3VRTA

Vdr ligand binding domain in complex with 2-mehylidene-19,25,26,27-tetranor-1alpha,24-dihydroxyvitamind3
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
249
structure length
238
Chain Sequence
LSEEQQHIIAILLDAHHKTYDPTYADFRDFRPPVRMSPLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTSDDQIVLLKSSAIEVIMLRSNQSFTMDDMSWDCGSQDYKYDVTDVSKAGHTLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAKLVEAIQDRLSNTLQTYIRCRHPPPGSHQLYAKMIQKLADLRSLNEEHSKQYRSLSFQPENSMKLTPLVLEVFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Butyl pocket formation in the vitamin d receptor strongly affects the agonistic or antagonistic behavior of ligands
pubmed doi rcsb
molecule keywords Vitamin D3 receptor
molecule tags Transcription
source organism Rattus norvegicus
total genus 93
structure length 238
sequence length 249
ec nomenclature
pdb deposition date 2012-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 3vrtA00
5I4VA 1MVCA 1ILGA 4NY9A 2ZMJA 5GICA 3X1HA 1YOKA 2H79A 2QW4A 1K7LA 4M8HA 1SQNA 1R6GA 4OFRA 4F9MA 2ABIA 2VV4B 1XZXX 1L2JA 4MGAB 2AA2A 3AUQA 5JI0D 4KZIA 4NIEA 2HCDA 3V4AA 2QNVA 3VT8A 1FD0A 1DB1A 5HZCA 5KCDA 3F7DA 1R20A 2P7ZA 3V49A 4IS8A 1YMTA 3K22A 5KRFA 3E94A 5KRJA 4OKXA 4Q50A 5DMFA 2J4AA 5DYBA 5G46A 1I37A 2ZXZA 2O4JA 5DIEA 1NAVA 2Q1VA 3N00A 4IA3A 4N1YA 2ZNNA 3V9YA 3UU7A 5AVLA 4ZOMA 4B7WA 5DXEA 1NQ7A 3HZFA 2Q7JA 4TUZB 4OK1A 1OVLA 1UPWA 2HVCA 5C4TA 4L96A 3O1EA 2R40D 3R2AA 1XV9B 3R5MA 2V0VA 4BCRA 1U3SA 2Q59A 3OMMA 5DV8A 5SYZA 3UVVB 3OGTA 4G1ZA 2AA7A 2PIOA 4XLDA 2ZL9A 1FM6D 2QPYA 2PKLA 2PIRA 3H0AA 1KNUA 3LBDA 1FCZA 4OZTU 2XHSA 4ZJWA 2Q70A 1FCXA 1U3RA 4MG5A 3WMHA 2VV1A 5IZ0A 4ZJRA 5EHJA 3PRGA 4OKBA 1K4WA 4N8RA 3ILZA 5G42A 5E0WA 4DK8A 4OEDA 1FM9A 1YUCA 3UP0A 1PDUA 3UUAB 2AX6A 3B66A 3W0IA 2I0GA 4FGYA 3K8SA 4IW6A 1M13A 5KRMA 3AX8A 2OVMA 3FEJA 2GL8A 4O8FA 2PJLA 1KV6A 5KRAA 3L0LA 5KROA 3BEJA 3P89A 3VT9A 4XT9A 1R20D 3V9VA 3OMKA 4J5XC 2Q5SA 2JFAB 2YLQA 3G8OA 4LNXA 5G43A 4RAKA 2VSTA 3VJTA 4E4KA 4UDBA 3DZYA 2AMAA 3IPQA 3FURA 4IA7A 4REEA 3W5RA 4Q13A 1YP0A 2Q8SA 4HEEX 4RFWA 4UDDA 2OUZA 2I4ZA 4FNEA 3CWDA 1U3QA 2QA6A 2NXXE 1A28A 3D90A 3VHVA 1ZEOA 5GIDA 3EYBA 5KYAA 1OSVA 2J14A 4MG7A 1RJKA 4R2UA 4ZNHA 2OZ7A 2HB8A 1ZAFA 3OLLA 1T5ZA 1NQ0A 3ADWA 3TKCA 5AWJA 1UPVA 3PEQA 3F5CB 4UDCA 4K7AA 2ZK4A 3UU7B 3ADVA 2YJAB 2AA5A 2AX9A 3H0AD 4P6XA 4IWFA 4CSJA 5DWGA 4OEZA 4EMAA 4N73A 2QMVA 2GPOA 3B67A 4G2IA 4PPPA 3WFGA 5DKEA 5JY3A 1PQ9A 3B0QA 2Q59B 4IVWA 5FQSA 3IMYA 2YFEA 4E2JA 1TFCA 2O9IA 1YINA 1FM9D 4K6IA 5DRMA 3VTDA 3WTQA 3CLDA 5E7VA 1FCYA 1X76A 3A2HA 2P1TA 3OKIA 5L7HA 1S0XA 2Q6SA 2VV1B 4J5XA 1QKNA 5DSHA 1T76A 5KRHA 1PRGA 2ZY0A 4PF3A 3D57A 1XAPA 2P1VA 2XYWA 2BJ4A 5DZ3A 4OZTE 4RMEA 5HJPA 1QKUA 2ZMIA 4JAZA 4OILA 1Q4XA 5DZ0A 3ET0A 3UUCA 1RDTA 3DY6A 1GWXA 5E0XA 4N5GA 2ZK2A 2G0HA 4DM8A 3OS8C 2HARA 3DZYD 4OZRU 5E14A 5G3JA 4DQMA 2ATHA 4S0SA 2GPUA 4OHAA 2HBHA 1SR7A 1T73A 4OJBA 5IXKA 3OMPA 3ZRBA 5DLRA 4OARA 3W0AA 4MGBA 4A4VA 1M7WA 1T63A 3BC5A 5EC9A 3KPZA 5DIDA 2ZASA 4FN9A 3WFFA 5AAUA 2B1ZA 5AWKA 5HCVA 5FQVA 3NSQA 3D24A 3GBKA 1XOWA 2PIUA 2J7XA 3P88A 3K23A 4IWCA 4ZO1X 1ZDTA 2QXMA 3KDTA 5E19A 3VHWA 3RUUA 5JJMA 2VSRA 1UHLA 3P0UA 4PPSA 1XP6A 5DVCA 5AAVA 3G0WA 1K74A 5HJSA 2POBA 3V3QA 3TY0A 4MG7B 1PCGA 3OLSA 4L98A 1T7TA 2IOGA 4NUFA 4E4QA 4OC7A 1T79A 1LV2A 2P54A 2QR9A 3BQDA 3HM1A 3L03A 5DV6A 5APKA 3W0HA 5KCWA 1M2ZA 2Q7IA 3G9EA 5DWEA 3VT3A 1PQ6A 1BSXA 1SJ0A 3OOFA 4DMAA 3VTCA 5KD9A 1XNXA 2YLYA 2HWQA 3CS6A 4YNKA 1I7GA 3B1MA 3OMQA 5DXMA 3UP3A 3FALA 5DX3A 2YATA 4NB6A 1XNNA 4MG8A 1XLSE 3ADUA 3MNOA 5L11A 2ZMHA 2IHQA 3HQ5A 5DUGA 2QH6A 4RZEA 1IE8A 3OS8A 3VJHA 5KRCA 2AWHA 1XB7A 2FVJA 2Q60A 3D6DA 1TXIA 4MGDA 3VN2A 2Q7KA 2QA8A 2ZFXA 5G5WA 3S9SA 1RDTD 1NRLA 2ACLA 2JJ3A 2R6WA 2YJDA 1L2IA 1WM0X 3ADTA 5B5BA 4J24A 1YYEA 2NV7A 4LNWA 3E7CA 5DXBB 4XHDA 3ZRAA 2PNUA 2BJ4B 1Y0SA 5ACCA 5DU5A 3W5TA 3WWRA 5HJPB 3A9EA 4PWLA 5DMCA 1QKTA 3VJSA 3MNEA 2B50A 1RK3A 1XIUA 3OS9A 2Q3YA 2QGTA 3A40X 2AX8A 4IA2A 2P15A 3ET1A 5DXQA 5AVIA 3DR1A 3OMOA 3GD2A 1FBYA 3R8DA 4G1DA 4YPQA 4MGBB 5EITA 2OVHA 1EXXA 4OZRE 4UDAA 3R8AA 4RMCA 1K74D 5KCUA 5DVVA 3E00A 3ET2A 3OSAA 2Q5GA 1HJ1A 2ZK6A 5AK2A 5FQPA 4YT1A 1NHZA 3AZ1A 4MG9A 1XJ7A 1E3KA 4RZFA 5C4OA 3VRWA 1YY4A 3CDPA 3D5FA 4DORA 5JJMB 1YIMA 4XUMA 4JYHA 2YLPA 1UHLB 3FS1A 1UOMA 3V3EA 1GWRA 4IVYA 3UUDA 5AAVB 5KCFA 3OAPA 5DV3A 5KR9A 4J26A 3VHUA 5H1EA 1ERRA 3GN8A 5DVSA 1YJEA 4ITFA 5M96A 2ZBSA 3DZUA 2B23A 5F9BA 3P8XA 5DI7A 3L0EA 1EXAA 1A52A 1X7BA 3PO9A 1ZDUA 3W0YA 2PINA 1QKMA 3L3ZA 4P6WA 4RUJA 4XI3A 4QE6A 3FEIA 4APUA 2GTKA 5EJVA 1PK5A 1OVLB 2Q5PA 3FALB 3KMRA 4TV1A 3L1BA 4MG8B 4S0TA 5DK9A 1DKFA 3W5QA 5DY8A 1G5YA 3WJ4A 3DCTA 3RLLA 2VV2A 1Z5XU 2F4BA 2GIUA 2PIQA 4JL4A 2HC4A 2ZVTA 4PP6A 4XUHA 5DZIA 2PIXA 5LWPA 3WT6A 3OKHA 1N46A 2QA8B 2VV0A 1N83A 1T7RA 1P93A 1GS4A 1S9QA 3M7RA 3QT0A 2QZOA 5DZ1A 3L3XA 1RKGA 2E2RA 3IPSA 1GWQA 3W0JA 3KWYA 4IU7A 2FAIA 1X7JA 2I4PA 5DRJA 1LBDA 1MV9A 1ZH7A 2W8YA 3A9EB 2PRGA 5DIGA 5DYDA 3B5RA 2PITA 3AZ3A 3GZ9A 3SP6A 3VSOA 3VJIA 1OSHA 3E00D 1HG4A 2REWA 4G1YA 1XP1A 3R5NA 4DK7A 4FHHA 2H77A 4OGHA 2P1UA 1T7MA 2AYRA 2QXSA 3B0WA 4OIVA 2ZNOA 1XVPA 4MG6A 3RY9A 3IXPA 2POGA 3A78A 1NQ2A 1XQCA 4X1GA 3OSWA 5AZTA 5HYKA 3CJWA 3H52A 3B0RA 2Z4JA 3AN3A 3HVLA 3MNPA 5E1CA 4R06A 5AYGA 2ZKCA 2AO6A 2OAXA 2ZK3A 2ZK5A 4MG9B 4QJRA 5IAWA 1XQ3A 4ZO1B 3JZBA 2HWRA 2PIWA 3VSPA 4G2HA 4OKTA 2ZLAA 4A4WA 3HODA 3B65A 3KDUA 4PVUA 5DKGA 3VT5A 5KCCA 4IQRA 1Y9RA 3GYTA 2AMBA 4OEYA 4OJ9A 3WT5A 1NDEA 5KRIA 4JGVA 3PLZA 4ZNWA 1U9EA 1G1UA 5DUHA 5DZHA 5G45A 5B41A 3X1IA 3B68A 3X31A 5EGVA 4ZNVA 2ZXNA 1X78A 1YA3A 3VRUA 1S0ZA 4PP5A 3T03A 5DX3B 4ITEA 5L7EA 1XDKA 1P8DA 4Y29A 4TV1B 3SP9A 2GPVA 3RLJA 1DKFB 1T65A 5E15A 3HLVA 1T74A 4QL8A 5DP0A 2R6YA 5KCEA 2NXXA 2YLOA 3OOKA 4POJA 3KMZA 3CS4A 3FC6A 2OM9A 2Q6RA 3O1DA 4LSJA 5KCTA 3A2JA 4RMDA 5GIEA 3AN4A 3JZCA 4QK4A 2Q7LA 5KRLA 3IA6A 2VV3A 4OH5A 3F5CA 3WGPA 1R1KA 3HC5A 2ZK0A 3OSIA 4KZJA 2EWPA 2Z4BA 1N4HA 1Z5XE 3TKMA 5AZVA 3HO0A 4M8EA 2QZOB 3KBAA 5A86A 4OJ4A 2QTUA 2QSEA 5DWLA 2Q6JA 3IXPD 3NSPA 3CQVA 4PLEA 5DKSA 2G5OA 4ZNTA 4IUIA 4LTWA 4WQPA 5ETHA 4G21A 1XP9A 3K6PA 4J5WC 3FXVA 4RUPA 3DCUA 4OKWA 3ERDA 3GYUA 4IA1A 3B0TA 3Q95A 5CJ6A 5DL4A 4POHA 5K13A 3VRVA 4G20A 1MZNA 1XVPB 1EREA 1KKQA 4IW8A 2I4JA 3GWSX 4IV4A 5ICKA 1G2NA 4Q0AC 4ZN9A 2BAWA 4JYIA 4JYGA 3RVFA 4MDDA 3PBAA 3W0CA 4OIUA 5DTVA 2NPAA 4WHGA 4RZGA 2A3IA 5FQRA 1X7EA 1ZGYA 2AXAA 3KMGA 5EI1A 3VRTA 1X7RA 3AURA 1I38A 2B1VA 1H9UA 1Z95A 5DWIA 5DKBA 2G0GA 1NAXA 1PZLA 2HAMA 2Q61A 2GP7A 3ADSA 2ZXMA 1NUOA 3CDSA 5KRKA 3A3ZX 2AA6A 5APJA 2J7YA 2PIPL 2P7AA 3OZJA 3ET3A 4PXMA 4R6SA 5DXKA 4DOSA 2QE4A 4FHIA 4K4JA 2VV4A 4MGAA 2ZK1A 2GPPA 3OLFA 3LMPA 4RUOX 4CI5A 1ILHA 2ZLCA 4IV2A 5DWJA 3ZR7A 1ZUCA 1R1KD 2HFPA 1XDKB 1IE9A 3KFCA 3OZ0A 4EM9A 2OCFA 3R29A 4ZNUA 3WJ5A 2XYJA 4J5WA 2QABA 4S15A 3X36A 4CI4A 3ERTA 1YOWA 3WT7A 3VI8A 1G50A 3FC6B 1S9PA 4MGDB 2I0JA 4ZNSA 5APHA 4DM6A 1PQCA 3VT7A 2GWXA 3B3KA 2V7CA 4X1FA 3SZ1A 5C4SA 2FSZA 3AZ2A 2ACLB 4WVDA 4YMQA 3GWXA 1RKHA 5KYJA 1ZKYA 2Q1HA 4HLWA 3VT6A 1XPCA 2G44A 5G44A 5GT4A 4TUZA 3HC6A 5FQTA 4S14A 3A2IA 3CS8A 2IOKA 4WHFA 5DXPA 3W5PA 4PLDA 1XV9A 2XYXA 4WLBA 4OEAA 2NW4A 2PIVA 3NOAA 4XTAA 3W0GA 4REFA 3UVVA 1XLSA 4KZMA 4RWVA 2LBDA 4ONIA 3PCUA 2AAXA 1VJBA 1OT7A 4XAOA 2ZNPA 4PRGA 5HYRA 5DXRA 2P7GA 3G8IA 4NQAB 3Q95B 3R8IA 3IPUA 4OFUA 2R40A 3VTBA 4QM0A 3FUGA 5DXBA 1NYXA 4QE8A 5DXGA 3AFRA 1R5KA 2HASA 3FLIA 3KYTA 4LBDA 4PP3A 2P4YA 4MGCA 1FM6A 4OH6A 1Y0XX 4OLMA 2JF9A 3CTBA 3UUAA 1S19A 3RUTA 3U9QA 3DZUD 1I7IA 3VT4A 3TX7B 1NQ1A 2QGWA 4WPFA 4ZI1A 2O4RA 1E3GA 4RE8A 2HB7A 3ZQTA 5C4UA 3AUNA 5DUEA 3UUDB 5LGAA 2AX7A 3L0JA 4ZN7A 2ZNQA 3V9TA 4A2JA 2XKWA 1SKXA 3ADXA 5L7GA 2AM9A 1T7FA 2YHDA 2JFAA 3DT3A 2AB2A
chains in the Genus database with same CATH superfamily
5I4VA 1MVCA 1ILGA 4NY9A 2ZMJA 5GICA 3X1HA 1YOKA 2H79A 2QW4A 1K7LA 4M8HA 1SQNA 1R6GA 4OFRA 4F9MA 2ABIA 2VV4B 1XZXX 1L2JA 4MGAB 2AA2A 3AUQA 5JI0D 4KZIA 4NIEA 2HCDA 3V4AA 2QNVA 3VT8A 1FD0A 1DB1A 5HZCA 5KCDA 3F7DA 1R20A 2P7ZA 3V49A 4IS8A 1YMTA 3K22A 5KRFA 3E94A 5KRJA 4OKXA 4Q50A 5DMFA 2J4AA 5DYBA 5G46A 1I37A 2ZXZA 2O4JA 5DIEA 1NAVA 2Q1VA 3N00A 4IA3A 4N1YA 2ZNNA 3V9YA 3UU7A 5AVLA 4ZOMA 4B7WA 5DXEA 1NQ7A 3HZFA 2Q7JA 4TUZB 4OK1A 1OVLA 1UPWA 2HVCA 5C4TA 4L96A 3O1EA 2R40D 3R2AA 1XV9B 3R5MA 2V0VA 4BCRA 1U3SA 2Q59A 3OMMA 5DV8A 5SYZA 3UVVB 3OGTA 4G1ZA 2AA7A 2PIOA 4XLDA 2ZL9A 1FM6D 2QPYA 2PKLA 2PIRA 3H0AA 1KNUA 3LBDA 1FCZA 4OZTU 2XHSA 4ZJWA 2Q70A 1FCXA 1U3RA 4MG5A 3WMHA 2VV1A 5IZ0A 4ZJRA 5EHJA 3PRGA 4OKBA 1K4WA 4N8RA 3ILZA 5G42A 5E0WA 4DK8A 4OEDA 1FM9A 1YUCA 3UP0A 1PDUA 3UUAB 2AX6A 3B66A 3W0IA 2I0GA 4FGYA 3K8SA 4IW6A 1M13A 5KRMA 3AX8A 2OVMA 3FEJA 2GL8A 4O8FA 2PJLA 1KV6A 5KRAA 3L0LA 5KROA 3BEJA 3P89A 3VT9A 4XT9A 1R20D 3V9VA 3OMKA 4J5XC 2Q5SA 2JFAB 2YLQA 3G8OA 4LNXA 5G43A 4RAKA 2VSTA 3VJTA 4E4KA 4UDBA 3DZYA 2AMAA 3IPQA 3FURA 4IA7A 4REEA 3W5RA 4Q13A 1YP0A 2Q8SA 4HEEX 4RFWA 4UDDA 2OUZA 2I4ZA 4FNEA 3CWDA 1U3QA 2QA6A 2NXXE 1A28A 3D90A 3VHVA 1ZEOA 5GIDA 3EYBA 5KYAA 1OSVA 2J14A 4MG7A 1RJKA 4R2UA 4ZNHA 2OZ7A 2HB8A 1ZAFA 3OLLA 1T5ZA 1NQ0A 3ADWA 3TKCA 5AWJA 1UPVA 3PEQA 3F5CB 4UDCA 4K7AA 2ZK4A 3UU7B 3ADVA 2YJAB 2AA5A 2AX9A 3H0AD 4P6XA 4IWFA 4CSJA 5DWGA 4OEZA 4EMAA 4N73A 2QMVA 2GPOA 3B67A 4G2IA 4PPPA 3WFGA 5DKEA 5JY3A 1PQ9A 3B0QA 2Q59B 4IVWA 5FQSA 3IMYA 2YFEA 4E2JA 1TFCA 2O9IA 1YINA 1FM9D 4K6IA 5DRMA 3VTDA 3WTQA 3CLDA 5E7VA 1FCYA 1X76A 3A2HA 2P1TA 3OKIA 5L7HA 1S0XA 2Q6SA 2VV1B 4J5XA 1QKNA 5DSHA 1T76A 5KRHA 1PRGA 2ZY0A 4PF3A 3D57A 1XAPA 2P1VA 2XYWA 2BJ4A 5DZ3A 4OZTE 4RMEA 5HJPA 1QKUA 2ZMIA 4JAZA 4OILA 1Q4XA 5DZ0A 3ET0A 3UUCA 1RDTA 3DY6A 1GWXA 5E0XA 4N5GA 2ZK2A 2G0HA 4DM8A 3OS8C 2HARA 3DZYD 4OZRU 5E14A 5G3JA 4DQMA 2ATHA 4S0SA 2GPUA 4OHAA 2HBHA 1SR7A 1T73A 4OJBA 5IXKA 3OMPA 3ZRBA 5DLRA 4OARA 3W0AA 4MGBA 4A4VA 1M7WA 1T63A 3BC5A 5EC9A 3KPZA 5DIDA 2ZASA 4FN9A 3WFFA 5AAUA 2B1ZA 5AWKA 5HCVA 5FQVA 3NSQA 3D24A 3GBKA 1XOWA 2PIUA 2J7XA 3P88A 3K23A 4IWCA 4ZO1X 1ZDTA 2QXMA 3KDTA 5E19A 3VHWA 3RUUA 5JJMA 2VSRA 1UHLA 3P0UA 4PPSA 1XP6A 5DVCA 5AAVA 3G0WA 1K74A 5HJSA 2POBA 3V3QA 3TY0A 4MG7B 1PCGA 3OLSA 4L98A 1T7TA 2IOGA 4NUFA 4E4QA 4OC7A 1T79A 1LV2A 2P54A 2QR9A 3BQDA 3HM1A 3L03A 5DV6A 5APKA 3W0HA 5KCWA 1M2ZA 2Q7IA 3G9EA 5DWEA 3VT3A 1PQ6A 1BSXA 1SJ0A 3OOFA 4DMAA 3VTCA 5KD9A 1XNXA 2YLYA 2HWQA 3CS6A 4YNKA 1I7GA 3B1MA 3OMQA 5DXMA 3UP3A 3FALA 5DX3A 2YATA 4NB6A 1XNNA 4MG8A 1XLSE 3ADUA 3MNOA 5L11A 2ZMHA 2IHQA 3HQ5A 5DUGA 2QH6A 4RZEA 1IE8A 3OS8A 3VJHA 5KRCA 2AWHA 1XB7A 2FVJA 2Q60A 3D6DA 1TXIA 4MGDA 3VN2A 2Q7KA 2QA8A 2ZFXA 5G5WA 3S9SA 1RDTD 1NRLA 2ACLA 2JJ3A 2R6WA 2YJDA 1L2IA 1WM0X 3ADTA 5B5BA 4J24A 1YYEA 2NV7A 4LNWA 3E7CA 5DXBB 4XHDA 3ZRAA 2PNUA 2BJ4B 1Y0SA 5ACCA 5DU5A 3W5TA 3WWRA 5HJPB 3A9EA 4PWLA 5DMCA 1QKTA 3VJSA 3MNEA 2B50A 1RK3A 1XIUA 3OS9A 2Q3YA 2QGTA 3A40X 2AX8A 4IA2A 2P15A 3ET1A 5DXQA 5AVIA 3DR1A 3OMOA 3GD2A 1FBYA 3R8DA 4G1DA 4YPQA 4MGBB 5EITA 2OVHA 1EXXA 4OZRE 4UDAA 3R8AA 4RMCA 1K74D 5KCUA 5DVVA 3E00A 3ET2A 3OSAA 2Q5GA 1HJ1A 2ZK6A 5AK2A 5FQPA 4YT1A 1NHZA 3AZ1A 4MG9A 1XJ7A 1E3KA 4RZFA 5C4OA 3VRWA 1YY4A 3CDPA 3D5FA 4DORA 5JJMB 1YIMA 4XUMA 4JYHA 2YLPA 1UHLB 3FS1A 1UOMA 3V3EA 1GWRA 4IVYA 3UUDA 5AAVB 5KCFA 3OAPA 5DV3A 5KR9A 4J26A 3VHUA 5H1EA 1ERRA 3GN8A 5DVSA 1YJEA 4ITFA 5M96A 2ZBSA 3DZUA 2B23A 5F9BA 3P8XA 5DI7A 3L0EA 1EXAA 1A52A 1X7BA 3PO9A 1ZDUA 3W0YA 2PINA 1QKMA 3L3ZA 4P6WA 4RUJA 4XI3A 4QE6A 3FEIA 4APUA 2GTKA 5EJVA 1PK5A 1OVLB 2Q5PA 3FALB 3KMRA 4TV1A 3L1BA 4MG8B 4S0TA 5DK9A 1DKFA 3W5QA 5DY8A 1G5YA 3WJ4A 3DCTA 3RLLA 2VV2A 1Z5XU 2F4BA 2GIUA 2PIQA 4JL4A 2HC4A 2ZVTA 4PP6A 4XUHA 5DZIA 2PIXA 5LWPA 3WT6A 3OKHA 1N46A 2QA8B 2VV0A 1N83A 1T7RA 1P93A 1GS4A 1S9QA 3M7RA 3QT0A 2QZOA 5DZ1A 3L3XA 1RKGA 2E2RA 3IPSA 1GWQA 3W0JA 3KWYA 4IU7A 2FAIA 1X7JA 2I4PA 5DRJA 1LBDA 1MV9A 1ZH7A 2W8YA 3A9EB 2PRGA 5DIGA 5DYDA 3B5RA 2PITA 3AZ3A 3GZ9A 3SP6A 3VSOA 3VJIA 1OSHA 3E00D 1HG4A 2REWA 4G1YA 1XP1A 3R5NA 4DK7A 4FHHA 2H77A 4OGHA 2P1UA 1T7MA 2AYRA 2QXSA 3B0WA 4OIVA 2ZNOA 1XVPA 4MG6A 3RY9A 3IXPA 2POGA 3A78A 1NQ2A 1XQCA 4X1GA 3OSWA 5AZTA 5HYKA 3CJWA 3H52A 3B0RA 2Z4JA 3AN3A 3HVLA 3MNPA 5E1CA 4R06A 5AYGA 2ZKCA 2AO6A 2OAXA 2ZK3A 2ZK5A 4MG9B 4QJRA 5IAWA 1XQ3A 4ZO1B 3JZBA 2HWRA 2PIWA 3VSPA 4G2HA 4OKTA 2ZLAA 4A4WA 3HODA 3B65A 3KDUA 4PVUA 5DKGA 3VT5A 5KCCA 4IQRA 1Y9RA 3GYTA 2AMBA 4OEYA 4OJ9A 3WT5A 1NDEA 5KRIA 4JGVA 3PLZA 4ZNWA 1U9EA 1G1UA 5DUHA 5DZHA 5G45A 5B41A 3X1IA 3B68A 3X31A 5EGVA 4ZNVA 2ZXNA 1X78A 1YA3A 3VRUA 1S0ZA 4PP5A 3T03A 5DX3B 4ITEA 5L7EA 1XDKA 1P8DA 4Y29A 4TV1B 3SP9A 2GPVA 3RLJA 1DKFB 1T65A 5E15A 3HLVA 1T74A 4QL8A 5DP0A 2R6YA 5KCEA 2NXXA 2YLOA 3OOKA 4POJA 3KMZA 3CS4A 3FC6A 2OM9A 2Q6RA 3O1DA 4LSJA 5KCTA 3A2JA 4RMDA 5GIEA 3AN4A 3JZCA 4QK4A 2Q7LA 5KRLA 3IA6A 2VV3A 4OH5A 3F5CA 3WGPA 1R1KA 3HC5A 2ZK0A 3OSIA 4KZJA 2EWPA 2Z4BA 1N4HA 1Z5XE 3TKMA 5AZVA 3HO0A 4M8EA 2QZOB 3KBAA 5A86A 4OJ4A 2QTUA 2QSEA 5DWLA 2Q6JA 3IXPD 3NSPA 3CQVA 4PLEA 5DKSA 2G5OA 4ZNTA 4IUIA 4LTWA 4WQPA 5ETHA 4G21A 1XP9A 3K6PA 4J5WC 3FXVA 4RUPA 3DCUA 4OKWA 3ERDA 3GYUA 4IA1A 3B0TA 3Q95A 5CJ6A 5DL4A 4POHA 5K13A 3VRVA 4G20A 1MZNA 1XVPB 1EREA 1KKQA 4IW8A 2I4JA 3GWSX 4IV4A 5ICKA 1G2NA 4Q0AC 4ZN9A 2BAWA 4JYIA 4JYGA 3RVFA 4MDDA 3PBAA 3W0CA 4OIUA 5DTVA 2NPAA 4WHGA 4RZGA 2A3IA 5FQRA 1X7EA 1ZGYA 2AXAA 3KMGA 5EI1A 3VRTA 1X7RA 3AURA 1I38A 2B1VA 1H9UA 1Z95A 5DWIA 5DKBA 2G0GA 1NAXA 1PZLA 2HAMA 2Q61A 2GP7A 3ADSA 2ZXMA 1NUOA 3CDSA 5KRKA 3A3ZX 2AA6A 5APJA 2J7YA 2PIPL 2P7AA 3OZJA 3ET3A 4PXMA 4R6SA 5DXKA 4DOSA 2QE4A 4FHIA 4K4JA 2VV4A 4MGAA 2ZK1A 2GPPA 3OLFA 3LMPA 4RUOX 4CI5A 1ILHA 2ZLCA 4IV2A 5DWJA 3ZR7A 1ZUCA 1R1KD 2HFPA 1XDKB 1IE9A 3KFCA 3OZ0A 4EM9A 2OCFA 3R29A 4ZNUA 3WJ5A 2XYJA 4J5WA 2QABA 4S15A 3X36A 4CI4A 3ERTA 1YOWA 3WT7A 3VI8A 1G50A 3FC6B 1S9PA 4MGDB 2I0JA 4ZNSA 5APHA 4DM6A 1PQCA 3VT7A 2GWXA 3B3KA 2V7CA 4X1FA 3SZ1A 5C4SA 2FSZA 3AZ2A 2ACLB 4WVDA 4YMQA 3GWXA 1RKHA 5KYJA 1ZKYA 2Q1HA 4HLWA 3VT6A 1XPCA 2G44A 5G44A 5GT4A 4TUZA 3HC6A 5FQTA 4S14A 3A2IA 3CS8A 2IOKA 4WHFA 5DXPA 3W5PA 4PLDA 1XV9A 2XYXA 4WLBA 4OEAA 2NW4A 2PIVA 3NOAA 4XTAA 3W0GA 4REFA 3UVVA 1XLSA 4KZMA 4RWVA 2LBDA 4ONIA 3PCUA 2AAXA 1VJBA 1OT7A 4XAOA 2ZNPA 4PRGA 5HYRA 5DXRA 2P7GA 3G8IA 4NQAB 3Q95B 3R8IA 3IPUA 4OFUA 2R40A 3VTBA 4QM0A 3FUGA 5DXBA 1NYXA 4QE8A 5DXGA 3AFRA 1R5KA 2HASA 3FLIA 3KYTA 4LBDA 4PP3A 2P4YA 4MGCA 1FM6A 4OH6A 1Y0XX 4OLMA 2JF9A 3CTBA 3UUAA 1S19A 3RUTA 3U9QA 3DZUD 1I7IA 3VT4A 3TX7B 1NQ1A 2QGWA 4WPFA 4ZI1A 2O4RA 1E3GA 4RE8A 2HB7A 3ZQTA 5C4UA 3AUNA 5DUEA 3UUDB 5LGAA 2AX7A 3L0JA 4ZN7A 2ZNQA 3V9TA 4A2JA 2XKWA 1SKXA 3ADXA 5L7GA 2AM9A 1T7FA 2YHDA 2JFAA 3DT3A 2AB2A
chains in the Genus database with same CATH topology
5I4VA 1MVCA 1ILGA 4NY9A 2ZMJA 5GICA 3X1HA 1YOKA 2H79A 2QW4A 1K7LA 4M8HA 1SQNA 1R6GA 4OFRA 4F9MA 2ABIA 2VV4B 1XZXX 1L2JA 4MGAB 2AA2A 3AUQA 5JI0D 4KZIA 4NIEA 2HCDA 3V4AA 2QNVA 3VT8A 1FD0A 1DB1A 5HZCA 5KCDA 3F7DA 1R20A 2P7ZA 3V49A 4IS8A 1YMTA 3K22A 5KRFA 3E94A 5KRJA 4OKXA 4Q50A 5DMFA 2J4AA 5DYBA 5G46A 1I37A 2ZXZA 2O4JA 5DIEA 1NAVA 2Q1VA 3N00A 4IA3A 4N1YA 2ZNNA 3V9YA 3UU7A 5AVLA 4ZOMA 4B7WA 5DXEA 1NQ7A 3HZFA 2Q7JA 4TUZB 4OK1A 1OVLA 1UPWA 2HVCA 5C4TA 4L96A 3O1EA 2R40D 3R2AA 1XV9B 3R5MA 2V0VA 4BCRA 1U3SA 2Q59A 3OMMA 5DV8A 5SYZA 3UVVB 3OGTA 4G1ZA 2AA7A 2PIOA 4XLDA 2ZL9A 1FM6D 2QPYA 2PKLA 2PIRA 3H0AA 1KNUA 3LBDA 1FCZA 4OZTU 2XHSA 4ZJWA 2Q70A 1FCXA 1U3RA 4MG5A 3WMHA 2VV1A 5IZ0A 4ZJRA 5EHJA 3PRGA 4OKBA 1K4WA 4N8RA 3ILZA 5G42A 5E0WA 4DK8A 4OEDA 1FM9A 1YUCA 3UP0A 1PDUA 3UUAB 2AX6A 3B66A 3W0IA 2I0GA 4FGYA 3K8SA 4IW6A 1M13A 5KRMA 3AX8A 2OVMA 3FEJA 2GL8A 4O8FA 2PJLA 1KV6A 5KRAA 3L0LA 5KROA 3BEJA 3P89A 3VT9A 4XT9A 1R20D 3V9VA 3OMKA 4J5XC 2Q5SA 2JFAB 2YLQA 3G8OA 4LNXA 5G43A 4RAKA 2VSTA 3VJTA 4E4KA 4UDBA 3DZYA 2AMAA 3IPQA 3FURA 4IA7A 4REEA 3W5RA 4Q13A 1YP0A 2Q8SA 4HEEX 4RFWA 4UDDA 2OUZA 2I4ZA 4FNEA 3CWDA 1U3QA 2QA6A 2NXXE 1A28A 3D90A 3VHVA 1ZEOA 5GIDA 3EYBA 5KYAA 1OSVA 2J14A 4MG7A 1RJKA 4R2UA 4ZNHA 2OZ7A 2HB8A 1ZAFA 3OLLA 1T5ZA 1NQ0A 3ADWA 3TKCA 5AWJA 1UPVA 3PEQA 3F5CB 4UDCA 4K7AA 2ZK4A 3UU7B 3ADVA 2YJAB 2AA5A 2AX9A 3H0AD 4P6XA 4IWFA 4CSJA 5DWGA 4OEZA 4EMAA 4N73A 2QMVA 2GPOA 3B67A 4G2IA 4PPPA 3WFGA 5DKEA 5JY3A 1PQ9A 3B0QA 2Q59B 4IVWA 5FQSA 3IMYA 2YFEA 4E2JA 1TFCA 2O9IA 1YINA 1FM9D 4K6IA 5DRMA 3VTDA 3WTQA 3CLDA 5E7VA 1FCYA 1X76A 3A2HA 2P1TA 3OKIA 5L7HA 1S0XA 2Q6SA 2VV1B 4J5XA 1QKNA 5DSHA 1T76A 5KRHA 1PRGA 2ZY0A 4PF3A 3D57A 1XAPA 2P1VA 2XYWA 2BJ4A 5DZ3A 4OZTE 4RMEA 5HJPA 1QKUA 2ZMIA 4JAZA 4OILA 1Q4XA 5DZ0A 3ET0A 3UUCA 1RDTA 3DY6A 1GWXA 5E0XA 4N5GA 2ZK2A 2G0HA 4DM8A 3OS8C 2HARA 3DZYD 4OZRU 5E14A 5G3JA 4DQMA 2ATHA 4S0SA 2GPUA 4OHAA 2HBHA 1SR7A 1T73A 4OJBA 5IXKA 3OMPA 3ZRBA 5DLRA 4OARA 3W0AA 4MGBA 4A4VA 1M7WA 1T63A 3BC5A 5EC9A 3KPZA 5DIDA 2ZASA 4FN9A 3WFFA 5AAUA 2B1ZA 5AWKA 5HCVA 5FQVA 3NSQA 3D24A 3GBKA 1XOWA 2PIUA 2J7XA 3P88A 3K23A 4IWCA 4ZO1X 1ZDTA 2QXMA 3KDTA 5E19A 3VHWA 3RUUA 5JJMA 2VSRA 1UHLA 3P0UA 4PPSA 1XP6A 5DVCA 5AAVA 3G0WA 1K74A 5HJSA 2POBA 3V3QA 3TY0A 4MG7B 1PCGA 3OLSA 4L98A 1T7TA 2IOGA 4NUFA 4E4QA 4OC7A 1T79A 1LV2A 2P54A 2QR9A 3BQDA 3HM1A 3L03A 5DV6A 5APKA 3W0HA 5KCWA 1M2ZA 2Q7IA 3G9EA 5DWEA 3VT3A 1PQ6A 1BSXA 1SJ0A 3OOFA 4DMAA 3VTCA 5KD9A 1XNXA 2YLYA 2HWQA 3CS6A 4YNKA 1I7GA 3B1MA 3OMQA 5DXMA 3UP3A 3FALA 5DX3A 2YATA 4NB6A 1XNNA 4MG8A 1XLSE 3ADUA 3MNOA 5L11A 2ZMHA 2IHQA 3HQ5A 5DUGA 2QH6A 4RZEA 1IE8A 3OS8A 3VJHA 5KRCA 2AWHA 1XB7A 2FVJA 2Q60A 3D6DA 1TXIA 4MGDA 3VN2A 2Q7KA 2QA8A 2ZFXA 5G5WA 3S9SA 1RDTD 1NRLA 2ACLA 2JJ3A 2R6WA 2YJDA 1L2IA 1WM0X 3ADTA 5B5BA 4J24A 1YYEA 2NV7A 4LNWA 3E7CA 5DXBB 4XHDA 3ZRAA 2PNUA 2BJ4B 1Y0SA 5ACCA 5DU5A 3W5TA 3WWRA 5HJPB 3A9EA 4PWLA 5DMCA 1QKTA 3VJSA 3MNEA 2B50A 1RK3A 1XIUA 3OS9A 2Q3YA 2QGTA 3A40X 2AX8A 4IA2A 2P15A 3ET1A 5DXQA 5AVIA 3DR1A 3OMOA 3GD2A 1FBYA 3R8DA 4G1DA 4YPQA 4MGBB 5EITA 2OVHA 1EXXA 4OZRE 4UDAA 3R8AA 4RMCA 1K74D 5KCUA 5DVVA 3E00A 3ET2A 3OSAA 2Q5GA 1HJ1A 2ZK6A 5AK2A 5FQPA 4YT1A 1NHZA 3AZ1A 4MG9A 1XJ7A 1E3KA 4RZFA 5C4OA 3VRWA 1YY4A 3CDPA 3D5FA 4DORA 5JJMB 1YIMA 4XUMA 4JYHA 2YLPA 1UHLB 3FS1A 1UOMA 3V3EA 1GWRA 4IVYA 3UUDA 5AAVB 5KCFA 3OAPA 5DV3A 5KR9A 4J26A 3VHUA 5H1EA 1ERRA 3GN8A 5DVSA 1YJEA 4ITFA 5M96A 2ZBSA 3DZUA 2B23A 5F9BA 3P8XA 5DI7A 3L0EA 1EXAA 1A52A 1X7BA 3PO9A 1ZDUA 3W0YA 2PINA 1QKMA 3L3ZA 4P6WA 4RUJA 4XI3A 4QE6A 3FEIA 4APUA 2GTKA 5EJVA 1PK5A 1OVLB 2Q5PA 3FALB 3KMRA 4TV1A 3L1BA 4MG8B 4S0TA 5DK9A 1DKFA 3W5QA 5DY8A 1G5YA 3WJ4A 3DCTA 3RLLA 2VV2A 1Z5XU 2F4BA 2GIUA 2PIQA 4JL4A 2HC4A 2ZVTA 4PP6A 4XUHA 5DZIA 2PIXA 5LWPA 3WT6A 3OKHA 1N46A 2QA8B 2VV0A 1N83A 1T7RA 1P93A 1GS4A 1S9QA 3M7RA 3QT0A 2QZOA 5DZ1A 3L3XA 1RKGA 2E2RA 3IPSA 1GWQA 3W0JA 3KWYA 4IU7A 2FAIA 1X7JA 2I4PA 5DRJA 1LBDA 1MV9A 1ZH7A 2W8YA 3A9EB 2PRGA 5DIGA 5DYDA 3B5RA 2PITA 3AZ3A 3GZ9A 3SP6A 3VSOA 3VJIA 1OSHA 3E00D 1HG4A 2REWA 4G1YA 1XP1A 3R5NA 4DK7A 4FHHA 2H77A 4OGHA 2P1UA 1T7MA 2AYRA 2QXSA 3B0WA 4OIVA 2ZNOA 1XVPA 4MG6A 3RY9A 3IXPA 2POGA 3A78A 1NQ2A 1XQCA 4X1GA 3OSWA 5AZTA 5HYKA 3CJWA 3H52A 3B0RA 2Z4JA 3AN3A 3HVLA 3MNPA 5E1CA 4R06A 5AYGA 2ZKCA 2AO6A 2OAXA 2ZK3A 2ZK5A 4MG9B 4QJRA 5IAWA 1XQ3A 4ZO1B 3JZBA 2HWRA 2PIWA 3VSPA 4G2HA 4OKTA 2ZLAA 4A4WA 3HODA 3B65A 3KDUA 4PVUA 5DKGA 3VT5A 5KCCA 4IQRA 1Y9RA 3GYTA 2AMBA 4OEYA 4OJ9A 3WT5A 1NDEA 5KRIA 4JGVA 3PLZA 4ZNWA 1U9EA 1G1UA 5DUHA 5DZHA 5G45A 5B41A 3X1IA 3B68A 3X31A 5EGVA 4ZNVA 2ZXNA 1X78A 1YA3A 3VRUA 1S0ZA 4PP5A 3T03A 5DX3B 4ITEA 5L7EA 1XDKA 1P8DA 4Y29A 4TV1B 3SP9A 2GPVA 3RLJA 1DKFB 1T65A 5E15A 3HLVA 1T74A 4QL8A 5DP0A 2R6YA 5KCEA 2NXXA 2YLOA 3OOKA 4POJA 3KMZA 3CS4A 3FC6A 2OM9A 2Q6RA 3O1DA 4LSJA 5KCTA 3A2JA 4RMDA 5GIEA 3AN4A 3JZCA 4QK4A 2Q7LA 5KRLA 3IA6A 2VV3A 4OH5A 3F5CA 3WGPA 1R1KA 3HC5A 2ZK0A 3OSIA 4KZJA 2EWPA 2Z4BA 1N4HA 1Z5XE 3TKMA 5AZVA 3HO0A 4M8EA 2QZOB 3KBAA 5A86A 4OJ4A 2QTUA 2QSEA 5DWLA 2Q6JA 3IXPD 3NSPA 3CQVA 4PLEA 5DKSA 2G5OA 4ZNTA 4IUIA 4LTWA 4WQPA 5ETHA 4G21A 1XP9A 3K6PA 4J5WC 3FXVA 4RUPA 3DCUA 4OKWA 3ERDA 3GYUA 4IA1A 3B0TA 3Q95A 5CJ6A 5DL4A 4POHA 5K13A 3VRVA 4G20A 1MZNA 1XVPB 1EREA 1KKQA 4IW8A 2I4JA 3GWSX 4IV4A 5ICKA 1G2NA 4Q0AC 4ZN9A 2BAWA 4JYIA 4JYGA 3RVFA 4MDDA 3PBAA 3W0CA 4OIUA 5DTVA 2NPAA 4WHGA 4RZGA 2A3IA 5FQRA 1X7EA 1ZGYA 2AXAA 3KMGA 5EI1A 3VRTA 1X7RA 3AURA 1I38A 2B1VA 1H9UA 1Z95A 5DWIA 5DKBA 2G0GA 1NAXA 1PZLA 2HAMA 2Q61A 2GP7A 3ADSA 2ZXMA 1NUOA 3CDSA 5KRKA 3A3ZX 2AA6A 5APJA 2J7YA 2PIPL 2P7AA 3OZJA 3ET3A 4PXMA 4R6SA 5DXKA 4DOSA 2QE4A 4FHIA 4K4JA 2VV4A 4MGAA 2ZK1A 2GPPA 3OLFA 3LMPA 4RUOX 4CI5A 1ILHA 2ZLCA 4IV2A 5DWJA 3ZR7A 1ZUCA 1R1KD 2HFPA 1XDKB 1IE9A 3KFCA 3OZ0A 4EM9A 2OCFA 3R29A 4ZNUA 3WJ5A 2XYJA 4J5WA 2QABA 4S15A 3X36A 4CI4A 3ERTA 1YOWA 3WT7A 3VI8A 1G50A 3FC6B 1S9PA 4MGDB 2I0JA 4ZNSA 5APHA 4DM6A 1PQCA 3VT7A 2GWXA 3B3KA 2V7CA 4X1FA 3SZ1A 5C4SA 2FSZA 3AZ2A 2ACLB 4WVDA 4YMQA 3GWXA 1RKHA 5KYJA 1ZKYA 2Q1HA 4HLWA 3VT6A 1XPCA 2G44A 5G44A 5GT4A 4TUZA 3HC6A 5FQTA 4S14A 3A2IA 3CS8A 2IOKA 4WHFA 5DXPA 3W5PA 4PLDA 1XV9A 2XYXA 4WLBA 4OEAA 2NW4A 2PIVA 3NOAA 4XTAA 3W0GA 4REFA 3UVVA 1XLSA 4KZMA 4RWVA 2LBDA 4ONIA 3PCUA 2AAXA 1VJBA 1OT7A 4XAOA 2ZNPA 4PRGA 5HYRA 5DXRA 2P7GA 3G8IA 4NQAB 3Q95B 3R8IA 3IPUA 4OFUA 2R40A 3VTBA 4QM0A 3FUGA 5DXBA 1NYXA 4QE8A 5DXGA 3AFRA 1R5KA 2HASA 3FLIA 3KYTA 4LBDA 4PP3A 2P4YA 4MGCA 1FM6A 4OH6A 1Y0XX 4OLMA 2JF9A 3CTBA 3UUAA 1S19A 3RUTA 3U9QA 3DZUD 1I7IA 3VT4A 3TX7B 1NQ1A 2QGWA 4WPFA 4ZI1A 2O4RA 1E3GA 4RE8A 2HB7A 3ZQTA 5C4UA 3AUNA 5DUEA 3UUDB 5LGAA 2AX7A 3L0JA 4ZN7A 2ZNQA 3V9TA 4A2JA 2XKWA 1SKXA 3ADXA 5L7GA 2AM9A 1T7FA 2YHDA 2JFAA 3DT3A 2AB2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I4V A;  1MVC A;  1ILG A;  4NY9 A;  2ZMJ A;  5GIC A;  3X1H A;  1YOK A;  2H79 A;  2QW4 A;  1K7L A;  4M8H A;  1SQN A;  1R6G A;  4OFR A;  4F9M A;  2ABI A;  2VV4 B;  1XZX X;  1L2J A;  4MGA B;  2AA2 A;  3AUQ A;  5JI0 D;  4KZI A;  4NIE A;  2HCD A;  3V4A A;  2QNV A;  3VT8 A;  1FD0 A;  1DB1 A;  5HZC A;  5KCD A;  3F7D A;  1R20 A;  2P7Z A;  3V49 A;  4IS8 A;  1YMT A;  3K22 A;  5KRF A;  3E94 A;  5KRJ A;  4OKX A;  4Q50 A;  5DMF A;  2J4A A;  5DYB A;  5G46 A;  1I37 A;  2ZXZ A;  2O4J A;  5DIE A;  1NAV A;  2Q1V A;  3N00 A;  4IA3 A;  4N1Y A;  2ZNN A;  3V9Y A;  3UU7 A;  5AVL A;  4ZOM A;  4B7W A;  5DXE A;  1NQ7 A;  3HZF A;  2Q7J A;  4TUZ B;  4OK1 A;  1OVL A;  1UPW A;  2HVC A;  5C4T A;  4L96 A;  3O1E A;  2R40 D;  3R2A A;  1XV9 B;  3R5M A;  2V0V A;  4BCR A;  1U3S A;  2Q59 A;  3OMM A;  5DV8 A;  5SYZ A;  3UVV B;  3OGT A;  4G1Z A;  2AA7 A;  2PIO A;  4XLD A;  2ZL9 A;  1FM6 D;  2QPY A;  2PKL A;  2PIR A;  3H0A A;  1KNU A;  3LBD A;  1FCZ A;  4OZT U;  2XHS A;  4ZJW A;  2Q70 A;  1FCX A;  1U3R A;  4MG5 A;  3WMH A;  2VV1 A;  5IZ0 A;  4ZJR A;  5EHJ A;  3PRG A;  4OKB A;  1K4W A;  4N8R A;  3ILZ A;  5G42 A;  5E0W A;  4DK8 A;  4OED A;  1FM9 A;  1YUC A;  3UP0 A;  1PDU A;  3UUA B;  2AX6 A;  3B66 A;  3W0I A;  2I0G A;  4FGY A;  3K8S A;  4IW6 A;  1M13 A;  5KRM A;  3AX8 A;  2OVM A;  3FEJ A;  2GL8 A;  4O8F A;  2PJL A;  1KV6 A;  5KRA A;  3L0L A;  5KRO A;  3BEJ A;  3P89 A;  3VT9 A;  4XT9 A;  1R20 D;  3V9V A;  3OMK A;  4J5X C;  2Q5S A;  2JFA B;  2YLQ A;  3G8O A;  4LNX A;  5G43 A;  4RAK A;  2VST A;  3VJT A;  4E4K A;  4UDB A;  3DZY A;  2AMA A;  3IPQ A;  3FUR A;  4IA7 A;  4REE A;  3W5R A;  4Q13 A;  1YP0 A;  2Q8S A;  4HEE X;  4RFW A;  4UDD A;  2OUZ A;  2I4Z A;  4FNE A;  3CWD A;  1U3Q A;  2QA6 A;  2NXX E;  1A28 A;  3D90 A;  3VHV A;  1ZEO A;  5GID A;  3EYB A;  5KYA A;  1OSV A;  2J14 A;  4MG7 A;  1RJK A;  4R2U A;  4ZNH A;  2OZ7 A;  2HB8 A;  1ZAF A;  3OLL A;  1T5Z A;  1NQ0 A;  3ADW A;  3TKC A;  5AWJ A;  1UPV A;  3PEQ A;  3F5C B;  4UDC A;  4K7A A;  2ZK4 A;  3UU7 B;  3ADV A;  2YJA B;  2AA5 A;  2AX9 A;  3H0A D;  4P6X A;  4IWF A;  4CSJ A;  5DWG A;  4OEZ A;  4EMA A;  4N73 A;  2QMV A;  2GPO A;  3B67 A;  4G2I A;  4PPP A;  3WFG A;  5DKE A;  5JY3 A;  1PQ9 A;  3B0Q A;  2Q59 B;  4IVW A;  5FQS A;  3IMY A;  2YFE A;  4E2J A;  1TFC A;  2O9I A;  1YIN A;  1FM9 D;  4K6I A;  5DRM A;  3VTD A;  3WTQ A;  3CLD A;  5E7V A;  1FCY A;  1X76 A;  3A2H A;  2P1T A;  3OKI A;  5L7H A;  1S0X A;  2Q6S A;  2VV1 B;  4J5X A;  1QKN A;  5DSH A;  1T76 A;  5KRH A;  1PRG A;  2ZY0 A;  4PF3 A;  3D57 A;  1XAP A;  2P1V A;  2XYW A;  2BJ4 A;  5DZ3 A;  4OZT E;  4RME A;  5HJP A;  1QKU A;  2ZMI A;  4JAZ A;  4OIL A;  1Q4X A;  5DZ0 A;  3ET0 A;  3UUC A;  1RDT A;  3DY6 A;  1GWX A;  5E0X A;  4N5G A;  2ZK2 A;  2G0H A;  4DM8 A;  3OS8 C;  2HAR A;  3DZY D;  4OZR U;  5E14 A;  5G3J A;  4DQM A;  2ATH A;  4S0S A;  2GPU A;  4OHA A;  2HBH A;  1SR7 A;  1T73 A;  4OJB A;  5IXK A;  3OMP A;  3ZRB A;  5DLR A;  4OAR A;  3W0A A;  4MGB A;  4A4V A;  1M7W A;  1T63 A;  3BC5 A;  5EC9 A;  3KPZ A;  5DID A;  2ZAS A;  4FN9 A;  3WFF A;  5AAU A;  2B1Z A;  5AWK A;  5HCV A;  5FQV A;  3NSQ A;  3D24 A;  3GBK A;  1XOW A;  2PIU A;  2J7X A;  3P88 A;  3K23 A;  4IWC A;  4ZO1 X;  1ZDT A;  2QXM A;  3KDT A;  5E19 A;  3VHW A;  3RUU A;  5JJM A;  2VSR A;  1UHL A;  3P0U A;  4PPS A;  1XP6 A;  5DVC A;  5AAV A;  3G0W A;  1K74 A;  5HJS A;  2POB A;  3V3Q A;  3TY0 A;  4MG7 B;  1PCG A;  3OLS A;  4L98 A;  1T7T A;  2IOG A;  4NUF A;  4E4Q A;  4OC7 A;  1T79 A;  1LV2 A;  2P54 A;  2QR9 A;  3BQD A;  3HM1 A;  3L03 A;  5DV6 A;  5APK A;  3W0H A;  5KCW A;  1M2Z A;  2Q7I A;  3G9E A;  5DWE A;  3VT3 A;  1PQ6 A;  1BSX A;  1SJ0 A;  3OOF A;  4DMA A;  3VTC A;  5KD9 A;  1XNX A;  2YLY A;  2HWQ A;  3CS6 A;  4YNK A;  1I7G A;  3B1M A;  3OMQ A;  5DXM A;  3UP3 A;  3FAL A;  5DX3 A;  2YAT A;  4NB6 A;  1XNN A;  4MG8 A;  1XLS E;  3ADU A;  3MNO A;  5L11 A;  2ZMH A;  2IHQ A;  3HQ5 A;  5DUG A;  2QH6 A;  4RZE A;  1IE8 A;  3OS8 A;  3VJH A;  5KRC A;  2AWH A;  1XB7 A;  2FVJ A;  2Q60 A;  3D6D A;  1TXI A;  4MGD A;  3VN2 A;  2Q7K A;  2QA8 A;  2ZFX A;  5G5W A;  3S9S A;  1RDT D;  1NRL A;  2ACL A;  2JJ3 A;  2R6W A;  2YJD A;  1L2I A;  1WM0 X;  3ADT A;  5B5B A;  4J24 A;  1YYE A;  2NV7 A;  4LNW A;  3E7C A;  5DXB B;  4XHD A;  3ZRA A;  2PNU A;  2BJ4 B;  1Y0S A;  5ACC A;  5DU5 A;  3W5T A;  3WWR A;  5HJP B;  3A9E A;  4PWL A;  5DMC A;  1QKT A;  3VJS A;  3MNE A;  2B50 A;  1RK3 A;  1XIU A;  3OS9 A;  2Q3Y A;  2QGT A;  3A40 X;  2AX8 A;  4IA2 A;  2P15 A;  3ET1 A;  5DXQ A;  5AVI A;  3DR1 A;  3OMO A;  3GD2 A;  1FBY A;  3R8D A;  4G1D A;  4YPQ A;  4MGB B;  5EIT A;  2OVH A;  1EXX A;  4OZR E;  4UDA A;  3R8A A;  4RMC A;  1K74 D;  5KCU A;  5DVV A;  3E00 A;  3ET2 A;  3OSA A;  2Q5G A;  1HJ1 A;  2ZK6 A;  5AK2 A;  5FQP A;  4YT1 A;  1NHZ A;  3AZ1 A;  4MG9 A;  1XJ7 A;  1E3K A;  4RZF A;  5C4O A;  3VRW A;  1YY4 A;  3CDP A;  3D5F A;  4DOR A;  5JJM B;  1YIM A;  4XUM A;  4JYH A;  2YLP A;  1UHL B;  3FS1 A;  1UOM A;  3V3E A;  1GWR A;  4IVY A;  3UUD A;  5AAV B;  5KCF A;  3OAP A;  5DV3 A;  5KR9 A;  4J26 A;  3VHU A;  5H1E A;  1ERR A;  3GN8 A;  5DVS A;  1YJE A;  4ITF A;  5M96 A;  2ZBS A;  3DZU A;  2B23 A;  5F9B A;  3P8X A;  5DI7 A;  3L0E A;  1EXA A;  1A52 A;  1X7B A;  3PO9 A;  1ZDU A;  3W0Y A;  2PIN A;  1QKM A;  3L3Z A;  4P6W A;  4RUJ A;  4XI3 A;  4QE6 A;  3FEI A;  4APU A;  2GTK A;  5EJV A;  1PK5 A;  1OVL B;  2Q5P A;  3FAL B;  3KMR A;  4TV1 A;  3L1B A;  4MG8 B;  4S0T A;  5DK9 A;  1DKF A;  3W5Q A;  5DY8 A;  1G5Y A;  3WJ4 A;  3DCT A;  3RLL A;  2VV2 A;  1Z5X U;  2F4B A;  2GIU A;  2PIQ A;  4JL4 A;  2HC4 A;  2ZVT A;  4PP6 A;  4XUH A;  5DZI A;  2PIX A;  5LWP A;  3WT6 A;  3OKH A;  1N46 A;  2QA8 B;  2VV0 A;  1N83 A;  1T7R A;  1P93 A;  1GS4 A;  1S9Q A;  3M7R A;  3QT0 A;  2QZO A;  5DZ1 A;  3L3X A;  1RKG A;  2E2R A;  3IPS A;  1GWQ A;  3W0J A;  3KWY A;  4IU7 A;  2FAI A;  1X7J A;  2I4P A;  5DRJ A;  1LBD A;  1MV9 A;  1ZH7 A;  2W8Y A;  3A9E B;  2PRG A;  5DIG A;  5DYD A;  3B5R A;  2PIT A;  3AZ3 A;  3GZ9 A;  3SP6 A;  3VSO A;  3VJI A;  1OSH A;  3E00 D;  1HG4 A;  2REW A;  4G1Y A;  1XP1 A;  3R5N A;  4DK7 A;  4FHH A;  2H77 A;  4OGH A;  2P1U A;  1T7M A;  2AYR A;  2QXS A;  3B0W A;  4OIV A;  2ZNO A;  1XVP A;  4MG6 A;  3RY9 A;  3IXP A;  2POG A;  3A78 A;  1NQ2 A;  1XQC A;  4X1G A;  3OSW A;  5AZT A;  5HYK A;  3CJW A;  3H52 A;  3B0R A;  2Z4J A;  3AN3 A;  3HVL A;  3MNP A;  5E1C A;  4R06 A;  5AYG A;  2ZKC A;  2AO6 A;  2OAX A;  2ZK3 A;  2ZK5 A;  4MG9 B;  4QJR A;  5IAW A;  1XQ3 A;  4ZO1 B;  3JZB A;  2HWR A;  2PIW A;  3VSP A;  4G2H A;  4OKT A;  2ZLA A;  4A4W A;  3HOD A;  3B65 A;  3KDU A;  4PVU A;  5DKG A;  3VT5 A;  5KCC A;  4IQR A;  1Y9R A;  3GYT A;  2AMB A;  4OEY A;  4OJ9 A;  3WT5 A;  1NDE A;  5KRI A;  4JGV A;  3PLZ A;  4ZNW A;  1U9E A;  1G1U A;  5DUH A;  5DZH A;  5G45 A;  5B41 A;  3X1I A;  3B68 A;  3X31 A;  5EGV A;  4ZNV A;  2ZXN A;  1X78 A;  1YA3 A;  3VRU A;  1S0Z A;  4PP5 A;  3T03 A;  5DX3 B;  4ITE A;  5L7E A;  1XDK A;  1P8D A;  4Y29 A;  4TV1 B;  3SP9 A;  2GPV A;  3RLJ A;  1DKF B;  1T65 A;  5E15 A;  3HLV A;  1T74 A;  4QL8 A;  5DP0 A;  2R6Y A;  5KCE A;  2NXX A;  2YLO A;  3OOK A;  4POJ A;  3KMZ A;  3CS4 A;  3FC6 A;  2OM9 A;  2Q6R A;  3O1D A;  4LSJ A;  5KCT A;  3A2J A;  4RMD A;  5GIE A;  3AN4 A;  3JZC A;  4QK4 A;  2Q7L A;  5KRL A;  3IA6 A;  2VV3 A;  4OH5 A;  3F5C A;  3WGP A;  1R1K A;  3HC5 A;  2ZK0 A;  3OSI A;  4KZJ A;  2EWP A;  2Z4B A;  1N4H A;  1Z5X E;  3TKM A;  5AZV A;  3HO0 A;  4M8E A;  2QZO B;  3KBA A;  5A86 A;  4OJ4 A;  2QTU A;  2QSE A;  5DWL A;  2Q6J A;  3IXP D;  3NSP A;  3CQV A;  4PLE A;  5DKS A;  2G5O A;  4ZNT A;  4IUI A;  4LTW A;  4WQP A;  5ETH A;  4G21 A;  1XP9 A;  3K6P A;  4J5W C;  3FXV A;  4RUP A;  3DCU A;  4OKW A;  3ERD A;  3GYU A;  4IA1 A;  3B0T A;  3Q95 A;  5CJ6 A;  5DL4 A;  4POH A;  5K13 A;  3VRV A;  4G20 A;  1MZN A;  1XVP B;  1ERE A;  1KKQ A;  4IW8 A;  2I4J A;  3GWS X;  4IV4 A;  5ICK A;  1G2N A;  4Q0A C;  4ZN9 A;  2BAW A;  4JYI A;  4JYG A;  3RVF A;  4MDD A;  3PBA A;  3W0C A;  4OIU A;  5DTV A;  2NPA A;  4WHG A;  4RZG A;  2A3I A;  5FQR A;  1X7E A;  1ZGY A;  2AXA A;  3KMG A;  5EI1 A;  3VRT A;  1X7R A;  3AUR A;  1I38 A;  2B1V A;  1H9U A;  1Z95 A;  5DWI A;  5DKB A;  2G0G A;  1NAX A;  1PZL A;  2HAM A;  2Q61 A;  2GP7 A;  3ADS A;  2ZXM A;  1NUO A;  3CDS A;  5KRK A;  3A3Z X;  2AA6 A;  5APJ A;  2J7Y A;  2PIP L;  2P7A A;  3OZJ A;  3ET3 A;  4PXM A;  4R6S A;  5DXK A;  4DOS A;  2QE4 A;  4FHI A;  4K4J A;  2VV4 A;  4MGA A;  2ZK1 A;  2GPP A;  3OLF A;  3LMP A;  4RUO X;  4CI5 A;  1ILH A;  2ZLC A;  4IV2 A;  5DWJ A;  3ZR7 A;  1ZUC A;  1R1K D;  2HFP A;  1XDK B;  1IE9 A;  3KFC A;  3OZ0 A;  4EM9 A;  2OCF A;  3R29 A;  4ZNU A;  3WJ5 A;  2XYJ A;  4J5W A;  2QAB A;  4S15 A;  3X36 A;  4CI4 A;  3ERT A;  1YOW A;  3WT7 A;  3VI8 A;  1G50 A;  3FC6 B;  1S9P A;  4MGD B;  2I0J A;  4ZNS A;  5APH A;  4DM6 A;  1PQC A;  3VT7 A;  2GWX A;  3B3K A;  2V7C A;  4X1F A;  3SZ1 A;  5C4S A;  2FSZ A;  3AZ2 A;  2ACL B;  4WVD A;  4YMQ A;  3GWX A;  1RKH A;  5KYJ A;  1ZKY A;  2Q1H A;  4HLW A;  3VT6 A;  1XPC A;  2G44 A;  5G44 A;  5GT4 A;  4TUZ A;  3HC6 A;  5FQT A;  4S14 A;  3A2I A;  3CS8 A;  2IOK A;  4WHF A;  5DXP A;  3W5P A;  4PLD A;  1XV9 A;  2XYX A;  4WLB A;  4OEA A;  2NW4 A;  2PIV A;  3NOA A;  4XTA A;  3W0G A;  4REF A;  3UVV A;  1XLS A;  4KZM A;  4RWV A;  2LBD A;  4ONI A;  3PCU A;  2AAX A;  1VJB A;  1OT7 A;  4XAO A;  2ZNP A;  4PRG A;  5HYR A;  5DXR A;  2P7G A;  3G8I A;  4NQA B;  3Q95 B;  3R8I A;  3IPU A;  4OFU A;  2R40 A;  3VTB A;  4QM0 A;  3FUG A;  5DXB A;  1NYX A;  4QE8 A;  5DXG A;  3AFR A;  1R5K A;  2HAS A;  3FLI A;  3KYT A;  4LBD A;  4PP3 A;  2P4Y A;  4MGC A;  1FM6 A;  4OH6 A;  1Y0X X;  4OLM A;  2JF9 A;  3CTB A;  3UUA A;  1S19 A;  3RUT A;  3U9Q A;  3DZU D;  1I7I A;  3VT4 A;  3TX7 B;  1NQ1 A;  2QGW A;  4WPF A;  4ZI1 A;  2O4R A;  1E3G A;  4RE8 A;  2HB7 A;  3ZQT A;  5C4U A;  3AUN A;  5DUE A;  3UUD B;  5LGA A;  2AX7 A;  3L0J A;  4ZN7 A;  2ZNQ A;  3V9T A;  4A2J A;  2XKW A;  1SKX A;  3ADX A;  5L7G A;  2AM9 A;  1T7F A;  2YHD A;  2JFA A;  3DT3 A;  2AB2 A; 
#chains in the Genus database with same CATH topology
 5I4V A;  1MVC A;  1ILG A;  4NY9 A;  2ZMJ A;  5GIC A;  3X1H A;  1YOK A;  2H79 A;  2QW4 A;  1K7L A;  4M8H A;  1SQN A;  1R6G A;  4OFR A;  4F9M A;  2ABI A;  2VV4 B;  1XZX X;  1L2J A;  4MGA B;  2AA2 A;  3AUQ A;  5JI0 D;  4KZI A;  4NIE A;  2HCD A;  3V4A A;  2QNV A;  3VT8 A;  1FD0 A;  1DB1 A;  5HZC A;  5KCD A;  3F7D A;  1R20 A;  2P7Z A;  3V49 A;  4IS8 A;  1YMT A;  3K22 A;  5KRF A;  3E94 A;  5KRJ A;  4OKX A;  4Q50 A;  5DMF A;  2J4A A;  5DYB A;  5G46 A;  1I37 A;  2ZXZ A;  2O4J A;  5DIE A;  1NAV A;  2Q1V A;  3N00 A;  4IA3 A;  4N1Y A;  2ZNN A;  3V9Y A;  3UU7 A;  5AVL A;  4ZOM A;  4B7W A;  5DXE A;  1NQ7 A;  3HZF A;  2Q7J A;  4TUZ B;  4OK1 A;  1OVL A;  1UPW A;  2HVC A;  5C4T A;  4L96 A;  3O1E A;  2R40 D;  3R2A A;  1XV9 B;  3R5M A;  2V0V A;  4BCR A;  1U3S A;  2Q59 A;  3OMM A;  5DV8 A;  5SYZ A;  3UVV B;  3OGT A;  4G1Z A;  2AA7 A;  2PIO A;  4XLD A;  2ZL9 A;  1FM6 D;  2QPY A;  2PKL A;  2PIR A;  3H0A A;  1KNU A;  3LBD A;  1FCZ A;  4OZT U;  2XHS A;  4ZJW A;  2Q70 A;  1FCX A;  1U3R A;  4MG5 A;  3WMH A;  2VV1 A;  5IZ0 A;  4ZJR A;  5EHJ A;  3PRG A;  4OKB A;  1K4W A;  4N8R A;  3ILZ A;  5G42 A;  5E0W A;  4DK8 A;  4OED A;  1FM9 A;  1YUC A;  3UP0 A;  1PDU A;  3UUA B;  2AX6 A;  3B66 A;  3W0I A;  2I0G A;  4FGY A;  3K8S A;  4IW6 A;  1M13 A;  5KRM A;  3AX8 A;  2OVM A;  3FEJ A;  2GL8 A;  4O8F A;  2PJL A;  1KV6 A;  5KRA A;  3L0L A;  5KRO A;  3BEJ A;  3P89 A;  3VT9 A;  4XT9 A;  1R20 D;  3V9V A;  3OMK A;  4J5X C;  2Q5S A;  2JFA B;  2YLQ A;  3G8O A;  4LNX A;  5G43 A;  4RAK A;  2VST A;  3VJT A;  4E4K A;  4UDB A;  3DZY A;  2AMA A;  3IPQ A;  3FUR A;  4IA7 A;  4REE A;  3W5R A;  4Q13 A;  1YP0 A;  2Q8S A;  4HEE X;  4RFW A;  4UDD A;  2OUZ A;  2I4Z A;  4FNE A;  3CWD A;  1U3Q A;  2QA6 A;  2NXX E;  1A28 A;  3D90 A;  3VHV A;  1ZEO A;  5GID A;  3EYB A;  5KYA A;  1OSV A;  2J14 A;  4MG7 A;  1RJK A;  4R2U A;  4ZNH A;  2OZ7 A;  2HB8 A;  1ZAF A;  3OLL A;  1T5Z A;  1NQ0 A;  3ADW A;  3TKC A;  5AWJ A;  1UPV A;  3PEQ A;  3F5C B;  4UDC A;  4K7A A;  2ZK4 A;  3UU7 B;  3ADV A;  2YJA B;  2AA5 A;  2AX9 A;  3H0A D;  4P6X A;  4IWF A;  4CSJ A;  5DWG A;  4OEZ A;  4EMA A;  4N73 A;  2QMV A;  2GPO A;  3B67 A;  4G2I A;  4PPP A;  3WFG A;  5DKE A;  5JY3 A;  1PQ9 A;  3B0Q A;  2Q59 B;  4IVW A;  5FQS A;  3IMY A;  2YFE A;  4E2J A;  1TFC A;  2O9I A;  1YIN A;  1FM9 D;  4K6I A;  5DRM A;  3VTD A;  3WTQ A;  3CLD A;  5E7V A;  1FCY A;  1X76 A;  3A2H A;  2P1T A;  3OKI A;  5L7H A;  1S0X A;  2Q6S A;  2VV1 B;  4J5X A;  1QKN A;  5DSH A;  1T76 A;  5KRH A;  1PRG A;  2ZY0 A;  4PF3 A;  3D57 A;  1XAP A;  2P1V A;  2XYW A;  2BJ4 A;  5DZ3 A;  4OZT E;  4RME A;  5HJP A;  1QKU A;  2ZMI A;  4JAZ A;  4OIL A;  1Q4X A;  5DZ0 A;  3ET0 A;  3UUC A;  1RDT A;  3DY6 A;  1GWX A;  5E0X A;  4N5G A;  2ZK2 A;  2G0H A;  4DM8 A;  3OS8 C;  2HAR A;  3DZY D;  4OZR U;  5E14 A;  5G3J A;  4DQM A;  2ATH A;  4S0S A;  2GPU A;  4OHA A;  2HBH A;  1SR7 A;  1T73 A;  4OJB A;  5IXK A;  3OMP A;  3ZRB A;  5DLR A;  4OAR A;  3W0A A;  4MGB A;  4A4V A;  1M7W A;  1T63 A;  3BC5 A;  5EC9 A;  3KPZ A;  5DID A;  2ZAS A;  4FN9 A;  3WFF A;  5AAU A;  2B1Z A;  5AWK A;  5HCV A;  5FQV A;  3NSQ A;  3D24 A;  3GBK A;  1XOW A;  2PIU A;  2J7X A;  3P88 A;  3K23 A;  4IWC A;  4ZO1 X;  1ZDT A;  2QXM A;  3KDT A;  5E19 A;  3VHW A;  3RUU A;  5JJM A;  2VSR A;  1UHL A;  3P0U A;  4PPS A;  1XP6 A;  5DVC A;  5AAV A;  3G0W A;  1K74 A;  5HJS A;  2POB A;  3V3Q A;  3TY0 A;  4MG7 B;  1PCG A;  3OLS A;  4L98 A;  1T7T A;  2IOG A;  4NUF A;  4E4Q A;  4OC7 A;  1T79 A;  1LV2 A;  2P54 A;  2QR9 A;  3BQD A;  3HM1 A;  3L03 A;  5DV6 A;  5APK A;  3W0H A;  5KCW A;  1M2Z A;  2Q7I A;  3G9E A;  5DWE A;  3VT3 A;  1PQ6 A;  1BSX A;  1SJ0 A;  3OOF A;  4DMA A;  3VTC A;  5KD9 A;  1XNX A;  2YLY A;  2HWQ A;  3CS6 A;  4YNK A;  1I7G A;  3B1M A;  3OMQ A;  5DXM A;  3UP3 A;  3FAL A;  5DX3 A;  2YAT A;  4NB6 A;  1XNN A;  4MG8 A;  1XLS E;  3ADU A;  3MNO A;  5L11 A;  2ZMH A;  2IHQ A;  3HQ5 A;  5DUG A;  2QH6 A;  4RZE A;  1IE8 A;  3OS8 A;  3VJH A;  5KRC A;  2AWH A;  1XB7 A;  2FVJ A;  2Q60 A;  3D6D A;  1TXI A;  4MGD A;  3VN2 A;  2Q7K A;  2QA8 A;  2ZFX A;  5G5W A;  3S9S A;  1RDT D;  1NRL A;  2ACL A;  2JJ3 A;  2R6W A;  2YJD A;  1L2I A;  1WM0 X;  3ADT A;  5B5B A;  4J24 A;  1YYE A;  2NV7 A;  4LNW A;  3E7C A;  5DXB B;  4XHD A;  3ZRA A;  2PNU A;  2BJ4 B;  1Y0S A;  5ACC A;  5DU5 A;  3W5T A;  3WWR A;  5HJP B;  3A9E A;  4PWL A;  5DMC A;  1QKT A;  3VJS A;  3MNE A;  2B50 A;  1RK3 A;  1XIU A;  3OS9 A;  2Q3Y A;  2QGT A;  3A40 X;  2AX8 A;  4IA2 A;  2P15 A;  3ET1 A;  5DXQ A;  5AVI A;  3DR1 A;  3OMO A;  3GD2 A;  1FBY A;  3R8D A;  4G1D A;  4YPQ A;  4MGB B;  5EIT A;  2OVH A;  1EXX A;  4OZR E;  4UDA A;  3R8A A;  4RMC A;  1K74 D;  5KCU A;  5DVV A;  3E00 A;  3ET2 A;  3OSA A;  2Q5G A;  1HJ1 A;  2ZK6 A;  5AK2 A;  5FQP A;  4YT1 A;  1NHZ A;  3AZ1 A;  4MG9 A;  1XJ7 A;  1E3K A;  4RZF A;  5C4O A;  3VRW A;  1YY4 A;  3CDP A;  3D5F A;  4DOR A;  5JJM B;  1YIM A;  4XUM A;  4JYH A;  2YLP A;  1UHL B;  3FS1 A;  1UOM A;  3V3E A;  1GWR A;  4IVY A;  3UUD A;  5AAV B;  5KCF A;  3OAP A;  5DV3 A;  5KR9 A;  4J26 A;  3VHU A;  5H1E A;  1ERR A;  3GN8 A;  5DVS A;  1YJE A;  4ITF A;  5M96 A;  2ZBS A;  3DZU A;  2B23 A;  5F9B A;  3P8X A;  5DI7 A;  3L0E A;  1EXA A;  1A52 A;  1X7B A;  3PO9 A;  1ZDU A;  3W0Y A;  2PIN A;  1QKM A;  3L3Z A;  4P6W A;  4RUJ A;  4XI3 A;  4QE6 A;  3FEI A;  4APU A;  2GTK A;  5EJV A;  1PK5 A;  1OVL B;  2Q5P A;  3FAL B;  3KMR A;  4TV1 A;  3L1B A;  4MG8 B;  4S0T A;  5DK9 A;  1DKF A;  3W5Q A;  5DY8 A;  1G5Y A;  3WJ4 A;  3DCT A;  3RLL A;  2VV2 A;  1Z5X U;  2F4B A;  2GIU A;  2PIQ A;  4JL4 A;  2HC4 A;  2ZVT A;  4PP6 A;  4XUH A;  5DZI A;  2PIX A;  5LWP A;  3WT6 A;  3OKH A;  1N46 A;  2QA8 B;  2VV0 A;  1N83 A;  1T7R A;  1P93 A;  1GS4 A;  1S9Q A;  3M7R A;  3QT0 A;  2QZO A;  5DZ1 A;  3L3X A;  1RKG A;  2E2R A;  3IPS A;  1GWQ A;  3W0J A;  3KWY A;  4IU7 A;  2FAI A;  1X7J A;  2I4P A;  5DRJ A;  1LBD A;  1MV9 A;  1ZH7 A;  2W8Y A;  3A9E B;  2PRG A;  5DIG A;  5DYD A;  3B5R A;  2PIT A;  3AZ3 A;  3GZ9 A;  3SP6 A;  3VSO A;  3VJI A;  1OSH A;  3E00 D;  1HG4 A;  2REW A;  4G1Y A;  1XP1 A;  3R5N A;  4DK7 A;  4FHH A;  2H77 A;  4OGH A;  2P1U A;  1T7M A;  2AYR A;  2QXS A;  3B0W A;  4OIV A;  2ZNO A;  1XVP A;  4MG6 A;  3RY9 A;  3IXP A;  2POG A;  3A78 A;  1NQ2 A;  1XQC A;  4X1G A;  3OSW A;  5AZT A;  5HYK A;  3CJW A;  3H52 A;  3B0R A;  2Z4J A;  3AN3 A;  3HVL A;  3MNP A;  5E1C A;  4R06 A;  5AYG A;  2ZKC A;  2AO6 A;  2OAX A;  2ZK3 A;  2ZK5 A;  4MG9 B;  4QJR A;  5IAW A;  1XQ3 A;  4ZO1 B;  3JZB A;  2HWR A;  2PIW A;  3VSP A;  4G2H A;  4OKT A;  2ZLA A;  4A4W A;  3HOD A;  3B65 A;  3KDU A;  4PVU A;  5DKG A;  3VT5 A;  5KCC A;  4IQR A;  1Y9R A;  3GYT A;  2AMB A;  4OEY A;  4OJ9 A;  3WT5 A;  1NDE A;  5KRI A;  4JGV A;  3PLZ A;  4ZNW A;  1U9E A;  1G1U A;  5DUH A;  5DZH A;  5G45 A;  5B41 A;  3X1I A;  3B68 A;  3X31 A;  5EGV A;  4ZNV A;  2ZXN A;  1X78 A;  1YA3 A;  3VRU A;  1S0Z A;  4PP5 A;  3T03 A;  5DX3 B;  4ITE A;  5L7E A;  1XDK A;  1P8D A;  4Y29 A;  4TV1 B;  3SP9 A;  2GPV A;  3RLJ A;  1DKF B;  1T65 A;  5E15 A;  3HLV A;  1T74 A;  4QL8 A;  5DP0 A;  2R6Y A;  5KCE A;  2NXX A;  2YLO A;  3OOK A;  4POJ A;  3KMZ A;  3CS4 A;  3FC6 A;  2OM9 A;  2Q6R A;  3O1D A;  4LSJ A;  5KCT A;  3A2J A;  4RMD A;  5GIE A;  3AN4 A;  3JZC A;  4QK4 A;  2Q7L A;  5KRL A;  3IA6 A;  2VV3 A;  4OH5 A;  3F5C A;  3WGP A;  1R1K A;  3HC5 A;  2ZK0 A;  3OSI A;  4KZJ A;  2EWP A;  2Z4B A;  1N4H A;  1Z5X E;  3TKM A;  5AZV A;  3HO0 A;  4M8E A;  2QZO B;  3KBA A;  5A86 A;  4OJ4 A;  2QTU A;  2QSE A;  5DWL A;  2Q6J A;  3IXP D;  3NSP A;  3CQV A;  4PLE A;  5DKS A;  2G5O A;  4ZNT A;  4IUI A;  4LTW A;  4WQP A;  5ETH A;  4G21 A;  1XP9 A;  3K6P A;  4J5W C;  3FXV A;  4RUP A;  3DCU A;  4OKW A;  3ERD A;  3GYU A;  4IA1 A;  3B0T A;  3Q95 A;  5CJ6 A;  5DL4 A;  4POH A;  5K13 A;  3VRV A;  4G20 A;  1MZN A;  1XVP B;  1ERE A;  1KKQ A;  4IW8 A;  2I4J A;  3GWS X;  4IV4 A;  5ICK A;  1G2N A;  4Q0A C;  4ZN9 A;  2BAW A;  4JYI A;  4JYG A;  3RVF A;  4MDD A;  3PBA A;  3W0C A;  4OIU A;  5DTV A;  2NPA A;  4WHG A;  4RZG A;  2A3I A;  5FQR A;  1X7E A;  1ZGY A;  2AXA A;  3KMG A;  5EI1 A;  3VRT A;  1X7R A;  3AUR A;  1I38 A;  2B1V A;  1H9U A;  1Z95 A;  5DWI A;  5DKB A;  2G0G A;  1NAX A;  1PZL A;  2HAM A;  2Q61 A;  2GP7 A;  3ADS A;  2ZXM A;  1NUO A;  3CDS A;  5KRK A;  3A3Z X;  2AA6 A;  5APJ A;  2J7Y A;  2PIP L;  2P7A A;  3OZJ A;  3ET3 A;  4PXM A;  4R6S A;  5DXK A;  4DOS A;  2QE4 A;  4FHI A;  4K4J A;  2VV4 A;  4MGA A;  2ZK1 A;  2GPP A;  3OLF A;  3LMP A;  4RUO X;  4CI5 A;  1ILH A;  2ZLC A;  4IV2 A;  5DWJ A;  3ZR7 A;  1ZUC A;  1R1K D;  2HFP A;  1XDK B;  1IE9 A;  3KFC A;  3OZ0 A;  4EM9 A;  2OCF A;  3R29 A;  4ZNU A;  3WJ5 A;  2XYJ A;  4J5W A;  2QAB A;  4S15 A;  3X36 A;  4CI4 A;  3ERT A;  1YOW A;  3WT7 A;  3VI8 A;  1G50 A;  3FC6 B;  1S9P A;  4MGD B;  2I0J A;  4ZNS A;  5APH A;  4DM6 A;  1PQC A;  3VT7 A;  2GWX A;  3B3K A;  2V7C A;  4X1F A;  3SZ1 A;  5C4S A;  2FSZ A;  3AZ2 A;  2ACL B;  4WVD A;  4YMQ A;  3GWX A;  1RKH A;  5KYJ A;  1ZKY A;  2Q1H A;  4HLW A;  3VT6 A;  1XPC A;  2G44 A;  5G44 A;  5GT4 A;  4TUZ A;  3HC6 A;  5FQT A;  4S14 A;  3A2I A;  3CS8 A;  2IOK A;  4WHF A;  5DXP A;  3W5P A;  4PLD A;  1XV9 A;  2XYX A;  4WLB A;  4OEA A;  2NW4 A;  2PIV A;  3NOA A;  4XTA A;  3W0G A;  4REF A;  3UVV A;  1XLS A;  4KZM A;  4RWV A;  2LBD A;  4ONI A;  3PCU A;  2AAX A;  1VJB A;  1OT7 A;  4XAO A;  2ZNP A;  4PRG A;  5HYR A;  5DXR A;  2P7G A;  3G8I A;  4NQA B;  3Q95 B;  3R8I A;  3IPU A;  4OFU A;  2R40 A;  3VTB A;  4QM0 A;  3FUG A;  5DXB A;  1NYX A;  4QE8 A;  5DXG A;  3AFR A;  1R5K A;  2HAS A;  3FLI A;  3KYT A;  4LBD A;  4PP3 A;  2P4Y A;  4MGC A;  1FM6 A;  4OH6 A;  1Y0X X;  4OLM A;  2JF9 A;  3CTB A;  3UUA A;  1S19 A;  3RUT A;  3U9Q A;  3DZU D;  1I7I A;  3VT4 A;  3TX7 B;  1NQ1 A;  2QGW A;  4WPF A;  4ZI1 A;  2O4R A;  1E3G A;  4RE8 A;  2HB7 A;  3ZQT A;  5C4U A;  3AUN A;  5DUE A;  3UUD B;  5LGA A;  2AX7 A;  3L0J A;  4ZN7 A;  2ZNQ A;  3V9T A;  4A2J A;  2XKW A;  1SKX A;  3ADX A;  5L7G A;  2AM9 A;  1T7F A;  2YHD A;  2JFA A;  3DT3 A;  2AB2 A; 
#chains in the Genus database with same CATH homology
 5I4V A;  1MVC A;  1ILG A;  4NY9 A;  2ZMJ A;  5GIC A;  3X1H A;  1YOK A;  2H79 A;  2QW4 A;  1K7L A;  4M8H A;  1SQN A;  1R6G A;  4OFR A;  4F9M A;  2ABI A;  2VV4 B;  1XZX X;  1L2J A;  4MGA B;  2AA2 A;  3AUQ A;  5JI0 D;  4KZI A;  4NIE A;  2HCD A;  3V4A A;  2QNV A;  3VT8 A;  1FD0 A;  1DB1 A;  5HZC A;  5KCD A;  3F7D A;  1R20 A;  2P7Z A;  3V49 A;  4IS8 A;  1YMT A;  3K22 A;  5KRF A;  3E94 A;  5KRJ A;  4OKX A;  4Q50 A;  5DMF A;  2J4A A;  5DYB A;  5G46 A;  1I37 A;  2ZXZ A;  2O4J A;  5DIE A;  1NAV A;  2Q1V A;  3N00 A;  4IA3 A;  4N1Y A;  2ZNN A;  3V9Y A;  3UU7 A;  5AVL A;  4ZOM A;  4B7W A;  5DXE A;  1NQ7 A;  3HZF A;  2Q7J A;  4TUZ B;  4OK1 A;  1OVL A;  1UPW A;  2HVC A;  5C4T A;  4L96 A;  3O1E A;  2R40 D;  3R2A A;  1XV9 B;  3R5M A;  2V0V A;  4BCR A;  1U3S A;  2Q59 A;  3OMM A;  5DV8 A;  5SYZ A;  3UVV B;  3OGT A;  4G1Z A;  2AA7 A;  2PIO A;  4XLD A;  2ZL9 A;  1FM6 D;  2QPY A;  2PKL A;  2PIR A;  3H0A A;  1KNU A;  3LBD A;  1FCZ A;  4OZT U;  2XHS A;  4ZJW A;  2Q70 A;  1FCX A;  1U3R A;  4MG5 A;  3WMH A;  2VV1 A;  5IZ0 A;  4ZJR A;  5EHJ A;  3PRG A;  4OKB A;  1K4W A;  4N8R A;  3ILZ A;  5G42 A;  5E0W A;  4DK8 A;  4OED A;  1FM9 A;  1YUC A;  3UP0 A;  1PDU A;  3UUA B;  2AX6 A;  3B66 A;  3W0I A;  2I0G A;  4FGY A;  3K8S A;  4IW6 A;  1M13 A;  5KRM A;  3AX8 A;  2OVM A;  3FEJ A;  2GL8 A;  4O8F A;  2PJL A;  1KV6 A;  5KRA A;  3L0L A;  5KRO A;  3BEJ A;  3P89 A;  3VT9 A;  4XT9 A;  1R20 D;  3V9V A;  3OMK A;  4J5X C;  2Q5S A;  2JFA B;  2YLQ A;  3G8O A;  4LNX A;  5G43 A;  4RAK A;  2VST A;  3VJT A;  4E4K A;  4UDB A;  3DZY A;  2AMA A;  3IPQ A;  3FUR A;  4IA7 A;  4REE A;  3W5R A;  4Q13 A;  1YP0 A;  2Q8S A;  4HEE X;  4RFW A;  4UDD A;  2OUZ A;  2I4Z A;  4FNE A;  3CWD A;  1U3Q A;  2QA6 A;  2NXX E;  1A28 A;  3D90 A;  3VHV A;  1ZEO A;  5GID A;  3EYB A;  5KYA A;  1OSV A;  2J14 A;  4MG7 A;  1RJK A;  4R2U A;  4ZNH A;  2OZ7 A;  2HB8 A;  1ZAF A;  3OLL A;  1T5Z A;  1NQ0 A;  3ADW A;  3TKC A;  5AWJ A;  1UPV A;  3PEQ A;  3F5C B;  4UDC A;  4K7A A;  2ZK4 A;  3UU7 B;  3ADV A;  2YJA B;  2AA5 A;  2AX9 A;  3H0A D;  4P6X A;  4IWF A;  4CSJ A;  5DWG A;  4OEZ A;  4EMA A;  4N73 A;  2QMV A;  2GPO A;  3B67 A;  4G2I A;  4PPP A;  3WFG A;  5DKE A;  5JY3 A;  1PQ9 A;  3B0Q A;  2Q59 B;  4IVW A;  5FQS A;  3IMY A;  2YFE A;  4E2J A;  1TFC A;  2O9I A;  1YIN A;  1FM9 D;  4K6I A;  5DRM A;  3VTD A;  3WTQ A;  3CLD A;  5E7V A;  1FCY A;  1X76 A;  3A2H A;  2P1T A;  3OKI A;  5L7H A;  1S0X A;  2Q6S A;  2VV1 B;  4J5X A;  1QKN A;  5DSH A;  1T76 A;  5KRH A;  1PRG A;  2ZY0 A;  4PF3 A;  3D57 A;  1XAP A;  2P1V A;  2XYW A;  2BJ4 A;  5DZ3 A;  4OZT E;  4RME A;  5HJP A;  1QKU A;  2ZMI A;  4JAZ A;  4OIL A;  1Q4X A;  5DZ0 A;  3ET0 A;  3UUC A;  1RDT A;  3DY6 A;  1GWX A;  5E0X A;  4N5G A;  2ZK2 A;  2G0H A;  4DM8 A;  3OS8 C;  2HAR A;  3DZY D;  4OZR U;  5E14 A;  5G3J A;  4DQM A;  2ATH A;  4S0S A;  2GPU A;  4OHA A;  2HBH A;  1SR7 A;  1T73 A;  4OJB A;  5IXK A;  3OMP A;  3ZRB A;  5DLR A;  4OAR A;  3W0A A;  4MGB A;  4A4V A;  1M7W A;  1T63 A;  3BC5 A;  5EC9 A;  3KPZ A;  5DID A;  2ZAS A;  4FN9 A;  3WFF A;  5AAU A;  2B1Z A;  5AWK A;  5HCV A;  5FQV A;  3NSQ A;  3D24 A;  3GBK A;  1XOW A;  2PIU A;  2J7X A;  3P88 A;  3K23 A;  4IWC A;  4ZO1 X;  1ZDT A;  2QXM A;  3KDT A;  5E19 A;  3VHW A;  3RUU A;  5JJM A;  2VSR A;  1UHL A;  3P0U A;  4PPS A;  1XP6 A;  5DVC A;  5AAV A;  3G0W A;  1K74 A;  5HJS A;  2POB A;  3V3Q A;  3TY0 A;  4MG7 B;  1PCG A;  3OLS A;  4L98 A;  1T7T A;  2IOG A;  4NUF A;  4E4Q A;  4OC7 A;  1T79 A;  1LV2 A;  2P54 A;  2QR9 A;  3BQD A;  3HM1 A;  3L03 A;  5DV6 A;  5APK A;  3W0H A;  5KCW A;  1M2Z A;  2Q7I A;  3G9E A;  5DWE A;  3VT3 A;  1PQ6 A;  1BSX A;  1SJ0 A;  3OOF A;  4DMA A;  3VTC A;  5KD9 A;  1XNX A;  2YLY A;  2HWQ A;  3CS6 A;  4YNK A;  1I7G A;  3B1M A;  3OMQ A;  5DXM A;  3UP3 A;  3FAL A;  5DX3 A;  2YAT A;  4NB6 A;  1XNN A;  4MG8 A;  1XLS E;  3ADU A;  3MNO A;  5L11 A;  2ZMH A;  2IHQ A;  3HQ5 A;  5DUG A;  2QH6 A;  4RZE A;  1IE8 A;  3OS8 A;  3VJH A;  5KRC A;  2AWH A;  1XB7 A;  2FVJ A;  2Q60 A;  3D6D A;  1TXI A;  4MGD A;  3VN2 A;  2Q7K A;  2QA8 A;  2ZFX A;  5G5W A;  3S9S A;  1RDT D;  1NRL A;  2ACL A;  2JJ3 A;  2R6W A;  2YJD A;  1L2I A;  1WM0 X;  3ADT A;  5B5B A;  4J24 A;  1YYE A;  2NV7 A;  4LNW A;  3E7C A;  5DXB B;  4XHD A;  3ZRA A;  2PNU A;  2BJ4 B;  1Y0S A;  5ACC A;  5DU5 A;  3W5T A;  3WWR A;  5HJP B;  3A9E A;  4PWL A;  5DMC A;  1QKT A;  3VJS A;  3MNE A;  2B50 A;  1RK3 A;  1XIU A;  3OS9 A;  2Q3Y A;  2QGT A;  3A40 X;  2AX8 A;  4IA2 A;  2P15 A;  3ET1 A;  5DXQ A;  5AVI A;  3DR1 A;  3OMO A;  3GD2 A;  1FBY A;  3R8D A;  4G1D A;  4YPQ A;  4MGB B;  5EIT A;  2OVH A;  1EXX A;  4OZR E;  4UDA A;  3R8A A;  4RMC A;  1K74 D;  5KCU A;  5DVV A;  3E00 A;  3ET2 A;  3OSA A;  2Q5G A;  1HJ1 A;  2ZK6 A;  5AK2 A;  5FQP A;  4YT1 A;  1NHZ A;  3AZ1 A;  4MG9 A;  1XJ7 A;  1E3K A;  4RZF A;  5C4O A;  3VRW A;  1YY4 A;  3CDP A;  3D5F A;  4DOR A;  5JJM B;  1YIM A;  4XUM A;  4JYH A;  2YLP A;  1UHL B;  3FS1 A;  1UOM A;  3V3E A;  1GWR A;  4IVY A;  3UUD A;  5AAV B;  5KCF A;  3OAP A;  5DV3 A;  5KR9 A;  4J26 A;  3VHU A;  5H1E A;  1ERR A;  3GN8 A;  5DVS A;  1YJE A;  4ITF A;  5M96 A;  2ZBS A;  3DZU A;  2B23 A;  5F9B A;  3P8X A;  5DI7 A;  3L0E A;  1EXA A;  1A52 A;  1X7B A;  3PO9 A;  1ZDU A;  3W0Y A;  2PIN A;  1QKM A;  3L3Z A;  4P6W A;  4RUJ A;  4XI3 A;  4QE6 A;  3FEI A;  4APU A;  2GTK A;  5EJV A;  1PK5 A;  1OVL B;  2Q5P A;  3FAL B;  3KMR A;  4TV1 A;  3L1B A;  4MG8 B;  4S0T A;  5DK9 A;  1DKF A;  3W5Q A;  5DY8 A;  1G5Y A;  3WJ4 A;  3DCT A;  3RLL A;  2VV2 A;  1Z5X U;  2F4B A;  2GIU A;  2PIQ A;  4JL4 A;  2HC4 A;  2ZVT A;  4PP6 A;  4XUH A;  5DZI A;  2PIX A;  5LWP A;  3WT6 A;  3OKH A;  1N46 A;  2QA8 B;  2VV0 A;  1N83 A;  1T7R A;  1P93 A;  1GS4 A;  1S9Q A;  3M7R A;  3QT0 A;  2QZO A;  5DZ1 A;  3L3X A;  1RKG A;  2E2R A;  3IPS A;  1GWQ A;  3W0J A;  3KWY A;  4IU7 A;  2FAI A;  1X7J A;  2I4P A;  5DRJ A;  1LBD A;  1MV9 A;  1ZH7 A;  2W8Y A;  3A9E B;  2PRG A;  5DIG A;  5DYD A;  3B5R A;  2PIT A;  3AZ3 A;  3GZ9 A;  3SP6 A;  3VSO A;  3VJI A;  1OSH A;  3E00 D;  1HG4 A;  2REW A;  4G1Y A;  1XP1 A;  3R5N A;  4DK7 A;  4FHH A;  2H77 A;  4OGH A;  2P1U A;  1T7M A;  2AYR A;  2QXS A;  3B0W A;  4OIV A;  2ZNO A;  1XVP A;  4MG6 A;  3RY9 A;  3IXP A;  2POG A;  3A78 A;  1NQ2 A;  1XQC A;  4X1G A;  3OSW A;  5AZT A;  5HYK A;  3CJW A;  3H52 A;  3B0R A;  2Z4J A;  3AN3 A;  3HVL A;  3MNP A;  5E1C A;  4R06 A;  5AYG A;  2ZKC A;  2AO6 A;  2OAX A;  2ZK3 A;  2ZK5 A;  4MG9 B;  4QJR A;  5IAW A;  1XQ3 A;  4ZO1 B;  3JZB A;  2HWR A;  2PIW A;  3VSP A;  4G2H A;  4OKT A;  2ZLA A;  4A4W A;  3HOD A;  3B65 A;  3KDU A;  4PVU A;  5DKG A;  3VT5 A;  5KCC A;  4IQR A;  1Y9R A;  3GYT A;  2AMB A;  4OEY A;  4OJ9 A;  3WT5 A;  1NDE A;  5KRI A;  4JGV A;  3PLZ A;  4ZNW A;  1U9E A;  1G1U A;  5DUH A;  5DZH A;  5G45 A;  5B41 A;  3X1I A;  3B68 A;  3X31 A;  5EGV A;  4ZNV A;  2ZXN A;  1X78 A;  1YA3 A;  3VRU A;  1S0Z A;  4PP5 A;  3T03 A;  5DX3 B;  4ITE A;  5L7E A;  1XDK A;  1P8D A;  4Y29 A;  4TV1 B;  3SP9 A;  2GPV A;  3RLJ A;  1DKF B;  1T65 A;  5E15 A;  3HLV A;  1T74 A;  4QL8 A;  5DP0 A;  2R6Y A;  5KCE A;  2NXX A;  2YLO A;  3OOK A;  4POJ A;  3KMZ A;  3CS4 A;  3FC6 A;  2OM9 A;  2Q6R A;  3O1D A;  4LSJ A;  5KCT A;  3A2J A;  4RMD A;  5GIE A;  3AN4 A;  3JZC A;  4QK4 A;  2Q7L A;  5KRL A;  3IA6 A;  2VV3 A;  4OH5 A;  3F5C A;  3WGP A;  1R1K A;  3HC5 A;  2ZK0 A;  3OSI A;  4KZJ A;  2EWP A;  2Z4B A;  1N4H A;  1Z5X E;  3TKM A;  5AZV A;  3HO0 A;  4M8E A;  2QZO B;  3KBA A;  5A86 A;  4OJ4 A;  2QTU A;  2QSE A;  5DWL A;  2Q6J A;  3IXP D;  3NSP A;  3CQV A;  4PLE A;  5DKS A;  2G5O A;  4ZNT A;  4IUI A;  4LTW A;  4WQP A;  5ETH A;  4G21 A;  1XP9 A;  3K6P A;  4J5W C;  3FXV A;  4RUP A;  3DCU A;  4OKW A;  3ERD A;  3GYU A;  4IA1 A;  3B0T A;  3Q95 A;  5CJ6 A;  5DL4 A;  4POH A;  5K13 A;  3VRV A;  4G20 A;  1MZN A;  1XVP B;  1ERE A;  1KKQ A;  4IW8 A;  2I4J A;  3GWS X;  4IV4 A;  5ICK A;  1G2N A;  4Q0A C;  4ZN9 A;  2BAW A;  4JYI A;  4JYG A;  3RVF A;  4MDD A;  3PBA A;  3W0C A;  4OIU A;  5DTV A;  2NPA A;  4WHG A;  4RZG A;  2A3I A;  5FQR A;  1X7E A;  1ZGY A;  2AXA A;  3KMG A;  5EI1 A;  3VRT A;  1X7R A;  3AUR A;  1I38 A;  2B1V A;  1H9U A;  1Z95 A;  5DWI A;  5DKB A;  2G0G A;  1NAX A;  1PZL A;  2HAM A;  2Q61 A;  2GP7 A;  3ADS A;  2ZXM A;  1NUO A;  3CDS A;  5KRK A;  3A3Z X;  2AA6 A;  5APJ A;  2J7Y A;  2PIP L;  2P7A A;  3OZJ A;  3ET3 A;  4PXM A;  4R6S A;  5DXK A;  4DOS A;  2QE4 A;  4FHI A;  4K4J A;  2VV4 A;  4MGA A;  2ZK1 A;  2GPP A;  3OLF A;  3LMP A;  4RUO X;  4CI5 A;  1ILH A;  2ZLC A;  4IV2 A;  5DWJ A;  3ZR7 A;  1ZUC A;  1R1K D;  2HFP A;  1XDK B;  1IE9 A;  3KFC A;  3OZ0 A;  4EM9 A;  2OCF A;  3R29 A;  4ZNU A;  3WJ5 A;  2XYJ A;  4J5W A;  2QAB A;  4S15 A;  3X36 A;  4CI4 A;  3ERT A;  1YOW A;  3WT7 A;  3VI8 A;  1G50 A;  3FC6 B;  1S9P A;  4MGD B;  2I0J A;  4ZNS A;  5APH A;  4DM6 A;  1PQC A;  3VT7 A;  2GWX A;  3B3K A;  2V7C A;  4X1F A;  3SZ1 A;  5C4S A;  2FSZ A;  3AZ2 A;  2ACL B;  4WVD A;  4YMQ A;  3GWX A;  1RKH A;  5KYJ A;  1ZKY A;  2Q1H A;  4HLW A;  3VT6 A;  1XPC A;  2G44 A;  5G44 A;  5GT4 A;  4TUZ A;  3HC6 A;  5FQT A;  4S14 A;  3A2I A;  3CS8 A;  2IOK A;  4WHF A;  5DXP A;  3W5P A;  4PLD A;  1XV9 A;  2XYX A;  4WLB A;  4OEA A;  2NW4 A;  2PIV A;  3NOA A;  4XTA A;  3W0G A;  4REF A;  3UVV A;  1XLS A;  4KZM A;  4RWV A;  2LBD A;  4ONI A;  3PCU A;  2AAX A;  1VJB A;  1OT7 A;  4XAO A;  2ZNP A;  4PRG A;  5HYR A;  5DXR A;  2P7G A;  3G8I A;  4NQA B;  3Q95 B;  3R8I A;  3IPU A;  4OFU A;  2R40 A;  3VTB A;  4QM0 A;  3FUG A;  5DXB A;  1NYX A;  4QE8 A;  5DXG A;  3AFR A;  1R5K A;  2HAS A;  3FLI A;  3KYT A;  4LBD A;  4PP3 A;  2P4Y A;  4MGC A;  1FM6 A;  4OH6 A;  1Y0X X;  4OLM A;  2JF9 A;  3CTB A;  3UUA A;  1S19 A;  3RUT A;  3U9Q A;  3DZU D;  1I7I A;  3VT4 A;  3TX7 B;  1NQ1 A;  2QGW A;  4WPF A;  4ZI1 A;  2O4R A;  1E3G A;  4RE8 A;  2HB7 A;  3ZQT A;  5C4U A;  3AUN A;  5DUE A;  3UUD B;  5LGA A;  2AX7 A;  3L0J A;  4ZN7 A;  2ZNQ A;  3V9T A;  4A2J A;  2XKW A;  1SKX A;  3ADX A;  5L7G A;  2AM9 A;  1T7F A;  2YHD A;  2JFA A;  3DT3 A;  2AB2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...