1NYXA

Ligand binding domain of the human peroxisome proliferator activated receptor gamma in complex with an agonist
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
275
structure length
260
Chain Sequence
DQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synthesis and biological and structural characterization of the dual-acting peroxisome proliferator-activated receptor alpha/gamma agonist ragaglitazar
pubmed doi rcsb
molecule keywords peroxisome proliferator activated receptor gamma
molecule tags Transcription
source organism Homo sapiens
total genus 95
structure length 260
sequence length 275
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 1nyxA00
3GWXA 1XV9B 2I4ZA 4PP6A 5G43A 2Q3YA 3L3ZA 3JZBA 5KRHA 2NV7A 1I7IA 2W8YA 3AN3A 4Y29A 1S19A 2P54A 4UDAA 1XLSE 2Q5GA 3B68A 5HJSA 3TY0A 3W0AA 4DM8A 1UHLA 4S0SA 2H77A 4X1GA 4J24A 4NY9A 2POGA 4MG7B 3LBDA 3RVFA 2ZMJA 2GL8A 2PIUA 3ADVA 4JGVA 3H0AA 4N8RA 2ZFXA 2VV4B 3K22A 4IA7A 3PLZA 3B0WA 4J26A 3FC6A 5G42A 2OZ7A 2P1UA 1U3SA 2Q6SA 4POHA 3VJIA 3W0JA 5DXBB 1I38A 3R8DA 5C4OA 2VV1B 1PQCA 5KCFA 3W0IA 1H9UA 3AURA 1Z5XU 2QXSA 4QM0A 4G1DA 3FEIA 5DMFA 1SKXA 4NB6A 2R6WA 4MGBA 3KFCA 4X1FA 5DXRA 5KRLA 4IA1A 4IW6A 3Q95B 3OMOA 4RFWA 5G44A 1GWXA 4R2UA 2GPUA 2ATHA 2GPVA 2NXXE 2ZL9A 1L2JA 4PXMA 4KZJA 4PP5A 4OJ9A 2VSTA 3HM1A 1ZUCA 1HJ1A 3ERDA 4G21A 3VT7A 2R6YA 2PJLA 3V3QA 1E3KA 1QKTA 3OKHA 4J5XA 1XNNA 5JY3A 4YPQA 1UPVA 2ZKCA 4RAKA 4EMAA 2QZOA 2ZK1A 5G46A 3W0YA 2O4RA 4ZO1B 5DV8A 3G8OA 4CI5A 5DYBA 2Q1HA 1XDKA 2YJAB 3ET2A 4RE8A 2JFAB 4MG9B 3HQ5A 2Z4JA 1ZH7A 5IAWA 4IVWA 3GBKA 2PKLA 4N73A 4OEDA 5DWLA 5KRAA 1PCGA 5DVVA 2AYRA 4J5WA 1ZDUA 3W0HA 1QKNA 3ZRAA 2I4JA 1U3RA 3VJHA 5I4VA 4TV1B 5DZ3A 1FCYA 2ZLAA 3B67A 3L3XA 3ADSA 3VSOA 2PIPL 2REWA 1LBDA 3A40X 1XP1A 2AX8A 3VT9A 2P4YA 1XQ3A 3R5NA 2ABIA 3D90A 1X7BA 3PRGA 3B1MA 5AWJA 5K13A 4K4JA 1FBYA 4OH5A 2G0HA 3L0EA 2QGWA 5DK9A 3F5CA 3KBAA 1K74A 1XP6A 2BAWA 3AUNA 2HARA 3F7DA 3L0JA 2PINA 1M2ZA 2QH6A 3CDSA 4MGDB 4ZI1A 5EC9A 1NAVA 4R06A 1GS4A 5A86A 1NDEA 5DMCA 3HZFA 4Q50A 2QTUA 3KWYA 1G1UA 1T63A 4PVUA 4OKTA 5ETHA 1XOWA 3A78A 2ACLA 5AVLA 3DZUA 3DZUD 1XV9A 3WGPA 4OLMA 3W5PA 3X1HA 2P1TA 5KYJA 3VJSA 4R6SA 3AUQA 3R29A 1RJKA 1FM6D 2J14A 5DXGA 2V0VA 3UUAB 3W5QA 5B41A 2ZK4A 4KZIA 1M7WA 2ZNPA 4MG7A 5FQSA 3V3EA 2ZXMA 4LSJA 5HZCA 1FCXA 4E2JA 4S0TA 5DVCA 3IPQA 3MNOA 4TUZB 5APKA 3WWRA 1OSHA 5DZ1A 2VV4A 3KDUA 4G20A 2AM9A 3ILZA 1XDKB 2QXMA 4JYHA 4LTWA 4Q13A 3WT6A 4OC7A 2VV1A 4PP3A 3CLDA 3V4AA 1A52A 4XI3A 4IVYA 2HCDA 3D57A 5DXMA 1XIUA 4MG5A 3X1IA 4J5XC 4UDDA 4WPFA 4ZO1X 2HWQA 4G2HA 3Q95A 3WT7A 4PLDA 3K23A 4ZNTA 1U3QA 3G9EA 4PF3A 3AZ2A 3HLVA 3EYBA 5HYKA 3M7RA 1UOMA 5DIEA 3TKCA 3VHWA 4XUMA 1YP0A 3LMPA 3VRUA 2JF9A 3P89A 1XP9A 3VTCA 1T7MA 1NRLA 2Q7JA 1DKFB 3OGTA 4J5WC 4RZEA 4DMAA 4FHHA 3GYUA 1PQ9A 3G8IA 1P8DA 1YOKA 2BJ4B 2B23A 1U9EA 2JFAA 2XYJA 2AMBA 3IA6A 4MG9A 2HAMA 4QK4A 5EHJA 1NHZA 4IS8A 4RUJA 2Q59B 2VV3A 4YMQA 3OOKA 1KKQA 2QMVA 1N46A 3WTQA 4TV1A 2Q6RA 4RMCA 1MV9A 3NSQA 3V9YA 5DVSA 2G0GA 2QA6A 3DR1A 4HLWA 5AYGA 5KRMA 1NAXA 1WM0X 4CI4A 2QNVA 1Y0XX 4WHFA 2LBDA 1ZKYA 5APHA 5L7GA 3OLFA 4S15A 1YY4A 4Q0AC 5C4SA 3RUUA 2G5OA 3H52A 3MNEA 1YOWA 1T5ZA 4ZOMA 5FQVA 4MGDA 5JJMB 3OSIA 3VHVA 2ZK3A 2Q7LA 1PZLA 2QSEA 1S0ZA 2PIXA 3VRTA 1EXXA 1K7LA 1ZDTA 2PIWA 4MGAB 3VN2A 5H1EA 2AX6A 1G50A 1Y0SA 4JYGA 5AVIA 4XT9A 3OMMA 3FS1A 3T03A 4REEA 5DXKA 5DUHA 3V9VA 2OCFA 3OKIA 2AMAA 2OVMA 4XLDA 3HC5A 3WFFA 3R2AA 4OILA 3ET1A 1FCZA 1M13A 4IA3A 2GTKA 4RMEA 4ONIA 5CJ6A 3UUAA 5DUEA 3DT3A 1L2IA 4RWVA 4JYIA 5DIGA 1Z95A 2P7GA 2QGTA 3OOFA 3FALB 3N00A 2HASA 4FNEA 3GN8A 4WVDA 2PIQA 4TUZA 2AAXA 2ZMHA 4OEZA 3ADWA 5DKSA 4B7WA 3AFRA 4A4VA 4EM9A 5DX3B 1NYXA 3HODA 3KYTA 3AZ3A 3JZCA 1T74A 3G0WA 5GIDA 2Q60A 3KPZA 3PO9A 4IW8A 1QKMA 1T7TA 2F4BA 2OVHA 2V7CA 3UVVA 3D6DA 2B1ZA 1T73A 4OFRA 2HC4A 3CWDA 4L96A 3VHUA 3V9TA 1PRGA 5F9BA 5ICKA 5FQRA 2XYWA 1R1KD 3B0RA 1R1KA 3B0QA 3GYTA 3OZ0A 1DB1A 1XQCA 3L1BA 4OJBA 2YLYA 5DKGA 3VTBA 4IQRA 5HYRA 5DZ0A 2AX9A 1DKFA 5AAUA 4RUPA 1XNXA 5L7HA 3PEQA 3P0UA 4BCRA 5DX3A 2BJ4A 2YATA 5EGVA 2J7YA 2QPYA 3VJTA 3OSWA 2P1VA 2Q59A 3OMKA 2Z4BA 4QE6A 4JAZA 1EXAA 5E14A 4POJA 4XUHA 5C4UA 3QT0A 5KYAA 5KROA 3L0LA 3VTDA 1YIMA 4OEYA 5DRJA 1RKHA 5C4TA 4MG8B 3B5RA 2ZASA 2ZMIA 5DYDA 1IE9A 1FM6A 2HB8A 3OS9A 1A28A 4ZNSA 2XYXA 2HWRA 5DSHA 2GPPA 4IU7A 5KRFA 2AB2A 2B1VA 3KMRA 5DIDA 1MZNA 3VRWA 1I7GA 4ITFA 1BSXA 2HFPA 1G5YA 4M8EA 5AAVB 1E3GA 3CS4A 4P6XA 4N1YA 4OJ4A 1R6GA 5DXPA 2AA7A 4JL4A 4KZMA 3FLIA 3VT5A 2I4PA 5JJMA 4S14A 1TFCA 2GP7A 4XAOA 5FQTA 1RK3A 2YJDA 4FN9A 5EI1A 4ZN9A 1RDTA 2GIUA 2GPOA 3B3KA 4A2JA 4CSJA 5ACCA 1NQ7A 2AA2A 3AN4A 4MGAA 3W5RA 4PPPA 3IPUA 3B0TA 3O1EA 5KRIA 1GWQA 3UVVB 5DLRA 5DWEA 3S9SA 2E2RA 2ZBSA 2Q7KA 4LNXA 3FXVA 4OIUA 5AK2A 3W0CA 2QABA 3DCTA 2H79A 3R5MA 3R8AA 5HCVA 2Q70A 3PBAA 3X36A 5E0WA 2YHDA 2AWHA 3OS8A 1KV6A 3FALA 3V49A 4OIVA 2I0GA 1I37A 2IOGA 2PNUA 4IA2A 1Y9RA 3FUGA 2PRGA 2PIVA 5DKEA 2ZK0A 5E19A 4NUFA 5JI0D 4NIEA 1YA3A 3K6PA 3OLSA 5GICA 1NQ0A 4ZNHA 3U9QA 5LGAA 4LBDA 5DV3A 3DZYD 4MDDA 4DOSA 4PLEA 2ZNOA 1X7JA 5DWJA 2FVJA 3OLLA 3UU7B 3D5FA 1EREA 1T7FA 1OVLB 5DTVA 3R8IA 2NW4A 1OSVA 1PQ6A 2J4AA 2QE4A 4WLBA 5LWPA 1XZXX 3NOAA 3OSAA 2P7ZA 3ADTA 4MG6A 4PWLA 1YYEA 3HO0A 2JJ3A 4YNKA 1FM9D 3UUDB 5FQPA 2NPAA 5KCCA 1LV2A 3ZQTA 4G1YA 5E15A 1FD0A 2I0JA 3A2HA 3VI8A 2ZNNA 4QL8A 3ERTA 1YINA 2QR9A 4ZJWA 5G45A 5DL4A 3OAPA 1T65A 2PIRA 3CTBA 2Q5SA 4LNWA 1X78A 5HJPB 3WJ4A 2Q1VA 1XVPB 4O8FA 4OZTU 2ZY0A 4E4QA 5KR9A 2IOKA 3E94A 1XB7A 4IV2A 1S9QA 4ITEA 5DZHA 4XHDA 5AZVA 5DXQA 5B5BA 2QA8B 3RY9A 3TKMA 4MG8A 5KCUA 3ADXA 3CS6A 4IWCA 3OZJA 3KMGA 5G3JA 2Q5PA 3B66A 3H0AD 2VSRA 5DY8A 3A9EA 5KCTA 4N5GA 5E0XA 1Q4XA 3VT6A 1KNUA 3AZ1A 2VV0A 2YLPA 5AAVA 2ZNQA 3NSPA 5AWKA 3VT4A 1ILHA 2XHSA 3WT5A 4PPSA 1SJ0A 5DU5A 2AA6A 3ZRBA 4OFUA 4QE8A 4ZNWA 5APJA 1HG4A 2AA5A 2YLQA 3OS8C 5L11A 2ZK6A 3HC6A 3W5TA 3A2JA 4RZFA 3P88A 3CJWA 3WFGA 3E00A 3E00D 1GWRA 4QJRA 3GD2A 5DRMA 1T7RA 3A3ZX 3P8XA 1OT7A 4OZRE 2EWPA 4OARA 5DWGA 2PIOA 2Q8SA 4DORA 2ZVTA 4XTAA 5KRJA 3KMZA 3ET0A 4OEAA 2J7XA 5KCWA 3VSPA 1T76A 2ZXZA 2AO6A 2QW4A 1ILGA 4K6IA 2AX7A 2Q6JA 4OH6A 3IPSA 5DKBA 2ZK2A 3VT3A 1NQ1A 4G1ZA 3TX7B 4ZJRA 5DI7A 4RUOX 1YJEA 4DM6A 2POBA 4ZNUA 1XPCA 5E7VA 1TXIA 2IHQA 3FURA 3UU7A 1UHLB 4ZN7A 1ZGYA 2A3IA 3DY6A 3L03A 5G5WA 1OVLA 1SR7A 5SYZA 2XKWA 3SP6A 2FAIA 3W0GA 3D24A 3IMYA 4NQAB 3BC5A 1S9PA 4FGYA 5EITA 2VV2A 2P7AA 3BEJA 1K74D 5E1CA 2Q61A 3KDTA 4F9MA 3RLLA 1K4WA 3A9EB 3B65A 3MNPA 5IZ0A 2OUZA 1N83A 3FC6B 3SP9A 4OKXA 5GT4A 3UUDA 1R20D 5KD9A 1R20A 1N4HA 5DXEA 3VRVA 3ADUA 5DP0A 4DQMA 3RUTA 2YFEA 4OK1A 4G2IA 1PDUA 4DK8A 5M96A 1QKUA 4MGBB 3WJ5A 1G2NA 5EJVA 5HJPA 2YLOA 4OZRU 5IXKA 1ZEOA 4HEEX 2P15A 5GIEA 5KCEA 3OMQA 1XVPA 2ZLCA 3HVLA 2PITA 2O4JA 3FEJA 1UPWA 3E7CA 4FHIA 4UDBA 2Q7IA 2OM9A 5DZIA 2QA8A 2OAXA 4OGHA 4OKWA 3UUCA 4A4WA 1SQNA 1X7RA 3WMHA 4MGCA 1YUCA 4IV4A 4WQPA 2QZOB 3AX8A 4OHAA 2FSZA 2GWXA 4OZTE 1MVCA 3CS8A 5DUGA 5DXBA 1P93A 4PRGA 1XLSA 3GZ9A 2ZXNA 2HBHA 1IE8A 1NUOA 3K8SA 4IWFA 2HVCA 1NQ2A 3PCUA 4L98A 4RMDA 4ZNVA 5L7EA 3A2IA 5KCDA 3O1DA 4K7AA 4OKBA 3SZ1A 3BQDA 4IUIA 3DZYA 3ZR7A 2O9IA 1T79A 2B50A 2G44A 3CQVA 2R40D 1X7EA 2R40A 1YMTA 4WHGA 3OMPA 5AZTA 1ERRA 1XAPA 4M8HA 4UDCA 3IXPD 3UP3A 1Z5XE 3IXPA 4REFA 3F5CB 4APUA 5KRKA 3CDPA 4YT1A 2ZK5A 2AXAA 4DK7A 3DCUA 3GWSX 1ZAFA 2HB7A 1S0XA 1FM9A 1RKGA 4P6WA 4RZGA 5DWIA 4E4KA 1XJ7A 3RLJA 5KRCA 3X31A 1VJBA 3VT8A 1X76A 3ET3A 3UP0A 2NXXA 1PK5A 1R5KA 5DV6A 1RDTD 2ACLB
chains in the Genus database with same CATH superfamily
3GWXA 1XV9B 2I4ZA 4PP6A 5G43A 2Q3YA 3L3ZA 3JZBA 5KRHA 2NV7A 1I7IA 2W8YA 3AN3A 4Y29A 1S19A 2P54A 4UDAA 1XLSE 2Q5GA 3B68A 5HJSA 3TY0A 3W0AA 4DM8A 1UHLA 4S0SA 2H77A 4X1GA 4J24A 4NY9A 2POGA 4MG7B 3LBDA 3RVFA 2ZMJA 2GL8A 2PIUA 3ADVA 4JGVA 3H0AA 4N8RA 2ZFXA 2VV4B 3K22A 4IA7A 3PLZA 3B0WA 4J26A 3FC6A 5G42A 2OZ7A 2P1UA 1U3SA 2Q6SA 4POHA 3VJIA 3W0JA 5DXBB 1I38A 3R8DA 5C4OA 2VV1B 1PQCA 5KCFA 3W0IA 1H9UA 3AURA 1Z5XU 2QXSA 4QM0A 4G1DA 3FEIA 5DMFA 1SKXA 4NB6A 2R6WA 4MGBA 3KFCA 4X1FA 5DXRA 5KRLA 4IA1A 4IW6A 3Q95B 3OMOA 4RFWA 5G44A 1GWXA 4R2UA 2GPUA 2ATHA 2GPVA 2NXXE 2ZL9A 1L2JA 4PXMA 4KZJA 4PP5A 4OJ9A 2VSTA 3HM1A 1ZUCA 1HJ1A 3ERDA 4G21A 3VT7A 2R6YA 2PJLA 3V3QA 1E3KA 1QKTA 3OKHA 4J5XA 1XNNA 5JY3A 4YPQA 1UPVA 2ZKCA 4RAKA 4EMAA 2QZOA 2ZK1A 5G46A 3W0YA 2O4RA 4ZO1B 5DV8A 3G8OA 4CI5A 5DYBA 2Q1HA 1XDKA 2YJAB 3ET2A 4RE8A 2JFAB 4MG9B 3HQ5A 2Z4JA 1ZH7A 5IAWA 4IVWA 3GBKA 2PKLA 4N73A 4OEDA 5DWLA 5KRAA 1PCGA 5DVVA 2AYRA 4J5WA 1ZDUA 3W0HA 1QKNA 3ZRAA 2I4JA 1U3RA 3VJHA 5I4VA 4TV1B 5DZ3A 1FCYA 2ZLAA 3B67A 3L3XA 3ADSA 3VSOA 2PIPL 2REWA 1LBDA 3A40X 1XP1A 2AX8A 3VT9A 2P4YA 1XQ3A 3R5NA 2ABIA 3D90A 1X7BA 3PRGA 3B1MA 5AWJA 5K13A 4K4JA 1FBYA 4OH5A 2G0HA 3L0EA 2QGWA 5DK9A 3F5CA 3KBAA 1K74A 1XP6A 2BAWA 3AUNA 2HARA 3F7DA 3L0JA 2PINA 1M2ZA 2QH6A 3CDSA 4MGDB 4ZI1A 5EC9A 1NAVA 4R06A 1GS4A 5A86A 1NDEA 5DMCA 3HZFA 4Q50A 2QTUA 3KWYA 1G1UA 1T63A 4PVUA 4OKTA 5ETHA 1XOWA 3A78A 2ACLA 5AVLA 3DZUA 3DZUD 1XV9A 3WGPA 4OLMA 3W5PA 3X1HA 2P1TA 5KYJA 3VJSA 4R6SA 3AUQA 3R29A 1RJKA 1FM6D 2J14A 5DXGA 2V0VA 3UUAB 3W5QA 5B41A 2ZK4A 4KZIA 1M7WA 2ZNPA 4MG7A 5FQSA 3V3EA 2ZXMA 4LSJA 5HZCA 1FCXA 4E2JA 4S0TA 5DVCA 3IPQA 3MNOA 4TUZB 5APKA 3WWRA 1OSHA 5DZ1A 2VV4A 3KDUA 4G20A 2AM9A 3ILZA 1XDKB 2QXMA 4JYHA 4LTWA 4Q13A 3WT6A 4OC7A 2VV1A 4PP3A 3CLDA 3V4AA 1A52A 4XI3A 4IVYA 2HCDA 3D57A 5DXMA 1XIUA 4MG5A 3X1IA 4J5XC 4UDDA 4WPFA 4ZO1X 2HWQA 4G2HA 3Q95A 3WT7A 4PLDA 3K23A 4ZNTA 1U3QA 3G9EA 4PF3A 3AZ2A 3HLVA 3EYBA 5HYKA 3M7RA 1UOMA 5DIEA 3TKCA 3VHWA 4XUMA 1YP0A 3LMPA 3VRUA 2JF9A 3P89A 1XP9A 3VTCA 1T7MA 1NRLA 2Q7JA 1DKFB 3OGTA 4J5WC 4RZEA 4DMAA 4FHHA 3GYUA 1PQ9A 3G8IA 1P8DA 1YOKA 2BJ4B 2B23A 1U9EA 2JFAA 2XYJA 2AMBA 3IA6A 4MG9A 2HAMA 4QK4A 5EHJA 1NHZA 4IS8A 4RUJA 2Q59B 2VV3A 4YMQA 3OOKA 1KKQA 2QMVA 1N46A 3WTQA 4TV1A 2Q6RA 4RMCA 1MV9A 3NSQA 3V9YA 5DVSA 2G0GA 2QA6A 3DR1A 4HLWA 5AYGA 5KRMA 1NAXA 1WM0X 4CI4A 2QNVA 1Y0XX 4WHFA 2LBDA 1ZKYA 5APHA 5L7GA 3OLFA 4S15A 1YY4A 4Q0AC 5C4SA 3RUUA 2G5OA 3H52A 3MNEA 1YOWA 1T5ZA 4ZOMA 5FQVA 4MGDA 5JJMB 3OSIA 3VHVA 2ZK3A 2Q7LA 1PZLA 2QSEA 1S0ZA 2PIXA 3VRTA 1EXXA 1K7LA 1ZDTA 2PIWA 4MGAB 3VN2A 5H1EA 2AX6A 1G50A 1Y0SA 4JYGA 5AVIA 4XT9A 3OMMA 3FS1A 3T03A 4REEA 5DXKA 5DUHA 3V9VA 2OCFA 3OKIA 2AMAA 2OVMA 4XLDA 3HC5A 3WFFA 3R2AA 4OILA 3ET1A 1FCZA 1M13A 4IA3A 2GTKA 4RMEA 4ONIA 5CJ6A 3UUAA 5DUEA 3DT3A 1L2IA 4RWVA 4JYIA 5DIGA 1Z95A 2P7GA 2QGTA 3OOFA 3FALB 3N00A 2HASA 4FNEA 3GN8A 4WVDA 2PIQA 4TUZA 2AAXA 2ZMHA 4OEZA 3ADWA 5DKSA 4B7WA 3AFRA 4A4VA 4EM9A 5DX3B 1NYXA 3HODA 3KYTA 3AZ3A 3JZCA 1T74A 3G0WA 5GIDA 2Q60A 3KPZA 3PO9A 4IW8A 1QKMA 1T7TA 2F4BA 2OVHA 2V7CA 3UVVA 3D6DA 2B1ZA 1T73A 4OFRA 2HC4A 3CWDA 4L96A 3VHUA 3V9TA 1PRGA 5F9BA 5ICKA 5FQRA 2XYWA 1R1KD 3B0RA 1R1KA 3B0QA 3GYTA 3OZ0A 1DB1A 1XQCA 3L1BA 4OJBA 2YLYA 5DKGA 3VTBA 4IQRA 5HYRA 5DZ0A 2AX9A 1DKFA 5AAUA 4RUPA 1XNXA 5L7HA 3PEQA 3P0UA 4BCRA 5DX3A 2BJ4A 2YATA 5EGVA 2J7YA 2QPYA 3VJTA 3OSWA 2P1VA 2Q59A 3OMKA 2Z4BA 4QE6A 4JAZA 1EXAA 5E14A 4POJA 4XUHA 5C4UA 3QT0A 5KYAA 5KROA 3L0LA 3VTDA 1YIMA 4OEYA 5DRJA 1RKHA 5C4TA 4MG8B 3B5RA 2ZASA 2ZMIA 5DYDA 1IE9A 1FM6A 2HB8A 3OS9A 1A28A 4ZNSA 2XYXA 2HWRA 5DSHA 2GPPA 4IU7A 5KRFA 2AB2A 2B1VA 3KMRA 5DIDA 1MZNA 3VRWA 1I7GA 4ITFA 1BSXA 2HFPA 1G5YA 4M8EA 5AAVB 1E3GA 3CS4A 4P6XA 4N1YA 4OJ4A 1R6GA 5DXPA 2AA7A 4JL4A 4KZMA 3FLIA 3VT5A 2I4PA 5JJMA 4S14A 1TFCA 2GP7A 4XAOA 5FQTA 1RK3A 2YJDA 4FN9A 5EI1A 4ZN9A 1RDTA 2GIUA 2GPOA 3B3KA 4A2JA 4CSJA 5ACCA 1NQ7A 2AA2A 3AN4A 4MGAA 3W5RA 4PPPA 3IPUA 3B0TA 3O1EA 5KRIA 1GWQA 3UVVB 5DLRA 5DWEA 3S9SA 2E2RA 2ZBSA 2Q7KA 4LNXA 3FXVA 4OIUA 5AK2A 3W0CA 2QABA 3DCTA 2H79A 3R5MA 3R8AA 5HCVA 2Q70A 3PBAA 3X36A 5E0WA 2YHDA 2AWHA 3OS8A 1KV6A 3FALA 3V49A 4OIVA 2I0GA 1I37A 2IOGA 2PNUA 4IA2A 1Y9RA 3FUGA 2PRGA 2PIVA 5DKEA 2ZK0A 5E19A 4NUFA 5JI0D 4NIEA 1YA3A 3K6PA 3OLSA 5GICA 1NQ0A 4ZNHA 3U9QA 5LGAA 4LBDA 5DV3A 3DZYD 4MDDA 4DOSA 4PLEA 2ZNOA 1X7JA 5DWJA 2FVJA 3OLLA 3UU7B 3D5FA 1EREA 1T7FA 1OVLB 5DTVA 3R8IA 2NW4A 1OSVA 1PQ6A 2J4AA 2QE4A 4WLBA 5LWPA 1XZXX 3NOAA 3OSAA 2P7ZA 3ADTA 4MG6A 4PWLA 1YYEA 3HO0A 2JJ3A 4YNKA 1FM9D 3UUDB 5FQPA 2NPAA 5KCCA 1LV2A 3ZQTA 4G1YA 5E15A 1FD0A 2I0JA 3A2HA 3VI8A 2ZNNA 4QL8A 3ERTA 1YINA 2QR9A 4ZJWA 5G45A 5DL4A 3OAPA 1T65A 2PIRA 3CTBA 2Q5SA 4LNWA 1X78A 5HJPB 3WJ4A 2Q1VA 1XVPB 4O8FA 4OZTU 2ZY0A 4E4QA 5KR9A 2IOKA 3E94A 1XB7A 4IV2A 1S9QA 4ITEA 5DZHA 4XHDA 5AZVA 5DXQA 5B5BA 2QA8B 3RY9A 3TKMA 4MG8A 5KCUA 3ADXA 3CS6A 4IWCA 3OZJA 3KMGA 5G3JA 2Q5PA 3B66A 3H0AD 2VSRA 5DY8A 3A9EA 5KCTA 4N5GA 5E0XA 1Q4XA 3VT6A 1KNUA 3AZ1A 2VV0A 2YLPA 5AAVA 2ZNQA 3NSPA 5AWKA 3VT4A 1ILHA 2XHSA 3WT5A 4PPSA 1SJ0A 5DU5A 2AA6A 3ZRBA 4OFUA 4QE8A 4ZNWA 5APJA 1HG4A 2AA5A 2YLQA 3OS8C 5L11A 2ZK6A 3HC6A 3W5TA 3A2JA 4RZFA 3P88A 3CJWA 3WFGA 3E00A 3E00D 1GWRA 4QJRA 3GD2A 5DRMA 1T7RA 3A3ZX 3P8XA 1OT7A 4OZRE 2EWPA 4OARA 5DWGA 2PIOA 2Q8SA 4DORA 2ZVTA 4XTAA 5KRJA 3KMZA 3ET0A 4OEAA 2J7XA 5KCWA 3VSPA 1T76A 2ZXZA 2AO6A 2QW4A 1ILGA 4K6IA 2AX7A 2Q6JA 4OH6A 3IPSA 5DKBA 2ZK2A 3VT3A 1NQ1A 4G1ZA 3TX7B 4ZJRA 5DI7A 4RUOX 1YJEA 4DM6A 2POBA 4ZNUA 1XPCA 5E7VA 1TXIA 2IHQA 3FURA 3UU7A 1UHLB 4ZN7A 1ZGYA 2A3IA 3DY6A 3L03A 5G5WA 1OVLA 1SR7A 5SYZA 2XKWA 3SP6A 2FAIA 3W0GA 3D24A 3IMYA 4NQAB 3BC5A 1S9PA 4FGYA 5EITA 2VV2A 2P7AA 3BEJA 1K74D 5E1CA 2Q61A 3KDTA 4F9MA 3RLLA 1K4WA 3A9EB 3B65A 3MNPA 5IZ0A 2OUZA 1N83A 3FC6B 3SP9A 4OKXA 5GT4A 3UUDA 1R20D 5KD9A 1R20A 1N4HA 5DXEA 3VRVA 3ADUA 5DP0A 4DQMA 3RUTA 2YFEA 4OK1A 4G2IA 1PDUA 4DK8A 5M96A 1QKUA 4MGBB 3WJ5A 1G2NA 5EJVA 5HJPA 2YLOA 4OZRU 5IXKA 1ZEOA 4HEEX 2P15A 5GIEA 5KCEA 3OMQA 1XVPA 2ZLCA 3HVLA 2PITA 2O4JA 3FEJA 1UPWA 3E7CA 4FHIA 4UDBA 2Q7IA 2OM9A 5DZIA 2QA8A 2OAXA 4OGHA 4OKWA 3UUCA 4A4WA 1SQNA 1X7RA 3WMHA 4MGCA 1YUCA 4IV4A 4WQPA 2QZOB 3AX8A 4OHAA 2FSZA 2GWXA 4OZTE 1MVCA 3CS8A 5DUGA 5DXBA 1P93A 4PRGA 1XLSA 3GZ9A 2ZXNA 2HBHA 1IE8A 1NUOA 3K8SA 4IWFA 2HVCA 1NQ2A 3PCUA 4L98A 4RMDA 4ZNVA 5L7EA 3A2IA 5KCDA 3O1DA 4K7AA 4OKBA 3SZ1A 3BQDA 4IUIA 3DZYA 3ZR7A 2O9IA 1T79A 2B50A 2G44A 3CQVA 2R40D 1X7EA 2R40A 1YMTA 4WHGA 3OMPA 5AZTA 1ERRA 1XAPA 4M8HA 4UDCA 3IXPD 3UP3A 1Z5XE 3IXPA 4REFA 3F5CB 4APUA 5KRKA 3CDPA 4YT1A 2ZK5A 2AXAA 4DK7A 3DCUA 3GWSX 1ZAFA 2HB7A 1S0XA 1FM9A 1RKGA 4P6WA 4RZGA 5DWIA 4E4KA 1XJ7A 3RLJA 5KRCA 3X31A 1VJBA 3VT8A 1X76A 3ET3A 3UP0A 2NXXA 1PK5A 1R5KA 5DV6A 1RDTD 2ACLB
chains in the Genus database with same CATH topology
3GWXA 1XV9B 2I4ZA 4PP6A 5G43A 2Q3YA 3L3ZA 3JZBA 5KRHA 2NV7A 1I7IA 2W8YA 3AN3A 4Y29A 1S19A 2P54A 4UDAA 1XLSE 2Q5GA 3B68A 5HJSA 3TY0A 3W0AA 4DM8A 1UHLA 4S0SA 2H77A 4X1GA 4J24A 4NY9A 2POGA 4MG7B 3LBDA 3RVFA 2ZMJA 2GL8A 2PIUA 3ADVA 4JGVA 3H0AA 4N8RA 2ZFXA 2VV4B 3K22A 4IA7A 3PLZA 3B0WA 4J26A 3FC6A 5G42A 2OZ7A 2P1UA 1U3SA 2Q6SA 4POHA 3VJIA 3W0JA 5DXBB 1I38A 3R8DA 5C4OA 2VV1B 1PQCA 5KCFA 3W0IA 1H9UA 3AURA 1Z5XU 2QXSA 4QM0A 4G1DA 3FEIA 5DMFA 1SKXA 4NB6A 2R6WA 4MGBA 3KFCA 4X1FA 5DXRA 5KRLA 4IA1A 4IW6A 3Q95B 3OMOA 4RFWA 5G44A 1GWXA 4R2UA 2GPUA 2ATHA 2GPVA 2NXXE 2ZL9A 1L2JA 4PXMA 4KZJA 4PP5A 4OJ9A 2VSTA 3HM1A 1ZUCA 1HJ1A 3ERDA 4G21A 3VT7A 2R6YA 2PJLA 3V3QA 1E3KA 1QKTA 3OKHA 4J5XA 1XNNA 5JY3A 4YPQA 1UPVA 2ZKCA 4RAKA 4EMAA 2QZOA 2ZK1A 5G46A 3W0YA 2O4RA 4ZO1B 5DV8A 3G8OA 4CI5A 5DYBA 2Q1HA 1XDKA 2YJAB 3ET2A 4RE8A 2JFAB 4MG9B 3HQ5A 2Z4JA 1ZH7A 5IAWA 4IVWA 3GBKA 2PKLA 4N73A 4OEDA 5DWLA 5KRAA 1PCGA 5DVVA 2AYRA 4J5WA 1ZDUA 3W0HA 1QKNA 3ZRAA 2I4JA 1U3RA 3VJHA 5I4VA 4TV1B 5DZ3A 1FCYA 2ZLAA 3B67A 3L3XA 3ADSA 3VSOA 2PIPL 2REWA 1LBDA 3A40X 1XP1A 2AX8A 3VT9A 2P4YA 1XQ3A 3R5NA 2ABIA 3D90A 1X7BA 3PRGA 3B1MA 5AWJA 5K13A 4K4JA 1FBYA 4OH5A 2G0HA 3L0EA 2QGWA 5DK9A 3F5CA 3KBAA 1K74A 1XP6A 2BAWA 3AUNA 2HARA 3F7DA 3L0JA 2PINA 1M2ZA 2QH6A 3CDSA 4MGDB 4ZI1A 5EC9A 1NAVA 4R06A 1GS4A 5A86A 1NDEA 5DMCA 3HZFA 4Q50A 2QTUA 3KWYA 1G1UA 1T63A 4PVUA 4OKTA 5ETHA 1XOWA 3A78A 2ACLA 5AVLA 3DZUA 3DZUD 1XV9A 3WGPA 4OLMA 3W5PA 3X1HA 2P1TA 5KYJA 3VJSA 4R6SA 3AUQA 3R29A 1RJKA 1FM6D 2J14A 5DXGA 2V0VA 3UUAB 3W5QA 5B41A 2ZK4A 4KZIA 1M7WA 2ZNPA 4MG7A 5FQSA 3V3EA 2ZXMA 4LSJA 5HZCA 1FCXA 4E2JA 4S0TA 5DVCA 3IPQA 3MNOA 4TUZB 5APKA 3WWRA 1OSHA 5DZ1A 2VV4A 3KDUA 4G20A 2AM9A 3ILZA 1XDKB 2QXMA 4JYHA 4LTWA 4Q13A 3WT6A 4OC7A 2VV1A 4PP3A 3CLDA 3V4AA 1A52A 4XI3A 4IVYA 2HCDA 3D57A 5DXMA 1XIUA 4MG5A 3X1IA 4J5XC 4UDDA 4WPFA 4ZO1X 2HWQA 4G2HA 3Q95A 3WT7A 4PLDA 3K23A 4ZNTA 1U3QA 3G9EA 4PF3A 3AZ2A 3HLVA 3EYBA 5HYKA 3M7RA 1UOMA 5DIEA 3TKCA 3VHWA 4XUMA 1YP0A 3LMPA 3VRUA 2JF9A 3P89A 1XP9A 3VTCA 1T7MA 1NRLA 2Q7JA 1DKFB 3OGTA 4J5WC 4RZEA 4DMAA 4FHHA 3GYUA 1PQ9A 3G8IA 1P8DA 1YOKA 2BJ4B 2B23A 1U9EA 2JFAA 2XYJA 2AMBA 3IA6A 4MG9A 2HAMA 4QK4A 5EHJA 1NHZA 4IS8A 4RUJA 2Q59B 2VV3A 4YMQA 3OOKA 1KKQA 2QMVA 1N46A 3WTQA 4TV1A 2Q6RA 4RMCA 1MV9A 3NSQA 3V9YA 5DVSA 2G0GA 2QA6A 3DR1A 4HLWA 5AYGA 5KRMA 1NAXA 1WM0X 4CI4A 2QNVA 1Y0XX 4WHFA 2LBDA 1ZKYA 5APHA 5L7GA 3OLFA 4S15A 1YY4A 4Q0AC 5C4SA 3RUUA 2G5OA 3H52A 3MNEA 1YOWA 1T5ZA 4ZOMA 5FQVA 4MGDA 5JJMB 3OSIA 3VHVA 2ZK3A 2Q7LA 1PZLA 2QSEA 1S0ZA 2PIXA 3VRTA 1EXXA 1K7LA 1ZDTA 2PIWA 4MGAB 3VN2A 5H1EA 2AX6A 1G50A 1Y0SA 4JYGA 5AVIA 4XT9A 3OMMA 3FS1A 3T03A 4REEA 5DXKA 5DUHA 3V9VA 2OCFA 3OKIA 2AMAA 2OVMA 4XLDA 3HC5A 3WFFA 3R2AA 4OILA 3ET1A 1FCZA 1M13A 4IA3A 2GTKA 4RMEA 4ONIA 5CJ6A 3UUAA 5DUEA 3DT3A 1L2IA 4RWVA 4JYIA 5DIGA 1Z95A 2P7GA 2QGTA 3OOFA 3FALB 3N00A 2HASA 4FNEA 3GN8A 4WVDA 2PIQA 4TUZA 2AAXA 2ZMHA 4OEZA 3ADWA 5DKSA 4B7WA 3AFRA 4A4VA 4EM9A 5DX3B 1NYXA 3HODA 3KYTA 3AZ3A 3JZCA 1T74A 3G0WA 5GIDA 2Q60A 3KPZA 3PO9A 4IW8A 1QKMA 1T7TA 2F4BA 2OVHA 2V7CA 3UVVA 3D6DA 2B1ZA 1T73A 4OFRA 2HC4A 3CWDA 4L96A 3VHUA 3V9TA 1PRGA 5F9BA 5ICKA 5FQRA 2XYWA 1R1KD 3B0RA 1R1KA 3B0QA 3GYTA 3OZ0A 1DB1A 1XQCA 3L1BA 4OJBA 2YLYA 5DKGA 3VTBA 4IQRA 5HYRA 5DZ0A 2AX9A 1DKFA 5AAUA 4RUPA 1XNXA 5L7HA 3PEQA 3P0UA 4BCRA 5DX3A 2BJ4A 2YATA 5EGVA 2J7YA 2QPYA 3VJTA 3OSWA 2P1VA 2Q59A 3OMKA 2Z4BA 4QE6A 4JAZA 1EXAA 5E14A 4POJA 4XUHA 5C4UA 3QT0A 5KYAA 5KROA 3L0LA 3VTDA 1YIMA 4OEYA 5DRJA 1RKHA 5C4TA 4MG8B 3B5RA 2ZASA 2ZMIA 5DYDA 1IE9A 1FM6A 2HB8A 3OS9A 1A28A 4ZNSA 2XYXA 2HWRA 5DSHA 2GPPA 4IU7A 5KRFA 2AB2A 2B1VA 3KMRA 5DIDA 1MZNA 3VRWA 1I7GA 4ITFA 1BSXA 2HFPA 1G5YA 4M8EA 5AAVB 1E3GA 3CS4A 4P6XA 4N1YA 4OJ4A 1R6GA 5DXPA 2AA7A 4JL4A 4KZMA 3FLIA 3VT5A 2I4PA 5JJMA 4S14A 1TFCA 2GP7A 4XAOA 5FQTA 1RK3A 2YJDA 4FN9A 5EI1A 4ZN9A 1RDTA 2GIUA 2GPOA 3B3KA 4A2JA 4CSJA 5ACCA 1NQ7A 2AA2A 3AN4A 4MGAA 3W5RA 4PPPA 3IPUA 3B0TA 3O1EA 5KRIA 1GWQA 3UVVB 5DLRA 5DWEA 3S9SA 2E2RA 2ZBSA 2Q7KA 4LNXA 3FXVA 4OIUA 5AK2A 3W0CA 2QABA 3DCTA 2H79A 3R5MA 3R8AA 5HCVA 2Q70A 3PBAA 3X36A 5E0WA 2YHDA 2AWHA 3OS8A 1KV6A 3FALA 3V49A 4OIVA 2I0GA 1I37A 2IOGA 2PNUA 4IA2A 1Y9RA 3FUGA 2PRGA 2PIVA 5DKEA 2ZK0A 5E19A 4NUFA 5JI0D 4NIEA 1YA3A 3K6PA 3OLSA 5GICA 1NQ0A 4ZNHA 3U9QA 5LGAA 4LBDA 5DV3A 3DZYD 4MDDA 4DOSA 4PLEA 2ZNOA 1X7JA 5DWJA 2FVJA 3OLLA 3UU7B 3D5FA 1EREA 1T7FA 1OVLB 5DTVA 3R8IA 2NW4A 1OSVA 1PQ6A 2J4AA 2QE4A 4WLBA 5LWPA 1XZXX 3NOAA 3OSAA 2P7ZA 3ADTA 4MG6A 4PWLA 1YYEA 3HO0A 2JJ3A 4YNKA 1FM9D 3UUDB 5FQPA 2NPAA 5KCCA 1LV2A 3ZQTA 4G1YA 5E15A 1FD0A 2I0JA 3A2HA 3VI8A 2ZNNA 4QL8A 3ERTA 1YINA 2QR9A 4ZJWA 5G45A 5DL4A 3OAPA 1T65A 2PIRA 3CTBA 2Q5SA 4LNWA 1X78A 5HJPB 3WJ4A 2Q1VA 1XVPB 4O8FA 4OZTU 2ZY0A 4E4QA 5KR9A 2IOKA 3E94A 1XB7A 4IV2A 1S9QA 4ITEA 5DZHA 4XHDA 5AZVA 5DXQA 5B5BA 2QA8B 3RY9A 3TKMA 4MG8A 5KCUA 3ADXA 3CS6A 4IWCA 3OZJA 3KMGA 5G3JA 2Q5PA 3B66A 3H0AD 2VSRA 5DY8A 3A9EA 5KCTA 4N5GA 5E0XA 1Q4XA 3VT6A 1KNUA 3AZ1A 2VV0A 2YLPA 5AAVA 2ZNQA 3NSPA 5AWKA 3VT4A 1ILHA 2XHSA 3WT5A 4PPSA 1SJ0A 5DU5A 2AA6A 3ZRBA 4OFUA 4QE8A 4ZNWA 5APJA 1HG4A 2AA5A 2YLQA 3OS8C 5L11A 2ZK6A 3HC6A 3W5TA 3A2JA 4RZFA 3P88A 3CJWA 3WFGA 3E00A 3E00D 1GWRA 4QJRA 3GD2A 5DRMA 1T7RA 3A3ZX 3P8XA 1OT7A 4OZRE 2EWPA 4OARA 5DWGA 2PIOA 2Q8SA 4DORA 2ZVTA 4XTAA 5KRJA 3KMZA 3ET0A 4OEAA 2J7XA 5KCWA 3VSPA 1T76A 2ZXZA 2AO6A 2QW4A 1ILGA 4K6IA 2AX7A 2Q6JA 4OH6A 3IPSA 5DKBA 2ZK2A 3VT3A 1NQ1A 4G1ZA 3TX7B 4ZJRA 5DI7A 4RUOX 1YJEA 4DM6A 2POBA 4ZNUA 1XPCA 5E7VA 1TXIA 2IHQA 3FURA 3UU7A 1UHLB 4ZN7A 1ZGYA 2A3IA 3DY6A 3L03A 5G5WA 1OVLA 1SR7A 5SYZA 2XKWA 3SP6A 2FAIA 3W0GA 3D24A 3IMYA 4NQAB 3BC5A 1S9PA 4FGYA 5EITA 2VV2A 2P7AA 3BEJA 1K74D 5E1CA 2Q61A 3KDTA 4F9MA 3RLLA 1K4WA 3A9EB 3B65A 3MNPA 5IZ0A 2OUZA 1N83A 3FC6B 3SP9A 4OKXA 5GT4A 3UUDA 1R20D 5KD9A 1R20A 1N4HA 5DXEA 3VRVA 3ADUA 5DP0A 4DQMA 3RUTA 2YFEA 4OK1A 4G2IA 1PDUA 4DK8A 5M96A 1QKUA 4MGBB 3WJ5A 1G2NA 5EJVA 5HJPA 2YLOA 4OZRU 5IXKA 1ZEOA 4HEEX 2P15A 5GIEA 5KCEA 3OMQA 1XVPA 2ZLCA 3HVLA 2PITA 2O4JA 3FEJA 1UPWA 3E7CA 4FHIA 4UDBA 2Q7IA 2OM9A 5DZIA 2QA8A 2OAXA 4OGHA 4OKWA 3UUCA 4A4WA 1SQNA 1X7RA 3WMHA 4MGCA 1YUCA 4IV4A 4WQPA 2QZOB 3AX8A 4OHAA 2FSZA 2GWXA 4OZTE 1MVCA 3CS8A 5DUGA 5DXBA 1P93A 4PRGA 1XLSA 3GZ9A 2ZXNA 2HBHA 1IE8A 1NUOA 3K8SA 4IWFA 2HVCA 1NQ2A 3PCUA 4L98A 4RMDA 4ZNVA 5L7EA 3A2IA 5KCDA 3O1DA 4K7AA 4OKBA 3SZ1A 3BQDA 4IUIA 3DZYA 3ZR7A 2O9IA 1T79A 2B50A 2G44A 3CQVA 2R40D 1X7EA 2R40A 1YMTA 4WHGA 3OMPA 5AZTA 1ERRA 1XAPA 4M8HA 4UDCA 3IXPD 3UP3A 1Z5XE 3IXPA 4REFA 3F5CB 4APUA 5KRKA 3CDPA 4YT1A 2ZK5A 2AXAA 4DK7A 3DCUA 3GWSX 1ZAFA 2HB7A 1S0XA 1FM9A 1RKGA 4P6WA 4RZGA 5DWIA 4E4KA 1XJ7A 3RLJA 5KRCA 3X31A 1VJBA 3VT8A 1X76A 3ET3A 3UP0A 2NXXA 1PK5A 1R5KA 5DV6A 1RDTD 2ACLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GWX A;  1XV9 B;  2I4Z A;  4PP6 A;  5G43 A;  2Q3Y A;  3L3Z A;  3JZB A;  5KRH A;  2NV7 A;  1I7I A;  2W8Y A;  3AN3 A;  4Y29 A;  1S19 A;  2P54 A;  4UDA A;  1XLS E;  2Q5G A;  3B68 A;  5HJS A;  3TY0 A;  3W0A A;  4DM8 A;  1UHL A;  4S0S A;  2H77 A;  4X1G A;  4J24 A;  4NY9 A;  2POG A;  4MG7 B;  3LBD A;  3RVF A;  2ZMJ A;  2GL8 A;  2PIU A;  3ADV A;  4JGV A;  3H0A A;  4N8R A;  2ZFX A;  2VV4 B;  3K22 A;  4IA7 A;  3PLZ A;  3B0W A;  4J26 A;  3FC6 A;  5G42 A;  2OZ7 A;  2P1U A;  1U3S A;  2Q6S A;  4POH A;  3VJI A;  3W0J A;  5DXB B;  1I38 A;  3R8D A;  5C4O A;  2VV1 B;  1PQC A;  5KCF A;  3W0I A;  1H9U A;  3AUR A;  1Z5X U;  2QXS A;  4QM0 A;  4G1D A;  3FEI A;  5DMF A;  1SKX A;  4NB6 A;  2R6W A;  4MGB A;  3KFC A;  4X1F A;  5DXR A;  5KRL A;  4IA1 A;  4IW6 A;  3Q95 B;  3OMO A;  4RFW A;  5G44 A;  1GWX A;  4R2U A;  2GPU A;  2ATH A;  2GPV A;  2NXX E;  2ZL9 A;  1L2J A;  4PXM A;  4KZJ A;  4PP5 A;  4OJ9 A;  2VST A;  3HM1 A;  1ZUC A;  1HJ1 A;  3ERD A;  4G21 A;  3VT7 A;  2R6Y A;  2PJL A;  3V3Q A;  1E3K A;  1QKT A;  3OKH A;  4J5X A;  1XNN A;  5JY3 A;  4YPQ A;  1UPV A;  2ZKC A;  4RAK A;  4EMA A;  2QZO A;  2ZK1 A;  5G46 A;  3W0Y A;  2O4R A;  4ZO1 B;  5DV8 A;  3G8O A;  4CI5 A;  5DYB A;  2Q1H A;  1XDK A;  2YJA B;  3ET2 A;  4RE8 A;  2JFA B;  4MG9 B;  3HQ5 A;  2Z4J A;  1ZH7 A;  5IAW A;  4IVW A;  3GBK A;  2PKL A;  4N73 A;  4OED A;  5DWL A;  5KRA A;  1PCG A;  5DVV A;  2AYR A;  4J5W A;  1ZDU A;  3W0H A;  1QKN A;  3ZRA A;  2I4J A;  1U3R A;  3VJH A;  5I4V A;  4TV1 B;  5DZ3 A;  1FCY A;  2ZLA A;  3B67 A;  3L3X A;  3ADS A;  3VSO A;  2PIP L;  2REW A;  1LBD A;  3A40 X;  1XP1 A;  2AX8 A;  3VT9 A;  2P4Y A;  1XQ3 A;  3R5N A;  2ABI A;  3D90 A;  1X7B A;  3PRG A;  3B1M A;  5AWJ A;  5K13 A;  4K4J A;  1FBY A;  4OH5 A;  2G0H A;  3L0E A;  2QGW A;  5DK9 A;  3F5C A;  3KBA A;  1K74 A;  1XP6 A;  2BAW A;  3AUN A;  2HAR A;  3F7D A;  3L0J A;  2PIN A;  1M2Z A;  2QH6 A;  3CDS A;  4MGD B;  4ZI1 A;  5EC9 A;  1NAV A;  4R06 A;  1GS4 A;  5A86 A;  1NDE A;  5DMC A;  3HZF A;  4Q50 A;  2QTU A;  3KWY A;  1G1U A;  1T63 A;  4PVU A;  4OKT A;  5ETH A;  1XOW A;  3A78 A;  2ACL A;  5AVL A;  3DZU A;  3DZU D;  1XV9 A;  3WGP A;  4OLM A;  3W5P A;  3X1H A;  2P1T A;  5KYJ A;  3VJS A;  4R6S A;  3AUQ A;  3R29 A;  1RJK A;  1FM6 D;  2J14 A;  5DXG A;  2V0V A;  3UUA B;  3W5Q A;  5B41 A;  2ZK4 A;  4KZI A;  1M7W A;  2ZNP A;  4MG7 A;  5FQS A;  3V3E A;  2ZXM A;  4LSJ A;  5HZC A;  1FCX A;  4E2J A;  4S0T A;  5DVC A;  3IPQ A;  3MNO A;  4TUZ B;  5APK A;  3WWR A;  1OSH A;  5DZ1 A;  2VV4 A;  3KDU A;  4G20 A;  2AM9 A;  3ILZ A;  1XDK B;  2QXM A;  4JYH A;  4LTW A;  4Q13 A;  3WT6 A;  4OC7 A;  2VV1 A;  4PP3 A;  3CLD A;  3V4A A;  1A52 A;  4XI3 A;  4IVY A;  2HCD A;  3D57 A;  5DXM A;  1XIU A;  4MG5 A;  3X1I A;  4J5X C;  4UDD A;  4WPF A;  4ZO1 X;  2HWQ A;  4G2H A;  3Q95 A;  3WT7 A;  4PLD A;  3K23 A;  4ZNT A;  1U3Q A;  3G9E A;  4PF3 A;  3AZ2 A;  3HLV A;  3EYB A;  5HYK A;  3M7R A;  1UOM A;  5DIE A;  3TKC A;  3VHW A;  4XUM A;  1YP0 A;  3LMP A;  3VRU A;  2JF9 A;  3P89 A;  1XP9 A;  3VTC A;  1T7M A;  1NRL A;  2Q7J A;  1DKF B;  3OGT A;  4J5W C;  4RZE A;  4DMA A;  4FHH A;  3GYU A;  1PQ9 A;  3G8I A;  1P8D A;  1YOK A;  2BJ4 B;  2B23 A;  1U9E A;  2JFA A;  2XYJ A;  2AMB A;  3IA6 A;  4MG9 A;  2HAM A;  4QK4 A;  5EHJ A;  1NHZ A;  4IS8 A;  4RUJ A;  2Q59 B;  2VV3 A;  4YMQ A;  3OOK A;  1KKQ A;  2QMV A;  1N46 A;  3WTQ A;  4TV1 A;  2Q6R A;  4RMC A;  1MV9 A;  3NSQ A;  3V9Y A;  5DVS A;  2G0G A;  2QA6 A;  3DR1 A;  4HLW A;  5AYG A;  5KRM A;  1NAX A;  1WM0 X;  4CI4 A;  2QNV A;  1Y0X X;  4WHF A;  2LBD A;  1ZKY A;  5APH A;  5L7G A;  3OLF A;  4S15 A;  1YY4 A;  4Q0A C;  5C4S A;  3RUU A;  2G5O A;  3H52 A;  3MNE A;  1YOW A;  1T5Z A;  4ZOM A;  5FQV A;  4MGD A;  5JJM B;  3OSI A;  3VHV A;  2ZK3 A;  2Q7L A;  1PZL A;  2QSE A;  1S0Z A;  2PIX A;  3VRT A;  1EXX A;  1K7L A;  1ZDT A;  2PIW A;  4MGA B;  3VN2 A;  5H1E A;  2AX6 A;  1G50 A;  1Y0S A;  4JYG A;  5AVI A;  4XT9 A;  3OMM A;  3FS1 A;  3T03 A;  4REE A;  5DXK A;  5DUH A;  3V9V A;  2OCF A;  3OKI A;  2AMA A;  2OVM A;  4XLD A;  3HC5 A;  3WFF A;  3R2A A;  4OIL A;  3ET1 A;  1FCZ A;  1M13 A;  4IA3 A;  2GTK A;  4RME A;  4ONI A;  5CJ6 A;  3UUA A;  5DUE A;  3DT3 A;  1L2I A;  4RWV A;  4JYI A;  5DIG A;  1Z95 A;  2P7G A;  2QGT A;  3OOF A;  3FAL B;  3N00 A;  2HAS A;  4FNE A;  3GN8 A;  4WVD A;  2PIQ A;  4TUZ A;  2AAX A;  2ZMH A;  4OEZ A;  3ADW A;  5DKS A;  4B7W A;  3AFR A;  4A4V A;  4EM9 A;  5DX3 B;  1NYX A;  3HOD A;  3KYT A;  3AZ3 A;  3JZC A;  1T74 A;  3G0W A;  5GID A;  2Q60 A;  3KPZ A;  3PO9 A;  4IW8 A;  1QKM A;  1T7T A;  2F4B A;  2OVH A;  2V7C A;  3UVV A;  3D6D A;  2B1Z A;  1T73 A;  4OFR A;  2HC4 A;  3CWD A;  4L96 A;  3VHU A;  3V9T A;  1PRG A;  5F9B A;  5ICK A;  5FQR A;  2XYW A;  1R1K D;  3B0R A;  1R1K A;  3B0Q A;  3GYT A;  3OZ0 A;  1DB1 A;  1XQC A;  3L1B A;  4OJB A;  2YLY A;  5DKG A;  3VTB A;  4IQR A;  5HYR A;  5DZ0 A;  2AX9 A;  1DKF A;  5AAU A;  4RUP A;  1XNX A;  5L7H A;  3PEQ A;  3P0U A;  4BCR A;  5DX3 A;  2BJ4 A;  2YAT A;  5EGV A;  2J7Y A;  2QPY A;  3VJT A;  3OSW A;  2P1V A;  2Q59 A;  3OMK A;  2Z4B A;  4QE6 A;  4JAZ A;  1EXA A;  5E14 A;  4POJ A;  4XUH A;  5C4U A;  3QT0 A;  5KYA A;  5KRO A;  3L0L A;  3VTD A;  1YIM A;  4OEY A;  5DRJ A;  1RKH A;  5C4T A;  4MG8 B;  3B5R A;  2ZAS A;  2ZMI A;  5DYD A;  1IE9 A;  1FM6 A;  2HB8 A;  3OS9 A;  1A28 A;  4ZNS A;  2XYX A;  2HWR A;  5DSH A;  2GPP A;  4IU7 A;  5KRF A;  2AB2 A;  2B1V A;  3KMR A;  5DID A;  1MZN A;  3VRW A;  1I7G A;  4ITF A;  1BSX A;  2HFP A;  1G5Y A;  4M8E A;  5AAV B;  1E3G A;  3CS4 A;  4P6X A;  4N1Y A;  4OJ4 A;  1R6G A;  5DXP A;  2AA7 A;  4JL4 A;  4KZM A;  3FLI A;  3VT5 A;  2I4P A;  5JJM A;  4S14 A;  1TFC A;  2GP7 A;  4XAO A;  5FQT A;  1RK3 A;  2YJD A;  4FN9 A;  5EI1 A;  4ZN9 A;  1RDT A;  2GIU A;  2GPO A;  3B3K A;  4A2J A;  4CSJ A;  5ACC A;  1NQ7 A;  2AA2 A;  3AN4 A;  4MGA A;  3W5R A;  4PPP A;  3IPU A;  3B0T A;  3O1E A;  5KRI A;  1GWQ A;  3UVV B;  5DLR A;  5DWE A;  3S9S A;  2E2R A;  2ZBS A;  2Q7K A;  4LNX A;  3FXV A;  4OIU A;  5AK2 A;  3W0C A;  2QAB A;  3DCT A;  2H79 A;  3R5M A;  3R8A A;  5HCV A;  2Q70 A;  3PBA A;  3X36 A;  5E0W A;  2YHD A;  2AWH A;  3OS8 A;  1KV6 A;  3FAL A;  3V49 A;  4OIV A;  2I0G A;  1I37 A;  2IOG A;  2PNU A;  4IA2 A;  1Y9R A;  3FUG A;  2PRG A;  2PIV A;  5DKE A;  2ZK0 A;  5E19 A;  4NUF A;  5JI0 D;  4NIE A;  1YA3 A;  3K6P A;  3OLS A;  5GIC A;  1NQ0 A;  4ZNH A;  3U9Q A;  5LGA A;  4LBD A;  5DV3 A;  3DZY D;  4MDD A;  4DOS A;  4PLE A;  2ZNO A;  1X7J A;  5DWJ A;  2FVJ A;  3OLL A;  3UU7 B;  3D5F A;  1ERE A;  1T7F A;  1OVL B;  5DTV A;  3R8I A;  2NW4 A;  1OSV A;  1PQ6 A;  2J4A A;  2QE4 A;  4WLB A;  5LWP A;  1XZX X;  3NOA A;  3OSA A;  2P7Z A;  3ADT A;  4MG6 A;  4PWL A;  1YYE A;  3HO0 A;  2JJ3 A;  4YNK A;  1FM9 D;  3UUD B;  5FQP A;  2NPA A;  5KCC A;  1LV2 A;  3ZQT A;  4G1Y A;  5E15 A;  1FD0 A;  2I0J A;  3A2H A;  3VI8 A;  2ZNN A;  4QL8 A;  3ERT A;  1YIN A;  2QR9 A;  4ZJW A;  5G45 A;  5DL4 A;  3OAP A;  1T65 A;  2PIR A;  3CTB A;  2Q5S A;  4LNW A;  1X78 A;  5HJP B;  3WJ4 A;  2Q1V A;  1XVP B;  4O8F A;  4OZT U;  2ZY0 A;  4E4Q A;  5KR9 A;  2IOK A;  3E94 A;  1XB7 A;  4IV2 A;  1S9Q A;  4ITE A;  5DZH A;  4XHD A;  5AZV A;  5DXQ A;  5B5B A;  2QA8 B;  3RY9 A;  3TKM A;  4MG8 A;  5KCU A;  3ADX A;  3CS6 A;  4IWC A;  3OZJ A;  3KMG A;  5G3J A;  2Q5P A;  3B66 A;  3H0A D;  2VSR A;  5DY8 A;  3A9E A;  5KCT A;  4N5G A;  5E0X A;  1Q4X A;  3VT6 A;  1KNU A;  3AZ1 A;  2VV0 A;  2YLP A;  5AAV A;  2ZNQ A;  3NSP A;  5AWK A;  3VT4 A;  1ILH A;  2XHS A;  3WT5 A;  4PPS A;  1SJ0 A;  5DU5 A;  2AA6 A;  3ZRB A;  4OFU A;  4QE8 A;  4ZNW A;  5APJ A;  1HG4 A;  2AA5 A;  2YLQ A;  3OS8 C;  5L11 A;  2ZK6 A;  3HC6 A;  3W5T A;  3A2J A;  4RZF A;  3P88 A;  3CJW A;  3WFG A;  3E00 A;  3E00 D;  1GWR A;  4QJR A;  3GD2 A;  5DRM A;  1T7R A;  3A3Z X;  3P8X A;  1OT7 A;  4OZR E;  2EWP A;  4OAR A;  5DWG A;  2PIO A;  2Q8S A;  4DOR A;  2ZVT A;  4XTA A;  5KRJ A;  3KMZ A;  3ET0 A;  4OEA A;  2J7X A;  5KCW A;  3VSP A;  1T76 A;  2ZXZ A;  2AO6 A;  2QW4 A;  1ILG A;  4K6I A;  2AX7 A;  2Q6J A;  4OH6 A;  3IPS A;  5DKB A;  2ZK2 A;  3VT3 A;  1NQ1 A;  4G1Z A;  3TX7 B;  4ZJR A;  5DI7 A;  4RUO X;  1YJE A;  4DM6 A;  2POB A;  4ZNU A;  1XPC A;  5E7V A;  1TXI A;  2IHQ A;  3FUR A;  3UU7 A;  1UHL B;  4ZN7 A;  1ZGY A;  2A3I A;  3DY6 A;  3L03 A;  5G5W A;  1OVL A;  1SR7 A;  5SYZ A;  2XKW A;  3SP6 A;  2FAI A;  3W0G A;  3D24 A;  3IMY A;  4NQA B;  3BC5 A;  1S9P A;  4FGY A;  5EIT A;  2VV2 A;  2P7A A;  3BEJ A;  1K74 D;  5E1C A;  2Q61 A;  3KDT A;  4F9M A;  3RLL A;  1K4W A;  3A9E B;  3B65 A;  3MNP A;  5IZ0 A;  2OUZ A;  1N83 A;  3FC6 B;  3SP9 A;  4OKX A;  5GT4 A;  3UUD A;  1R20 D;  5KD9 A;  1R20 A;  1N4H A;  5DXE A;  3VRV A;  3ADU A;  5DP0 A;  4DQM A;  3RUT A;  2YFE A;  4OK1 A;  4G2I A;  1PDU A;  4DK8 A;  5M96 A;  1QKU A;  4MGB B;  3WJ5 A;  1G2N A;  5EJV A;  5HJP A;  2YLO A;  4OZR U;  5IXK A;  1ZEO A;  4HEE X;  2P15 A;  5GIE A;  5KCE A;  3OMQ A;  1XVP A;  2ZLC A;  3HVL A;  2PIT A;  2O4J A;  3FEJ A;  1UPW A;  3E7C A;  4FHI A;  4UDB A;  2Q7I A;  2OM9 A;  5DZI A;  2QA8 A;  2OAX A;  4OGH A;  4OKW A;  3UUC A;  4A4W A;  1SQN A;  1X7R A;  3WMH A;  4MGC A;  1YUC A;  4IV4 A;  4WQP A;  2QZO B;  3AX8 A;  4OHA A;  2FSZ A;  2GWX A;  4OZT E;  1MVC A;  3CS8 A;  5DUG A;  5DXB A;  1P93 A;  4PRG A;  1XLS A;  3GZ9 A;  2ZXN A;  2HBH A;  1IE8 A;  1NUO A;  3K8S A;  4IWF A;  2HVC A;  1NQ2 A;  3PCU A;  4L98 A;  4RMD A;  4ZNV A;  5L7E A;  3A2I A;  5KCD A;  3O1D A;  4K7A A;  4OKB A;  3SZ1 A;  3BQD A;  4IUI A;  3DZY A;  3ZR7 A;  2O9I A;  1T79 A;  2B50 A;  2G44 A;  3CQV A;  2R40 D;  1X7E A;  2R40 A;  1YMT A;  4WHG A;  3OMP A;  5AZT A;  1ERR A;  1XAP A;  4M8H A;  4UDC A;  3IXP D;  3UP3 A;  1Z5X E;  3IXP A;  4REF A;  3F5C B;  4APU A;  5KRK A;  3CDP A;  4YT1 A;  2ZK5 A;  2AXA A;  4DK7 A;  3DCU A;  3GWS X;  1ZAF A;  2HB7 A;  1S0X A;  1FM9 A;  1RKG A;  4P6W A;  4RZG A;  5DWI A;  4E4K A;  1XJ7 A;  3RLJ A;  5KRC A;  3X31 A;  1VJB A;  3VT8 A;  1X76 A;  3ET3 A;  3UP0 A;  2NXX A;  1PK5 A;  1R5K A;  5DV6 A;  1RDT D;  2ACL B; 
#chains in the Genus database with same CATH topology
 3GWX A;  1XV9 B;  2I4Z A;  4PP6 A;  5G43 A;  2Q3Y A;  3L3Z A;  3JZB A;  5KRH A;  2NV7 A;  1I7I A;  2W8Y A;  3AN3 A;  4Y29 A;  1S19 A;  2P54 A;  4UDA A;  1XLS E;  2Q5G A;  3B68 A;  5HJS A;  3TY0 A;  3W0A A;  4DM8 A;  1UHL A;  4S0S A;  2H77 A;  4X1G A;  4J24 A;  4NY9 A;  2POG A;  4MG7 B;  3LBD A;  3RVF A;  2ZMJ A;  2GL8 A;  2PIU A;  3ADV A;  4JGV A;  3H0A A;  4N8R A;  2ZFX A;  2VV4 B;  3K22 A;  4IA7 A;  3PLZ A;  3B0W A;  4J26 A;  3FC6 A;  5G42 A;  2OZ7 A;  2P1U A;  1U3S A;  2Q6S A;  4POH A;  3VJI A;  3W0J A;  5DXB B;  1I38 A;  3R8D A;  5C4O A;  2VV1 B;  1PQC A;  5KCF A;  3W0I A;  1H9U A;  3AUR A;  1Z5X U;  2QXS A;  4QM0 A;  4G1D A;  3FEI A;  5DMF A;  1SKX A;  4NB6 A;  2R6W A;  4MGB A;  3KFC A;  4X1F A;  5DXR A;  5KRL A;  4IA1 A;  4IW6 A;  3Q95 B;  3OMO A;  4RFW A;  5G44 A;  1GWX A;  4R2U A;  2GPU A;  2ATH A;  2GPV A;  2NXX E;  2ZL9 A;  1L2J A;  4PXM A;  4KZJ A;  4PP5 A;  4OJ9 A;  2VST A;  3HM1 A;  1ZUC A;  1HJ1 A;  3ERD A;  4G21 A;  3VT7 A;  2R6Y A;  2PJL A;  3V3Q A;  1E3K A;  1QKT A;  3OKH A;  4J5X A;  1XNN A;  5JY3 A;  4YPQ A;  1UPV A;  2ZKC A;  4RAK A;  4EMA A;  2QZO A;  2ZK1 A;  5G46 A;  3W0Y A;  2O4R A;  4ZO1 B;  5DV8 A;  3G8O A;  4CI5 A;  5DYB A;  2Q1H A;  1XDK A;  2YJA B;  3ET2 A;  4RE8 A;  2JFA B;  4MG9 B;  3HQ5 A;  2Z4J A;  1ZH7 A;  5IAW A;  4IVW A;  3GBK A;  2PKL A;  4N73 A;  4OED A;  5DWL A;  5KRA A;  1PCG A;  5DVV A;  2AYR A;  4J5W A;  1ZDU A;  3W0H A;  1QKN A;  3ZRA A;  2I4J A;  1U3R A;  3VJH A;  5I4V A;  4TV1 B;  5DZ3 A;  1FCY A;  2ZLA A;  3B67 A;  3L3X A;  3ADS A;  3VSO A;  2PIP L;  2REW A;  1LBD A;  3A40 X;  1XP1 A;  2AX8 A;  3VT9 A;  2P4Y A;  1XQ3 A;  3R5N A;  2ABI A;  3D90 A;  1X7B A;  3PRG A;  3B1M A;  5AWJ A;  5K13 A;  4K4J A;  1FBY A;  4OH5 A;  2G0H A;  3L0E A;  2QGW A;  5DK9 A;  3F5C A;  3KBA A;  1K74 A;  1XP6 A;  2BAW A;  3AUN A;  2HAR A;  3F7D A;  3L0J A;  2PIN A;  1M2Z A;  2QH6 A;  3CDS A;  4MGD B;  4ZI1 A;  5EC9 A;  1NAV A;  4R06 A;  1GS4 A;  5A86 A;  1NDE A;  5DMC A;  3HZF A;  4Q50 A;  2QTU A;  3KWY A;  1G1U A;  1T63 A;  4PVU A;  4OKT A;  5ETH A;  1XOW A;  3A78 A;  2ACL A;  5AVL A;  3DZU A;  3DZU D;  1XV9 A;  3WGP A;  4OLM A;  3W5P A;  3X1H A;  2P1T A;  5KYJ A;  3VJS A;  4R6S A;  3AUQ A;  3R29 A;  1RJK A;  1FM6 D;  2J14 A;  5DXG A;  2V0V A;  3UUA B;  3W5Q A;  5B41 A;  2ZK4 A;  4KZI A;  1M7W A;  2ZNP A;  4MG7 A;  5FQS A;  3V3E A;  2ZXM A;  4LSJ A;  5HZC A;  1FCX A;  4E2J A;  4S0T A;  5DVC A;  3IPQ A;  3MNO A;  4TUZ B;  5APK A;  3WWR A;  1OSH A;  5DZ1 A;  2VV4 A;  3KDU A;  4G20 A;  2AM9 A;  3ILZ A;  1XDK B;  2QXM A;  4JYH A;  4LTW A;  4Q13 A;  3WT6 A;  4OC7 A;  2VV1 A;  4PP3 A;  3CLD A;  3V4A A;  1A52 A;  4XI3 A;  4IVY A;  2HCD A;  3D57 A;  5DXM A;  1XIU A;  4MG5 A;  3X1I A;  4J5X C;  4UDD A;  4WPF A;  4ZO1 X;  2HWQ A;  4G2H A;  3Q95 A;  3WT7 A;  4PLD A;  3K23 A;  4ZNT A;  1U3Q A;  3G9E A;  4PF3 A;  3AZ2 A;  3HLV A;  3EYB A;  5HYK A;  3M7R A;  1UOM A;  5DIE A;  3TKC A;  3VHW A;  4XUM A;  1YP0 A;  3LMP A;  3VRU A;  2JF9 A;  3P89 A;  1XP9 A;  3VTC A;  1T7M A;  1NRL A;  2Q7J A;  1DKF B;  3OGT A;  4J5W C;  4RZE A;  4DMA A;  4FHH A;  3GYU A;  1PQ9 A;  3G8I A;  1P8D A;  1YOK A;  2BJ4 B;  2B23 A;  1U9E A;  2JFA A;  2XYJ A;  2AMB A;  3IA6 A;  4MG9 A;  2HAM A;  4QK4 A;  5EHJ A;  1NHZ A;  4IS8 A;  4RUJ A;  2Q59 B;  2VV3 A;  4YMQ A;  3OOK A;  1KKQ A;  2QMV A;  1N46 A;  3WTQ A;  4TV1 A;  2Q6R A;  4RMC A;  1MV9 A;  3NSQ A;  3V9Y A;  5DVS A;  2G0G A;  2QA6 A;  3DR1 A;  4HLW A;  5AYG A;  5KRM A;  1NAX A;  1WM0 X;  4CI4 A;  2QNV A;  1Y0X X;  4WHF A;  2LBD A;  1ZKY A;  5APH A;  5L7G A;  3OLF A;  4S15 A;  1YY4 A;  4Q0A C;  5C4S A;  3RUU A;  2G5O A;  3H52 A;  3MNE A;  1YOW A;  1T5Z A;  4ZOM A;  5FQV A;  4MGD A;  5JJM B;  3OSI A;  3VHV A;  2ZK3 A;  2Q7L A;  1PZL A;  2QSE A;  1S0Z A;  2PIX A;  3VRT A;  1EXX A;  1K7L A;  1ZDT A;  2PIW A;  4MGA B;  3VN2 A;  5H1E A;  2AX6 A;  1G50 A;  1Y0S A;  4JYG A;  5AVI A;  4XT9 A;  3OMM A;  3FS1 A;  3T03 A;  4REE A;  5DXK A;  5DUH A;  3V9V A;  2OCF A;  3OKI A;  2AMA A;  2OVM A;  4XLD A;  3HC5 A;  3WFF A;  3R2A A;  4OIL A;  3ET1 A;  1FCZ A;  1M13 A;  4IA3 A;  2GTK A;  4RME A;  4ONI A;  5CJ6 A;  3UUA A;  5DUE A;  3DT3 A;  1L2I A;  4RWV A;  4JYI A;  5DIG A;  1Z95 A;  2P7G A;  2QGT A;  3OOF A;  3FAL B;  3N00 A;  2HAS A;  4FNE A;  3GN8 A;  4WVD A;  2PIQ A;  4TUZ A;  2AAX A;  2ZMH A;  4OEZ A;  3ADW A;  5DKS A;  4B7W A;  3AFR A;  4A4V A;  4EM9 A;  5DX3 B;  1NYX A;  3HOD A;  3KYT A;  3AZ3 A;  3JZC A;  1T74 A;  3G0W A;  5GID A;  2Q60 A;  3KPZ A;  3PO9 A;  4IW8 A;  1QKM A;  1T7T A;  2F4B A;  2OVH A;  2V7C A;  3UVV A;  3D6D A;  2B1Z A;  1T73 A;  4OFR A;  2HC4 A;  3CWD A;  4L96 A;  3VHU A;  3V9T A;  1PRG A;  5F9B A;  5ICK A;  5FQR A;  2XYW A;  1R1K D;  3B0R A;  1R1K A;  3B0Q A;  3GYT A;  3OZ0 A;  1DB1 A;  1XQC A;  3L1B A;  4OJB A;  2YLY A;  5DKG A;  3VTB A;  4IQR A;  5HYR A;  5DZ0 A;  2AX9 A;  1DKF A;  5AAU A;  4RUP A;  1XNX A;  5L7H A;  3PEQ A;  3P0U A;  4BCR A;  5DX3 A;  2BJ4 A;  2YAT A;  5EGV A;  2J7Y A;  2QPY A;  3VJT A;  3OSW A;  2P1V A;  2Q59 A;  3OMK A;  2Z4B A;  4QE6 A;  4JAZ A;  1EXA A;  5E14 A;  4POJ A;  4XUH A;  5C4U A;  3QT0 A;  5KYA A;  5KRO A;  3L0L A;  3VTD A;  1YIM A;  4OEY A;  5DRJ A;  1RKH A;  5C4T A;  4MG8 B;  3B5R A;  2ZAS A;  2ZMI A;  5DYD A;  1IE9 A;  1FM6 A;  2HB8 A;  3OS9 A;  1A28 A;  4ZNS A;  2XYX A;  2HWR A;  5DSH A;  2GPP A;  4IU7 A;  5KRF A;  2AB2 A;  2B1V A;  3KMR A;  5DID A;  1MZN A;  3VRW A;  1I7G A;  4ITF A;  1BSX A;  2HFP A;  1G5Y A;  4M8E A;  5AAV B;  1E3G A;  3CS4 A;  4P6X A;  4N1Y A;  4OJ4 A;  1R6G A;  5DXP A;  2AA7 A;  4JL4 A;  4KZM A;  3FLI A;  3VT5 A;  2I4P A;  5JJM A;  4S14 A;  1TFC A;  2GP7 A;  4XAO A;  5FQT A;  1RK3 A;  2YJD A;  4FN9 A;  5EI1 A;  4ZN9 A;  1RDT A;  2GIU A;  2GPO A;  3B3K A;  4A2J A;  4CSJ A;  5ACC A;  1NQ7 A;  2AA2 A;  3AN4 A;  4MGA A;  3W5R A;  4PPP A;  3IPU A;  3B0T A;  3O1E A;  5KRI A;  1GWQ A;  3UVV B;  5DLR A;  5DWE A;  3S9S A;  2E2R A;  2ZBS A;  2Q7K A;  4LNX A;  3FXV A;  4OIU A;  5AK2 A;  3W0C A;  2QAB A;  3DCT A;  2H79 A;  3R5M A;  3R8A A;  5HCV A;  2Q70 A;  3PBA A;  3X36 A;  5E0W A;  2YHD A;  2AWH A;  3OS8 A;  1KV6 A;  3FAL A;  3V49 A;  4OIV A;  2I0G A;  1I37 A;  2IOG A;  2PNU A;  4IA2 A;  1Y9R A;  3FUG A;  2PRG A;  2PIV A;  5DKE A;  2ZK0 A;  5E19 A;  4NUF A;  5JI0 D;  4NIE A;  1YA3 A;  3K6P A;  3OLS A;  5GIC A;  1NQ0 A;  4ZNH A;  3U9Q A;  5LGA A;  4LBD A;  5DV3 A;  3DZY D;  4MDD A;  4DOS A;  4PLE A;  2ZNO A;  1X7J A;  5DWJ A;  2FVJ A;  3OLL A;  3UU7 B;  3D5F A;  1ERE A;  1T7F A;  1OVL B;  5DTV A;  3R8I A;  2NW4 A;  1OSV A;  1PQ6 A;  2J4A A;  2QE4 A;  4WLB A;  5LWP A;  1XZX X;  3NOA A;  3OSA A;  2P7Z A;  3ADT A;  4MG6 A;  4PWL A;  1YYE A;  3HO0 A;  2JJ3 A;  4YNK A;  1FM9 D;  3UUD B;  5FQP A;  2NPA A;  5KCC A;  1LV2 A;  3ZQT A;  4G1Y A;  5E15 A;  1FD0 A;  2I0J A;  3A2H A;  3VI8 A;  2ZNN A;  4QL8 A;  3ERT A;  1YIN A;  2QR9 A;  4ZJW A;  5G45 A;  5DL4 A;  3OAP A;  1T65 A;  2PIR A;  3CTB A;  2Q5S A;  4LNW A;  1X78 A;  5HJP B;  3WJ4 A;  2Q1V A;  1XVP B;  4O8F A;  4OZT U;  2ZY0 A;  4E4Q A;  5KR9 A;  2IOK A;  3E94 A;  1XB7 A;  4IV2 A;  1S9Q A;  4ITE A;  5DZH A;  4XHD A;  5AZV A;  5DXQ A;  5B5B A;  2QA8 B;  3RY9 A;  3TKM A;  4MG8 A;  5KCU A;  3ADX A;  3CS6 A;  4IWC A;  3OZJ A;  3KMG A;  5G3J A;  2Q5P A;  3B66 A;  3H0A D;  2VSR A;  5DY8 A;  3A9E A;  5KCT A;  4N5G A;  5E0X A;  1Q4X A;  3VT6 A;  1KNU A;  3AZ1 A;  2VV0 A;  2YLP A;  5AAV A;  2ZNQ A;  3NSP A;  5AWK A;  3VT4 A;  1ILH A;  2XHS A;  3WT5 A;  4PPS A;  1SJ0 A;  5DU5 A;  2AA6 A;  3ZRB A;  4OFU A;  4QE8 A;  4ZNW A;  5APJ A;  1HG4 A;  2AA5 A;  2YLQ A;  3OS8 C;  5L11 A;  2ZK6 A;  3HC6 A;  3W5T A;  3A2J A;  4RZF A;  3P88 A;  3CJW A;  3WFG A;  3E00 A;  3E00 D;  1GWR A;  4QJR A;  3GD2 A;  5DRM A;  1T7R A;  3A3Z X;  3P8X A;  1OT7 A;  4OZR E;  2EWP A;  4OAR A;  5DWG A;  2PIO A;  2Q8S A;  4DOR A;  2ZVT A;  4XTA A;  5KRJ A;  3KMZ A;  3ET0 A;  4OEA A;  2J7X A;  5KCW A;  3VSP A;  1T76 A;  2ZXZ A;  2AO6 A;  2QW4 A;  1ILG A;  4K6I A;  2AX7 A;  2Q6J A;  4OH6 A;  3IPS A;  5DKB A;  2ZK2 A;  3VT3 A;  1NQ1 A;  4G1Z A;  3TX7 B;  4ZJR A;  5DI7 A;  4RUO X;  1YJE A;  4DM6 A;  2POB A;  4ZNU A;  1XPC A;  5E7V A;  1TXI A;  2IHQ A;  3FUR A;  3UU7 A;  1UHL B;  4ZN7 A;  1ZGY A;  2A3I A;  3DY6 A;  3L03 A;  5G5W A;  1OVL A;  1SR7 A;  5SYZ A;  2XKW A;  3SP6 A;  2FAI A;  3W0G A;  3D24 A;  3IMY A;  4NQA B;  3BC5 A;  1S9P A;  4FGY A;  5EIT A;  2VV2 A;  2P7A A;  3BEJ A;  1K74 D;  5E1C A;  2Q61 A;  3KDT A;  4F9M A;  3RLL A;  1K4W A;  3A9E B;  3B65 A;  3MNP A;  5IZ0 A;  2OUZ A;  1N83 A;  3FC6 B;  3SP9 A;  4OKX A;  5GT4 A;  3UUD A;  1R20 D;  5KD9 A;  1R20 A;  1N4H A;  5DXE A;  3VRV A;  3ADU A;  5DP0 A;  4DQM A;  3RUT A;  2YFE A;  4OK1 A;  4G2I A;  1PDU A;  4DK8 A;  5M96 A;  1QKU A;  4MGB B;  3WJ5 A;  1G2N A;  5EJV A;  5HJP A;  2YLO A;  4OZR U;  5IXK A;  1ZEO A;  4HEE X;  2P15 A;  5GIE A;  5KCE A;  3OMQ A;  1XVP A;  2ZLC A;  3HVL A;  2PIT A;  2O4J A;  3FEJ A;  1UPW A;  3E7C A;  4FHI A;  4UDB A;  2Q7I A;  2OM9 A;  5DZI A;  2QA8 A;  2OAX A;  4OGH A;  4OKW A;  3UUC A;  4A4W A;  1SQN A;  1X7R A;  3WMH A;  4MGC A;  1YUC A;  4IV4 A;  4WQP A;  2QZO B;  3AX8 A;  4OHA A;  2FSZ A;  2GWX A;  4OZT E;  1MVC A;  3CS8 A;  5DUG A;  5DXB A;  1P93 A;  4PRG A;  1XLS A;  3GZ9 A;  2ZXN A;  2HBH A;  1IE8 A;  1NUO A;  3K8S A;  4IWF A;  2HVC A;  1NQ2 A;  3PCU A;  4L98 A;  4RMD A;  4ZNV A;  5L7E A;  3A2I A;  5KCD A;  3O1D A;  4K7A A;  4OKB A;  3SZ1 A;  3BQD A;  4IUI A;  3DZY A;  3ZR7 A;  2O9I A;  1T79 A;  2B50 A;  2G44 A;  3CQV A;  2R40 D;  1X7E A;  2R40 A;  1YMT A;  4WHG A;  3OMP A;  5AZT A;  1ERR A;  1XAP A;  4M8H A;  4UDC A;  3IXP D;  3UP3 A;  1Z5X E;  3IXP A;  4REF A;  3F5C B;  4APU A;  5KRK A;  3CDP A;  4YT1 A;  2ZK5 A;  2AXA A;  4DK7 A;  3DCU A;  3GWS X;  1ZAF A;  2HB7 A;  1S0X A;  1FM9 A;  1RKG A;  4P6W A;  4RZG A;  5DWI A;  4E4K A;  1XJ7 A;  3RLJ A;  5KRC A;  3X31 A;  1VJB A;  3VT8 A;  1X76 A;  3ET3 A;  3UP0 A;  2NXX A;  1PK5 A;  1R5K A;  5DV6 A;  1RDT D;  2ACL B; 
#chains in the Genus database with same CATH homology
 3GWX A;  1XV9 B;  2I4Z A;  4PP6 A;  5G43 A;  2Q3Y A;  3L3Z A;  3JZB A;  5KRH A;  2NV7 A;  1I7I A;  2W8Y A;  3AN3 A;  4Y29 A;  1S19 A;  2P54 A;  4UDA A;  1XLS E;  2Q5G A;  3B68 A;  5HJS A;  3TY0 A;  3W0A A;  4DM8 A;  1UHL A;  4S0S A;  2H77 A;  4X1G A;  4J24 A;  4NY9 A;  2POG A;  4MG7 B;  3LBD A;  3RVF A;  2ZMJ A;  2GL8 A;  2PIU A;  3ADV A;  4JGV A;  3H0A A;  4N8R A;  2ZFX A;  2VV4 B;  3K22 A;  4IA7 A;  3PLZ A;  3B0W A;  4J26 A;  3FC6 A;  5G42 A;  2OZ7 A;  2P1U A;  1U3S A;  2Q6S A;  4POH A;  3VJI A;  3W0J A;  5DXB B;  1I38 A;  3R8D A;  5C4O A;  2VV1 B;  1PQC A;  5KCF A;  3W0I A;  1H9U A;  3AUR A;  1Z5X U;  2QXS A;  4QM0 A;  4G1D A;  3FEI A;  5DMF A;  1SKX A;  4NB6 A;  2R6W A;  4MGB A;  3KFC A;  4X1F A;  5DXR A;  5KRL A;  4IA1 A;  4IW6 A;  3Q95 B;  3OMO A;  4RFW A;  5G44 A;  1GWX A;  4R2U A;  2GPU A;  2ATH A;  2GPV A;  2NXX E;  2ZL9 A;  1L2J A;  4PXM A;  4KZJ A;  4PP5 A;  4OJ9 A;  2VST A;  3HM1 A;  1ZUC A;  1HJ1 A;  3ERD A;  4G21 A;  3VT7 A;  2R6Y A;  2PJL A;  3V3Q A;  1E3K A;  1QKT A;  3OKH A;  4J5X A;  1XNN A;  5JY3 A;  4YPQ A;  1UPV A;  2ZKC A;  4RAK A;  4EMA A;  2QZO A;  2ZK1 A;  5G46 A;  3W0Y A;  2O4R A;  4ZO1 B;  5DV8 A;  3G8O A;  4CI5 A;  5DYB A;  2Q1H A;  1XDK A;  2YJA B;  3ET2 A;  4RE8 A;  2JFA B;  4MG9 B;  3HQ5 A;  2Z4J A;  1ZH7 A;  5IAW A;  4IVW A;  3GBK A;  2PKL A;  4N73 A;  4OED A;  5DWL A;  5KRA A;  1PCG A;  5DVV A;  2AYR A;  4J5W A;  1ZDU A;  3W0H A;  1QKN A;  3ZRA A;  2I4J A;  1U3R A;  3VJH A;  5I4V A;  4TV1 B;  5DZ3 A;  1FCY A;  2ZLA A;  3B67 A;  3L3X A;  3ADS A;  3VSO A;  2PIP L;  2REW A;  1LBD A;  3A40 X;  1XP1 A;  2AX8 A;  3VT9 A;  2P4Y A;  1XQ3 A;  3R5N A;  2ABI A;  3D90 A;  1X7B A;  3PRG A;  3B1M A;  5AWJ A;  5K13 A;  4K4J A;  1FBY A;  4OH5 A;  2G0H A;  3L0E A;  2QGW A;  5DK9 A;  3F5C A;  3KBA A;  1K74 A;  1XP6 A;  2BAW A;  3AUN A;  2HAR A;  3F7D A;  3L0J A;  2PIN A;  1M2Z A;  2QH6 A;  3CDS A;  4MGD B;  4ZI1 A;  5EC9 A;  1NAV A;  4R06 A;  1GS4 A;  5A86 A;  1NDE A;  5DMC A;  3HZF A;  4Q50 A;  2QTU A;  3KWY A;  1G1U A;  1T63 A;  4PVU A;  4OKT A;  5ETH A;  1XOW A;  3A78 A;  2ACL A;  5AVL A;  3DZU A;  3DZU D;  1XV9 A;  3WGP A;  4OLM A;  3W5P A;  3X1H A;  2P1T A;  5KYJ A;  3VJS A;  4R6S A;  3AUQ A;  3R29 A;  1RJK A;  1FM6 D;  2J14 A;  5DXG A;  2V0V A;  3UUA B;  3W5Q A;  5B41 A;  2ZK4 A;  4KZI A;  1M7W A;  2ZNP A;  4MG7 A;  5FQS A;  3V3E A;  2ZXM A;  4LSJ A;  5HZC A;  1FCX A;  4E2J A;  4S0T A;  5DVC A;  3IPQ A;  3MNO A;  4TUZ B;  5APK A;  3WWR A;  1OSH A;  5DZ1 A;  2VV4 A;  3KDU A;  4G20 A;  2AM9 A;  3ILZ A;  1XDK B;  2QXM A;  4JYH A;  4LTW A;  4Q13 A;  3WT6 A;  4OC7 A;  2VV1 A;  4PP3 A;  3CLD A;  3V4A A;  1A52 A;  4XI3 A;  4IVY A;  2HCD A;  3D57 A;  5DXM A;  1XIU A;  4MG5 A;  3X1I A;  4J5X C;  4UDD A;  4WPF A;  4ZO1 X;  2HWQ A;  4G2H A;  3Q95 A;  3WT7 A;  4PLD A;  3K23 A;  4ZNT A;  1U3Q A;  3G9E A;  4PF3 A;  3AZ2 A;  3HLV A;  3EYB A;  5HYK A;  3M7R A;  1UOM A;  5DIE A;  3TKC A;  3VHW A;  4XUM A;  1YP0 A;  3LMP A;  3VRU A;  2JF9 A;  3P89 A;  1XP9 A;  3VTC A;  1T7M A;  1NRL A;  2Q7J A;  1DKF B;  3OGT A;  4J5W C;  4RZE A;  4DMA A;  4FHH A;  3GYU A;  1PQ9 A;  3G8I A;  1P8D A;  1YOK A;  2BJ4 B;  2B23 A;  1U9E A;  2JFA A;  2XYJ A;  2AMB A;  3IA6 A;  4MG9 A;  2HAM A;  4QK4 A;  5EHJ A;  1NHZ A;  4IS8 A;  4RUJ A;  2Q59 B;  2VV3 A;  4YMQ A;  3OOK A;  1KKQ A;  2QMV A;  1N46 A;  3WTQ A;  4TV1 A;  2Q6R A;  4RMC A;  1MV9 A;  3NSQ A;  3V9Y A;  5DVS A;  2G0G A;  2QA6 A;  3DR1 A;  4HLW A;  5AYG A;  5KRM A;  1NAX A;  1WM0 X;  4CI4 A;  2QNV A;  1Y0X X;  4WHF A;  2LBD A;  1ZKY A;  5APH A;  5L7G A;  3OLF A;  4S15 A;  1YY4 A;  4Q0A C;  5C4S A;  3RUU A;  2G5O A;  3H52 A;  3MNE A;  1YOW A;  1T5Z A;  4ZOM A;  5FQV A;  4MGD A;  5JJM B;  3OSI A;  3VHV A;  2ZK3 A;  2Q7L A;  1PZL A;  2QSE A;  1S0Z A;  2PIX A;  3VRT A;  1EXX A;  1K7L A;  1ZDT A;  2PIW A;  4MGA B;  3VN2 A;  5H1E A;  2AX6 A;  1G50 A;  1Y0S A;  4JYG A;  5AVI A;  4XT9 A;  3OMM A;  3FS1 A;  3T03 A;  4REE A;  5DXK A;  5DUH A;  3V9V A;  2OCF A;  3OKI A;  2AMA A;  2OVM A;  4XLD A;  3HC5 A;  3WFF A;  3R2A A;  4OIL A;  3ET1 A;  1FCZ A;  1M13 A;  4IA3 A;  2GTK A;  4RME A;  4ONI A;  5CJ6 A;  3UUA A;  5DUE A;  3DT3 A;  1L2I A;  4RWV A;  4JYI A;  5DIG A;  1Z95 A;  2P7G A;  2QGT A;  3OOF A;  3FAL B;  3N00 A;  2HAS A;  4FNE A;  3GN8 A;  4WVD A;  2PIQ A;  4TUZ A;  2AAX A;  2ZMH A;  4OEZ A;  3ADW A;  5DKS A;  4B7W A;  3AFR A;  4A4V A;  4EM9 A;  5DX3 B;  1NYX A;  3HOD A;  3KYT A;  3AZ3 A;  3JZC A;  1T74 A;  3G0W A;  5GID A;  2Q60 A;  3KPZ A;  3PO9 A;  4IW8 A;  1QKM A;  1T7T A;  2F4B A;  2OVH A;  2V7C A;  3UVV A;  3D6D A;  2B1Z A;  1T73 A;  4OFR A;  2HC4 A;  3CWD A;  4L96 A;  3VHU A;  3V9T A;  1PRG A;  5F9B A;  5ICK A;  5FQR A;  2XYW A;  1R1K D;  3B0R A;  1R1K A;  3B0Q A;  3GYT A;  3OZ0 A;  1DB1 A;  1XQC A;  3L1B A;  4OJB A;  2YLY A;  5DKG A;  3VTB A;  4IQR A;  5HYR A;  5DZ0 A;  2AX9 A;  1DKF A;  5AAU A;  4RUP A;  1XNX A;  5L7H A;  3PEQ A;  3P0U A;  4BCR A;  5DX3 A;  2BJ4 A;  2YAT A;  5EGV A;  2J7Y A;  2QPY A;  3VJT A;  3OSW A;  2P1V A;  2Q59 A;  3OMK A;  2Z4B A;  4QE6 A;  4JAZ A;  1EXA A;  5E14 A;  4POJ A;  4XUH A;  5C4U A;  3QT0 A;  5KYA A;  5KRO A;  3L0L A;  3VTD A;  1YIM A;  4OEY A;  5DRJ A;  1RKH A;  5C4T A;  4MG8 B;  3B5R A;  2ZAS A;  2ZMI A;  5DYD A;  1IE9 A;  1FM6 A;  2HB8 A;  3OS9 A;  1A28 A;  4ZNS A;  2XYX A;  2HWR A;  5DSH A;  2GPP A;  4IU7 A;  5KRF A;  2AB2 A;  2B1V A;  3KMR A;  5DID A;  1MZN A;  3VRW A;  1I7G A;  4ITF A;  1BSX A;  2HFP A;  1G5Y A;  4M8E A;  5AAV B;  1E3G A;  3CS4 A;  4P6X A;  4N1Y A;  4OJ4 A;  1R6G A;  5DXP A;  2AA7 A;  4JL4 A;  4KZM A;  3FLI A;  3VT5 A;  2I4P A;  5JJM A;  4S14 A;  1TFC A;  2GP7 A;  4XAO A;  5FQT A;  1RK3 A;  2YJD A;  4FN9 A;  5EI1 A;  4ZN9 A;  1RDT A;  2GIU A;  2GPO A;  3B3K A;  4A2J A;  4CSJ A;  5ACC A;  1NQ7 A;  2AA2 A;  3AN4 A;  4MGA A;  3W5R A;  4PPP A;  3IPU A;  3B0T A;  3O1E A;  5KRI A;  1GWQ A;  3UVV B;  5DLR A;  5DWE A;  3S9S A;  2E2R A;  2ZBS A;  2Q7K A;  4LNX A;  3FXV A;  4OIU A;  5AK2 A;  3W0C A;  2QAB A;  3DCT A;  2H79 A;  3R5M A;  3R8A A;  5HCV A;  2Q70 A;  3PBA A;  3X36 A;  5E0W A;  2YHD A;  2AWH A;  3OS8 A;  1KV6 A;  3FAL A;  3V49 A;  4OIV A;  2I0G A;  1I37 A;  2IOG A;  2PNU A;  4IA2 A;  1Y9R A;  3FUG A;  2PRG A;  2PIV A;  5DKE A;  2ZK0 A;  5E19 A;  4NUF A;  5JI0 D;  4NIE A;  1YA3 A;  3K6P A;  3OLS A;  5GIC A;  1NQ0 A;  4ZNH A;  3U9Q A;  5LGA A;  4LBD A;  5DV3 A;  3DZY D;  4MDD A;  4DOS A;  4PLE A;  2ZNO A;  1X7J A;  5DWJ A;  2FVJ A;  3OLL A;  3UU7 B;  3D5F A;  1ERE A;  1T7F A;  1OVL B;  5DTV A;  3R8I A;  2NW4 A;  1OSV A;  1PQ6 A;  2J4A A;  2QE4 A;  4WLB A;  5LWP A;  1XZX X;  3NOA A;  3OSA A;  2P7Z A;  3ADT A;  4MG6 A;  4PWL A;  1YYE A;  3HO0 A;  2JJ3 A;  4YNK A;  1FM9 D;  3UUD B;  5FQP A;  2NPA A;  5KCC A;  1LV2 A;  3ZQT A;  4G1Y A;  5E15 A;  1FD0 A;  2I0J A;  3A2H A;  3VI8 A;  2ZNN A;  4QL8 A;  3ERT A;  1YIN A;  2QR9 A;  4ZJW A;  5G45 A;  5DL4 A;  3OAP A;  1T65 A;  2PIR A;  3CTB A;  2Q5S A;  4LNW A;  1X78 A;  5HJP B;  3WJ4 A;  2Q1V A;  1XVP B;  4O8F A;  4OZT U;  2ZY0 A;  4E4Q A;  5KR9 A;  2IOK A;  3E94 A;  1XB7 A;  4IV2 A;  1S9Q A;  4ITE A;  5DZH A;  4XHD A;  5AZV A;  5DXQ A;  5B5B A;  2QA8 B;  3RY9 A;  3TKM A;  4MG8 A;  5KCU A;  3ADX A;  3CS6 A;  4IWC A;  3OZJ A;  3KMG A;  5G3J A;  2Q5P A;  3B66 A;  3H0A D;  2VSR A;  5DY8 A;  3A9E A;  5KCT A;  4N5G A;  5E0X A;  1Q4X A;  3VT6 A;  1KNU A;  3AZ1 A;  2VV0 A;  2YLP A;  5AAV A;  2ZNQ A;  3NSP A;  5AWK A;  3VT4 A;  1ILH A;  2XHS A;  3WT5 A;  4PPS A;  1SJ0 A;  5DU5 A;  2AA6 A;  3ZRB A;  4OFU A;  4QE8 A;  4ZNW A;  5APJ A;  1HG4 A;  2AA5 A;  2YLQ A;  3OS8 C;  5L11 A;  2ZK6 A;  3HC6 A;  3W5T A;  3A2J A;  4RZF A;  3P88 A;  3CJW A;  3WFG A;  3E00 A;  3E00 D;  1GWR A;  4QJR A;  3GD2 A;  5DRM A;  1T7R A;  3A3Z X;  3P8X A;  1OT7 A;  4OZR E;  2EWP A;  4OAR A;  5DWG A;  2PIO A;  2Q8S A;  4DOR A;  2ZVT A;  4XTA A;  5KRJ A;  3KMZ A;  3ET0 A;  4OEA A;  2J7X A;  5KCW A;  3VSP A;  1T76 A;  2ZXZ A;  2AO6 A;  2QW4 A;  1ILG A;  4K6I A;  2AX7 A;  2Q6J A;  4OH6 A;  3IPS A;  5DKB A;  2ZK2 A;  3VT3 A;  1NQ1 A;  4G1Z A;  3TX7 B;  4ZJR A;  5DI7 A;  4RUO X;  1YJE A;  4DM6 A;  2POB A;  4ZNU A;  1XPC A;  5E7V A;  1TXI A;  2IHQ A;  3FUR A;  3UU7 A;  1UHL B;  4ZN7 A;  1ZGY A;  2A3I A;  3DY6 A;  3L03 A;  5G5W A;  1OVL A;  1SR7 A;  5SYZ A;  2XKW A;  3SP6 A;  2FAI A;  3W0G A;  3D24 A;  3IMY A;  4NQA B;  3BC5 A;  1S9P A;  4FGY A;  5EIT A;  2VV2 A;  2P7A A;  3BEJ A;  1K74 D;  5E1C A;  2Q61 A;  3KDT A;  4F9M A;  3RLL A;  1K4W A;  3A9E B;  3B65 A;  3MNP A;  5IZ0 A;  2OUZ A;  1N83 A;  3FC6 B;  3SP9 A;  4OKX A;  5GT4 A;  3UUD A;  1R20 D;  5KD9 A;  1R20 A;  1N4H A;  5DXE A;  3VRV A;  3ADU A;  5DP0 A;  4DQM A;  3RUT A;  2YFE A;  4OK1 A;  4G2I A;  1PDU A;  4DK8 A;  5M96 A;  1QKU A;  4MGB B;  3WJ5 A;  1G2N A;  5EJV A;  5HJP A;  2YLO A;  4OZR U;  5IXK A;  1ZEO A;  4HEE X;  2P15 A;  5GIE A;  5KCE A;  3OMQ A;  1XVP A;  2ZLC A;  3HVL A;  2PIT A;  2O4J A;  3FEJ A;  1UPW A;  3E7C A;  4FHI A;  4UDB A;  2Q7I A;  2OM9 A;  5DZI A;  2QA8 A;  2OAX A;  4OGH A;  4OKW A;  3UUC A;  4A4W A;  1SQN A;  1X7R A;  3WMH A;  4MGC A;  1YUC A;  4IV4 A;  4WQP A;  2QZO B;  3AX8 A;  4OHA A;  2FSZ A;  2GWX A;  4OZT E;  1MVC A;  3CS8 A;  5DUG A;  5DXB A;  1P93 A;  4PRG A;  1XLS A;  3GZ9 A;  2ZXN A;  2HBH A;  1IE8 A;  1NUO A;  3K8S A;  4IWF A;  2HVC A;  1NQ2 A;  3PCU A;  4L98 A;  4RMD A;  4ZNV A;  5L7E A;  3A2I A;  5KCD A;  3O1D A;  4K7A A;  4OKB A;  3SZ1 A;  3BQD A;  4IUI A;  3DZY A;  3ZR7 A;  2O9I A;  1T79 A;  2B50 A;  2G44 A;  3CQV A;  2R40 D;  1X7E A;  2R40 A;  1YMT A;  4WHG A;  3OMP A;  5AZT A;  1ERR A;  1XAP A;  4M8H A;  4UDC A;  3IXP D;  3UP3 A;  1Z5X E;  3IXP A;  4REF A;  3F5C B;  4APU A;  5KRK A;  3CDP A;  4YT1 A;  2ZK5 A;  2AXA A;  4DK7 A;  3DCU A;  3GWS X;  1ZAF A;  2HB7 A;  1S0X A;  1FM9 A;  1RKG A;  4P6W A;  4RZG A;  5DWI A;  4E4K A;  1XJ7 A;  3RLJ A;  5KRC A;  3X31 A;  1VJB A;  3VT8 A;  1X76 A;  3ET3 A;  3UP0 A;  2NXX A;  1PK5 A;  1R5K A;  5DV6 A;  1RDT D;  2ACL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...