3K22A 3IPSA 2JFAB 3OSIA 4OEDA 2QE4A 3DZUA 2PRGA 4OKXA 1FCXA 3GWXA 3OMPA 2OZ7A 5CJ6A 1GWXA 4OH5A 1NDEA 3TY0A 5IAWA 3A3ZX 2Q1HA 5DKEA 3H52A 4OKTA 1QKMA 4IWFA 1L2IA 2P7ZA 2VV1A 4LBDA 1R20A 5DXQA 5KD9A 3TKCA 4NQAB 4A2JA 5KR9A 4XUMA 3JZBA 4HEEX 3VRVA 2J7XA 1X78A 4ZNUA 3W0CA 2GP7A 1Y0XX 3EYBA 1UOMA 3OSWA 1QKNA 4OKWA 4XAOA 3UUAB 3A9EA 3ET0A 3WJ5A 3OLLA 5C4SA 5DV6A 4UDDA 2YFEA 3DCTA 3KMGA 3AZ1A 4MGBB 2QTUA 1A52A 1UPVA 2A3IA 2JF9A 4NY9A 4IA1A 2REWA 5ETHA 4JAZA 3SP6A 2Q1VA 4OEYA 4ZN7A 1NHZA 1Q4XA 4MGDA 2VSRA 5EC9A 5AVLA 1KV6A 1GWQA 2FAIA 1G2NA 2ZNNA 1K4WA 3IXPD 3OSAA 4FHHA 5B5BA 1X7EA 1K74D 3B1MA 3GN8A 5EI1A 3H0AA 5AAVB 2VV0A 3E00A 3VJHA 4M8HA 5L7HA 3UVVA 2G5OA 2QMVA 2Q7IA 3R5MA 1I7GA 1XVPB 5HJSA 3D6DA 4NUFA 3SZ1A 3GD2A 3OKHA 3VRWA 2ZLCA 3CDSA 3HM1A 1MVCA 1X7JA 3NOAA 4OZTU 5DUGA 4J24A 2P7GA 5AZTA 1IE8A 4OJ4A 4OH6A 3FEIA 2AB2A 1RJKA 4MG7A 5G3JA 5JI0D 4MG8A 2ACLA 1Y0SA 2ZMJA 5DX3A 2VV4A 4ZJRA 3L3ZA 3CS8A 4OK1A 3T03A 4E4QA 4Q0AC 1SQNA 2AXAA 2H79A 2VV2A 5L11A 1T76A 2GIUA 2B23A 3UUDB 3AX8A 1MV9A 3W0AA 5ACCA 4QL8A 1PK5A 3B65A 5DSHA 2P7AA 1U3RA 4BCRA 3F7DA 2AAXA 4G1YA 5DZ1A 5DWLA 3HQ5A 5DXMA 5FQRA 2XHSA 3AZ2A 4PVUA 3WFFA 3W5QA 2ZXZA 2ZK5A 3D5FA 3R2AA 2Q3YA 2QGWA 5DMCA 1UHLA 5E19A 2Z4BA 4N73A 4MG5A 5DXPA 4JL4A 4TUZA 2VV1B 2LBDA 3KFCA 2J7YA 1TXIA 1SR7A 3JZCA 2YJDA 3OKIA 4J5XC 4PF3A 4QK4A 4REFA 2NPAA 1RDTA 2AA6A 2YLOA 2GPVA 2I4JA 3ET2A 2QABA 3ADXA 4MGCA 5DUEA 5FQSA 5A86A 1XZXX 1DB1A 4IV4A 2W8YA 4PXMA 3DZUD 2I0JA 3A9EB 3P88A 1HG4A 1PQ9A 4K4JA 4OZRU 4UDBA 4RZEA 1XIUA 5KROA 3NSQA 5AVIA 5AAVA 4PLEA 1R1KD 4OKBA 2VSTA 1NYXA 3LBDA 1S19A 1XVPA 4POJA 4X1FA 1R20D 4IA7A 4G1ZA 4MGDB 5DYBA 4RAKA 3X1IA 1FCZA 3O1DA 1YYEA 1ZKYA 4ZNTA 2QXMA 2ZK1A 5HYKA 2ZKCA 1N4HA 1E3KA 2P4YA 3OMKA 4OARA 5DZ0A 2R6WA 3L0JA 3UVVB 3GZ9A 4MG9B 3WGPA 3AURA 4KZIA 1P93A 5AWJA 2ZVTA 4DMAA 1I38A 4RUJA 3OAPA 5DI7A 5EJVA 4PLDA 3B67A 4JYHA 2ZNPA 2ZMHA 5FQVA 3VSPA 5DWIA 3MNOA 5DKBA 2AMAA 2PIXA 3NSPA 3W0HA 4ZO1X 3D57A 5DZ3A 3PLZA 2Q5PA 5DXBA 4A4WA 4OILA 5KRJA 4MG7B 3OMQA 4IA2A 3VRUA 2ACLB 3CTBA 4E2JA 5DX3B 2OM9A 2OUZA 2Q8SA 1NQ7A 2BJ4A 3H0AD 4OEZA 3OMOA 4IU7A 2QXSA 5KRMA 3LMPA 2QA6A 2QNVA 1YA3A 3B3KA 5DV8A 1HJ1A 4FN9A 4XLDA 5FQTA 5G45A 4PPSA 3RUUA 3HC6A 3X36A 1X7RA 1YIMA 5DXEA 3VI8A 3VRTA 4DK8A 2AA2A 1T5ZA 3WT7A 3VT6A 1M2ZA 2AWHA 5HJPA 5L7GA 3GYTA 5DXRA 5KRKA 4WQPA 4QE6A 5C4UA 3L1BA 1VJBA 1I37A 4CI4A 1Z5XE 2FVJA 1N83A 4XUHA 4DK7A 3D24A 3AN4A 3GBKA 3BC5A 1FBYA 4XTAA 1UHLB 4ZO1B 1XB7A 4IW6A 4TUZB 2GPUA 2YJAB 2XYXA 2AA5A 3V3QA 2PIVA 3VN2A 4R06A 1G1UA 4APUA 4M8EA 3S9SA 4MDDA 3RVFA 5APJA 2AMBA 4KZMA 5KCTA 2QW4A 2ZK0A 1T73A 3HODA 4N1YA 5DU5A 3VT7A 1NUOA 2B1ZA 4JYIA 5APKA 5DVSA 3Q95A 2QZOA 3VTDA 1YUCA 5G43A 2AM9A 4LSJA 4OEAA 4MG9A 3W5TA 3OZ0A 2PIPL 1RKHA 1EREA 1NQ1A 2HARA 1XP1A 5DIEA 1RDTD 5AWKA 2PIWA 3RY9A 1PZLA 1XDKA 3AUNA 5FQPA 1KKQA 1FM6D 3UU7B 4CI5A 5LWPA 2R40A 5KCDA 3D90A 2YLYA 5KRFA 3B68A 2P1UA 5DWGA 1IE9A 1XJ7A 3V9VA 4ZOMA 3VT5A 4IA3A 1G50A 4G2HA 5DIGA 3FS1A 5KYAA 5DMFA 4L98A 2ZXMA 4J26A 2Q6JA 4RMEA 1XOWA 2ZBSA 3ADTA 5DXBB 3WWRA 3PCUA 5GICA 2Q61A 2ABIA 3OS8C 5KRHA 2BJ4B 2PKLA 3B66A 5DXGA 2I4PA 2NV7A 3VT8A 4L96A 3VTBA 4OFUA 4OJ9A 2Q5SA 3PEQA 1FD0A 3A2IA 2HBHA 3G8OA 3K8SA 5DV3A 3VT3A 5IZ0A 5HJPB 3R8AA 1YY4A 4J5WC 1H9UA 3ADUA 3DCUA 4P6WA 4YMQA 2YLQA 1ILHA 5G44A 3FALB 4ZN9A 3OMMA 3M7RA 3HLVA 2B50A 5GIEA 4A4VA 5HZCA 3UP0A 5DTVA 2GPOA 1YMTA 2Q7JA 2V0VA 2AYRA 3UUCA 1XQ3A 2P54A 2XKWA 3B0QA 1LV2A 1MZNA 3K6PA 5E14A 5IXKA 3DZYD 2O4RA 2XYJA 4MG6A 2POGA 3MNEA 3B0TA 4OZTE 3ET1A 2NXXA 5GT4A 1BSXA 1XPCA 1ZDUA 4N8RA 5E15A 3CS4A 3IXPA 5G5WA 3KWYA 4MGAA 1K74A 1OT7A 4PP5A 4YT1A 3A2JA 3R8DA 2Q7LA 1M13A 5KCEA 3VTCA 3HC5A 4K7AA 4DM6A 5C4OA 3G0WA 3KPZA 1G5YA 2H77A 2PINA 1M7WA 3ADVA 5DKSA 1QKTA 3Q95B 2QZOB 5EGVA 3U9QA 3VHVA 1R6GA 2Q6SA 3UU7A 4N5GA 1YINA 2IHQA 3QT0A 5DXKA 2NXXE 1P8DA 1T79A 4PP6A 2ZY0A 5DL4A 5EHJA 3VHWA 3W0GA 2AA7A 5KCCA 2XYWA 5AYGA 4F9MA 5DY8A 4IWCA 2ZNOA 3L3XA 3OS9A 4K6IA 5AK2A 5DYDA 3CJWA 1ZAFA 3VJIA 2F4BA 3KDUA 3PBAA 4Q50A 4JYGA 4IW8A 1XDKB 4POHA 1RK3A 3OOFA 3HO0A 2PIQA 2PIRA 5DZIA 4B7WA 2Q70A 3CS6A 4OHAA 3ILZA 2P1VA 5DWJA 1TFCA 3E00D 4OIVA 5K13A 4J5XA 3IMYA 4RFWA 1Z95A
chains in the Genus database with same CATH topology
4ITFA 4WLBA 5H1EA 5KRIA 5KCWA 4Q13A 4G20A 4OZRE 2J14A 2ZL9A 5F9BA 2ZFXA 4S0SA 3V49A 3K23A 3RLLA 3FALA 4FGYA 3HVLA 3R8IA 2HB7A 1YJEA 4IUIA 3E7CA 5E0XA 1XAPA 3E94A 2I4ZA 3KYTA 1U9EA 5I4VA 4OC7A 3WFGA 1NAVA 4NIEA 4RMCA 3ERTA 3CLDA 5DRMA 3KMRA 1S0XA 2QSEA 4IVWA 1T65A 3IPQA 1T74A 2YLPA 2I0GA 5DLRA 2HWQA 2G0HA 4DQMA 1T7FA 4S14A 4FHIA 4KZJA 2AX6A 3WTQA 5HCVA 3VHUA 1ZUCA 5DZHA 3ZRBA 5DRJA 2YHDA 4ITEA 3WJ4A 1PCGA 2QA8A 1S9QA 3SP9A 3W0IA 4RZFA 1FM9A 1X76A 3GYUA 4NB6A 4XHDA 5JY3A 1R1KA 2ZXNA 3FURA 3DY6A 3L0EA 3ZQTA 1E3GA 3AFRA 5DWEA 3V9YA 3A40X 5SYZA 2ZK6A 4MGAB 1EXXA 4ZNHA 2GL8A 3P89A 2EWPA 4REEA 4TV1A 3RLJA 2HB8A 5JJMA 4HLWA 4G1DA 5DVVA 3V9TA 3W0YA 1PDUA 1ERRA 1U3SA 2HAMA 4ZNSA 5KRAA 1KNUA 1XV9A 2OVHA 3IA6A 5LGAA 1L2JA 3FXVA 2AX9A 4PP3A 1DKFA 3WT5A 3ZR7A 1GS4A 3N00A 3OGTA 4WHGA 2QR9A 3OLSA 3FC6A 2ATHA 2O9IA 4G2IA 5DUHA 3TX7B 2P15A 1NAXA 2HWRA 3PO9A 2IOGA 4LNXA 5E0WA 3OOKA 1ZGYA 2OCFA 1XNXA 3UP3A 1ILGA 3MNPA 1SKXA 4UDCA 2Q59A 1NRLA 3AZ3A 3G8IA 5DK9A 3A78A 1A28A 3CWDA 5ICKA 3P0UA 3BEJA 4UDAA 2O4JA 2ZK3A 3FLIA 3L03A 4RUPA 3KBAA 4LNWA 4RZGA 3CQVA 3G9EA 2Z4JA 2ZK2A 3OZJA 4X1GA 3B0RA 4YPQA 2NW4A 2PITA 1OVLA 1R5KA 1S9PA 5HYRA 1T7TA 5C4TA 4IS8A 1ZDTA 3HZFA 4S0TA 3WT6A 4R6SA 2B1VA 2PNUA 1WM0X 2IOKA 1YOKA 4DORA 3FEJA 4WPFA 5KCUA 5L7EA 3W5PA 4P6XA 1ZH7A 2JFAA 3O1EA 4OFRA 1T7RA 2GPPA 1NQ2A 2VV3A 2Q5GA 4ONIA 1LBDA 4S15A 1S0ZA 3OLFA 1T63A 2OVMA 3FUGA 4IVYA 4PPPA 4WVDA 4LTWA 5E1CA 2Q60A 2POBA 2P1TA 3BQDA 3F5CB 4PWLA 3W5RA 5G46A 1SJ0A 2Q7KA 2QPYA 5AAUA 4O8FA 5DP0A 4CSJA 1XP6A 2GWXA 3AUQA 2AX7A 4E4KA 4RUOX 3ZRAA 2PJLA 4QJRA 2E2RA 4RWVA 2ZNQA 3TKMA 5M96A 2QA8B 4XT9A 1YP0A 4ZNVA 2OAXA 3R5NA 3P8XA 3KMZA 1T7MA 3UUAA 1GWRA 1XLSA 2BAWA 2AX8A 1YOWA 2AO6A 4QM0A 2YATA 4XI3A 1Y9RA 4YNKA 4ZNWA 4IQRA 5DIDA 4JGVA 4IV2A 2R6YA 4MGBA 4OGHA 3W0JA 3IPUA 5GIDA 1PRGA 2ZLAA 2HVCA 1EXAA 2JJ3A 2V7CA 1FM6A 3ADWA 4TV1B 3V3EA 4RMDA 2HCDA 5JJMB 2ZASA 3OS8A 2QGTA 3L0LA 4PRGA 2G44A 3V4AA 2QH6A 4OIUA 5B41A 1U3QA 1XLSE 1XV9B 2HASA 1XNNA 3WMHA 3VJSA 1FM9D 1Z5XU 3AN3A 4WHFA 1DKFB 5KCFA 3RUTA 5G42A 1UPWA 3VT9A 3B5RA 3VSOA 4ZI1A 1OSVA 3ET3A 4J5WA 1XP9A 1XQCA 1PQ6A 2G0GA 3FC6B 4OJBA 1OSHA 5AZVA 3ADSA 4Y29A 2ZMIA 5EITA 1K7LA 3GWSX 5E7VA 3VJTA 4R2UA 3X1HA 5KRLA 1ZEOA 2Q59B 4RE8A 4OLMA 1N46A 3R29A 4G21A 3X31A 3CDPA 2PIOA 3DR1A 3KDTA 5DKGA 2FSZA 2ZK4A 3B0WA 3VT4A 2Q6RA 4ZJWA 2R40D 1FCYA 2J4AA 4DM8A 3DT3A 2GTKA 5DVCA 1PQCA 3PRGA 1NQ0A 1OVLB 4DOSA 3ERDA 3UUDA 5KYJA 1I7IA 2HC4A 4MG8B 5APHA 2HFPA 4FNEA 5KRCA 1X7BA 3F5CA 4QE8A 2PIUA 3DZYA 1RKGA 2VV4B 4EMAA 3A2HA 1QKUA 4EM9A 3K22A 3IPSA 2JFAB 3OSIA 4OEDA 2QE4A 3DZUA 2PRGA 4OKXA 1FCXA 3GWXA 3OMPA 2OZ7A 5CJ6A 1GWXA 4OH5A 1NDEA 3TY0A 5IAWA 3A3ZX 2Q1HA 5DKEA 3H52A 4OKTA 1QKMA 4IWFA 1L2IA 2P7ZA 2VV1A 4LBDA 1R20A 5DXQA 5KD9A 3TKCA 4NQAB 4A2JA 5KR9A 4XUMA 3JZBA 4HEEX 3VRVA 2J7XA 1X78A 4ZNUA 3W0CA 2GP7A 1Y0XX 3EYBA 1UOMA 3OSWA 1QKNA 4OKWA 4XAOA 3UUAB 3A9EA 3ET0A 3WJ5A 3OLLA 5C4SA 5DV6A 4UDDA 2YFEA 3DCTA 3KMGA 3AZ1A 4MGBB 2QTUA 1A52A 1UPVA 2A3IA 2JF9A 4NY9A 4IA1A 2REWA 5ETHA 4JAZA 3SP6A 2Q1VA 4OEYA 4ZN7A 1NHZA 1Q4XA 4MGDA 2VSRA 5EC9A 5AVLA 1KV6A 1GWQA 2FAIA 1G2NA 2ZNNA 1K4WA 3IXPD 3OSAA 4FHHA 5B5BA 1X7EA 1K74D 3B1MA 3GN8A 5EI1A 3H0AA 5AAVB 2VV0A 3E00A 3VJHA 4M8HA 5L7HA 3UVVA 2G5OA 2QMVA 2Q7IA 3R5MA 1I7GA 1XVPB 5HJSA 3D6DA 4NUFA 3SZ1A 3GD2A 3OKHA 3VRWA 2ZLCA 3CDSA 3HM1A 1MVCA 1X7JA 3NOAA 4OZTU 5DUGA 4J24A 2P7GA 5AZTA 1IE8A 4OJ4A 4OH6A 3FEIA 2AB2A 1RJKA 4MG7A 5G3JA 5JI0D 4MG8A 2ACLA 1Y0SA 2ZMJA 5DX3A 2VV4A 4ZJRA 3L3ZA 3CS8A 4OK1A 3T03A 4E4QA 4Q0AC 1SQNA 2AXAA 2H79A 2VV2A 5L11A 1T76A 2GIUA 2B23A 3UUDB 3AX8A 1MV9A 3W0AA 5ACCA 4QL8A 1PK5A 3B65A 5DSHA 2P7AA 1U3RA 4BCRA 3F7DA 2AAXA 4G1YA 5DZ1A 5DWLA 3HQ5A 5DXMA 5FQRA 2XHSA 3AZ2A 4PVUA 3WFFA 3W5QA 2ZXZA 2ZK5A 3D5FA 3R2AA 2Q3YA 2QGWA 5DMCA 1UHLA 5E19A 2Z4BA 4N73A 4MG5A 5DXPA 4JL4A 4TUZA 2VV1B 2LBDA 3KFCA 2J7YA 1TXIA 1SR7A 3JZCA 2YJDA 3OKIA 4J5XC 4PF3A 4QK4A 4REFA 2NPAA 1RDTA 2AA6A 2YLOA 2GPVA 2I4JA 3ET2A 2QABA 3ADXA 4MGCA 5DUEA 5FQSA 5A86A 1XZXX 1DB1A 4IV4A 2W8YA 4PXMA 3DZUD 2I0JA 3A9EB 3P88A 1HG4A 1PQ9A 4K4JA 4OZRU 4UDBA 4RZEA 1XIUA 5KROA 3NSQA 5AVIA 5AAVA 4PLEA 1R1KD 4OKBA 2VSTA 1NYXA 3LBDA 1S19A 1XVPA 4POJA 4X1FA 1R20D 4IA7A 4G1ZA 4MGDB 5DYBA 4RAKA 3X1IA 1FCZA 3O1DA 1YYEA 1ZKYA 4ZNTA 2QXMA 2ZK1A 5HYKA 2ZKCA 1N4HA 1E3KA 2P4YA 3OMKA 4OARA 5DZ0A 2R6WA 3L0JA 3UVVB 3GZ9A 4MG9B 3WGPA 3AURA 4KZIA 1P93A 5AWJA 2ZVTA 4DMAA 1I38A 4RUJA 3OAPA 5DI7A 5EJVA 4PLDA 3B67A 4JYHA 2ZNPA 2ZMHA 5FQVA 3VSPA 5DWIA 3MNOA 5DKBA 2AMAA 2PIXA 3NSPA 3W0HA 4ZO1X 3D57A 5DZ3A 3PLZA 2Q5PA 5DXBA 4A4WA 4OILA 5KRJA 4MG7B 3OMQA 4IA2A 3VRUA 2ACLB 3CTBA 4E2JA 5DX3B 2OM9A 2OUZA 2Q8SA 1NQ7A 2BJ4A 3H0AD 4OEZA 3OMOA 4IU7A 2QXSA 5KRMA 3LMPA 2QA6A 2QNVA 1YA3A 3B3KA 5DV8A 1HJ1A 4FN9A 4XLDA 5FQTA 5G45A 4PPSA 3RUUA 3HC6A 3X36A 1X7RA 1YIMA 5DXEA 3VI8A 3VRTA 4DK8A 2AA2A 1T5ZA 3WT7A 3VT6A 1M2ZA 2AWHA 5HJPA 5L7GA 3GYTA 5DXRA 5KRKA 4WQPA 4QE6A 5C4UA 3L1BA 1VJBA 1I37A 4CI4A 1Z5XE 2FVJA 1N83A 4XUHA 4DK7A 3D24A 3AN4A 3GBKA 3BC5A 1FBYA 4XTAA 1UHLB 4ZO1B 1XB7A 4IW6A 4TUZB 2GPUA 2YJAB 2XYXA 2AA5A 3V3QA 2PIVA 3VN2A 4R06A 1G1UA 4APUA 4M8EA 3S9SA 4MDDA 3RVFA 5APJA 2AMBA 4KZMA 5KCTA 2QW4A 2ZK0A 1T73A 3HODA 4N1YA 5DU5A 3VT7A 1NUOA 2B1ZA 4JYIA 5APKA 5DVSA 3Q95A 2QZOA 3VTDA 1YUCA 5G43A 2AM9A 4LSJA 4OEAA 4MG9A 3W5TA 3OZ0A 2PIPL 1RKHA 1EREA 1NQ1A 2HARA 1XP1A 5DIEA 1RDTD 5AWKA 2PIWA 3RY9A 1PZLA 1XDKA 3AUNA 5FQPA 1KKQA 1FM6D 3UU7B 4CI5A 5LWPA 2R40A 5KCDA 3D90A 2YLYA 5KRFA 3B68A 2P1UA 5DWGA 1IE9A 1XJ7A 3V9VA 4ZOMA 3VT5A 4IA3A 1G50A 4G2HA 5DIGA 3FS1A 5KYAA 5DMFA 4L98A 2ZXMA 4J26A 2Q6JA 4RMEA 1XOWA 2ZBSA 3ADTA 5DXBB 3WWRA 3PCUA 5GICA 2Q61A 2ABIA 3OS8C 5KRHA 2BJ4B 2PKLA 3B66A 5DXGA 2I4PA 2NV7A 3VT8A 4L96A 3VTBA 4OFUA 4OJ9A 2Q5SA 3PEQA 1FD0A 3A2IA 2HBHA 3G8OA 3K8SA 5DV3A 3VT3A 5IZ0A 5HJPB 3R8AA 1YY4A 4J5WC 1H9UA 3ADUA 3DCUA 4P6WA 4YMQA 2YLQA 1ILHA 5G44A 3FALB 4ZN9A 3OMMA 3M7RA 3HLVA 2B50A 5GIEA 4A4VA 5HZCA 3UP0A 5DTVA 2GPOA 1YMTA 2Q7JA 2V0VA 2AYRA 3UUCA 1XQ3A 2P54A 2XKWA 3B0QA 1LV2A 1MZNA 3K6PA 5E14A 5IXKA 3DZYD 2O4RA 2XYJA 4MG6A 2POGA 3MNEA 3B0TA 4OZTE 3ET1A 2NXXA 5GT4A 1BSXA 1XPCA 1ZDUA 4N8RA 5E15A 3CS4A 3IXPA 5G5WA 3KWYA 4MGAA 1K74A 1OT7A 4PP5A 4YT1A 3A2JA 3R8DA 2Q7LA 1M13A 5KCEA 3VTCA 3HC5A 4K7AA 4DM6A 5C4OA 3G0WA 3KPZA 1G5YA 2H77A 2PINA 1M7WA 3ADVA 5DKSA 1QKTA 3Q95B 2QZOB 5EGVA 3U9QA 3VHVA 1R6GA 2Q6SA 3UU7A 4N5GA 1YINA 2IHQA 3QT0A 5DXKA 2NXXE 1P8DA 1T79A 4PP6A 2ZY0A 5DL4A 5EHJA 3VHWA 3W0GA 2AA7A 5KCCA 2XYWA 5AYGA 4F9MA 5DY8A 4IWCA 2ZNOA 3L3XA 3OS9A 4K6IA 5AK2A 5DYDA 3CJWA 1ZAFA 3VJIA 2F4BA 3KDUA 3PBAA 4Q50A 4JYGA 4IW8A 1XDKB 4POHA 1RK3A 3OOFA 3HO0A 2PIQA 2PIRA 5DZIA 4B7WA 2Q70A 3CS6A 4OHAA 3ILZA 2P1VA 5DWJA 1TFCA 3E00D 4OIVA 5K13A 4J5XA 3IMYA 4RFWA 1Z95A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ITF A;  4WLB A;  5H1E A;  5KRI A;  5KCW A;  4Q13 A;  4G20 A;  4OZR E;  2J14 A;  2ZL9 A;  5F9B A;  2ZFX A;  4S0S A;  3V49 A;  3K23 A;  3RLL A;  3FAL A;  4FGY A;  3HVL A;  3R8I A;  2HB7 A;  1YJE A;  4IUI A;  3E7C A;  5E0X A;  1XAP A;  3E94 A;  2I4Z A;  3KYT A;  1U9E A;  5I4V A;  4OC7 A;  3WFG A;  1NAV A;  4NIE A;  4RMC A;  3ERT A;  3CLD A;  5DRM A;  3KMR A;  1S0X A;  2QSE A;  4IVW A;  1T65 A;  3IPQ A;  1T74 A;  2YLP A;  2I0G A;  5DLR A;  2HWQ A;  2G0H A;  4DQM A;  1T7F A;  4S14 A;  4FHI A;  4KZJ A;  2AX6 A;  3WTQ A;  5HCV A;  3VHU A;  1ZUC A;  5DZH A;  3ZRB A;  5DRJ A;  2YHD A;  4ITE A;  3WJ4 A;  1PCG A;  2QA8 A;  1S9Q A;  3SP9 A;  3W0I A;  4RZF A;  1FM9 A;  1X76 A;  3GYU A;  4NB6 A;  4XHD A;  5JY3 A;  1R1K A;  2ZXN A;  3FUR A;  3DY6 A;  3L0E A;  3ZQT A;  1E3G A;  3AFR A;  5DWE A;  3V9Y A;  3A40 X;  5SYZ A;  2ZK6 A;  4MGA B;  1EXX A;  4ZNH A;  2GL8 A;  3P89 A;  2EWP A;  4REE A;  4TV1 A;  3RLJ A;  2HB8 A;  5JJM A;  4HLW A;  4G1D A;  5DVV A;  3V9T A;  3W0Y A;  1PDU A;  1ERR A;  1U3S A;  2HAM A;  4ZNS A;  5KRA A;  1KNU A;  1XV9 A;  2OVH A;  3IA6 A;  5LGA A;  1L2J A;  3FXV A;  2AX9 A;  4PP3 A;  1DKF A;  3WT5 A;  3ZR7 A;  1GS4 A;  3N00 A;  3OGT A;  4WHG A;  2QR9 A;  3OLS A;  3FC6 A;  2ATH A;  2O9I A;  4G2I A;  5DUH A;  3TX7 B;  2P15 A;  1NAX A;  2HWR A;  3PO9 A;  2IOG A;  4LNX A;  5E0W A;  3OOK A;  1ZGY A;  2OCF A;  1XNX A;  3UP3 A;  1ILG A;  3MNP A;  1SKX A;  4UDC A;  2Q59 A;  1NRL A;  3AZ3 A;  3G8I A;  5DK9 A;  3A78 A;  1A28 A;  3CWD A;  5ICK A;  3P0U A;  3BEJ A;  4UDA A;  2O4J A;  2ZK3 A;  3FLI A;  3L03 A;  4RUP A;  3KBA A;  4LNW A;  4RZG A;  3CQV A;  3G9E A;  2Z4J A;  2ZK2 A;  3OZJ A;  4X1G A;  3B0R A;  4YPQ A;  2NW4 A;  2PIT A;  1OVL A;  1R5K A;  1S9P A;  5HYR A;  1T7T A;  5C4T A;  4IS8 A;  1ZDT A;  3HZF A;  4S0T A;  3WT6 A;  4R6S A;  2B1V A;  2PNU A;  1WM0 X;  2IOK A;  1YOK A;  4DOR A;  3FEJ A;  4WPF A;  5KCU A;  5L7E A;  3W5P A;  4P6X A;  1ZH7 A;  2JFA A;  3O1E A;  4OFR A;  1T7R A;  2GPP A;  1NQ2 A;  2VV3 A;  2Q5G A;  4ONI A;  1LBD A;  4S15 A;  1S0Z A;  3OLF A;  1T63 A;  2OVM A;  3FUG A;  4IVY A;  4PPP A;  4WVD A;  4LTW A;  5E1C A;  2Q60 A;  2POB A;  2P1T A;  3BQD A;  3F5C B;  4PWL A;  3W5R A;  5G46 A;  1SJ0 A;  2Q7K A;  2QPY A;  5AAU A;  4O8F A;  5DP0 A;  4CSJ A;  1XP6 A;  2GWX A;  3AUQ A;  2AX7 A;  4E4K A;  4RUO X;  3ZRA A;  2PJL A;  4QJR A;  2E2R A;  4RWV A;  2ZNQ A;  3TKM A;  5M96 A;  2QA8 B;  4XT9 A;  1YP0 A;  4ZNV A;  2OAX A;  3R5N A;  3P8X A;  3KMZ A;  1T7M A;  3UUA A;  1GWR A;  1XLS A;  2BAW A;  2AX8 A;  1YOW A;  2AO6 A;  4QM0 A;  2YAT A;  4XI3 A;  1Y9R A;  4YNK A;  4ZNW A;  4IQR A;  5DID A;  4JGV A;  4IV2 A;  2R6Y A;  4MGB A;  4OGH A;  3W0J A;  3IPU A;  5GID A;  1PRG A;  2ZLA A;  2HVC A;  1EXA A;  2JJ3 A;  2V7C A;  1FM6 A;  3ADW A;  4TV1 B;  3V3E A;  4RMD A;  2HCD A;  5JJM B;  2ZAS A;  3OS8 A;  2QGT A;  3L0L A;  4PRG A;  2G44 A;  3V4A A;  2QH6 A;  4OIU A;  5B41 A;  1U3Q A;  1XLS E;  1XV9 B;  2HAS A;  1XNN A;  3WMH A;  3VJS A;  1FM9 D;  1Z5X U;  3AN3 A;  4WHF A;  1DKF B;  5KCF A;  3RUT A;  5G42 A;  1UPW A;  3VT9 A;  3B5R A;  3VSO A;  4ZI1 A;  1OSV A;  3ET3 A;  4J5W A;  1XP9 A;  1XQC A;  1PQ6 A;  2G0G A;  3FC6 B;  4OJB A;  1OSH A;  5AZV A;  3ADS A;  4Y29 A;  2ZMI A;  5EIT A;  1K7L A;  3GWS X;  5E7V A;  3VJT A;  4R2U A;  3X1H A;  5KRL A;  1ZEO A;  2Q59 B;  4RE8 A;  4OLM A;  1N46 A;  3R29 A;  4G21 A;  3X31 A;  3CDP A;  2PIO A;  3DR1 A;  3KDT A;  5DKG A;  2FSZ A;  2ZK4 A;  3B0W A;  3VT4 A;  2Q6R A;  4ZJW A;  2R40 D;  1FCY A;  2J4A A;  4DM8 A;  3DT3 A;  2GTK A;  5DVC A;  1PQC A;  3PRG A;  1NQ0 A;  1OVL B;  4DOS A;  3ERD A;  3UUD A;  5KYJ A;  1I7I A;  2HC4 A;  4MG8 B;  5APH A;  2HFP A;  4FNE A;  5KRC A;  1X7B A;  3F5C A;  4QE8 A;  2PIU A;  3DZY A;  1RKG A;  2VV4 B;  4EMA A;  3A2H A;  1QKU A;  4EM9 A;  3K22 A;  3IPS A;  2JFA B;  3OSI A;  4OED A;  2QE4 A;  3DZU A;  2PRG A;  4OKX A;  1FCX A;  3GWX A;  3OMP A;  2OZ7 A;  5CJ6 A;  1GWX A;  4OH5 A;  1NDE A;  3TY0 A;  5IAW A;  3A3Z X;  2Q1H A;  5DKE A;  3H52 A;  4OKT A;  1QKM A;  4IWF A;  1L2I A;  2P7Z A;  2VV1 A;  4LBD A;  1R20 A;  5DXQ A;  5KD9 A;  3TKC A;  4NQA B;  4A2J A;  5KR9 A;  4XUM A;  3JZB A;  4HEE X;  3VRV A;  2J7X A;  1X78 A;  4ZNU A;  3W0C A;  2GP7 A;  1Y0X X;  3EYB A;  1UOM A;  3OSW A;  1QKN A;  4OKW A;  4XAO A;  3UUA B;  3A9E A;  3ET0 A;  3WJ5 A;  3OLL A;  5C4S A;  5DV6 A;  4UDD A;  2YFE A;  3DCT A;  3KMG A;  3AZ1 A;  4MGB B;  2QTU A;  1A52 A;  1UPV A;  2A3I A;  2JF9 A;  4NY9 A;  4IA1 A;  2REW A;  5ETH A;  4JAZ A;  3SP6 A;  2Q1V A;  4OEY A;  4ZN7 A;  1NHZ A;  1Q4X A;  4MGD A;  2VSR A;  5EC9 A;  5AVL A;  1KV6 A;  1GWQ A;  2FAI A;  1G2N A;  2ZNN A;  1K4W A;  3IXP D;  3OSA A;  4FHH A;  5B5B A;  1X7E A;  1K74 D;  3B1M A;  3GN8 A;  5EI1 A;  3H0A A;  5AAV B;  2VV0 A;  3E00 A;  3VJH A;  4M8H A;  5L7H A;  3UVV A;  2G5O A;  2QMV A;  2Q7I A;  3R5M A;  1I7G A;  1XVP B;  5HJS A;  3D6D A;  4NUF A;  3SZ1 A;  3GD2 A;  3OKH A;  3VRW A;  2ZLC A;  3CDS A;  3HM1 A;  1MVC A;  1X7J A;  3NOA A;  4OZT U;  5DUG A;  4J24 A;  2P7G A;  5AZT A;  1IE8 A;  4OJ4 A;  4OH6 A;  3FEI A;  2AB2 A;  1RJK A;  4MG7 A;  5G3J A;  5JI0 D;  4MG8 A;  2ACL A;  1Y0S A;  2ZMJ A;  5DX3 A;  2VV4 A;  4ZJR A;  3L3Z A;  3CS8 A;  4OK1 A;  3T03 A;  4E4Q A;  4Q0A C;  1SQN A;  2AXA A;  2H79 A;  2VV2 A;  5L11 A;  1T76 A;  2GIU A;  2B23 A;  3UUD B;  3AX8 A;  1MV9 A;  3W0A A;  5ACC A;  4QL8 A;  1PK5 A;  3B65 A;  5DSH A;  2P7A A;  1U3R A;  4BCR A;  3F7D A;  2AAX A;  4G1Y A;  5DZ1 A;  5DWL A;  3HQ5 A;  5DXM A;  5FQR A;  2XHS A;  3AZ2 A;  4PVU A;  3WFF A;  3W5Q A;  2ZXZ A;  2ZK5 A;  3D5F A;  3R2A A;  2Q3Y A;  2QGW A;  5DMC A;  1UHL A;  5E19 A;  2Z4B A;  4N73 A;  4MG5 A;  5DXP A;  4JL4 A;  4TUZ A;  2VV1 B;  2LBD A;  3KFC A;  2J7Y A;  1TXI A;  1SR7 A;  3JZC A;  2YJD A;  3OKI A;  4J5X C;  4PF3 A;  4QK4 A;  4REF A;  2NPA A;  1RDT A;  2AA6 A;  2YLO A;  2GPV A;  2I4J A;  3ET2 A;  2QAB A;  3ADX A;  4MGC A;  5DUE A;  5FQS A;  5A86 A;  1XZX X;  1DB1 A;  4IV4 A;  2W8Y A;  4PXM A;  3DZU D;  2I0J A;  3A9E B;  3P88 A;  1HG4 A;  1PQ9 A;  4K4J A;  4OZR U;  4UDB A;  4RZE A;  1XIU A;  5KRO A;  3NSQ A;  5AVI A;  5AAV A;  4PLE A;  1R1K D;  4OKB A;  2VST A;  1NYX A;  3LBD A;  1S19 A;  1XVP A;  4POJ A;  4X1F A;  1R20 D;  4IA7 A;  4G1Z A;  4MGD B;  5DYB A;  4RAK A;  3X1I A;  1FCZ A;  3O1D A;  1YYE A;  1ZKY A;  4ZNT A;  2QXM A;  2ZK1 A;  5HYK A;  2ZKC A;  1N4H A;  1E3K A;  2P4Y A;  3OMK A;  4OAR A;  5DZ0 A;  2R6W A;  3L0J A;  3UVV B;  3GZ9 A;  4MG9 B;  3WGP A;  3AUR A;  4KZI A;  1P93 A;  5AWJ A;  2ZVT A;  4DMA A;  1I38 A;  4RUJ A;  3OAP A;  5DI7 A;  5EJV A;  4PLD A;  3B67 A;  4JYH A;  2ZNP A;  2ZMH A;  5FQV A;  3VSP A;  5DWI A;  3MNO A;  5DKB A;  2AMA A;  2PIX A;  3NSP A;  3W0H A;  4ZO1 X;  3D57 A;  5DZ3 A;  3PLZ A;  2Q5P A;  5DXB A;  4A4W A;  4OIL A;  5KRJ A;  4MG7 B;  3OMQ A;  4IA2 A;  3VRU A;  2ACL B;  3CTB A;  4E2J A;  5DX3 B;  2OM9 A;  2OUZ A;  2Q8S A;  1NQ7 A;  2BJ4 A;  3H0A D;  4OEZ A;  3OMO A;  4IU7 A;  2QXS A;  5KRM A;  3LMP A;  2QA6 A;  2QNV A;  1YA3 A;  3B3K A;  5DV8 A;  1HJ1 A;  4FN9 A;  4XLD A;  5FQT A;  5G45 A;  4PPS A;  3RUU A;  3HC6 A;  3X36 A;  1X7R A;  1YIM A;  5DXE A;  3VI8 A;  3VRT A;  4DK8 A;  2AA2 A;  1T5Z A;  3WT7 A;  3VT6 A;  1M2Z A;  2AWH A;  5HJP A;  5L7G A;  3GYT A;  5DXR A;  5KRK A;  4WQP A;  4QE6 A;  5C4U A;  3L1B A;  1VJB A;  1I37 A;  4CI4 A;  1Z5X E;  2FVJ A;  1N83 A;  4XUH A;  4DK7 A;  3D24 A;  3AN4 A;  3GBK A;  3BC5 A;  1FBY A;  4XTA A;  1UHL B;  4ZO1 B;  1XB7 A;  4IW6 A;  4TUZ B;  2GPU A;  2YJA B;  2XYX A;  2AA5 A;  3V3Q A;  2PIV A;  3VN2 A;  4R06 A;  1G1U A;  4APU A;  4M8E A;  3S9S A;  4MDD A;  3RVF A;  5APJ A;  2AMB A;  4KZM A;  5KCT A;  2QW4 A;  2ZK0 A;  1T73 A;  3HOD A;  4N1Y A;  5DU5 A;  3VT7 A;  1NUO A;  2B1Z A;  4JYI A;  5APK A;  5DVS A;  3Q95 A;  2QZO A;  3VTD A;  1YUC A;  5G43 A;  2AM9 A;  4LSJ A;  4OEA A;  4MG9 A;  3W5T A;  3OZ0 A;  2PIP L;  1RKH A;  1ERE A;  1NQ1 A;  2HAR A;  1XP1 A;  5DIE A;  1RDT D;  5AWK A;  2PIW A;  3RY9 A;  1PZL A;  1XDK A;  3AUN A;  5FQP A;  1KKQ A;  1FM6 D;  3UU7 B;  4CI5 A;  5LWP A;  2R40 A;  5KCD A;  3D90 A;  2YLY A;  5KRF A;  3B68 A;  2P1U A;  5DWG A;  1IE9 A;  1XJ7 A;  3V9V A;  4ZOM A;  3VT5 A;  4IA3 A;  1G50 A;  4G2H A;  5DIG A;  3FS1 A;  5KYA A;  5DMF A;  4L98 A;  2ZXM A;  4J26 A;  2Q6J A;  4RME A;  1XOW A;  2ZBS A;  3ADT A;  5DXB B;  3WWR A;  3PCU A;  5GIC A;  2Q61 A;  2ABI A;  3OS8 C;  5KRH A;  2BJ4 B;  2PKL A;  3B66 A;  5DXG A;  2I4P A;  2NV7 A;  3VT8 A;  4L96 A;  3VTB A;  4OFU A;  4OJ9 A;  2Q5S A;  3PEQ A;  1FD0 A;  3A2I A;  2HBH A;  3G8O A;  3K8S A;  5DV3 A;  3VT3 A;  5IZ0 A;  5HJP B;  3R8A A;  1YY4 A;  4J5W C;  1H9U A;  3ADU A;  3DCU A;  4P6W A;  4YMQ A;  2YLQ A;  1ILH A;  5G44 A;  3FAL B;  4ZN9 A;  3OMM A;  3M7R A;  3HLV A;  2B50 A;  5GIE A;  4A4V A;  5HZC A;  3UP0 A;  5DTV A;  2GPO A;  1YMT A;  2Q7J A;  2V0V A;  2AYR A;  3UUC A;  1XQ3 A;  2P54 A;  2XKW A;  3B0Q A;  1LV2 A;  1MZN A;  3K6P A;  5E14 A;  5IXK A;  3DZY D;  2O4R A;  2XYJ A;  4MG6 A;  2POG A;  3MNE A;  3B0T A;  4OZT E;  3ET1 A;  2NXX A;  5GT4 A;  1BSX A;  1XPC A;  1ZDU A;  4N8R A;  5E15 A;  3CS4 A;  3IXP A;  5G5W A;  3KWY A;  4MGA A;  1K74 A;  1OT7 A;  4PP5 A;  4YT1 A;  3A2J A;  3R8D A;  2Q7L A;  1M13 A;  5KCE A;  3VTC A;  3HC5 A;  4K7A A;  4DM6 A;  5C4O A;  3G0W A;  3KPZ A;  1G5Y A;  2H77 A;  2PIN A;  1M7W A;  3ADV A;  5DKS A;  1QKT A;  3Q95 B;  2QZO B;  5EGV A;  3U9Q A;  3VHV A;  1R6G A;  2Q6S A;  3UU7 A;  4N5G A;  1YIN A;  2IHQ A;  3QT0 A;  5DXK A;  2NXX E;  1P8D A;  1T79 A;  4PP6 A;  2ZY0 A;  5DL4 A;  5EHJ A;  3VHW A;  3W0G A;  2AA7 A;  5KCC A;  2XYW A;  5AYG A;  4F9M A;  5DY8 A;  4IWC A;  2ZNO A;  3L3X A;  3OS9 A;  4K6I A;  5AK2 A;  5DYD A;  3CJW A;  1ZAF A;  3VJI A;  2F4B A;  3KDU A;  3PBA A;  4Q50 A;  4JYG A;  4IW8 A;  1XDK B;  4POH A;  1RK3 A;  3OOF A;  3HO0 A;  2PIQ A;  2PIR A;  5DZI A;  4B7W A;  2Q70 A;  3CS6 A;  4OHA A;  3ILZ A;  2P1V A;  5DWJ A;  1TFC A;  3E00 D;  4OIV A;  5K13 A;  4J5X A;  3IMY A;  4RFW A;  1Z95 A; 
#chains in the Genus database with same CATH topology
 4ITF A;  4WLB A;  5H1E A;  5KRI A;  5KCW A;  4Q13 A;  4G20 A;  4OZR E;  2J14 A;  2ZL9 A;  5F9B A;  2ZFX A;  4S0S A;  3V49 A;  3K23 A;  3RLL A;  3FAL A;  4FGY A;  3HVL A;  3R8I A;  2HB7 A;  1YJE A;  4IUI A;  3E7C A;  5E0X A;  1XAP A;  3E94 A;  2I4Z A;  3KYT A;  1U9E A;  5I4V A;  4OC7 A;  3WFG A;  1NAV A;  4NIE A;  4RMC A;  3ERT A;  3CLD A;  5DRM A;  3KMR A;  1S0X A;  2QSE A;  4IVW A;  1T65 A;  3IPQ A;  1T74 A;  2YLP A;  2I0G A;  5DLR A;  2HWQ A;  2G0H A;  4DQM A;  1T7F A;  4S14 A;  4FHI A;  4KZJ A;  2AX6 A;  3WTQ A;  5HCV A;  3VHU A;  1ZUC A;  5DZH A;  3ZRB A;  5DRJ A;  2YHD A;  4ITE A;  3WJ4 A;  1PCG A;  2QA8 A;  1S9Q A;  3SP9 A;  3W0I A;  4RZF A;  1FM9 A;  1X76 A;  3GYU A;  4NB6 A;  4XHD A;  5JY3 A;  1R1K A;  2ZXN A;  3FUR A;  3DY6 A;  3L0E A;  3ZQT A;  1E3G A;  3AFR A;  5DWE A;  3V9Y A;  3A40 X;  5SYZ A;  2ZK6 A;  4MGA B;  1EXX A;  4ZNH A;  2GL8 A;  3P89 A;  2EWP A;  4REE A;  4TV1 A;  3RLJ A;  2HB8 A;  5JJM A;  4HLW A;  4G1D A;  5DVV A;  3V9T A;  3W0Y A;  1PDU A;  1ERR A;  1U3S A;  2HAM A;  4ZNS A;  5KRA A;  1KNU A;  1XV9 A;  2OVH A;  3IA6 A;  5LGA A;  1L2J A;  3FXV A;  2AX9 A;  4PP3 A;  1DKF A;  3WT5 A;  3ZR7 A;  1GS4 A;  3N00 A;  3OGT A;  4WHG A;  2QR9 A;  3OLS A;  3FC6 A;  2ATH A;  2O9I A;  4G2I A;  5DUH A;  3TX7 B;  2P15 A;  1NAX A;  2HWR A;  3PO9 A;  2IOG A;  4LNX A;  5E0W A;  3OOK A;  1ZGY A;  2OCF A;  1XNX A;  3UP3 A;  1ILG A;  3MNP A;  1SKX A;  4UDC A;  2Q59 A;  1NRL A;  3AZ3 A;  3G8I A;  5DK9 A;  3A78 A;  1A28 A;  3CWD A;  5ICK A;  3P0U A;  3BEJ A;  4UDA A;  2O4J A;  2ZK3 A;  3FLI A;  3L03 A;  4RUP A;  3KBA A;  4LNW A;  4RZG A;  3CQV A;  3G9E A;  2Z4J A;  2ZK2 A;  3OZJ A;  4X1G A;  3B0R A;  4YPQ A;  2NW4 A;  2PIT A;  1OVL A;  1R5K A;  1S9P A;  5HYR A;  1T7T A;  5C4T A;  4IS8 A;  1ZDT A;  3HZF A;  4S0T A;  3WT6 A;  4R6S A;  2B1V A;  2PNU A;  1WM0 X;  2IOK A;  1YOK A;  4DOR A;  3FEJ A;  4WPF A;  5KCU A;  5L7E A;  3W5P A;  4P6X A;  1ZH7 A;  2JFA A;  3O1E A;  4OFR A;  1T7R A;  2GPP A;  1NQ2 A;  2VV3 A;  2Q5G A;  4ONI A;  1LBD A;  4S15 A;  1S0Z A;  3OLF A;  1T63 A;  2OVM A;  3FUG A;  4IVY A;  4PPP A;  4WVD A;  4LTW A;  5E1C A;  2Q60 A;  2POB A;  2P1T A;  3BQD A;  3F5C B;  4PWL A;  3W5R A;  5G46 A;  1SJ0 A;  2Q7K A;  2QPY A;  5AAU A;  4O8F A;  5DP0 A;  4CSJ A;  1XP6 A;  2GWX A;  3AUQ A;  2AX7 A;  4E4K A;  4RUO X;  3ZRA A;  2PJL A;  4QJR A;  2E2R A;  4RWV A;  2ZNQ A;  3TKM A;  5M96 A;  2QA8 B;  4XT9 A;  1YP0 A;  4ZNV A;  2OAX A;  3R5N A;  3P8X A;  3KMZ A;  1T7M A;  3UUA A;  1GWR A;  1XLS A;  2BAW A;  2AX8 A;  1YOW A;  2AO6 A;  4QM0 A;  2YAT A;  4XI3 A;  1Y9R A;  4YNK A;  4ZNW A;  4IQR A;  5DID A;  4JGV A;  4IV2 A;  2R6Y A;  4MGB A;  4OGH A;  3W0J A;  3IPU A;  5GID A;  1PRG A;  2ZLA A;  2HVC A;  1EXA A;  2JJ3 A;  2V7C A;  1FM6 A;  3ADW A;  4TV1 B;  3V3E A;  4RMD A;  2HCD A;  5JJM B;  2ZAS A;  3OS8 A;  2QGT A;  3L0L A;  4PRG A;  2G44 A;  3V4A A;  2QH6 A;  4OIU A;  5B41 A;  1U3Q A;  1XLS E;  1XV9 B;  2HAS A;  1XNN A;  3WMH A;  3VJS A;  1FM9 D;  1Z5X U;  3AN3 A;  4WHF A;  1DKF B;  5KCF A;  3RUT A;  5G42 A;  1UPW A;  3VT9 A;  3B5R A;  3VSO A;  4ZI1 A;  1OSV A;  3ET3 A;  4J5W A;  1XP9 A;  1XQC A;  1PQ6 A;  2G0G A;  3FC6 B;  4OJB A;  1OSH A;  5AZV A;  3ADS A;  4Y29 A;  2ZMI A;  5EIT A;  1K7L A;  3GWS X;  5E7V A;  3VJT A;  4R2U A;  3X1H A;  5KRL A;  1ZEO A;  2Q59 B;  4RE8 A;  4OLM A;  1N46 A;  3R29 A;  4G21 A;  3X31 A;  3CDP A;  2PIO A;  3DR1 A;  3KDT A;  5DKG A;  2FSZ A;  2ZK4 A;  3B0W A;  3VT4 A;  2Q6R A;  4ZJW A;  2R40 D;  1FCY A;  2J4A A;  4DM8 A;  3DT3 A;  2GTK A;  5DVC A;  1PQC A;  3PRG A;  1NQ0 A;  1OVL B;  4DOS A;  3ERD A;  3UUD A;  5KYJ A;  1I7I A;  2HC4 A;  4MG8 B;  5APH A;  2HFP A;  4FNE A;  5KRC A;  1X7B A;  3F5C A;  4QE8 A;  2PIU A;  3DZY A;  1RKG A;  2VV4 B;  4EMA A;  3A2H A;  1QKU A;  4EM9 A;  3K22 A;  3IPS A;  2JFA B;  3OSI A;  4OED A;  2QE4 A;  3DZU A;  2PRG A;  4OKX A;  1FCX A;  3GWX A;  3OMP A;  2OZ7 A;  5CJ6 A;  1GWX A;  4OH5 A;  1NDE A;  3TY0 A;  5IAW A;  3A3Z X;  2Q1H A;  5DKE A;  3H52 A;  4OKT A;  1QKM A;  4IWF A;  1L2I A;  2P7Z A;  2VV1 A;  4LBD A;  1R20 A;  5DXQ A;  5KD9 A;  3TKC A;  4NQA B;  4A2J A;  5KR9 A;  4XUM A;  3JZB A;  4HEE X;  3VRV A;  2J7X A;  1X78 A;  4ZNU A;  3W0C A;  2GP7 A;  1Y0X X;  3EYB A;  1UOM A;  3OSW A;  1QKN A;  4OKW A;  4XAO A;  3UUA B;  3A9E A;  3ET0 A;  3WJ5 A;  3OLL A;  5C4S A;  5DV6 A;  4UDD A;  2YFE A;  3DCT A;  3KMG A;  3AZ1 A;  4MGB B;  2QTU A;  1A52 A;  1UPV A;  2A3I A;  2JF9 A;  4NY9 A;  4IA1 A;  2REW A;  5ETH A;  4JAZ A;  3SP6 A;  2Q1V A;  4OEY A;  4ZN7 A;  1NHZ A;  1Q4X A;  4MGD A;  2VSR A;  5EC9 A;  5AVL A;  1KV6 A;  1GWQ A;  2FAI A;  1G2N A;  2ZNN A;  1K4W A;  3IXP D;  3OSA A;  4FHH A;  5B5B A;  1X7E A;  1K74 D;  3B1M A;  3GN8 A;  5EI1 A;  3H0A A;  5AAV B;  2VV0 A;  3E00 A;  3VJH A;  4M8H A;  5L7H A;  3UVV A;  2G5O A;  2QMV A;  2Q7I A;  3R5M A;  1I7G A;  1XVP B;  5HJS A;  3D6D A;  4NUF A;  3SZ1 A;  3GD2 A;  3OKH A;  3VRW A;  2ZLC A;  3CDS A;  3HM1 A;  1MVC A;  1X7J A;  3NOA A;  4OZT U;  5DUG A;  4J24 A;  2P7G A;  5AZT A;  1IE8 A;  4OJ4 A;  4OH6 A;  3FEI A;  2AB2 A;  1RJK A;  4MG7 A;  5G3J A;  5JI0 D;  4MG8 A;  2ACL A;  1Y0S A;  2ZMJ A;  5DX3 A;  2VV4 A;  4ZJR A;  3L3Z A;  3CS8 A;  4OK1 A;  3T03 A;  4E4Q A;  4Q0A C;  1SQN A;  2AXA A;  2H79 A;  2VV2 A;  5L11 A;  1T76 A;  2GIU A;  2B23 A;  3UUD B;  3AX8 A;  1MV9 A;  3W0A A;  5ACC A;  4QL8 A;  1PK5 A;  3B65 A;  5DSH A;  2P7A A;  1U3R A;  4BCR A;  3F7D A;  2AAX A;  4G1Y A;  5DZ1 A;  5DWL A;  3HQ5 A;  5DXM A;  5FQR A;  2XHS A;  3AZ2 A;  4PVU A;  3WFF A;  3W5Q A;  2ZXZ A;  2ZK5 A;  3D5F A;  3R2A A;  2Q3Y A;  2QGW A;  5DMC A;  1UHL A;  5E19 A;  2Z4B A;  4N73 A;  4MG5 A;  5DXP A;  4JL4 A;  4TUZ A;  2VV1 B;  2LBD A;  3KFC A;  2J7Y A;  1TXI A;  1SR7 A;  3JZC A;  2YJD A;  3OKI A;  4J5X C;  4PF3 A;  4QK4 A;  4REF A;  2NPA A;  1RDT A;  2AA6 A;  2YLO A;  2GPV A;  2I4J A;  3ET2 A;  2QAB A;  3ADX A;  4MGC A;  5DUE A;  5FQS A;  5A86 A;  1XZX X;  1DB1 A;  4IV4 A;  2W8Y A;  4PXM A;  3DZU D;  2I0J A;  3A9E B;  3P88 A;  1HG4 A;  1PQ9 A;  4K4J A;  4OZR U;  4UDB A;  4RZE A;  1XIU A;  5KRO A;  3NSQ A;  5AVI A;  5AAV A;  4PLE A;  1R1K D;  4OKB A;  2VST A;  1NYX A;  3LBD A;  1S19 A;  1XVP A;  4POJ A;  4X1F A;  1R20 D;  4IA7 A;  4G1Z A;  4MGD B;  5DYB A;  4RAK A;  3X1I A;  1FCZ A;  3O1D A;  1YYE A;  1ZKY A;  4ZNT A;  2QXM A;  2ZK1 A;  5HYK A;  2ZKC A;  1N4H A;  1E3K A;  2P4Y A;  3OMK A;  4OAR A;  5DZ0 A;  2R6W A;  3L0J A;  3UVV B;  3GZ9 A;  4MG9 B;  3WGP A;  3AUR A;  4KZI A;  1P93 A;  5AWJ A;  2ZVT A;  4DMA A;  1I38 A;  4RUJ A;  3OAP A;  5DI7 A;  5EJV A;  4PLD A;  3B67 A;  4JYH A;  2ZNP A;  2ZMH A;  5FQV A;  3VSP A;  5DWI A;  3MNO A;  5DKB A;  2AMA A;  2PIX A;  3NSP A;  3W0H A;  4ZO1 X;  3D57 A;  5DZ3 A;  3PLZ A;  2Q5P A;  5DXB A;  4A4W A;  4OIL A;  5KRJ A;  4MG7 B;  3OMQ A;  4IA2 A;  3VRU A;  2ACL B;  3CTB A;  4E2J A;  5DX3 B;  2OM9 A;  2OUZ A;  2Q8S A;  1NQ7 A;  2BJ4 A;  3H0A D;  4OEZ A;  3OMO A;  4IU7 A;  2QXS A;  5KRM A;  3LMP A;  2QA6 A;  2QNV A;  1YA3 A;  3B3K A;  5DV8 A;  1HJ1 A;  4FN9 A;  4XLD A;  5FQT A;  5G45 A;  4PPS A;  3RUU A;  3HC6 A;  3X36 A;  1X7R A;  1YIM A;  5DXE A;  3VI8 A;  3VRT A;  4DK8 A;  2AA2 A;  1T5Z A;  3WT7 A;  3VT6 A;  1M2Z A;  2AWH A;  5HJP A;  5L7G A;  3GYT A;  5DXR A;  5KRK A;  4WQP A;  4QE6 A;  5C4U A;  3L1B A;  1VJB A;  1I37 A;  4CI4 A;  1Z5X E;  2FVJ A;  1N83 A;  4XUH A;  4DK7 A;  3D24 A;  3AN4 A;  3GBK A;  3BC5 A;  1FBY A;  4XTA A;  1UHL B;  4ZO1 B;  1XB7 A;  4IW6 A;  4TUZ B;  2GPU A;  2YJA B;  2XYX A;  2AA5 A;  3V3Q A;  2PIV A;  3VN2 A;  4R06 A;  1G1U A;  4APU A;  4M8E A;  3S9S A;  4MDD A;  3RVF A;  5APJ A;  2AMB A;  4KZM A;  5KCT A;  2QW4 A;  2ZK0 A;  1T73 A;  3HOD A;  4N1Y A;  5DU5 A;  3VT7 A;  1NUO A;  2B1Z A;  4JYI A;  5APK A;  5DVS A;  3Q95 A;  2QZO A;  3VTD A;  1YUC A;  5G43 A;  2AM9 A;  4LSJ A;  4OEA A;  4MG9 A;  3W5T A;  3OZ0 A;  2PIP L;  1RKH A;  1ERE A;  1NQ1 A;  2HAR A;  1XP1 A;  5DIE A;  1RDT D;  5AWK A;  2PIW A;  3RY9 A;  1PZL A;  1XDK A;  3AUN A;  5FQP A;  1KKQ A;  1FM6 D;  3UU7 B;  4CI5 A;  5LWP A;  2R40 A;  5KCD A;  3D90 A;  2YLY A;  5KRF A;  3B68 A;  2P1U A;  5DWG A;  1IE9 A;  1XJ7 A;  3V9V A;  4ZOM A;  3VT5 A;  4IA3 A;  1G50 A;  4G2H A;  5DIG A;  3FS1 A;  5KYA A;  5DMF A;  4L98 A;  2ZXM A;  4J26 A;  2Q6J A;  4RME A;  1XOW A;  2ZBS A;  3ADT A;  5DXB B;  3WWR A;  3PCU A;  5GIC A;  2Q61 A;  2ABI A;  3OS8 C;  5KRH A;  2BJ4 B;  2PKL A;  3B66 A;  5DXG A;  2I4P A;  2NV7 A;  3VT8 A;  4L96 A;  3VTB A;  4OFU A;  4OJ9 A;  2Q5S A;  3PEQ A;  1FD0 A;  3A2I A;  2HBH A;  3G8O A;  3K8S A;  5DV3 A;  3VT3 A;  5IZ0 A;  5HJP B;  3R8A A;  1YY4 A;  4J5W C;  1H9U A;  3ADU A;  3DCU A;  4P6W A;  4YMQ A;  2YLQ A;  1ILH A;  5G44 A;  3FAL B;  4ZN9 A;  3OMM A;  3M7R A;  3HLV A;  2B50 A;  5GIE A;  4A4V A;  5HZC A;  3UP0 A;  5DTV A;  2GPO A;  1YMT A;  2Q7J A;  2V0V A;  2AYR A;  3UUC A;  1XQ3 A;  2P54 A;  2XKW A;  3B0Q A;  1LV2 A;  1MZN A;  3K6P A;  5E14 A;  5IXK A;  3DZY D;  2O4R A;  2XYJ A;  4MG6 A;  2POG A;  3MNE A;  3B0T A;  4OZT E;  3ET1 A;  2NXX A;  5GT4 A;  1BSX A;  1XPC A;  1ZDU A;  4N8R A;  5E15 A;  3CS4 A;  3IXP A;  5G5W A;  3KWY A;  4MGA A;  1K74 A;  1OT7 A;  4PP5 A;  4YT1 A;  3A2J A;  3R8D A;  2Q7L A;  1M13 A;  5KCE A;  3VTC A;  3HC5 A;  4K7A A;  4DM6 A;  5C4O A;  3G0W A;  3KPZ A;  1G5Y A;  2H77 A;  2PIN A;  1M7W A;  3ADV A;  5DKS A;  1QKT A;  3Q95 B;  2QZO B;  5EGV A;  3U9Q A;  3VHV A;  1R6G A;  2Q6S A;  3UU7 A;  4N5G A;  1YIN A;  2IHQ A;  3QT0 A;  5DXK A;  2NXX E;  1P8D A;  1T79 A;  4PP6 A;  2ZY0 A;  5DL4 A;  5EHJ A;  3VHW A;  3W0G A;  2AA7 A;  5KCC A;  2XYW A;  5AYG A;  4F9M A;  5DY8 A;  4IWC A;  2ZNO A;  3L3X A;  3OS9 A;  4K6I A;  5AK2 A;  5DYD A;  3CJW A;  1ZAF A;  3VJI A;  2F4B A;  3KDU A;  3PBA A;  4Q50 A;  4JYG A;  4IW8 A;  1XDK B;  4POH A;  1RK3 A;  3OOF A;  3HO0 A;  2PIQ A;  2PIR A;  5DZI A;  4B7W A;  2Q70 A;  3CS6 A;  4OHA A;  3ILZ A;  2P1V A;  5DWJ A;  1TFC A;  3E00 D;  4OIV A;  5K13 A;  4J5X A;  3IMY A;  4RFW A;  1Z95 A; 
#chains in the Genus database with same CATH homology
 4ITF A;  4WLB A;  5H1E A;  5KRI A;  5KCW A;  4Q13 A;  4G20 A;  4OZR E;  2J14 A;  2ZL9 A;  5F9B A;  2ZFX A;  4S0S A;  3V49 A;  3K23 A;  3RLL A;  3FAL A;  4FGY A;  3HVL A;  3R8I A;  2HB7 A;  1YJE A;  4IUI A;  3E7C A;  5E0X A;  1XAP A;  3E94 A;  2I4Z A;  3KYT A;  1U9E A;  5I4V A;  4OC7 A;  3WFG A;  1NAV A;  4NIE A;  4RMC A;  3ERT A;  3CLD A;  5DRM A;  3KMR A;  1S0X A;  2QSE A;  4IVW A;  1T65 A;  3IPQ A;  1T74 A;  2YLP A;  2I0G A;  5DLR A;  2HWQ A;  2G0H A;  4DQM A;  1T7F A;  4S14 A;  4FHI A;  4KZJ A;  2AX6 A;  3WTQ A;  5HCV A;  3VHU A;  1ZUC A;  5DZH A;  3ZRB A;  5DRJ A;  2YHD A;  4ITE A;  3WJ4 A;  1PCG A;  2QA8 A;  1S9Q A;  3SP9 A;  3W0I A;  4RZF A;  1FM9 A;  1X76 A;  3GYU A;  4NB6 A;  4XHD A;  5JY3 A;  1R1K A;  2ZXN A;  3FUR A;  3DY6 A;  3L0E A;  3ZQT A;  1E3G A;  3AFR A;  5DWE A;  3V9Y A;  3A40 X;  5SYZ A;  2ZK6 A;  4MGA B;  1EXX A;  4ZNH A;  2GL8 A;  3P89 A;  2EWP A;  4REE A;  4TV1 A;  3RLJ A;  2HB8 A;  5JJM A;  4HLW A;  4G1D A;  5DVV A;  3V9T A;  3W0Y A;  1PDU A;  1ERR A;  1U3S A;  2HAM A;  4ZNS A;  5KRA A;  1KNU A;  1XV9 A;  2OVH A;  3IA6 A;  5LGA A;  1L2J A;  3FXV A;  2AX9 A;  4PP3 A;  1DKF A;  3WT5 A;  3ZR7 A;  1GS4 A;  3N00 A;  3OGT A;  4WHG A;  2QR9 A;  3OLS A;  3FC6 A;  2ATH A;  2O9I A;  4G2I A;  5DUH A;  3TX7 B;  2P15 A;  1NAX A;  2HWR A;  3PO9 A;  2IOG A;  4LNX A;  5E0W A;  3OOK A;  1ZGY A;  2OCF A;  1XNX A;  3UP3 A;  1ILG A;  3MNP A;  1SKX A;  4UDC A;  2Q59 A;  1NRL A;  3AZ3 A;  3G8I A;  5DK9 A;  3A78 A;  1A28 A;  3CWD A;  5ICK A;  3P0U A;  3BEJ A;  4UDA A;  2O4J A;  2ZK3 A;  3FLI A;  3L03 A;  4RUP A;  3KBA A;  4LNW A;  4RZG A;  3CQV A;  3G9E A;  2Z4J A;  2ZK2 A;  3OZJ A;  4X1G A;  3B0R A;  4YPQ A;  2NW4 A;  2PIT A;  1OVL A;  1R5K A;  1S9P A;  5HYR A;  1T7T A;  5C4T A;  4IS8 A;  1ZDT A;  3HZF A;  4S0T A;  3WT6 A;  4R6S A;  2B1V A;  2PNU A;  1WM0 X;  2IOK A;  1YOK A;  4DOR A;  3FEJ A;  4WPF A;  5KCU A;  5L7E A;  3W5P A;  4P6X A;  1ZH7 A;  2JFA A;  3O1E A;  4OFR A;  1T7R A;  2GPP A;  1NQ2 A;  2VV3 A;  2Q5G A;  4ONI A;  1LBD A;  4S15 A;  1S0Z A;  3OLF A;  1T63 A;  2OVM A;  3FUG A;  4IVY A;  4PPP A;  4WVD A;  4LTW A;  5E1C A;  2Q60 A;  2POB A;  2P1T A;  3BQD A;  3F5C B;  4PWL A;  3W5R A;  5G46 A;  1SJ0 A;  2Q7K A;  2QPY A;  5AAU A;  4O8F A;  5DP0 A;  4CSJ A;  1XP6 A;  2GWX A;  3AUQ A;  2AX7 A;  4E4K A;  4RUO X;  3ZRA A;  2PJL A;  4QJR A;  2E2R A;  4RWV A;  2ZNQ A;  3TKM A;  5M96 A;  2QA8 B;  4XT9 A;  1YP0 A;  4ZNV A;  2OAX A;  3R5N A;  3P8X A;  3KMZ A;  1T7M A;  3UUA A;  1GWR A;  1XLS A;  2BAW A;  2AX8 A;  1YOW A;  2AO6 A;  4QM0 A;  2YAT A;  4XI3 A;  1Y9R A;  4YNK A;  4ZNW A;  4IQR A;  5DID A;  4JGV A;  4IV2 A;  2R6Y A;  4MGB A;  4OGH A;  3W0J A;  3IPU A;  5GID A;  1PRG A;  2ZLA A;  2HVC A;  1EXA A;  2JJ3 A;  2V7C A;  1FM6 A;  3ADW A;  4TV1 B;  3V3E A;  4RMD A;  2HCD A;  5JJM B;  2ZAS A;  3OS8 A;  2QGT A;  3L0L A;  4PRG A;  2G44 A;  3V4A A;  2QH6 A;  4OIU A;  5B41 A;  1U3Q A;  1XLS E;  1XV9 B;  2HAS A;  1XNN A;  3WMH A;  3VJS A;  1FM9 D;  1Z5X U;  3AN3 A;  4WHF A;  1DKF B;  5KCF A;  3RUT A;  5G42 A;  1UPW A;  3VT9 A;  3B5R A;  3VSO A;  4ZI1 A;  1OSV A;  3ET3 A;  4J5W A;  1XP9 A;  1XQC A;  1PQ6 A;  2G0G A;  3FC6 B;  4OJB A;  1OSH A;  5AZV A;  3ADS A;  4Y29 A;  2ZMI A;  5EIT A;  1K7L A;  3GWS X;  5E7V A;  3VJT A;  4R2U A;  3X1H A;  5KRL A;  1ZEO A;  2Q59 B;  4RE8 A;  4OLM A;  1N46 A;  3R29 A;  4G21 A;  3X31 A;  3CDP A;  2PIO A;  3DR1 A;  3KDT A;  5DKG A;  2FSZ A;  2ZK4 A;  3B0W A;  3VT4 A;  2Q6R A;  4ZJW A;  2R40 D;  1FCY A;  2J4A A;  4DM8 A;  3DT3 A;  2GTK A;  5DVC A;  1PQC A;  3PRG A;  1NQ0 A;  1OVL B;  4DOS A;  3ERD A;  3UUD A;  5KYJ A;  1I7I A;  2HC4 A;  4MG8 B;  5APH A;  2HFP A;  4FNE A;  5KRC A;  1X7B A;  3F5C A;  4QE8 A;  2PIU A;  3DZY A;  1RKG A;  2VV4 B;  4EMA A;  3A2H A;  1QKU A;  4EM9 A;  3K22 A;  3IPS A;  2JFA B;  3OSI A;  4OED A;  2QE4 A;  3DZU A;  2PRG A;  4OKX A;  1FCX A;  3GWX A;  3OMP A;  2OZ7 A;  5CJ6 A;  1GWX A;  4OH5 A;  1NDE A;  3TY0 A;  5IAW A;  3A3Z X;  2Q1H A;  5DKE A;  3H52 A;  4OKT A;  1QKM A;  4IWF A;  1L2I A;  2P7Z A;  2VV1 A;  4LBD A;  1R20 A;  5DXQ A;  5KD9 A;  3TKC A;  4NQA B;  4A2J A;  5KR9 A;  4XUM A;  3JZB A;  4HEE X;  3VRV A;  2J7X A;  1X78 A;  4ZNU A;  3W0C A;  2GP7 A;  1Y0X X;  3EYB A;  1UOM A;  3OSW A;  1QKN A;  4OKW A;  4XAO A;  3UUA B;  3A9E A;  3ET0 A;  3WJ5 A;  3OLL A;  5C4S A;  5DV6 A;  4UDD A;  2YFE A;  3DCT A;  3KMG A;  3AZ1 A;  4MGB B;  2QTU A;  1A52 A;  1UPV A;  2A3I A;  2JF9 A;  4NY9 A;  4IA1 A;  2REW A;  5ETH A;  4JAZ A;  3SP6 A;  2Q1V A;  4OEY A;  4ZN7 A;  1NHZ A;  1Q4X A;  4MGD A;  2VSR A;  5EC9 A;  5AVL A;  1KV6 A;  1GWQ A;  2FAI A;  1G2N A;  2ZNN A;  1K4W A;  3IXP D;  3OSA A;  4FHH A;  5B5B A;  1X7E A;  1K74 D;  3B1M A;  3GN8 A;  5EI1 A;  3H0A A;  5AAV B;  2VV0 A;  3E00 A;  3VJH A;  4M8H A;  5L7H A;  3UVV A;  2G5O A;  2QMV A;  2Q7I A;  3R5M A;  1I7G A;  1XVP B;  5HJS A;  3D6D A;  4NUF A;  3SZ1 A;  3GD2 A;  3OKH A;  3VRW A;  2ZLC A;  3CDS A;  3HM1 A;  1MVC A;  1X7J A;  3NOA A;  4OZT U;  5DUG A;  4J24 A;  2P7G A;  5AZT A;  1IE8 A;  4OJ4 A;  4OH6 A;  3FEI A;  2AB2 A;  1RJK A;  4MG7 A;  5G3J A;  5JI0 D;  4MG8 A;  2ACL A;  1Y0S A;  2ZMJ A;  5DX3 A;  2VV4 A;  4ZJR A;  3L3Z A;  3CS8 A;  4OK1 A;  3T03 A;  4E4Q A;  4Q0A C;  1SQN A;  2AXA A;  2H79 A;  2VV2 A;  5L11 A;  1T76 A;  2GIU A;  2B23 A;  3UUD B;  3AX8 A;  1MV9 A;  3W0A A;  5ACC A;  4QL8 A;  1PK5 A;  3B65 A;  5DSH A;  2P7A A;  1U3R A;  4BCR A;  3F7D A;  2AAX A;  4G1Y A;  5DZ1 A;  5DWL A;  3HQ5 A;  5DXM A;  5FQR A;  2XHS A;  3AZ2 A;  4PVU A;  3WFF A;  3W5Q A;  2ZXZ A;  2ZK5 A;  3D5F A;  3R2A A;  2Q3Y A;  2QGW A;  5DMC A;  1UHL A;  5E19 A;  2Z4B A;  4N73 A;  4MG5 A;  5DXP A;  4JL4 A;  4TUZ A;  2VV1 B;  2LBD A;  3KFC A;  2J7Y A;  1TXI A;  1SR7 A;  3JZC A;  2YJD A;  3OKI A;  4J5X C;  4PF3 A;  4QK4 A;  4REF A;  2NPA A;  1RDT A;  2AA6 A;  2YLO A;  2GPV A;  2I4J A;  3ET2 A;  2QAB A;  3ADX A;  4MGC A;  5DUE A;  5FQS A;  5A86 A;  1XZX X;  1DB1 A;  4IV4 A;  2W8Y A;  4PXM A;  3DZU D;  2I0J A;  3A9E B;  3P88 A;  1HG4 A;  1PQ9 A;  4K4J A;  4OZR U;  4UDB A;  4RZE A;  1XIU A;  5KRO A;  3NSQ A;  5AVI A;  5AAV A;  4PLE A;  1R1K D;  4OKB A;  2VST A;  1NYX A;  3LBD A;  1S19 A;  1XVP A;  4POJ A;  4X1F A;  1R20 D;  4IA7 A;  4G1Z A;  4MGD B;  5DYB A;  4RAK A;  3X1I A;  1FCZ A;  3O1D A;  1YYE A;  1ZKY A;  4ZNT A;  2QXM A;  2ZK1 A;  5HYK A;  2ZKC A;  1N4H A;  1E3K A;  2P4Y A;  3OMK A;  4OAR A;  5DZ0 A;  2R6W A;  3L0J A;  3UVV B;  3GZ9 A;  4MG9 B;  3WGP A;  3AUR A;  4KZI A;  1P93 A;  5AWJ A;  2ZVT A;  4DMA A;  1I38 A;  4RUJ A;  3OAP A;  5DI7 A;  5EJV A;  4PLD A;  3B67 A;  4JYH A;  2ZNP A;  2ZMH A;  5FQV A;  3VSP A;  5DWI A;  3MNO A;  5DKB A;  2AMA A;  2PIX A;  3NSP A;  3W0H A;  4ZO1 X;  3D57 A;  5DZ3 A;  3PLZ A;  2Q5P A;  5DXB A;  4A4W A;  4OIL A;  5KRJ A;  4MG7 B;  3OMQ A;  4IA2 A;  3VRU A;  2ACL B;  3CTB A;  4E2J A;  5DX3 B;  2OM9 A;  2OUZ A;  2Q8S A;  1NQ7 A;  2BJ4 A;  3H0A D;  4OEZ A;  3OMO A;  4IU7 A;  2QXS A;  5KRM A;  3LMP A;  2QA6 A;  2QNV A;  1YA3 A;  3B3K A;  5DV8 A;  1HJ1 A;  4FN9 A;  4XLD A;  5FQT A;  5G45 A;  4PPS A;  3RUU A;  3HC6 A;  3X36 A;  1X7R A;  1YIM A;  5DXE A;  3VI8 A;  3VRT A;  4DK8 A;  2AA2 A;  1T5Z A;  3WT7 A;  3VT6 A;  1M2Z A;  2AWH A;  5HJP A;  5L7G A;  3GYT A;  5DXR A;  5KRK A;  4WQP A;  4QE6 A;  5C4U A;  3L1B A;  1VJB A;  1I37 A;  4CI4 A;  1Z5X E;  2FVJ A;  1N83 A;  4XUH A;  4DK7 A;  3D24 A;  3AN4 A;  3GBK A;  3BC5 A;  1FBY A;  4XTA A;  1UHL B;  4ZO1 B;  1XB7 A;  4IW6 A;  4TUZ B;  2GPU A;  2YJA B;  2XYX A;  2AA5 A;  3V3Q A;  2PIV A;  3VN2 A;  4R06 A;  1G1U A;  4APU A;  4M8E A;  3S9S A;  4MDD A;  3RVF A;  5APJ A;  2AMB A;  4KZM A;  5KCT A;  2QW4 A;  2ZK0 A;  1T73 A;  3HOD A;  4N1Y A;  5DU5 A;  3VT7 A;  1NUO A;  2B1Z A;  4JYI A;  5APK A;  5DVS A;  3Q95 A;  2QZO A;  3VTD A;  1YUC A;  5G43 A;  2AM9 A;  4LSJ A;  4OEA A;  4MG9 A;  3W5T A;  3OZ0 A;  2PIP L;  1RKH A;  1ERE A;  1NQ1 A;  2HAR A;  1XP1 A;  5DIE A;  1RDT D;  5AWK A;  2PIW A;  3RY9 A;  1PZL A;  1XDK A;  3AUN A;  5FQP A;  1KKQ A;  1FM6 D;  3UU7 B;  4CI5 A;  5LWP A;  2R40 A;  5KCD A;  3D90 A;  2YLY A;  5KRF A;  3B68 A;  2P1U A;  5DWG A;  1IE9 A;  1XJ7 A;  3V9V A;  4ZOM A;  3VT5 A;  4IA3 A;  1G50 A;  4G2H A;  5DIG A;  3FS1 A;  5KYA A;  5DMF A;  4L98 A;  2ZXM A;  4J26 A;  2Q6J A;  4RME A;  1XOW A;  2ZBS A;  3ADT A;  5DXB B;  3WWR A;  3PCU A;  5GIC A;  2Q61 A;  2ABI A;  3OS8 C;  5KRH A;  2BJ4 B;  2PKL A;  3B66 A;  5DXG A;  2I4P A;  2NV7 A;  3VT8 A;  4L96 A;  3VTB A;  4OFU A;  4OJ9 A;  2Q5S A;  3PEQ A;  1FD0 A;  3A2I A;  2HBH A;  3G8O A;  3K8S A;  5DV3 A;  3VT3 A;  5IZ0 A;  5HJP B;  3R8A A;  1YY4 A;  4J5W C;  1H9U A;  3ADU A;  3DCU A;  4P6W A;  4YMQ A;  2YLQ A;  1ILH A;  5G44 A;  3FAL B;  4ZN9 A;  3OMM A;  3M7R A;  3HLV A;  2B50 A;  5GIE A;  4A4V A;  5HZC A;  3UP0 A;  5DTV A;  2GPO A;  1YMT A;  2Q7J A;  2V0V A;  2AYR A;  3UUC A;  1XQ3 A;  2P54 A;  2XKW A;  3B0Q A;  1LV2 A;  1MZN A;  3K6P A;  5E14 A;  5IXK A;  3DZY D;  2O4R A;  2XYJ A;  4MG6 A;  2POG A;  3MNE A;  3B0T A;  4OZT E;  3ET1 A;  2NXX A;  5GT4 A;  1BSX A;  1XPC A;  1ZDU A;  4N8R A;  5E15 A;  3CS4 A;  3IXP A;  5G5W A;  3KWY A;  4MGA A;  1K74 A;  1OT7 A;  4PP5 A;  4YT1 A;  3A2J A;  3R8D A;  2Q7L A;  1M13 A;  5KCE A;  3VTC A;  3HC5 A;  4K7A A;  4DM6 A;  5C4O A;  3G0W A;  3KPZ A;  1G5Y A;  2H77 A;  2PIN A;  1M7W A;  3ADV A;  5DKS A;  1QKT A;  3Q95 B;  2QZO B;  5EGV A;  3U9Q A;  3VHV A;  1R6G A;  2Q6S A;  3UU7 A;  4N5G A;  1YIN A;  2IHQ A;  3QT0 A;  5DXK A;  2NXX E;  1P8D A;  1T79 A;  4PP6 A;  2ZY0 A;  5DL4 A;  5EHJ A;  3VHW A;  3W0G A;  2AA7 A;  5KCC A;  2XYW A;  5AYG A;  4F9M A;  5DY8 A;  4IWC A;  2ZNO A;  3L3X A;  3OS9 A;  4K6I A;  5AK2 A;  5DYD A;  3CJW A;  1ZAF A;  3VJI A;  2F4B A;  3KDU A;  3PBA A;  4Q50 A;  4JYG A;  4IW8 A;  1XDK B;  4POH A;  1RK3 A;  3OOF A;  3HO0 A;  2PIQ A;  2PIR A;  5DZI A;  4B7W A;  2Q70 A;  3CS6 A;  4OHA A;  3ILZ A;  2P1V A;  5DWJ A;  1TFC A;  3E00 D;  4OIV A;  5K13 A;  4J5X A;  3IMY A;  4RFW A;  1Z95 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...