5DKGA

Crystal structure of the er-alpha ligand-binding domain in complex with a t-butyl-substituted, methyl, triaryl-ethylene derivative 4,4'-[2-(4-tert-butylphenyl)prop-1-ene-1,1-diyl]diphenol
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
245
structure length
231
Chain Sequence
NSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCPLSDLLLEMLDAHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Predictive features of ligand-specific signaling through the estrogen receptor.
pubmed doi rcsb
molecule keywords Estrogen receptor
molecule tags Transcription
source organism Homo sapiens
total genus 87
structure length 231
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 5dkgA00
3IXPD 3B0RA 1QKUA 2ZBSA 4ZNVA 3W0AA 3VI8A 4PRGA 2AWHA 4J5WA 4REFA 2Q1VA 1QKMA 3H52A 5KRMA 5APHA 4TUZA 5DK9A 5DI7A 3ERTA 3B65A 1XQ3A 2P54A 3ADVA 3OGTA 3W0YA 1T7RA 1G50A 2AX8A 3VT3A 4A2JA 4ZI1A 4EM9A 1MVCA 2GPPA 3A2IA 4PP6A 3BEJA 1Z5XE 1NAXA 1X76A 4ZNSA 4HEEX 4F9MA 4OARA 5DYDA 1RKHA 2Q6SA 3AURA 3FALA 1PQCA 5KRCA 1Z95A 3F7DA 2G5OA 2GP7A 2QTUA 3ADSA 5APKA 3L03A 3W0HA 3DZUD 1ZGYA 2H77A 3B0QA 1NDEA 3GYUA 1OVLB 4N1YA 4ZNUA 5KRJA 5DX3B 4M8HA 3IPUA 5KRIA 2ZK0A 1U3SA 1RK3A 1VJBA 3IPQA 3LBDA 5AK2A 2Q7KA 1G2NA 4REEA 4RFWA 4DM6A 3P89A 4XAOA 2HB8A 1T7TA 4JGVA 1IE9A 1FCXA 1A52A 4J5XA 4G20A 1X7BA 1T65A 4UDBA 1PQ6A 2POBA 4TUZB 2ZMHA 3GYTA 5EC9A 4OIUA 4QL8A 2YJDA 1GS4A 2Q7JA 5KCDA 2B1VA 2VV0A 2YLQA 4IA1A 5DVVA 1FCYA 3HODA 4IWCA 3KMZA 1LV2A 3A3ZX 3R5MA 3CDSA 3NSPA 4MG9A 1TFCA 2Q6JA 5DVSA 3GN8A 4YNKA 2QA8B 3E7CA 2QSEA 5DU5A 1U9EA 4OLMA 1ZUCA 2XYJA 3A9EB 3OOKA 3K22A 4A4WA 4ZN9A 3QT0A 3OS8A 3DZYD 4G1YA 2PIWA 3WT6A 1M13A 1SR7A 2P1VA 3DT3A 1Z5XU 4DM8A 4L98A 4G1ZA 3ILZA 2Q3YA 2Q8SA 1K4WA 2QH6A 3OLFA 3KDTA 3R5NA 3OKIA 5L7GA 3ADWA 4G21A 3OAPA 5IAWA 1U3RA 1YY4A 3K6PA 4J26A 2B50A 2P1UA 1FM9D 2AB2A 5DV6A 3F5CB 2J4AA 2ZNOA 4EMAA 3VSPA 4ZOMA 1KV6A 3KMGA 4QE6A 4PLEA 4IV2A 5DXKA 3VT6A 4K6IA 4MG9B 5DL4A 3WJ4A 4DQMA 2FVJA 3G8IA 5G5WA 3VTCA 4UDDA 3U9QA 3WGPA 3OMMA 3GZ9A 2ZK3A 4S15A 5LWPA 2IOGA 3D6DA 4HLWA 5DXPA 3R2AA 4L96A 3V9VA 2QABA 3H0AD 4RUOX 2GPOA 2Q70A 4MGAA 4RZFA 3UUCA 5DKSA 3AZ2A 3ZR7A 2ZNNA 2ZK2A 1R20D 5HYRA 4TV1B 4FHHA 1QKNA 2VV4A 4N5GA 3SP9A 3FEIA 5DVCA 4MGBB 2Q1HA 3UP0A 3RUTA 1HJ1A 3W5PA 1RDTA 3ADTA 4J5XC 1XNNA 5DWJA 1FBYA 3VTDA 3X1IA 4E4QA 5JJMB 2JFAB 2QXSA 3R29A 2ZKCA 3HZFA 1A28A 2ACLA 4QK4A 3ERDA 4N73A 2ZMJA 4ZO1X 5A86A 2PIRA 3FUGA 1UHLA 4MGDA 2OM9A 5G43A 3SP6A 1ILHA 4POHA 4POJA 5KCEA 3TX7B 3WT5A 3ET2A 4MG8A 2HASA 4ZNWA 4XI3A 5E0XA 3OMKA 4IW6A 4S14A 5G3JA 2O4RA 3VRUA 4QJRA 1XJ7A 4MGAB 2LBDA 3P0UA 2ATHA 2PIOA 1X78A 4R06A 1L2JA 2YJAB 3B66A 2PRGA 3PLZA 4Q13A 5E0WA 5KYJA 3CS8A 3WTQA 2BJ4B 3DZUA 1T63A 1SKXA 4DMAA 2PKLA 2ZK4A 1NHZA 4RMDA 1PK5A 1P8DA 1I7IA 3IMYA 4UDAA 3UVVA 1RDTD 2QPYA 1MZNA 2YLOA 3AN3A 3D24A 3HC5A 4G2IA 5DIEA 1UPVA 1YMTA 2ZLAA 5G44A 2AMAA 2IOKA 2YLPA 2PNUA 2Z4BA 2VV3A 3UU7A 5K13A 3UUDA 5DZ3A 4CI5A 3FC6A 3FLIA 1PCGA 4RE8A 4UDCA 3BC5A 2Q59A 5E15A 1ILGA 5DUHA 4MDDA 4ZJWA 1XPCA 1YIMA 4OEZA 5DTVA 1R1KA 3D90A 3Q95B 4WHFA 2ZXMA 2XHSA 3VRTA 3NOAA 3WMHA 3OSWA 1YJEA 3B3KA 3ET1A 3V9YA 3HC6A 3VHVA 3ADXA 5DKBA 1PZLA 2B23A 5AWJA 2PIUA 4OIVA 3HM1A 1XB7A 3PRGA 2QXMA 4XUHA 1XV9A 1OSHA 3UP3A 2GWXA 4JAZA 3DZYA 5AAVB 5FQVA 5EJVA 3R8DA 5EGVA 5AYGA 3ET0A 5ICKA 2AYRA 2AMBA 1T5ZA 1ZAFA 2HAMA 5DP0A 4NUFA 4OKTA 3UU7B 3W5TA 1M7WA 3X1HA 3VJTA 3UUDB 3IPSA 5DUGA 3A2HA 2NV7A 3R8IA 1Y0SA 2V0VA 4OZRE 3AX8A 3P8XA 3W5RA 4OZTE 1R1KD 1FM9A 5DZ0A 2Q5GA 2HFPA 3OMOA 2I4PA 4DK8A 2HCDA 2AM9A 5DMFA 2G0HA 1N83A 1XDKA 5E14A 5DWLA 3CDPA 2PIVA 3BQDA 3FALB 1SJ0A 3LMPA 4KZJA 3VJHA 3OS9A 4QM0A 2QZOA 5AWKA 4PLDA 4MGCA 2FSZA 4XUMA 2J14A 3OZJA 2R6YA 2ZMIA 2GPUA 2I4JA 3G0WA 4S0TA 3H0AA 3CLDA 4Q50A 1XP6A 5DXBA 1MV9A 5HYKA 5KRKA 2AAXA 5GICA 1M2ZA 3CTBA 1YINA 3AZ3A 1R20A 1OT7A 1NUOA 5KRFA 4DOSA 1PDUA 1UOMA 5DY8A 4FN9A 1HG4A 4RUJA 4M8EA 3V49A 2BAWA 2Z4JA 3CQVA 1XQCA 4FNEA 5HJPA 5KCUA 1FCZA 4OKWA 3V9TA 1K7LA 3W5QA 5EI1A 3KWYA 2GIUA 3AZ1A 3L3ZA 4R2UA 1N4HA 5C4TA 2NPAA 2P7ZA 4PPPA 1FD0A 3W0GA 1S9PA 2OVHA 1R5KA 2I0JA 3O1DA 3TY0A 1NAVA 4OZRU 2HWQA 3V3EA 4JL4A 5GIDA 4OZTU 4NY9A 3S9SA 2F4BA 2FAIA 3A40X 1X7RA 3W0IA 5KYAA 1FM6A 5DKGA 3KDUA 2EWPA 3MNEA 4ZO1B 1S9QA 3VJSA 2PJLA 4JYHA 3KMRA 2P7AA 4E2JA 4MG5A 2ZLCA 3FURA 5DV8A 1I37A 2QNVA 3A78A 2W8YA 2Q5PA 4RWVA 1YOKA 3AUQA 4X1GA 4PPSA 3KYTA 2Q6RA 1ZEOA 2QW4A 5IXKA 3WJ5A 4PP5A 4FGYA 3P88A 4Q0AC 4XLDA 4G1DA 4IA2A 1R6GA 1BSXA 2Q7IA 1DB1A 4IUIA 4PVUA 4QE8A 2QR9A 4X1FA 5DZ1A 4RAKA 1XOWA 1XP1A 4NIEA 4WVDA 4OILA 4N8RA 1I7GA 2XKWA 3ADUA 3DCTA 3GWSX 3VT8A 5G42A 4OKBA 4OC7A 2QA6A 2VSRA 5FQTA 1SQNA 1XVPA 5JY3A 1T7MA 4RZEA 3FS1A 4G2HA 5E19A 1WM0X 1UPWA 5FQSA 2G0GA 2VV1A 1FM6D 5APJA 5DXMA 3GBKA 4IW8A 4MG7A 4OK1A 5DV3A 2NXXA 3KBAA 4APUA 5DXGA 4IQRA 2ZY0A 4LSJA 4ZNTA 1P93A 4ZNHA 2HBHA 2VV4B 5AZVA 1DKFA 3OSAA 5GIEA 3HO0A 1EXAA 3B1MA 4JYIA 3L3XA 3RLLA 5KRHA 2O9IA 2VV2A 5G45A 1G1UA 4DK7A 4IU7A 3UUAA 3MNOA 2ACLB 2NW4A 5AZTA 1E3KA 1Y9RA 1K74D 3HLVA 1T74A 5F9BA 4RMCA 1UHLB 2Q5SA 4MGDB 3ZRBA 5I4VA 3GD2A 5M96A 5AVIA 5AAUA 2XYWA 4IV4A 2ZNQA 5FQRA 3PEQA 3AN4A 1ZKYA 1EREA 3B0TA 4MG8B 2GL8A 4ONIA 2E2RA 1E3GA 2HWRA 1YUCA 5AVLA 3RLJA 4OEYA 4RMEA 5C4UA 3VRVA 1L2IA 5HJSA 3VTBA 3AUNA 3CJWA 5DX3A 4WLBA 4PP3A 2AX7A 3W0CA 2OVMA 1TXIA 3NSQA 2B1ZA 2YLYA 3FEJA 4OH6A 4WQPA 3EYBA 3OSIA 4IWFA 2ZL9A 5DWGA 3GWXA 4PF3A 2A3IA 1XAPA 2PINA 1DKFB 5DLRA 2OAXA 3PBAA 3WT7A 3E00D 3TKCA 3UVVB 1IE8A 1YYEA 2V7CA 4LNXA 4OJBA 5DRJA 3B5RA 5DZHA 1GWQA 4PWLA 3UUAB 1NQ0A 4KZIA 2OZ7A 1ZH7A 3JZBA 2AO6A 3V3QA 3FC6B 4A4VA 2ZK5A 5L11A 2Q59B 3OZ0A 1YA3A 2P1TA 5KRAA 3CWDA 2P4YA 3G9EA 4FHIA 4OJ4A 2QA8A 3K23A 5KRLA 5DSHA 5DZIA 5KR9A 3A9EA 3L0JA 2HB7A 5KD9A 4ZN7A 2NXXE 5DUEA 2YHDA 2Q61A 4WHGA 2PIPL 4IS8A 5C4OA 4KZMA 2AX6A 5KROA 1OSVA 1T73A 2AA5A 4RZGA 5CJ6A 4YMQA 2I4ZA 1KKQA 2R40A 1XV9B 4NB6A 5H1EA 3RY9A 1RJKA 5SYZA 2HVCA 2XYXA 4MG6A 4CI4A 5DIDA 3M7RA 3V4AA 3L0EA 4YT1A 5C4SA 4LBDA 4XT9A 1EXXA 3VT4A 5KCFA 2JF9A 4XHDA 1XLSE 3F5CA 3CS4A 2H79A 3X31A 5DIGA 2ABIA 1XP9A 2GTKA 3B0WA 4ITFA 1NRLA 3VSOA 5DXRA 5DRMA 5DWEA 2P7GA 3JZCA 4LNWA 2QGWA 1Q4XA 4IA7A 4IVYA 4OH5A 2R6WA 2ZNPA 3E94A 5DXQA 2AA2A 3R8AA 2ZVTA 2OUZA 5ETHA 4OJ9A 1KNUA 5E1CA 3KPZA 1XDKB 1S0ZA 3KFCA 3A2JA 3OOFA 2J7YA 1G5YA 3ZRAA 2QE4A 1PRGA 2QMVA 2P15A 2R40D 5HCVA 2QZOB 4CSJA 3B67A 5EITA 5ACCA 2PIQA 5FQPA 1T79A 1N46A 3L0LA 2ZK1A 4OFRA 4TV1A 3RVFA 5LGAA 3DR1A 5KCWA 1QKTA 1YOWA 4MGBA 3OMQA 3PCUA 2J7XA 5DXBB 1Y0XX 1NYXA 2ZXZA 2G44A 5JJMA 4J5WC 4Y29A 3L1BA 4YPQA 1YP0A 2JFAA 3ZQTA 4J24A 5L7HA 1XNXA 3SZ1A 3MNPA 4PXMA 2HARA 3B68A 4OGHA 1RKGA 3WFGA 1XZXX 5HJPB 3VT9A 2YATA 3WWRA 1ZDUA 2Q7LA 5JI0D 3TKMA 4BCRA 3VHWA 3D5FA 4E4KA 3WFFA 1LBDA 5GT4A 2GPVA 4ITEA 1K74A 4IVWA 1I38A 3VJIA 2ZK6A 3FXVA 3OKHA 2REWA 2I0GA 5IZ0A 3OMPA 4OEDA 3T03A 2PITA 2HC4A 1S19A 3N00A 2ZFXA 3VHUA 2BJ4A 2POGA 4OKXA 4JYGA 1X7JA 5DXEA 4ZJRA 4NQAB 2AA7A 4K4JA 4RUPA 5KCCA 1ERRA 3IA6A 2AXAA 3IXPA 4O8FA 5DKEA 5KCTA 2PIXA 1H9UA 1NQ1A 3OLSA 3W0JA 4WPFA 5L7EA 3E00A 4LTWA 5DYBA 5DMCA 5B41A 5B5BA 3HVLA 1GWRA 3DY6A 1PQ9A 4K7AA 3CS6A 4DORA 1T7FA 2O4JA 3AFRA 4S0SA 5G46A 3G8OA 5HZCA 4IA3A 1T76A 3Q95A 3PO9A 1XIUA 5DWIA 4OHAA 2AA6A 1ZDTA 2YFEA 5EHJA 1XLSA 3ET3A 3O1EA 3OLLA 3VT5A 1XVPB 2ZASA 1X7EA 2JJ3A 2VSTA 4OEAA 3VRWA 4P6XA 1U3QA 3OS8C 1S0XA 4XTAA 2IHQA 2VV1B 4OFUA 4R6SA 3VN2A 1GWXA 3DCUA 3RUUA 3VT7A 2Q60A 2AX9A 4B7WA 4MG7B 3D57A 1OVLA 2QGTA 1NQ2A 3HQ5A 4P6WA 5E7VA 5AAVA 3X36A 2OCFA 2ZXNA 3K8SA 1NQ7A
chains in the Genus database with same CATH superfamily
3IXPD 3B0RA 1QKUA 2ZBSA 4ZNVA 3W0AA 3VI8A 4PRGA 2AWHA 4J5WA 4REFA 2Q1VA 1QKMA 3H52A 5KRMA 5APHA 4TUZA 5DK9A 5DI7A 3ERTA 3B65A 1XQ3A 2P54A 3ADVA 3OGTA 3W0YA 1T7RA 1G50A 2AX8A 3VT3A 4A2JA 4ZI1A 4EM9A 1MVCA 2GPPA 3A2IA 4PP6A 3BEJA 1Z5XE 1NAXA 1X76A 4ZNSA 4HEEX 4F9MA 4OARA 5DYDA 1RKHA 2Q6SA 3AURA 3FALA 1PQCA 5KRCA 1Z95A 3F7DA 2G5OA 2GP7A 2QTUA 3ADSA 5APKA 3L03A 3W0HA 3DZUD 1ZGYA 2H77A 3B0QA 1NDEA 3GYUA 1OVLB 4N1YA 4ZNUA 5KRJA 5DX3B 4M8HA 3IPUA 5KRIA 2ZK0A 1U3SA 1RK3A 1VJBA 3IPQA 3LBDA 5AK2A 2Q7KA 1G2NA 4REEA 4RFWA 4DM6A 3P89A 4XAOA 2HB8A 1T7TA 4JGVA 1IE9A 1FCXA 1A52A 4J5XA 4G20A 1X7BA 1T65A 4UDBA 1PQ6A 2POBA 4TUZB 2ZMHA 3GYTA 5EC9A 4OIUA 4QL8A 2YJDA 1GS4A 2Q7JA 5KCDA 2B1VA 2VV0A 2YLQA 4IA1A 5DVVA 1FCYA 3HODA 4IWCA 3KMZA 1LV2A 3A3ZX 3R5MA 3CDSA 3NSPA 4MG9A 1TFCA 2Q6JA 5DVSA 3GN8A 4YNKA 2QA8B 3E7CA 2QSEA 5DU5A 1U9EA 4OLMA 1ZUCA 2XYJA 3A9EB 3OOKA 3K22A 4A4WA 4ZN9A 3QT0A 3OS8A 3DZYD 4G1YA 2PIWA 3WT6A 1M13A 1SR7A 2P1VA 3DT3A 1Z5XU 4DM8A 4L98A 4G1ZA 3ILZA 2Q3YA 2Q8SA 1K4WA 2QH6A 3OLFA 3KDTA 3R5NA 3OKIA 5L7GA 3ADWA 4G21A 3OAPA 5IAWA 1U3RA 1YY4A 3K6PA 4J26A 2B50A 2P1UA 1FM9D 2AB2A 5DV6A 3F5CB 2J4AA 2ZNOA 4EMAA 3VSPA 4ZOMA 1KV6A 3KMGA 4QE6A 4PLEA 4IV2A 5DXKA 3VT6A 4K6IA 4MG9B 5DL4A 3WJ4A 4DQMA 2FVJA 3G8IA 5G5WA 3VTCA 4UDDA 3U9QA 3WGPA 3OMMA 3GZ9A 2ZK3A 4S15A 5LWPA 2IOGA 3D6DA 4HLWA 5DXPA 3R2AA 4L96A 3V9VA 2QABA 3H0AD 4RUOX 2GPOA 2Q70A 4MGAA 4RZFA 3UUCA 5DKSA 3AZ2A 3ZR7A 2ZNNA 2ZK2A 1R20D 5HYRA 4TV1B 4FHHA 1QKNA 2VV4A 4N5GA 3SP9A 3FEIA 5DVCA 4MGBB 2Q1HA 3UP0A 3RUTA 1HJ1A 3W5PA 1RDTA 3ADTA 4J5XC 1XNNA 5DWJA 1FBYA 3VTDA 3X1IA 4E4QA 5JJMB 2JFAB 2QXSA 3R29A 2ZKCA 3HZFA 1A28A 2ACLA 4QK4A 3ERDA 4N73A 2ZMJA 4ZO1X 5A86A 2PIRA 3FUGA 1UHLA 4MGDA 2OM9A 5G43A 3SP6A 1ILHA 4POHA 4POJA 5KCEA 3TX7B 3WT5A 3ET2A 4MG8A 2HASA 4ZNWA 4XI3A 5E0XA 3OMKA 4IW6A 4S14A 5G3JA 2O4RA 3VRUA 4QJRA 1XJ7A 4MGAB 2LBDA 3P0UA 2ATHA 2PIOA 1X78A 4R06A 1L2JA 2YJAB 3B66A 2PRGA 3PLZA 4Q13A 5E0WA 5KYJA 3CS8A 3WTQA 2BJ4B 3DZUA 1T63A 1SKXA 4DMAA 2PKLA 2ZK4A 1NHZA 4RMDA 1PK5A 1P8DA 1I7IA 3IMYA 4UDAA 3UVVA 1RDTD 2QPYA 1MZNA 2YLOA 3AN3A 3D24A 3HC5A 4G2IA 5DIEA 1UPVA 1YMTA 2ZLAA 5G44A 2AMAA 2IOKA 2YLPA 2PNUA 2Z4BA 2VV3A 3UU7A 5K13A 3UUDA 5DZ3A 4CI5A 3FC6A 3FLIA 1PCGA 4RE8A 4UDCA 3BC5A 2Q59A 5E15A 1ILGA 5DUHA 4MDDA 4ZJWA 1XPCA 1YIMA 4OEZA 5DTVA 1R1KA 3D90A 3Q95B 4WHFA 2ZXMA 2XHSA 3VRTA 3NOAA 3WMHA 3OSWA 1YJEA 3B3KA 3ET1A 3V9YA 3HC6A 3VHVA 3ADXA 5DKBA 1PZLA 2B23A 5AWJA 2PIUA 4OIVA 3HM1A 1XB7A 3PRGA 2QXMA 4XUHA 1XV9A 1OSHA 3UP3A 2GWXA 4JAZA 3DZYA 5AAVB 5FQVA 5EJVA 3R8DA 5EGVA 5AYGA 3ET0A 5ICKA 2AYRA 2AMBA 1T5ZA 1ZAFA 2HAMA 5DP0A 4NUFA 4OKTA 3UU7B 3W5TA 1M7WA 3X1HA 3VJTA 3UUDB 3IPSA 5DUGA 3A2HA 2NV7A 3R8IA 1Y0SA 2V0VA 4OZRE 3AX8A 3P8XA 3W5RA 4OZTE 1R1KD 1FM9A 5DZ0A 2Q5GA 2HFPA 3OMOA 2I4PA 4DK8A 2HCDA 2AM9A 5DMFA 2G0HA 1N83A 1XDKA 5E14A 5DWLA 3CDPA 2PIVA 3BQDA 3FALB 1SJ0A 3LMPA 4KZJA 3VJHA 3OS9A 4QM0A 2QZOA 5AWKA 4PLDA 4MGCA 2FSZA 4XUMA 2J14A 3OZJA 2R6YA 2ZMIA 2GPUA 2I4JA 3G0WA 4S0TA 3H0AA 3CLDA 4Q50A 1XP6A 5DXBA 1MV9A 5HYKA 5KRKA 2AAXA 5GICA 1M2ZA 3CTBA 1YINA 3AZ3A 1R20A 1OT7A 1NUOA 5KRFA 4DOSA 1PDUA 1UOMA 5DY8A 4FN9A 1HG4A 4RUJA 4M8EA 3V49A 2BAWA 2Z4JA 3CQVA 1XQCA 4FNEA 5HJPA 5KCUA 1FCZA 4OKWA 3V9TA 1K7LA 3W5QA 5EI1A 3KWYA 2GIUA 3AZ1A 3L3ZA 4R2UA 1N4HA 5C4TA 2NPAA 2P7ZA 4PPPA 1FD0A 3W0GA 1S9PA 2OVHA 1R5KA 2I0JA 3O1DA 3TY0A 1NAVA 4OZRU 2HWQA 3V3EA 4JL4A 5GIDA 4OZTU 4NY9A 3S9SA 2F4BA 2FAIA 3A40X 1X7RA 3W0IA 5KYAA 1FM6A 5DKGA 3KDUA 2EWPA 3MNEA 4ZO1B 1S9QA 3VJSA 2PJLA 4JYHA 3KMRA 2P7AA 4E2JA 4MG5A 2ZLCA 3FURA 5DV8A 1I37A 2QNVA 3A78A 2W8YA 2Q5PA 4RWVA 1YOKA 3AUQA 4X1GA 4PPSA 3KYTA 2Q6RA 1ZEOA 2QW4A 5IXKA 3WJ5A 4PP5A 4FGYA 3P88A 4Q0AC 4XLDA 4G1DA 4IA2A 1R6GA 1BSXA 2Q7IA 1DB1A 4IUIA 4PVUA 4QE8A 2QR9A 4X1FA 5DZ1A 4RAKA 1XOWA 1XP1A 4NIEA 4WVDA 4OILA 4N8RA 1I7GA 2XKWA 3ADUA 3DCTA 3GWSX 3VT8A 5G42A 4OKBA 4OC7A 2QA6A 2VSRA 5FQTA 1SQNA 1XVPA 5JY3A 1T7MA 4RZEA 3FS1A 4G2HA 5E19A 1WM0X 1UPWA 5FQSA 2G0GA 2VV1A 1FM6D 5APJA 5DXMA 3GBKA 4IW8A 4MG7A 4OK1A 5DV3A 2NXXA 3KBAA 4APUA 5DXGA 4IQRA 2ZY0A 4LSJA 4ZNTA 1P93A 4ZNHA 2HBHA 2VV4B 5AZVA 1DKFA 3OSAA 5GIEA 3HO0A 1EXAA 3B1MA 4JYIA 3L3XA 3RLLA 5KRHA 2O9IA 2VV2A 5G45A 1G1UA 4DK7A 4IU7A 3UUAA 3MNOA 2ACLB 2NW4A 5AZTA 1E3KA 1Y9RA 1K74D 3HLVA 1T74A 5F9BA 4RMCA 1UHLB 2Q5SA 4MGDB 3ZRBA 5I4VA 3GD2A 5M96A 5AVIA 5AAUA 2XYWA 4IV4A 2ZNQA 5FQRA 3PEQA 3AN4A 1ZKYA 1EREA 3B0TA 4MG8B 2GL8A 4ONIA 2E2RA 1E3GA 2HWRA 1YUCA 5AVLA 3RLJA 4OEYA 4RMEA 5C4UA 3VRVA 1L2IA 5HJSA 3VTBA 3AUNA 3CJWA 5DX3A 4WLBA 4PP3A 2AX7A 3W0CA 2OVMA 1TXIA 3NSQA 2B1ZA 2YLYA 3FEJA 4OH6A 4WQPA 3EYBA 3OSIA 4IWFA 2ZL9A 5DWGA 3GWXA 4PF3A 2A3IA 1XAPA 2PINA 1DKFB 5DLRA 2OAXA 3PBAA 3WT7A 3E00D 3TKCA 3UVVB 1IE8A 1YYEA 2V7CA 4LNXA 4OJBA 5DRJA 3B5RA 5DZHA 1GWQA 4PWLA 3UUAB 1NQ0A 4KZIA 2OZ7A 1ZH7A 3JZBA 2AO6A 3V3QA 3FC6B 4A4VA 2ZK5A 5L11A 2Q59B 3OZ0A 1YA3A 2P1TA 5KRAA 3CWDA 2P4YA 3G9EA 4FHIA 4OJ4A 2QA8A 3K23A 5KRLA 5DSHA 5DZIA 5KR9A 3A9EA 3L0JA 2HB7A 5KD9A 4ZN7A 2NXXE 5DUEA 2YHDA 2Q61A 4WHGA 2PIPL 4IS8A 5C4OA 4KZMA 2AX6A 5KROA 1OSVA 1T73A 2AA5A 4RZGA 5CJ6A 4YMQA 2I4ZA 1KKQA 2R40A 1XV9B 4NB6A 5H1EA 3RY9A 1RJKA 5SYZA 2HVCA 2XYXA 4MG6A 4CI4A 5DIDA 3M7RA 3V4AA 3L0EA 4YT1A 5C4SA 4LBDA 4XT9A 1EXXA 3VT4A 5KCFA 2JF9A 4XHDA 1XLSE 3F5CA 3CS4A 2H79A 3X31A 5DIGA 2ABIA 1XP9A 2GTKA 3B0WA 4ITFA 1NRLA 3VSOA 5DXRA 5DRMA 5DWEA 2P7GA 3JZCA 4LNWA 2QGWA 1Q4XA 4IA7A 4IVYA 4OH5A 2R6WA 2ZNPA 3E94A 5DXQA 2AA2A 3R8AA 2ZVTA 2OUZA 5ETHA 4OJ9A 1KNUA 5E1CA 3KPZA 1XDKB 1S0ZA 3KFCA 3A2JA 3OOFA 2J7YA 1G5YA 3ZRAA 2QE4A 1PRGA 2QMVA 2P15A 2R40D 5HCVA 2QZOB 4CSJA 3B67A 5EITA 5ACCA 2PIQA 5FQPA 1T79A 1N46A 3L0LA 2ZK1A 4OFRA 4TV1A 3RVFA 5LGAA 3DR1A 5KCWA 1QKTA 1YOWA 4MGBA 3OMQA 3PCUA 2J7XA 5DXBB 1Y0XX 1NYXA 2ZXZA 2G44A 5JJMA 4J5WC 4Y29A 3L1BA 4YPQA 1YP0A 2JFAA 3ZQTA 4J24A 5L7HA 1XNXA 3SZ1A 3MNPA 4PXMA 2HARA 3B68A 4OGHA 1RKGA 3WFGA 1XZXX 5HJPB 3VT9A 2YATA 3WWRA 1ZDUA 2Q7LA 5JI0D 3TKMA 4BCRA 3VHWA 3D5FA 4E4KA 3WFFA 1LBDA 5GT4A 2GPVA 4ITEA 1K74A 4IVWA 1I38A 3VJIA 2ZK6A 3FXVA 3OKHA 2REWA 2I0GA 5IZ0A 3OMPA 4OEDA 3T03A 2PITA 2HC4A 1S19A 3N00A 2ZFXA 3VHUA 2BJ4A 2POGA 4OKXA 4JYGA 1X7JA 5DXEA 4ZJRA 4NQAB 2AA7A 4K4JA 4RUPA 5KCCA 1ERRA 3IA6A 2AXAA 3IXPA 4O8FA 5DKEA 5KCTA 2PIXA 1H9UA 1NQ1A 3OLSA 3W0JA 4WPFA 5L7EA 3E00A 4LTWA 5DYBA 5DMCA 5B41A 5B5BA 3HVLA 1GWRA 3DY6A 1PQ9A 4K7AA 3CS6A 4DORA 1T7FA 2O4JA 3AFRA 4S0SA 5G46A 3G8OA 5HZCA 4IA3A 1T76A 3Q95A 3PO9A 1XIUA 5DWIA 4OHAA 2AA6A 1ZDTA 2YFEA 5EHJA 1XLSA 3ET3A 3O1EA 3OLLA 3VT5A 1XVPB 2ZASA 1X7EA 2JJ3A 2VSTA 4OEAA 3VRWA 4P6XA 1U3QA 3OS8C 1S0XA 4XTAA 2IHQA 2VV1B 4OFUA 4R6SA 3VN2A 1GWXA 3DCUA 3RUUA 3VT7A 2Q60A 2AX9A 4B7WA 4MG7B 3D57A 1OVLA 2QGTA 1NQ2A 3HQ5A 4P6WA 5E7VA 5AAVA 3X36A 2OCFA 2ZXNA 3K8SA 1NQ7A
chains in the Genus database with same CATH topology
3IXPD 3B0RA 1QKUA 2ZBSA 4ZNVA 3W0AA 3VI8A 4PRGA 2AWHA 4J5WA 4REFA 2Q1VA 1QKMA 3H52A 5KRMA 5APHA 4TUZA 5DK9A 5DI7A 3ERTA 3B65A 1XQ3A 2P54A 3ADVA 3OGTA 3W0YA 1T7RA 1G50A 2AX8A 3VT3A 4A2JA 4ZI1A 4EM9A 1MVCA 2GPPA 3A2IA 4PP6A 3BEJA 1Z5XE 1NAXA 1X76A 4ZNSA 4HEEX 4F9MA 4OARA 5DYDA 1RKHA 2Q6SA 3AURA 3FALA 1PQCA 5KRCA 1Z95A 3F7DA 2G5OA 2GP7A 2QTUA 3ADSA 5APKA 3L03A 3W0HA 3DZUD 1ZGYA 2H77A 3B0QA 1NDEA 3GYUA 1OVLB 4N1YA 4ZNUA 5KRJA 5DX3B 4M8HA 3IPUA 5KRIA 2ZK0A 1U3SA 1RK3A 1VJBA 3IPQA 3LBDA 5AK2A 2Q7KA 1G2NA 4REEA 4RFWA 4DM6A 3P89A 4XAOA 2HB8A 1T7TA 4JGVA 1IE9A 1FCXA 1A52A 4J5XA 4G20A 1X7BA 1T65A 4UDBA 1PQ6A 2POBA 4TUZB 2ZMHA 3GYTA 5EC9A 4OIUA 4QL8A 2YJDA 1GS4A 2Q7JA 5KCDA 2B1VA 2VV0A 2YLQA 4IA1A 5DVVA 1FCYA 3HODA 4IWCA 3KMZA 1LV2A 3A3ZX 3R5MA 3CDSA 3NSPA 4MG9A 1TFCA 2Q6JA 5DVSA 3GN8A 4YNKA 2QA8B 3E7CA 2QSEA 5DU5A 1U9EA 4OLMA 1ZUCA 2XYJA 3A9EB 3OOKA 3K22A 4A4WA 4ZN9A 3QT0A 3OS8A 3DZYD 4G1YA 2PIWA 3WT6A 1M13A 1SR7A 2P1VA 3DT3A 1Z5XU 4DM8A 4L98A 4G1ZA 3ILZA 2Q3YA 2Q8SA 1K4WA 2QH6A 3OLFA 3KDTA 3R5NA 3OKIA 5L7GA 3ADWA 4G21A 3OAPA 5IAWA 1U3RA 1YY4A 3K6PA 4J26A 2B50A 2P1UA 1FM9D 2AB2A 5DV6A 3F5CB 2J4AA 2ZNOA 4EMAA 3VSPA 4ZOMA 1KV6A 3KMGA 4QE6A 4PLEA 4IV2A 5DXKA 3VT6A 4K6IA 4MG9B 5DL4A 3WJ4A 4DQMA 2FVJA 3G8IA 5G5WA 3VTCA 4UDDA 3U9QA 3WGPA 3OMMA 3GZ9A 2ZK3A 4S15A 5LWPA 2IOGA 3D6DA 4HLWA 5DXPA 3R2AA 4L96A 3V9VA 2QABA 3H0AD 4RUOX 2GPOA 2Q70A 4MGAA 4RZFA 3UUCA 5DKSA 3AZ2A 3ZR7A 2ZNNA 2ZK2A 1R20D 5HYRA 4TV1B 4FHHA 1QKNA 2VV4A 4N5GA 3SP9A 3FEIA 5DVCA 4MGBB 2Q1HA 3UP0A 3RUTA 1HJ1A 3W5PA 1RDTA 3ADTA 4J5XC 1XNNA 5DWJA 1FBYA 3VTDA 3X1IA 4E4QA 5JJMB 2JFAB 2QXSA 3R29A 2ZKCA 3HZFA 1A28A 2ACLA 4QK4A 3ERDA 4N73A 2ZMJA 4ZO1X 5A86A 2PIRA 3FUGA 1UHLA 4MGDA 2OM9A 5G43A 3SP6A 1ILHA 4POHA 4POJA 5KCEA 3TX7B 3WT5A 3ET2A 4MG8A 2HASA 4ZNWA 4XI3A 5E0XA 3OMKA 4IW6A 4S14A 5G3JA 2O4RA 3VRUA 4QJRA 1XJ7A 4MGAB 2LBDA 3P0UA 2ATHA 2PIOA 1X78A 4R06A 1L2JA 2YJAB 3B66A 2PRGA 3PLZA 4Q13A 5E0WA 5KYJA 3CS8A 3WTQA 2BJ4B 3DZUA 1T63A 1SKXA 4DMAA 2PKLA 2ZK4A 1NHZA 4RMDA 1PK5A 1P8DA 1I7IA 3IMYA 4UDAA 3UVVA 1RDTD 2QPYA 1MZNA 2YLOA 3AN3A 3D24A 3HC5A 4G2IA 5DIEA 1UPVA 1YMTA 2ZLAA 5G44A 2AMAA 2IOKA 2YLPA 2PNUA 2Z4BA 2VV3A 3UU7A 5K13A 3UUDA 5DZ3A 4CI5A 3FC6A 3FLIA 1PCGA 4RE8A 4UDCA 3BC5A 2Q59A 5E15A 1ILGA 5DUHA 4MDDA 4ZJWA 1XPCA 1YIMA 4OEZA 5DTVA 1R1KA 3D90A 3Q95B 4WHFA 2ZXMA 2XHSA 3VRTA 3NOAA 3WMHA 3OSWA 1YJEA 3B3KA 3ET1A 3V9YA 3HC6A 3VHVA 3ADXA 5DKBA 1PZLA 2B23A 5AWJA 2PIUA 4OIVA 3HM1A 1XB7A 3PRGA 2QXMA 4XUHA 1XV9A 1OSHA 3UP3A 2GWXA 4JAZA 3DZYA 5AAVB 5FQVA 5EJVA 3R8DA 5EGVA 5AYGA 3ET0A 5ICKA 2AYRA 2AMBA 1T5ZA 1ZAFA 2HAMA 5DP0A 4NUFA 4OKTA 3UU7B 3W5TA 1M7WA 3X1HA 3VJTA 3UUDB 3IPSA 5DUGA 3A2HA 2NV7A 3R8IA 1Y0SA 2V0VA 4OZRE 3AX8A 3P8XA 3W5RA 4OZTE 1R1KD 1FM9A 5DZ0A 2Q5GA 2HFPA 3OMOA 2I4PA 4DK8A 2HCDA 2AM9A 5DMFA 2G0HA 1N83A 1XDKA 5E14A 5DWLA 3CDPA 2PIVA 3BQDA 3FALB 1SJ0A 3LMPA 4KZJA 3VJHA 3OS9A 4QM0A 2QZOA 5AWKA 4PLDA 4MGCA 2FSZA 4XUMA 2J14A 3OZJA 2R6YA 2ZMIA 2GPUA 2I4JA 3G0WA 4S0TA 3H0AA 3CLDA 4Q50A 1XP6A 5DXBA 1MV9A 5HYKA 5KRKA 2AAXA 5GICA 1M2ZA 3CTBA 1YINA 3AZ3A 1R20A 1OT7A 1NUOA 5KRFA 4DOSA 1PDUA 1UOMA 5DY8A 4FN9A 1HG4A 4RUJA 4M8EA 3V49A 2BAWA 2Z4JA 3CQVA 1XQCA 4FNEA 5HJPA 5KCUA 1FCZA 4OKWA 3V9TA 1K7LA 3W5QA 5EI1A 3KWYA 2GIUA 3AZ1A 3L3ZA 4R2UA 1N4HA 5C4TA 2NPAA 2P7ZA 4PPPA 1FD0A 3W0GA 1S9PA 2OVHA 1R5KA 2I0JA 3O1DA 3TY0A 1NAVA 4OZRU 2HWQA 3V3EA 4JL4A 5GIDA 4OZTU 4NY9A 3S9SA 2F4BA 2FAIA 3A40X 1X7RA 3W0IA 5KYAA 1FM6A 5DKGA 3KDUA 2EWPA 3MNEA 4ZO1B 1S9QA 3VJSA 2PJLA 4JYHA 3KMRA 2P7AA 4E2JA 4MG5A 2ZLCA 3FURA 5DV8A 1I37A 2QNVA 3A78A 2W8YA 2Q5PA 4RWVA 1YOKA 3AUQA 4X1GA 4PPSA 3KYTA 2Q6RA 1ZEOA 2QW4A 5IXKA 3WJ5A 4PP5A 4FGYA 3P88A 4Q0AC 4XLDA 4G1DA 4IA2A 1R6GA 1BSXA 2Q7IA 1DB1A 4IUIA 4PVUA 4QE8A 2QR9A 4X1FA 5DZ1A 4RAKA 1XOWA 1XP1A 4NIEA 4WVDA 4OILA 4N8RA 1I7GA 2XKWA 3ADUA 3DCTA 3GWSX 3VT8A 5G42A 4OKBA 4OC7A 2QA6A 2VSRA 5FQTA 1SQNA 1XVPA 5JY3A 1T7MA 4RZEA 3FS1A 4G2HA 5E19A 1WM0X 1UPWA 5FQSA 2G0GA 2VV1A 1FM6D 5APJA 5DXMA 3GBKA 4IW8A 4MG7A 4OK1A 5DV3A 2NXXA 3KBAA 4APUA 5DXGA 4IQRA 2ZY0A 4LSJA 4ZNTA 1P93A 4ZNHA 2HBHA 2VV4B 5AZVA 1DKFA 3OSAA 5GIEA 3HO0A 1EXAA 3B1MA 4JYIA 3L3XA 3RLLA 5KRHA 2O9IA 2VV2A 5G45A 1G1UA 4DK7A 4IU7A 3UUAA 3MNOA 2ACLB 2NW4A 5AZTA 1E3KA 1Y9RA 1K74D 3HLVA 1T74A 5F9BA 4RMCA 1UHLB 2Q5SA 4MGDB 3ZRBA 5I4VA 3GD2A 5M96A 5AVIA 5AAUA 2XYWA 4IV4A 2ZNQA 5FQRA 3PEQA 3AN4A 1ZKYA 1EREA 3B0TA 4MG8B 2GL8A 4ONIA 2E2RA 1E3GA 2HWRA 1YUCA 5AVLA 3RLJA 4OEYA 4RMEA 5C4UA 3VRVA 1L2IA 5HJSA 3VTBA 3AUNA 3CJWA 5DX3A 4WLBA 4PP3A 2AX7A 3W0CA 2OVMA 1TXIA 3NSQA 2B1ZA 2YLYA 3FEJA 4OH6A 4WQPA 3EYBA 3OSIA 4IWFA 2ZL9A 5DWGA 3GWXA 4PF3A 2A3IA 1XAPA 2PINA 1DKFB 5DLRA 2OAXA 3PBAA 3WT7A 3E00D 3TKCA 3UVVB 1IE8A 1YYEA 2V7CA 4LNXA 4OJBA 5DRJA 3B5RA 5DZHA 1GWQA 4PWLA 3UUAB 1NQ0A 4KZIA 2OZ7A 1ZH7A 3JZBA 2AO6A 3V3QA 3FC6B 4A4VA 2ZK5A 5L11A 2Q59B 3OZ0A 1YA3A 2P1TA 5KRAA 3CWDA 2P4YA 3G9EA 4FHIA 4OJ4A 2QA8A 3K23A 5KRLA 5DSHA 5DZIA 5KR9A 3A9EA 3L0JA 2HB7A 5KD9A 4ZN7A 2NXXE 5DUEA 2YHDA 2Q61A 4WHGA 2PIPL 4IS8A 5C4OA 4KZMA 2AX6A 5KROA 1OSVA 1T73A 2AA5A 4RZGA 5CJ6A 4YMQA 2I4ZA 1KKQA 2R40A 1XV9B 4NB6A 5H1EA 3RY9A 1RJKA 5SYZA 2HVCA 2XYXA 4MG6A 4CI4A 5DIDA 3M7RA 3V4AA 3L0EA 4YT1A 5C4SA 4LBDA 4XT9A 1EXXA 3VT4A 5KCFA 2JF9A 4XHDA 1XLSE 3F5CA 3CS4A 2H79A 3X31A 5DIGA 2ABIA 1XP9A 2GTKA 3B0WA 4ITFA 1NRLA 3VSOA 5DXRA 5DRMA 5DWEA 2P7GA 3JZCA 4LNWA 2QGWA 1Q4XA 4IA7A 4IVYA 4OH5A 2R6WA 2ZNPA 3E94A 5DXQA 2AA2A 3R8AA 2ZVTA 2OUZA 5ETHA 4OJ9A 1KNUA 5E1CA 3KPZA 1XDKB 1S0ZA 3KFCA 3A2JA 3OOFA 2J7YA 1G5YA 3ZRAA 2QE4A 1PRGA 2QMVA 2P15A 2R40D 5HCVA 2QZOB 4CSJA 3B67A 5EITA 5ACCA 2PIQA 5FQPA 1T79A 1N46A 3L0LA 2ZK1A 4OFRA 4TV1A 3RVFA 5LGAA 3DR1A 5KCWA 1QKTA 1YOWA 4MGBA 3OMQA 3PCUA 2J7XA 5DXBB 1Y0XX 1NYXA 2ZXZA 2G44A 5JJMA 4J5WC 4Y29A 3L1BA 4YPQA 1YP0A 2JFAA 3ZQTA 4J24A 5L7HA 1XNXA 3SZ1A 3MNPA 4PXMA 2HARA 3B68A 4OGHA 1RKGA 3WFGA 1XZXX 5HJPB 3VT9A 2YATA 3WWRA 1ZDUA 2Q7LA 5JI0D 3TKMA 4BCRA 3VHWA 3D5FA 4E4KA 3WFFA 1LBDA 5GT4A 2GPVA 4ITEA 1K74A 4IVWA 1I38A 3VJIA 2ZK6A 3FXVA 3OKHA 2REWA 2I0GA 5IZ0A 3OMPA 4OEDA 3T03A 2PITA 2HC4A 1S19A 3N00A 2ZFXA 3VHUA 2BJ4A 2POGA 4OKXA 4JYGA 1X7JA 5DXEA 4ZJRA 4NQAB 2AA7A 4K4JA 4RUPA 5KCCA 1ERRA 3IA6A 2AXAA 3IXPA 4O8FA 5DKEA 5KCTA 2PIXA 1H9UA 1NQ1A 3OLSA 3W0JA 4WPFA 5L7EA 3E00A 4LTWA 5DYBA 5DMCA 5B41A 5B5BA 3HVLA 1GWRA 3DY6A 1PQ9A 4K7AA 3CS6A 4DORA 1T7FA 2O4JA 3AFRA 4S0SA 5G46A 3G8OA 5HZCA 4IA3A 1T76A 3Q95A 3PO9A 1XIUA 5DWIA 4OHAA 2AA6A 1ZDTA 2YFEA 5EHJA 1XLSA 3ET3A 3O1EA 3OLLA 3VT5A 1XVPB 2ZASA 1X7EA 2JJ3A 2VSTA 4OEAA 3VRWA 4P6XA 1U3QA 3OS8C 1S0XA 4XTAA 2IHQA 2VV1B 4OFUA 4R6SA 3VN2A 1GWXA 3DCUA 3RUUA 3VT7A 2Q60A 2AX9A 4B7WA 4MG7B 3D57A 1OVLA 2QGTA 1NQ2A 3HQ5A 4P6WA 5E7VA 5AAVA 3X36A 2OCFA 2ZXNA 3K8SA 1NQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IXP D;  3B0R A;  1QKU A;  2ZBS A;  4ZNV A;  3W0A A;  3VI8 A;  4PRG A;  2AWH A;  4J5W A;  4REF A;  2Q1V A;  1QKM A;  3H52 A;  5KRM A;  5APH A;  4TUZ A;  5DK9 A;  5DI7 A;  3ERT A;  3B65 A;  1XQ3 A;  2P54 A;  3ADV A;  3OGT A;  3W0Y A;  1T7R A;  1G50 A;  2AX8 A;  3VT3 A;  4A2J A;  4ZI1 A;  4EM9 A;  1MVC A;  2GPP A;  3A2I A;  4PP6 A;  3BEJ A;  1Z5X E;  1NAX A;  1X76 A;  4ZNS A;  4HEE X;  4F9M A;  4OAR A;  5DYD A;  1RKH A;  2Q6S A;  3AUR A;  3FAL A;  1PQC A;  5KRC A;  1Z95 A;  3F7D A;  2G5O A;  2GP7 A;  2QTU A;  3ADS A;  5APK A;  3L03 A;  3W0H A;  3DZU D;  1ZGY A;  2H77 A;  3B0Q A;  1NDE A;  3GYU A;  1OVL B;  4N1Y A;  4ZNU A;  5KRJ A;  5DX3 B;  4M8H A;  3IPU A;  5KRI A;  2ZK0 A;  1U3S A;  1RK3 A;  1VJB A;  3IPQ A;  3LBD A;  5AK2 A;  2Q7K A;  1G2N A;  4REE A;  4RFW A;  4DM6 A;  3P89 A;  4XAO A;  2HB8 A;  1T7T A;  4JGV A;  1IE9 A;  1FCX A;  1A52 A;  4J5X A;  4G20 A;  1X7B A;  1T65 A;  4UDB A;  1PQ6 A;  2POB A;  4TUZ B;  2ZMH A;  3GYT A;  5EC9 A;  4OIU A;  4QL8 A;  2YJD A;  1GS4 A;  2Q7J A;  5KCD A;  2B1V A;  2VV0 A;  2YLQ A;  4IA1 A;  5DVV A;  1FCY A;  3HOD A;  4IWC A;  3KMZ A;  1LV2 A;  3A3Z X;  3R5M A;  3CDS A;  3NSP A;  4MG9 A;  1TFC A;  2Q6J A;  5DVS A;  3GN8 A;  4YNK A;  2QA8 B;  3E7C A;  2QSE A;  5DU5 A;  1U9E A;  4OLM A;  1ZUC A;  2XYJ A;  3A9E B;  3OOK A;  3K22 A;  4A4W A;  4ZN9 A;  3QT0 A;  3OS8 A;  3DZY D;  4G1Y A;  2PIW A;  3WT6 A;  1M13 A;  1SR7 A;  2P1V A;  3DT3 A;  1Z5X U;  4DM8 A;  4L98 A;  4G1Z A;  3ILZ A;  2Q3Y A;  2Q8S A;  1K4W A;  2QH6 A;  3OLF A;  3KDT A;  3R5N A;  3OKI A;  5L7G A;  3ADW A;  4G21 A;  3OAP A;  5IAW A;  1U3R A;  1YY4 A;  3K6P A;  4J26 A;  2B50 A;  2P1U A;  1FM9 D;  2AB2 A;  5DV6 A;  3F5C B;  2J4A A;  2ZNO A;  4EMA A;  3VSP A;  4ZOM A;  1KV6 A;  3KMG A;  4QE6 A;  4PLE A;  4IV2 A;  5DXK A;  3VT6 A;  4K6I A;  4MG9 B;  5DL4 A;  3WJ4 A;  4DQM A;  2FVJ A;  3G8I A;  5G5W A;  3VTC A;  4UDD A;  3U9Q A;  3WGP A;  3OMM A;  3GZ9 A;  2ZK3 A;  4S15 A;  5LWP A;  2IOG A;  3D6D A;  4HLW A;  5DXP A;  3R2A A;  4L96 A;  3V9V A;  2QAB A;  3H0A D;  4RUO X;  2GPO A;  2Q70 A;  4MGA A;  4RZF A;  3UUC A;  5DKS A;  3AZ2 A;  3ZR7 A;  2ZNN A;  2ZK2 A;  1R20 D;  5HYR A;  4TV1 B;  4FHH A;  1QKN A;  2VV4 A;  4N5G A;  3SP9 A;  3FEI A;  5DVC A;  4MGB B;  2Q1H A;  3UP0 A;  3RUT A;  1HJ1 A;  3W5P A;  1RDT A;  3ADT A;  4J5X C;  1XNN A;  5DWJ A;  1FBY A;  3VTD A;  3X1I A;  4E4Q A;  5JJM B;  2JFA B;  2QXS A;  3R29 A;  2ZKC A;  3HZF A;  1A28 A;  2ACL A;  4QK4 A;  3ERD A;  4N73 A;  2ZMJ A;  4ZO1 X;  5A86 A;  2PIR A;  3FUG A;  1UHL A;  4MGD A;  2OM9 A;  5G43 A;  3SP6 A;  1ILH A;  4POH A;  4POJ A;  5KCE A;  3TX7 B;  3WT5 A;  3ET2 A;  4MG8 A;  2HAS A;  4ZNW A;  4XI3 A;  5E0X A;  3OMK A;  4IW6 A;  4S14 A;  5G3J A;  2O4R A;  3VRU A;  4QJR A;  1XJ7 A;  4MGA B;  2LBD A;  3P0U A;  2ATH A;  2PIO A;  1X78 A;  4R06 A;  1L2J A;  2YJA B;  3B66 A;  2PRG A;  3PLZ A;  4Q13 A;  5E0W A;  5KYJ A;  3CS8 A;  3WTQ A;  2BJ4 B;  3DZU A;  1T63 A;  1SKX A;  4DMA A;  2PKL A;  2ZK4 A;  1NHZ A;  4RMD A;  1PK5 A;  1P8D A;  1I7I A;  3IMY A;  4UDA A;  3UVV A;  1RDT D;  2QPY A;  1MZN A;  2YLO A;  3AN3 A;  3D24 A;  3HC5 A;  4G2I A;  5DIE A;  1UPV A;  1YMT A;  2ZLA A;  5G44 A;  2AMA A;  2IOK A;  2YLP A;  2PNU A;  2Z4B A;  2VV3 A;  3UU7 A;  5K13 A;  3UUD A;  5DZ3 A;  4CI5 A;  3FC6 A;  3FLI A;  1PCG A;  4RE8 A;  4UDC A;  3BC5 A;  2Q59 A;  5E15 A;  1ILG A;  5DUH A;  4MDD A;  4ZJW A;  1XPC A;  1YIM A;  4OEZ A;  5DTV A;  1R1K A;  3D90 A;  3Q95 B;  4WHF A;  2ZXM A;  2XHS A;  3VRT A;  3NOA A;  3WMH A;  3OSW A;  1YJE A;  3B3K A;  3ET1 A;  3V9Y A;  3HC6 A;  3VHV A;  3ADX A;  5DKB A;  1PZL A;  2B23 A;  5AWJ A;  2PIU A;  4OIV A;  3HM1 A;  1XB7 A;  3PRG A;  2QXM A;  4XUH A;  1XV9 A;  1OSH A;  3UP3 A;  2GWX A;  4JAZ A;  3DZY A;  5AAV B;  5FQV A;  5EJV A;  3R8D A;  5EGV A;  5AYG A;  3ET0 A;  5ICK A;  2AYR A;  2AMB A;  1T5Z A;  1ZAF A;  2HAM A;  5DP0 A;  4NUF A;  4OKT A;  3UU7 B;  3W5T A;  1M7W A;  3X1H A;  3VJT A;  3UUD B;  3IPS A;  5DUG A;  3A2H A;  2NV7 A;  3R8I A;  1Y0S A;  2V0V A;  4OZR E;  3AX8 A;  3P8X A;  3W5R A;  4OZT E;  1R1K D;  1FM9 A;  5DZ0 A;  2Q5G A;  2HFP A;  3OMO A;  2I4P A;  4DK8 A;  2HCD A;  2AM9 A;  5DMF A;  2G0H A;  1N83 A;  1XDK A;  5E14 A;  5DWL A;  3CDP A;  2PIV A;  3BQD A;  3FAL B;  1SJ0 A;  3LMP A;  4KZJ A;  3VJH A;  3OS9 A;  4QM0 A;  2QZO A;  5AWK A;  4PLD A;  4MGC A;  2FSZ A;  4XUM A;  2J14 A;  3OZJ A;  2R6Y A;  2ZMI A;  2GPU A;  2I4J A;  3G0W A;  4S0T A;  3H0A A;  3CLD A;  4Q50 A;  1XP6 A;  5DXB A;  1MV9 A;  5HYK A;  5KRK A;  2AAX A;  5GIC A;  1M2Z A;  3CTB A;  1YIN A;  3AZ3 A;  1R20 A;  1OT7 A;  1NUO A;  5KRF A;  4DOS A;  1PDU A;  1UOM A;  5DY8 A;  4FN9 A;  1HG4 A;  4RUJ A;  4M8E A;  3V49 A;  2BAW A;  2Z4J A;  3CQV A;  1XQC A;  4FNE A;  5HJP A;  5KCU A;  1FCZ A;  4OKW A;  3V9T A;  1K7L A;  3W5Q A;  5EI1 A;  3KWY A;  2GIU A;  3AZ1 A;  3L3Z A;  4R2U A;  1N4H A;  5C4T A;  2NPA A;  2P7Z A;  4PPP A;  1FD0 A;  3W0G A;  1S9P A;  2OVH A;  1R5K A;  2I0J A;  3O1D A;  3TY0 A;  1NAV A;  4OZR U;  2HWQ A;  3V3E A;  4JL4 A;  5GID A;  4OZT U;  4NY9 A;  3S9S A;  2F4B A;  2FAI A;  3A40 X;  1X7R A;  3W0I A;  5KYA A;  1FM6 A;  5DKG A;  3KDU A;  2EWP A;  3MNE A;  4ZO1 B;  1S9Q A;  3VJS A;  2PJL A;  4JYH A;  3KMR A;  2P7A A;  4E2J A;  4MG5 A;  2ZLC A;  3FUR A;  5DV8 A;  1I37 A;  2QNV A;  3A78 A;  2W8Y A;  2Q5P A;  4RWV A;  1YOK A;  3AUQ A;  4X1G A;  4PPS A;  3KYT A;  2Q6R A;  1ZEO A;  2QW4 A;  5IXK A;  3WJ5 A;  4PP5 A;  4FGY A;  3P88 A;  4Q0A C;  4XLD A;  4G1D A;  4IA2 A;  1R6G A;  1BSX A;  2Q7I A;  1DB1 A;  4IUI A;  4PVU A;  4QE8 A;  2QR9 A;  4X1F A;  5DZ1 A;  4RAK A;  1XOW A;  1XP1 A;  4NIE A;  4WVD A;  4OIL A;  4N8R A;  1I7G A;  2XKW A;  3ADU A;  3DCT A;  3GWS X;  3VT8 A;  5G42 A;  4OKB A;  4OC7 A;  2QA6 A;  2VSR A;  5FQT A;  1SQN A;  1XVP A;  5JY3 A;  1T7M A;  4RZE A;  3FS1 A;  4G2H A;  5E19 A;  1WM0 X;  1UPW A;  5FQS A;  2G0G A;  2VV1 A;  1FM6 D;  5APJ A;  5DXM A;  3GBK A;  4IW8 A;  4MG7 A;  4OK1 A;  5DV3 A;  2NXX A;  3KBA A;  4APU A;  5DXG A;  4IQR A;  2ZY0 A;  4LSJ A;  4ZNT A;  1P93 A;  4ZNH A;  2HBH A;  2VV4 B;  5AZV A;  1DKF A;  3OSA A;  5GIE A;  3HO0 A;  1EXA A;  3B1M A;  4JYI A;  3L3X A;  3RLL A;  5KRH A;  2O9I A;  2VV2 A;  5G45 A;  1G1U A;  4DK7 A;  4IU7 A;  3UUA A;  3MNO A;  2ACL B;  2NW4 A;  5AZT A;  1E3K A;  1Y9R A;  1K74 D;  3HLV A;  1T74 A;  5F9B A;  4RMC A;  1UHL B;  2Q5S A;  4MGD B;  3ZRB A;  5I4V A;  3GD2 A;  5M96 A;  5AVI A;  5AAU A;  2XYW A;  4IV4 A;  2ZNQ A;  5FQR A;  3PEQ A;  3AN4 A;  1ZKY A;  1ERE A;  3B0T A;  4MG8 B;  2GL8 A;  4ONI A;  2E2R A;  1E3G A;  2HWR A;  1YUC A;  5AVL A;  3RLJ A;  4OEY A;  4RME A;  5C4U A;  3VRV A;  1L2I A;  5HJS A;  3VTB A;  3AUN A;  3CJW A;  5DX3 A;  4WLB A;  4PP3 A;  2AX7 A;  3W0C A;  2OVM A;  1TXI A;  3NSQ A;  2B1Z A;  2YLY A;  3FEJ A;  4OH6 A;  4WQP A;  3EYB A;  3OSI A;  4IWF A;  2ZL9 A;  5DWG A;  3GWX A;  4PF3 A;  2A3I A;  1XAP A;  2PIN A;  1DKF B;  5DLR A;  2OAX A;  3PBA A;  3WT7 A;  3E00 D;  3TKC A;  3UVV B;  1IE8 A;  1YYE A;  2V7C A;  4LNX A;  4OJB A;  5DRJ A;  3B5R A;  5DZH A;  1GWQ A;  4PWL A;  3UUA B;  1NQ0 A;  4KZI A;  2OZ7 A;  1ZH7 A;  3JZB A;  2AO6 A;  3V3Q A;  3FC6 B;  4A4V A;  2ZK5 A;  5L11 A;  2Q59 B;  3OZ0 A;  1YA3 A;  2P1T A;  5KRA A;  3CWD A;  2P4Y A;  3G9E A;  4FHI A;  4OJ4 A;  2QA8 A;  3K23 A;  5KRL A;  5DSH A;  5DZI A;  5KR9 A;  3A9E A;  3L0J A;  2HB7 A;  5KD9 A;  4ZN7 A;  2NXX E;  5DUE A;  2YHD A;  2Q61 A;  4WHG A;  2PIP L;  4IS8 A;  5C4O A;  4KZM A;  2AX6 A;  5KRO A;  1OSV A;  1T73 A;  2AA5 A;  4RZG A;  5CJ6 A;  4YMQ A;  2I4Z A;  1KKQ A;  2R40 A;  1XV9 B;  4NB6 A;  5H1E A;  3RY9 A;  1RJK A;  5SYZ A;  2HVC A;  2XYX A;  4MG6 A;  4CI4 A;  5DID A;  3M7R A;  3V4A A;  3L0E A;  4YT1 A;  5C4S A;  4LBD A;  4XT9 A;  1EXX A;  3VT4 A;  5KCF A;  2JF9 A;  4XHD A;  1XLS E;  3F5C A;  3CS4 A;  2H79 A;  3X31 A;  5DIG A;  2ABI A;  1XP9 A;  2GTK A;  3B0W A;  4ITF A;  1NRL A;  3VSO A;  5DXR A;  5DRM A;  5DWE A;  2P7G A;  3JZC A;  4LNW A;  2QGW A;  1Q4X A;  4IA7 A;  4IVY A;  4OH5 A;  2R6W A;  2ZNP A;  3E94 A;  5DXQ A;  2AA2 A;  3R8A A;  2ZVT A;  2OUZ A;  5ETH A;  4OJ9 A;  1KNU A;  5E1C A;  3KPZ A;  1XDK B;  1S0Z A;  3KFC A;  3A2J A;  3OOF A;  2J7Y A;  1G5Y A;  3ZRA A;  2QE4 A;  1PRG A;  2QMV A;  2P15 A;  2R40 D;  5HCV A;  2QZO B;  4CSJ A;  3B67 A;  5EIT A;  5ACC A;  2PIQ A;  5FQP A;  1T79 A;  1N46 A;  3L0L A;  2ZK1 A;  4OFR A;  4TV1 A;  3RVF A;  5LGA A;  3DR1 A;  5KCW A;  1QKT A;  1YOW A;  4MGB A;  3OMQ A;  3PCU A;  2J7X A;  5DXB B;  1Y0X X;  1NYX A;  2ZXZ A;  2G44 A;  5JJM A;  4J5W C;  4Y29 A;  3L1B A;  4YPQ A;  1YP0 A;  2JFA A;  3ZQT A;  4J24 A;  5L7H A;  1XNX A;  3SZ1 A;  3MNP A;  4PXM A;  2HAR A;  3B68 A;  4OGH A;  1RKG A;  3WFG A;  1XZX X;  5HJP B;  3VT9 A;  2YAT A;  3WWR A;  1ZDU A;  2Q7L A;  5JI0 D;  3TKM A;  4BCR A;  3VHW A;  3D5F A;  4E4K A;  3WFF A;  1LBD A;  5GT4 A;  2GPV A;  4ITE A;  1K74 A;  4IVW A;  1I38 A;  3VJI A;  2ZK6 A;  3FXV A;  3OKH A;  2REW A;  2I0G A;  5IZ0 A;  3OMP A;  4OED A;  3T03 A;  2PIT A;  2HC4 A;  1S19 A;  3N00 A;  2ZFX A;  3VHU A;  2BJ4 A;  2POG A;  4OKX A;  4JYG A;  1X7J A;  5DXE A;  4ZJR A;  4NQA B;  2AA7 A;  4K4J A;  4RUP A;  5KCC A;  1ERR A;  3IA6 A;  2AXA A;  3IXP A;  4O8F A;  5DKE A;  5KCT A;  2PIX A;  1H9U A;  1NQ1 A;  3OLS A;  3W0J A;  4WPF A;  5L7E A;  3E00 A;  4LTW A;  5DYB A;  5DMC A;  5B41 A;  5B5B A;  3HVL A;  1GWR A;  3DY6 A;  1PQ9 A;  4K7A A;  3CS6 A;  4DOR A;  1T7F A;  2O4J A;  3AFR A;  4S0S A;  5G46 A;  3G8O A;  5HZC A;  4IA3 A;  1T76 A;  3Q95 A;  3PO9 A;  1XIU A;  5DWI A;  4OHA A;  2AA6 A;  1ZDT A;  2YFE A;  5EHJ A;  1XLS A;  3ET3 A;  3O1E A;  3OLL A;  3VT5 A;  1XVP B;  2ZAS A;  1X7E A;  2JJ3 A;  2VST A;  4OEA A;  3VRW A;  4P6X A;  1U3Q A;  3OS8 C;  1S0X A;  4XTA A;  2IHQ A;  2VV1 B;  4OFU A;  4R6S A;  3VN2 A;  1GWX A;  3DCU A;  3RUU A;  3VT7 A;  2Q60 A;  2AX9 A;  4B7W A;  4MG7 B;  3D57 A;  1OVL A;  2QGT A;  1NQ2 A;  3HQ5 A;  4P6W A;  5E7V A;  5AAV A;  3X36 A;  2OCF A;  2ZXN A;  3K8S A;  1NQ7 A; 
#chains in the Genus database with same CATH topology
 3IXP D;  3B0R A;  1QKU A;  2ZBS A;  4ZNV A;  3W0A A;  3VI8 A;  4PRG A;  2AWH A;  4J5W A;  4REF A;  2Q1V A;  1QKM A;  3H52 A;  5KRM A;  5APH A;  4TUZ A;  5DK9 A;  5DI7 A;  3ERT A;  3B65 A;  1XQ3 A;  2P54 A;  3ADV A;  3OGT A;  3W0Y A;  1T7R A;  1G50 A;  2AX8 A;  3VT3 A;  4A2J A;  4ZI1 A;  4EM9 A;  1MVC A;  2GPP A;  3A2I A;  4PP6 A;  3BEJ A;  1Z5X E;  1NAX A;  1X76 A;  4ZNS A;  4HEE X;  4F9M A;  4OAR A;  5DYD A;  1RKH A;  2Q6S A;  3AUR A;  3FAL A;  1PQC A;  5KRC A;  1Z95 A;  3F7D A;  2G5O A;  2GP7 A;  2QTU A;  3ADS A;  5APK A;  3L03 A;  3W0H A;  3DZU D;  1ZGY A;  2H77 A;  3B0Q A;  1NDE A;  3GYU A;  1OVL B;  4N1Y A;  4ZNU A;  5KRJ A;  5DX3 B;  4M8H A;  3IPU A;  5KRI A;  2ZK0 A;  1U3S A;  1RK3 A;  1VJB A;  3IPQ A;  3LBD A;  5AK2 A;  2Q7K A;  1G2N A;  4REE A;  4RFW A;  4DM6 A;  3P89 A;  4XAO A;  2HB8 A;  1T7T A;  4JGV A;  1IE9 A;  1FCX A;  1A52 A;  4J5X A;  4G20 A;  1X7B A;  1T65 A;  4UDB A;  1PQ6 A;  2POB A;  4TUZ B;  2ZMH A;  3GYT A;  5EC9 A;  4OIU A;  4QL8 A;  2YJD A;  1GS4 A;  2Q7J A;  5KCD A;  2B1V A;  2VV0 A;  2YLQ A;  4IA1 A;  5DVV A;  1FCY A;  3HOD A;  4IWC A;  3KMZ A;  1LV2 A;  3A3Z X;  3R5M A;  3CDS A;  3NSP A;  4MG9 A;  1TFC A;  2Q6J A;  5DVS A;  3GN8 A;  4YNK A;  2QA8 B;  3E7C A;  2QSE A;  5DU5 A;  1U9E A;  4OLM A;  1ZUC A;  2XYJ A;  3A9E B;  3OOK A;  3K22 A;  4A4W A;  4ZN9 A;  3QT0 A;  3OS8 A;  3DZY D;  4G1Y A;  2PIW A;  3WT6 A;  1M13 A;  1SR7 A;  2P1V A;  3DT3 A;  1Z5X U;  4DM8 A;  4L98 A;  4G1Z A;  3ILZ A;  2Q3Y A;  2Q8S A;  1K4W A;  2QH6 A;  3OLF A;  3KDT A;  3R5N A;  3OKI A;  5L7G A;  3ADW A;  4G21 A;  3OAP A;  5IAW A;  1U3R A;  1YY4 A;  3K6P A;  4J26 A;  2B50 A;  2P1U A;  1FM9 D;  2AB2 A;  5DV6 A;  3F5C B;  2J4A A;  2ZNO A;  4EMA A;  3VSP A;  4ZOM A;  1KV6 A;  3KMG A;  4QE6 A;  4PLE A;  4IV2 A;  5DXK A;  3VT6 A;  4K6I A;  4MG9 B;  5DL4 A;  3WJ4 A;  4DQM A;  2FVJ A;  3G8I A;  5G5W A;  3VTC A;  4UDD A;  3U9Q A;  3WGP A;  3OMM A;  3GZ9 A;  2ZK3 A;  4S15 A;  5LWP A;  2IOG A;  3D6D A;  4HLW A;  5DXP A;  3R2A A;  4L96 A;  3V9V A;  2QAB A;  3H0A D;  4RUO X;  2GPO A;  2Q70 A;  4MGA A;  4RZF A;  3UUC A;  5DKS A;  3AZ2 A;  3ZR7 A;  2ZNN A;  2ZK2 A;  1R20 D;  5HYR A;  4TV1 B;  4FHH A;  1QKN A;  2VV4 A;  4N5G A;  3SP9 A;  3FEI A;  5DVC A;  4MGB B;  2Q1H A;  3UP0 A;  3RUT A;  1HJ1 A;  3W5P A;  1RDT A;  3ADT A;  4J5X C;  1XNN A;  5DWJ A;  1FBY A;  3VTD A;  3X1I A;  4E4Q A;  5JJM B;  2JFA B;  2QXS A;  3R29 A;  2ZKC A;  3HZF A;  1A28 A;  2ACL A;  4QK4 A;  3ERD A;  4N73 A;  2ZMJ A;  4ZO1 X;  5A86 A;  2PIR A;  3FUG A;  1UHL A;  4MGD A;  2OM9 A;  5G43 A;  3SP6 A;  1ILH A;  4POH A;  4POJ A;  5KCE A;  3TX7 B;  3WT5 A;  3ET2 A;  4MG8 A;  2HAS A;  4ZNW A;  4XI3 A;  5E0X A;  3OMK A;  4IW6 A;  4S14 A;  5G3J A;  2O4R A;  3VRU A;  4QJR A;  1XJ7 A;  4MGA B;  2LBD A;  3P0U A;  2ATH A;  2PIO A;  1X78 A;  4R06 A;  1L2J A;  2YJA B;  3B66 A;  2PRG A;  3PLZ A;  4Q13 A;  5E0W A;  5KYJ A;  3CS8 A;  3WTQ A;  2BJ4 B;  3DZU A;  1T63 A;  1SKX A;  4DMA A;  2PKL A;  2ZK4 A;  1NHZ A;  4RMD A;  1PK5 A;  1P8D A;  1I7I A;  3IMY A;  4UDA A;  3UVV A;  1RDT D;  2QPY A;  1MZN A;  2YLO A;  3AN3 A;  3D24 A;  3HC5 A;  4G2I A;  5DIE A;  1UPV A;  1YMT A;  2ZLA A;  5G44 A;  2AMA A;  2IOK A;  2YLP A;  2PNU A;  2Z4B A;  2VV3 A;  3UU7 A;  5K13 A;  3UUD A;  5DZ3 A;  4CI5 A;  3FC6 A;  3FLI A;  1PCG A;  4RE8 A;  4UDC A;  3BC5 A;  2Q59 A;  5E15 A;  1ILG A;  5DUH A;  4MDD A;  4ZJW A;  1XPC A;  1YIM A;  4OEZ A;  5DTV A;  1R1K A;  3D90 A;  3Q95 B;  4WHF A;  2ZXM A;  2XHS A;  3VRT A;  3NOA A;  3WMH A;  3OSW A;  1YJE A;  3B3K A;  3ET1 A;  3V9Y A;  3HC6 A;  3VHV A;  3ADX A;  5DKB A;  1PZL A;  2B23 A;  5AWJ A;  2PIU A;  4OIV A;  3HM1 A;  1XB7 A;  3PRG A;  2QXM A;  4XUH A;  1XV9 A;  1OSH A;  3UP3 A;  2GWX A;  4JAZ A;  3DZY A;  5AAV B;  5FQV A;  5EJV A;  3R8D A;  5EGV A;  5AYG A;  3ET0 A;  5ICK A;  2AYR A;  2AMB A;  1T5Z A;  1ZAF A;  2HAM A;  5DP0 A;  4NUF A;  4OKT A;  3UU7 B;  3W5T A;  1M7W A;  3X1H A;  3VJT A;  3UUD B;  3IPS A;  5DUG A;  3A2H A;  2NV7 A;  3R8I A;  1Y0S A;  2V0V A;  4OZR E;  3AX8 A;  3P8X A;  3W5R A;  4OZT E;  1R1K D;  1FM9 A;  5DZ0 A;  2Q5G A;  2HFP A;  3OMO A;  2I4P A;  4DK8 A;  2HCD A;  2AM9 A;  5DMF A;  2G0H A;  1N83 A;  1XDK A;  5E14 A;  5DWL A;  3CDP A;  2PIV A;  3BQD A;  3FAL B;  1SJ0 A;  3LMP A;  4KZJ A;  3VJH A;  3OS9 A;  4QM0 A;  2QZO A;  5AWK A;  4PLD A;  4MGC A;  2FSZ A;  4XUM A;  2J14 A;  3OZJ A;  2R6Y A;  2ZMI A;  2GPU A;  2I4J A;  3G0W A;  4S0T A;  3H0A A;  3CLD A;  4Q50 A;  1XP6 A;  5DXB A;  1MV9 A;  5HYK A;  5KRK A;  2AAX A;  5GIC A;  1M2Z A;  3CTB A;  1YIN A;  3AZ3 A;  1R20 A;  1OT7 A;  1NUO A;  5KRF A;  4DOS A;  1PDU A;  1UOM A;  5DY8 A;  4FN9 A;  1HG4 A;  4RUJ A;  4M8E A;  3V49 A;  2BAW A;  2Z4J A;  3CQV A;  1XQC A;  4FNE A;  5HJP A;  5KCU A;  1FCZ A;  4OKW A;  3V9T A;  1K7L A;  3W5Q A;  5EI1 A;  3KWY A;  2GIU A;  3AZ1 A;  3L3Z A;  4R2U A;  1N4H A;  5C4T A;  2NPA A;  2P7Z A;  4PPP A;  1FD0 A;  3W0G A;  1S9P A;  2OVH A;  1R5K A;  2I0J A;  3O1D A;  3TY0 A;  1NAV A;  4OZR U;  2HWQ A;  3V3E A;  4JL4 A;  5GID A;  4OZT U;  4NY9 A;  3S9S A;  2F4B A;  2FAI A;  3A40 X;  1X7R A;  3W0I A;  5KYA A;  1FM6 A;  5DKG A;  3KDU A;  2EWP A;  3MNE A;  4ZO1 B;  1S9Q A;  3VJS A;  2PJL A;  4JYH A;  3KMR A;  2P7A A;  4E2J A;  4MG5 A;  2ZLC A;  3FUR A;  5DV8 A;  1I37 A;  2QNV A;  3A78 A;  2W8Y A;  2Q5P A;  4RWV A;  1YOK A;  3AUQ A;  4X1G A;  4PPS A;  3KYT A;  2Q6R A;  1ZEO A;  2QW4 A;  5IXK A;  3WJ5 A;  4PP5 A;  4FGY A;  3P88 A;  4Q0A C;  4XLD A;  4G1D A;  4IA2 A;  1R6G A;  1BSX A;  2Q7I A;  1DB1 A;  4IUI A;  4PVU A;  4QE8 A;  2QR9 A;  4X1F A;  5DZ1 A;  4RAK A;  1XOW A;  1XP1 A;  4NIE A;  4WVD A;  4OIL A;  4N8R A;  1I7G A;  2XKW A;  3ADU A;  3DCT A;  3GWS X;  3VT8 A;  5G42 A;  4OKB A;  4OC7 A;  2QA6 A;  2VSR A;  5FQT A;  1SQN A;  1XVP A;  5JY3 A;  1T7M A;  4RZE A;  3FS1 A;  4G2H A;  5E19 A;  1WM0 X;  1UPW A;  5FQS A;  2G0G A;  2VV1 A;  1FM6 D;  5APJ A;  5DXM A;  3GBK A;  4IW8 A;  4MG7 A;  4OK1 A;  5DV3 A;  2NXX A;  3KBA A;  4APU A;  5DXG A;  4IQR A;  2ZY0 A;  4LSJ A;  4ZNT A;  1P93 A;  4ZNH A;  2HBH A;  2VV4 B;  5AZV A;  1DKF A;  3OSA A;  5GIE A;  3HO0 A;  1EXA A;  3B1M A;  4JYI A;  3L3X A;  3RLL A;  5KRH A;  2O9I A;  2VV2 A;  5G45 A;  1G1U A;  4DK7 A;  4IU7 A;  3UUA A;  3MNO A;  2ACL B;  2NW4 A;  5AZT A;  1E3K A;  1Y9R A;  1K74 D;  3HLV A;  1T74 A;  5F9B A;  4RMC A;  1UHL B;  2Q5S A;  4MGD B;  3ZRB A;  5I4V A;  3GD2 A;  5M96 A;  5AVI A;  5AAU A;  2XYW A;  4IV4 A;  2ZNQ A;  5FQR A;  3PEQ A;  3AN4 A;  1ZKY A;  1ERE A;  3B0T A;  4MG8 B;  2GL8 A;  4ONI A;  2E2R A;  1E3G A;  2HWR A;  1YUC A;  5AVL A;  3RLJ A;  4OEY A;  4RME A;  5C4U A;  3VRV A;  1L2I A;  5HJS A;  3VTB A;  3AUN A;  3CJW A;  5DX3 A;  4WLB A;  4PP3 A;  2AX7 A;  3W0C A;  2OVM A;  1TXI A;  3NSQ A;  2B1Z A;  2YLY A;  3FEJ A;  4OH6 A;  4WQP A;  3EYB A;  3OSI A;  4IWF A;  2ZL9 A;  5DWG A;  3GWX A;  4PF3 A;  2A3I A;  1XAP A;  2PIN A;  1DKF B;  5DLR A;  2OAX A;  3PBA A;  3WT7 A;  3E00 D;  3TKC A;  3UVV B;  1IE8 A;  1YYE A;  2V7C A;  4LNX A;  4OJB A;  5DRJ A;  3B5R A;  5DZH A;  1GWQ A;  4PWL A;  3UUA B;  1NQ0 A;  4KZI A;  2OZ7 A;  1ZH7 A;  3JZB A;  2AO6 A;  3V3Q A;  3FC6 B;  4A4V A;  2ZK5 A;  5L11 A;  2Q59 B;  3OZ0 A;  1YA3 A;  2P1T A;  5KRA A;  3CWD A;  2P4Y A;  3G9E A;  4FHI A;  4OJ4 A;  2QA8 A;  3K23 A;  5KRL A;  5DSH A;  5DZI A;  5KR9 A;  3A9E A;  3L0J A;  2HB7 A;  5KD9 A;  4ZN7 A;  2NXX E;  5DUE A;  2YHD A;  2Q61 A;  4WHG A;  2PIP L;  4IS8 A;  5C4O A;  4KZM A;  2AX6 A;  5KRO A;  1OSV A;  1T73 A;  2AA5 A;  4RZG A;  5CJ6 A;  4YMQ A;  2I4Z A;  1KKQ A;  2R40 A;  1XV9 B;  4NB6 A;  5H1E A;  3RY9 A;  1RJK A;  5SYZ A;  2HVC A;  2XYX A;  4MG6 A;  4CI4 A;  5DID A;  3M7R A;  3V4A A;  3L0E A;  4YT1 A;  5C4S A;  4LBD A;  4XT9 A;  1EXX A;  3VT4 A;  5KCF A;  2JF9 A;  4XHD A;  1XLS E;  3F5C A;  3CS4 A;  2H79 A;  3X31 A;  5DIG A;  2ABI A;  1XP9 A;  2GTK A;  3B0W A;  4ITF A;  1NRL A;  3VSO A;  5DXR A;  5DRM A;  5DWE A;  2P7G A;  3JZC A;  4LNW A;  2QGW A;  1Q4X A;  4IA7 A;  4IVY A;  4OH5 A;  2R6W A;  2ZNP A;  3E94 A;  5DXQ A;  2AA2 A;  3R8A A;  2ZVT A;  2OUZ A;  5ETH A;  4OJ9 A;  1KNU A;  5E1C A;  3KPZ A;  1XDK B;  1S0Z A;  3KFC A;  3A2J A;  3OOF A;  2J7Y A;  1G5Y A;  3ZRA A;  2QE4 A;  1PRG A;  2QMV A;  2P15 A;  2R40 D;  5HCV A;  2QZO B;  4CSJ A;  3B67 A;  5EIT A;  5ACC A;  2PIQ A;  5FQP A;  1T79 A;  1N46 A;  3L0L A;  2ZK1 A;  4OFR A;  4TV1 A;  3RVF A;  5LGA A;  3DR1 A;  5KCW A;  1QKT A;  1YOW A;  4MGB A;  3OMQ A;  3PCU A;  2J7X A;  5DXB B;  1Y0X X;  1NYX A;  2ZXZ A;  2G44 A;  5JJM A;  4J5W C;  4Y29 A;  3L1B A;  4YPQ A;  1YP0 A;  2JFA A;  3ZQT A;  4J24 A;  5L7H A;  1XNX A;  3SZ1 A;  3MNP A;  4PXM A;  2HAR A;  3B68 A;  4OGH A;  1RKG A;  3WFG A;  1XZX X;  5HJP B;  3VT9 A;  2YAT A;  3WWR A;  1ZDU A;  2Q7L A;  5JI0 D;  3TKM A;  4BCR A;  3VHW A;  3D5F A;  4E4K A;  3WFF A;  1LBD A;  5GT4 A;  2GPV A;  4ITE A;  1K74 A;  4IVW A;  1I38 A;  3VJI A;  2ZK6 A;  3FXV A;  3OKH A;  2REW A;  2I0G A;  5IZ0 A;  3OMP A;  4OED A;  3T03 A;  2PIT A;  2HC4 A;  1S19 A;  3N00 A;  2ZFX A;  3VHU A;  2BJ4 A;  2POG A;  4OKX A;  4JYG A;  1X7J A;  5DXE A;  4ZJR A;  4NQA B;  2AA7 A;  4K4J A;  4RUP A;  5KCC A;  1ERR A;  3IA6 A;  2AXA A;  3IXP A;  4O8F A;  5DKE A;  5KCT A;  2PIX A;  1H9U A;  1NQ1 A;  3OLS A;  3W0J A;  4WPF A;  5L7E A;  3E00 A;  4LTW A;  5DYB A;  5DMC A;  5B41 A;  5B5B A;  3HVL A;  1GWR A;  3DY6 A;  1PQ9 A;  4K7A A;  3CS6 A;  4DOR A;  1T7F A;  2O4J A;  3AFR A;  4S0S A;  5G46 A;  3G8O A;  5HZC A;  4IA3 A;  1T76 A;  3Q95 A;  3PO9 A;  1XIU A;  5DWI A;  4OHA A;  2AA6 A;  1ZDT A;  2YFE A;  5EHJ A;  1XLS A;  3ET3 A;  3O1E A;  3OLL A;  3VT5 A;  1XVP B;  2ZAS A;  1X7E A;  2JJ3 A;  2VST A;  4OEA A;  3VRW A;  4P6X A;  1U3Q A;  3OS8 C;  1S0X A;  4XTA A;  2IHQ A;  2VV1 B;  4OFU A;  4R6S A;  3VN2 A;  1GWX A;  3DCU A;  3RUU A;  3VT7 A;  2Q60 A;  2AX9 A;  4B7W A;  4MG7 B;  3D57 A;  1OVL A;  2QGT A;  1NQ2 A;  3HQ5 A;  4P6W A;  5E7V A;  5AAV A;  3X36 A;  2OCF A;  2ZXN A;  3K8S A;  1NQ7 A; 
#chains in the Genus database with same CATH homology
 3IXP D;  3B0R A;  1QKU A;  2ZBS A;  4ZNV A;  3W0A A;  3VI8 A;  4PRG A;  2AWH A;  4J5W A;  4REF A;  2Q1V A;  1QKM A;  3H52 A;  5KRM A;  5APH A;  4TUZ A;  5DK9 A;  5DI7 A;  3ERT A;  3B65 A;  1XQ3 A;  2P54 A;  3ADV A;  3OGT A;  3W0Y A;  1T7R A;  1G50 A;  2AX8 A;  3VT3 A;  4A2J A;  4ZI1 A;  4EM9 A;  1MVC A;  2GPP A;  3A2I A;  4PP6 A;  3BEJ A;  1Z5X E;  1NAX A;  1X76 A;  4ZNS A;  4HEE X;  4F9M A;  4OAR A;  5DYD A;  1RKH A;  2Q6S A;  3AUR A;  3FAL A;  1PQC A;  5KRC A;  1Z95 A;  3F7D A;  2G5O A;  2GP7 A;  2QTU A;  3ADS A;  5APK A;  3L03 A;  3W0H A;  3DZU D;  1ZGY A;  2H77 A;  3B0Q A;  1NDE A;  3GYU A;  1OVL B;  4N1Y A;  4ZNU A;  5KRJ A;  5DX3 B;  4M8H A;  3IPU A;  5KRI A;  2ZK0 A;  1U3S A;  1RK3 A;  1VJB A;  3IPQ A;  3LBD A;  5AK2 A;  2Q7K A;  1G2N A;  4REE A;  4RFW A;  4DM6 A;  3P89 A;  4XAO A;  2HB8 A;  1T7T A;  4JGV A;  1IE9 A;  1FCX A;  1A52 A;  4J5X A;  4G20 A;  1X7B A;  1T65 A;  4UDB A;  1PQ6 A;  2POB A;  4TUZ B;  2ZMH A;  3GYT A;  5EC9 A;  4OIU A;  4QL8 A;  2YJD A;  1GS4 A;  2Q7J A;  5KCD A;  2B1V A;  2VV0 A;  2YLQ A;  4IA1 A;  5DVV A;  1FCY A;  3HOD A;  4IWC A;  3KMZ A;  1LV2 A;  3A3Z X;  3R5M A;  3CDS A;  3NSP A;  4MG9 A;  1TFC A;  2Q6J A;  5DVS A;  3GN8 A;  4YNK A;  2QA8 B;  3E7C A;  2QSE A;  5DU5 A;  1U9E A;  4OLM A;  1ZUC A;  2XYJ A;  3A9E B;  3OOK A;  3K22 A;  4A4W A;  4ZN9 A;  3QT0 A;  3OS8 A;  3DZY D;  4G1Y A;  2PIW A;  3WT6 A;  1M13 A;  1SR7 A;  2P1V A;  3DT3 A;  1Z5X U;  4DM8 A;  4L98 A;  4G1Z A;  3ILZ A;  2Q3Y A;  2Q8S A;  1K4W A;  2QH6 A;  3OLF A;  3KDT A;  3R5N A;  3OKI A;  5L7G A;  3ADW A;  4G21 A;  3OAP A;  5IAW A;  1U3R A;  1YY4 A;  3K6P A;  4J26 A;  2B50 A;  2P1U A;  1FM9 D;  2AB2 A;  5DV6 A;  3F5C B;  2J4A A;  2ZNO A;  4EMA A;  3VSP A;  4ZOM A;  1KV6 A;  3KMG A;  4QE6 A;  4PLE A;  4IV2 A;  5DXK A;  3VT6 A;  4K6I A;  4MG9 B;  5DL4 A;  3WJ4 A;  4DQM A;  2FVJ A;  3G8I A;  5G5W A;  3VTC A;  4UDD A;  3U9Q A;  3WGP A;  3OMM A;  3GZ9 A;  2ZK3 A;  4S15 A;  5LWP A;  2IOG A;  3D6D A;  4HLW A;  5DXP A;  3R2A A;  4L96 A;  3V9V A;  2QAB A;  3H0A D;  4RUO X;  2GPO A;  2Q70 A;  4MGA A;  4RZF A;  3UUC A;  5DKS A;  3AZ2 A;  3ZR7 A;  2ZNN A;  2ZK2 A;  1R20 D;  5HYR A;  4TV1 B;  4FHH A;  1QKN A;  2VV4 A;  4N5G A;  3SP9 A;  3FEI A;  5DVC A;  4MGB B;  2Q1H A;  3UP0 A;  3RUT A;  1HJ1 A;  3W5P A;  1RDT A;  3ADT A;  4J5X C;  1XNN A;  5DWJ A;  1FBY A;  3VTD A;  3X1I A;  4E4Q A;  5JJM B;  2JFA B;  2QXS A;  3R29 A;  2ZKC A;  3HZF A;  1A28 A;  2ACL A;  4QK4 A;  3ERD A;  4N73 A;  2ZMJ A;  4ZO1 X;  5A86 A;  2PIR A;  3FUG A;  1UHL A;  4MGD A;  2OM9 A;  5G43 A;  3SP6 A;  1ILH A;  4POH A;  4POJ A;  5KCE A;  3TX7 B;  3WT5 A;  3ET2 A;  4MG8 A;  2HAS A;  4ZNW A;  4XI3 A;  5E0X A;  3OMK A;  4IW6 A;  4S14 A;  5G3J A;  2O4R A;  3VRU A;  4QJR A;  1XJ7 A;  4MGA B;  2LBD A;  3P0U A;  2ATH A;  2PIO A;  1X78 A;  4R06 A;  1L2J A;  2YJA B;  3B66 A;  2PRG A;  3PLZ A;  4Q13 A;  5E0W A;  5KYJ A;  3CS8 A;  3WTQ A;  2BJ4 B;  3DZU A;  1T63 A;  1SKX A;  4DMA A;  2PKL A;  2ZK4 A;  1NHZ A;  4RMD A;  1PK5 A;  1P8D A;  1I7I A;  3IMY A;  4UDA A;  3UVV A;  1RDT D;  2QPY A;  1MZN A;  2YLO A;  3AN3 A;  3D24 A;  3HC5 A;  4G2I A;  5DIE A;  1UPV A;  1YMT A;  2ZLA A;  5G44 A;  2AMA A;  2IOK A;  2YLP A;  2PNU A;  2Z4B A;  2VV3 A;  3UU7 A;  5K13 A;  3UUD A;  5DZ3 A;  4CI5 A;  3FC6 A;  3FLI A;  1PCG A;  4RE8 A;  4UDC A;  3BC5 A;  2Q59 A;  5E15 A;  1ILG A;  5DUH A;  4MDD A;  4ZJW A;  1XPC A;  1YIM A;  4OEZ A;  5DTV A;  1R1K A;  3D90 A;  3Q95 B;  4WHF A;  2ZXM A;  2XHS A;  3VRT A;  3NOA A;  3WMH A;  3OSW A;  1YJE A;  3B3K A;  3ET1 A;  3V9Y A;  3HC6 A;  3VHV A;  3ADX A;  5DKB A;  1PZL A;  2B23 A;  5AWJ A;  2PIU A;  4OIV A;  3HM1 A;  1XB7 A;  3PRG A;  2QXM A;  4XUH A;  1XV9 A;  1OSH A;  3UP3 A;  2GWX A;  4JAZ A;  3DZY A;  5AAV B;  5FQV A;  5EJV A;  3R8D A;  5EGV A;  5AYG A;  3ET0 A;  5ICK A;  2AYR A;  2AMB A;  1T5Z A;  1ZAF A;  2HAM A;  5DP0 A;  4NUF A;  4OKT A;  3UU7 B;  3W5T A;  1M7W A;  3X1H A;  3VJT A;  3UUD B;  3IPS A;  5DUG A;  3A2H A;  2NV7 A;  3R8I A;  1Y0S A;  2V0V A;  4OZR E;  3AX8 A;  3P8X A;  3W5R A;  4OZT E;  1R1K D;  1FM9 A;  5DZ0 A;  2Q5G A;  2HFP A;  3OMO A;  2I4P A;  4DK8 A;  2HCD A;  2AM9 A;  5DMF A;  2G0H A;  1N83 A;  1XDK A;  5E14 A;  5DWL A;  3CDP A;  2PIV A;  3BQD A;  3FAL B;  1SJ0 A;  3LMP A;  4KZJ A;  3VJH A;  3OS9 A;  4QM0 A;  2QZO A;  5AWK A;  4PLD A;  4MGC A;  2FSZ A;  4XUM A;  2J14 A;  3OZJ A;  2R6Y A;  2ZMI A;  2GPU A;  2I4J A;  3G0W A;  4S0T A;  3H0A A;  3CLD A;  4Q50 A;  1XP6 A;  5DXB A;  1MV9 A;  5HYK A;  5KRK A;  2AAX A;  5GIC A;  1M2Z A;  3CTB A;  1YIN A;  3AZ3 A;  1R20 A;  1OT7 A;  1NUO A;  5KRF A;  4DOS A;  1PDU A;  1UOM A;  5DY8 A;  4FN9 A;  1HG4 A;  4RUJ A;  4M8E A;  3V49 A;  2BAW A;  2Z4J A;  3CQV A;  1XQC A;  4FNE A;  5HJP A;  5KCU A;  1FCZ A;  4OKW A;  3V9T A;  1K7L A;  3W5Q A;  5EI1 A;  3KWY A;  2GIU A;  3AZ1 A;  3L3Z A;  4R2U A;  1N4H A;  5C4T A;  2NPA A;  2P7Z A;  4PPP A;  1FD0 A;  3W0G A;  1S9P A;  2OVH A;  1R5K A;  2I0J A;  3O1D A;  3TY0 A;  1NAV A;  4OZR U;  2HWQ A;  3V3E A;  4JL4 A;  5GID A;  4OZT U;  4NY9 A;  3S9S A;  2F4B A;  2FAI A;  3A40 X;  1X7R A;  3W0I A;  5KYA A;  1FM6 A;  5DKG A;  3KDU A;  2EWP A;  3MNE A;  4ZO1 B;  1S9Q A;  3VJS A;  2PJL A;  4JYH A;  3KMR A;  2P7A A;  4E2J A;  4MG5 A;  2ZLC A;  3FUR A;  5DV8 A;  1I37 A;  2QNV A;  3A78 A;  2W8Y A;  2Q5P A;  4RWV A;  1YOK A;  3AUQ A;  4X1G A;  4PPS A;  3KYT A;  2Q6R A;  1ZEO A;  2QW4 A;  5IXK A;  3WJ5 A;  4PP5 A;  4FGY A;  3P88 A;  4Q0A C;  4XLD A;  4G1D A;  4IA2 A;  1R6G A;  1BSX A;  2Q7I A;  1DB1 A;  4IUI A;  4PVU A;  4QE8 A;  2QR9 A;  4X1F A;  5DZ1 A;  4RAK A;  1XOW A;  1XP1 A;  4NIE A;  4WVD A;  4OIL A;  4N8R A;  1I7G A;  2XKW A;  3ADU A;  3DCT A;  3GWS X;  3VT8 A;  5G42 A;  4OKB A;  4OC7 A;  2QA6 A;  2VSR A;  5FQT A;  1SQN A;  1XVP A;  5JY3 A;  1T7M A;  4RZE A;  3FS1 A;  4G2H A;  5E19 A;  1WM0 X;  1UPW A;  5FQS A;  2G0G A;  2VV1 A;  1FM6 D;  5APJ A;  5DXM A;  3GBK A;  4IW8 A;  4MG7 A;  4OK1 A;  5DV3 A;  2NXX A;  3KBA A;  4APU A;  5DXG A;  4IQR A;  2ZY0 A;  4LSJ A;  4ZNT A;  1P93 A;  4ZNH A;  2HBH A;  2VV4 B;  5AZV A;  1DKF A;  3OSA A;  5GIE A;  3HO0 A;  1EXA A;  3B1M A;  4JYI A;  3L3X A;  3RLL A;  5KRH A;  2O9I A;  2VV2 A;  5G45 A;  1G1U A;  4DK7 A;  4IU7 A;  3UUA A;  3MNO A;  2ACL B;  2NW4 A;  5AZT A;  1E3K A;  1Y9R A;  1K74 D;  3HLV A;  1T74 A;  5F9B A;  4RMC A;  1UHL B;  2Q5S A;  4MGD B;  3ZRB A;  5I4V A;  3GD2 A;  5M96 A;  5AVI A;  5AAU A;  2XYW A;  4IV4 A;  2ZNQ A;  5FQR A;  3PEQ A;  3AN4 A;  1ZKY A;  1ERE A;  3B0T A;  4MG8 B;  2GL8 A;  4ONI A;  2E2R A;  1E3G A;  2HWR A;  1YUC A;  5AVL A;  3RLJ A;  4OEY A;  4RME A;  5C4U A;  3VRV A;  1L2I A;  5HJS A;  3VTB A;  3AUN A;  3CJW A;  5DX3 A;  4WLB A;  4PP3 A;  2AX7 A;  3W0C A;  2OVM A;  1TXI A;  3NSQ A;  2B1Z A;  2YLY A;  3FEJ A;  4OH6 A;  4WQP A;  3EYB A;  3OSI A;  4IWF A;  2ZL9 A;  5DWG A;  3GWX A;  4PF3 A;  2A3I A;  1XAP A;  2PIN A;  1DKF B;  5DLR A;  2OAX A;  3PBA A;  3WT7 A;  3E00 D;  3TKC A;  3UVV B;  1IE8 A;  1YYE A;  2V7C A;  4LNX A;  4OJB A;  5DRJ A;  3B5R A;  5DZH A;  1GWQ A;  4PWL A;  3UUA B;  1NQ0 A;  4KZI A;  2OZ7 A;  1ZH7 A;  3JZB A;  2AO6 A;  3V3Q A;  3FC6 B;  4A4V A;  2ZK5 A;  5L11 A;  2Q59 B;  3OZ0 A;  1YA3 A;  2P1T A;  5KRA A;  3CWD A;  2P4Y A;  3G9E A;  4FHI A;  4OJ4 A;  2QA8 A;  3K23 A;  5KRL A;  5DSH A;  5DZI A;  5KR9 A;  3A9E A;  3L0J A;  2HB7 A;  5KD9 A;  4ZN7 A;  2NXX E;  5DUE A;  2YHD A;  2Q61 A;  4WHG A;  2PIP L;  4IS8 A;  5C4O A;  4KZM A;  2AX6 A;  5KRO A;  1OSV A;  1T73 A;  2AA5 A;  4RZG A;  5CJ6 A;  4YMQ A;  2I4Z A;  1KKQ A;  2R40 A;  1XV9 B;  4NB6 A;  5H1E A;  3RY9 A;  1RJK A;  5SYZ A;  2HVC A;  2XYX A;  4MG6 A;  4CI4 A;  5DID A;  3M7R A;  3V4A A;  3L0E A;  4YT1 A;  5C4S A;  4LBD A;  4XT9 A;  1EXX A;  3VT4 A;  5KCF A;  2JF9 A;  4XHD A;  1XLS E;  3F5C A;  3CS4 A;  2H79 A;  3X31 A;  5DIG A;  2ABI A;  1XP9 A;  2GTK A;  3B0W A;  4ITF A;  1NRL A;  3VSO A;  5DXR A;  5DRM A;  5DWE A;  2P7G A;  3JZC A;  4LNW A;  2QGW A;  1Q4X A;  4IA7 A;  4IVY A;  4OH5 A;  2R6W A;  2ZNP A;  3E94 A;  5DXQ A;  2AA2 A;  3R8A A;  2ZVT A;  2OUZ A;  5ETH A;  4OJ9 A;  1KNU A;  5E1C A;  3KPZ A;  1XDK B;  1S0Z A;  3KFC A;  3A2J A;  3OOF A;  2J7Y A;  1G5Y A;  3ZRA A;  2QE4 A;  1PRG A;  2QMV A;  2P15 A;  2R40 D;  5HCV A;  2QZO B;  4CSJ A;  3B67 A;  5EIT A;  5ACC A;  2PIQ A;  5FQP A;  1T79 A;  1N46 A;  3L0L A;  2ZK1 A;  4OFR A;  4TV1 A;  3RVF A;  5LGA A;  3DR1 A;  5KCW A;  1QKT A;  1YOW A;  4MGB A;  3OMQ A;  3PCU A;  2J7X A;  5DXB B;  1Y0X X;  1NYX A;  2ZXZ A;  2G44 A;  5JJM A;  4J5W C;  4Y29 A;  3L1B A;  4YPQ A;  1YP0 A;  2JFA A;  3ZQT A;  4J24 A;  5L7H A;  1XNX A;  3SZ1 A;  3MNP A;  4PXM A;  2HAR A;  3B68 A;  4OGH A;  1RKG A;  3WFG A;  1XZX X;  5HJP B;  3VT9 A;  2YAT A;  3WWR A;  1ZDU A;  2Q7L A;  5JI0 D;  3TKM A;  4BCR A;  3VHW A;  3D5F A;  4E4K A;  3WFF A;  1LBD A;  5GT4 A;  2GPV A;  4ITE A;  1K74 A;  4IVW A;  1I38 A;  3VJI A;  2ZK6 A;  3FXV A;  3OKH A;  2REW A;  2I0G A;  5IZ0 A;  3OMP A;  4OED A;  3T03 A;  2PIT A;  2HC4 A;  1S19 A;  3N00 A;  2ZFX A;  3VHU A;  2BJ4 A;  2POG A;  4OKX A;  4JYG A;  1X7J A;  5DXE A;  4ZJR A;  4NQA B;  2AA7 A;  4K4J A;  4RUP A;  5KCC A;  1ERR A;  3IA6 A;  2AXA A;  3IXP A;  4O8F A;  5DKE A;  5KCT A;  2PIX A;  1H9U A;  1NQ1 A;  3OLS A;  3W0J A;  4WPF A;  5L7E A;  3E00 A;  4LTW A;  5DYB A;  5DMC A;  5B41 A;  5B5B A;  3HVL A;  1GWR A;  3DY6 A;  1PQ9 A;  4K7A A;  3CS6 A;  4DOR A;  1T7F A;  2O4J A;  3AFR A;  4S0S A;  5G46 A;  3G8O A;  5HZC A;  4IA3 A;  1T76 A;  3Q95 A;  3PO9 A;  1XIU A;  5DWI A;  4OHA A;  2AA6 A;  1ZDT A;  2YFE A;  5EHJ A;  1XLS A;  3ET3 A;  3O1E A;  3OLL A;  3VT5 A;  1XVP B;  2ZAS A;  1X7E A;  2JJ3 A;  2VST A;  4OEA A;  3VRW A;  4P6X A;  1U3Q A;  3OS8 C;  1S0X A;  4XTA A;  2IHQ A;  2VV1 B;  4OFU A;  4R6S A;  3VN2 A;  1GWX A;  3DCU A;  3RUU A;  3VT7 A;  2Q60 A;  2AX9 A;  4B7W A;  4MG7 B;  3D57 A;  1OVL A;  2QGT A;  1NQ2 A;  3HQ5 A;  4P6W A;  5E7V A;  5AAV A;  3X36 A;  2OCF A;  2ZXN A;  3K8S A;  1NQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...