2BAWA

Human nuclear receptor-ligand complex 1
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
265
structure length
250
Chain Sequence
LKAFSKHIYNAYLKNFNMTKKKARSILTKAPFVIHDIETLWQAEKGLVWKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQQLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reevaluation of the PPAR-beta/delta Ligand Binding Domain Model Reveals Why It Exhibits the Activated Form
pubmed doi rcsb
molecule keywords Peroxisome proliferator activated receptor delta
molecule tags Transcription
source organism Homo sapiens
total genus 98
structure length 250
sequence length 265
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 2bawA00
3B68A 3ZR7A 4HEEX 1M2ZA 2IHQA 3Q95A 3K22A 4TV1A 3OKIA 3L3ZA 1RDTD 1NRLA 4NIEA 4OKWA 5DMFA 2W8YA 4MDDA 4TUZB 4Q0AC 1MVCA 5CJ6A 3DR1A 2Q7IA 4IQRA 3OLLA 3OMOA 4CI4A 3VI8A 5GIDA 4G21A 3OS8A 2I4PA 1PQ9A 3NSPA 1R1KA 2Q6JA 3VJTA 3WT6A 4REEA 4MG8A 2O4RA 3DT3A 3H0AD 3HODA 5DRMA 5DU5A 2ZVTA 1ZDTA 3OMPA 4ZO1B 3W5PA 1YJEA 2JFAA 2QGWA 2HBHA 3IXPD 5SYZA 1ZGYA 2GPVA 4UDDA 1KV6A 5DKGA 3VT6A 3BC5A 3VTCA 3VT5A 3UVVB 3DZYA 1TFCA 3GZ9A 2P4YA 3AN3A 3N00A 4ZI1A 2ZK0A 1LV2A 5KR9A 3UP0A 4YPQA 1N46A 3VJHA 3WMHA 2HAMA 5DXBB 4RUJA 2Q59B 5LGAA 1A52A 1VJBA 5DWIA 4FHHA 3ERTA 5KRLA 5KCTA 5DXMA 5DZ1A 5K13A 1YP0A 4WPFA 3H0AA 5KRHA 1XV9A 3D5FA 5AZVA 3HC5A 3FLIA 2PIOA 4LTWA 3V4AA 2OZ7A 1Y0XX 3VJIA 1U3QA 4E2JA 1T79A 4P6WA 3VSPA 2Q70A 3CDPA 4YNKA 1R5KA 5HJPA 2B1VA 1IE8A 2AA6A 3B65A 2B1ZA 5AYGA 3O1EA 3JZBA 3R8DA 5L7HA 1NAXA 2I4ZA 3DZUD 5EI1A 3W5TA 3L1BA 3GWSX 5FQSA 4L98A 4Q13A 4MGAA 5G43A 2YLPA 4OEDA 4E4QA 2HWQA 3ADTA 3WGPA 4F9MA 4IV4A 5ACCA 3R8AA 1RKHA 3AN4A 3ADWA 1OVLB 4LSJA 4IVWA 5DZ3A 1LBDA 4MGBA 5FQTA 4OZTE 3FEJA 1NQ0A 2QA8B 3W0IA 1X7JA 3PO9A 1YA3A 2AWHA 1MZNA 4MGCA 5IZ0A 3WFGA 4CSJA 1FD0A 4YMQA 1FM9A 3AX8A 2G5OA 4ZNSA 2QA6A 3OOFA 3WFFA 2AXAA 2P1TA 3WWRA 1I38A 3HC6A 3W0HA 4POHA 3V49A 4ZJRA 4ITEA 2HVCA 1Y9RA 2JFAB 2AX6A 3OGTA 4IV2A 2FSZA 5DVCA 3KDTA 3B67A 5C4SA 4OKTA 4XAOA 2H79A 3A40X 1Z5XE 1R20A 1RJKA 5H1EA 1ERRA 3CWDA 1TXIA 3PEQA 1N4HA 2AA7A 2ZNPA 3NSQA 3X1HA 4PXMA 1NQ7A 3GD2A 3CQVA 1DKFA 1UPVA 3EYBA 4XUMA 5DTVA 4OGHA 4XI3A 1T7MA 2EWPA 2HC4A 4HLWA 4S0TA 3SP6A 3VTBA 5IAWA 2ZLCA 5C4UA 2P7AA 3IMYA 1P93A 1X7RA 3L03A 1NHZA 2VSTA 3OSWA 3OAPA 4OEAA 3VRTA 4M8HA 5DY8A 3KMRA 4JYHA 5L7EA 3W0GA 1ILHA 3E00A 2PJLA 4G2IA 5F9BA 3HLVA 3G0WA 4ZNHA 1T7FA 3X1IA 4OEYA 3ET2A 2GPPA 3KMGA 5DUHA 2Q1VA 2HFPA 4EMAA 5KD9A 3E94A 3L3XA 3A78A 1YOWA 5DYBA 5G5WA 3W5QA 1S19A 4PVUA 4XTAA 4DMAA 1I7IA 3D24A 4E4KA 3F7DA 3R2AA 5DUGA 3VT7A 2AX7A 4Q50A 2PKLA 4IA7A 3PCUA 4POJA 2AB2A 5L11A 2FAIA 3AZ3A 5DWEA 4XHDA 1PQ6A 2ZXNA 4MGDA 5KCDA 4G1YA 2YATA 1PZLA 4S0SA 3TKCA 3W5RA 3OSAA 1G50A 4ITFA 4PPPA 5DIDA 5GIEA 3TY0A 2PIVA 1OSHA 1FBYA 3DCUA 2AAXA 3VHWA 1ZAFA 3H52A 5E15A 1R1KD 2HWRA 1PRGA 3VJSA 5E7VA 1RKGA 2R40A 2AX8A 4ZOMA 1YUCA 1RK3A 4PF3A 1MV9A 2AMBA 1Q4XA 3B0TA 3UUAA 2ZBSA 3GBKA 2ZNOA 4A2JA 3AUNA 3FALA 4OJ9A 4N73A 5E0WA 2AA2A 4K4JA 2PIXA 4NUFA 4X1FA 3DCTA 3DZYD 3R29A 3IA6A 4XUHA 4MG9A 3OMKA 1S0ZA 2AO6A 3UU7A 3GYTA 2ZK4A 3KFCA 2Z4JA 4WHGA 3OZ0A 5DXGA 3ADVA 4LNWA 1NDEA 1XQ3A 3K23A 2GIUA 5AVLA 4B7WA 3IPQA 5JI0D 3RUTA 1T74A 1UOMA 3OZJA 1L2JA 2R6YA 4IA3A 3OOKA 2Q3YA 2VV3A 1EXXA 1XIUA 1GWQA 3AUQA 1YINA 2XKWA 1XDKA 2G0HA 2V7CA 1M7WA 1PDUA 3OLFA 2XYXA 4J5WA 4KZMA 2QNVA 2BAWA 4KZJA 5DX3B 3V9TA 1UHLA 4IA1A 5AWJA 2HASA 4OH6A 1WM0X 2Q5PA 4J5XC 4O8FA 1T65A 5EITA 1PQCA 2NPAA 2J4AA 3CS6A 3OLSA 3OMQA 1UPWA 2ACLA 2YHDA 1IE9A 4R06A 3VRVA 1XNXA 5JJMB 2I0GA 5LWPA 4DM8A 2VV1A 1PCGA 1T5ZA 3A3ZX 4G1ZA 3WT7A 1KKQA 4FHIA 5DMCA 5E19A 1KNUA 4DK8A 2B23A 3BQDA 4ZNWA 4UDAA 2OCFA 4RMDA 1X7EA 5G3JA 1FM9D 1G1UA 5DXQA 5HYKA 4R6SA 5JY3A 5AZTA 1T7TA 2QH6A 3AZ2A 1NQ1A 2B50A 2Q61A 5A86A 4OZRU 4G20A 5KRCA 3P88A 1SQNA 5HJSA 3X36A 4DM6A 3VT9A 1XVPA 3AZ1A 1R20D 3Q95B 3UP3A 2ATHA 4TV1B 4DORA 4RAKA 5I4VA 1N83A 3P89A 4PP5A 3CJWA 3FXVA 3UUCA 1EXAA 1XLSA 5GICA 1QKNA 1OSVA 3KWYA 3RLJA 1R6GA 5DXEA 5AAVA 3OKHA 4MG8B 1SJ0A 1P8DA 4FN9A 5DXKA 1K4WA 4MG5A 3A9EA 5DP0A 1ZUCA 5APHA 4APUA 5B41A 3E00D 4P6XA 3FUGA 4OC7A 4RZEA 2ZMIA 5ICKA 4BCRA 5HYRA 1QKUA 3W0YA 1GS4A 4RMCA 2NV7A 3ADSA 1UHLB 2P54A 5E14A 2GPOA 5C4TA 5KRMA 3FC6A 2JF9A 1K74A 5KYJA 3OS8C 1YY4A 4WVDA 3B0RA 3DY6A 2V0VA 5DV8A 3T03A 3O1DA 3VN2A 4L96A 1S9QA 2ACLB 1XV9B 2OAXA 2REWA 2I4JA 2P1UA 4S15A 1U9EA 4EM9A 5KCFA 2Q7LA 1T76A 2OVHA 2BJ4A 2PIUA 3V3EA 4YT1A 3AFRA 2VV4A 2PITA 3LMPA 5DYDA 4LNXA 3NOAA 3FURA 3VT3A 3UUDA 2ZY0A 4J5WC 2ZXMA 5DV6A 5HJPB 1YMTA 5DZIA 4QE8A 3ZQTA 5DWLA 2O9IA 3K6PA 3PBAA 1A28A 2AX9A 2R40D 4MG6A 2HB8A 3GWXA 4OARA 4FNEA 5HCVA 3CTBA 3U9QA 2GL8A 2Q5GA 2ZMJA 3KBAA 4J26A 4MGAB 5KRAA 1XVPB 4OKXA 4ZNTA 3W0JA 2HARA 2GWXA 3VHUA 5DVSA 3KDUA 2YLOA 1ILGA 5EGVA 5FQRA 4PP6A 4MGBB 5E1CA 3FS1A 5EHJA 3IPSA 4JYGA 2YLYA 3VT8A 5KROA 3W0AA 2OVMA 3M7RA 5DIGA 2GTKA 1ZEOA 5DL4A 1XP9A 4MG7A 4JYIA 1EREA 3BEJA 3ET3A 3UVVA 2IOGA 2PINA 2P1VA 5FQPA 3MNEA 3B0QA 5M96A 5DWGA 2ZK3A 2XYWA 3VRWA 1HJ1A 3VRUA 1GWRA 1XAPA 2AM9A 2Q6RA 3MNPA 3MNOA 2Q59A 4KZIA 3GYUA 5DXBA 1FM6A 2PIRA 2NW4A 1FCYA 2J14A 2P7ZA 4DOSA 2G44A 4PP3A 2PIPL 1X78A 3FC6B 1DKFB 4IWFA 2Z4BA 4DK7A 4OHAA 2P15A 5DRJA 1Y0SA 3ADUA 1XOWA 2QABA 3AURA 1U3SA 5DZHA 4JAZA 4REFA 4PLDA 5E0XA 2NXXA 4X1GA 4ZO1X 4K7AA 4IVYA 1X7BA 2BJ4B 3G9EA 3CS4A 3L0JA 1XB7A 1XP1A 1SR7A 4QL8A 3VT4A 2GPUA 2JJ3A 3OS9A 3UUDB 5KRKA 3D6DA 2ZK6A 3IPUA 3CS8A 3R8IA 4RZFA 4Y29A 2I0JA 1NQ2A 2POBA 2QTUA 4WHFA 2Q5SA 5G46A 3ZRBA 4RZGA 1G5YA 1YOKA 1E3KA 3F5CA 1OVLA 1XQCA 3RLLA 3TX7B 2Q7KA 5AAVB 2ZK2A 4IS8A 5DZ0A 3TKMA 2QA8A 4ZNUA 4JGVA 4WQPA 5DKEA 1T7RA 1L2IA 2AA5A 3L0LA 3ET0A 1SKXA 2ZXZA 4MGDB 4NQAB 1M13A 1S9PA 4QJRA 1BSXA 3QT0A 4MG7B 1FCZA 3S9SA 1YIMA 3WJ5A 2QZOA 3B0WA 3FEIA 1NYXA 4PWLA 2OUZA 1DB1A 2QGTA 5KYAA 2PRGA 3D57A 4ONIA 4OZRE 5AWKA 5KCEA 4PRGA 1RDTA 2H77A 2QXSA 3WJ4A 2Q6SA 2Q60A 4IA2A 2HCDA 5DVVA 2YLQA 4N8RA 3A2IA 2YJDA 3B3KA 4UDBA 3UUAB 1H9UA 2IOKA 3FALB 1XNNA 2ZLAA 3X31A 1ZKYA 3ERDA 1XLSE 2PNUA 3SP9A 5DXPA 5EC9A 4MG9B 5DUEA 4QK4A 4QE6A 3UU7B 4ZN7A 4A4VA 3IXPA 1XP6A 5APKA 1K74D 2HB7A 4ZN9A 4XT9A 4OKBA 2ZFXA 2QMVA 4CI5A 4PLEA 3ZRAA 3ILZA 2QSEA 4IW6A 1E3GA 2XHSA 4JL4A 3GN8A 3VTDA 2J7YA 4RWVA 2GP7A 4OFUA 2A3IA 5KRJA 2AYRA 3KMZA 5FQVA 3B5RA 4OFRA 3K8SA 1PK5A 4ZNVA 3VSOA 3PRGA 4OIVA 4QM0A 4DQMA 2R6WA 2QW4A 1XDKB 2O4JA 5DKBA 3JZCA 1HG4A 1I37A 3R5NA 1K7LA 2ZL9A 3F5CB 1QKMA 1T63A 4RFWA 4WLBA 5G42A 3ET1A 4OJ4A 3CDSA 5DXRA 3V3QA 2F4BA 4OZTU 2VSRA 2QPYA 5EJVA 5AVIA 5G44A 1XPCA 3G8OA 3HO0A 5DIEA 4OK1A 3A2JA 2PIWA 3G8IA 2PIQA 2VV1B 4IWCA 5DSHA 3DZUA 4N1YA 3OMMA 2G0GA 3VHVA 4A4WA 2ABIA 4R2UA 3ADXA 2E2RA 4IUIA 3HZFA 5L7GA 5AK2A 2XYJA 4K6IA 5KRFA 2QZOB 2Q1HA 3SZ1A 2QXMA 2LBDA 4RE8A 3RVFA 5IXKA 4J24A 2QR9A 1Z5XU 4ZJWA 2P7GA 5APJA 1GWXA 4OILA 4TUZA 2ZK5A 1NAVA 3W0CA 1G2NA 4IW8A 4NB6A 1I7GA 5DK9A 1FM6D 2POGA 2VV0A 1Z95A 2FVJA 3HVLA 4OH5A 4J5XA 2Q7JA 5C4OA 2AMAA 3LBDA 4G2HA 5HZCA 5ETHA 2OM9A 1XJ7A 4PPSA 3HM1A 4G1DA 3E7CA 4RMEA 3RY9A 1OT7A 4OJBA 2J7XA 2ZMHA 4S14A 2ZNNA 5DWJA 3R5MA 5KCCA 3P8XA 2Q8SA 2YJAB 3HQ5A 3OSIA 5G45A 3A2HA 3CLDA 5KCWA 1NUOA 4N5GA 5DX3A 3L0EA 1ZH7A 1X76A 1YYEA 3A9EB 5DLRA 4M8EA 4XLDA 1QKTA 2QE4A 2VV2A 4NY9A 3PLZA 4IU7A 5DV3A 3D90A 3P0UA 3RUUA 5KRIA 5GT4A 1T73A 3WTQA 5JJMA 5DKSA 1ZDUA 2YFEA 2ZNQA 1FCXA 2NXXE 3B66A 1U3RA 1XZXX 3WT5A 4OIUA 4RUOX 4UDCA 3KPZA 4FGYA 2ZK1A 4LBDA 5AAUA 5DI7A 1S0XA 3V9VA 5B5BA 4OLMA 2ZKCA 3KYTA 4RUPA 2VV4B 3V9YA 5KCUA 2ZASA 3B1MA 4OEZA
chains in the Genus database with same CATH superfamily
3B68A 3ZR7A 4HEEX 1M2ZA 2IHQA 3Q95A 3K22A 4TV1A 3OKIA 3L3ZA 1RDTD 1NRLA 4NIEA 4OKWA 5DMFA 2W8YA 4MDDA 4TUZB 4Q0AC 1MVCA 5CJ6A 3DR1A 2Q7IA 4IQRA 3OLLA 3OMOA 4CI4A 3VI8A 5GIDA 4G21A 3OS8A 2I4PA 1PQ9A 3NSPA 1R1KA 2Q6JA 3VJTA 3WT6A 4REEA 4MG8A 2O4RA 3DT3A 3H0AD 3HODA 5DRMA 5DU5A 2ZVTA 1ZDTA 3OMPA 4ZO1B 3W5PA 1YJEA 2JFAA 2QGWA 2HBHA 3IXPD 5SYZA 1ZGYA 2GPVA 4UDDA 1KV6A 5DKGA 3VT6A 3BC5A 3VTCA 3VT5A 3UVVB 3DZYA 1TFCA 3GZ9A 2P4YA 3AN3A 3N00A 4ZI1A 2ZK0A 1LV2A 5KR9A 3UP0A 4YPQA 1N46A 3VJHA 3WMHA 2HAMA 5DXBB 4RUJA 2Q59B 5LGAA 1A52A 1VJBA 5DWIA 4FHHA 3ERTA 5KRLA 5KCTA 5DXMA 5DZ1A 5K13A 1YP0A 4WPFA 3H0AA 5KRHA 1XV9A 3D5FA 5AZVA 3HC5A 3FLIA 2PIOA 4LTWA 3V4AA 2OZ7A 1Y0XX 3VJIA 1U3QA 4E2JA 1T79A 4P6WA 3VSPA 2Q70A 3CDPA 4YNKA 1R5KA 5HJPA 2B1VA 1IE8A 2AA6A 3B65A 2B1ZA 5AYGA 3O1EA 3JZBA 3R8DA 5L7HA 1NAXA 2I4ZA 3DZUD 5EI1A 3W5TA 3L1BA 3GWSX 5FQSA 4L98A 4Q13A 4MGAA 5G43A 2YLPA 4OEDA 4E4QA 2HWQA 3ADTA 3WGPA 4F9MA 4IV4A 5ACCA 3R8AA 1RKHA 3AN4A 3ADWA 1OVLB 4LSJA 4IVWA 5DZ3A 1LBDA 4MGBA 5FQTA 4OZTE 3FEJA 1NQ0A 2QA8B 3W0IA 1X7JA 3PO9A 1YA3A 2AWHA 1MZNA 4MGCA 5IZ0A 3WFGA 4CSJA 1FD0A 4YMQA 1FM9A 3AX8A 2G5OA 4ZNSA 2QA6A 3OOFA 3WFFA 2AXAA 2P1TA 3WWRA 1I38A 3HC6A 3W0HA 4POHA 3V49A 4ZJRA 4ITEA 2HVCA 1Y9RA 2JFAB 2AX6A 3OGTA 4IV2A 2FSZA 5DVCA 3KDTA 3B67A 5C4SA 4OKTA 4XAOA 2H79A 3A40X 1Z5XE 1R20A 1RJKA 5H1EA 1ERRA 3CWDA 1TXIA 3PEQA 1N4HA 2AA7A 2ZNPA 3NSQA 3X1HA 4PXMA 1NQ7A 3GD2A 3CQVA 1DKFA 1UPVA 3EYBA 4XUMA 5DTVA 4OGHA 4XI3A 1T7MA 2EWPA 2HC4A 4HLWA 4S0TA 3SP6A 3VTBA 5IAWA 2ZLCA 5C4UA 2P7AA 3IMYA 1P93A 1X7RA 3L03A 1NHZA 2VSTA 3OSWA 3OAPA 4OEAA 3VRTA 4M8HA 5DY8A 3KMRA 4JYHA 5L7EA 3W0GA 1ILHA 3E00A 2PJLA 4G2IA 5F9BA 3HLVA 3G0WA 4ZNHA 1T7FA 3X1IA 4OEYA 3ET2A 2GPPA 3KMGA 5DUHA 2Q1VA 2HFPA 4EMAA 5KD9A 3E94A 3L3XA 3A78A 1YOWA 5DYBA 5G5WA 3W5QA 1S19A 4PVUA 4XTAA 4DMAA 1I7IA 3D24A 4E4KA 3F7DA 3R2AA 5DUGA 3VT7A 2AX7A 4Q50A 2PKLA 4IA7A 3PCUA 4POJA 2AB2A 5L11A 2FAIA 3AZ3A 5DWEA 4XHDA 1PQ6A 2ZXNA 4MGDA 5KCDA 4G1YA 2YATA 1PZLA 4S0SA 3TKCA 3W5RA 3OSAA 1G50A 4ITFA 4PPPA 5DIDA 5GIEA 3TY0A 2PIVA 1OSHA 1FBYA 3DCUA 2AAXA 3VHWA 1ZAFA 3H52A 5E15A 1R1KD 2HWRA 1PRGA 3VJSA 5E7VA 1RKGA 2R40A 2AX8A 4ZOMA 1YUCA 1RK3A 4PF3A 1MV9A 2AMBA 1Q4XA 3B0TA 3UUAA 2ZBSA 3GBKA 2ZNOA 4A2JA 3AUNA 3FALA 4OJ9A 4N73A 5E0WA 2AA2A 4K4JA 2PIXA 4NUFA 4X1FA 3DCTA 3DZYD 3R29A 3IA6A 4XUHA 4MG9A 3OMKA 1S0ZA 2AO6A 3UU7A 3GYTA 2ZK4A 3KFCA 2Z4JA 4WHGA 3OZ0A 5DXGA 3ADVA 4LNWA 1NDEA 1XQ3A 3K23A 2GIUA 5AVLA 4B7WA 3IPQA 5JI0D 3RUTA 1T74A 1UOMA 3OZJA 1L2JA 2R6YA 4IA3A 3OOKA 2Q3YA 2VV3A 1EXXA 1XIUA 1GWQA 3AUQA 1YINA 2XKWA 1XDKA 2G0HA 2V7CA 1M7WA 1PDUA 3OLFA 2XYXA 4J5WA 4KZMA 2QNVA 2BAWA 4KZJA 5DX3B 3V9TA 1UHLA 4IA1A 5AWJA 2HASA 4OH6A 1WM0X 2Q5PA 4J5XC 4O8FA 1T65A 5EITA 1PQCA 2NPAA 2J4AA 3CS6A 3OLSA 3OMQA 1UPWA 2ACLA 2YHDA 1IE9A 4R06A 3VRVA 1XNXA 5JJMB 2I0GA 5LWPA 4DM8A 2VV1A 1PCGA 1T5ZA 3A3ZX 4G1ZA 3WT7A 1KKQA 4FHIA 5DMCA 5E19A 1KNUA 4DK8A 2B23A 3BQDA 4ZNWA 4UDAA 2OCFA 4RMDA 1X7EA 5G3JA 1FM9D 1G1UA 5DXQA 5HYKA 4R6SA 5JY3A 5AZTA 1T7TA 2QH6A 3AZ2A 1NQ1A 2B50A 2Q61A 5A86A 4OZRU 4G20A 5KRCA 3P88A 1SQNA 5HJSA 3X36A 4DM6A 3VT9A 1XVPA 3AZ1A 1R20D 3Q95B 3UP3A 2ATHA 4TV1B 4DORA 4RAKA 5I4VA 1N83A 3P89A 4PP5A 3CJWA 3FXVA 3UUCA 1EXAA 1XLSA 5GICA 1QKNA 1OSVA 3KWYA 3RLJA 1R6GA 5DXEA 5AAVA 3OKHA 4MG8B 1SJ0A 1P8DA 4FN9A 5DXKA 1K4WA 4MG5A 3A9EA 5DP0A 1ZUCA 5APHA 4APUA 5B41A 3E00D 4P6XA 3FUGA 4OC7A 4RZEA 2ZMIA 5ICKA 4BCRA 5HYRA 1QKUA 3W0YA 1GS4A 4RMCA 2NV7A 3ADSA 1UHLB 2P54A 5E14A 2GPOA 5C4TA 5KRMA 3FC6A 2JF9A 1K74A 5KYJA 3OS8C 1YY4A 4WVDA 3B0RA 3DY6A 2V0VA 5DV8A 3T03A 3O1DA 3VN2A 4L96A 1S9QA 2ACLB 1XV9B 2OAXA 2REWA 2I4JA 2P1UA 4S15A 1U9EA 4EM9A 5KCFA 2Q7LA 1T76A 2OVHA 2BJ4A 2PIUA 3V3EA 4YT1A 3AFRA 2VV4A 2PITA 3LMPA 5DYDA 4LNXA 3NOAA 3FURA 3VT3A 3UUDA 2ZY0A 4J5WC 2ZXMA 5DV6A 5HJPB 1YMTA 5DZIA 4QE8A 3ZQTA 5DWLA 2O9IA 3K6PA 3PBAA 1A28A 2AX9A 2R40D 4MG6A 2HB8A 3GWXA 4OARA 4FNEA 5HCVA 3CTBA 3U9QA 2GL8A 2Q5GA 2ZMJA 3KBAA 4J26A 4MGAB 5KRAA 1XVPB 4OKXA 4ZNTA 3W0JA 2HARA 2GWXA 3VHUA 5DVSA 3KDUA 2YLOA 1ILGA 5EGVA 5FQRA 4PP6A 4MGBB 5E1CA 3FS1A 5EHJA 3IPSA 4JYGA 2YLYA 3VT8A 5KROA 3W0AA 2OVMA 3M7RA 5DIGA 2GTKA 1ZEOA 5DL4A 1XP9A 4MG7A 4JYIA 1EREA 3BEJA 3ET3A 3UVVA 2IOGA 2PINA 2P1VA 5FQPA 3MNEA 3B0QA 5M96A 5DWGA 2ZK3A 2XYWA 3VRWA 1HJ1A 3VRUA 1GWRA 1XAPA 2AM9A 2Q6RA 3MNPA 3MNOA 2Q59A 4KZIA 3GYUA 5DXBA 1FM6A 2PIRA 2NW4A 1FCYA 2J14A 2P7ZA 4DOSA 2G44A 4PP3A 2PIPL 1X78A 3FC6B 1DKFB 4IWFA 2Z4BA 4DK7A 4OHAA 2P15A 5DRJA 1Y0SA 3ADUA 1XOWA 2QABA 3AURA 1U3SA 5DZHA 4JAZA 4REFA 4PLDA 5E0XA 2NXXA 4X1GA 4ZO1X 4K7AA 4IVYA 1X7BA 2BJ4B 3G9EA 3CS4A 3L0JA 1XB7A 1XP1A 1SR7A 4QL8A 3VT4A 2GPUA 2JJ3A 3OS9A 3UUDB 5KRKA 3D6DA 2ZK6A 3IPUA 3CS8A 3R8IA 4RZFA 4Y29A 2I0JA 1NQ2A 2POBA 2QTUA 4WHFA 2Q5SA 5G46A 3ZRBA 4RZGA 1G5YA 1YOKA 1E3KA 3F5CA 1OVLA 1XQCA 3RLLA 3TX7B 2Q7KA 5AAVB 2ZK2A 4IS8A 5DZ0A 3TKMA 2QA8A 4ZNUA 4JGVA 4WQPA 5DKEA 1T7RA 1L2IA 2AA5A 3L0LA 3ET0A 1SKXA 2ZXZA 4MGDB 4NQAB 1M13A 1S9PA 4QJRA 1BSXA 3QT0A 4MG7B 1FCZA 3S9SA 1YIMA 3WJ5A 2QZOA 3B0WA 3FEIA 1NYXA 4PWLA 2OUZA 1DB1A 2QGTA 5KYAA 2PRGA 3D57A 4ONIA 4OZRE 5AWKA 5KCEA 4PRGA 1RDTA 2H77A 2QXSA 3WJ4A 2Q6SA 2Q60A 4IA2A 2HCDA 5DVVA 2YLQA 4N8RA 3A2IA 2YJDA 3B3KA 4UDBA 3UUAB 1H9UA 2IOKA 3FALB 1XNNA 2ZLAA 3X31A 1ZKYA 3ERDA 1XLSE 2PNUA 3SP9A 5DXPA 5EC9A 4MG9B 5DUEA 4QK4A 4QE6A 3UU7B 4ZN7A 4A4VA 3IXPA 1XP6A 5APKA 1K74D 2HB7A 4ZN9A 4XT9A 4OKBA 2ZFXA 2QMVA 4CI5A 4PLEA 3ZRAA 3ILZA 2QSEA 4IW6A 1E3GA 2XHSA 4JL4A 3GN8A 3VTDA 2J7YA 4RWVA 2GP7A 4OFUA 2A3IA 5KRJA 2AYRA 3KMZA 5FQVA 3B5RA 4OFRA 3K8SA 1PK5A 4ZNVA 3VSOA 3PRGA 4OIVA 4QM0A 4DQMA 2R6WA 2QW4A 1XDKB 2O4JA 5DKBA 3JZCA 1HG4A 1I37A 3R5NA 1K7LA 2ZL9A 3F5CB 1QKMA 1T63A 4RFWA 4WLBA 5G42A 3ET1A 4OJ4A 3CDSA 5DXRA 3V3QA 2F4BA 4OZTU 2VSRA 2QPYA 5EJVA 5AVIA 5G44A 1XPCA 3G8OA 3HO0A 5DIEA 4OK1A 3A2JA 2PIWA 3G8IA 2PIQA 2VV1B 4IWCA 5DSHA 3DZUA 4N1YA 3OMMA 2G0GA 3VHVA 4A4WA 2ABIA 4R2UA 3ADXA 2E2RA 4IUIA 3HZFA 5L7GA 5AK2A 2XYJA 4K6IA 5KRFA 2QZOB 2Q1HA 3SZ1A 2QXMA 2LBDA 4RE8A 3RVFA 5IXKA 4J24A 2QR9A 1Z5XU 4ZJWA 2P7GA 5APJA 1GWXA 4OILA 4TUZA 2ZK5A 1NAVA 3W0CA 1G2NA 4IW8A 4NB6A 1I7GA 5DK9A 1FM6D 2POGA 2VV0A 1Z95A 2FVJA 3HVLA 4OH5A 4J5XA 2Q7JA 5C4OA 2AMAA 3LBDA 4G2HA 5HZCA 5ETHA 2OM9A 1XJ7A 4PPSA 3HM1A 4G1DA 3E7CA 4RMEA 3RY9A 1OT7A 4OJBA 2J7XA 2ZMHA 4S14A 2ZNNA 5DWJA 3R5MA 5KCCA 3P8XA 2Q8SA 2YJAB 3HQ5A 3OSIA 5G45A 3A2HA 3CLDA 5KCWA 1NUOA 4N5GA 5DX3A 3L0EA 1ZH7A 1X76A 1YYEA 3A9EB 5DLRA 4M8EA 4XLDA 1QKTA 2QE4A 2VV2A 4NY9A 3PLZA 4IU7A 5DV3A 3D90A 3P0UA 3RUUA 5KRIA 5GT4A 1T73A 3WTQA 5JJMA 5DKSA 1ZDUA 2YFEA 2ZNQA 1FCXA 2NXXE 3B66A 1U3RA 1XZXX 3WT5A 4OIUA 4RUOX 4UDCA 3KPZA 4FGYA 2ZK1A 4LBDA 5AAUA 5DI7A 1S0XA 3V9VA 5B5BA 4OLMA 2ZKCA 3KYTA 4RUPA 2VV4B 3V9YA 5KCUA 2ZASA 3B1MA 4OEZA
chains in the Genus database with same CATH topology
3B68A 3ZR7A 4HEEX 1M2ZA 2IHQA 3Q95A 3K22A 4TV1A 3OKIA 3L3ZA 1RDTD 1NRLA 4NIEA 4OKWA 5DMFA 2W8YA 4MDDA 4TUZB 4Q0AC 1MVCA 5CJ6A 3DR1A 2Q7IA 4IQRA 3OLLA 3OMOA 4CI4A 3VI8A 5GIDA 4G21A 3OS8A 2I4PA 1PQ9A 3NSPA 1R1KA 2Q6JA 3VJTA 3WT6A 4REEA 4MG8A 2O4RA 3DT3A 3H0AD 3HODA 5DRMA 5DU5A 2ZVTA 1ZDTA 3OMPA 4ZO1B 3W5PA 1YJEA 2JFAA 2QGWA 2HBHA 3IXPD 5SYZA 1ZGYA 2GPVA 4UDDA 1KV6A 5DKGA 3VT6A 3BC5A 3VTCA 3VT5A 3UVVB 3DZYA 1TFCA 3GZ9A 2P4YA 3AN3A 3N00A 4ZI1A 2ZK0A 1LV2A 5KR9A 3UP0A 4YPQA 1N46A 3VJHA 3WMHA 2HAMA 5DXBB 4RUJA 2Q59B 5LGAA 1A52A 1VJBA 5DWIA 4FHHA 3ERTA 5KRLA 5KCTA 5DXMA 5DZ1A 5K13A 1YP0A 4WPFA 3H0AA 5KRHA 1XV9A 3D5FA 5AZVA 3HC5A 3FLIA 2PIOA 4LTWA 3V4AA 2OZ7A 1Y0XX 3VJIA 1U3QA 4E2JA 1T79A 4P6WA 3VSPA 2Q70A 3CDPA 4YNKA 1R5KA 5HJPA 2B1VA 1IE8A 2AA6A 3B65A 2B1ZA 5AYGA 3O1EA 3JZBA 3R8DA 5L7HA 1NAXA 2I4ZA 3DZUD 5EI1A 3W5TA 3L1BA 3GWSX 5FQSA 4L98A 4Q13A 4MGAA 5G43A 2YLPA 4OEDA 4E4QA 2HWQA 3ADTA 3WGPA 4F9MA 4IV4A 5ACCA 3R8AA 1RKHA 3AN4A 3ADWA 1OVLB 4LSJA 4IVWA 5DZ3A 1LBDA 4MGBA 5FQTA 4OZTE 3FEJA 1NQ0A 2QA8B 3W0IA 1X7JA 3PO9A 1YA3A 2AWHA 1MZNA 4MGCA 5IZ0A 3WFGA 4CSJA 1FD0A 4YMQA 1FM9A 3AX8A 2G5OA 4ZNSA 2QA6A 3OOFA 3WFFA 2AXAA 2P1TA 3WWRA 1I38A 3HC6A 3W0HA 4POHA 3V49A 4ZJRA 4ITEA 2HVCA 1Y9RA 2JFAB 2AX6A 3OGTA 4IV2A 2FSZA 5DVCA 3KDTA 3B67A 5C4SA 4OKTA 4XAOA 2H79A 3A40X 1Z5XE 1R20A 1RJKA 5H1EA 1ERRA 3CWDA 1TXIA 3PEQA 1N4HA 2AA7A 2ZNPA 3NSQA 3X1HA 4PXMA 1NQ7A 3GD2A 3CQVA 1DKFA 1UPVA 3EYBA 4XUMA 5DTVA 4OGHA 4XI3A 1T7MA 2EWPA 2HC4A 4HLWA 4S0TA 3SP6A 3VTBA 5IAWA 2ZLCA 5C4UA 2P7AA 3IMYA 1P93A 1X7RA 3L03A 1NHZA 2VSTA 3OSWA 3OAPA 4OEAA 3VRTA 4M8HA 5DY8A 3KMRA 4JYHA 5L7EA 3W0GA 1ILHA 3E00A 2PJLA 4G2IA 5F9BA 3HLVA 3G0WA 4ZNHA 1T7FA 3X1IA 4OEYA 3ET2A 2GPPA 3KMGA 5DUHA 2Q1VA 2HFPA 4EMAA 5KD9A 3E94A 3L3XA 3A78A 1YOWA 5DYBA 5G5WA 3W5QA 1S19A 4PVUA 4XTAA 4DMAA 1I7IA 3D24A 4E4KA 3F7DA 3R2AA 5DUGA 3VT7A 2AX7A 4Q50A 2PKLA 4IA7A 3PCUA 4POJA 2AB2A 5L11A 2FAIA 3AZ3A 5DWEA 4XHDA 1PQ6A 2ZXNA 4MGDA 5KCDA 4G1YA 2YATA 1PZLA 4S0SA 3TKCA 3W5RA 3OSAA 1G50A 4ITFA 4PPPA 5DIDA 5GIEA 3TY0A 2PIVA 1OSHA 1FBYA 3DCUA 2AAXA 3VHWA 1ZAFA 3H52A 5E15A 1R1KD 2HWRA 1PRGA 3VJSA 5E7VA 1RKGA 2R40A 2AX8A 4ZOMA 1YUCA 1RK3A 4PF3A 1MV9A 2AMBA 1Q4XA 3B0TA 3UUAA 2ZBSA 3GBKA 2ZNOA 4A2JA 3AUNA 3FALA 4OJ9A 4N73A 5E0WA 2AA2A 4K4JA 2PIXA 4NUFA 4X1FA 3DCTA 3DZYD 3R29A 3IA6A 4XUHA 4MG9A 3OMKA 1S0ZA 2AO6A 3UU7A 3GYTA 2ZK4A 3KFCA 2Z4JA 4WHGA 3OZ0A 5DXGA 3ADVA 4LNWA 1NDEA 1XQ3A 3K23A 2GIUA 5AVLA 4B7WA 3IPQA 5JI0D 3RUTA 1T74A 1UOMA 3OZJA 1L2JA 2R6YA 4IA3A 3OOKA 2Q3YA 2VV3A 1EXXA 1XIUA 1GWQA 3AUQA 1YINA 2XKWA 1XDKA 2G0HA 2V7CA 1M7WA 1PDUA 3OLFA 2XYXA 4J5WA 4KZMA 2QNVA 2BAWA 4KZJA 5DX3B 3V9TA 1UHLA 4IA1A 5AWJA 2HASA 4OH6A 1WM0X 2Q5PA 4J5XC 4O8FA 1T65A 5EITA 1PQCA 2NPAA 2J4AA 3CS6A 3OLSA 3OMQA 1UPWA 2ACLA 2YHDA 1IE9A 4R06A 3VRVA 1XNXA 5JJMB 2I0GA 5LWPA 4DM8A 2VV1A 1PCGA 1T5ZA 3A3ZX 4G1ZA 3WT7A 1KKQA 4FHIA 5DMCA 5E19A 1KNUA 4DK8A 2B23A 3BQDA 4ZNWA 4UDAA 2OCFA 4RMDA 1X7EA 5G3JA 1FM9D 1G1UA 5DXQA 5HYKA 4R6SA 5JY3A 5AZTA 1T7TA 2QH6A 3AZ2A 1NQ1A 2B50A 2Q61A 5A86A 4OZRU 4G20A 5KRCA 3P88A 1SQNA 5HJSA 3X36A 4DM6A 3VT9A 1XVPA 3AZ1A 1R20D 3Q95B 3UP3A 2ATHA 4TV1B 4DORA 4RAKA 5I4VA 1N83A 3P89A 4PP5A 3CJWA 3FXVA 3UUCA 1EXAA 1XLSA 5GICA 1QKNA 1OSVA 3KWYA 3RLJA 1R6GA 5DXEA 5AAVA 3OKHA 4MG8B 1SJ0A 1P8DA 4FN9A 5DXKA 1K4WA 4MG5A 3A9EA 5DP0A 1ZUCA 5APHA 4APUA 5B41A 3E00D 4P6XA 3FUGA 4OC7A 4RZEA 2ZMIA 5ICKA 4BCRA 5HYRA 1QKUA 3W0YA 1GS4A 4RMCA 2NV7A 3ADSA 1UHLB 2P54A 5E14A 2GPOA 5C4TA 5KRMA 3FC6A 2JF9A 1K74A 5KYJA 3OS8C 1YY4A 4WVDA 3B0RA 3DY6A 2V0VA 5DV8A 3T03A 3O1DA 3VN2A 4L96A 1S9QA 2ACLB 1XV9B 2OAXA 2REWA 2I4JA 2P1UA 4S15A 1U9EA 4EM9A 5KCFA 2Q7LA 1T76A 2OVHA 2BJ4A 2PIUA 3V3EA 4YT1A 3AFRA 2VV4A 2PITA 3LMPA 5DYDA 4LNXA 3NOAA 3FURA 3VT3A 3UUDA 2ZY0A 4J5WC 2ZXMA 5DV6A 5HJPB 1YMTA 5DZIA 4QE8A 3ZQTA 5DWLA 2O9IA 3K6PA 3PBAA 1A28A 2AX9A 2R40D 4MG6A 2HB8A 3GWXA 4OARA 4FNEA 5HCVA 3CTBA 3U9QA 2GL8A 2Q5GA 2ZMJA 3KBAA 4J26A 4MGAB 5KRAA 1XVPB 4OKXA 4ZNTA 3W0JA 2HARA 2GWXA 3VHUA 5DVSA 3KDUA 2YLOA 1ILGA 5EGVA 5FQRA 4PP6A 4MGBB 5E1CA 3FS1A 5EHJA 3IPSA 4JYGA 2YLYA 3VT8A 5KROA 3W0AA 2OVMA 3M7RA 5DIGA 2GTKA 1ZEOA 5DL4A 1XP9A 4MG7A 4JYIA 1EREA 3BEJA 3ET3A 3UVVA 2IOGA 2PINA 2P1VA 5FQPA 3MNEA 3B0QA 5M96A 5DWGA 2ZK3A 2XYWA 3VRWA 1HJ1A 3VRUA 1GWRA 1XAPA 2AM9A 2Q6RA 3MNPA 3MNOA 2Q59A 4KZIA 3GYUA 5DXBA 1FM6A 2PIRA 2NW4A 1FCYA 2J14A 2P7ZA 4DOSA 2G44A 4PP3A 2PIPL 1X78A 3FC6B 1DKFB 4IWFA 2Z4BA 4DK7A 4OHAA 2P15A 5DRJA 1Y0SA 3ADUA 1XOWA 2QABA 3AURA 1U3SA 5DZHA 4JAZA 4REFA 4PLDA 5E0XA 2NXXA 4X1GA 4ZO1X 4K7AA 4IVYA 1X7BA 2BJ4B 3G9EA 3CS4A 3L0JA 1XB7A 1XP1A 1SR7A 4QL8A 3VT4A 2GPUA 2JJ3A 3OS9A 3UUDB 5KRKA 3D6DA 2ZK6A 3IPUA 3CS8A 3R8IA 4RZFA 4Y29A 2I0JA 1NQ2A 2POBA 2QTUA 4WHFA 2Q5SA 5G46A 3ZRBA 4RZGA 1G5YA 1YOKA 1E3KA 3F5CA 1OVLA 1XQCA 3RLLA 3TX7B 2Q7KA 5AAVB 2ZK2A 4IS8A 5DZ0A 3TKMA 2QA8A 4ZNUA 4JGVA 4WQPA 5DKEA 1T7RA 1L2IA 2AA5A 3L0LA 3ET0A 1SKXA 2ZXZA 4MGDB 4NQAB 1M13A 1S9PA 4QJRA 1BSXA 3QT0A 4MG7B 1FCZA 3S9SA 1YIMA 3WJ5A 2QZOA 3B0WA 3FEIA 1NYXA 4PWLA 2OUZA 1DB1A 2QGTA 5KYAA 2PRGA 3D57A 4ONIA 4OZRE 5AWKA 5KCEA 4PRGA 1RDTA 2H77A 2QXSA 3WJ4A 2Q6SA 2Q60A 4IA2A 2HCDA 5DVVA 2YLQA 4N8RA 3A2IA 2YJDA 3B3KA 4UDBA 3UUAB 1H9UA 2IOKA 3FALB 1XNNA 2ZLAA 3X31A 1ZKYA 3ERDA 1XLSE 2PNUA 3SP9A 5DXPA 5EC9A 4MG9B 5DUEA 4QK4A 4QE6A 3UU7B 4ZN7A 4A4VA 3IXPA 1XP6A 5APKA 1K74D 2HB7A 4ZN9A 4XT9A 4OKBA 2ZFXA 2QMVA 4CI5A 4PLEA 3ZRAA 3ILZA 2QSEA 4IW6A 1E3GA 2XHSA 4JL4A 3GN8A 3VTDA 2J7YA 4RWVA 2GP7A 4OFUA 2A3IA 5KRJA 2AYRA 3KMZA 5FQVA 3B5RA 4OFRA 3K8SA 1PK5A 4ZNVA 3VSOA 3PRGA 4OIVA 4QM0A 4DQMA 2R6WA 2QW4A 1XDKB 2O4JA 5DKBA 3JZCA 1HG4A 1I37A 3R5NA 1K7LA 2ZL9A 3F5CB 1QKMA 1T63A 4RFWA 4WLBA 5G42A 3ET1A 4OJ4A 3CDSA 5DXRA 3V3QA 2F4BA 4OZTU 2VSRA 2QPYA 5EJVA 5AVIA 5G44A 1XPCA 3G8OA 3HO0A 5DIEA 4OK1A 3A2JA 2PIWA 3G8IA 2PIQA 2VV1B 4IWCA 5DSHA 3DZUA 4N1YA 3OMMA 2G0GA 3VHVA 4A4WA 2ABIA 4R2UA 3ADXA 2E2RA 4IUIA 3HZFA 5L7GA 5AK2A 2XYJA 4K6IA 5KRFA 2QZOB 2Q1HA 3SZ1A 2QXMA 2LBDA 4RE8A 3RVFA 5IXKA 4J24A 2QR9A 1Z5XU 4ZJWA 2P7GA 5APJA 1GWXA 4OILA 4TUZA 2ZK5A 1NAVA 3W0CA 1G2NA 4IW8A 4NB6A 1I7GA 5DK9A 1FM6D 2POGA 2VV0A 1Z95A 2FVJA 3HVLA 4OH5A 4J5XA 2Q7JA 5C4OA 2AMAA 3LBDA 4G2HA 5HZCA 5ETHA 2OM9A 1XJ7A 4PPSA 3HM1A 4G1DA 3E7CA 4RMEA 3RY9A 1OT7A 4OJBA 2J7XA 2ZMHA 4S14A 2ZNNA 5DWJA 3R5MA 5KCCA 3P8XA 2Q8SA 2YJAB 3HQ5A 3OSIA 5G45A 3A2HA 3CLDA 5KCWA 1NUOA 4N5GA 5DX3A 3L0EA 1ZH7A 1X76A 1YYEA 3A9EB 5DLRA 4M8EA 4XLDA 1QKTA 2QE4A 2VV2A 4NY9A 3PLZA 4IU7A 5DV3A 3D90A 3P0UA 3RUUA 5KRIA 5GT4A 1T73A 3WTQA 5JJMA 5DKSA 1ZDUA 2YFEA 2ZNQA 1FCXA 2NXXE 3B66A 1U3RA 1XZXX 3WT5A 4OIUA 4RUOX 4UDCA 3KPZA 4FGYA 2ZK1A 4LBDA 5AAUA 5DI7A 1S0XA 3V9VA 5B5BA 4OLMA 2ZKCA 3KYTA 4RUPA 2VV4B 3V9YA 5KCUA 2ZASA 3B1MA 4OEZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B68 A;  3ZR7 A;  4HEE X;  1M2Z A;  2IHQ A;  3Q95 A;  3K22 A;  4TV1 A;  3OKI A;  3L3Z A;  1RDT D;  1NRL A;  4NIE A;  4OKW A;  5DMF A;  2W8Y A;  4MDD A;  4TUZ B;  4Q0A C;  1MVC A;  5CJ6 A;  3DR1 A;  2Q7I A;  4IQR A;  3OLL A;  3OMO A;  4CI4 A;  3VI8 A;  5GID A;  4G21 A;  3OS8 A;  2I4P A;  1PQ9 A;  3NSP A;  1R1K A;  2Q6J A;  3VJT A;  3WT6 A;  4REE A;  4MG8 A;  2O4R A;  3DT3 A;  3H0A D;  3HOD A;  5DRM A;  5DU5 A;  2ZVT A;  1ZDT A;  3OMP A;  4ZO1 B;  3W5P A;  1YJE A;  2JFA A;  2QGW A;  2HBH A;  3IXP D;  5SYZ A;  1ZGY A;  2GPV A;  4UDD A;  1KV6 A;  5DKG A;  3VT6 A;  3BC5 A;  3VTC A;  3VT5 A;  3UVV B;  3DZY A;  1TFC A;  3GZ9 A;  2P4Y A;  3AN3 A;  3N00 A;  4ZI1 A;  2ZK0 A;  1LV2 A;  5KR9 A;  3UP0 A;  4YPQ A;  1N46 A;  3VJH A;  3WMH A;  2HAM A;  5DXB B;  4RUJ A;  2Q59 B;  5LGA A;  1A52 A;  1VJB A;  5DWI A;  4FHH A;  3ERT A;  5KRL A;  5KCT A;  5DXM A;  5DZ1 A;  5K13 A;  1YP0 A;  4WPF A;  3H0A A;  5KRH A;  1XV9 A;  3D5F A;  5AZV A;  3HC5 A;  3FLI A;  2PIO A;  4LTW A;  3V4A A;  2OZ7 A;  1Y0X X;  3VJI A;  1U3Q A;  4E2J A;  1T79 A;  4P6W A;  3VSP A;  2Q70 A;  3CDP A;  4YNK A;  1R5K A;  5HJP A;  2B1V A;  1IE8 A;  2AA6 A;  3B65 A;  2B1Z A;  5AYG A;  3O1E A;  3JZB A;  3R8D A;  5L7H A;  1NAX A;  2I4Z A;  3DZU D;  5EI1 A;  3W5T A;  3L1B A;  3GWS X;  5FQS A;  4L98 A;  4Q13 A;  4MGA A;  5G43 A;  2YLP A;  4OED A;  4E4Q A;  2HWQ A;  3ADT A;  3WGP A;  4F9M A;  4IV4 A;  5ACC A;  3R8A A;  1RKH A;  3AN4 A;  3ADW A;  1OVL B;  4LSJ A;  4IVW A;  5DZ3 A;  1LBD A;  4MGB A;  5FQT A;  4OZT E;  3FEJ A;  1NQ0 A;  2QA8 B;  3W0I A;  1X7J A;  3PO9 A;  1YA3 A;  2AWH A;  1MZN A;  4MGC A;  5IZ0 A;  3WFG A;  4CSJ A;  1FD0 A;  4YMQ A;  1FM9 A;  3AX8 A;  2G5O A;  4ZNS A;  2QA6 A;  3OOF A;  3WFF A;  2AXA A;  2P1T A;  3WWR A;  1I38 A;  3HC6 A;  3W0H A;  4POH A;  3V49 A;  4ZJR A;  4ITE A;  2HVC A;  1Y9R A;  2JFA B;  2AX6 A;  3OGT A;  4IV2 A;  2FSZ A;  5DVC A;  3KDT A;  3B67 A;  5C4S A;  4OKT A;  4XAO A;  2H79 A;  3A40 X;  1Z5X E;  1R20 A;  1RJK A;  5H1E A;  1ERR A;  3CWD A;  1TXI A;  3PEQ A;  1N4H A;  2AA7 A;  2ZNP A;  3NSQ A;  3X1H A;  4PXM A;  1NQ7 A;  3GD2 A;  3CQV A;  1DKF A;  1UPV A;  3EYB A;  4XUM A;  5DTV A;  4OGH A;  4XI3 A;  1T7M A;  2EWP A;  2HC4 A;  4HLW A;  4S0T A;  3SP6 A;  3VTB A;  5IAW A;  2ZLC A;  5C4U A;  2P7A A;  3IMY A;  1P93 A;  1X7R A;  3L03 A;  1NHZ A;  2VST A;  3OSW A;  3OAP A;  4OEA A;  3VRT A;  4M8H A;  5DY8 A;  3KMR A;  4JYH A;  5L7E A;  3W0G A;  1ILH A;  3E00 A;  2PJL A;  4G2I A;  5F9B A;  3HLV A;  3G0W A;  4ZNH A;  1T7F A;  3X1I A;  4OEY A;  3ET2 A;  2GPP A;  3KMG A;  5DUH A;  2Q1V A;  2HFP A;  4EMA A;  5KD9 A;  3E94 A;  3L3X A;  3A78 A;  1YOW A;  5DYB A;  5G5W A;  3W5Q A;  1S19 A;  4PVU A;  4XTA A;  4DMA A;  1I7I A;  3D24 A;  4E4K A;  3F7D A;  3R2A A;  5DUG A;  3VT7 A;  2AX7 A;  4Q50 A;  2PKL A;  4IA7 A;  3PCU A;  4POJ A;  2AB2 A;  5L11 A;  2FAI A;  3AZ3 A;  5DWE A;  4XHD A;  1PQ6 A;  2ZXN A;  4MGD A;  5KCD A;  4G1Y A;  2YAT A;  1PZL A;  4S0S A;  3TKC A;  3W5R A;  3OSA A;  1G50 A;  4ITF A;  4PPP A;  5DID A;  5GIE A;  3TY0 A;  2PIV A;  1OSH A;  1FBY A;  3DCU A;  2AAX A;  3VHW A;  1ZAF A;  3H52 A;  5E15 A;  1R1K D;  2HWR A;  1PRG A;  3VJS A;  5E7V A;  1RKG A;  2R40 A;  2AX8 A;  4ZOM A;  1YUC A;  1RK3 A;  4PF3 A;  1MV9 A;  2AMB A;  1Q4X A;  3B0T A;  3UUA A;  2ZBS A;  3GBK A;  2ZNO A;  4A2J A;  3AUN A;  3FAL A;  4OJ9 A;  4N73 A;  5E0W A;  2AA2 A;  4K4J A;  2PIX A;  4NUF A;  4X1F A;  3DCT A;  3DZY D;  3R29 A;  3IA6 A;  4XUH A;  4MG9 A;  3OMK A;  1S0Z A;  2AO6 A;  3UU7 A;  3GYT A;  2ZK4 A;  3KFC A;  2Z4J A;  4WHG A;  3OZ0 A;  5DXG A;  3ADV A;  4LNW A;  1NDE A;  1XQ3 A;  3K23 A;  2GIU A;  5AVL A;  4B7W A;  3IPQ A;  5JI0 D;  3RUT A;  1T74 A;  1UOM A;  3OZJ A;  1L2J A;  2R6Y A;  4IA3 A;  3OOK A;  2Q3Y A;  2VV3 A;  1EXX A;  1XIU A;  1GWQ A;  3AUQ A;  1YIN A;  2XKW A;  1XDK A;  2G0H A;  2V7C A;  1M7W A;  1PDU A;  3OLF A;  2XYX A;  4J5W A;  4KZM A;  2QNV A;  2BAW A;  4KZJ A;  5DX3 B;  3V9T A;  1UHL A;  4IA1 A;  5AWJ A;  2HAS A;  4OH6 A;  1WM0 X;  2Q5P A;  4J5X C;  4O8F A;  1T65 A;  5EIT A;  1PQC A;  2NPA A;  2J4A A;  3CS6 A;  3OLS A;  3OMQ A;  1UPW A;  2ACL A;  2YHD A;  1IE9 A;  4R06 A;  3VRV A;  1XNX A;  5JJM B;  2I0G A;  5LWP A;  4DM8 A;  2VV1 A;  1PCG A;  1T5Z A;  3A3Z X;  4G1Z A;  3WT7 A;  1KKQ A;  4FHI A;  5DMC A;  5E19 A;  1KNU A;  4DK8 A;  2B23 A;  3BQD A;  4ZNW A;  4UDA A;  2OCF A;  4RMD A;  1X7E A;  5G3J A;  1FM9 D;  1G1U A;  5DXQ A;  5HYK A;  4R6S A;  5JY3 A;  5AZT A;  1T7T A;  2QH6 A;  3AZ2 A;  1NQ1 A;  2B50 A;  2Q61 A;  5A86 A;  4OZR U;  4G20 A;  5KRC A;  3P88 A;  1SQN A;  5HJS A;  3X36 A;  4DM6 A;  3VT9 A;  1XVP A;  3AZ1 A;  1R20 D;  3Q95 B;  3UP3 A;  2ATH A;  4TV1 B;  4DOR A;  4RAK A;  5I4V A;  1N83 A;  3P89 A;  4PP5 A;  3CJW A;  3FXV A;  3UUC A;  1EXA A;  1XLS A;  5GIC A;  1QKN A;  1OSV A;  3KWY A;  3RLJ A;  1R6G A;  5DXE A;  5AAV A;  3OKH A;  4MG8 B;  1SJ0 A;  1P8D A;  4FN9 A;  5DXK A;  1K4W A;  4MG5 A;  3A9E A;  5DP0 A;  1ZUC A;  5APH A;  4APU A;  5B41 A;  3E00 D;  4P6X A;  3FUG A;  4OC7 A;  4RZE A;  2ZMI A;  5ICK A;  4BCR A;  5HYR A;  1QKU A;  3W0Y A;  1GS4 A;  4RMC A;  2NV7 A;  3ADS A;  1UHL B;  2P54 A;  5E14 A;  2GPO A;  5C4T A;  5KRM A;  3FC6 A;  2JF9 A;  1K74 A;  5KYJ A;  3OS8 C;  1YY4 A;  4WVD A;  3B0R A;  3DY6 A;  2V0V A;  5DV8 A;  3T03 A;  3O1D A;  3VN2 A;  4L96 A;  1S9Q A;  2ACL B;  1XV9 B;  2OAX A;  2REW A;  2I4J A;  2P1U A;  4S15 A;  1U9E A;  4EM9 A;  5KCF A;  2Q7L A;  1T76 A;  2OVH A;  2BJ4 A;  2PIU A;  3V3E A;  4YT1 A;  3AFR A;  2VV4 A;  2PIT A;  3LMP A;  5DYD A;  4LNX A;  3NOA A;  3FUR A;  3VT3 A;  3UUD A;  2ZY0 A;  4J5W C;  2ZXM A;  5DV6 A;  5HJP B;  1YMT A;  5DZI A;  4QE8 A;  3ZQT A;  5DWL A;  2O9I A;  3K6P A;  3PBA A;  1A28 A;  2AX9 A;  2R40 D;  4MG6 A;  2HB8 A;  3GWX A;  4OAR A;  4FNE A;  5HCV A;  3CTB A;  3U9Q A;  2GL8 A;  2Q5G A;  2ZMJ A;  3KBA A;  4J26 A;  4MGA B;  5KRA A;  1XVP B;  4OKX A;  4ZNT A;  3W0J A;  2HAR A;  2GWX A;  3VHU A;  5DVS A;  3KDU A;  2YLO A;  1ILG A;  5EGV A;  5FQR A;  4PP6 A;  4MGB B;  5E1C A;  3FS1 A;  5EHJ A;  3IPS A;  4JYG A;  2YLY A;  3VT8 A;  5KRO A;  3W0A A;  2OVM A;  3M7R A;  5DIG A;  2GTK A;  1ZEO A;  5DL4 A;  1XP9 A;  4MG7 A;  4JYI A;  1ERE A;  3BEJ A;  3ET3 A;  3UVV A;  2IOG A;  2PIN A;  2P1V A;  5FQP A;  3MNE A;  3B0Q A;  5M96 A;  5DWG A;  2ZK3 A;  2XYW A;  3VRW A;  1HJ1 A;  3VRU A;  1GWR A;  1XAP A;  2AM9 A;  2Q6R A;  3MNP A;  3MNO A;  2Q59 A;  4KZI A;  3GYU A;  5DXB A;  1FM6 A;  2PIR A;  2NW4 A;  1FCY A;  2J14 A;  2P7Z A;  4DOS A;  2G44 A;  4PP3 A;  2PIP L;  1X78 A;  3FC6 B;  1DKF B;  4IWF A;  2Z4B A;  4DK7 A;  4OHA A;  2P15 A;  5DRJ A;  1Y0S A;  3ADU A;  1XOW A;  2QAB A;  3AUR A;  1U3S A;  5DZH A;  4JAZ A;  4REF A;  4PLD A;  5E0X A;  2NXX A;  4X1G A;  4ZO1 X;  4K7A A;  4IVY A;  1X7B A;  2BJ4 B;  3G9E A;  3CS4 A;  3L0J A;  1XB7 A;  1XP1 A;  1SR7 A;  4QL8 A;  3VT4 A;  2GPU A;  2JJ3 A;  3OS9 A;  3UUD B;  5KRK A;  3D6D A;  2ZK6 A;  3IPU A;  3CS8 A;  3R8I A;  4RZF A;  4Y29 A;  2I0J A;  1NQ2 A;  2POB A;  2QTU A;  4WHF A;  2Q5S A;  5G46 A;  3ZRB A;  4RZG A;  1G5Y A;  1YOK A;  1E3K A;  3F5C A;  1OVL A;  1XQC A;  3RLL A;  3TX7 B;  2Q7K A;  5AAV B;  2ZK2 A;  4IS8 A;  5DZ0 A;  3TKM A;  2QA8 A;  4ZNU A;  4JGV A;  4WQP A;  5DKE A;  1T7R A;  1L2I A;  2AA5 A;  3L0L A;  3ET0 A;  1SKX A;  2ZXZ A;  4MGD B;  4NQA B;  1M13 A;  1S9P A;  4QJR A;  1BSX A;  3QT0 A;  4MG7 B;  1FCZ A;  3S9S A;  1YIM A;  3WJ5 A;  2QZO A;  3B0W A;  3FEI A;  1NYX A;  4PWL A;  2OUZ A;  1DB1 A;  2QGT A;  5KYA A;  2PRG A;  3D57 A;  4ONI A;  4OZR E;  5AWK A;  5KCE A;  4PRG A;  1RDT A;  2H77 A;  2QXS A;  3WJ4 A;  2Q6S A;  2Q60 A;  4IA2 A;  2HCD A;  5DVV A;  2YLQ A;  4N8R A;  3A2I A;  2YJD A;  3B3K A;  4UDB A;  3UUA B;  1H9U A;  2IOK A;  3FAL B;  1XNN A;  2ZLA A;  3X31 A;  1ZKY A;  3ERD A;  1XLS E;  2PNU A;  3SP9 A;  5DXP A;  5EC9 A;  4MG9 B;  5DUE A;  4QK4 A;  4QE6 A;  3UU7 B;  4ZN7 A;  4A4V A;  3IXP A;  1XP6 A;  5APK A;  1K74 D;  2HB7 A;  4ZN9 A;  4XT9 A;  4OKB A;  2ZFX A;  2QMV A;  4CI5 A;  4PLE A;  3ZRA A;  3ILZ A;  2QSE A;  4IW6 A;  1E3G A;  2XHS A;  4JL4 A;  3GN8 A;  3VTD A;  2J7Y A;  4RWV A;  2GP7 A;  4OFU A;  2A3I A;  5KRJ A;  2AYR A;  3KMZ A;  5FQV A;  3B5R A;  4OFR A;  3K8S A;  1PK5 A;  4ZNV A;  3VSO A;  3PRG A;  4OIV A;  4QM0 A;  4DQM A;  2R6W A;  2QW4 A;  1XDK B;  2O4J A;  5DKB A;  3JZC A;  1HG4 A;  1I37 A;  3R5N A;  1K7L A;  2ZL9 A;  3F5C B;  1QKM A;  1T63 A;  4RFW A;  4WLB A;  5G42 A;  3ET1 A;  4OJ4 A;  3CDS A;  5DXR A;  3V3Q A;  2F4B A;  4OZT U;  2VSR A;  2QPY A;  5EJV A;  5AVI A;  5G44 A;  1XPC A;  3G8O A;  3HO0 A;  5DIE A;  4OK1 A;  3A2J A;  2PIW A;  3G8I A;  2PIQ A;  2VV1 B;  4IWC A;  5DSH A;  3DZU A;  4N1Y A;  3OMM A;  2G0G A;  3VHV A;  4A4W A;  2ABI A;  4R2U A;  3ADX A;  2E2R A;  4IUI A;  3HZF A;  5L7G A;  5AK2 A;  2XYJ A;  4K6I A;  5KRF A;  2QZO B;  2Q1H A;  3SZ1 A;  2QXM A;  2LBD A;  4RE8 A;  3RVF A;  5IXK A;  4J24 A;  2QR9 A;  1Z5X U;  4ZJW A;  2P7G A;  5APJ A;  1GWX A;  4OIL A;  4TUZ A;  2ZK5 A;  1NAV A;  3W0C A;  1G2N A;  4IW8 A;  4NB6 A;  1I7G A;  5DK9 A;  1FM6 D;  2POG A;  2VV0 A;  1Z95 A;  2FVJ A;  3HVL A;  4OH5 A;  4J5X A;  2Q7J A;  5C4O A;  2AMA A;  3LBD A;  4G2H A;  5HZC A;  5ETH A;  2OM9 A;  1XJ7 A;  4PPS A;  3HM1 A;  4G1D A;  3E7C A;  4RME A;  3RY9 A;  1OT7 A;  4OJB A;  2J7X A;  2ZMH A;  4S14 A;  2ZNN A;  5DWJ A;  3R5M A;  5KCC A;  3P8X A;  2Q8S A;  2YJA B;  3HQ5 A;  3OSI A;  5G45 A;  3A2H A;  3CLD A;  5KCW A;  1NUO A;  4N5G A;  5DX3 A;  3L0E A;  1ZH7 A;  1X76 A;  1YYE A;  3A9E B;  5DLR A;  4M8E A;  4XLD A;  1QKT A;  2QE4 A;  2VV2 A;  4NY9 A;  3PLZ A;  4IU7 A;  5DV3 A;  3D90 A;  3P0U A;  3RUU A;  5KRI A;  5GT4 A;  1T73 A;  3WTQ A;  5JJM A;  5DKS A;  1ZDU A;  2YFE A;  2ZNQ A;  1FCX A;  2NXX E;  3B66 A;  1U3R A;  1XZX X;  3WT5 A;  4OIU A;  4RUO X;  4UDC A;  3KPZ A;  4FGY A;  2ZK1 A;  4LBD A;  5AAU A;  5DI7 A;  1S0X A;  3V9V A;  5B5B A;  4OLM A;  2ZKC A;  3KYT A;  4RUP A;  2VV4 B;  3V9Y A;  5KCU A;  2ZAS A;  3B1M A;  4OEZ A; 
#chains in the Genus database with same CATH topology
 3B68 A;  3ZR7 A;  4HEE X;  1M2Z A;  2IHQ A;  3Q95 A;  3K22 A;  4TV1 A;  3OKI A;  3L3Z A;  1RDT D;  1NRL A;  4NIE A;  4OKW A;  5DMF A;  2W8Y A;  4MDD A;  4TUZ B;  4Q0A C;  1MVC A;  5CJ6 A;  3DR1 A;  2Q7I A;  4IQR A;  3OLL A;  3OMO A;  4CI4 A;  3VI8 A;  5GID A;  4G21 A;  3OS8 A;  2I4P A;  1PQ9 A;  3NSP A;  1R1K A;  2Q6J A;  3VJT A;  3WT6 A;  4REE A;  4MG8 A;  2O4R A;  3DT3 A;  3H0A D;  3HOD A;  5DRM A;  5DU5 A;  2ZVT A;  1ZDT A;  3OMP A;  4ZO1 B;  3W5P A;  1YJE A;  2JFA A;  2QGW A;  2HBH A;  3IXP D;  5SYZ A;  1ZGY A;  2GPV A;  4UDD A;  1KV6 A;  5DKG A;  3VT6 A;  3BC5 A;  3VTC A;  3VT5 A;  3UVV B;  3DZY A;  1TFC A;  3GZ9 A;  2P4Y A;  3AN3 A;  3N00 A;  4ZI1 A;  2ZK0 A;  1LV2 A;  5KR9 A;  3UP0 A;  4YPQ A;  1N46 A;  3VJH A;  3WMH A;  2HAM A;  5DXB B;  4RUJ A;  2Q59 B;  5LGA A;  1A52 A;  1VJB A;  5DWI A;  4FHH A;  3ERT A;  5KRL A;  5KCT A;  5DXM A;  5DZ1 A;  5K13 A;  1YP0 A;  4WPF A;  3H0A A;  5KRH A;  1XV9 A;  3D5F A;  5AZV A;  3HC5 A;  3FLI A;  2PIO A;  4LTW A;  3V4A A;  2OZ7 A;  1Y0X X;  3VJI A;  1U3Q A;  4E2J A;  1T79 A;  4P6W A;  3VSP A;  2Q70 A;  3CDP A;  4YNK A;  1R5K A;  5HJP A;  2B1V A;  1IE8 A;  2AA6 A;  3B65 A;  2B1Z A;  5AYG A;  3O1E A;  3JZB A;  3R8D A;  5L7H A;  1NAX A;  2I4Z A;  3DZU D;  5EI1 A;  3W5T A;  3L1B A;  3GWS X;  5FQS A;  4L98 A;  4Q13 A;  4MGA A;  5G43 A;  2YLP A;  4OED A;  4E4Q A;  2HWQ A;  3ADT A;  3WGP A;  4F9M A;  4IV4 A;  5ACC A;  3R8A A;  1RKH A;  3AN4 A;  3ADW A;  1OVL B;  4LSJ A;  4IVW A;  5DZ3 A;  1LBD A;  4MGB A;  5FQT A;  4OZT E;  3FEJ A;  1NQ0 A;  2QA8 B;  3W0I A;  1X7J A;  3PO9 A;  1YA3 A;  2AWH A;  1MZN A;  4MGC A;  5IZ0 A;  3WFG A;  4CSJ A;  1FD0 A;  4YMQ A;  1FM9 A;  3AX8 A;  2G5O A;  4ZNS A;  2QA6 A;  3OOF A;  3WFF A;  2AXA A;  2P1T A;  3WWR A;  1I38 A;  3HC6 A;  3W0H A;  4POH A;  3V49 A;  4ZJR A;  4ITE A;  2HVC A;  1Y9R A;  2JFA B;  2AX6 A;  3OGT A;  4IV2 A;  2FSZ A;  5DVC A;  3KDT A;  3B67 A;  5C4S A;  4OKT A;  4XAO A;  2H79 A;  3A40 X;  1Z5X E;  1R20 A;  1RJK A;  5H1E A;  1ERR A;  3CWD A;  1TXI A;  3PEQ A;  1N4H A;  2AA7 A;  2ZNP A;  3NSQ A;  3X1H A;  4PXM A;  1NQ7 A;  3GD2 A;  3CQV A;  1DKF A;  1UPV A;  3EYB A;  4XUM A;  5DTV A;  4OGH A;  4XI3 A;  1T7M A;  2EWP A;  2HC4 A;  4HLW A;  4S0T A;  3SP6 A;  3VTB A;  5IAW A;  2ZLC A;  5C4U A;  2P7A A;  3IMY A;  1P93 A;  1X7R A;  3L03 A;  1NHZ A;  2VST A;  3OSW A;  3OAP A;  4OEA A;  3VRT A;  4M8H A;  5DY8 A;  3KMR A;  4JYH A;  5L7E A;  3W0G A;  1ILH A;  3E00 A;  2PJL A;  4G2I A;  5F9B A;  3HLV A;  3G0W A;  4ZNH A;  1T7F A;  3X1I A;  4OEY A;  3ET2 A;  2GPP A;  3KMG A;  5DUH A;  2Q1V A;  2HFP A;  4EMA A;  5KD9 A;  3E94 A;  3L3X A;  3A78 A;  1YOW A;  5DYB A;  5G5W A;  3W5Q A;  1S19 A;  4PVU A;  4XTA A;  4DMA A;  1I7I A;  3D24 A;  4E4K A;  3F7D A;  3R2A A;  5DUG A;  3VT7 A;  2AX7 A;  4Q50 A;  2PKL A;  4IA7 A;  3PCU A;  4POJ A;  2AB2 A;  5L11 A;  2FAI A;  3AZ3 A;  5DWE A;  4XHD A;  1PQ6 A;  2ZXN A;  4MGD A;  5KCD A;  4G1Y A;  2YAT A;  1PZL A;  4S0S A;  3TKC A;  3W5R A;  3OSA A;  1G50 A;  4ITF A;  4PPP A;  5DID A;  5GIE A;  3TY0 A;  2PIV A;  1OSH A;  1FBY A;  3DCU A;  2AAX A;  3VHW A;  1ZAF A;  3H52 A;  5E15 A;  1R1K D;  2HWR A;  1PRG A;  3VJS A;  5E7V A;  1RKG A;  2R40 A;  2AX8 A;  4ZOM A;  1YUC A;  1RK3 A;  4PF3 A;  1MV9 A;  2AMB A;  1Q4X A;  3B0T A;  3UUA A;  2ZBS A;  3GBK A;  2ZNO A;  4A2J A;  3AUN A;  3FAL A;  4OJ9 A;  4N73 A;  5E0W A;  2AA2 A;  4K4J A;  2PIX A;  4NUF A;  4X1F A;  3DCT A;  3DZY D;  3R29 A;  3IA6 A;  4XUH A;  4MG9 A;  3OMK A;  1S0Z A;  2AO6 A;  3UU7 A;  3GYT A;  2ZK4 A;  3KFC A;  2Z4J A;  4WHG A;  3OZ0 A;  5DXG A;  3ADV A;  4LNW A;  1NDE A;  1XQ3 A;  3K23 A;  2GIU A;  5AVL A;  4B7W A;  3IPQ A;  5JI0 D;  3RUT A;  1T74 A;  1UOM A;  3OZJ A;  1L2J A;  2R6Y A;  4IA3 A;  3OOK A;  2Q3Y A;  2VV3 A;  1EXX A;  1XIU A;  1GWQ A;  3AUQ A;  1YIN A;  2XKW A;  1XDK A;  2G0H A;  2V7C A;  1M7W A;  1PDU A;  3OLF A;  2XYX A;  4J5W A;  4KZM A;  2QNV A;  2BAW A;  4KZJ A;  5DX3 B;  3V9T A;  1UHL A;  4IA1 A;  5AWJ A;  2HAS A;  4OH6 A;  1WM0 X;  2Q5P A;  4J5X C;  4O8F A;  1T65 A;  5EIT A;  1PQC A;  2NPA A;  2J4A A;  3CS6 A;  3OLS A;  3OMQ A;  1UPW A;  2ACL A;  2YHD A;  1IE9 A;  4R06 A;  3VRV A;  1XNX A;  5JJM B;  2I0G A;  5LWP A;  4DM8 A;  2VV1 A;  1PCG A;  1T5Z A;  3A3Z X;  4G1Z A;  3WT7 A;  1KKQ A;  4FHI A;  5DMC A;  5E19 A;  1KNU A;  4DK8 A;  2B23 A;  3BQD A;  4ZNW A;  4UDA A;  2OCF A;  4RMD A;  1X7E A;  5G3J A;  1FM9 D;  1G1U A;  5DXQ A;  5HYK A;  4R6S A;  5JY3 A;  5AZT A;  1T7T A;  2QH6 A;  3AZ2 A;  1NQ1 A;  2B50 A;  2Q61 A;  5A86 A;  4OZR U;  4G20 A;  5KRC A;  3P88 A;  1SQN A;  5HJS A;  3X36 A;  4DM6 A;  3VT9 A;  1XVP A;  3AZ1 A;  1R20 D;  3Q95 B;  3UP3 A;  2ATH A;  4TV1 B;  4DOR A;  4RAK A;  5I4V A;  1N83 A;  3P89 A;  4PP5 A;  3CJW A;  3FXV A;  3UUC A;  1EXA A;  1XLS A;  5GIC A;  1QKN A;  1OSV A;  3KWY A;  3RLJ A;  1R6G A;  5DXE A;  5AAV A;  3OKH A;  4MG8 B;  1SJ0 A;  1P8D A;  4FN9 A;  5DXK A;  1K4W A;  4MG5 A;  3A9E A;  5DP0 A;  1ZUC A;  5APH A;  4APU A;  5B41 A;  3E00 D;  4P6X A;  3FUG A;  4OC7 A;  4RZE A;  2ZMI A;  5ICK A;  4BCR A;  5HYR A;  1QKU A;  3W0Y A;  1GS4 A;  4RMC A;  2NV7 A;  3ADS A;  1UHL B;  2P54 A;  5E14 A;  2GPO A;  5C4T A;  5KRM A;  3FC6 A;  2JF9 A;  1K74 A;  5KYJ A;  3OS8 C;  1YY4 A;  4WVD A;  3B0R A;  3DY6 A;  2V0V A;  5DV8 A;  3T03 A;  3O1D A;  3VN2 A;  4L96 A;  1S9Q A;  2ACL B;  1XV9 B;  2OAX A;  2REW A;  2I4J A;  2P1U A;  4S15 A;  1U9E A;  4EM9 A;  5KCF A;  2Q7L A;  1T76 A;  2OVH A;  2BJ4 A;  2PIU A;  3V3E A;  4YT1 A;  3AFR A;  2VV4 A;  2PIT A;  3LMP A;  5DYD A;  4LNX A;  3NOA A;  3FUR A;  3VT3 A;  3UUD A;  2ZY0 A;  4J5W C;  2ZXM A;  5DV6 A;  5HJP B;  1YMT A;  5DZI A;  4QE8 A;  3ZQT A;  5DWL A;  2O9I A;  3K6P A;  3PBA A;  1A28 A;  2AX9 A;  2R40 D;  4MG6 A;  2HB8 A;  3GWX A;  4OAR A;  4FNE A;  5HCV A;  3CTB A;  3U9Q A;  2GL8 A;  2Q5G A;  2ZMJ A;  3KBA A;  4J26 A;  4MGA B;  5KRA A;  1XVP B;  4OKX A;  4ZNT A;  3W0J A;  2HAR A;  2GWX A;  3VHU A;  5DVS A;  3KDU A;  2YLO A;  1ILG A;  5EGV A;  5FQR A;  4PP6 A;  4MGB B;  5E1C A;  3FS1 A;  5EHJ A;  3IPS A;  4JYG A;  2YLY A;  3VT8 A;  5KRO A;  3W0A A;  2OVM A;  3M7R A;  5DIG A;  2GTK A;  1ZEO A;  5DL4 A;  1XP9 A;  4MG7 A;  4JYI A;  1ERE A;  3BEJ A;  3ET3 A;  3UVV A;  2IOG A;  2PIN A;  2P1V A;  5FQP A;  3MNE A;  3B0Q A;  5M96 A;  5DWG A;  2ZK3 A;  2XYW A;  3VRW A;  1HJ1 A;  3VRU A;  1GWR A;  1XAP A;  2AM9 A;  2Q6R A;  3MNP A;  3MNO A;  2Q59 A;  4KZI A;  3GYU A;  5DXB A;  1FM6 A;  2PIR A;  2NW4 A;  1FCY A;  2J14 A;  2P7Z A;  4DOS A;  2G44 A;  4PP3 A;  2PIP L;  1X78 A;  3FC6 B;  1DKF B;  4IWF A;  2Z4B A;  4DK7 A;  4OHA A;  2P15 A;  5DRJ A;  1Y0S A;  3ADU A;  1XOW A;  2QAB A;  3AUR A;  1U3S A;  5DZH A;  4JAZ A;  4REF A;  4PLD A;  5E0X A;  2NXX A;  4X1G A;  4ZO1 X;  4K7A A;  4IVY A;  1X7B A;  2BJ4 B;  3G9E A;  3CS4 A;  3L0J A;  1XB7 A;  1XP1 A;  1SR7 A;  4QL8 A;  3VT4 A;  2GPU A;  2JJ3 A;  3OS9 A;  3UUD B;  5KRK A;  3D6D A;  2ZK6 A;  3IPU A;  3CS8 A;  3R8I A;  4RZF A;  4Y29 A;  2I0J A;  1NQ2 A;  2POB A;  2QTU A;  4WHF A;  2Q5S A;  5G46 A;  3ZRB A;  4RZG A;  1G5Y A;  1YOK A;  1E3K A;  3F5C A;  1OVL A;  1XQC A;  3RLL A;  3TX7 B;  2Q7K A;  5AAV B;  2ZK2 A;  4IS8 A;  5DZ0 A;  3TKM A;  2QA8 A;  4ZNU A;  4JGV A;  4WQP A;  5DKE A;  1T7R A;  1L2I A;  2AA5 A;  3L0L A;  3ET0 A;  1SKX A;  2ZXZ A;  4MGD B;  4NQA B;  1M13 A;  1S9P A;  4QJR A;  1BSX A;  3QT0 A;  4MG7 B;  1FCZ A;  3S9S A;  1YIM A;  3WJ5 A;  2QZO A;  3B0W A;  3FEI A;  1NYX A;  4PWL A;  2OUZ A;  1DB1 A;  2QGT A;  5KYA A;  2PRG A;  3D57 A;  4ONI A;  4OZR E;  5AWK A;  5KCE A;  4PRG A;  1RDT A;  2H77 A;  2QXS A;  3WJ4 A;  2Q6S A;  2Q60 A;  4IA2 A;  2HCD A;  5DVV A;  2YLQ A;  4N8R A;  3A2I A;  2YJD A;  3B3K A;  4UDB A;  3UUA B;  1H9U A;  2IOK A;  3FAL B;  1XNN A;  2ZLA A;  3X31 A;  1ZKY A;  3ERD A;  1XLS E;  2PNU A;  3SP9 A;  5DXP A;  5EC9 A;  4MG9 B;  5DUE A;  4QK4 A;  4QE6 A;  3UU7 B;  4ZN7 A;  4A4V A;  3IXP A;  1XP6 A;  5APK A;  1K74 D;  2HB7 A;  4ZN9 A;  4XT9 A;  4OKB A;  2ZFX A;  2QMV A;  4CI5 A;  4PLE A;  3ZRA A;  3ILZ A;  2QSE A;  4IW6 A;  1E3G A;  2XHS A;  4JL4 A;  3GN8 A;  3VTD A;  2J7Y A;  4RWV A;  2GP7 A;  4OFU A;  2A3I A;  5KRJ A;  2AYR A;  3KMZ A;  5FQV A;  3B5R A;  4OFR A;  3K8S A;  1PK5 A;  4ZNV A;  3VSO A;  3PRG A;  4OIV A;  4QM0 A;  4DQM A;  2R6W A;  2QW4 A;  1XDK B;  2O4J A;  5DKB A;  3JZC A;  1HG4 A;  1I37 A;  3R5N A;  1K7L A;  2ZL9 A;  3F5C B;  1QKM A;  1T63 A;  4RFW A;  4WLB A;  5G42 A;  3ET1 A;  4OJ4 A;  3CDS A;  5DXR A;  3V3Q A;  2F4B A;  4OZT U;  2VSR A;  2QPY A;  5EJV A;  5AVI A;  5G44 A;  1XPC A;  3G8O A;  3HO0 A;  5DIE A;  4OK1 A;  3A2J A;  2PIW A;  3G8I A;  2PIQ A;  2VV1 B;  4IWC A;  5DSH A;  3DZU A;  4N1Y A;  3OMM A;  2G0G A;  3VHV A;  4A4W A;  2ABI A;  4R2U A;  3ADX A;  2E2R A;  4IUI A;  3HZF A;  5L7G A;  5AK2 A;  2XYJ A;  4K6I A;  5KRF A;  2QZO B;  2Q1H A;  3SZ1 A;  2QXM A;  2LBD A;  4RE8 A;  3RVF A;  5IXK A;  4J24 A;  2QR9 A;  1Z5X U;  4ZJW A;  2P7G A;  5APJ A;  1GWX A;  4OIL A;  4TUZ A;  2ZK5 A;  1NAV A;  3W0C A;  1G2N A;  4IW8 A;  4NB6 A;  1I7G A;  5DK9 A;  1FM6 D;  2POG A;  2VV0 A;  1Z95 A;  2FVJ A;  3HVL A;  4OH5 A;  4J5X A;  2Q7J A;  5C4O A;  2AMA A;  3LBD A;  4G2H A;  5HZC A;  5ETH A;  2OM9 A;  1XJ7 A;  4PPS A;  3HM1 A;  4G1D A;  3E7C A;  4RME A;  3RY9 A;  1OT7 A;  4OJB A;  2J7X A;  2ZMH A;  4S14 A;  2ZNN A;  5DWJ A;  3R5M A;  5KCC A;  3P8X A;  2Q8S A;  2YJA B;  3HQ5 A;  3OSI A;  5G45 A;  3A2H A;  3CLD A;  5KCW A;  1NUO A;  4N5G A;  5DX3 A;  3L0E A;  1ZH7 A;  1X76 A;  1YYE A;  3A9E B;  5DLR A;  4M8E A;  4XLD A;  1QKT A;  2QE4 A;  2VV2 A;  4NY9 A;  3PLZ A;  4IU7 A;  5DV3 A;  3D90 A;  3P0U A;  3RUU A;  5KRI A;  5GT4 A;  1T73 A;  3WTQ A;  5JJM A;  5DKS A;  1ZDU A;  2YFE A;  2ZNQ A;  1FCX A;  2NXX E;  3B66 A;  1U3R A;  1XZX X;  3WT5 A;  4OIU A;  4RUO X;  4UDC A;  3KPZ A;  4FGY A;  2ZK1 A;  4LBD A;  5AAU A;  5DI7 A;  1S0X A;  3V9V A;  5B5B A;  4OLM A;  2ZKC A;  3KYT A;  4RUP A;  2VV4 B;  3V9Y A;  5KCU A;  2ZAS A;  3B1M A;  4OEZ A; 
#chains in the Genus database with same CATH homology
 3B68 A;  3ZR7 A;  4HEE X;  1M2Z A;  2IHQ A;  3Q95 A;  3K22 A;  4TV1 A;  3OKI A;  3L3Z A;  1RDT D;  1NRL A;  4NIE A;  4OKW A;  5DMF A;  2W8Y A;  4MDD A;  4TUZ B;  4Q0A C;  1MVC A;  5CJ6 A;  3DR1 A;  2Q7I A;  4IQR A;  3OLL A;  3OMO A;  4CI4 A;  3VI8 A;  5GID A;  4G21 A;  3OS8 A;  2I4P A;  1PQ9 A;  3NSP A;  1R1K A;  2Q6J A;  3VJT A;  3WT6 A;  4REE A;  4MG8 A;  2O4R A;  3DT3 A;  3H0A D;  3HOD A;  5DRM A;  5DU5 A;  2ZVT A;  1ZDT A;  3OMP A;  4ZO1 B;  3W5P A;  1YJE A;  2JFA A;  2QGW A;  2HBH A;  3IXP D;  5SYZ A;  1ZGY A;  2GPV A;  4UDD A;  1KV6 A;  5DKG A;  3VT6 A;  3BC5 A;  3VTC A;  3VT5 A;  3UVV B;  3DZY A;  1TFC A;  3GZ9 A;  2P4Y A;  3AN3 A;  3N00 A;  4ZI1 A;  2ZK0 A;  1LV2 A;  5KR9 A;  3UP0 A;  4YPQ A;  1N46 A;  3VJH A;  3WMH A;  2HAM A;  5DXB B;  4RUJ A;  2Q59 B;  5LGA A;  1A52 A;  1VJB A;  5DWI A;  4FHH A;  3ERT A;  5KRL A;  5KCT A;  5DXM A;  5DZ1 A;  5K13 A;  1YP0 A;  4WPF A;  3H0A A;  5KRH A;  1XV9 A;  3D5F A;  5AZV A;  3HC5 A;  3FLI A;  2PIO A;  4LTW A;  3V4A A;  2OZ7 A;  1Y0X X;  3VJI A;  1U3Q A;  4E2J A;  1T79 A;  4P6W A;  3VSP A;  2Q70 A;  3CDP A;  4YNK A;  1R5K A;  5HJP A;  2B1V A;  1IE8 A;  2AA6 A;  3B65 A;  2B1Z A;  5AYG A;  3O1E A;  3JZB A;  3R8D A;  5L7H A;  1NAX A;  2I4Z A;  3DZU D;  5EI1 A;  3W5T A;  3L1B A;  3GWS X;  5FQS A;  4L98 A;  4Q13 A;  4MGA A;  5G43 A;  2YLP A;  4OED A;  4E4Q A;  2HWQ A;  3ADT A;  3WGP A;  4F9M A;  4IV4 A;  5ACC A;  3R8A A;  1RKH A;  3AN4 A;  3ADW A;  1OVL B;  4LSJ A;  4IVW A;  5DZ3 A;  1LBD A;  4MGB A;  5FQT A;  4OZT E;  3FEJ A;  1NQ0 A;  2QA8 B;  3W0I A;  1X7J A;  3PO9 A;  1YA3 A;  2AWH A;  1MZN A;  4MGC A;  5IZ0 A;  3WFG A;  4CSJ A;  1FD0 A;  4YMQ A;  1FM9 A;  3AX8 A;  2G5O A;  4ZNS A;  2QA6 A;  3OOF A;  3WFF A;  2AXA A;  2P1T A;  3WWR A;  1I38 A;  3HC6 A;  3W0H A;  4POH A;  3V49 A;  4ZJR A;  4ITE A;  2HVC A;  1Y9R A;  2JFA B;  2AX6 A;  3OGT A;  4IV2 A;  2FSZ A;  5DVC A;  3KDT A;  3B67 A;  5C4S A;  4OKT A;  4XAO A;  2H79 A;  3A40 X;  1Z5X E;  1R20 A;  1RJK A;  5H1E A;  1ERR A;  3CWD A;  1TXI A;  3PEQ A;  1N4H A;  2AA7 A;  2ZNP A;  3NSQ A;  3X1H A;  4PXM A;  1NQ7 A;  3GD2 A;  3CQV A;  1DKF A;  1UPV A;  3EYB A;  4XUM A;  5DTV A;  4OGH A;  4XI3 A;  1T7M A;  2EWP A;  2HC4 A;  4HLW A;  4S0T A;  3SP6 A;  3VTB A;  5IAW A;  2ZLC A;  5C4U A;  2P7A A;  3IMY A;  1P93 A;  1X7R A;  3L03 A;  1NHZ A;  2VST A;  3OSW A;  3OAP A;  4OEA A;  3VRT A;  4M8H A;  5DY8 A;  3KMR A;  4JYH A;  5L7E A;  3W0G A;  1ILH A;  3E00 A;  2PJL A;  4G2I A;  5F9B A;  3HLV A;  3G0W A;  4ZNH A;  1T7F A;  3X1I A;  4OEY A;  3ET2 A;  2GPP A;  3KMG A;  5DUH A;  2Q1V A;  2HFP A;  4EMA A;  5KD9 A;  3E94 A;  3L3X A;  3A78 A;  1YOW A;  5DYB A;  5G5W A;  3W5Q A;  1S19 A;  4PVU A;  4XTA A;  4DMA A;  1I7I A;  3D24 A;  4E4K A;  3F7D A;  3R2A A;  5DUG A;  3VT7 A;  2AX7 A;  4Q50 A;  2PKL A;  4IA7 A;  3PCU A;  4POJ A;  2AB2 A;  5L11 A;  2FAI A;  3AZ3 A;  5DWE A;  4XHD A;  1PQ6 A;  2ZXN A;  4MGD A;  5KCD A;  4G1Y A;  2YAT A;  1PZL A;  4S0S A;  3TKC A;  3W5R A;  3OSA A;  1G50 A;  4ITF A;  4PPP A;  5DID A;  5GIE A;  3TY0 A;  2PIV A;  1OSH A;  1FBY A;  3DCU A;  2AAX A;  3VHW A;  1ZAF A;  3H52 A;  5E15 A;  1R1K D;  2HWR A;  1PRG A;  3VJS A;  5E7V A;  1RKG A;  2R40 A;  2AX8 A;  4ZOM A;  1YUC A;  1RK3 A;  4PF3 A;  1MV9 A;  2AMB A;  1Q4X A;  3B0T A;  3UUA A;  2ZBS A;  3GBK A;  2ZNO A;  4A2J A;  3AUN A;  3FAL A;  4OJ9 A;  4N73 A;  5E0W A;  2AA2 A;  4K4J A;  2PIX A;  4NUF A;  4X1F A;  3DCT A;  3DZY D;  3R29 A;  3IA6 A;  4XUH A;  4MG9 A;  3OMK A;  1S0Z A;  2AO6 A;  3UU7 A;  3GYT A;  2ZK4 A;  3KFC A;  2Z4J A;  4WHG A;  3OZ0 A;  5DXG A;  3ADV A;  4LNW A;  1NDE A;  1XQ3 A;  3K23 A;  2GIU A;  5AVL A;  4B7W A;  3IPQ A;  5JI0 D;  3RUT A;  1T74 A;  1UOM A;  3OZJ A;  1L2J A;  2R6Y A;  4IA3 A;  3OOK A;  2Q3Y A;  2VV3 A;  1EXX A;  1XIU A;  1GWQ A;  3AUQ A;  1YIN A;  2XKW A;  1XDK A;  2G0H A;  2V7C A;  1M7W A;  1PDU A;  3OLF A;  2XYX A;  4J5W A;  4KZM A;  2QNV A;  2BAW A;  4KZJ A;  5DX3 B;  3V9T A;  1UHL A;  4IA1 A;  5AWJ A;  2HAS A;  4OH6 A;  1WM0 X;  2Q5P A;  4J5X C;  4O8F A;  1T65 A;  5EIT A;  1PQC A;  2NPA A;  2J4A A;  3CS6 A;  3OLS A;  3OMQ A;  1UPW A;  2ACL A;  2YHD A;  1IE9 A;  4R06 A;  3VRV A;  1XNX A;  5JJM B;  2I0G A;  5LWP A;  4DM8 A;  2VV1 A;  1PCG A;  1T5Z A;  3A3Z X;  4G1Z A;  3WT7 A;  1KKQ A;  4FHI A;  5DMC A;  5E19 A;  1KNU A;  4DK8 A;  2B23 A;  3BQD A;  4ZNW A;  4UDA A;  2OCF A;  4RMD A;  1X7E A;  5G3J A;  1FM9 D;  1G1U A;  5DXQ A;  5HYK A;  4R6S A;  5JY3 A;  5AZT A;  1T7T A;  2QH6 A;  3AZ2 A;  1NQ1 A;  2B50 A;  2Q61 A;  5A86 A;  4OZR U;  4G20 A;  5KRC A;  3P88 A;  1SQN A;  5HJS A;  3X36 A;  4DM6 A;  3VT9 A;  1XVP A;  3AZ1 A;  1R20 D;  3Q95 B;  3UP3 A;  2ATH A;  4TV1 B;  4DOR A;  4RAK A;  5I4V A;  1N83 A;  3P89 A;  4PP5 A;  3CJW A;  3FXV A;  3UUC A;  1EXA A;  1XLS A;  5GIC A;  1QKN A;  1OSV A;  3KWY A;  3RLJ A;  1R6G A;  5DXE A;  5AAV A;  3OKH A;  4MG8 B;  1SJ0 A;  1P8D A;  4FN9 A;  5DXK A;  1K4W A;  4MG5 A;  3A9E A;  5DP0 A;  1ZUC A;  5APH A;  4APU A;  5B41 A;  3E00 D;  4P6X A;  3FUG A;  4OC7 A;  4RZE A;  2ZMI A;  5ICK A;  4BCR A;  5HYR A;  1QKU A;  3W0Y A;  1GS4 A;  4RMC A;  2NV7 A;  3ADS A;  1UHL B;  2P54 A;  5E14 A;  2GPO A;  5C4T A;  5KRM A;  3FC6 A;  2JF9 A;  1K74 A;  5KYJ A;  3OS8 C;  1YY4 A;  4WVD A;  3B0R A;  3DY6 A;  2V0V A;  5DV8 A;  3T03 A;  3O1D A;  3VN2 A;  4L96 A;  1S9Q A;  2ACL B;  1XV9 B;  2OAX A;  2REW A;  2I4J A;  2P1U A;  4S15 A;  1U9E A;  4EM9 A;  5KCF A;  2Q7L A;  1T76 A;  2OVH A;  2BJ4 A;  2PIU A;  3V3E A;  4YT1 A;  3AFR A;  2VV4 A;  2PIT A;  3LMP A;  5DYD A;  4LNX A;  3NOA A;  3FUR A;  3VT3 A;  3UUD A;  2ZY0 A;  4J5W C;  2ZXM A;  5DV6 A;  5HJP B;  1YMT A;  5DZI A;  4QE8 A;  3ZQT A;  5DWL A;  2O9I A;  3K6P A;  3PBA A;  1A28 A;  2AX9 A;  2R40 D;  4MG6 A;  2HB8 A;  3GWX A;  4OAR A;  4FNE A;  5HCV A;  3CTB A;  3U9Q A;  2GL8 A;  2Q5G A;  2ZMJ A;  3KBA A;  4J26 A;  4MGA B;  5KRA A;  1XVP B;  4OKX A;  4ZNT A;  3W0J A;  2HAR A;  2GWX A;  3VHU A;  5DVS A;  3KDU A;  2YLO A;  1ILG A;  5EGV A;  5FQR A;  4PP6 A;  4MGB B;  5E1C A;  3FS1 A;  5EHJ A;  3IPS A;  4JYG A;  2YLY A;  3VT8 A;  5KRO A;  3W0A A;  2OVM A;  3M7R A;  5DIG A;  2GTK A;  1ZEO A;  5DL4 A;  1XP9 A;  4MG7 A;  4JYI A;  1ERE A;  3BEJ A;  3ET3 A;  3UVV A;  2IOG A;  2PIN A;  2P1V A;  5FQP A;  3MNE A;  3B0Q A;  5M96 A;  5DWG A;  2ZK3 A;  2XYW A;  3VRW A;  1HJ1 A;  3VRU A;  1GWR A;  1XAP A;  2AM9 A;  2Q6R A;  3MNP A;  3MNO A;  2Q59 A;  4KZI A;  3GYU A;  5DXB A;  1FM6 A;  2PIR A;  2NW4 A;  1FCY A;  2J14 A;  2P7Z A;  4DOS A;  2G44 A;  4PP3 A;  2PIP L;  1X78 A;  3FC6 B;  1DKF B;  4IWF A;  2Z4B A;  4DK7 A;  4OHA A;  2P15 A;  5DRJ A;  1Y0S A;  3ADU A;  1XOW A;  2QAB A;  3AUR A;  1U3S A;  5DZH A;  4JAZ A;  4REF A;  4PLD A;  5E0X A;  2NXX A;  4X1G A;  4ZO1 X;  4K7A A;  4IVY A;  1X7B A;  2BJ4 B;  3G9E A;  3CS4 A;  3L0J A;  1XB7 A;  1XP1 A;  1SR7 A;  4QL8 A;  3VT4 A;  2GPU A;  2JJ3 A;  3OS9 A;  3UUD B;  5KRK A;  3D6D A;  2ZK6 A;  3IPU A;  3CS8 A;  3R8I A;  4RZF A;  4Y29 A;  2I0J A;  1NQ2 A;  2POB A;  2QTU A;  4WHF A;  2Q5S A;  5G46 A;  3ZRB A;  4RZG A;  1G5Y A;  1YOK A;  1E3K A;  3F5C A;  1OVL A;  1XQC A;  3RLL A;  3TX7 B;  2Q7K A;  5AAV B;  2ZK2 A;  4IS8 A;  5DZ0 A;  3TKM A;  2QA8 A;  4ZNU A;  4JGV A;  4WQP A;  5DKE A;  1T7R A;  1L2I A;  2AA5 A;  3L0L A;  3ET0 A;  1SKX A;  2ZXZ A;  4MGD B;  4NQA B;  1M13 A;  1S9P A;  4QJR A;  1BSX A;  3QT0 A;  4MG7 B;  1FCZ A;  3S9S A;  1YIM A;  3WJ5 A;  2QZO A;  3B0W A;  3FEI A;  1NYX A;  4PWL A;  2OUZ A;  1DB1 A;  2QGT A;  5KYA A;  2PRG A;  3D57 A;  4ONI A;  4OZR E;  5AWK A;  5KCE A;  4PRG A;  1RDT A;  2H77 A;  2QXS A;  3WJ4 A;  2Q6S A;  2Q60 A;  4IA2 A;  2HCD A;  5DVV A;  2YLQ A;  4N8R A;  3A2I A;  2YJD A;  3B3K A;  4UDB A;  3UUA B;  1H9U A;  2IOK A;  3FAL B;  1XNN A;  2ZLA A;  3X31 A;  1ZKY A;  3ERD A;  1XLS E;  2PNU A;  3SP9 A;  5DXP A;  5EC9 A;  4MG9 B;  5DUE A;  4QK4 A;  4QE6 A;  3UU7 B;  4ZN7 A;  4A4V A;  3IXP A;  1XP6 A;  5APK A;  1K74 D;  2HB7 A;  4ZN9 A;  4XT9 A;  4OKB A;  2ZFX A;  2QMV A;  4CI5 A;  4PLE A;  3ZRA A;  3ILZ A;  2QSE A;  4IW6 A;  1E3G A;  2XHS A;  4JL4 A;  3GN8 A;  3VTD A;  2J7Y A;  4RWV A;  2GP7 A;  4OFU A;  2A3I A;  5KRJ A;  2AYR A;  3KMZ A;  5FQV A;  3B5R A;  4OFR A;  3K8S A;  1PK5 A;  4ZNV A;  3VSO A;  3PRG A;  4OIV A;  4QM0 A;  4DQM A;  2R6W A;  2QW4 A;  1XDK B;  2O4J A;  5DKB A;  3JZC A;  1HG4 A;  1I37 A;  3R5N A;  1K7L A;  2ZL9 A;  3F5C B;  1QKM A;  1T63 A;  4RFW A;  4WLB A;  5G42 A;  3ET1 A;  4OJ4 A;  3CDS A;  5DXR A;  3V3Q A;  2F4B A;  4OZT U;  2VSR A;  2QPY A;  5EJV A;  5AVI A;  5G44 A;  1XPC A;  3G8O A;  3HO0 A;  5DIE A;  4OK1 A;  3A2J A;  2PIW A;  3G8I A;  2PIQ A;  2VV1 B;  4IWC A;  5DSH A;  3DZU A;  4N1Y A;  3OMM A;  2G0G A;  3VHV A;  4A4W A;  2ABI A;  4R2U A;  3ADX A;  2E2R A;  4IUI A;  3HZF A;  5L7G A;  5AK2 A;  2XYJ A;  4K6I A;  5KRF A;  2QZO B;  2Q1H A;  3SZ1 A;  2QXM A;  2LBD A;  4RE8 A;  3RVF A;  5IXK A;  4J24 A;  2QR9 A;  1Z5X U;  4ZJW A;  2P7G A;  5APJ A;  1GWX A;  4OIL A;  4TUZ A;  2ZK5 A;  1NAV A;  3W0C A;  1G2N A;  4IW8 A;  4NB6 A;  1I7G A;  5DK9 A;  1FM6 D;  2POG A;  2VV0 A;  1Z95 A;  2FVJ A;  3HVL A;  4OH5 A;  4J5X A;  2Q7J A;  5C4O A;  2AMA A;  3LBD A;  4G2H A;  5HZC A;  5ETH A;  2OM9 A;  1XJ7 A;  4PPS A;  3HM1 A;  4G1D A;  3E7C A;  4RME A;  3RY9 A;  1OT7 A;  4OJB A;  2J7X A;  2ZMH A;  4S14 A;  2ZNN A;  5DWJ A;  3R5M A;  5KCC A;  3P8X A;  2Q8S A;  2YJA B;  3HQ5 A;  3OSI A;  5G45 A;  3A2H A;  3CLD A;  5KCW A;  1NUO A;  4N5G A;  5DX3 A;  3L0E A;  1ZH7 A;  1X76 A;  1YYE A;  3A9E B;  5DLR A;  4M8E A;  4XLD A;  1QKT A;  2QE4 A;  2VV2 A;  4NY9 A;  3PLZ A;  4IU7 A;  5DV3 A;  3D90 A;  3P0U A;  3RUU A;  5KRI A;  5GT4 A;  1T73 A;  3WTQ A;  5JJM A;  5DKS A;  1ZDU A;  2YFE A;  2ZNQ A;  1FCX A;  2NXX E;  3B66 A;  1U3R A;  1XZX X;  3WT5 A;  4OIU A;  4RUO X;  4UDC A;  3KPZ A;  4FGY A;  2ZK1 A;  4LBD A;  5AAU A;  5DI7 A;  1S0X A;  3V9V A;  5B5B A;  4OLM A;  2ZKC A;  3KYT A;  4RUP A;  2VV4 B;  3V9Y A;  5KCU A;  2ZAS A;  3B1M A;  4OEZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...