1PDUA

Ligand-binding domain of drosophila orphan nuclear receptor dhr38
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
230
structure length
230
Chain Sequence
AISLITALVRSHVDTTPDPSCLDYSHYEEQSMSEADKVQQFYQLLTSSVDVIKQFAEKIPGYFDLLPEDQELLFQSASLELFVLRLAYRARIDDTKLIFCNGTVLHRTQCLRSFGEWLNDIMEFSRSLHNLEIDISAFACLCALTLITERHGLREPKKVEQLQMKIIGSLRDHVTYNAEAQKKQHYFSRLLGKLPELRSLSVQGLQRIFYLKLEDLVPAPALIENMFVTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Drosophila orphan nuclear receptor DHR38 mediates an atypical ecdysteroid signaling pathway.
pubmed doi rcsb
molecule keywords nuclear hormone receptor HR38
molecule tags Hormone/growth factor receptor
source organism Drosophila melanogaster
total genus 91
structure length 230
sequence length 230
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 1pduA00
1YY4A 3VT3A 4R2UA 4UDBA 5JJMB 3E94A 1VJBA 5DVSA 4OLMA 3W0HA 3W5RA 2HBHA 1ZGYA 5E14A 3F5CA 3VT5A 2F4BA 2ABIA 2VV4A 4G20A 1G1UA 5HJPA 5G43A 4G1YA 2GPOA 2ZY0A 1XNXA 3CS6A 3W5QA 2OM9A 4R06A 3R2AA 4L98A 4MGAB 1T7MA 2I4PA 2PKLA 3A9EA 2QGTA 4IV4A 4NUFA 3UUCA 1L2JA 4K4JA 4UDDA 2Q6SA 1FM6A 3K22A 4DK8A 4F9MA 1S0XA 4WPFA 1FCZA 3OGTA 5C4SA 3KBAA 4QK4A 5DP0A 3IMYA 4S0SA 3AZ2A 4MDDA 3ET0A 3WGPA 1RDTD 4OZTU 4FHIA 3NSPA 3VTBA 3ZQTA 2BJ4A 2VV1B 4Q13A 5DSHA 4XT9A 3VJHA 5DWJA 5L11A 5L7EA 1N83A 3BEJA 3CDPA 1G5YA 1XNNA 3HODA 3AURA 2Q3YA 4IWCA 5APHA 4JGVA 3B5RA 1YUCA 1OT7A 3V4AA 4ZN7A 4RZEA 1NQ7A 4YMQA 1FCXA 2OCFA 1MVCA 3FC6A 2R6YA 3L3ZA 4RZGA 1T76A 5L7HA 5KRHA 4OEZA 5C4UA 3GN8A 1QKUA 1OVLB 2GP7A 4A4WA 1Q4XA 1XDKA 1ILGA 4RMDA 3SP6A 3UP0A 2HWRA 2Q1HA 4WHGA 3GYTA 2B50A 5DXEA 4IVYA 1PCGA 2ACLA 2FAIA 4XUMA 4YPQA 3AUNA 3UUAB 3HLVA 2QSEA 3KPZA 2PNUA 4DOSA 3UVVB 1FM9D 5DV6A 5DTVA 3A78A 1PK5A 3RLLA 3FLIA 2R40A 5DVCA 3V49A 2Q61A 1XP1A 1ZEOA 4HLWA 5KRJA 4RE8A 5JJMA 5E1CA 5DWLA 3WTQA 4NB6A 2ZMJA 4OZRE 3OKIA 1SR7A 4FN9A 5C4TA 2ZASA 1XJ7A 3KMRA 2QW4A 3D24A 2PIOA 3Q95B 1SQNA 1WM0X 3UUDB 4N5GA 3U9QA 3D57A 2AX9A 2PINA 4G21A 3KMZA 5DXGA 1QKNA 2PIUA 3ET2A 5DXQA 4MGAA 4OJ9A 4IA7A 5E7VA 2LBDA 1NUOA 1PZLA 2GWXA 2O9IA 2GL8A 3DZYA 3KWYA 3WMHA 3G9EA 5AAUA 4Q0AC 5DIGA 5KCFA 2YHDA 1ERRA 2PJLA 2VV4B 1ZUCA 2ZXZA 4KZIA 4MG9B 4P6XA 4PP5A 4QL8A 5GIDA 3VHVA 5HJPB 2OUZA 3AZ1A 3VT6A 2V0VA 5AAVA 3R8AA 4K6IA 2VV1A 3PO9A 5KCUA 3B0TA 5DZ3A 4LNXA 3AX8A 4M8EA 2P54A 5KCCA 3DCTA 2AO6A 2YLQA 5SYZA 4N73A 4TV1B 5DU5A 4E2JA 1KNUA 4RFWA 1XQ3A 3S9SA 4OEAA 1XPCA 1YA3A 1LBDA 3VSOA 2AX7A 2O4RA 2PIRA 3A40X 3B1MA 1OVLA 2ATHA 2GTKA 2HASA 3AFRA 4OKXA 4PPPA 5HJSA 2I0JA 3AZ3A 2Q8SA 2AX8A 4OKTA 1K4WA 4ZO1X 3ZRAA 2Q6RA 3L0JA 1G50A 1ZH7A 2ZNQA 2YJAB 3RUUA 2QZOB 3KDUA 1DKFB 4QM0A 5EHJA 2Q7KA 3F7DA 5APKA 1Y0XX 5F9BA 3UUAA 2P1TA 5G3JA 5AVIA 3WJ4A 3VHUA 3H0AD 3UVVA 4OHAA 3VRUA 2B1ZA 5DKBA 4IV2A 1ZAFA 3LMPA 4WHFA 1I7GA 1MZNA 1K7LA 2YFEA 3OLFA 4IA2A 4WVDA 3DZUA 2NPAA 1P93A 4FNEA 5DWIA 4OILA 2Q60A 2ZNNA 3JZCA 5DUEA 2ZNOA 3X36A 3OSWA 1XQCA 2QR9A 5EI1A 3TKMA 3R8IA 1N46A 4UDCA 1LV2A 3WFGA 2HAMA 4LSJA 2QPYA 2I4ZA 1A28A 4KZMA 1NRLA 3OAPA 2JJ3A 5E0WA 4OFUA 1QKTA 4OIVA 3VJTA 3CTBA 3OLSA 2ZBSA 5DIDA 3UP3A 2NXXA 3VJIA 1FBYA 1Y0SA 2XYWA 3H0AA 1MV9A 5IZ0A 1X7BA 1A52A 3ET3A 3P88A 3VT9A 1NAVA 3VHWA 5B5BA 3VN2A 4MGDB 4MG9A 3ADSA 5DXRA 5CJ6A 4QE6A 1UHLB 1T7RA 1PDUA 1R6GA 5DIEA 4L96A 4PF3A 5C4OA 1T65A 1Y9RA 5DYBA 3OMOA 4OKWA 3SZ1A 2QXMA 4OIUA 3R5NA 2BAWA 2XYXA 4PXMA 4XAOA 3MNEA 1SJ0A 2PIQA 4N1YA 2HC4A 5KD9A 4TV1A 2HWQA 1OSVA 4OJ4A 4EM9A 2QNVA 1R1KD 5KYAA 3OS9A 5AAVB 2YATA 5DMCA 4DK7A 2ZK2A 5DZ1A 1EREA 5KCEA 3W5PA 2QZOA 2VSRA 1DKFA 1S0ZA 3B0QA 5DZIA 3FEIA 2FVJA 4IW8A 4XHDA 4LTWA 5HYRA 1S9PA 3W5TA 1Z95A 3RLJA 3AN4A 3HC5A 3TKCA 3WJ5A 1HG4A 1T5ZA 1Z5XE 4BCRA 2ZVTA 3B67A 3PLZA 4IA1A 4X1GA 3KMGA 4IUIA 1UPVA 4DMAA 4E4QA 3R29A 4RUPA 3T03A 3IPQA 2G5OA 3L03A 1G2NA 3FURA 4Q50A 5DKGA 3FS1A 4OH6A 1RDTA 4REFA 1BSXA 3FEJA 1IE9A 1H9UA 2ZXMA 2OVMA 3GWXA 3UU7B 4E4KA 1S9QA 1P8DA 1U3QA 2YLYA 3DT3A 2J7XA 3G0WA 2ZK4A 3IXPD 3OZ0A 4G1ZA 5G46A 2AAXA 4FHHA 2VV0A 5G45A 3H52A 3QT0A 4DORA 4CI5A 5DI7A 3W0YA 2Q7LA 1R20D 4OKBA 2G44A 3FXVA 2Q7JA 1XZXX 5HZCA 1T7FA 1GWRA 4MGDA 3PBAA 1UHLA 2V7CA 3PCUA 2ZFXA 4QE8A 3VRVA 3VTDA 5DV3A 3AN3A 4LBDA 5AVLA 1XLSA 2Q70A 2ZMHA 4ZNUA 3B0WA 2NXXE 4XUHA 5KRCA 2HVCA 1FM9A 3CJWA 3GD2A 4PP3A 3PEQA 1K74D 2I0GA 3CLDA 4OEYA 4A4VA 3ADTA 1ZDTA 4ZO1B 3BC5A 4LNWA 3WT7A 5DXPA 1U3RA 4RAKA 5G5WA 5KCDA 2VSTA 2QA6A 3DZYD 2Q5PA 4RMEA 5KRKA 1TXIA 5DUGA 5ACCA 2YLOA 5K13A 4MG7B 3L0EA 1RJKA 5DWEA 2G0HA 4PP6A 2W8YA 1Z5XU 5AWJA 4OJBA 2AM9A 2O4JA 1X76A 3FALB 4RMCA 3ADXA 4MG5A 3K6PA 2I4JA 4J5XA 4X1FA 1PQCA 5KRMA 1U9EA 2Z4BA 2VV3A 3V3EA 5I4VA 2H77A 2ZK6A 1FCYA 2ZL9A 2PIWA 2NW4A 4J26A 5DKSA 2P4YA 2J14A 1RKGA 3TX7B 2QXSA 5EJVA 5DX3A 3OOKA 4PVUA 1T74A 1XP9A 4MG8B 3A2IA 4QJRA 2AMAA 4KZJA 1XV9A 5DXBB 5HCVA 4OZRU 1ILHA 3UU7A 2JFAB 2OZ7A 1EXXA 1X7JA 4JYHA 4ZNVA 3D6DA 4OK1A 5G44A 2B23A 4M8HA 3RUTA 3A2HA 3GWSX 2PRGA 4OFRA 2AYRA 4IW6A 5DWGA 3G8IA 4NQAB 3GBKA 2IHQA 3OS8C 1YJEA 2AA2A 3RY9A 5DZ0A 4NY9A 2YJDA 5AWKA 3V3QA 1PQ6A 3L1BA 2YLPA 4P6WA 1X7RA 3CWDA 3DCUA 3B65A 3CDSA 1XB7A 4O8FA 3KYTA 3VT7A 4RUOX 3D5FA 2IOGA 1NHZA 4ZNSA 1YIMA 5DVVA 3W0AA 3ZRBA 5KCWA 1I37A 1XP6A 2XHSA 3OSIA 5GICA 3AUQA 3VI8A 3WT6A 3MNPA 4R6SA 3VRTA 2E2RA 4ZI1A 5DXKA 5L7GA 1IE8A 3NSQA 4PLEA 4ZNHA 2Q59B 3GZ9A 2H79A 1R5KA 5HYKA 2ZLAA 3ERDA 3O1DA 2QTUA 5DLRA 4JYGA 1FM6D 4ONIA 5ETHA 4B7WA 4ZN9A 1M13A 1NQ0A 1XLSE 5APJA 3V9TA 2ZK0A 2Q7IA 1DB1A 1L2IA 4MG7A 4OGHA 3B66A 1T63A 1OSHA 3CQVA 4Y29A 4DM6A 3MNOA 4IS8A 4RWVA 4G2HA 2ZK1A 2AA5A 3HVLA 3DY6A 2GPPA 3FALA 4J5WA 2Q6JA 2ZLCA 3FUGA 2Q5GA 5GT4A 3VT8A 2Z4JA 3HQ5A 1X7EA 4JYIA 4ZOMA 5EITA 3KDTA 4J5XC 2AWHA 1YOKA 3OMKA 1EXAA 5ICKA 3WFFA 1PQ9A 2P15A 2AB2A 4CSJA 1RK3A 1RKHA 3N00A 2HB8A 2PITA 3IA6A 3B68A 1X78A 4FGYA 2VV2A 4ITEA 3B0RA 4UDAA 3OLLA 4POHA 4MG8A 3R8DA 4XLDA 5DXBA 3P89A 2JFAA 5DRMA 4ITFA 3V9VA 4TUZB 3ERTA 2GIUA 3X1HA 3VRWA 3OMMA 3W0GA 1R1KA 4IQRA 1SKXA 1YYEA 3ADVA 4WQPA 1FD0A 2R40D 1QKMA 3KFCA 2P7ZA 3ADUA 3GYUA 4IU7A 3BQDA 5DX3B 4APUA 2QE4A 1XV9B 3ZR7A 2G0GA 3E7CA 3LBDA 3VSPA 5DY8A 3W0JA 5IXKA 4RUJA 3VTCA 4OH5A 2HARA 5FQSA 5JY3A 2P7AA 3OS8A 5KYJA 3NOAA 3VT4A 4DQMA 3TY0A 1T7TA 4MG6A 4G1DA 5E19A 3A3ZX 2OVHA 4IA3A 2R6WA 3EYBA 3M7RA 2J4AA 5FQVA 3W0IA 5KROA 2Q59A 2Q1VA 3K23A 1NAXA 3SP9A 3OMQA 3HM1A 2GPUA 2AA7A 5M96A 5H1EA 2AA6A 3OKHA 4RZFA 5LWPA 1ZDUA 1S19A 1E3GA 2QH6A 5DRJA 1NYXA 2QA8B 3IXPA 5DKEA 1XVPB 2AX6A 2J7YA 4IVWA 3OMPA 4JAZA 5AZTA 4OARA 4WLBA 4A2JA 2QGWA 1GS4A 4OC7A 5AZVA 2ZK5A 4DM8A 1N4HA 4ZJRA 4PLDA 2XKWA 2NV7A 1R20A 3D90A 5FQRA 4J5WC 4PPSA 4XI3A 4MGBB 5DUHA 4N8RA 3E00D 4PRGA 2A3IA 3JZBA 3CS4A 2P7GA 3OZJA 1KKQA 1YMTA 2POBA 5B41A 1YP0A 2PIXA 5DZHA 3IPSA 4MGCA 1NDEA 3HO0A 4ZJWA 1E3KA 1T79A 1T73A 1XOWA 1I7IA 3HC6A 4ZNTA 2GPVA 5IAWA 3F5CB 4YNKA 5FQPA 1TFCA 3X31A 5KRIA 1XAPA 1U3SA 4TUZA 3L3XA 1XIUA 2AMBA 1YINA 3IPUA 4HEEX 3A9EB 3G8OA 4PWLA 2P1VA 1K74A 4IWFA 5KRFA 3X1IA 3K8SA 5AK2A 2P1UA 2B1VA 3ADWA 2ZKCA 4K7AA 2IOKA 3DZUD 5EC9A 5KR9A 4S0TA 5KRLA 1M2ZA 2FSZA 4OEDA 2ZK3A 3E00A 3CS8A 5DYDA 2JF9A 2XYJA 4G2IA 2BJ4B 3V9YA 3OOFA 3PRGA 1NQ1A 2HFPA 1PRGA 1M7WA 1HJ1A 1UOMA 4OZTE 5E0XA 4S14A 1YOWA 5DV8A 5FQTA 4CI4A 1NQ2A 5KCTA 3A2JA 2QMVA 2AXAA 3FC6B 4JL4A 3W0CA 5DXMA 3P8XA 4EMAA 5DMFA 2POGA 3ET1A 5DL4A 2PIVA 3VJSA 2ZNPA 3O1EA 2QABA 4REEA 3WT5A 4POJA 1XDKB 2Q5SA 3OSAA 5KRAA 4NIEA 1ZKYA 4YT1A 3R5MA 4XTAA 3HZFA 5E15A 3ILZA 4J24A 2ACLB 2ZMIA 2REWA 1UPWA 2QA8A 2EWPA 3B3KA 5EGVA 1XVPA 5JI0D 1GWQA 5AYGA 2OAXA 5A86A 3RVFA 1GWXA 3L0LA 4ZNWA 5LGAA 1I38A 1KV6A 2ZXNA 2HB7A 3P0UA 2PIPL 3Q95A 5GIEA 3WWRA 3UUDA 4S15A 3DR1A 4MGBA 5DK9A 2HCDA 5G42A
chains in the Genus database with same CATH superfamily
1YY4A 3VT3A 4R2UA 4UDBA 5JJMB 3E94A 1VJBA 5DVSA 4OLMA 3W0HA 3W5RA 2HBHA 1ZGYA 5E14A 3F5CA 3VT5A 2F4BA 2ABIA 2VV4A 4G20A 1G1UA 5HJPA 5G43A 4G1YA 2GPOA 2ZY0A 1XNXA 3CS6A 3W5QA 2OM9A 4R06A 3R2AA 4L98A 4MGAB 1T7MA 2I4PA 2PKLA 3A9EA 2QGTA 4IV4A 4NUFA 3UUCA 1L2JA 4K4JA 4UDDA 2Q6SA 1FM6A 3K22A 4DK8A 4F9MA 1S0XA 4WPFA 1FCZA 3OGTA 5C4SA 3KBAA 4QK4A 5DP0A 3IMYA 4S0SA 3AZ2A 4MDDA 3ET0A 3WGPA 1RDTD 4OZTU 4FHIA 3NSPA 3VTBA 3ZQTA 2BJ4A 2VV1B 4Q13A 5DSHA 4XT9A 3VJHA 5DWJA 5L11A 5L7EA 1N83A 3BEJA 3CDPA 1G5YA 1XNNA 3HODA 3AURA 2Q3YA 4IWCA 5APHA 4JGVA 3B5RA 1YUCA 1OT7A 3V4AA 4ZN7A 4RZEA 1NQ7A 4YMQA 1FCXA 2OCFA 1MVCA 3FC6A 2R6YA 3L3ZA 4RZGA 1T76A 5L7HA 5KRHA 4OEZA 5C4UA 3GN8A 1QKUA 1OVLB 2GP7A 4A4WA 1Q4XA 1XDKA 1ILGA 4RMDA 3SP6A 3UP0A 2HWRA 2Q1HA 4WHGA 3GYTA 2B50A 5DXEA 4IVYA 1PCGA 2ACLA 2FAIA 4XUMA 4YPQA 3AUNA 3UUAB 3HLVA 2QSEA 3KPZA 2PNUA 4DOSA 3UVVB 1FM9D 5DV6A 5DTVA 3A78A 1PK5A 3RLLA 3FLIA 2R40A 5DVCA 3V49A 2Q61A 1XP1A 1ZEOA 4HLWA 5KRJA 4RE8A 5JJMA 5E1CA 5DWLA 3WTQA 4NB6A 2ZMJA 4OZRE 3OKIA 1SR7A 4FN9A 5C4TA 2ZASA 1XJ7A 3KMRA 2QW4A 3D24A 2PIOA 3Q95B 1SQNA 1WM0X 3UUDB 4N5GA 3U9QA 3D57A 2AX9A 2PINA 4G21A 3KMZA 5DXGA 1QKNA 2PIUA 3ET2A 5DXQA 4MGAA 4OJ9A 4IA7A 5E7VA 2LBDA 1NUOA 1PZLA 2GWXA 2O9IA 2GL8A 3DZYA 3KWYA 3WMHA 3G9EA 5AAUA 4Q0AC 5DIGA 5KCFA 2YHDA 1ERRA 2PJLA 2VV4B 1ZUCA 2ZXZA 4KZIA 4MG9B 4P6XA 4PP5A 4QL8A 5GIDA 3VHVA 5HJPB 2OUZA 3AZ1A 3VT6A 2V0VA 5AAVA 3R8AA 4K6IA 2VV1A 3PO9A 5KCUA 3B0TA 5DZ3A 4LNXA 3AX8A 4M8EA 2P54A 5KCCA 3DCTA 2AO6A 2YLQA 5SYZA 4N73A 4TV1B 5DU5A 4E2JA 1KNUA 4RFWA 1XQ3A 3S9SA 4OEAA 1XPCA 1YA3A 1LBDA 3VSOA 2AX7A 2O4RA 2PIRA 3A40X 3B1MA 1OVLA 2ATHA 2GTKA 2HASA 3AFRA 4OKXA 4PPPA 5HJSA 2I0JA 3AZ3A 2Q8SA 2AX8A 4OKTA 1K4WA 4ZO1X 3ZRAA 2Q6RA 3L0JA 1G50A 1ZH7A 2ZNQA 2YJAB 3RUUA 2QZOB 3KDUA 1DKFB 4QM0A 5EHJA 2Q7KA 3F7DA 5APKA 1Y0XX 5F9BA 3UUAA 2P1TA 5G3JA 5AVIA 3WJ4A 3VHUA 3H0AD 3UVVA 4OHAA 3VRUA 2B1ZA 5DKBA 4IV2A 1ZAFA 3LMPA 4WHFA 1I7GA 1MZNA 1K7LA 2YFEA 3OLFA 4IA2A 4WVDA 3DZUA 2NPAA 1P93A 4FNEA 5DWIA 4OILA 2Q60A 2ZNNA 3JZCA 5DUEA 2ZNOA 3X36A 3OSWA 1XQCA 2QR9A 5EI1A 3TKMA 3R8IA 1N46A 4UDCA 1LV2A 3WFGA 2HAMA 4LSJA 2QPYA 2I4ZA 1A28A 4KZMA 1NRLA 3OAPA 2JJ3A 5E0WA 4OFUA 1QKTA 4OIVA 3VJTA 3CTBA 3OLSA 2ZBSA 5DIDA 3UP3A 2NXXA 3VJIA 1FBYA 1Y0SA 2XYWA 3H0AA 1MV9A 5IZ0A 1X7BA 1A52A 3ET3A 3P88A 3VT9A 1NAVA 3VHWA 5B5BA 3VN2A 4MGDB 4MG9A 3ADSA 5DXRA 5CJ6A 4QE6A 1UHLB 1T7RA 1PDUA 1R6GA 5DIEA 4L96A 4PF3A 5C4OA 1T65A 1Y9RA 5DYBA 3OMOA 4OKWA 3SZ1A 2QXMA 4OIUA 3R5NA 2BAWA 2XYXA 4PXMA 4XAOA 3MNEA 1SJ0A 2PIQA 4N1YA 2HC4A 5KD9A 4TV1A 2HWQA 1OSVA 4OJ4A 4EM9A 2QNVA 1R1KD 5KYAA 3OS9A 5AAVB 2YATA 5DMCA 4DK7A 2ZK2A 5DZ1A 1EREA 5KCEA 3W5PA 2QZOA 2VSRA 1DKFA 1S0ZA 3B0QA 5DZIA 3FEIA 2FVJA 4IW8A 4XHDA 4LTWA 5HYRA 1S9PA 3W5TA 1Z95A 3RLJA 3AN4A 3HC5A 3TKCA 3WJ5A 1HG4A 1T5ZA 1Z5XE 4BCRA 2ZVTA 3B67A 3PLZA 4IA1A 4X1GA 3KMGA 4IUIA 1UPVA 4DMAA 4E4QA 3R29A 4RUPA 3T03A 3IPQA 2G5OA 3L03A 1G2NA 3FURA 4Q50A 5DKGA 3FS1A 4OH6A 1RDTA 4REFA 1BSXA 3FEJA 1IE9A 1H9UA 2ZXMA 2OVMA 3GWXA 3UU7B 4E4KA 1S9QA 1P8DA 1U3QA 2YLYA 3DT3A 2J7XA 3G0WA 2ZK4A 3IXPD 3OZ0A 4G1ZA 5G46A 2AAXA 4FHHA 2VV0A 5G45A 3H52A 3QT0A 4DORA 4CI5A 5DI7A 3W0YA 2Q7LA 1R20D 4OKBA 2G44A 3FXVA 2Q7JA 1XZXX 5HZCA 1T7FA 1GWRA 4MGDA 3PBAA 1UHLA 2V7CA 3PCUA 2ZFXA 4QE8A 3VRVA 3VTDA 5DV3A 3AN3A 4LBDA 5AVLA 1XLSA 2Q70A 2ZMHA 4ZNUA 3B0WA 2NXXE 4XUHA 5KRCA 2HVCA 1FM9A 3CJWA 3GD2A 4PP3A 3PEQA 1K74D 2I0GA 3CLDA 4OEYA 4A4VA 3ADTA 1ZDTA 4ZO1B 3BC5A 4LNWA 3WT7A 5DXPA 1U3RA 4RAKA 5G5WA 5KCDA 2VSTA 2QA6A 3DZYD 2Q5PA 4RMEA 5KRKA 1TXIA 5DUGA 5ACCA 2YLOA 5K13A 4MG7B 3L0EA 1RJKA 5DWEA 2G0HA 4PP6A 2W8YA 1Z5XU 5AWJA 4OJBA 2AM9A 2O4JA 1X76A 3FALB 4RMCA 3ADXA 4MG5A 3K6PA 2I4JA 4J5XA 4X1FA 1PQCA 5KRMA 1U9EA 2Z4BA 2VV3A 3V3EA 5I4VA 2H77A 2ZK6A 1FCYA 2ZL9A 2PIWA 2NW4A 4J26A 5DKSA 2P4YA 2J14A 1RKGA 3TX7B 2QXSA 5EJVA 5DX3A 3OOKA 4PVUA 1T74A 1XP9A 4MG8B 3A2IA 4QJRA 2AMAA 4KZJA 1XV9A 5DXBB 5HCVA 4OZRU 1ILHA 3UU7A 2JFAB 2OZ7A 1EXXA 1X7JA 4JYHA 4ZNVA 3D6DA 4OK1A 5G44A 2B23A 4M8HA 3RUTA 3A2HA 3GWSX 2PRGA 4OFRA 2AYRA 4IW6A 5DWGA 3G8IA 4NQAB 3GBKA 2IHQA 3OS8C 1YJEA 2AA2A 3RY9A 5DZ0A 4NY9A 2YJDA 5AWKA 3V3QA 1PQ6A 3L1BA 2YLPA 4P6WA 1X7RA 3CWDA 3DCUA 3B65A 3CDSA 1XB7A 4O8FA 3KYTA 3VT7A 4RUOX 3D5FA 2IOGA 1NHZA 4ZNSA 1YIMA 5DVVA 3W0AA 3ZRBA 5KCWA 1I37A 1XP6A 2XHSA 3OSIA 5GICA 3AUQA 3VI8A 3WT6A 3MNPA 4R6SA 3VRTA 2E2RA 4ZI1A 5DXKA 5L7GA 1IE8A 3NSQA 4PLEA 4ZNHA 2Q59B 3GZ9A 2H79A 1R5KA 5HYKA 2ZLAA 3ERDA 3O1DA 2QTUA 5DLRA 4JYGA 1FM6D 4ONIA 5ETHA 4B7WA 4ZN9A 1M13A 1NQ0A 1XLSE 5APJA 3V9TA 2ZK0A 2Q7IA 1DB1A 1L2IA 4MG7A 4OGHA 3B66A 1T63A 1OSHA 3CQVA 4Y29A 4DM6A 3MNOA 4IS8A 4RWVA 4G2HA 2ZK1A 2AA5A 3HVLA 3DY6A 2GPPA 3FALA 4J5WA 2Q6JA 2ZLCA 3FUGA 2Q5GA 5GT4A 3VT8A 2Z4JA 3HQ5A 1X7EA 4JYIA 4ZOMA 5EITA 3KDTA 4J5XC 2AWHA 1YOKA 3OMKA 1EXAA 5ICKA 3WFFA 1PQ9A 2P15A 2AB2A 4CSJA 1RK3A 1RKHA 3N00A 2HB8A 2PITA 3IA6A 3B68A 1X78A 4FGYA 2VV2A 4ITEA 3B0RA 4UDAA 3OLLA 4POHA 4MG8A 3R8DA 4XLDA 5DXBA 3P89A 2JFAA 5DRMA 4ITFA 3V9VA 4TUZB 3ERTA 2GIUA 3X1HA 3VRWA 3OMMA 3W0GA 1R1KA 4IQRA 1SKXA 1YYEA 3ADVA 4WQPA 1FD0A 2R40D 1QKMA 3KFCA 2P7ZA 3ADUA 3GYUA 4IU7A 3BQDA 5DX3B 4APUA 2QE4A 1XV9B 3ZR7A 2G0GA 3E7CA 3LBDA 3VSPA 5DY8A 3W0JA 5IXKA 4RUJA 3VTCA 4OH5A 2HARA 5FQSA 5JY3A 2P7AA 3OS8A 5KYJA 3NOAA 3VT4A 4DQMA 3TY0A 1T7TA 4MG6A 4G1DA 5E19A 3A3ZX 2OVHA 4IA3A 2R6WA 3EYBA 3M7RA 2J4AA 5FQVA 3W0IA 5KROA 2Q59A 2Q1VA 3K23A 1NAXA 3SP9A 3OMQA 3HM1A 2GPUA 2AA7A 5M96A 5H1EA 2AA6A 3OKHA 4RZFA 5LWPA 1ZDUA 1S19A 1E3GA 2QH6A 5DRJA 1NYXA 2QA8B 3IXPA 5DKEA 1XVPB 2AX6A 2J7YA 4IVWA 3OMPA 4JAZA 5AZTA 4OARA 4WLBA 4A2JA 2QGWA 1GS4A 4OC7A 5AZVA 2ZK5A 4DM8A 1N4HA 4ZJRA 4PLDA 2XKWA 2NV7A 1R20A 3D90A 5FQRA 4J5WC 4PPSA 4XI3A 4MGBB 5DUHA 4N8RA 3E00D 4PRGA 2A3IA 3JZBA 3CS4A 2P7GA 3OZJA 1KKQA 1YMTA 2POBA 5B41A 1YP0A 2PIXA 5DZHA 3IPSA 4MGCA 1NDEA 3HO0A 4ZJWA 1E3KA 1T79A 1T73A 1XOWA 1I7IA 3HC6A 4ZNTA 2GPVA 5IAWA 3F5CB 4YNKA 5FQPA 1TFCA 3X31A 5KRIA 1XAPA 1U3SA 4TUZA 3L3XA 1XIUA 2AMBA 1YINA 3IPUA 4HEEX 3A9EB 3G8OA 4PWLA 2P1VA 1K74A 4IWFA 5KRFA 3X1IA 3K8SA 5AK2A 2P1UA 2B1VA 3ADWA 2ZKCA 4K7AA 2IOKA 3DZUD 5EC9A 5KR9A 4S0TA 5KRLA 1M2ZA 2FSZA 4OEDA 2ZK3A 3E00A 3CS8A 5DYDA 2JF9A 2XYJA 4G2IA 2BJ4B 3V9YA 3OOFA 3PRGA 1NQ1A 2HFPA 1PRGA 1M7WA 1HJ1A 1UOMA 4OZTE 5E0XA 4S14A 1YOWA 5DV8A 5FQTA 4CI4A 1NQ2A 5KCTA 3A2JA 2QMVA 2AXAA 3FC6B 4JL4A 3W0CA 5DXMA 3P8XA 4EMAA 5DMFA 2POGA 3ET1A 5DL4A 2PIVA 3VJSA 2ZNPA 3O1EA 2QABA 4REEA 3WT5A 4POJA 1XDKB 2Q5SA 3OSAA 5KRAA 4NIEA 1ZKYA 4YT1A 3R5MA 4XTAA 3HZFA 5E15A 3ILZA 4J24A 2ACLB 2ZMIA 2REWA 1UPWA 2QA8A 2EWPA 3B3KA 5EGVA 1XVPA 5JI0D 1GWQA 5AYGA 2OAXA 5A86A 3RVFA 1GWXA 3L0LA 4ZNWA 5LGAA 1I38A 1KV6A 2ZXNA 2HB7A 3P0UA 2PIPL 3Q95A 5GIEA 3WWRA 3UUDA 4S15A 3DR1A 4MGBA 5DK9A 2HCDA 5G42A
chains in the Genus database with same CATH topology
1YY4A 3VT3A 4R2UA 4UDBA 5JJMB 3E94A 1VJBA 5DVSA 4OLMA 3W0HA 3W5RA 2HBHA 1ZGYA 5E14A 3F5CA 3VT5A 2F4BA 2ABIA 2VV4A 4G20A 1G1UA 5HJPA 5G43A 4G1YA 2GPOA 2ZY0A 1XNXA 3CS6A 3W5QA 2OM9A 4R06A 3R2AA 4L98A 4MGAB 1T7MA 2I4PA 2PKLA 3A9EA 2QGTA 4IV4A 4NUFA 3UUCA 1L2JA 4K4JA 4UDDA 2Q6SA 1FM6A 3K22A 4DK8A 4F9MA 1S0XA 4WPFA 1FCZA 3OGTA 5C4SA 3KBAA 4QK4A 5DP0A 3IMYA 4S0SA 3AZ2A 4MDDA 3ET0A 3WGPA 1RDTD 4OZTU 4FHIA 3NSPA 3VTBA 3ZQTA 2BJ4A 2VV1B 4Q13A 5DSHA 4XT9A 3VJHA 5DWJA 5L11A 5L7EA 1N83A 3BEJA 3CDPA 1G5YA 1XNNA 3HODA 3AURA 2Q3YA 4IWCA 5APHA 4JGVA 3B5RA 1YUCA 1OT7A 3V4AA 4ZN7A 4RZEA 1NQ7A 4YMQA 1FCXA 2OCFA 1MVCA 3FC6A 2R6YA 3L3ZA 4RZGA 1T76A 5L7HA 5KRHA 4OEZA 5C4UA 3GN8A 1QKUA 1OVLB 2GP7A 4A4WA 1Q4XA 1XDKA 1ILGA 4RMDA 3SP6A 3UP0A 2HWRA 2Q1HA 4WHGA 3GYTA 2B50A 5DXEA 4IVYA 1PCGA 2ACLA 2FAIA 4XUMA 4YPQA 3AUNA 3UUAB 3HLVA 2QSEA 3KPZA 2PNUA 4DOSA 3UVVB 1FM9D 5DV6A 5DTVA 3A78A 1PK5A 3RLLA 3FLIA 2R40A 5DVCA 3V49A 2Q61A 1XP1A 1ZEOA 4HLWA 5KRJA 4RE8A 5JJMA 5E1CA 5DWLA 3WTQA 4NB6A 2ZMJA 4OZRE 3OKIA 1SR7A 4FN9A 5C4TA 2ZASA 1XJ7A 3KMRA 2QW4A 3D24A 2PIOA 3Q95B 1SQNA 1WM0X 3UUDB 4N5GA 3U9QA 3D57A 2AX9A 2PINA 4G21A 3KMZA 5DXGA 1QKNA 2PIUA 3ET2A 5DXQA 4MGAA 4OJ9A 4IA7A 5E7VA 2LBDA 1NUOA 1PZLA 2GWXA 2O9IA 2GL8A 3DZYA 3KWYA 3WMHA 3G9EA 5AAUA 4Q0AC 5DIGA 5KCFA 2YHDA 1ERRA 2PJLA 2VV4B 1ZUCA 2ZXZA 4KZIA 4MG9B 4P6XA 4PP5A 4QL8A 5GIDA 3VHVA 5HJPB 2OUZA 3AZ1A 3VT6A 2V0VA 5AAVA 3R8AA 4K6IA 2VV1A 3PO9A 5KCUA 3B0TA 5DZ3A 4LNXA 3AX8A 4M8EA 2P54A 5KCCA 3DCTA 2AO6A 2YLQA 5SYZA 4N73A 4TV1B 5DU5A 4E2JA 1KNUA 4RFWA 1XQ3A 3S9SA 4OEAA 1XPCA 1YA3A 1LBDA 3VSOA 2AX7A 2O4RA 2PIRA 3A40X 3B1MA 1OVLA 2ATHA 2GTKA 2HASA 3AFRA 4OKXA 4PPPA 5HJSA 2I0JA 3AZ3A 2Q8SA 2AX8A 4OKTA 1K4WA 4ZO1X 3ZRAA 2Q6RA 3L0JA 1G50A 1ZH7A 2ZNQA 2YJAB 3RUUA 2QZOB 3KDUA 1DKFB 4QM0A 5EHJA 2Q7KA 3F7DA 5APKA 1Y0XX 5F9BA 3UUAA 2P1TA 5G3JA 5AVIA 3WJ4A 3VHUA 3H0AD 3UVVA 4OHAA 3VRUA 2B1ZA 5DKBA 4IV2A 1ZAFA 3LMPA 4WHFA 1I7GA 1MZNA 1K7LA 2YFEA 3OLFA 4IA2A 4WVDA 3DZUA 2NPAA 1P93A 4FNEA 5DWIA 4OILA 2Q60A 2ZNNA 3JZCA 5DUEA 2ZNOA 3X36A 3OSWA 1XQCA 2QR9A 5EI1A 3TKMA 3R8IA 1N46A 4UDCA 1LV2A 3WFGA 2HAMA 4LSJA 2QPYA 2I4ZA 1A28A 4KZMA 1NRLA 3OAPA 2JJ3A 5E0WA 4OFUA 1QKTA 4OIVA 3VJTA 3CTBA 3OLSA 2ZBSA 5DIDA 3UP3A 2NXXA 3VJIA 1FBYA 1Y0SA 2XYWA 3H0AA 1MV9A 5IZ0A 1X7BA 1A52A 3ET3A 3P88A 3VT9A 1NAVA 3VHWA 5B5BA 3VN2A 4MGDB 4MG9A 3ADSA 5DXRA 5CJ6A 4QE6A 1UHLB 1T7RA 1PDUA 1R6GA 5DIEA 4L96A 4PF3A 5C4OA 1T65A 1Y9RA 5DYBA 3OMOA 4OKWA 3SZ1A 2QXMA 4OIUA 3R5NA 2BAWA 2XYXA 4PXMA 4XAOA 3MNEA 1SJ0A 2PIQA 4N1YA 2HC4A 5KD9A 4TV1A 2HWQA 1OSVA 4OJ4A 4EM9A 2QNVA 1R1KD 5KYAA 3OS9A 5AAVB 2YATA 5DMCA 4DK7A 2ZK2A 5DZ1A 1EREA 5KCEA 3W5PA 2QZOA 2VSRA 1DKFA 1S0ZA 3B0QA 5DZIA 3FEIA 2FVJA 4IW8A 4XHDA 4LTWA 5HYRA 1S9PA 3W5TA 1Z95A 3RLJA 3AN4A 3HC5A 3TKCA 3WJ5A 1HG4A 1T5ZA 1Z5XE 4BCRA 2ZVTA 3B67A 3PLZA 4IA1A 4X1GA 3KMGA 4IUIA 1UPVA 4DMAA 4E4QA 3R29A 4RUPA 3T03A 3IPQA 2G5OA 3L03A 1G2NA 3FURA 4Q50A 5DKGA 3FS1A 4OH6A 1RDTA 4REFA 1BSXA 3FEJA 1IE9A 1H9UA 2ZXMA 2OVMA 3GWXA 3UU7B 4E4KA 1S9QA 1P8DA 1U3QA 2YLYA 3DT3A 2J7XA 3G0WA 2ZK4A 3IXPD 3OZ0A 4G1ZA 5G46A 2AAXA 4FHHA 2VV0A 5G45A 3H52A 3QT0A 4DORA 4CI5A 5DI7A 3W0YA 2Q7LA 1R20D 4OKBA 2G44A 3FXVA 2Q7JA 1XZXX 5HZCA 1T7FA 1GWRA 4MGDA 3PBAA 1UHLA 2V7CA 3PCUA 2ZFXA 4QE8A 3VRVA 3VTDA 5DV3A 3AN3A 4LBDA 5AVLA 1XLSA 2Q70A 2ZMHA 4ZNUA 3B0WA 2NXXE 4XUHA 5KRCA 2HVCA 1FM9A 3CJWA 3GD2A 4PP3A 3PEQA 1K74D 2I0GA 3CLDA 4OEYA 4A4VA 3ADTA 1ZDTA 4ZO1B 3BC5A 4LNWA 3WT7A 5DXPA 1U3RA 4RAKA 5G5WA 5KCDA 2VSTA 2QA6A 3DZYD 2Q5PA 4RMEA 5KRKA 1TXIA 5DUGA 5ACCA 2YLOA 5K13A 4MG7B 3L0EA 1RJKA 5DWEA 2G0HA 4PP6A 2W8YA 1Z5XU 5AWJA 4OJBA 2AM9A 2O4JA 1X76A 3FALB 4RMCA 3ADXA 4MG5A 3K6PA 2I4JA 4J5XA 4X1FA 1PQCA 5KRMA 1U9EA 2Z4BA 2VV3A 3V3EA 5I4VA 2H77A 2ZK6A 1FCYA 2ZL9A 2PIWA 2NW4A 4J26A 5DKSA 2P4YA 2J14A 1RKGA 3TX7B 2QXSA 5EJVA 5DX3A 3OOKA 4PVUA 1T74A 1XP9A 4MG8B 3A2IA 4QJRA 2AMAA 4KZJA 1XV9A 5DXBB 5HCVA 4OZRU 1ILHA 3UU7A 2JFAB 2OZ7A 1EXXA 1X7JA 4JYHA 4ZNVA 3D6DA 4OK1A 5G44A 2B23A 4M8HA 3RUTA 3A2HA 3GWSX 2PRGA 4OFRA 2AYRA 4IW6A 5DWGA 3G8IA 4NQAB 3GBKA 2IHQA 3OS8C 1YJEA 2AA2A 3RY9A 5DZ0A 4NY9A 2YJDA 5AWKA 3V3QA 1PQ6A 3L1BA 2YLPA 4P6WA 1X7RA 3CWDA 3DCUA 3B65A 3CDSA 1XB7A 4O8FA 3KYTA 3VT7A 4RUOX 3D5FA 2IOGA 1NHZA 4ZNSA 1YIMA 5DVVA 3W0AA 3ZRBA 5KCWA 1I37A 1XP6A 2XHSA 3OSIA 5GICA 3AUQA 3VI8A 3WT6A 3MNPA 4R6SA 3VRTA 2E2RA 4ZI1A 5DXKA 5L7GA 1IE8A 3NSQA 4PLEA 4ZNHA 2Q59B 3GZ9A 2H79A 1R5KA 5HYKA 2ZLAA 3ERDA 3O1DA 2QTUA 5DLRA 4JYGA 1FM6D 4ONIA 5ETHA 4B7WA 4ZN9A 1M13A 1NQ0A 1XLSE 5APJA 3V9TA 2ZK0A 2Q7IA 1DB1A 1L2IA 4MG7A 4OGHA 3B66A 1T63A 1OSHA 3CQVA 4Y29A 4DM6A 3MNOA 4IS8A 4RWVA 4G2HA 2ZK1A 2AA5A 3HVLA 3DY6A 2GPPA 3FALA 4J5WA 2Q6JA 2ZLCA 3FUGA 2Q5GA 5GT4A 3VT8A 2Z4JA 3HQ5A 1X7EA 4JYIA 4ZOMA 5EITA 3KDTA 4J5XC 2AWHA 1YOKA 3OMKA 1EXAA 5ICKA 3WFFA 1PQ9A 2P15A 2AB2A 4CSJA 1RK3A 1RKHA 3N00A 2HB8A 2PITA 3IA6A 3B68A 1X78A 4FGYA 2VV2A 4ITEA 3B0RA 4UDAA 3OLLA 4POHA 4MG8A 3R8DA 4XLDA 5DXBA 3P89A 2JFAA 5DRMA 4ITFA 3V9VA 4TUZB 3ERTA 2GIUA 3X1HA 3VRWA 3OMMA 3W0GA 1R1KA 4IQRA 1SKXA 1YYEA 3ADVA 4WQPA 1FD0A 2R40D 1QKMA 3KFCA 2P7ZA 3ADUA 3GYUA 4IU7A 3BQDA 5DX3B 4APUA 2QE4A 1XV9B 3ZR7A 2G0GA 3E7CA 3LBDA 3VSPA 5DY8A 3W0JA 5IXKA 4RUJA 3VTCA 4OH5A 2HARA 5FQSA 5JY3A 2P7AA 3OS8A 5KYJA 3NOAA 3VT4A 4DQMA 3TY0A 1T7TA 4MG6A 4G1DA 5E19A 3A3ZX 2OVHA 4IA3A 2R6WA 3EYBA 3M7RA 2J4AA 5FQVA 3W0IA 5KROA 2Q59A 2Q1VA 3K23A 1NAXA 3SP9A 3OMQA 3HM1A 2GPUA 2AA7A 5M96A 5H1EA 2AA6A 3OKHA 4RZFA 5LWPA 1ZDUA 1S19A 1E3GA 2QH6A 5DRJA 1NYXA 2QA8B 3IXPA 5DKEA 1XVPB 2AX6A 2J7YA 4IVWA 3OMPA 4JAZA 5AZTA 4OARA 4WLBA 4A2JA 2QGWA 1GS4A 4OC7A 5AZVA 2ZK5A 4DM8A 1N4HA 4ZJRA 4PLDA 2XKWA 2NV7A 1R20A 3D90A 5FQRA 4J5WC 4PPSA 4XI3A 4MGBB 5DUHA 4N8RA 3E00D 4PRGA 2A3IA 3JZBA 3CS4A 2P7GA 3OZJA 1KKQA 1YMTA 2POBA 5B41A 1YP0A 2PIXA 5DZHA 3IPSA 4MGCA 1NDEA 3HO0A 4ZJWA 1E3KA 1T79A 1T73A 1XOWA 1I7IA 3HC6A 4ZNTA 2GPVA 5IAWA 3F5CB 4YNKA 5FQPA 1TFCA 3X31A 5KRIA 1XAPA 1U3SA 4TUZA 3L3XA 1XIUA 2AMBA 1YINA 3IPUA 4HEEX 3A9EB 3G8OA 4PWLA 2P1VA 1K74A 4IWFA 5KRFA 3X1IA 3K8SA 5AK2A 2P1UA 2B1VA 3ADWA 2ZKCA 4K7AA 2IOKA 3DZUD 5EC9A 5KR9A 4S0TA 5KRLA 1M2ZA 2FSZA 4OEDA 2ZK3A 3E00A 3CS8A 5DYDA 2JF9A 2XYJA 4G2IA 2BJ4B 3V9YA 3OOFA 3PRGA 1NQ1A 2HFPA 1PRGA 1M7WA 1HJ1A 1UOMA 4OZTE 5E0XA 4S14A 1YOWA 5DV8A 5FQTA 4CI4A 1NQ2A 5KCTA 3A2JA 2QMVA 2AXAA 3FC6B 4JL4A 3W0CA 5DXMA 3P8XA 4EMAA 5DMFA 2POGA 3ET1A 5DL4A 2PIVA 3VJSA 2ZNPA 3O1EA 2QABA 4REEA 3WT5A 4POJA 1XDKB 2Q5SA 3OSAA 5KRAA 4NIEA 1ZKYA 4YT1A 3R5MA 4XTAA 3HZFA 5E15A 3ILZA 4J24A 2ACLB 2ZMIA 2REWA 1UPWA 2QA8A 2EWPA 3B3KA 5EGVA 1XVPA 5JI0D 1GWQA 5AYGA 2OAXA 5A86A 3RVFA 1GWXA 3L0LA 4ZNWA 5LGAA 1I38A 1KV6A 2ZXNA 2HB7A 3P0UA 2PIPL 3Q95A 5GIEA 3WWRA 3UUDA 4S15A 3DR1A 4MGBA 5DK9A 2HCDA 5G42A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YY4 A;  3VT3 A;  4R2U A;  4UDB A;  5JJM B;  3E94 A;  1VJB A;  5DVS A;  4OLM A;  3W0H A;  3W5R A;  2HBH A;  1ZGY A;  5E14 A;  3F5C A;  3VT5 A;  2F4B A;  2ABI A;  2VV4 A;  4G20 A;  1G1U A;  5HJP A;  5G43 A;  4G1Y A;  2GPO A;  2ZY0 A;  1XNX A;  3CS6 A;  3W5Q A;  2OM9 A;  4R06 A;  3R2A A;  4L98 A;  4MGA B;  1T7M A;  2I4P A;  2PKL A;  3A9E A;  2QGT A;  4IV4 A;  4NUF A;  3UUC A;  1L2J A;  4K4J A;  4UDD A;  2Q6S A;  1FM6 A;  3K22 A;  4DK8 A;  4F9M A;  1S0X A;  4WPF A;  1FCZ A;  3OGT A;  5C4S A;  3KBA A;  4QK4 A;  5DP0 A;  3IMY A;  4S0S A;  3AZ2 A;  4MDD A;  3ET0 A;  3WGP A;  1RDT D;  4OZT U;  4FHI A;  3NSP A;  3VTB A;  3ZQT A;  2BJ4 A;  2VV1 B;  4Q13 A;  5DSH A;  4XT9 A;  3VJH A;  5DWJ A;  5L11 A;  5L7E A;  1N83 A;  3BEJ A;  3CDP A;  1G5Y A;  1XNN A;  3HOD A;  3AUR A;  2Q3Y A;  4IWC A;  5APH A;  4JGV A;  3B5R A;  1YUC A;  1OT7 A;  3V4A A;  4ZN7 A;  4RZE A;  1NQ7 A;  4YMQ A;  1FCX A;  2OCF A;  1MVC A;  3FC6 A;  2R6Y A;  3L3Z A;  4RZG A;  1T76 A;  5L7H A;  5KRH A;  4OEZ A;  5C4U A;  3GN8 A;  1QKU A;  1OVL B;  2GP7 A;  4A4W A;  1Q4X A;  1XDK A;  1ILG A;  4RMD A;  3SP6 A;  3UP0 A;  2HWR A;  2Q1H A;  4WHG A;  3GYT A;  2B50 A;  5DXE A;  4IVY A;  1PCG A;  2ACL A;  2FAI A;  4XUM A;  4YPQ A;  3AUN A;  3UUA B;  3HLV A;  2QSE A;  3KPZ A;  2PNU A;  4DOS A;  3UVV B;  1FM9 D;  5DV6 A;  5DTV A;  3A78 A;  1PK5 A;  3RLL A;  3FLI A;  2R40 A;  5DVC A;  3V49 A;  2Q61 A;  1XP1 A;  1ZEO A;  4HLW A;  5KRJ A;  4RE8 A;  5JJM A;  5E1C A;  5DWL A;  3WTQ A;  4NB6 A;  2ZMJ A;  4OZR E;  3OKI A;  1SR7 A;  4FN9 A;  5C4T A;  2ZAS A;  1XJ7 A;  3KMR A;  2QW4 A;  3D24 A;  2PIO A;  3Q95 B;  1SQN A;  1WM0 X;  3UUD B;  4N5G A;  3U9Q A;  3D57 A;  2AX9 A;  2PIN A;  4G21 A;  3KMZ A;  5DXG A;  1QKN A;  2PIU A;  3ET2 A;  5DXQ A;  4MGA A;  4OJ9 A;  4IA7 A;  5E7V A;  2LBD A;  1NUO A;  1PZL A;  2GWX A;  2O9I A;  2GL8 A;  3DZY A;  3KWY A;  3WMH A;  3G9E A;  5AAU A;  4Q0A C;  5DIG A;  5KCF A;  2YHD A;  1ERR A;  2PJL A;  2VV4 B;  1ZUC A;  2ZXZ A;  4KZI A;  4MG9 B;  4P6X A;  4PP5 A;  4QL8 A;  5GID A;  3VHV A;  5HJP B;  2OUZ A;  3AZ1 A;  3VT6 A;  2V0V A;  5AAV A;  3R8A A;  4K6I A;  2VV1 A;  3PO9 A;  5KCU A;  3B0T A;  5DZ3 A;  4LNX A;  3AX8 A;  4M8E A;  2P54 A;  5KCC A;  3DCT A;  2AO6 A;  2YLQ A;  5SYZ A;  4N73 A;  4TV1 B;  5DU5 A;  4E2J A;  1KNU A;  4RFW A;  1XQ3 A;  3S9S A;  4OEA A;  1XPC A;  1YA3 A;  1LBD A;  3VSO A;  2AX7 A;  2O4R A;  2PIR A;  3A40 X;  3B1M A;  1OVL A;  2ATH A;  2GTK A;  2HAS A;  3AFR A;  4OKX A;  4PPP A;  5HJS A;  2I0J A;  3AZ3 A;  2Q8S A;  2AX8 A;  4OKT A;  1K4W A;  4ZO1 X;  3ZRA A;  2Q6R A;  3L0J A;  1G50 A;  1ZH7 A;  2ZNQ A;  2YJA B;  3RUU A;  2QZO B;  3KDU A;  1DKF B;  4QM0 A;  5EHJ A;  2Q7K A;  3F7D A;  5APK A;  1Y0X X;  5F9B A;  3UUA A;  2P1T A;  5G3J A;  5AVI A;  3WJ4 A;  3VHU A;  3H0A D;  3UVV A;  4OHA A;  3VRU A;  2B1Z A;  5DKB A;  4IV2 A;  1ZAF A;  3LMP A;  4WHF A;  1I7G A;  1MZN A;  1K7L A;  2YFE A;  3OLF A;  4IA2 A;  4WVD A;  3DZU A;  2NPA A;  1P93 A;  4FNE A;  5DWI A;  4OIL A;  2Q60 A;  2ZNN A;  3JZC A;  5DUE A;  2ZNO A;  3X36 A;  3OSW A;  1XQC A;  2QR9 A;  5EI1 A;  3TKM A;  3R8I A;  1N46 A;  4UDC A;  1LV2 A;  3WFG A;  2HAM A;  4LSJ A;  2QPY A;  2I4Z A;  1A28 A;  4KZM A;  1NRL A;  3OAP A;  2JJ3 A;  5E0W A;  4OFU A;  1QKT A;  4OIV A;  3VJT A;  3CTB A;  3OLS A;  2ZBS A;  5DID A;  3UP3 A;  2NXX A;  3VJI A;  1FBY A;  1Y0S A;  2XYW A;  3H0A A;  1MV9 A;  5IZ0 A;  1X7B A;  1A52 A;  3ET3 A;  3P88 A;  3VT9 A;  1NAV A;  3VHW A;  5B5B A;  3VN2 A;  4MGD B;  4MG9 A;  3ADS A;  5DXR A;  5CJ6 A;  4QE6 A;  1UHL B;  1T7R A;  1PDU A;  1R6G A;  5DIE A;  4L96 A;  4PF3 A;  5C4O A;  1T65 A;  1Y9R A;  5DYB A;  3OMO A;  4OKW A;  3SZ1 A;  2QXM A;  4OIU A;  3R5N A;  2BAW A;  2XYX A;  4PXM A;  4XAO A;  3MNE A;  1SJ0 A;  2PIQ A;  4N1Y A;  2HC4 A;  5KD9 A;  4TV1 A;  2HWQ A;  1OSV A;  4OJ4 A;  4EM9 A;  2QNV A;  1R1K D;  5KYA A;  3OS9 A;  5AAV B;  2YAT A;  5DMC A;  4DK7 A;  2ZK2 A;  5DZ1 A;  1ERE A;  5KCE A;  3W5P A;  2QZO A;  2VSR A;  1DKF A;  1S0Z A;  3B0Q A;  5DZI A;  3FEI A;  2FVJ A;  4IW8 A;  4XHD A;  4LTW A;  5HYR A;  1S9P A;  3W5T A;  1Z95 A;  3RLJ A;  3AN4 A;  3HC5 A;  3TKC A;  3WJ5 A;  1HG4 A;  1T5Z A;  1Z5X E;  4BCR A;  2ZVT A;  3B67 A;  3PLZ A;  4IA1 A;  4X1G A;  3KMG A;  4IUI A;  1UPV A;  4DMA A;  4E4Q A;  3R29 A;  4RUP A;  3T03 A;  3IPQ A;  2G5O A;  3L03 A;  1G2N A;  3FUR A;  4Q50 A;  5DKG A;  3FS1 A;  4OH6 A;  1RDT A;  4REF A;  1BSX A;  3FEJ A;  1IE9 A;  1H9U A;  2ZXM A;  2OVM A;  3GWX A;  3UU7 B;  4E4K A;  1S9Q A;  1P8D A;  1U3Q A;  2YLY A;  3DT3 A;  2J7X A;  3G0W A;  2ZK4 A;  3IXP D;  3OZ0 A;  4G1Z A;  5G46 A;  2AAX A;  4FHH A;  2VV0 A;  5G45 A;  3H52 A;  3QT0 A;  4DOR A;  4CI5 A;  5DI7 A;  3W0Y A;  2Q7L A;  1R20 D;  4OKB A;  2G44 A;  3FXV A;  2Q7J A;  1XZX X;  5HZC A;  1T7F A;  1GWR A;  4MGD A;  3PBA A;  1UHL A;  2V7C A;  3PCU A;  2ZFX A;  4QE8 A;  3VRV A;  3VTD A;  5DV3 A;  3AN3 A;  4LBD A;  5AVL A;  1XLS A;  2Q70 A;  2ZMH A;  4ZNU A;  3B0W A;  2NXX E;  4XUH A;  5KRC A;  2HVC A;  1FM9 A;  3CJW A;  3GD2 A;  4PP3 A;  3PEQ A;  1K74 D;  2I0G A;  3CLD A;  4OEY A;  4A4V A;  3ADT A;  1ZDT A;  4ZO1 B;  3BC5 A;  4LNW A;  3WT7 A;  5DXP A;  1U3R A;  4RAK A;  5G5W A;  5KCD A;  2VST A;  2QA6 A;  3DZY D;  2Q5P A;  4RME A;  5KRK A;  1TXI A;  5DUG A;  5ACC A;  2YLO A;  5K13 A;  4MG7 B;  3L0E A;  1RJK A;  5DWE A;  2G0H A;  4PP6 A;  2W8Y A;  1Z5X U;  5AWJ A;  4OJB A;  2AM9 A;  2O4J A;  1X76 A;  3FAL B;  4RMC A;  3ADX A;  4MG5 A;  3K6P A;  2I4J A;  4J5X A;  4X1F A;  1PQC A;  5KRM A;  1U9E A;  2Z4B A;  2VV3 A;  3V3E A;  5I4V A;  2H77 A;  2ZK6 A;  1FCY A;  2ZL9 A;  2PIW A;  2NW4 A;  4J26 A;  5DKS A;  2P4Y A;  2J14 A;  1RKG A;  3TX7 B;  2QXS A;  5EJV A;  5DX3 A;  3OOK A;  4PVU A;  1T74 A;  1XP9 A;  4MG8 B;  3A2I A;  4QJR A;  2AMA A;  4KZJ A;  1XV9 A;  5DXB B;  5HCV A;  4OZR U;  1ILH A;  3UU7 A;  2JFA B;  2OZ7 A;  1EXX A;  1X7J A;  4JYH A;  4ZNV A;  3D6D A;  4OK1 A;  5G44 A;  2B23 A;  4M8H A;  3RUT A;  3A2H A;  3GWS X;  2PRG A;  4OFR A;  2AYR A;  4IW6 A;  5DWG A;  3G8I A;  4NQA B;  3GBK A;  2IHQ A;  3OS8 C;  1YJE A;  2AA2 A;  3RY9 A;  5DZ0 A;  4NY9 A;  2YJD A;  5AWK A;  3V3Q A;  1PQ6 A;  3L1B A;  2YLP A;  4P6W A;  1X7R A;  3CWD A;  3DCU A;  3B65 A;  3CDS A;  1XB7 A;  4O8F A;  3KYT A;  3VT7 A;  4RUO X;  3D5F A;  2IOG A;  1NHZ A;  4ZNS A;  1YIM A;  5DVV A;  3W0A A;  3ZRB A;  5KCW A;  1I37 A;  1XP6 A;  2XHS A;  3OSI A;  5GIC A;  3AUQ A;  3VI8 A;  3WT6 A;  3MNP A;  4R6S A;  3VRT A;  2E2R A;  4ZI1 A;  5DXK A;  5L7G A;  1IE8 A;  3NSQ A;  4PLE A;  4ZNH A;  2Q59 B;  3GZ9 A;  2H79 A;  1R5K A;  5HYK A;  2ZLA A;  3ERD A;  3O1D A;  2QTU A;  5DLR A;  4JYG A;  1FM6 D;  4ONI A;  5ETH A;  4B7W A;  4ZN9 A;  1M13 A;  1NQ0 A;  1XLS E;  5APJ A;  3V9T A;  2ZK0 A;  2Q7I A;  1DB1 A;  1L2I A;  4MG7 A;  4OGH A;  3B66 A;  1T63 A;  1OSH A;  3CQV A;  4Y29 A;  4DM6 A;  3MNO A;  4IS8 A;  4RWV A;  4G2H A;  2ZK1 A;  2AA5 A;  3HVL A;  3DY6 A;  2GPP A;  3FAL A;  4J5W A;  2Q6J A;  2ZLC A;  3FUG A;  2Q5G A;  5GT4 A;  3VT8 A;  2Z4J A;  3HQ5 A;  1X7E A;  4JYI A;  4ZOM A;  5EIT A;  3KDT A;  4J5X C;  2AWH A;  1YOK A;  3OMK A;  1EXA A;  5ICK A;  3WFF A;  1PQ9 A;  2P15 A;  2AB2 A;  4CSJ A;  1RK3 A;  1RKH A;  3N00 A;  2HB8 A;  2PIT A;  3IA6 A;  3B68 A;  1X78 A;  4FGY A;  2VV2 A;  4ITE A;  3B0R A;  4UDA A;  3OLL A;  4POH A;  4MG8 A;  3R8D A;  4XLD A;  5DXB A;  3P89 A;  2JFA A;  5DRM A;  4ITF A;  3V9V A;  4TUZ B;  3ERT A;  2GIU A;  3X1H A;  3VRW A;  3OMM A;  3W0G A;  1R1K A;  4IQR A;  1SKX A;  1YYE A;  3ADV A;  4WQP A;  1FD0 A;  2R40 D;  1QKM A;  3KFC A;  2P7Z A;  3ADU A;  3GYU A;  4IU7 A;  3BQD A;  5DX3 B;  4APU A;  2QE4 A;  1XV9 B;  3ZR7 A;  2G0G A;  3E7C A;  3LBD A;  3VSP A;  5DY8 A;  3W0J A;  5IXK A;  4RUJ A;  3VTC A;  4OH5 A;  2HAR A;  5FQS A;  5JY3 A;  2P7A A;  3OS8 A;  5KYJ A;  3NOA A;  3VT4 A;  4DQM A;  3TY0 A;  1T7T A;  4MG6 A;  4G1D A;  5E19 A;  3A3Z X;  2OVH A;  4IA3 A;  2R6W A;  3EYB A;  3M7R A;  2J4A A;  5FQV A;  3W0I A;  5KRO A;  2Q59 A;  2Q1V A;  3K23 A;  1NAX A;  3SP9 A;  3OMQ A;  3HM1 A;  2GPU A;  2AA7 A;  5M96 A;  5H1E A;  2AA6 A;  3OKH A;  4RZF A;  5LWP A;  1ZDU A;  1S19 A;  1E3G A;  2QH6 A;  5DRJ A;  1NYX A;  2QA8 B;  3IXP A;  5DKE A;  1XVP B;  2AX6 A;  2J7Y A;  4IVW A;  3OMP A;  4JAZ A;  5AZT A;  4OAR A;  4WLB A;  4A2J A;  2QGW A;  1GS4 A;  4OC7 A;  5AZV A;  2ZK5 A;  4DM8 A;  1N4H A;  4ZJR A;  4PLD A;  2XKW A;  2NV7 A;  1R20 A;  3D90 A;  5FQR A;  4J5W C;  4PPS A;  4XI3 A;  4MGB B;  5DUH A;  4N8R A;  3E00 D;  4PRG A;  2A3I A;  3JZB A;  3CS4 A;  2P7G A;  3OZJ A;  1KKQ A;  1YMT A;  2POB A;  5B41 A;  1YP0 A;  2PIX A;  5DZH A;  3IPS A;  4MGC A;  1NDE A;  3HO0 A;  4ZJW A;  1E3K A;  1T79 A;  1T73 A;  1XOW A;  1I7I A;  3HC6 A;  4ZNT A;  2GPV A;  5IAW A;  3F5C B;  4YNK A;  5FQP A;  1TFC A;  3X31 A;  5KRI A;  1XAP A;  1U3S A;  4TUZ A;  3L3X A;  1XIU A;  2AMB A;  1YIN A;  3IPU A;  4HEE X;  3A9E B;  3G8O A;  4PWL A;  2P1V A;  1K74 A;  4IWF A;  5KRF A;  3X1I A;  3K8S A;  5AK2 A;  2P1U A;  2B1V A;  3ADW A;  2ZKC A;  4K7A A;  2IOK A;  3DZU D;  5EC9 A;  5KR9 A;  4S0T A;  5KRL A;  1M2Z A;  2FSZ A;  4OED A;  2ZK3 A;  3E00 A;  3CS8 A;  5DYD A;  2JF9 A;  2XYJ A;  4G2I A;  2BJ4 B;  3V9Y A;  3OOF A;  3PRG A;  1NQ1 A;  2HFP A;  1PRG A;  1M7W A;  1HJ1 A;  1UOM A;  4OZT E;  5E0X A;  4S14 A;  1YOW A;  5DV8 A;  5FQT A;  4CI4 A;  1NQ2 A;  5KCT A;  3A2J A;  2QMV A;  2AXA A;  3FC6 B;  4JL4 A;  3W0C A;  5DXM A;  3P8X A;  4EMA A;  5DMF A;  2POG A;  3ET1 A;  5DL4 A;  2PIV A;  3VJS A;  2ZNP A;  3O1E A;  2QAB A;  4REE A;  3WT5 A;  4POJ A;  1XDK B;  2Q5S A;  3OSA A;  5KRA A;  4NIE A;  1ZKY A;  4YT1 A;  3R5M A;  4XTA A;  3HZF A;  5E15 A;  3ILZ A;  4J24 A;  2ACL B;  2ZMI A;  2REW A;  1UPW A;  2QA8 A;  2EWP A;  3B3K A;  5EGV A;  1XVP A;  5JI0 D;  1GWQ A;  5AYG A;  2OAX A;  5A86 A;  3RVF A;  1GWX A;  3L0L A;  4ZNW A;  5LGA A;  1I38 A;  1KV6 A;  2ZXN A;  2HB7 A;  3P0U A;  2PIP L;  3Q95 A;  5GIE A;  3WWR A;  3UUD A;  4S15 A;  3DR1 A;  4MGB A;  5DK9 A;  2HCD A;  5G42 A; 
#chains in the Genus database with same CATH topology
 1YY4 A;  3VT3 A;  4R2U A;  4UDB A;  5JJM B;  3E94 A;  1VJB A;  5DVS A;  4OLM A;  3W0H A;  3W5R A;  2HBH A;  1ZGY A;  5E14 A;  3F5C A;  3VT5 A;  2F4B A;  2ABI A;  2VV4 A;  4G20 A;  1G1U A;  5HJP A;  5G43 A;  4G1Y A;  2GPO A;  2ZY0 A;  1XNX A;  3CS6 A;  3W5Q A;  2OM9 A;  4R06 A;  3R2A A;  4L98 A;  4MGA B;  1T7M A;  2I4P A;  2PKL A;  3A9E A;  2QGT A;  4IV4 A;  4NUF A;  3UUC A;  1L2J A;  4K4J A;  4UDD A;  2Q6S A;  1FM6 A;  3K22 A;  4DK8 A;  4F9M A;  1S0X A;  4WPF A;  1FCZ A;  3OGT A;  5C4S A;  3KBA A;  4QK4 A;  5DP0 A;  3IMY A;  4S0S A;  3AZ2 A;  4MDD A;  3ET0 A;  3WGP A;  1RDT D;  4OZT U;  4FHI A;  3NSP A;  3VTB A;  3ZQT A;  2BJ4 A;  2VV1 B;  4Q13 A;  5DSH A;  4XT9 A;  3VJH A;  5DWJ A;  5L11 A;  5L7E A;  1N83 A;  3BEJ A;  3CDP A;  1G5Y A;  1XNN A;  3HOD A;  3AUR A;  2Q3Y A;  4IWC A;  5APH A;  4JGV A;  3B5R A;  1YUC A;  1OT7 A;  3V4A A;  4ZN7 A;  4RZE A;  1NQ7 A;  4YMQ A;  1FCX A;  2OCF A;  1MVC A;  3FC6 A;  2R6Y A;  3L3Z A;  4RZG A;  1T76 A;  5L7H A;  5KRH A;  4OEZ A;  5C4U A;  3GN8 A;  1QKU A;  1OVL B;  2GP7 A;  4A4W A;  1Q4X A;  1XDK A;  1ILG A;  4RMD A;  3SP6 A;  3UP0 A;  2HWR A;  2Q1H A;  4WHG A;  3GYT A;  2B50 A;  5DXE A;  4IVY A;  1PCG A;  2ACL A;  2FAI A;  4XUM A;  4YPQ A;  3AUN A;  3UUA B;  3HLV A;  2QSE A;  3KPZ A;  2PNU A;  4DOS A;  3UVV B;  1FM9 D;  5DV6 A;  5DTV A;  3A78 A;  1PK5 A;  3RLL A;  3FLI A;  2R40 A;  5DVC A;  3V49 A;  2Q61 A;  1XP1 A;  1ZEO A;  4HLW A;  5KRJ A;  4RE8 A;  5JJM A;  5E1C A;  5DWL A;  3WTQ A;  4NB6 A;  2ZMJ A;  4OZR E;  3OKI A;  1SR7 A;  4FN9 A;  5C4T A;  2ZAS A;  1XJ7 A;  3KMR A;  2QW4 A;  3D24 A;  2PIO A;  3Q95 B;  1SQN A;  1WM0 X;  3UUD B;  4N5G A;  3U9Q A;  3D57 A;  2AX9 A;  2PIN A;  4G21 A;  3KMZ A;  5DXG A;  1QKN A;  2PIU A;  3ET2 A;  5DXQ A;  4MGA A;  4OJ9 A;  4IA7 A;  5E7V A;  2LBD A;  1NUO A;  1PZL A;  2GWX A;  2O9I A;  2GL8 A;  3DZY A;  3KWY A;  3WMH A;  3G9E A;  5AAU A;  4Q0A C;  5DIG A;  5KCF A;  2YHD A;  1ERR A;  2PJL A;  2VV4 B;  1ZUC A;  2ZXZ A;  4KZI A;  4MG9 B;  4P6X A;  4PP5 A;  4QL8 A;  5GID A;  3VHV A;  5HJP B;  2OUZ A;  3AZ1 A;  3VT6 A;  2V0V A;  5AAV A;  3R8A A;  4K6I A;  2VV1 A;  3PO9 A;  5KCU A;  3B0T A;  5DZ3 A;  4LNX A;  3AX8 A;  4M8E A;  2P54 A;  5KCC A;  3DCT A;  2AO6 A;  2YLQ A;  5SYZ A;  4N73 A;  4TV1 B;  5DU5 A;  4E2J A;  1KNU A;  4RFW A;  1XQ3 A;  3S9S A;  4OEA A;  1XPC A;  1YA3 A;  1LBD A;  3VSO A;  2AX7 A;  2O4R A;  2PIR A;  3A40 X;  3B1M A;  1OVL A;  2ATH A;  2GTK A;  2HAS A;  3AFR A;  4OKX A;  4PPP A;  5HJS A;  2I0J A;  3AZ3 A;  2Q8S A;  2AX8 A;  4OKT A;  1K4W A;  4ZO1 X;  3ZRA A;  2Q6R A;  3L0J A;  1G50 A;  1ZH7 A;  2ZNQ A;  2YJA B;  3RUU A;  2QZO B;  3KDU A;  1DKF B;  4QM0 A;  5EHJ A;  2Q7K A;  3F7D A;  5APK A;  1Y0X X;  5F9B A;  3UUA A;  2P1T A;  5G3J A;  5AVI A;  3WJ4 A;  3VHU A;  3H0A D;  3UVV A;  4OHA A;  3VRU A;  2B1Z A;  5DKB A;  4IV2 A;  1ZAF A;  3LMP A;  4WHF A;  1I7G A;  1MZN A;  1K7L A;  2YFE A;  3OLF A;  4IA2 A;  4WVD A;  3DZU A;  2NPA A;  1P93 A;  4FNE A;  5DWI A;  4OIL A;  2Q60 A;  2ZNN A;  3JZC A;  5DUE A;  2ZNO A;  3X36 A;  3OSW A;  1XQC A;  2QR9 A;  5EI1 A;  3TKM A;  3R8I A;  1N46 A;  4UDC A;  1LV2 A;  3WFG A;  2HAM A;  4LSJ A;  2QPY A;  2I4Z A;  1A28 A;  4KZM A;  1NRL A;  3OAP A;  2JJ3 A;  5E0W A;  4OFU A;  1QKT A;  4OIV A;  3VJT A;  3CTB A;  3OLS A;  2ZBS A;  5DID A;  3UP3 A;  2NXX A;  3VJI A;  1FBY A;  1Y0S A;  2XYW A;  3H0A A;  1MV9 A;  5IZ0 A;  1X7B A;  1A52 A;  3ET3 A;  3P88 A;  3VT9 A;  1NAV A;  3VHW A;  5B5B A;  3VN2 A;  4MGD B;  4MG9 A;  3ADS A;  5DXR A;  5CJ6 A;  4QE6 A;  1UHL B;  1T7R A;  1PDU A;  1R6G A;  5DIE A;  4L96 A;  4PF3 A;  5C4O A;  1T65 A;  1Y9R A;  5DYB A;  3OMO A;  4OKW A;  3SZ1 A;  2QXM A;  4OIU A;  3R5N A;  2BAW A;  2XYX A;  4PXM A;  4XAO A;  3MNE A;  1SJ0 A;  2PIQ A;  4N1Y A;  2HC4 A;  5KD9 A;  4TV1 A;  2HWQ A;  1OSV A;  4OJ4 A;  4EM9 A;  2QNV A;  1R1K D;  5KYA A;  3OS9 A;  5AAV B;  2YAT A;  5DMC A;  4DK7 A;  2ZK2 A;  5DZ1 A;  1ERE A;  5KCE A;  3W5P A;  2QZO A;  2VSR A;  1DKF A;  1S0Z A;  3B0Q A;  5DZI A;  3FEI A;  2FVJ A;  4IW8 A;  4XHD A;  4LTW A;  5HYR A;  1S9P A;  3W5T A;  1Z95 A;  3RLJ A;  3AN4 A;  3HC5 A;  3TKC A;  3WJ5 A;  1HG4 A;  1T5Z A;  1Z5X E;  4BCR A;  2ZVT A;  3B67 A;  3PLZ A;  4IA1 A;  4X1G A;  3KMG A;  4IUI A;  1UPV A;  4DMA A;  4E4Q A;  3R29 A;  4RUP A;  3T03 A;  3IPQ A;  2G5O A;  3L03 A;  1G2N A;  3FUR A;  4Q50 A;  5DKG A;  3FS1 A;  4OH6 A;  1RDT A;  4REF A;  1BSX A;  3FEJ A;  1IE9 A;  1H9U A;  2ZXM A;  2OVM A;  3GWX A;  3UU7 B;  4E4K A;  1S9Q A;  1P8D A;  1U3Q A;  2YLY A;  3DT3 A;  2J7X A;  3G0W A;  2ZK4 A;  3IXP D;  3OZ0 A;  4G1Z A;  5G46 A;  2AAX A;  4FHH A;  2VV0 A;  5G45 A;  3H52 A;  3QT0 A;  4DOR A;  4CI5 A;  5DI7 A;  3W0Y A;  2Q7L A;  1R20 D;  4OKB A;  2G44 A;  3FXV A;  2Q7J A;  1XZX X;  5HZC A;  1T7F A;  1GWR A;  4MGD A;  3PBA A;  1UHL A;  2V7C A;  3PCU A;  2ZFX A;  4QE8 A;  3VRV A;  3VTD A;  5DV3 A;  3AN3 A;  4LBD A;  5AVL A;  1XLS A;  2Q70 A;  2ZMH A;  4ZNU A;  3B0W A;  2NXX E;  4XUH A;  5KRC A;  2HVC A;  1FM9 A;  3CJW A;  3GD2 A;  4PP3 A;  3PEQ A;  1K74 D;  2I0G A;  3CLD A;  4OEY A;  4A4V A;  3ADT A;  1ZDT A;  4ZO1 B;  3BC5 A;  4LNW A;  3WT7 A;  5DXP A;  1U3R A;  4RAK A;  5G5W A;  5KCD A;  2VST A;  2QA6 A;  3DZY D;  2Q5P A;  4RME A;  5KRK A;  1TXI A;  5DUG A;  5ACC A;  2YLO A;  5K13 A;  4MG7 B;  3L0E A;  1RJK A;  5DWE A;  2G0H A;  4PP6 A;  2W8Y A;  1Z5X U;  5AWJ A;  4OJB A;  2AM9 A;  2O4J A;  1X76 A;  3FAL B;  4RMC A;  3ADX A;  4MG5 A;  3K6P A;  2I4J A;  4J5X A;  4X1F A;  1PQC A;  5KRM A;  1U9E A;  2Z4B A;  2VV3 A;  3V3E A;  5I4V A;  2H77 A;  2ZK6 A;  1FCY A;  2ZL9 A;  2PIW A;  2NW4 A;  4J26 A;  5DKS A;  2P4Y A;  2J14 A;  1RKG A;  3TX7 B;  2QXS A;  5EJV A;  5DX3 A;  3OOK A;  4PVU A;  1T74 A;  1XP9 A;  4MG8 B;  3A2I A;  4QJR A;  2AMA A;  4KZJ A;  1XV9 A;  5DXB B;  5HCV A;  4OZR U;  1ILH A;  3UU7 A;  2JFA B;  2OZ7 A;  1EXX A;  1X7J A;  4JYH A;  4ZNV A;  3D6D A;  4OK1 A;  5G44 A;  2B23 A;  4M8H A;  3RUT A;  3A2H A;  3GWS X;  2PRG A;  4OFR A;  2AYR A;  4IW6 A;  5DWG A;  3G8I A;  4NQA B;  3GBK A;  2IHQ A;  3OS8 C;  1YJE A;  2AA2 A;  3RY9 A;  5DZ0 A;  4NY9 A;  2YJD A;  5AWK A;  3V3Q A;  1PQ6 A;  3L1B A;  2YLP A;  4P6W A;  1X7R A;  3CWD A;  3DCU A;  3B65 A;  3CDS A;  1XB7 A;  4O8F A;  3KYT A;  3VT7 A;  4RUO X;  3D5F A;  2IOG A;  1NHZ A;  4ZNS A;  1YIM A;  5DVV A;  3W0A A;  3ZRB A;  5KCW A;  1I37 A;  1XP6 A;  2XHS A;  3OSI A;  5GIC A;  3AUQ A;  3VI8 A;  3WT6 A;  3MNP A;  4R6S A;  3VRT A;  2E2R A;  4ZI1 A;  5DXK A;  5L7G A;  1IE8 A;  3NSQ A;  4PLE A;  4ZNH A;  2Q59 B;  3GZ9 A;  2H79 A;  1R5K A;  5HYK A;  2ZLA A;  3ERD A;  3O1D A;  2QTU A;  5DLR A;  4JYG A;  1FM6 D;  4ONI A;  5ETH A;  4B7W A;  4ZN9 A;  1M13 A;  1NQ0 A;  1XLS E;  5APJ A;  3V9T A;  2ZK0 A;  2Q7I A;  1DB1 A;  1L2I A;  4MG7 A;  4OGH A;  3B66 A;  1T63 A;  1OSH A;  3CQV A;  4Y29 A;  4DM6 A;  3MNO A;  4IS8 A;  4RWV A;  4G2H A;  2ZK1 A;  2AA5 A;  3HVL A;  3DY6 A;  2GPP A;  3FAL A;  4J5W A;  2Q6J A;  2ZLC A;  3FUG A;  2Q5G A;  5GT4 A;  3VT8 A;  2Z4J A;  3HQ5 A;  1X7E A;  4JYI A;  4ZOM A;  5EIT A;  3KDT A;  4J5X C;  2AWH A;  1YOK A;  3OMK A;  1EXA A;  5ICK A;  3WFF A;  1PQ9 A;  2P15 A;  2AB2 A;  4CSJ A;  1RK3 A;  1RKH A;  3N00 A;  2HB8 A;  2PIT A;  3IA6 A;  3B68 A;  1X78 A;  4FGY A;  2VV2 A;  4ITE A;  3B0R A;  4UDA A;  3OLL A;  4POH A;  4MG8 A;  3R8D A;  4XLD A;  5DXB A;  3P89 A;  2JFA A;  5DRM A;  4ITF A;  3V9V A;  4TUZ B;  3ERT A;  2GIU A;  3X1H A;  3VRW A;  3OMM A;  3W0G A;  1R1K A;  4IQR A;  1SKX A;  1YYE A;  3ADV A;  4WQP A;  1FD0 A;  2R40 D;  1QKM A;  3KFC A;  2P7Z A;  3ADU A;  3GYU A;  4IU7 A;  3BQD A;  5DX3 B;  4APU A;  2QE4 A;  1XV9 B;  3ZR7 A;  2G0G A;  3E7C A;  3LBD A;  3VSP A;  5DY8 A;  3W0J A;  5IXK A;  4RUJ A;  3VTC A;  4OH5 A;  2HAR A;  5FQS A;  5JY3 A;  2P7A A;  3OS8 A;  5KYJ A;  3NOA A;  3VT4 A;  4DQM A;  3TY0 A;  1T7T A;  4MG6 A;  4G1D A;  5E19 A;  3A3Z X;  2OVH A;  4IA3 A;  2R6W A;  3EYB A;  3M7R A;  2J4A A;  5FQV A;  3W0I A;  5KRO A;  2Q59 A;  2Q1V A;  3K23 A;  1NAX A;  3SP9 A;  3OMQ A;  3HM1 A;  2GPU A;  2AA7 A;  5M96 A;  5H1E A;  2AA6 A;  3OKH A;  4RZF A;  5LWP A;  1ZDU A;  1S19 A;  1E3G A;  2QH6 A;  5DRJ A;  1NYX A;  2QA8 B;  3IXP A;  5DKE A;  1XVP B;  2AX6 A;  2J7Y A;  4IVW A;  3OMP A;  4JAZ A;  5AZT A;  4OAR A;  4WLB A;  4A2J A;  2QGW A;  1GS4 A;  4OC7 A;  5AZV A;  2ZK5 A;  4DM8 A;  1N4H A;  4ZJR A;  4PLD A;  2XKW A;  2NV7 A;  1R20 A;  3D90 A;  5FQR A;  4J5W C;  4PPS A;  4XI3 A;  4MGB B;  5DUH A;  4N8R A;  3E00 D;  4PRG A;  2A3I A;  3JZB A;  3CS4 A;  2P7G A;  3OZJ A;  1KKQ A;  1YMT A;  2POB A;  5B41 A;  1YP0 A;  2PIX A;  5DZH A;  3IPS A;  4MGC A;  1NDE A;  3HO0 A;  4ZJW A;  1E3K A;  1T79 A;  1T73 A;  1XOW A;  1I7I A;  3HC6 A;  4ZNT A;  2GPV A;  5IAW A;  3F5C B;  4YNK A;  5FQP A;  1TFC A;  3X31 A;  5KRI A;  1XAP A;  1U3S A;  4TUZ A;  3L3X A;  1XIU A;  2AMB A;  1YIN A;  3IPU A;  4HEE X;  3A9E B;  3G8O A;  4PWL A;  2P1V A;  1K74 A;  4IWF A;  5KRF A;  3X1I A;  3K8S A;  5AK2 A;  2P1U A;  2B1V A;  3ADW A;  2ZKC A;  4K7A A;  2IOK A;  3DZU D;  5EC9 A;  5KR9 A;  4S0T A;  5KRL A;  1M2Z A;  2FSZ A;  4OED A;  2ZK3 A;  3E00 A;  3CS8 A;  5DYD A;  2JF9 A;  2XYJ A;  4G2I A;  2BJ4 B;  3V9Y A;  3OOF A;  3PRG A;  1NQ1 A;  2HFP A;  1PRG A;  1M7W A;  1HJ1 A;  1UOM A;  4OZT E;  5E0X A;  4S14 A;  1YOW A;  5DV8 A;  5FQT A;  4CI4 A;  1NQ2 A;  5KCT A;  3A2J A;  2QMV A;  2AXA A;  3FC6 B;  4JL4 A;  3W0C A;  5DXM A;  3P8X A;  4EMA A;  5DMF A;  2POG A;  3ET1 A;  5DL4 A;  2PIV A;  3VJS A;  2ZNP A;  3O1E A;  2QAB A;  4REE A;  3WT5 A;  4POJ A;  1XDK B;  2Q5S A;  3OSA A;  5KRA A;  4NIE A;  1ZKY A;  4YT1 A;  3R5M A;  4XTA A;  3HZF A;  5E15 A;  3ILZ A;  4J24 A;  2ACL B;  2ZMI A;  2REW A;  1UPW A;  2QA8 A;  2EWP A;  3B3K A;  5EGV A;  1XVP A;  5JI0 D;  1GWQ A;  5AYG A;  2OAX A;  5A86 A;  3RVF A;  1GWX A;  3L0L A;  4ZNW A;  5LGA A;  1I38 A;  1KV6 A;  2ZXN A;  2HB7 A;  3P0U A;  2PIP L;  3Q95 A;  5GIE A;  3WWR A;  3UUD A;  4S15 A;  3DR1 A;  4MGB A;  5DK9 A;  2HCD A;  5G42 A; 
#chains in the Genus database with same CATH homology
 1YY4 A;  3VT3 A;  4R2U A;  4UDB A;  5JJM B;  3E94 A;  1VJB A;  5DVS A;  4OLM A;  3W0H A;  3W5R A;  2HBH A;  1ZGY A;  5E14 A;  3F5C A;  3VT5 A;  2F4B A;  2ABI A;  2VV4 A;  4G20 A;  1G1U A;  5HJP A;  5G43 A;  4G1Y A;  2GPO A;  2ZY0 A;  1XNX A;  3CS6 A;  3W5Q A;  2OM9 A;  4R06 A;  3R2A A;  4L98 A;  4MGA B;  1T7M A;  2I4P A;  2PKL A;  3A9E A;  2QGT A;  4IV4 A;  4NUF A;  3UUC A;  1L2J A;  4K4J A;  4UDD A;  2Q6S A;  1FM6 A;  3K22 A;  4DK8 A;  4F9M A;  1S0X A;  4WPF A;  1FCZ A;  3OGT A;  5C4S A;  3KBA A;  4QK4 A;  5DP0 A;  3IMY A;  4S0S A;  3AZ2 A;  4MDD A;  3ET0 A;  3WGP A;  1RDT D;  4OZT U;  4FHI A;  3NSP A;  3VTB A;  3ZQT A;  2BJ4 A;  2VV1 B;  4Q13 A;  5DSH A;  4XT9 A;  3VJH A;  5DWJ A;  5L11 A;  5L7E A;  1N83 A;  3BEJ A;  3CDP A;  1G5Y A;  1XNN A;  3HOD A;  3AUR A;  2Q3Y A;  4IWC A;  5APH A;  4JGV A;  3B5R A;  1YUC A;  1OT7 A;  3V4A A;  4ZN7 A;  4RZE A;  1NQ7 A;  4YMQ A;  1FCX A;  2OCF A;  1MVC A;  3FC6 A;  2R6Y A;  3L3Z A;  4RZG A;  1T76 A;  5L7H A;  5KRH A;  4OEZ A;  5C4U A;  3GN8 A;  1QKU A;  1OVL B;  2GP7 A;  4A4W A;  1Q4X A;  1XDK A;  1ILG A;  4RMD A;  3SP6 A;  3UP0 A;  2HWR A;  2Q1H A;  4WHG A;  3GYT A;  2B50 A;  5DXE A;  4IVY A;  1PCG A;  2ACL A;  2FAI A;  4XUM A;  4YPQ A;  3AUN A;  3UUA B;  3HLV A;  2QSE A;  3KPZ A;  2PNU A;  4DOS A;  3UVV B;  1FM9 D;  5DV6 A;  5DTV A;  3A78 A;  1PK5 A;  3RLL A;  3FLI A;  2R40 A;  5DVC A;  3V49 A;  2Q61 A;  1XP1 A;  1ZEO A;  4HLW A;  5KRJ A;  4RE8 A;  5JJM A;  5E1C A;  5DWL A;  3WTQ A;  4NB6 A;  2ZMJ A;  4OZR E;  3OKI A;  1SR7 A;  4FN9 A;  5C4T A;  2ZAS A;  1XJ7 A;  3KMR A;  2QW4 A;  3D24 A;  2PIO A;  3Q95 B;  1SQN A;  1WM0 X;  3UUD B;  4N5G A;  3U9Q A;  3D57 A;  2AX9 A;  2PIN A;  4G21 A;  3KMZ A;  5DXG A;  1QKN A;  2PIU A;  3ET2 A;  5DXQ A;  4MGA A;  4OJ9 A;  4IA7 A;  5E7V A;  2LBD A;  1NUO A;  1PZL A;  2GWX A;  2O9I A;  2GL8 A;  3DZY A;  3KWY A;  3WMH A;  3G9E A;  5AAU A;  4Q0A C;  5DIG A;  5KCF A;  2YHD A;  1ERR A;  2PJL A;  2VV4 B;  1ZUC A;  2ZXZ A;  4KZI A;  4MG9 B;  4P6X A;  4PP5 A;  4QL8 A;  5GID A;  3VHV A;  5HJP B;  2OUZ A;  3AZ1 A;  3VT6 A;  2V0V A;  5AAV A;  3R8A A;  4K6I A;  2VV1 A;  3PO9 A;  5KCU A;  3B0T A;  5DZ3 A;  4LNX A;  3AX8 A;  4M8E A;  2P54 A;  5KCC A;  3DCT A;  2AO6 A;  2YLQ A;  5SYZ A;  4N73 A;  4TV1 B;  5DU5 A;  4E2J A;  1KNU A;  4RFW A;  1XQ3 A;  3S9S A;  4OEA A;  1XPC A;  1YA3 A;  1LBD A;  3VSO A;  2AX7 A;  2O4R A;  2PIR A;  3A40 X;  3B1M A;  1OVL A;  2ATH A;  2GTK A;  2HAS A;  3AFR A;  4OKX A;  4PPP A;  5HJS A;  2I0J A;  3AZ3 A;  2Q8S A;  2AX8 A;  4OKT A;  1K4W A;  4ZO1 X;  3ZRA A;  2Q6R A;  3L0J A;  1G50 A;  1ZH7 A;  2ZNQ A;  2YJA B;  3RUU A;  2QZO B;  3KDU A;  1DKF B;  4QM0 A;  5EHJ A;  2Q7K A;  3F7D A;  5APK A;  1Y0X X;  5F9B A;  3UUA A;  2P1T A;  5G3J A;  5AVI A;  3WJ4 A;  3VHU A;  3H0A D;  3UVV A;  4OHA A;  3VRU A;  2B1Z A;  5DKB A;  4IV2 A;  1ZAF A;  3LMP A;  4WHF A;  1I7G A;  1MZN A;  1K7L A;  2YFE A;  3OLF A;  4IA2 A;  4WVD A;  3DZU A;  2NPA A;  1P93 A;  4FNE A;  5DWI A;  4OIL A;  2Q60 A;  2ZNN A;  3JZC A;  5DUE A;  2ZNO A;  3X36 A;  3OSW A;  1XQC A;  2QR9 A;  5EI1 A;  3TKM A;  3R8I A;  1N46 A;  4UDC A;  1LV2 A;  3WFG A;  2HAM A;  4LSJ A;  2QPY A;  2I4Z A;  1A28 A;  4KZM A;  1NRL A;  3OAP A;  2JJ3 A;  5E0W A;  4OFU A;  1QKT A;  4OIV A;  3VJT A;  3CTB A;  3OLS A;  2ZBS A;  5DID A;  3UP3 A;  2NXX A;  3VJI A;  1FBY A;  1Y0S A;  2XYW A;  3H0A A;  1MV9 A;  5IZ0 A;  1X7B A;  1A52 A;  3ET3 A;  3P88 A;  3VT9 A;  1NAV A;  3VHW A;  5B5B A;  3VN2 A;  4MGD B;  4MG9 A;  3ADS A;  5DXR A;  5CJ6 A;  4QE6 A;  1UHL B;  1T7R A;  1PDU A;  1R6G A;  5DIE A;  4L96 A;  4PF3 A;  5C4O A;  1T65 A;  1Y9R A;  5DYB A;  3OMO A;  4OKW A;  3SZ1 A;  2QXM A;  4OIU A;  3R5N A;  2BAW A;  2XYX A;  4PXM A;  4XAO A;  3MNE A;  1SJ0 A;  2PIQ A;  4N1Y A;  2HC4 A;  5KD9 A;  4TV1 A;  2HWQ A;  1OSV A;  4OJ4 A;  4EM9 A;  2QNV A;  1R1K D;  5KYA A;  3OS9 A;  5AAV B;  2YAT A;  5DMC A;  4DK7 A;  2ZK2 A;  5DZ1 A;  1ERE A;  5KCE A;  3W5P A;  2QZO A;  2VSR A;  1DKF A;  1S0Z A;  3B0Q A;  5DZI A;  3FEI A;  2FVJ A;  4IW8 A;  4XHD A;  4LTW A;  5HYR A;  1S9P A;  3W5T A;  1Z95 A;  3RLJ A;  3AN4 A;  3HC5 A;  3TKC A;  3WJ5 A;  1HG4 A;  1T5Z A;  1Z5X E;  4BCR A;  2ZVT A;  3B67 A;  3PLZ A;  4IA1 A;  4X1G A;  3KMG A;  4IUI A;  1UPV A;  4DMA A;  4E4Q A;  3R29 A;  4RUP A;  3T03 A;  3IPQ A;  2G5O A;  3L03 A;  1G2N A;  3FUR A;  4Q50 A;  5DKG A;  3FS1 A;  4OH6 A;  1RDT A;  4REF A;  1BSX A;  3FEJ A;  1IE9 A;  1H9U A;  2ZXM A;  2OVM A;  3GWX A;  3UU7 B;  4E4K A;  1S9Q A;  1P8D A;  1U3Q A;  2YLY A;  3DT3 A;  2J7X A;  3G0W A;  2ZK4 A;  3IXP D;  3OZ0 A;  4G1Z A;  5G46 A;  2AAX A;  4FHH A;  2VV0 A;  5G45 A;  3H52 A;  3QT0 A;  4DOR A;  4CI5 A;  5DI7 A;  3W0Y A;  2Q7L A;  1R20 D;  4OKB A;  2G44 A;  3FXV A;  2Q7J A;  1XZX X;  5HZC A;  1T7F A;  1GWR A;  4MGD A;  3PBA A;  1UHL A;  2V7C A;  3PCU A;  2ZFX A;  4QE8 A;  3VRV A;  3VTD A;  5DV3 A;  3AN3 A;  4LBD A;  5AVL A;  1XLS A;  2Q70 A;  2ZMH A;  4ZNU A;  3B0W A;  2NXX E;  4XUH A;  5KRC A;  2HVC A;  1FM9 A;  3CJW A;  3GD2 A;  4PP3 A;  3PEQ A;  1K74 D;  2I0G A;  3CLD A;  4OEY A;  4A4V A;  3ADT A;  1ZDT A;  4ZO1 B;  3BC5 A;  4LNW A;  3WT7 A;  5DXP A;  1U3R A;  4RAK A;  5G5W A;  5KCD A;  2VST A;  2QA6 A;  3DZY D;  2Q5P A;  4RME A;  5KRK A;  1TXI A;  5DUG A;  5ACC A;  2YLO A;  5K13 A;  4MG7 B;  3L0E A;  1RJK A;  5DWE A;  2G0H A;  4PP6 A;  2W8Y A;  1Z5X U;  5AWJ A;  4OJB A;  2AM9 A;  2O4J A;  1X76 A;  3FAL B;  4RMC A;  3ADX A;  4MG5 A;  3K6P A;  2I4J A;  4J5X A;  4X1F A;  1PQC A;  5KRM A;  1U9E A;  2Z4B A;  2VV3 A;  3V3E A;  5I4V A;  2H77 A;  2ZK6 A;  1FCY A;  2ZL9 A;  2PIW A;  2NW4 A;  4J26 A;  5DKS A;  2P4Y A;  2J14 A;  1RKG A;  3TX7 B;  2QXS A;  5EJV A;  5DX3 A;  3OOK A;  4PVU A;  1T74 A;  1XP9 A;  4MG8 B;  3A2I A;  4QJR A;  2AMA A;  4KZJ A;  1XV9 A;  5DXB B;  5HCV A;  4OZR U;  1ILH A;  3UU7 A;  2JFA B;  2OZ7 A;  1EXX A;  1X7J A;  4JYH A;  4ZNV A;  3D6D A;  4OK1 A;  5G44 A;  2B23 A;  4M8H A;  3RUT A;  3A2H A;  3GWS X;  2PRG A;  4OFR A;  2AYR A;  4IW6 A;  5DWG A;  3G8I A;  4NQA B;  3GBK A;  2IHQ A;  3OS8 C;  1YJE A;  2AA2 A;  3RY9 A;  5DZ0 A;  4NY9 A;  2YJD A;  5AWK A;  3V3Q A;  1PQ6 A;  3L1B A;  2YLP A;  4P6W A;  1X7R A;  3CWD A;  3DCU A;  3B65 A;  3CDS A;  1XB7 A;  4O8F A;  3KYT A;  3VT7 A;  4RUO X;  3D5F A;  2IOG A;  1NHZ A;  4ZNS A;  1YIM A;  5DVV A;  3W0A A;  3ZRB A;  5KCW A;  1I37 A;  1XP6 A;  2XHS A;  3OSI A;  5GIC A;  3AUQ A;  3VI8 A;  3WT6 A;  3MNP A;  4R6S A;  3VRT A;  2E2R A;  4ZI1 A;  5DXK A;  5L7G A;  1IE8 A;  3NSQ A;  4PLE A;  4ZNH A;  2Q59 B;  3GZ9 A;  2H79 A;  1R5K A;  5HYK A;  2ZLA A;  3ERD A;  3O1D A;  2QTU A;  5DLR A;  4JYG A;  1FM6 D;  4ONI A;  5ETH A;  4B7W A;  4ZN9 A;  1M13 A;  1NQ0 A;  1XLS E;  5APJ A;  3V9T A;  2ZK0 A;  2Q7I A;  1DB1 A;  1L2I A;  4MG7 A;  4OGH A;  3B66 A;  1T63 A;  1OSH A;  3CQV A;  4Y29 A;  4DM6 A;  3MNO A;  4IS8 A;  4RWV A;  4G2H A;  2ZK1 A;  2AA5 A;  3HVL A;  3DY6 A;  2GPP A;  3FAL A;  4J5W A;  2Q6J A;  2ZLC A;  3FUG A;  2Q5G A;  5GT4 A;  3VT8 A;  2Z4J A;  3HQ5 A;  1X7E A;  4JYI A;  4ZOM A;  5EIT A;  3KDT A;  4J5X C;  2AWH A;  1YOK A;  3OMK A;  1EXA A;  5ICK A;  3WFF A;  1PQ9 A;  2P15 A;  2AB2 A;  4CSJ A;  1RK3 A;  1RKH A;  3N00 A;  2HB8 A;  2PIT A;  3IA6 A;  3B68 A;  1X78 A;  4FGY A;  2VV2 A;  4ITE A;  3B0R A;  4UDA A;  3OLL A;  4POH A;  4MG8 A;  3R8D A;  4XLD A;  5DXB A;  3P89 A;  2JFA A;  5DRM A;  4ITF A;  3V9V A;  4TUZ B;  3ERT A;  2GIU A;  3X1H A;  3VRW A;  3OMM A;  3W0G A;  1R1K A;  4IQR A;  1SKX A;  1YYE A;  3ADV A;  4WQP A;  1FD0 A;  2R40 D;  1QKM A;  3KFC A;  2P7Z A;  3ADU A;  3GYU A;  4IU7 A;  3BQD A;  5DX3 B;  4APU A;  2QE4 A;  1XV9 B;  3ZR7 A;  2G0G A;  3E7C A;  3LBD A;  3VSP A;  5DY8 A;  3W0J A;  5IXK A;  4RUJ A;  3VTC A;  4OH5 A;  2HAR A;  5FQS A;  5JY3 A;  2P7A A;  3OS8 A;  5KYJ A;  3NOA A;  3VT4 A;  4DQM A;  3TY0 A;  1T7T A;  4MG6 A;  4G1D A;  5E19 A;  3A3Z X;  2OVH A;  4IA3 A;  2R6W A;  3EYB A;  3M7R A;  2J4A A;  5FQV A;  3W0I A;  5KRO A;  2Q59 A;  2Q1V A;  3K23 A;  1NAX A;  3SP9 A;  3OMQ A;  3HM1 A;  2GPU A;  2AA7 A;  5M96 A;  5H1E A;  2AA6 A;  3OKH A;  4RZF A;  5LWP A;  1ZDU A;  1S19 A;  1E3G A;  2QH6 A;  5DRJ A;  1NYX A;  2QA8 B;  3IXP A;  5DKE A;  1XVP B;  2AX6 A;  2J7Y A;  4IVW A;  3OMP A;  4JAZ A;  5AZT A;  4OAR A;  4WLB A;  4A2J A;  2QGW A;  1GS4 A;  4OC7 A;  5AZV A;  2ZK5 A;  4DM8 A;  1N4H A;  4ZJR A;  4PLD A;  2XKW A;  2NV7 A;  1R20 A;  3D90 A;  5FQR A;  4J5W C;  4PPS A;  4XI3 A;  4MGB B;  5DUH A;  4N8R A;  3E00 D;  4PRG A;  2A3I A;  3JZB A;  3CS4 A;  2P7G A;  3OZJ A;  1KKQ A;  1YMT A;  2POB A;  5B41 A;  1YP0 A;  2PIX A;  5DZH A;  3IPS A;  4MGC A;  1NDE A;  3HO0 A;  4ZJW A;  1E3K A;  1T79 A;  1T73 A;  1XOW A;  1I7I A;  3HC6 A;  4ZNT A;  2GPV A;  5IAW A;  3F5C B;  4YNK A;  5FQP A;  1TFC A;  3X31 A;  5KRI A;  1XAP A;  1U3S A;  4TUZ A;  3L3X A;  1XIU A;  2AMB A;  1YIN A;  3IPU A;  4HEE X;  3A9E B;  3G8O A;  4PWL A;  2P1V A;  1K74 A;  4IWF A;  5KRF A;  3X1I A;  3K8S A;  5AK2 A;  2P1U A;  2B1V A;  3ADW A;  2ZKC A;  4K7A A;  2IOK A;  3DZU D;  5EC9 A;  5KR9 A;  4S0T A;  5KRL A;  1M2Z A;  2FSZ A;  4OED A;  2ZK3 A;  3E00 A;  3CS8 A;  5DYD A;  2JF9 A;  2XYJ A;  4G2I A;  2BJ4 B;  3V9Y A;  3OOF A;  3PRG A;  1NQ1 A;  2HFP A;  1PRG A;  1M7W A;  1HJ1 A;  1UOM A;  4OZT E;  5E0X A;  4S14 A;  1YOW A;  5DV8 A;  5FQT A;  4CI4 A;  1NQ2 A;  5KCT A;  3A2J A;  2QMV A;  2AXA A;  3FC6 B;  4JL4 A;  3W0C A;  5DXM A;  3P8X A;  4EMA A;  5DMF A;  2POG A;  3ET1 A;  5DL4 A;  2PIV A;  3VJS A;  2ZNP A;  3O1E A;  2QAB A;  4REE A;  3WT5 A;  4POJ A;  1XDK B;  2Q5S A;  3OSA A;  5KRA A;  4NIE A;  1ZKY A;  4YT1 A;  3R5M A;  4XTA A;  3HZF A;  5E15 A;  3ILZ A;  4J24 A;  2ACL B;  2ZMI A;  2REW A;  1UPW A;  2QA8 A;  2EWP A;  3B3K A;  5EGV A;  1XVP A;  5JI0 D;  1GWQ A;  5AYG A;  2OAX A;  5A86 A;  3RVF A;  1GWX A;  3L0L A;  4ZNW A;  5LGA A;  1I38 A;  1KV6 A;  2ZXN A;  2HB7 A;  3P0U A;  2PIP L;  3Q95 A;  5GIE A;  3WWR A;  3UUD A;  4S15 A;  3DR1 A;  4MGB A;  5DK9 A;  2HCD A;  5G42 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...