3FURA

Crystal structure of pparg in complex with int131
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
272
structure length
256
Chain Sequence
PESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title INT131: a selective modulator of PPAR gamma
pubmed rcsb
molecule keywords Peroxisome proliferator-activated receptor gamma
molecule tags Transcription/transcription regulator
source organism Homo sapiens
total genus 99
structure length 256
sequence length 272
ec nomenclature
pdb deposition date 2009-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 3furA00
3MNOA 4OZRU 1T7RA 3V3EA 2AXAA 2Q1HA 4ZO1X 3OLFA 5HCVA 5KR9A 2GP7A 4XT9A 1HG4A 1XB7A 3KDTA 3NSQA 5JI0D 1T79A 2Q6RA 4DK7A 4NQAB 4ZJRA 1OVLB 4WPFA 1GWRA 2AX8A 5L7HA 4XLDA 4DM8A 3B3KA 3JZCA 1R1KA 2I4ZA 4XAOA 4YT1A 3OSAA 2QA8A 3OLSA 2IHQA 2PIXA 2VV0A 3NSPA 3GBKA 3KPZA 5DVCA 5APKA 4APUA 3KWYA 2QSEA 2PIUA 5AVIA 3S9SA 3ZRAA 4UDAA 2ACLA 2ZXMA 3M7RA 4P6XA 2F4BA 4IS8A 4PRGA 5KRKA 2QXSA 5E15A 3R8DA 5G3JA 1NUOA 2Q1VA 2VV1A 4QK4A 4ZNUA 2VV4B 2Q59B 3VSPA 4J5XC 2AM9A 3QT0A 3VTDA 1P8DA 1UHLA 4TV1A 3X36A 3PO9A 2Q61A 3L0EA 3WJ5A 2ABIA 1T7FA 3D5FA 5DVVA 3OAPA 4LBDA 3W0HA 2ZK4A 4K7AA 2PRGA 3B1MA 1ILHA 2GIUA 2P4YA 4OK1A 4Q13A 1TFCA 3AUNA 4N5GA 4QE8A 5DLRA 3SP9A 1R1KD 1XZXX 2J7XA 2P7AA 4IW6A 2PIVA 4CI4A 4ZN9A 1Z5XU 2IOGA 3D57A 5AYGA 1NDEA 3AN3A 3WT7A 1SKXA 4IWCA 3CS6A 4LTWA 5DKEA 2AA6A 2NW4A 3VT7A 1T65A 1OT7A 4L96A 5KYAA 5IXKA 5DXEA 5KRFA 4IW8A 5A86A 3GYTA 3IA6A 2I4JA 5DXPA 3A2HA 4FHHA 3R8IA 1E3GA 1RK3A 1T5ZA 2HB7A 4IVYA 5DZHA 4G1ZA 5DXQA 2VV3A 5HYRA 1Y0SA 4XUHA 2ACLB 5GT4A 3KYTA 1EXAA 5ETHA 1XP6A 4RWVA 5DUEA 2AMBA 1PQCA 3FLIA 2VV1B 3L3ZA 4OGHA 3DY6A 3R5MA 4RUPA 3A3ZX 2PINA 3CDSA 4X1FA 1X76A 4LNWA 1SJ0A 1XLSE 1UHLB 4TV1B 2ZASA 3UUCA 5DRJA 1PZLA 2QH6A 3B65A 1G2NA 4OZTU 3X1IA 2JF9A 3GD2A 2PITA 3IXPA 3B66A 3IPUA 1SQNA 1ZH7A 4RZGA 1ZEOA 1GWXA 1PQ9A 3PBAA 4OHAA 1T76A 1YINA 5DSHA 5G44A 1G1UA 3TKCA 3VHUA 4A4VA 3D24A 3P8XA 4PP5A 3OMPA 3CTBA 3B0TA 4ITEA 5L11A 2B1VA 3D90A 3B67A 3ERDA 3WGPA 4ZI1A 4OILA 2QXMA 5DKGA 5JJMA 1S19A 2AYRA 1K4WA 4RMEA 4G21A 2O9IA 2OCFA 2QR9A 3LMPA 4CSJA 4OC7A 4PPSA 4WLBA 5DK9A 2P7GA 2OVHA 1KV6A 2Q5GA 4OKBA 1QKUA 5AAVA 5AWKA 5DYDA 5EHJA 2ZK3A 1NRLA 1ZDUA 1IE9A 3IXPD 4MG6A 3WT6A 3JZBA 4RFWA 1YY4A 4K6IA 5G43A 2PIWA 2QGTA 4R6SA 5KRCA 4KZIA 5KCUA 1XQ3A 1Y9RA 3ILZA 3FEJA 2YHDA 3ADSA 4OJBA 5KCCA 3GWSX 1PCGA 3CS4A 1MZNA 1T63A 2YJDA 5ACCA 3W0YA 3CQVA 4RMCA 4OJ9A 2VSTA 1XVPA 4OFRA 3UU7A 2Q6JA 2Q3YA 2ZXNA 4MG7A 5HYKA 1XDKA 2ZL9A 3L0JA 3L1BA 5E14A 2NPAA 3HM1A 3V9YA 5HJSA 2PIOA 2Q6SA 4J5WA 2ZVTA 1EREA 1GS4A 1G50A 2HAMA 3Q95A 5JJMB 1MVCA 3ADXA 2O4JA 4REFA 1X7EA 1WM0X 2PJLA 3IPSA 3VRTA 3VSOA 2W8YA 2NXXE 1NHZA 3R8AA 3V9VA 4IA2A 4EM9A 4IUIA 4OH5A 5DV6A 5KD9A 2I0GA 1I38A 5AAVB 3AZ2A 1XV9A 5I4VA 4UDDA 1TXIA 4MG8A 3HLVA 3OMOA 3GZ9A 1GWQA 1XOWA 2GL8A 4G1DA 5DIEA 1FM9A 3UVVA 2QGWA 3WT5A 2ZK6A 2GPVA 4FHIA 4HEEX 5EJVA 4LSJA 3ADTA 3HC5A 4MGAA 4K4JA 1L2JA 2XHSA 3DT3A 1G5YA 3HODA 4RUJA 2PNUA 3ET3A 3OZJA 3OMMA 3K22A 4OARA 1T7TA 4J26A 2HWRA 3HZFA 4L98A 4MG7B 3UUDA 3UU7B 3F5CA 3UUAA 1XDKB 2R6WA 2P1UA 3VJIA 4OLMA 2B50A 3VT6A 5ICKA 3PCUA 4IU7A 1EXXA 2ZNNA 3VRWA 4ZJWA 1LBDA 3Q95B 2JJ3A 3N00A 2V7CA 3KFCA 1NQ7A 4G2IA 4IV4A 4JAZA 2Q7JA 3V3QA 3VHWA 4PLEA 1Q4XA 1Z95A 4N73A 1RKGA 3AURA 1KKQA 3FALA 3GN8A 1YOKA 4OZRE 5FQTA 4OEZA 2Q60A 2PIQA 1FM9D 1XNXA 2Q70A 4IA3A 4F9MA 5KRHA 4QL8A 4PLDA 5DVSA 1I7GA 1ZUCA 2NV7A 1A28A 1XV9B 2ZMJA 1FCZA 4R06A 5FQVA 5LWPA 1X78A 2XKWA 2ZXZA 1DKFA 4MG8B 1T73A 3UVVB 3V4AA 4M8EA 1I37A 1X7RA 3K8SA 4NIEA 2HB8A 2QNVA 4OJ4A 2LBDA 1Y0XX 5DV8A 3G8IA 3K23A 4JGVA 4MGAB 4RZFA 4WHFA 4ZNHA 1P93A 5AZVA 5G45A 3ET2A 4R2UA 2EWPA 4OH6A 2XYWA 1YP0A 5AWJA 4ITFA 4E4KA 2QA8B 2FAIA 2ZY0A 1ILGA 3UUDB 3UUAB 2A3IA 3F5CB 4S14A 3W5QA 4QM0A 2AB2A 4ZN7A 2ZKCA 1NQ1A 3OOFA 4OIVA 1E3KA 5FQPA 2REWA 3VN2A 4A4WA 4ZNTA 5KCTA 3VRUA 4ZOMA 3B68A 5APJA 1DB1A 3R2AA 4MG9A 5IAWA 3A9EA 4XHDA 2ZNQA 1YIMA 3AN4A 4G20A 4REEA 3ZR7A 3FALB 2ZMHA 3HQ5A 2AA2A 1UPWA 2AAXA 4E2JA 3CS8A 1Z5XE 5EC9A 5DXKA 1DKFB 3L03A 5DWLA 2OZ7A 5HJPA 3RLLA 4A2JA 2PIPL 3AZ1A 3DCUA 5APHA 3UP3A 4EMAA 4Q50A 5K13A 4KZJA 2P15A 3T03A 1SR7A 3VHVA 2P7ZA 2Q7LA 3A2JA 2Z4JA 5AK2A 5EGVA 5DY8A 3X1HA 5KRIA 1H9UA 5KROA 1S0XA 2QA6A 5G5WA 5IZ0A 5SYZA 3E94A 3W0AA 5DL4A 5DWIA 1YYEA 2G0GA 2IOKA 1FBYA 5E1CA 5DX3A 3O1EA 4MG9B 3TKMA 4B7WA 2BJ4A 5DKBA 3A9EB 2YATA 3G8OA 5CJ6A 5AAUA 4IA7A 1XPCA 2GPPA 3AUQA 3VT9A 1MV9A 1RDTA 4FN9A 1ZDTA 2POBA 3B0RA 3VT4A 5KCDA 2HASA 3A78A 3OS8A 5EITA 5C4SA 3ZRBA 2ZMIA 1XLSA 1ZKYA 2HFPA 1QKMA 4FNEA 2J14A 2GWXA 3E7CA 3KDUA 4OEDA 2AX6A 1X7BA 4J24A 4PP3A 3AX8A 4ZO1B 5DU5A 3VTBA 1YMTA 1I7IA 3B0WA 4KZMA 4WHGA 3R5NA 3VJSA 2AMAA 3W5RA 2ZNOA 2O4RA 1KNUA 4Q0AC 2I0JA 1N46A 4MGDA 4N1YA 4WQPA 5DZ1A 3VJTA 4YNKA 5DX3B 4RE8A 2Q7IA 5E7VA 3WFGA 2BJ4B 4OFUA 5H1EA 1RDTD 2BAWA 1L2IA 4NB6A 5KCWA 5DXBA 3W0JA 5KRMA 2XYXA 4JL4A 5KCEA 5EI1A 3VJHA 2P1VA 1U3RA 1U3SA 2AA7A 3ERTA 4S0TA 3OS9A 3VT3A 4DQMA 5DWJA 4BCRA 2G44A 4RAKA 4OEAA 3OSIA 3W0GA 3PEQA 1YJEA 2JFAA 3CLDA 5DKSA 2OVMA 3F7DA 5L7GA 1FM6A 2YLOA 4WVDA 3KBAA 3RVFA 3OKIA 2ZNPA 1RJKA 1NAXA 3OS8C 3GWXA 3W0CA 2ZK2A 4DM6A 3PRGA 3FC6A 2R6YA 1A52A 1XVPB 2B1ZA 2VV4A 4IVWA 5C4UA 3K6PA 4J5XA 3A40X 5DTVA 1U3QA 5GIDA 2ZK1A 2HVCA 5JY3A 2YLPA 3D6DA 5DZ0A 3CDPA 3DZYA 3ZQTA 5E19A 4MGDB 4J5WC 3VT5A 2HARA 5FQRA 2HCDA 1XQCA 2PKLA 5GIEA 2OM9A 3RLJA 3OLLA 3ET0A 1S0ZA 4UDBA 4ONIA 3DR1A 4YMQA 4Y29A 1IE8A 3WFFA 5DXBB 2ZLCA 3FUGA 4NUFA 3RY9A 1QKNA 1U9EA 3R29A 4YPQA 3UP0A 1FM6D 5E0WA 4LNXA 2ATHA 3DCTA 3VRVA 1QKTA 3KMRA 3WTQA 3VI8A 3U9QA 2PIRA 2JFAB 2VV2A 3VT8A 2FVJA 3G9EA 3H0AA 4OKWA 2YLYA 3HVLA 3DZUA 4PWLA 5G46A 5DWGA 2NXXA 1UOMA 2HC4A 3WJ4A 3B5RA 2QMVA 3BC5A 3KMGA 2QE4A 4HLWA 4IA1A 5DXMA 3TX7B 1FCYA 3FC6B 3E00A 3EYBA 5DWEA 5F9BA 1XP1A 5DIDA 5KRJA 3DZYD 1ERRA 3W5PA 3RUTA 1YOWA 3MNPA 3FXVA 4XI3A 2ZK5A 2OAXA 1RKHA 3OKHA 3HO0A 3P89A 1M7WA 4FGYA 1NQ2A 5HZCA 1NYXA 3LBDA 3ET1A 5B5BA 3ADUA 3CJWA 4MG5A 2VSRA 4IV2A 5AZTA 5DUHA 2HWQA 1ZGYA 2G0HA 2XYJA 4DOSA 1PK5A 4MGCA 5DV3A 1NAVA 5AVLA 2QW4A 4PXMA 1N4HA 1M2ZA 3H0AD 4POHA 3W0IA 4UDCA 3OSWA 3DZUD 4ZNSA 4IQRA 3FEIA 4JYHA 1YA3A 2P1TA 5LGAA 2AX9A 3WMHA 3WWRA 1K74A 3FURA 2I4PA 4X1GA 5KYJA 3E00D 1VJBA 5DMFA 4DORA 1YUCA 1R20A 2ZBSA 2AWHA 4NY9A 1OSVA 2V0VA 1R6GA 2R40A 3B0QA 2QPYA 4JYIA 4TUZA 2QTUA 4N8RA 3PLZA 2OUZA 4RMDA 3OGTA 3P0UA 4POJA 4QJRA 2ZFXA 5DXRA 3FS1A 1PRGA 4OKTA 2Z4BA 2YJAB 3CWDA 4ZNVA 3ADVA 5DIGA 3V49A 3AFRA 1LV2A 4PVUA 2Q8SA 4G1YA 4RZEA 4XUMA 4OZTE 2H77A 5DP0A 5E0XA 1M13A 2FSZA 3P88A 4CI5A 2J7YA 3TY0A 5KRLA 3MNEA 3SP6A 4DK8A 3IPQA 1K74D 5G42A 3O1DA 1NQ0A 3BQDA 4XTAA 4PP6A 5HJPB 3L0LA 1R20D 2QZOA 2GTKA 3AZ3A 1BSXA 1XNNA 2J4AA 4MGBA 5DUGA 3ADWA 2R40D 4OEYA 4DMAA 4ZNWA 3A2IA 4G2HA 5KCFA 1FCXA 5M96A 3OOKA 4E4QA 2AX7A 2QABA 5DYBA 5GICA 1X7JA 4IWFA 4OIUA 5DZ3A 5L7EA 1XAPA 1OSHA 2AA5A 4MDDA 2POGA 4TUZB 1K7LA 2AO6A 5DRMA 2Q5PA 1T7MA 4S15A 3H52A 3V9TA 3OMQA 3VTCA 1ZAFA 4QE6A 1S9QA 4PF3A 1FD0A 4S0SA 1R5KA 2E2RA 2Q5SA 1HJ1A 3SZ1A 3KMZA 1PDUA 5DZIA 3HC6A 5B41A 1OVLA 1XP9A 4JYGA 4O8FA 2Q7KA 3W5TA 5C4TA 1PQ6A 2H79A 5FQSA 4P6WA 2HBHA 3G0WA 2P54A 1S9PA 3L3XA 4PPPA 2YFEA 1XJ7A 3GYUA 2QZOB 5DXGA 2ZK0A 4MGBB 1T74A 3OZ0A 2GPOA 3BEJA 1UPVA 5KRAA 5C4OA 3RUUA 4RUOX 2ZLAA 5DMCA 2GPUA 2YLQA 5DI7A 1N83A 2B23A 2Q59A 3OMKA 3X31A 3NOAA 2G5OA 4OKXA 4M8HA 1XIUA 3IMYA
chains in the Genus database with same CATH superfamily
3MNOA 4OZRU 1T7RA 3V3EA 2AXAA 2Q1HA 4ZO1X 3OLFA 5HCVA 5KR9A 2GP7A 4XT9A 1HG4A 1XB7A 3KDTA 3NSQA 5JI0D 1T79A 2Q6RA 4DK7A 4NQAB 4ZJRA 1OVLB 4WPFA 1GWRA 2AX8A 5L7HA 4XLDA 4DM8A 3B3KA 3JZCA 1R1KA 2I4ZA 4XAOA 4YT1A 3OSAA 2QA8A 3OLSA 2IHQA 2PIXA 2VV0A 3NSPA 3GBKA 3KPZA 5DVCA 5APKA 4APUA 3KWYA 2QSEA 2PIUA 5AVIA 3S9SA 3ZRAA 4UDAA 2ACLA 2ZXMA 3M7RA 4P6XA 2F4BA 4IS8A 4PRGA 5KRKA 2QXSA 5E15A 3R8DA 5G3JA 1NUOA 2Q1VA 2VV1A 4QK4A 4ZNUA 2VV4B 2Q59B 3VSPA 4J5XC 2AM9A 3QT0A 3VTDA 1P8DA 1UHLA 4TV1A 3X36A 3PO9A 2Q61A 3L0EA 3WJ5A 2ABIA 1T7FA 3D5FA 5DVVA 3OAPA 4LBDA 3W0HA 2ZK4A 4K7AA 2PRGA 3B1MA 1ILHA 2GIUA 2P4YA 4OK1A 4Q13A 1TFCA 3AUNA 4N5GA 4QE8A 5DLRA 3SP9A 1R1KD 1XZXX 2J7XA 2P7AA 4IW6A 2PIVA 4CI4A 4ZN9A 1Z5XU 2IOGA 3D57A 5AYGA 1NDEA 3AN3A 3WT7A 1SKXA 4IWCA 3CS6A 4LTWA 5DKEA 2AA6A 2NW4A 3VT7A 1T65A 1OT7A 4L96A 5KYAA 5IXKA 5DXEA 5KRFA 4IW8A 5A86A 3GYTA 3IA6A 2I4JA 5DXPA 3A2HA 4FHHA 3R8IA 1E3GA 1RK3A 1T5ZA 2HB7A 4IVYA 5DZHA 4G1ZA 5DXQA 2VV3A 5HYRA 1Y0SA 4XUHA 2ACLB 5GT4A 3KYTA 1EXAA 5ETHA 1XP6A 4RWVA 5DUEA 2AMBA 1PQCA 3FLIA 2VV1B 3L3ZA 4OGHA 3DY6A 3R5MA 4RUPA 3A3ZX 2PINA 3CDSA 4X1FA 1X76A 4LNWA 1SJ0A 1XLSE 1UHLB 4TV1B 2ZASA 3UUCA 5DRJA 1PZLA 2QH6A 3B65A 1G2NA 4OZTU 3X1IA 2JF9A 3GD2A 2PITA 3IXPA 3B66A 3IPUA 1SQNA 1ZH7A 4RZGA 1ZEOA 1GWXA 1PQ9A 3PBAA 4OHAA 1T76A 1YINA 5DSHA 5G44A 1G1UA 3TKCA 3VHUA 4A4VA 3D24A 3P8XA 4PP5A 3OMPA 3CTBA 3B0TA 4ITEA 5L11A 2B1VA 3D90A 3B67A 3ERDA 3WGPA 4ZI1A 4OILA 2QXMA 5DKGA 5JJMA 1S19A 2AYRA 1K4WA 4RMEA 4G21A 2O9IA 2OCFA 2QR9A 3LMPA 4CSJA 4OC7A 4PPSA 4WLBA 5DK9A 2P7GA 2OVHA 1KV6A 2Q5GA 4OKBA 1QKUA 5AAVA 5AWKA 5DYDA 5EHJA 2ZK3A 1NRLA 1ZDUA 1IE9A 3IXPD 4MG6A 3WT6A 3JZBA 4RFWA 1YY4A 4K6IA 5G43A 2PIWA 2QGTA 4R6SA 5KRCA 4KZIA 5KCUA 1XQ3A 1Y9RA 3ILZA 3FEJA 2YHDA 3ADSA 4OJBA 5KCCA 3GWSX 1PCGA 3CS4A 1MZNA 1T63A 2YJDA 5ACCA 3W0YA 3CQVA 4RMCA 4OJ9A 2VSTA 1XVPA 4OFRA 3UU7A 2Q6JA 2Q3YA 2ZXNA 4MG7A 5HYKA 1XDKA 2ZL9A 3L0JA 3L1BA 5E14A 2NPAA 3HM1A 3V9YA 5HJSA 2PIOA 2Q6SA 4J5WA 2ZVTA 1EREA 1GS4A 1G50A 2HAMA 3Q95A 5JJMB 1MVCA 3ADXA 2O4JA 4REFA 1X7EA 1WM0X 2PJLA 3IPSA 3VRTA 3VSOA 2W8YA 2NXXE 1NHZA 3R8AA 3V9VA 4IA2A 4EM9A 4IUIA 4OH5A 5DV6A 5KD9A 2I0GA 1I38A 5AAVB 3AZ2A 1XV9A 5I4VA 4UDDA 1TXIA 4MG8A 3HLVA 3OMOA 3GZ9A 1GWQA 1XOWA 2GL8A 4G1DA 5DIEA 1FM9A 3UVVA 2QGWA 3WT5A 2ZK6A 2GPVA 4FHIA 4HEEX 5EJVA 4LSJA 3ADTA 3HC5A 4MGAA 4K4JA 1L2JA 2XHSA 3DT3A 1G5YA 3HODA 4RUJA 2PNUA 3ET3A 3OZJA 3OMMA 3K22A 4OARA 1T7TA 4J26A 2HWRA 3HZFA 4L98A 4MG7B 3UUDA 3UU7B 3F5CA 3UUAA 1XDKB 2R6WA 2P1UA 3VJIA 4OLMA 2B50A 3VT6A 5ICKA 3PCUA 4IU7A 1EXXA 2ZNNA 3VRWA 4ZJWA 1LBDA 3Q95B 2JJ3A 3N00A 2V7CA 3KFCA 1NQ7A 4G2IA 4IV4A 4JAZA 2Q7JA 3V3QA 3VHWA 4PLEA 1Q4XA 1Z95A 4N73A 1RKGA 3AURA 1KKQA 3FALA 3GN8A 1YOKA 4OZRE 5FQTA 4OEZA 2Q60A 2PIQA 1FM9D 1XNXA 2Q70A 4IA3A 4F9MA 5KRHA 4QL8A 4PLDA 5DVSA 1I7GA 1ZUCA 2NV7A 1A28A 1XV9B 2ZMJA 1FCZA 4R06A 5FQVA 5LWPA 1X78A 2XKWA 2ZXZA 1DKFA 4MG8B 1T73A 3UVVB 3V4AA 4M8EA 1I37A 1X7RA 3K8SA 4NIEA 2HB8A 2QNVA 4OJ4A 2LBDA 1Y0XX 5DV8A 3G8IA 3K23A 4JGVA 4MGAB 4RZFA 4WHFA 4ZNHA 1P93A 5AZVA 5G45A 3ET2A 4R2UA 2EWPA 4OH6A 2XYWA 1YP0A 5AWJA 4ITFA 4E4KA 2QA8B 2FAIA 2ZY0A 1ILGA 3UUDB 3UUAB 2A3IA 3F5CB 4S14A 3W5QA 4QM0A 2AB2A 4ZN7A 2ZKCA 1NQ1A 3OOFA 4OIVA 1E3KA 5FQPA 2REWA 3VN2A 4A4WA 4ZNTA 5KCTA 3VRUA 4ZOMA 3B68A 5APJA 1DB1A 3R2AA 4MG9A 5IAWA 3A9EA 4XHDA 2ZNQA 1YIMA 3AN4A 4G20A 4REEA 3ZR7A 3FALB 2ZMHA 3HQ5A 2AA2A 1UPWA 2AAXA 4E2JA 3CS8A 1Z5XE 5EC9A 5DXKA 1DKFB 3L03A 5DWLA 2OZ7A 5HJPA 3RLLA 4A2JA 2PIPL 3AZ1A 3DCUA 5APHA 3UP3A 4EMAA 4Q50A 5K13A 4KZJA 2P15A 3T03A 1SR7A 3VHVA 2P7ZA 2Q7LA 3A2JA 2Z4JA 5AK2A 5EGVA 5DY8A 3X1HA 5KRIA 1H9UA 5KROA 1S0XA 2QA6A 5G5WA 5IZ0A 5SYZA 3E94A 3W0AA 5DL4A 5DWIA 1YYEA 2G0GA 2IOKA 1FBYA 5E1CA 5DX3A 3O1EA 4MG9B 3TKMA 4B7WA 2BJ4A 5DKBA 3A9EB 2YATA 3G8OA 5CJ6A 5AAUA 4IA7A 1XPCA 2GPPA 3AUQA 3VT9A 1MV9A 1RDTA 4FN9A 1ZDTA 2POBA 3B0RA 3VT4A 5KCDA 2HASA 3A78A 3OS8A 5EITA 5C4SA 3ZRBA 2ZMIA 1XLSA 1ZKYA 2HFPA 1QKMA 4FNEA 2J14A 2GWXA 3E7CA 3KDUA 4OEDA 2AX6A 1X7BA 4J24A 4PP3A 3AX8A 4ZO1B 5DU5A 3VTBA 1YMTA 1I7IA 3B0WA 4KZMA 4WHGA 3R5NA 3VJSA 2AMAA 3W5RA 2ZNOA 2O4RA 1KNUA 4Q0AC 2I0JA 1N46A 4MGDA 4N1YA 4WQPA 5DZ1A 3VJTA 4YNKA 5DX3B 4RE8A 2Q7IA 5E7VA 3WFGA 2BJ4B 4OFUA 5H1EA 1RDTD 2BAWA 1L2IA 4NB6A 5KCWA 5DXBA 3W0JA 5KRMA 2XYXA 4JL4A 5KCEA 5EI1A 3VJHA 2P1VA 1U3RA 1U3SA 2AA7A 3ERTA 4S0TA 3OS9A 3VT3A 4DQMA 5DWJA 4BCRA 2G44A 4RAKA 4OEAA 3OSIA 3W0GA 3PEQA 1YJEA 2JFAA 3CLDA 5DKSA 2OVMA 3F7DA 5L7GA 1FM6A 2YLOA 4WVDA 3KBAA 3RVFA 3OKIA 2ZNPA 1RJKA 1NAXA 3OS8C 3GWXA 3W0CA 2ZK2A 4DM6A 3PRGA 3FC6A 2R6YA 1A52A 1XVPB 2B1ZA 2VV4A 4IVWA 5C4UA 3K6PA 4J5XA 3A40X 5DTVA 1U3QA 5GIDA 2ZK1A 2HVCA 5JY3A 2YLPA 3D6DA 5DZ0A 3CDPA 3DZYA 3ZQTA 5E19A 4MGDB 4J5WC 3VT5A 2HARA 5FQRA 2HCDA 1XQCA 2PKLA 5GIEA 2OM9A 3RLJA 3OLLA 3ET0A 1S0ZA 4UDBA 4ONIA 3DR1A 4YMQA 4Y29A 1IE8A 3WFFA 5DXBB 2ZLCA 3FUGA 4NUFA 3RY9A 1QKNA 1U9EA 3R29A 4YPQA 3UP0A 1FM6D 5E0WA 4LNXA 2ATHA 3DCTA 3VRVA 1QKTA 3KMRA 3WTQA 3VI8A 3U9QA 2PIRA 2JFAB 2VV2A 3VT8A 2FVJA 3G9EA 3H0AA 4OKWA 2YLYA 3HVLA 3DZUA 4PWLA 5G46A 5DWGA 2NXXA 1UOMA 2HC4A 3WJ4A 3B5RA 2QMVA 3BC5A 3KMGA 2QE4A 4HLWA 4IA1A 5DXMA 3TX7B 1FCYA 3FC6B 3E00A 3EYBA 5DWEA 5F9BA 1XP1A 5DIDA 5KRJA 3DZYD 1ERRA 3W5PA 3RUTA 1YOWA 3MNPA 3FXVA 4XI3A 2ZK5A 2OAXA 1RKHA 3OKHA 3HO0A 3P89A 1M7WA 4FGYA 1NQ2A 5HZCA 1NYXA 3LBDA 3ET1A 5B5BA 3ADUA 3CJWA 4MG5A 2VSRA 4IV2A 5AZTA 5DUHA 2HWQA 1ZGYA 2G0HA 2XYJA 4DOSA 1PK5A 4MGCA 5DV3A 1NAVA 5AVLA 2QW4A 4PXMA 1N4HA 1M2ZA 3H0AD 4POHA 3W0IA 4UDCA 3OSWA 3DZUD 4ZNSA 4IQRA 3FEIA 4JYHA 1YA3A 2P1TA 5LGAA 2AX9A 3WMHA 3WWRA 1K74A 3FURA 2I4PA 4X1GA 5KYJA 3E00D 1VJBA 5DMFA 4DORA 1YUCA 1R20A 2ZBSA 2AWHA 4NY9A 1OSVA 2V0VA 1R6GA 2R40A 3B0QA 2QPYA 4JYIA 4TUZA 2QTUA 4N8RA 3PLZA 2OUZA 4RMDA 3OGTA 3P0UA 4POJA 4QJRA 2ZFXA 5DXRA 3FS1A 1PRGA 4OKTA 2Z4BA 2YJAB 3CWDA 4ZNVA 3ADVA 5DIGA 3V49A 3AFRA 1LV2A 4PVUA 2Q8SA 4G1YA 4RZEA 4XUMA 4OZTE 2H77A 5DP0A 5E0XA 1M13A 2FSZA 3P88A 4CI5A 2J7YA 3TY0A 5KRLA 3MNEA 3SP6A 4DK8A 3IPQA 1K74D 5G42A 3O1DA 1NQ0A 3BQDA 4XTAA 4PP6A 5HJPB 3L0LA 1R20D 2QZOA 2GTKA 3AZ3A 1BSXA 1XNNA 2J4AA 4MGBA 5DUGA 3ADWA 2R40D 4OEYA 4DMAA 4ZNWA 3A2IA 4G2HA 5KCFA 1FCXA 5M96A 3OOKA 4E4QA 2AX7A 2QABA 5DYBA 5GICA 1X7JA 4IWFA 4OIUA 5DZ3A 5L7EA 1XAPA 1OSHA 2AA5A 4MDDA 2POGA 4TUZB 1K7LA 2AO6A 5DRMA 2Q5PA 1T7MA 4S15A 3H52A 3V9TA 3OMQA 3VTCA 1ZAFA 4QE6A 1S9QA 4PF3A 1FD0A 4S0SA 1R5KA 2E2RA 2Q5SA 1HJ1A 3SZ1A 3KMZA 1PDUA 5DZIA 3HC6A 5B41A 1OVLA 1XP9A 4JYGA 4O8FA 2Q7KA 3W5TA 5C4TA 1PQ6A 2H79A 5FQSA 4P6WA 2HBHA 3G0WA 2P54A 1S9PA 3L3XA 4PPPA 2YFEA 1XJ7A 3GYUA 2QZOB 5DXGA 2ZK0A 4MGBB 1T74A 3OZ0A 2GPOA 3BEJA 1UPVA 5KRAA 5C4OA 3RUUA 4RUOX 2ZLAA 5DMCA 2GPUA 2YLQA 5DI7A 1N83A 2B23A 2Q59A 3OMKA 3X31A 3NOAA 2G5OA 4OKXA 4M8HA 1XIUA 3IMYA
chains in the Genus database with same CATH topology
3MNOA 4OZRU 1T7RA 3V3EA 2AXAA 2Q1HA 4ZO1X 3OLFA 5HCVA 5KR9A 2GP7A 4XT9A 1HG4A 1XB7A 3KDTA 3NSQA 5JI0D 1T79A 2Q6RA 4DK7A 4NQAB 4ZJRA 1OVLB 4WPFA 1GWRA 2AX8A 5L7HA 4XLDA 4DM8A 3B3KA 3JZCA 1R1KA 2I4ZA 4XAOA 4YT1A 3OSAA 2QA8A 3OLSA 2IHQA 2PIXA 2VV0A 3NSPA 3GBKA 3KPZA 5DVCA 5APKA 4APUA 3KWYA 2QSEA 2PIUA 5AVIA 3S9SA 3ZRAA 4UDAA 2ACLA 2ZXMA 3M7RA 4P6XA 2F4BA 4IS8A 4PRGA 5KRKA 2QXSA 5E15A 3R8DA 5G3JA 1NUOA 2Q1VA 2VV1A 4QK4A 4ZNUA 2VV4B 2Q59B 3VSPA 4J5XC 2AM9A 3QT0A 3VTDA 1P8DA 1UHLA 4TV1A 3X36A 3PO9A 2Q61A 3L0EA 3WJ5A 2ABIA 1T7FA 3D5FA 5DVVA 3OAPA 4LBDA 3W0HA 2ZK4A 4K7AA 2PRGA 3B1MA 1ILHA 2GIUA 2P4YA 4OK1A 4Q13A 1TFCA 3AUNA 4N5GA 4QE8A 5DLRA 3SP9A 1R1KD 1XZXX 2J7XA 2P7AA 4IW6A 2PIVA 4CI4A 4ZN9A 1Z5XU 2IOGA 3D57A 5AYGA 1NDEA 3AN3A 3WT7A 1SKXA 4IWCA 3CS6A 4LTWA 5DKEA 2AA6A 2NW4A 3VT7A 1T65A 1OT7A 4L96A 5KYAA 5IXKA 5DXEA 5KRFA 4IW8A 5A86A 3GYTA 3IA6A 2I4JA 5DXPA 3A2HA 4FHHA 3R8IA 1E3GA 1RK3A 1T5ZA 2HB7A 4IVYA 5DZHA 4G1ZA 5DXQA 2VV3A 5HYRA 1Y0SA 4XUHA 2ACLB 5GT4A 3KYTA 1EXAA 5ETHA 1XP6A 4RWVA 5DUEA 2AMBA 1PQCA 3FLIA 2VV1B 3L3ZA 4OGHA 3DY6A 3R5MA 4RUPA 3A3ZX 2PINA 3CDSA 4X1FA 1X76A 4LNWA 1SJ0A 1XLSE 1UHLB 4TV1B 2ZASA 3UUCA 5DRJA 1PZLA 2QH6A 3B65A 1G2NA 4OZTU 3X1IA 2JF9A 3GD2A 2PITA 3IXPA 3B66A 3IPUA 1SQNA 1ZH7A 4RZGA 1ZEOA 1GWXA 1PQ9A 3PBAA 4OHAA 1T76A 1YINA 5DSHA 5G44A 1G1UA 3TKCA 3VHUA 4A4VA 3D24A 3P8XA 4PP5A 3OMPA 3CTBA 3B0TA 4ITEA 5L11A 2B1VA 3D90A 3B67A 3ERDA 3WGPA 4ZI1A 4OILA 2QXMA 5DKGA 5JJMA 1S19A 2AYRA 1K4WA 4RMEA 4G21A 2O9IA 2OCFA 2QR9A 3LMPA 4CSJA 4OC7A 4PPSA 4WLBA 5DK9A 2P7GA 2OVHA 1KV6A 2Q5GA 4OKBA 1QKUA 5AAVA 5AWKA 5DYDA 5EHJA 2ZK3A 1NRLA 1ZDUA 1IE9A 3IXPD 4MG6A 3WT6A 3JZBA 4RFWA 1YY4A 4K6IA 5G43A 2PIWA 2QGTA 4R6SA 5KRCA 4KZIA 5KCUA 1XQ3A 1Y9RA 3ILZA 3FEJA 2YHDA 3ADSA 4OJBA 5KCCA 3GWSX 1PCGA 3CS4A 1MZNA 1T63A 2YJDA 5ACCA 3W0YA 3CQVA 4RMCA 4OJ9A 2VSTA 1XVPA 4OFRA 3UU7A 2Q6JA 2Q3YA 2ZXNA 4MG7A 5HYKA 1XDKA 2ZL9A 3L0JA 3L1BA 5E14A 2NPAA 3HM1A 3V9YA 5HJSA 2PIOA 2Q6SA 4J5WA 2ZVTA 1EREA 1GS4A 1G50A 2HAMA 3Q95A 5JJMB 1MVCA 3ADXA 2O4JA 4REFA 1X7EA 1WM0X 2PJLA 3IPSA 3VRTA 3VSOA 2W8YA 2NXXE 1NHZA 3R8AA 3V9VA 4IA2A 4EM9A 4IUIA 4OH5A 5DV6A 5KD9A 2I0GA 1I38A 5AAVB 3AZ2A 1XV9A 5I4VA 4UDDA 1TXIA 4MG8A 3HLVA 3OMOA 3GZ9A 1GWQA 1XOWA 2GL8A 4G1DA 5DIEA 1FM9A 3UVVA 2QGWA 3WT5A 2ZK6A 2GPVA 4FHIA 4HEEX 5EJVA 4LSJA 3ADTA 3HC5A 4MGAA 4K4JA 1L2JA 2XHSA 3DT3A 1G5YA 3HODA 4RUJA 2PNUA 3ET3A 3OZJA 3OMMA 3K22A 4OARA 1T7TA 4J26A 2HWRA 3HZFA 4L98A 4MG7B 3UUDA 3UU7B 3F5CA 3UUAA 1XDKB 2R6WA 2P1UA 3VJIA 4OLMA 2B50A 3VT6A 5ICKA 3PCUA 4IU7A 1EXXA 2ZNNA 3VRWA 4ZJWA 1LBDA 3Q95B 2JJ3A 3N00A 2V7CA 3KFCA 1NQ7A 4G2IA 4IV4A 4JAZA 2Q7JA 3V3QA 3VHWA 4PLEA 1Q4XA 1Z95A 4N73A 1RKGA 3AURA 1KKQA 3FALA 3GN8A 1YOKA 4OZRE 5FQTA 4OEZA 2Q60A 2PIQA 1FM9D 1XNXA 2Q70A 4IA3A 4F9MA 5KRHA 4QL8A 4PLDA 5DVSA 1I7GA 1ZUCA 2NV7A 1A28A 1XV9B 2ZMJA 1FCZA 4R06A 5FQVA 5LWPA 1X78A 2XKWA 2ZXZA 1DKFA 4MG8B 1T73A 3UVVB 3V4AA 4M8EA 1I37A 1X7RA 3K8SA 4NIEA 2HB8A 2QNVA 4OJ4A 2LBDA 1Y0XX 5DV8A 3G8IA 3K23A 4JGVA 4MGAB 4RZFA 4WHFA 4ZNHA 1P93A 5AZVA 5G45A 3ET2A 4R2UA 2EWPA 4OH6A 2XYWA 1YP0A 5AWJA 4ITFA 4E4KA 2QA8B 2FAIA 2ZY0A 1ILGA 3UUDB 3UUAB 2A3IA 3F5CB 4S14A 3W5QA 4QM0A 2AB2A 4ZN7A 2ZKCA 1NQ1A 3OOFA 4OIVA 1E3KA 5FQPA 2REWA 3VN2A 4A4WA 4ZNTA 5KCTA 3VRUA 4ZOMA 3B68A 5APJA 1DB1A 3R2AA 4MG9A 5IAWA 3A9EA 4XHDA 2ZNQA 1YIMA 3AN4A 4G20A 4REEA 3ZR7A 3FALB 2ZMHA 3HQ5A 2AA2A 1UPWA 2AAXA 4E2JA 3CS8A 1Z5XE 5EC9A 5DXKA 1DKFB 3L03A 5DWLA 2OZ7A 5HJPA 3RLLA 4A2JA 2PIPL 3AZ1A 3DCUA 5APHA 3UP3A 4EMAA 4Q50A 5K13A 4KZJA 2P15A 3T03A 1SR7A 3VHVA 2P7ZA 2Q7LA 3A2JA 2Z4JA 5AK2A 5EGVA 5DY8A 3X1HA 5KRIA 1H9UA 5KROA 1S0XA 2QA6A 5G5WA 5IZ0A 5SYZA 3E94A 3W0AA 5DL4A 5DWIA 1YYEA 2G0GA 2IOKA 1FBYA 5E1CA 5DX3A 3O1EA 4MG9B 3TKMA 4B7WA 2BJ4A 5DKBA 3A9EB 2YATA 3G8OA 5CJ6A 5AAUA 4IA7A 1XPCA 2GPPA 3AUQA 3VT9A 1MV9A 1RDTA 4FN9A 1ZDTA 2POBA 3B0RA 3VT4A 5KCDA 2HASA 3A78A 3OS8A 5EITA 5C4SA 3ZRBA 2ZMIA 1XLSA 1ZKYA 2HFPA 1QKMA 4FNEA 2J14A 2GWXA 3E7CA 3KDUA 4OEDA 2AX6A 1X7BA 4J24A 4PP3A 3AX8A 4ZO1B 5DU5A 3VTBA 1YMTA 1I7IA 3B0WA 4KZMA 4WHGA 3R5NA 3VJSA 2AMAA 3W5RA 2ZNOA 2O4RA 1KNUA 4Q0AC 2I0JA 1N46A 4MGDA 4N1YA 4WQPA 5DZ1A 3VJTA 4YNKA 5DX3B 4RE8A 2Q7IA 5E7VA 3WFGA 2BJ4B 4OFUA 5H1EA 1RDTD 2BAWA 1L2IA 4NB6A 5KCWA 5DXBA 3W0JA 5KRMA 2XYXA 4JL4A 5KCEA 5EI1A 3VJHA 2P1VA 1U3RA 1U3SA 2AA7A 3ERTA 4S0TA 3OS9A 3VT3A 4DQMA 5DWJA 4BCRA 2G44A 4RAKA 4OEAA 3OSIA 3W0GA 3PEQA 1YJEA 2JFAA 3CLDA 5DKSA 2OVMA 3F7DA 5L7GA 1FM6A 2YLOA 4WVDA 3KBAA 3RVFA 3OKIA 2ZNPA 1RJKA 1NAXA 3OS8C 3GWXA 3W0CA 2ZK2A 4DM6A 3PRGA 3FC6A 2R6YA 1A52A 1XVPB 2B1ZA 2VV4A 4IVWA 5C4UA 3K6PA 4J5XA 3A40X 5DTVA 1U3QA 5GIDA 2ZK1A 2HVCA 5JY3A 2YLPA 3D6DA 5DZ0A 3CDPA 3DZYA 3ZQTA 5E19A 4MGDB 4J5WC 3VT5A 2HARA 5FQRA 2HCDA 1XQCA 2PKLA 5GIEA 2OM9A 3RLJA 3OLLA 3ET0A 1S0ZA 4UDBA 4ONIA 3DR1A 4YMQA 4Y29A 1IE8A 3WFFA 5DXBB 2ZLCA 3FUGA 4NUFA 3RY9A 1QKNA 1U9EA 3R29A 4YPQA 3UP0A 1FM6D 5E0WA 4LNXA 2ATHA 3DCTA 3VRVA 1QKTA 3KMRA 3WTQA 3VI8A 3U9QA 2PIRA 2JFAB 2VV2A 3VT8A 2FVJA 3G9EA 3H0AA 4OKWA 2YLYA 3HVLA 3DZUA 4PWLA 5G46A 5DWGA 2NXXA 1UOMA 2HC4A 3WJ4A 3B5RA 2QMVA 3BC5A 3KMGA 2QE4A 4HLWA 4IA1A 5DXMA 3TX7B 1FCYA 3FC6B 3E00A 3EYBA 5DWEA 5F9BA 1XP1A 5DIDA 5KRJA 3DZYD 1ERRA 3W5PA 3RUTA 1YOWA 3MNPA 3FXVA 4XI3A 2ZK5A 2OAXA 1RKHA 3OKHA 3HO0A 3P89A 1M7WA 4FGYA 1NQ2A 5HZCA 1NYXA 3LBDA 3ET1A 5B5BA 3ADUA 3CJWA 4MG5A 2VSRA 4IV2A 5AZTA 5DUHA 2HWQA 1ZGYA 2G0HA 2XYJA 4DOSA 1PK5A 4MGCA 5DV3A 1NAVA 5AVLA 2QW4A 4PXMA 1N4HA 1M2ZA 3H0AD 4POHA 3W0IA 4UDCA 3OSWA 3DZUD 4ZNSA 4IQRA 3FEIA 4JYHA 1YA3A 2P1TA 5LGAA 2AX9A 3WMHA 3WWRA 1K74A 3FURA 2I4PA 4X1GA 5KYJA 3E00D 1VJBA 5DMFA 4DORA 1YUCA 1R20A 2ZBSA 2AWHA 4NY9A 1OSVA 2V0VA 1R6GA 2R40A 3B0QA 2QPYA 4JYIA 4TUZA 2QTUA 4N8RA 3PLZA 2OUZA 4RMDA 3OGTA 3P0UA 4POJA 4QJRA 2ZFXA 5DXRA 3FS1A 1PRGA 4OKTA 2Z4BA 2YJAB 3CWDA 4ZNVA 3ADVA 5DIGA 3V49A 3AFRA 1LV2A 4PVUA 2Q8SA 4G1YA 4RZEA 4XUMA 4OZTE 2H77A 5DP0A 5E0XA 1M13A 2FSZA 3P88A 4CI5A 2J7YA 3TY0A 5KRLA 3MNEA 3SP6A 4DK8A 3IPQA 1K74D 5G42A 3O1DA 1NQ0A 3BQDA 4XTAA 4PP6A 5HJPB 3L0LA 1R20D 2QZOA 2GTKA 3AZ3A 1BSXA 1XNNA 2J4AA 4MGBA 5DUGA 3ADWA 2R40D 4OEYA 4DMAA 4ZNWA 3A2IA 4G2HA 5KCFA 1FCXA 5M96A 3OOKA 4E4QA 2AX7A 2QABA 5DYBA 5GICA 1X7JA 4IWFA 4OIUA 5DZ3A 5L7EA 1XAPA 1OSHA 2AA5A 4MDDA 2POGA 4TUZB 1K7LA 2AO6A 5DRMA 2Q5PA 1T7MA 4S15A 3H52A 3V9TA 3OMQA 3VTCA 1ZAFA 4QE6A 1S9QA 4PF3A 1FD0A 4S0SA 1R5KA 2E2RA 2Q5SA 1HJ1A 3SZ1A 3KMZA 1PDUA 5DZIA 3HC6A 5B41A 1OVLA 1XP9A 4JYGA 4O8FA 2Q7KA 3W5TA 5C4TA 1PQ6A 2H79A 5FQSA 4P6WA 2HBHA 3G0WA 2P54A 1S9PA 3L3XA 4PPPA 2YFEA 1XJ7A 3GYUA 2QZOB 5DXGA 2ZK0A 4MGBB 1T74A 3OZ0A 2GPOA 3BEJA 1UPVA 5KRAA 5C4OA 3RUUA 4RUOX 2ZLAA 5DMCA 2GPUA 2YLQA 5DI7A 1N83A 2B23A 2Q59A 3OMKA 3X31A 3NOAA 2G5OA 4OKXA 4M8HA 1XIUA 3IMYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MNO A;  4OZR U;  1T7R A;  3V3E A;  2AXA A;  2Q1H A;  4ZO1 X;  3OLF A;  5HCV A;  5KR9 A;  2GP7 A;  4XT9 A;  1HG4 A;  1XB7 A;  3KDT A;  3NSQ A;  5JI0 D;  1T79 A;  2Q6R A;  4DK7 A;  4NQA B;  4ZJR A;  1OVL B;  4WPF A;  1GWR A;  2AX8 A;  5L7H A;  4XLD A;  4DM8 A;  3B3K A;  3JZC A;  1R1K A;  2I4Z A;  4XAO A;  4YT1 A;  3OSA A;  2QA8 A;  3OLS A;  2IHQ A;  2PIX A;  2VV0 A;  3NSP A;  3GBK A;  3KPZ A;  5DVC A;  5APK A;  4APU A;  3KWY A;  2QSE A;  2PIU A;  5AVI A;  3S9S A;  3ZRA A;  4UDA A;  2ACL A;  2ZXM A;  3M7R A;  4P6X A;  2F4B A;  4IS8 A;  4PRG A;  5KRK A;  2QXS A;  5E15 A;  3R8D A;  5G3J A;  1NUO A;  2Q1V A;  2VV1 A;  4QK4 A;  4ZNU A;  2VV4 B;  2Q59 B;  3VSP A;  4J5X C;  2AM9 A;  3QT0 A;  3VTD A;  1P8D A;  1UHL A;  4TV1 A;  3X36 A;  3PO9 A;  2Q61 A;  3L0E A;  3WJ5 A;  2ABI A;  1T7F A;  3D5F A;  5DVV A;  3OAP A;  4LBD A;  3W0H A;  2ZK4 A;  4K7A A;  2PRG A;  3B1M A;  1ILH A;  2GIU A;  2P4Y A;  4OK1 A;  4Q13 A;  1TFC A;  3AUN A;  4N5G A;  4QE8 A;  5DLR A;  3SP9 A;  1R1K D;  1XZX X;  2J7X A;  2P7A A;  4IW6 A;  2PIV A;  4CI4 A;  4ZN9 A;  1Z5X U;  2IOG A;  3D57 A;  5AYG A;  1NDE A;  3AN3 A;  3WT7 A;  1SKX A;  4IWC A;  3CS6 A;  4LTW A;  5DKE A;  2AA6 A;  2NW4 A;  3VT7 A;  1T65 A;  1OT7 A;  4L96 A;  5KYA A;  5IXK A;  5DXE A;  5KRF A;  4IW8 A;  5A86 A;  3GYT A;  3IA6 A;  2I4J A;  5DXP A;  3A2H A;  4FHH A;  3R8I A;  1E3G A;  1RK3 A;  1T5Z A;  2HB7 A;  4IVY A;  5DZH A;  4G1Z A;  5DXQ A;  2VV3 A;  5HYR A;  1Y0S A;  4XUH A;  2ACL B;  5GT4 A;  3KYT A;  1EXA A;  5ETH A;  1XP6 A;  4RWV A;  5DUE A;  2AMB A;  1PQC A;  3FLI A;  2VV1 B;  3L3Z A;  4OGH A;  3DY6 A;  3R5M A;  4RUP A;  3A3Z X;  2PIN A;  3CDS A;  4X1F A;  1X76 A;  4LNW A;  1SJ0 A;  1XLS E;  1UHL B;  4TV1 B;  2ZAS A;  3UUC A;  5DRJ A;  1PZL A;  2QH6 A;  3B65 A;  1G2N A;  4OZT U;  3X1I A;  2JF9 A;  3GD2 A;  2PIT A;  3IXP A;  3B66 A;  3IPU A;  1SQN A;  1ZH7 A;  4RZG A;  1ZEO A;  1GWX A;  1PQ9 A;  3PBA A;  4OHA A;  1T76 A;  1YIN A;  5DSH A;  5G44 A;  1G1U A;  3TKC A;  3VHU A;  4A4V A;  3D24 A;  3P8X A;  4PP5 A;  3OMP A;  3CTB A;  3B0T A;  4ITE A;  5L11 A;  2B1V A;  3D90 A;  3B67 A;  3ERD A;  3WGP A;  4ZI1 A;  4OIL A;  2QXM A;  5DKG A;  5JJM A;  1S19 A;  2AYR A;  1K4W A;  4RME A;  4G21 A;  2O9I A;  2OCF A;  2QR9 A;  3LMP A;  4CSJ A;  4OC7 A;  4PPS A;  4WLB A;  5DK9 A;  2P7G A;  2OVH A;  1KV6 A;  2Q5G A;  4OKB A;  1QKU A;  5AAV A;  5AWK A;  5DYD A;  5EHJ A;  2ZK3 A;  1NRL A;  1ZDU A;  1IE9 A;  3IXP D;  4MG6 A;  3WT6 A;  3JZB A;  4RFW A;  1YY4 A;  4K6I A;  5G43 A;  2PIW A;  2QGT A;  4R6S A;  5KRC A;  4KZI A;  5KCU A;  1XQ3 A;  1Y9R A;  3ILZ A;  3FEJ A;  2YHD A;  3ADS A;  4OJB A;  5KCC A;  3GWS X;  1PCG A;  3CS4 A;  1MZN A;  1T63 A;  2YJD A;  5ACC A;  3W0Y A;  3CQV A;  4RMC A;  4OJ9 A;  2VST A;  1XVP A;  4OFR A;  3UU7 A;  2Q6J A;  2Q3Y A;  2ZXN A;  4MG7 A;  5HYK A;  1XDK A;  2ZL9 A;  3L0J A;  3L1B A;  5E14 A;  2NPA A;  3HM1 A;  3V9Y A;  5HJS A;  2PIO A;  2Q6S A;  4J5W A;  2ZVT A;  1ERE A;  1GS4 A;  1G50 A;  2HAM A;  3Q95 A;  5JJM B;  1MVC A;  3ADX A;  2O4J A;  4REF A;  1X7E A;  1WM0 X;  2PJL A;  3IPS A;  3VRT A;  3VSO A;  2W8Y A;  2NXX E;  1NHZ A;  3R8A A;  3V9V A;  4IA2 A;  4EM9 A;  4IUI A;  4OH5 A;  5DV6 A;  5KD9 A;  2I0G A;  1I38 A;  5AAV B;  3AZ2 A;  1XV9 A;  5I4V A;  4UDD A;  1TXI A;  4MG8 A;  3HLV A;  3OMO A;  3GZ9 A;  1GWQ A;  1XOW A;  2GL8 A;  4G1D A;  5DIE A;  1FM9 A;  3UVV A;  2QGW A;  3WT5 A;  2ZK6 A;  2GPV A;  4FHI A;  4HEE X;  5EJV A;  4LSJ A;  3ADT A;  3HC5 A;  4MGA A;  4K4J A;  1L2J A;  2XHS A;  3DT3 A;  1G5Y A;  3HOD A;  4RUJ A;  2PNU A;  3ET3 A;  3OZJ A;  3OMM A;  3K22 A;  4OAR A;  1T7T A;  4J26 A;  2HWR A;  3HZF A;  4L98 A;  4MG7 B;  3UUD A;  3UU7 B;  3F5C A;  3UUA A;  1XDK B;  2R6W A;  2P1U A;  3VJI A;  4OLM A;  2B50 A;  3VT6 A;  5ICK A;  3PCU A;  4IU7 A;  1EXX A;  2ZNN A;  3VRW A;  4ZJW A;  1LBD A;  3Q95 B;  2JJ3 A;  3N00 A;  2V7C A;  3KFC A;  1NQ7 A;  4G2I A;  4IV4 A;  4JAZ A;  2Q7J A;  3V3Q A;  3VHW A;  4PLE A;  1Q4X A;  1Z95 A;  4N73 A;  1RKG A;  3AUR A;  1KKQ A;  3FAL A;  3GN8 A;  1YOK A;  4OZR E;  5FQT A;  4OEZ A;  2Q60 A;  2PIQ A;  1FM9 D;  1XNX A;  2Q70 A;  4IA3 A;  4F9M A;  5KRH A;  4QL8 A;  4PLD A;  5DVS A;  1I7G A;  1ZUC A;  2NV7 A;  1A28 A;  1XV9 B;  2ZMJ A;  1FCZ A;  4R06 A;  5FQV A;  5LWP A;  1X78 A;  2XKW A;  2ZXZ A;  1DKF A;  4MG8 B;  1T73 A;  3UVV B;  3V4A A;  4M8E A;  1I37 A;  1X7R A;  3K8S A;  4NIE A;  2HB8 A;  2QNV A;  4OJ4 A;  2LBD A;  1Y0X X;  5DV8 A;  3G8I A;  3K23 A;  4JGV A;  4MGA B;  4RZF A;  4WHF A;  4ZNH A;  1P93 A;  5AZV A;  5G45 A;  3ET2 A;  4R2U A;  2EWP A;  4OH6 A;  2XYW A;  1YP0 A;  5AWJ A;  4ITF A;  4E4K A;  2QA8 B;  2FAI A;  2ZY0 A;  1ILG A;  3UUD B;  3UUA B;  2A3I A;  3F5C B;  4S14 A;  3W5Q A;  4QM0 A;  2AB2 A;  4ZN7 A;  2ZKC A;  1NQ1 A;  3OOF A;  4OIV A;  1E3K A;  5FQP A;  2REW A;  3VN2 A;  4A4W A;  4ZNT A;  5KCT A;  3VRU A;  4ZOM A;  3B68 A;  5APJ A;  1DB1 A;  3R2A A;  4MG9 A;  5IAW A;  3A9E A;  4XHD A;  2ZNQ A;  1YIM A;  3AN4 A;  4G20 A;  4REE A;  3ZR7 A;  3FAL B;  2ZMH A;  3HQ5 A;  2AA2 A;  1UPW A;  2AAX A;  4E2J A;  3CS8 A;  1Z5X E;  5EC9 A;  5DXK A;  1DKF B;  3L03 A;  5DWL A;  2OZ7 A;  5HJP A;  3RLL A;  4A2J A;  2PIP L;  3AZ1 A;  3DCU A;  5APH A;  3UP3 A;  4EMA A;  4Q50 A;  5K13 A;  4KZJ A;  2P15 A;  3T03 A;  1SR7 A;  3VHV A;  2P7Z A;  2Q7L A;  3A2J A;  2Z4J A;  5AK2 A;  5EGV A;  5DY8 A;  3X1H A;  5KRI A;  1H9U A;  5KRO A;  1S0X A;  2QA6 A;  5G5W A;  5IZ0 A;  5SYZ A;  3E94 A;  3W0A A;  5DL4 A;  5DWI A;  1YYE A;  2G0G A;  2IOK A;  1FBY A;  5E1C A;  5DX3 A;  3O1E A;  4MG9 B;  3TKM A;  4B7W A;  2BJ4 A;  5DKB A;  3A9E B;  2YAT A;  3G8O A;  5CJ6 A;  5AAU A;  4IA7 A;  1XPC A;  2GPP A;  3AUQ A;  3VT9 A;  1MV9 A;  1RDT A;  4FN9 A;  1ZDT A;  2POB A;  3B0R A;  3VT4 A;  5KCD A;  2HAS A;  3A78 A;  3OS8 A;  5EIT A;  5C4S A;  3ZRB A;  2ZMI A;  1XLS A;  1ZKY A;  2HFP A;  1QKM A;  4FNE A;  2J14 A;  2GWX A;  3E7C A;  3KDU A;  4OED A;  2AX6 A;  1X7B A;  4J24 A;  4PP3 A;  3AX8 A;  4ZO1 B;  5DU5 A;  3VTB A;  1YMT A;  1I7I A;  3B0W A;  4KZM A;  4WHG A;  3R5N A;  3VJS A;  2AMA A;  3W5R A;  2ZNO A;  2O4R A;  1KNU A;  4Q0A C;  2I0J A;  1N46 A;  4MGD A;  4N1Y A;  4WQP A;  5DZ1 A;  3VJT A;  4YNK A;  5DX3 B;  4RE8 A;  2Q7I A;  5E7V A;  3WFG A;  2BJ4 B;  4OFU A;  5H1E A;  1RDT D;  2BAW A;  1L2I A;  4NB6 A;  5KCW A;  5DXB A;  3W0J A;  5KRM A;  2XYX A;  4JL4 A;  5KCE A;  5EI1 A;  3VJH A;  2P1V A;  1U3R A;  1U3S A;  2AA7 A;  3ERT A;  4S0T A;  3OS9 A;  3VT3 A;  4DQM A;  5DWJ A;  4BCR A;  2G44 A;  4RAK A;  4OEA A;  3OSI A;  3W0G A;  3PEQ A;  1YJE A;  2JFA A;  3CLD A;  5DKS A;  2OVM A;  3F7D A;  5L7G A;  1FM6 A;  2YLO A;  4WVD A;  3KBA A;  3RVF A;  3OKI A;  2ZNP A;  1RJK A;  1NAX A;  3OS8 C;  3GWX A;  3W0C A;  2ZK2 A;  4DM6 A;  3PRG A;  3FC6 A;  2R6Y A;  1A52 A;  1XVP B;  2B1Z A;  2VV4 A;  4IVW A;  5C4U A;  3K6P A;  4J5X A;  3A40 X;  5DTV A;  1U3Q A;  5GID A;  2ZK1 A;  2HVC A;  5JY3 A;  2YLP A;  3D6D A;  5DZ0 A;  3CDP A;  3DZY A;  3ZQT A;  5E19 A;  4MGD B;  4J5W C;  3VT5 A;  2HAR A;  5FQR A;  2HCD A;  1XQC A;  2PKL A;  5GIE A;  2OM9 A;  3RLJ A;  3OLL A;  3ET0 A;  1S0Z A;  4UDB A;  4ONI A;  3DR1 A;  4YMQ A;  4Y29 A;  1IE8 A;  3WFF A;  5DXB B;  2ZLC A;  3FUG A;  4NUF A;  3RY9 A;  1QKN A;  1U9E A;  3R29 A;  4YPQ A;  3UP0 A;  1FM6 D;  5E0W A;  4LNX A;  2ATH A;  3DCT A;  3VRV A;  1QKT A;  3KMR A;  3WTQ A;  3VI8 A;  3U9Q A;  2PIR A;  2JFA B;  2VV2 A;  3VT8 A;  2FVJ A;  3G9E A;  3H0A A;  4OKW A;  2YLY A;  3HVL A;  3DZU A;  4PWL A;  5G46 A;  5DWG A;  2NXX A;  1UOM A;  2HC4 A;  3WJ4 A;  3B5R A;  2QMV A;  3BC5 A;  3KMG A;  2QE4 A;  4HLW A;  4IA1 A;  5DXM A;  3TX7 B;  1FCY A;  3FC6 B;  3E00 A;  3EYB A;  5DWE A;  5F9B A;  1XP1 A;  5DID A;  5KRJ A;  3DZY D;  1ERR A;  3W5P A;  3RUT A;  1YOW A;  3MNP A;  3FXV A;  4XI3 A;  2ZK5 A;  2OAX A;  1RKH A;  3OKH A;  3HO0 A;  3P89 A;  1M7W A;  4FGY A;  1NQ2 A;  5HZC A;  1NYX A;  3LBD A;  3ET1 A;  5B5B A;  3ADU A;  3CJW A;  4MG5 A;  2VSR A;  4IV2 A;  5AZT A;  5DUH A;  2HWQ A;  1ZGY A;  2G0H A;  2XYJ A;  4DOS A;  1PK5 A;  4MGC A;  5DV3 A;  1NAV A;  5AVL A;  2QW4 A;  4PXM A;  1N4H A;  1M2Z A;  3H0A D;  4POH A;  3W0I A;  4UDC A;  3OSW A;  3DZU D;  4ZNS A;  4IQR A;  3FEI A;  4JYH A;  1YA3 A;  2P1T A;  5LGA A;  2AX9 A;  3WMH A;  3WWR A;  1K74 A;  3FUR A;  2I4P A;  4X1G A;  5KYJ A;  3E00 D;  1VJB A;  5DMF A;  4DOR A;  1YUC A;  1R20 A;  2ZBS A;  2AWH A;  4NY9 A;  1OSV A;  2V0V A;  1R6G A;  2R40 A;  3B0Q A;  2QPY A;  4JYI A;  4TUZ A;  2QTU A;  4N8R A;  3PLZ A;  2OUZ A;  4RMD A;  3OGT A;  3P0U A;  4POJ A;  4QJR A;  2ZFX A;  5DXR A;  3FS1 A;  1PRG A;  4OKT A;  2Z4B A;  2YJA B;  3CWD A;  4ZNV A;  3ADV A;  5DIG A;  3V49 A;  3AFR A;  1LV2 A;  4PVU A;  2Q8S A;  4G1Y A;  4RZE A;  4XUM A;  4OZT E;  2H77 A;  5DP0 A;  5E0X A;  1M13 A;  2FSZ A;  3P88 A;  4CI5 A;  2J7Y A;  3TY0 A;  5KRL A;  3MNE A;  3SP6 A;  4DK8 A;  3IPQ A;  1K74 D;  5G42 A;  3O1D A;  1NQ0 A;  3BQD A;  4XTA A;  4PP6 A;  5HJP B;  3L0L A;  1R20 D;  2QZO A;  2GTK A;  3AZ3 A;  1BSX A;  1XNN A;  2J4A A;  4MGB A;  5DUG A;  3ADW A;  2R40 D;  4OEY A;  4DMA A;  4ZNW A;  3A2I A;  4G2H A;  5KCF A;  1FCX A;  5M96 A;  3OOK A;  4E4Q A;  2AX7 A;  2QAB A;  5DYB A;  5GIC A;  1X7J A;  4IWF A;  4OIU A;  5DZ3 A;  5L7E A;  1XAP A;  1OSH A;  2AA5 A;  4MDD A;  2POG A;  4TUZ B;  1K7L A;  2AO6 A;  5DRM A;  2Q5P A;  1T7M A;  4S15 A;  3H52 A;  3V9T A;  3OMQ A;  3VTC A;  1ZAF A;  4QE6 A;  1S9Q A;  4PF3 A;  1FD0 A;  4S0S A;  1R5K A;  2E2R A;  2Q5S A;  1HJ1 A;  3SZ1 A;  3KMZ A;  1PDU A;  5DZI A;  3HC6 A;  5B41 A;  1OVL A;  1XP9 A;  4JYG A;  4O8F A;  2Q7K A;  3W5T A;  5C4T A;  1PQ6 A;  2H79 A;  5FQS A;  4P6W A;  2HBH A;  3G0W A;  2P54 A;  1S9P A;  3L3X A;  4PPP A;  2YFE A;  1XJ7 A;  3GYU A;  2QZO B;  5DXG A;  2ZK0 A;  4MGB B;  1T74 A;  3OZ0 A;  2GPO A;  3BEJ A;  1UPV A;  5KRA A;  5C4O A;  3RUU A;  4RUO X;  2ZLA A;  5DMC A;  2GPU A;  2YLQ A;  5DI7 A;  1N83 A;  2B23 A;  2Q59 A;  3OMK A;  3X31 A;  3NOA A;  2G5O A;  4OKX A;  4M8H A;  1XIU A;  3IMY A; 
#chains in the Genus database with same CATH topology
 3MNO A;  4OZR U;  1T7R A;  3V3E A;  2AXA A;  2Q1H A;  4ZO1 X;  3OLF A;  5HCV A;  5KR9 A;  2GP7 A;  4XT9 A;  1HG4 A;  1XB7 A;  3KDT A;  3NSQ A;  5JI0 D;  1T79 A;  2Q6R A;  4DK7 A;  4NQA B;  4ZJR A;  1OVL B;  4WPF A;  1GWR A;  2AX8 A;  5L7H A;  4XLD A;  4DM8 A;  3B3K A;  3JZC A;  1R1K A;  2I4Z A;  4XAO A;  4YT1 A;  3OSA A;  2QA8 A;  3OLS A;  2IHQ A;  2PIX A;  2VV0 A;  3NSP A;  3GBK A;  3KPZ A;  5DVC A;  5APK A;  4APU A;  3KWY A;  2QSE A;  2PIU A;  5AVI A;  3S9S A;  3ZRA A;  4UDA A;  2ACL A;  2ZXM A;  3M7R A;  4P6X A;  2F4B A;  4IS8 A;  4PRG A;  5KRK A;  2QXS A;  5E15 A;  3R8D A;  5G3J A;  1NUO A;  2Q1V A;  2VV1 A;  4QK4 A;  4ZNU A;  2VV4 B;  2Q59 B;  3VSP A;  4J5X C;  2AM9 A;  3QT0 A;  3VTD A;  1P8D A;  1UHL A;  4TV1 A;  3X36 A;  3PO9 A;  2Q61 A;  3L0E A;  3WJ5 A;  2ABI A;  1T7F A;  3D5F A;  5DVV A;  3OAP A;  4LBD A;  3W0H A;  2ZK4 A;  4K7A A;  2PRG A;  3B1M A;  1ILH A;  2GIU A;  2P4Y A;  4OK1 A;  4Q13 A;  1TFC A;  3AUN A;  4N5G A;  4QE8 A;  5DLR A;  3SP9 A;  1R1K D;  1XZX X;  2J7X A;  2P7A A;  4IW6 A;  2PIV A;  4CI4 A;  4ZN9 A;  1Z5X U;  2IOG A;  3D57 A;  5AYG A;  1NDE A;  3AN3 A;  3WT7 A;  1SKX A;  4IWC A;  3CS6 A;  4LTW A;  5DKE A;  2AA6 A;  2NW4 A;  3VT7 A;  1T65 A;  1OT7 A;  4L96 A;  5KYA A;  5IXK A;  5DXE A;  5KRF A;  4IW8 A;  5A86 A;  3GYT A;  3IA6 A;  2I4J A;  5DXP A;  3A2H A;  4FHH A;  3R8I A;  1E3G A;  1RK3 A;  1T5Z A;  2HB7 A;  4IVY A;  5DZH A;  4G1Z A;  5DXQ A;  2VV3 A;  5HYR A;  1Y0S A;  4XUH A;  2ACL B;  5GT4 A;  3KYT A;  1EXA A;  5ETH A;  1XP6 A;  4RWV A;  5DUE A;  2AMB A;  1PQC A;  3FLI A;  2VV1 B;  3L3Z A;  4OGH A;  3DY6 A;  3R5M A;  4RUP A;  3A3Z X;  2PIN A;  3CDS A;  4X1F A;  1X76 A;  4LNW A;  1SJ0 A;  1XLS E;  1UHL B;  4TV1 B;  2ZAS A;  3UUC A;  5DRJ A;  1PZL A;  2QH6 A;  3B65 A;  1G2N A;  4OZT U;  3X1I A;  2JF9 A;  3GD2 A;  2PIT A;  3IXP A;  3B66 A;  3IPU A;  1SQN A;  1ZH7 A;  4RZG A;  1ZEO A;  1GWX A;  1PQ9 A;  3PBA A;  4OHA A;  1T76 A;  1YIN A;  5DSH A;  5G44 A;  1G1U A;  3TKC A;  3VHU A;  4A4V A;  3D24 A;  3P8X A;  4PP5 A;  3OMP A;  3CTB A;  3B0T A;  4ITE A;  5L11 A;  2B1V A;  3D90 A;  3B67 A;  3ERD A;  3WGP A;  4ZI1 A;  4OIL A;  2QXM A;  5DKG A;  5JJM A;  1S19 A;  2AYR A;  1K4W A;  4RME A;  4G21 A;  2O9I A;  2OCF A;  2QR9 A;  3LMP A;  4CSJ A;  4OC7 A;  4PPS A;  4WLB A;  5DK9 A;  2P7G A;  2OVH A;  1KV6 A;  2Q5G A;  4OKB A;  1QKU A;  5AAV A;  5AWK A;  5DYD A;  5EHJ A;  2ZK3 A;  1NRL A;  1ZDU A;  1IE9 A;  3IXP D;  4MG6 A;  3WT6 A;  3JZB A;  4RFW A;  1YY4 A;  4K6I A;  5G43 A;  2PIW A;  2QGT A;  4R6S A;  5KRC A;  4KZI A;  5KCU A;  1XQ3 A;  1Y9R A;  3ILZ A;  3FEJ A;  2YHD A;  3ADS A;  4OJB A;  5KCC A;  3GWS X;  1PCG A;  3CS4 A;  1MZN A;  1T63 A;  2YJD A;  5ACC A;  3W0Y A;  3CQV A;  4RMC A;  4OJ9 A;  2VST A;  1XVP A;  4OFR A;  3UU7 A;  2Q6J A;  2Q3Y A;  2ZXN A;  4MG7 A;  5HYK A;  1XDK A;  2ZL9 A;  3L0J A;  3L1B A;  5E14 A;  2NPA A;  3HM1 A;  3V9Y A;  5HJS A;  2PIO A;  2Q6S A;  4J5W A;  2ZVT A;  1ERE A;  1GS4 A;  1G50 A;  2HAM A;  3Q95 A;  5JJM B;  1MVC A;  3ADX A;  2O4J A;  4REF A;  1X7E A;  1WM0 X;  2PJL A;  3IPS A;  3VRT A;  3VSO A;  2W8Y A;  2NXX E;  1NHZ A;  3R8A A;  3V9V A;  4IA2 A;  4EM9 A;  4IUI A;  4OH5 A;  5DV6 A;  5KD9 A;  2I0G A;  1I38 A;  5AAV B;  3AZ2 A;  1XV9 A;  5I4V A;  4UDD A;  1TXI A;  4MG8 A;  3HLV A;  3OMO A;  3GZ9 A;  1GWQ A;  1XOW A;  2GL8 A;  4G1D A;  5DIE A;  1FM9 A;  3UVV A;  2QGW A;  3WT5 A;  2ZK6 A;  2GPV A;  4FHI A;  4HEE X;  5EJV A;  4LSJ A;  3ADT A;  3HC5 A;  4MGA A;  4K4J A;  1L2J A;  2XHS A;  3DT3 A;  1G5Y A;  3HOD A;  4RUJ A;  2PNU A;  3ET3 A;  3OZJ A;  3OMM A;  3K22 A;  4OAR A;  1T7T A;  4J26 A;  2HWR A;  3HZF A;  4L98 A;  4MG7 B;  3UUD A;  3UU7 B;  3F5C A;  3UUA A;  1XDK B;  2R6W A;  2P1U A;  3VJI A;  4OLM A;  2B50 A;  3VT6 A;  5ICK A;  3PCU A;  4IU7 A;  1EXX A;  2ZNN A;  3VRW A;  4ZJW A;  1LBD A;  3Q95 B;  2JJ3 A;  3N00 A;  2V7C A;  3KFC A;  1NQ7 A;  4G2I A;  4IV4 A;  4JAZ A;  2Q7J A;  3V3Q A;  3VHW A;  4PLE A;  1Q4X A;  1Z95 A;  4N73 A;  1RKG A;  3AUR A;  1KKQ A;  3FAL A;  3GN8 A;  1YOK A;  4OZR E;  5FQT A;  4OEZ A;  2Q60 A;  2PIQ A;  1FM9 D;  1XNX A;  2Q70 A;  4IA3 A;  4F9M A;  5KRH A;  4QL8 A;  4PLD A;  5DVS A;  1I7G A;  1ZUC A;  2NV7 A;  1A28 A;  1XV9 B;  2ZMJ A;  1FCZ A;  4R06 A;  5FQV A;  5LWP A;  1X78 A;  2XKW A;  2ZXZ A;  1DKF A;  4MG8 B;  1T73 A;  3UVV B;  3V4A A;  4M8E A;  1I37 A;  1X7R A;  3K8S A;  4NIE A;  2HB8 A;  2QNV A;  4OJ4 A;  2LBD A;  1Y0X X;  5DV8 A;  3G8I A;  3K23 A;  4JGV A;  4MGA B;  4RZF A;  4WHF A;  4ZNH A;  1P93 A;  5AZV A;  5G45 A;  3ET2 A;  4R2U A;  2EWP A;  4OH6 A;  2XYW A;  1YP0 A;  5AWJ A;  4ITF A;  4E4K A;  2QA8 B;  2FAI A;  2ZY0 A;  1ILG A;  3UUD B;  3UUA B;  2A3I A;  3F5C B;  4S14 A;  3W5Q A;  4QM0 A;  2AB2 A;  4ZN7 A;  2ZKC A;  1NQ1 A;  3OOF A;  4OIV A;  1E3K A;  5FQP A;  2REW A;  3VN2 A;  4A4W A;  4ZNT A;  5KCT A;  3VRU A;  4ZOM A;  3B68 A;  5APJ A;  1DB1 A;  3R2A A;  4MG9 A;  5IAW A;  3A9E A;  4XHD A;  2ZNQ A;  1YIM A;  3AN4 A;  4G20 A;  4REE A;  3ZR7 A;  3FAL B;  2ZMH A;  3HQ5 A;  2AA2 A;  1UPW A;  2AAX A;  4E2J A;  3CS8 A;  1Z5X E;  5EC9 A;  5DXK A;  1DKF B;  3L03 A;  5DWL A;  2OZ7 A;  5HJP A;  3RLL A;  4A2J A;  2PIP L;  3AZ1 A;  3DCU A;  5APH A;  3UP3 A;  4EMA A;  4Q50 A;  5K13 A;  4KZJ A;  2P15 A;  3T03 A;  1SR7 A;  3VHV A;  2P7Z A;  2Q7L A;  3A2J A;  2Z4J A;  5AK2 A;  5EGV A;  5DY8 A;  3X1H A;  5KRI A;  1H9U A;  5KRO A;  1S0X A;  2QA6 A;  5G5W A;  5IZ0 A;  5SYZ A;  3E94 A;  3W0A A;  5DL4 A;  5DWI A;  1YYE A;  2G0G A;  2IOK A;  1FBY A;  5E1C A;  5DX3 A;  3O1E A;  4MG9 B;  3TKM A;  4B7W A;  2BJ4 A;  5DKB A;  3A9E B;  2YAT A;  3G8O A;  5CJ6 A;  5AAU A;  4IA7 A;  1XPC A;  2GPP A;  3AUQ A;  3VT9 A;  1MV9 A;  1RDT A;  4FN9 A;  1ZDT A;  2POB A;  3B0R A;  3VT4 A;  5KCD A;  2HAS A;  3A78 A;  3OS8 A;  5EIT A;  5C4S A;  3ZRB A;  2ZMI A;  1XLS A;  1ZKY A;  2HFP A;  1QKM A;  4FNE A;  2J14 A;  2GWX A;  3E7C A;  3KDU A;  4OED A;  2AX6 A;  1X7B A;  4J24 A;  4PP3 A;  3AX8 A;  4ZO1 B;  5DU5 A;  3VTB A;  1YMT A;  1I7I A;  3B0W A;  4KZM A;  4WHG A;  3R5N A;  3VJS A;  2AMA A;  3W5R A;  2ZNO A;  2O4R A;  1KNU A;  4Q0A C;  2I0J A;  1N46 A;  4MGD A;  4N1Y A;  4WQP A;  5DZ1 A;  3VJT A;  4YNK A;  5DX3 B;  4RE8 A;  2Q7I A;  5E7V A;  3WFG A;  2BJ4 B;  4OFU A;  5H1E A;  1RDT D;  2BAW A;  1L2I A;  4NB6 A;  5KCW A;  5DXB A;  3W0J A;  5KRM A;  2XYX A;  4JL4 A;  5KCE A;  5EI1 A;  3VJH A;  2P1V A;  1U3R A;  1U3S A;  2AA7 A;  3ERT A;  4S0T A;  3OS9 A;  3VT3 A;  4DQM A;  5DWJ A;  4BCR A;  2G44 A;  4RAK A;  4OEA A;  3OSI A;  3W0G A;  3PEQ A;  1YJE A;  2JFA A;  3CLD A;  5DKS A;  2OVM A;  3F7D A;  5L7G A;  1FM6 A;  2YLO A;  4WVD A;  3KBA A;  3RVF A;  3OKI A;  2ZNP A;  1RJK A;  1NAX A;  3OS8 C;  3GWX A;  3W0C A;  2ZK2 A;  4DM6 A;  3PRG A;  3FC6 A;  2R6Y A;  1A52 A;  1XVP B;  2B1Z A;  2VV4 A;  4IVW A;  5C4U A;  3K6P A;  4J5X A;  3A40 X;  5DTV A;  1U3Q A;  5GID A;  2ZK1 A;  2HVC A;  5JY3 A;  2YLP A;  3D6D A;  5DZ0 A;  3CDP A;  3DZY A;  3ZQT A;  5E19 A;  4MGD B;  4J5W C;  3VT5 A;  2HAR A;  5FQR A;  2HCD A;  1XQC A;  2PKL A;  5GIE A;  2OM9 A;  3RLJ A;  3OLL A;  3ET0 A;  1S0Z A;  4UDB A;  4ONI A;  3DR1 A;  4YMQ A;  4Y29 A;  1IE8 A;  3WFF A;  5DXB B;  2ZLC A;  3FUG A;  4NUF A;  3RY9 A;  1QKN A;  1U9E A;  3R29 A;  4YPQ A;  3UP0 A;  1FM6 D;  5E0W A;  4LNX A;  2ATH A;  3DCT A;  3VRV A;  1QKT A;  3KMR A;  3WTQ A;  3VI8 A;  3U9Q A;  2PIR A;  2JFA B;  2VV2 A;  3VT8 A;  2FVJ A;  3G9E A;  3H0A A;  4OKW A;  2YLY A;  3HVL A;  3DZU A;  4PWL A;  5G46 A;  5DWG A;  2NXX A;  1UOM A;  2HC4 A;  3WJ4 A;  3B5R A;  2QMV A;  3BC5 A;  3KMG A;  2QE4 A;  4HLW A;  4IA1 A;  5DXM A;  3TX7 B;  1FCY A;  3FC6 B;  3E00 A;  3EYB A;  5DWE A;  5F9B A;  1XP1 A;  5DID A;  5KRJ A;  3DZY D;  1ERR A;  3W5P A;  3RUT A;  1YOW A;  3MNP A;  3FXV A;  4XI3 A;  2ZK5 A;  2OAX A;  1RKH A;  3OKH A;  3HO0 A;  3P89 A;  1M7W A;  4FGY A;  1NQ2 A;  5HZC A;  1NYX A;  3LBD A;  3ET1 A;  5B5B A;  3ADU A;  3CJW A;  4MG5 A;  2VSR A;  4IV2 A;  5AZT A;  5DUH A;  2HWQ A;  1ZGY A;  2G0H A;  2XYJ A;  4DOS A;  1PK5 A;  4MGC A;  5DV3 A;  1NAV A;  5AVL A;  2QW4 A;  4PXM A;  1N4H A;  1M2Z A;  3H0A D;  4POH A;  3W0I A;  4UDC A;  3OSW A;  3DZU D;  4ZNS A;  4IQR A;  3FEI A;  4JYH A;  1YA3 A;  2P1T A;  5LGA A;  2AX9 A;  3WMH A;  3WWR A;  1K74 A;  3FUR A;  2I4P A;  4X1G A;  5KYJ A;  3E00 D;  1VJB A;  5DMF A;  4DOR A;  1YUC A;  1R20 A;  2ZBS A;  2AWH A;  4NY9 A;  1OSV A;  2V0V A;  1R6G A;  2R40 A;  3B0Q A;  2QPY A;  4JYI A;  4TUZ A;  2QTU A;  4N8R A;  3PLZ A;  2OUZ A;  4RMD A;  3OGT A;  3P0U A;  4POJ A;  4QJR A;  2ZFX A;  5DXR A;  3FS1 A;  1PRG A;  4OKT A;  2Z4B A;  2YJA B;  3CWD A;  4ZNV A;  3ADV A;  5DIG A;  3V49 A;  3AFR A;  1LV2 A;  4PVU A;  2Q8S A;  4G1Y A;  4RZE A;  4XUM A;  4OZT E;  2H77 A;  5DP0 A;  5E0X A;  1M13 A;  2FSZ A;  3P88 A;  4CI5 A;  2J7Y A;  3TY0 A;  5KRL A;  3MNE A;  3SP6 A;  4DK8 A;  3IPQ A;  1K74 D;  5G42 A;  3O1D A;  1NQ0 A;  3BQD A;  4XTA A;  4PP6 A;  5HJP B;  3L0L A;  1R20 D;  2QZO A;  2GTK A;  3AZ3 A;  1BSX A;  1XNN A;  2J4A A;  4MGB A;  5DUG A;  3ADW A;  2R40 D;  4OEY A;  4DMA A;  4ZNW A;  3A2I A;  4G2H A;  5KCF A;  1FCX A;  5M96 A;  3OOK A;  4E4Q A;  2AX7 A;  2QAB A;  5DYB A;  5GIC A;  1X7J A;  4IWF A;  4OIU A;  5DZ3 A;  5L7E A;  1XAP A;  1OSH A;  2AA5 A;  4MDD A;  2POG A;  4TUZ B;  1K7L A;  2AO6 A;  5DRM A;  2Q5P A;  1T7M A;  4S15 A;  3H52 A;  3V9T A;  3OMQ A;  3VTC A;  1ZAF A;  4QE6 A;  1S9Q A;  4PF3 A;  1FD0 A;  4S0S A;  1R5K A;  2E2R A;  2Q5S A;  1HJ1 A;  3SZ1 A;  3KMZ A;  1PDU A;  5DZI A;  3HC6 A;  5B41 A;  1OVL A;  1XP9 A;  4JYG A;  4O8F A;  2Q7K A;  3W5T A;  5C4T A;  1PQ6 A;  2H79 A;  5FQS A;  4P6W A;  2HBH A;  3G0W A;  2P54 A;  1S9P A;  3L3X A;  4PPP A;  2YFE A;  1XJ7 A;  3GYU A;  2QZO B;  5DXG A;  2ZK0 A;  4MGB B;  1T74 A;  3OZ0 A;  2GPO A;  3BEJ A;  1UPV A;  5KRA A;  5C4O A;  3RUU A;  4RUO X;  2ZLA A;  5DMC A;  2GPU A;  2YLQ A;  5DI7 A;  1N83 A;  2B23 A;  2Q59 A;  3OMK A;  3X31 A;  3NOA A;  2G5O A;  4OKX A;  4M8H A;  1XIU A;  3IMY A; 
#chains in the Genus database with same CATH homology
 3MNO A;  4OZR U;  1T7R A;  3V3E A;  2AXA A;  2Q1H A;  4ZO1 X;  3OLF A;  5HCV A;  5KR9 A;  2GP7 A;  4XT9 A;  1HG4 A;  1XB7 A;  3KDT A;  3NSQ A;  5JI0 D;  1T79 A;  2Q6R A;  4DK7 A;  4NQA B;  4ZJR A;  1OVL B;  4WPF A;  1GWR A;  2AX8 A;  5L7H A;  4XLD A;  4DM8 A;  3B3K A;  3JZC A;  1R1K A;  2I4Z A;  4XAO A;  4YT1 A;  3OSA A;  2QA8 A;  3OLS A;  2IHQ A;  2PIX A;  2VV0 A;  3NSP A;  3GBK A;  3KPZ A;  5DVC A;  5APK A;  4APU A;  3KWY A;  2QSE A;  2PIU A;  5AVI A;  3S9S A;  3ZRA A;  4UDA A;  2ACL A;  2ZXM A;  3M7R A;  4P6X A;  2F4B A;  4IS8 A;  4PRG A;  5KRK A;  2QXS A;  5E15 A;  3R8D A;  5G3J A;  1NUO A;  2Q1V A;  2VV1 A;  4QK4 A;  4ZNU A;  2VV4 B;  2Q59 B;  3VSP A;  4J5X C;  2AM9 A;  3QT0 A;  3VTD A;  1P8D A;  1UHL A;  4TV1 A;  3X36 A;  3PO9 A;  2Q61 A;  3L0E A;  3WJ5 A;  2ABI A;  1T7F A;  3D5F A;  5DVV A;  3OAP A;  4LBD A;  3W0H A;  2ZK4 A;  4K7A A;  2PRG A;  3B1M A;  1ILH A;  2GIU A;  2P4Y A;  4OK1 A;  4Q13 A;  1TFC A;  3AUN A;  4N5G A;  4QE8 A;  5DLR A;  3SP9 A;  1R1K D;  1XZX X;  2J7X A;  2P7A A;  4IW6 A;  2PIV A;  4CI4 A;  4ZN9 A;  1Z5X U;  2IOG A;  3D57 A;  5AYG A;  1NDE A;  3AN3 A;  3WT7 A;  1SKX A;  4IWC A;  3CS6 A;  4LTW A;  5DKE A;  2AA6 A;  2NW4 A;  3VT7 A;  1T65 A;  1OT7 A;  4L96 A;  5KYA A;  5IXK A;  5DXE A;  5KRF A;  4IW8 A;  5A86 A;  3GYT A;  3IA6 A;  2I4J A;  5DXP A;  3A2H A;  4FHH A;  3R8I A;  1E3G A;  1RK3 A;  1T5Z A;  2HB7 A;  4IVY A;  5DZH A;  4G1Z A;  5DXQ A;  2VV3 A;  5HYR A;  1Y0S A;  4XUH A;  2ACL B;  5GT4 A;  3KYT A;  1EXA A;  5ETH A;  1XP6 A;  4RWV A;  5DUE A;  2AMB A;  1PQC A;  3FLI A;  2VV1 B;  3L3Z A;  4OGH A;  3DY6 A;  3R5M A;  4RUP A;  3A3Z X;  2PIN A;  3CDS A;  4X1F A;  1X76 A;  4LNW A;  1SJ0 A;  1XLS E;  1UHL B;  4TV1 B;  2ZAS A;  3UUC A;  5DRJ A;  1PZL A;  2QH6 A;  3B65 A;  1G2N A;  4OZT U;  3X1I A;  2JF9 A;  3GD2 A;  2PIT A;  3IXP A;  3B66 A;  3IPU A;  1SQN A;  1ZH7 A;  4RZG A;  1ZEO A;  1GWX A;  1PQ9 A;  3PBA A;  4OHA A;  1T76 A;  1YIN A;  5DSH A;  5G44 A;  1G1U A;  3TKC A;  3VHU A;  4A4V A;  3D24 A;  3P8X A;  4PP5 A;  3OMP A;  3CTB A;  3B0T A;  4ITE A;  5L11 A;  2B1V A;  3D90 A;  3B67 A;  3ERD A;  3WGP A;  4ZI1 A;  4OIL A;  2QXM A;  5DKG A;  5JJM A;  1S19 A;  2AYR A;  1K4W A;  4RME A;  4G21 A;  2O9I A;  2OCF A;  2QR9 A;  3LMP A;  4CSJ A;  4OC7 A;  4PPS A;  4WLB A;  5DK9 A;  2P7G A;  2OVH A;  1KV6 A;  2Q5G A;  4OKB A;  1QKU A;  5AAV A;  5AWK A;  5DYD A;  5EHJ A;  2ZK3 A;  1NRL A;  1ZDU A;  1IE9 A;  3IXP D;  4MG6 A;  3WT6 A;  3JZB A;  4RFW A;  1YY4 A;  4K6I A;  5G43 A;  2PIW A;  2QGT A;  4R6S A;  5KRC A;  4KZI A;  5KCU A;  1XQ3 A;  1Y9R A;  3ILZ A;  3FEJ A;  2YHD A;  3ADS A;  4OJB A;  5KCC A;  3GWS X;  1PCG A;  3CS4 A;  1MZN A;  1T63 A;  2YJD A;  5ACC A;  3W0Y A;  3CQV A;  4RMC A;  4OJ9 A;  2VST A;  1XVP A;  4OFR A;  3UU7 A;  2Q6J A;  2Q3Y A;  2ZXN A;  4MG7 A;  5HYK A;  1XDK A;  2ZL9 A;  3L0J A;  3L1B A;  5E14 A;  2NPA A;  3HM1 A;  3V9Y A;  5HJS A;  2PIO A;  2Q6S A;  4J5W A;  2ZVT A;  1ERE A;  1GS4 A;  1G50 A;  2HAM A;  3Q95 A;  5JJM B;  1MVC A;  3ADX A;  2O4J A;  4REF A;  1X7E A;  1WM0 X;  2PJL A;  3IPS A;  3VRT A;  3VSO A;  2W8Y A;  2NXX E;  1NHZ A;  3R8A A;  3V9V A;  4IA2 A;  4EM9 A;  4IUI A;  4OH5 A;  5DV6 A;  5KD9 A;  2I0G A;  1I38 A;  5AAV B;  3AZ2 A;  1XV9 A;  5I4V A;  4UDD A;  1TXI A;  4MG8 A;  3HLV A;  3OMO A;  3GZ9 A;  1GWQ A;  1XOW A;  2GL8 A;  4G1D A;  5DIE A;  1FM9 A;  3UVV A;  2QGW A;  3WT5 A;  2ZK6 A;  2GPV A;  4FHI A;  4HEE X;  5EJV A;  4LSJ A;  3ADT A;  3HC5 A;  4MGA A;  4K4J A;  1L2J A;  2XHS A;  3DT3 A;  1G5Y A;  3HOD A;  4RUJ A;  2PNU A;  3ET3 A;  3OZJ A;  3OMM A;  3K22 A;  4OAR A;  1T7T A;  4J26 A;  2HWR A;  3HZF A;  4L98 A;  4MG7 B;  3UUD A;  3UU7 B;  3F5C A;  3UUA A;  1XDK B;  2R6W A;  2P1U A;  3VJI A;  4OLM A;  2B50 A;  3VT6 A;  5ICK A;  3PCU A;  4IU7 A;  1EXX A;  2ZNN A;  3VRW A;  4ZJW A;  1LBD A;  3Q95 B;  2JJ3 A;  3N00 A;  2V7C A;  3KFC A;  1NQ7 A;  4G2I A;  4IV4 A;  4JAZ A;  2Q7J A;  3V3Q A;  3VHW A;  4PLE A;  1Q4X A;  1Z95 A;  4N73 A;  1RKG A;  3AUR A;  1KKQ A;  3FAL A;  3GN8 A;  1YOK A;  4OZR E;  5FQT A;  4OEZ A;  2Q60 A;  2PIQ A;  1FM9 D;  1XNX A;  2Q70 A;  4IA3 A;  4F9M A;  5KRH A;  4QL8 A;  4PLD A;  5DVS A;  1I7G A;  1ZUC A;  2NV7 A;  1A28 A;  1XV9 B;  2ZMJ A;  1FCZ A;  4R06 A;  5FQV A;  5LWP A;  1X78 A;  2XKW A;  2ZXZ A;  1DKF A;  4MG8 B;  1T73 A;  3UVV B;  3V4A A;  4M8E A;  1I37 A;  1X7R A;  3K8S A;  4NIE A;  2HB8 A;  2QNV A;  4OJ4 A;  2LBD A;  1Y0X X;  5DV8 A;  3G8I A;  3K23 A;  4JGV A;  4MGA B;  4RZF A;  4WHF A;  4ZNH A;  1P93 A;  5AZV A;  5G45 A;  3ET2 A;  4R2U A;  2EWP A;  4OH6 A;  2XYW A;  1YP0 A;  5AWJ A;  4ITF A;  4E4K A;  2QA8 B;  2FAI A;  2ZY0 A;  1ILG A;  3UUD B;  3UUA B;  2A3I A;  3F5C B;  4S14 A;  3W5Q A;  4QM0 A;  2AB2 A;  4ZN7 A;  2ZKC A;  1NQ1 A;  3OOF A;  4OIV A;  1E3K A;  5FQP A;  2REW A;  3VN2 A;  4A4W A;  4ZNT A;  5KCT A;  3VRU A;  4ZOM A;  3B68 A;  5APJ A;  1DB1 A;  3R2A A;  4MG9 A;  5IAW A;  3A9E A;  4XHD A;  2ZNQ A;  1YIM A;  3AN4 A;  4G20 A;  4REE A;  3ZR7 A;  3FAL B;  2ZMH A;  3HQ5 A;  2AA2 A;  1UPW A;  2AAX A;  4E2J A;  3CS8 A;  1Z5X E;  5EC9 A;  5DXK A;  1DKF B;  3L03 A;  5DWL A;  2OZ7 A;  5HJP A;  3RLL A;  4A2J A;  2PIP L;  3AZ1 A;  3DCU A;  5APH A;  3UP3 A;  4EMA A;  4Q50 A;  5K13 A;  4KZJ A;  2P15 A;  3T03 A;  1SR7 A;  3VHV A;  2P7Z A;  2Q7L A;  3A2J A;  2Z4J A;  5AK2 A;  5EGV A;  5DY8 A;  3X1H A;  5KRI A;  1H9U A;  5KRO A;  1S0X A;  2QA6 A;  5G5W A;  5IZ0 A;  5SYZ A;  3E94 A;  3W0A A;  5DL4 A;  5DWI A;  1YYE A;  2G0G A;  2IOK A;  1FBY A;  5E1C A;  5DX3 A;  3O1E A;  4MG9 B;  3TKM A;  4B7W A;  2BJ4 A;  5DKB A;  3A9E B;  2YAT A;  3G8O A;  5CJ6 A;  5AAU A;  4IA7 A;  1XPC A;  2GPP A;  3AUQ A;  3VT9 A;  1MV9 A;  1RDT A;  4FN9 A;  1ZDT A;  2POB A;  3B0R A;  3VT4 A;  5KCD A;  2HAS A;  3A78 A;  3OS8 A;  5EIT A;  5C4S A;  3ZRB A;  2ZMI A;  1XLS A;  1ZKY A;  2HFP A;  1QKM A;  4FNE A;  2J14 A;  2GWX A;  3E7C A;  3KDU A;  4OED A;  2AX6 A;  1X7B A;  4J24 A;  4PP3 A;  3AX8 A;  4ZO1 B;  5DU5 A;  3VTB A;  1YMT A;  1I7I A;  3B0W A;  4KZM A;  4WHG A;  3R5N A;  3VJS A;  2AMA A;  3W5R A;  2ZNO A;  2O4R A;  1KNU A;  4Q0A C;  2I0J A;  1N46 A;  4MGD A;  4N1Y A;  4WQP A;  5DZ1 A;  3VJT A;  4YNK A;  5DX3 B;  4RE8 A;  2Q7I A;  5E7V A;  3WFG A;  2BJ4 B;  4OFU A;  5H1E A;  1RDT D;  2BAW A;  1L2I A;  4NB6 A;  5KCW A;  5DXB A;  3W0J A;  5KRM A;  2XYX A;  4JL4 A;  5KCE A;  5EI1 A;  3VJH A;  2P1V A;  1U3R A;  1U3S A;  2AA7 A;  3ERT A;  4S0T A;  3OS9 A;  3VT3 A;  4DQM A;  5DWJ A;  4BCR A;  2G44 A;  4RAK A;  4OEA A;  3OSI A;  3W0G A;  3PEQ A;  1YJE A;  2JFA A;  3CLD A;  5DKS A;  2OVM A;  3F7D A;  5L7G A;  1FM6 A;  2YLO A;  4WVD A;  3KBA A;  3RVF A;  3OKI A;  2ZNP A;  1RJK A;  1NAX A;  3OS8 C;  3GWX A;  3W0C A;  2ZK2 A;  4DM6 A;  3PRG A;  3FC6 A;  2R6Y A;  1A52 A;  1XVP B;  2B1Z A;  2VV4 A;  4IVW A;  5C4U A;  3K6P A;  4J5X A;  3A40 X;  5DTV A;  1U3Q A;  5GID A;  2ZK1 A;  2HVC A;  5JY3 A;  2YLP A;  3D6D A;  5DZ0 A;  3CDP A;  3DZY A;  3ZQT A;  5E19 A;  4MGD B;  4J5W C;  3VT5 A;  2HAR A;  5FQR A;  2HCD A;  1XQC A;  2PKL A;  5GIE A;  2OM9 A;  3RLJ A;  3OLL A;  3ET0 A;  1S0Z A;  4UDB A;  4ONI A;  3DR1 A;  4YMQ A;  4Y29 A;  1IE8 A;  3WFF A;  5DXB B;  2ZLC A;  3FUG A;  4NUF A;  3RY9 A;  1QKN A;  1U9E A;  3R29 A;  4YPQ A;  3UP0 A;  1FM6 D;  5E0W A;  4LNX A;  2ATH A;  3DCT A;  3VRV A;  1QKT A;  3KMR A;  3WTQ A;  3VI8 A;  3U9Q A;  2PIR A;  2JFA B;  2VV2 A;  3VT8 A;  2FVJ A;  3G9E A;  3H0A A;  4OKW A;  2YLY A;  3HVL A;  3DZU A;  4PWL A;  5G46 A;  5DWG A;  2NXX A;  1UOM A;  2HC4 A;  3WJ4 A;  3B5R A;  2QMV A;  3BC5 A;  3KMG A;  2QE4 A;  4HLW A;  4IA1 A;  5DXM A;  3TX7 B;  1FCY A;  3FC6 B;  3E00 A;  3EYB A;  5DWE A;  5F9B A;  1XP1 A;  5DID A;  5KRJ A;  3DZY D;  1ERR A;  3W5P A;  3RUT A;  1YOW A;  3MNP A;  3FXV A;  4XI3 A;  2ZK5 A;  2OAX A;  1RKH A;  3OKH A;  3HO0 A;  3P89 A;  1M7W A;  4FGY A;  1NQ2 A;  5HZC A;  1NYX A;  3LBD A;  3ET1 A;  5B5B A;  3ADU A;  3CJW A;  4MG5 A;  2VSR A;  4IV2 A;  5AZT A;  5DUH A;  2HWQ A;  1ZGY A;  2G0H A;  2XYJ A;  4DOS A;  1PK5 A;  4MGC A;  5DV3 A;  1NAV A;  5AVL A;  2QW4 A;  4PXM A;  1N4H A;  1M2Z A;  3H0A D;  4POH A;  3W0I A;  4UDC A;  3OSW A;  3DZU D;  4ZNS A;  4IQR A;  3FEI A;  4JYH A;  1YA3 A;  2P1T A;  5LGA A;  2AX9 A;  3WMH A;  3WWR A;  1K74 A;  3FUR A;  2I4P A;  4X1G A;  5KYJ A;  3E00 D;  1VJB A;  5DMF A;  4DOR A;  1YUC A;  1R20 A;  2ZBS A;  2AWH A;  4NY9 A;  1OSV A;  2V0V A;  1R6G A;  2R40 A;  3B0Q A;  2QPY A;  4JYI A;  4TUZ A;  2QTU A;  4N8R A;  3PLZ A;  2OUZ A;  4RMD A;  3OGT A;  3P0U A;  4POJ A;  4QJR A;  2ZFX A;  5DXR A;  3FS1 A;  1PRG A;  4OKT A;  2Z4B A;  2YJA B;  3CWD A;  4ZNV A;  3ADV A;  5DIG A;  3V49 A;  3AFR A;  1LV2 A;  4PVU A;  2Q8S A;  4G1Y A;  4RZE A;  4XUM A;  4OZT E;  2H77 A;  5DP0 A;  5E0X A;  1M13 A;  2FSZ A;  3P88 A;  4CI5 A;  2J7Y A;  3TY0 A;  5KRL A;  3MNE A;  3SP6 A;  4DK8 A;  3IPQ A;  1K74 D;  5G42 A;  3O1D A;  1NQ0 A;  3BQD A;  4XTA A;  4PP6 A;  5HJP B;  3L0L A;  1R20 D;  2QZO A;  2GTK A;  3AZ3 A;  1BSX A;  1XNN A;  2J4A A;  4MGB A;  5DUG A;  3ADW A;  2R40 D;  4OEY A;  4DMA A;  4ZNW A;  3A2I A;  4G2H A;  5KCF A;  1FCX A;  5M96 A;  3OOK A;  4E4Q A;  2AX7 A;  2QAB A;  5DYB A;  5GIC A;  1X7J A;  4IWF A;  4OIU A;  5DZ3 A;  5L7E A;  1XAP A;  1OSH A;  2AA5 A;  4MDD A;  2POG A;  4TUZ B;  1K7L A;  2AO6 A;  5DRM A;  2Q5P A;  1T7M A;  4S15 A;  3H52 A;  3V9T A;  3OMQ A;  3VTC A;  1ZAF A;  4QE6 A;  1S9Q A;  4PF3 A;  1FD0 A;  4S0S A;  1R5K A;  2E2R A;  2Q5S A;  1HJ1 A;  3SZ1 A;  3KMZ A;  1PDU A;  5DZI A;  3HC6 A;  5B41 A;  1OVL A;  1XP9 A;  4JYG A;  4O8F A;  2Q7K A;  3W5T A;  5C4T A;  1PQ6 A;  2H79 A;  5FQS A;  4P6W A;  2HBH A;  3G0W A;  2P54 A;  1S9P A;  3L3X A;  4PPP A;  2YFE A;  1XJ7 A;  3GYU A;  2QZO B;  5DXG A;  2ZK0 A;  4MGB B;  1T74 A;  3OZ0 A;  2GPO A;  3BEJ A;  1UPV A;  5KRA A;  5C4O A;  3RUU A;  4RUO X;  2ZLA A;  5DMC A;  2GPU A;  2YLQ A;  5DI7 A;  1N83 A;  2B23 A;  2Q59 A;  3OMK A;  3X31 A;  3NOA A;  2G5O A;  4OKX A;  4M8H A;  1XIU A;  3IMY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...