1NDEA

Estrogen receptor beta with selective triazine modulator
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
240
structure length
231
Chain Sequence
DALSPEQLVLTLLEAEPPHVLISRPSFTEASMMMSLTKLADKELVHMISWAKKIPGFVELSLFDQVRLLESCWMEVLMMGLMWRSIDHPGKLIFAPDLVLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVKAMILLNSSMYATQDADSSRKLAHLLNAVTDALVWVIAKSGISSQQQSMRLANLLMLLSHVRHASNKGMEHLLNMKCKPVYDLLLEMLNAHVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A New Series of Estrogen Receptor Modulators That Display Selectivity for Estrogen Receptor beta
pubmed doi rcsb
molecule keywords Estrogen receptor beta
molecule tags Transcription
source organism Homo sapiens
total genus 71
structure length 231
sequence length 240
ec nomenclature
pdb deposition date 2002-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 1ndeA00
3B3KA 4XTAA 1PK5A 1X7EA 3HO0A 2ZNQA 3ILZA 3FS1A 2REWA 5DI7A 5APHA 2V7CA 2JJ3A 5ETHA 3R29A 4PLEA 4QE6A 3PCUA 3RLJA 2HVCA 2Q61A 4MGCA 3W5RA 1UOMA 2BJ4B 1I7GA 5KRJA 3BQDA 2ZBSA 5B5BA 2PIQA 3UUAB 1R6GA 2R6WA 4ZJRA 2GP7A 3VTCA 3B0QA 3FEIA 5DXKA 4FN9A 4YMQA 1A52A 2OVHA 1XOWA 2AA2A 1YUCA 5C4SA 3AN4A 1G1UA 2PIWA 1U3QA 3OMOA 4ZN9A 2PRGA 2P7ZA 4ZNWA 3V49A 2I0GA 4PVUA 2ACLA 2JF9A 3HC6A 5HYRA 5L11A 2G5OA 2PITA 3IMYA 5KRLA 2AXAA 2LBDA 4ZOMA 1XQ3A 3ADSA 4KZMA 4QM0A 4OILA 4ZI1A 2R40D 3HVLA 3H0AA 4P6XA 2GPVA 4OHAA 3P8XA 4RWVA 4Q0AC 1XVPB 5APJA 1RDTA 5FQRA 3RY9A 2Q59A 1K74A 4OKWA 4REFA 3ZR7A 3NSPA 1QKTA 3S9SA 3CLDA 3FALA 2Q3YA 3OKIA 3VJIA 2J7XA 1MVCA 1NQ0A 1FM9D 2QE4A 3O1DA 2Q60A 3OS9A 1NAXA 1YOKA 3M7RA 3VJSA 3ZQTA 1X76A 2QSEA 5DUEA 3W0JA 3UP0A 1DKFB 3SP6A 5K13A 1GWQA 4DORA 1TFCA 2ZL9A 4PPPA 4EMAA 1RKGA 2VV4A 4OZTU 1N4HA 1T7RA 4XI3A 5L7GA 4LTWA 3IPQA 2Q6JA 5DU5A 5DV8A 4OIUA 1ZKYA 2OVMA 4S14A 2JFAA 2ZMJA 4ZN7A 1LV2A 2ZY0A 3DZYA 1TXIA 2PKLA 4RMCA 5GICA 3UUDA 2YFEA 4FHIA 5DKEA 3R8IA 3OAPA 2QA6A 4M8EA 4NIEA 3FC6A 3UU7B 1GWRA 4A4VA 5AAVA 3SP9A 1X7JA 3A2HA 3ADUA 2QMVA 3IPUA 2YHDA 3IA6A 3G9EA 2A3IA 3F7DA 2I4PA 4PF3A 3WFGA 3MNEA 2H79A 3W0GA 2GPPA 3OMPA 4G1YA 4MG9A 4OGHA 3UUCA 5JJMB 2W8YA 5KRFA 4OFUA 1NDEA 5DRMA 1OSVA 1XNXA 4IWCA 5DIDA 3VJHA 5GIEA 4X1FA 4ZNHA 4OH6A 1T7MA 2Q1VA 3VHUA 2I4JA 4OC7A 2QGTA 3E7CA 4PWLA 5KROA 1U3SA 1Y0SA 1P8DA 5DMCA 1LBDA 1N46A 3D57A 2NXXE 5DKGA 3VRTA 2AA7A 3VHVA 5DXPA 4ONIA 1YOWA 1OT7A 5IXKA 1XP6A 1R20A 3HZFA 4J5WA 1OVLB 4CI5A 5HJPB 3ET3A 5KCFA 4IW6A 5KCCA 5DXQA 4OEZA 2Q1HA 3FEJA 3F5CA 5B41A 4IVYA 2YJDA 1E3KA 3CJWA 4HLWA 4J24A 3ET1A 4O8FA 4POJA 4YPQA 2PIOA 5KRIA 4IA3A 1FM6A 3EYBA 4OEDA 3W0CA 1XLSE 2HARA 2Q7IA 4IA1A 2GL8A 5DIEA 3JZCA 3IXPD 4ITEA 4MG8B 5AYGA 4OJ4A 1T7TA 1UHLA 1ZAFA 1ILGA 1Z95A 1N83A 4J5XA 3BC5A 1YJEA 4K4JA 2HWQA 2VV2A 3RLLA 4JYIA 4KZJA 4MG6A 4WQPA 3K22A 3B66A 1I37A 1KV6A 3FALB 3X36A 2XYJA 3D6DA 5IZ0A 3UP3A 4DM6A 4RZEA 2HASA 1S0ZA 4IS8A 4ZNTA 3OOKA 5KYAA 4NY9A 4YNKA 3K23A 2VSTA 1T7FA 3MNOA 5G5WA 4IWFA 3VT6A 3AZ3A 1QKUA 1ZDUA 3E94A 4REEA 2QH6A 5DX3B 3WT7A 2Q5GA 5E14A 3W0HA 5DMFA 4S0SA 2XHSA 2PNUA 1XB7A 3AZ1A 4UDBA 3QT0A 2AX7A 2JFAB 3O1EA 5KRAA 2HAMA 3WFFA 5LWPA 1R5KA 4MG7A 4ITFA 4IW8A 3ERTA 3R8DA 2P7GA 3AUQA 3X1HA 5KRCA 3DY6A 1HJ1A 2EWPA 2FAIA 3TX7B 3E00A 4RZFA 2PJLA 4N5GA 2R40A 3HM1A 1YY4A 1PQ6A 2QR9A 1IE8A 4K6IA 1NUOA 4WLBA 5DXBA 4NUFA 1ZDTA 1ZUCA 4QK4A 5E0XA 5FQTA 5G44A 3OSAA 3SZ1A 3ADVA 3DR1A 3HC5A 1GWXA 1XDKB 2OCFA 3OLSA 2E2RA 1FCZA 3WT6A 5ACCA 5KYJA 1X78A 4TV1A 3VI8A 1XQCA 2P7AA 4IA2A 2P15A 3OKHA 4L98A 5C4UA 2Q70A 5KCUA 3FUGA 5DKSA 2ZNNA 3GYTA 3CS4A 3GWXA 3W0AA 1L2IA 3ADWA 2ABIA 3KMZA 1K4WA 1X7RA 4IV4A 4IV2A 1U9EA 4HEEX 2YLYA 2H77A 1SJ0A 3VT7A 3VT3A 4A4WA 4OARA 3DZUA 4N1YA 3OS8A 3WGPA 4G1ZA 4LNWA 1PDUA 5AZTA 5G42A 3FXVA 4TUZA 1T65A 3X31A 3AX8A 1ZEOA 2GPUA 4OZRU 4MGDA 3UVVA 3F5CB 1Z5XU 4OK1A 3WTQA 5KD9A 1K7LA 4OIVA 4E4KA 4IQRA 3U9QA 1I38A 3CDPA 2HFPA 5C4TA 1EXXA 1KNUA 4G1DA 4MGBA 2ATHA 3OOFA 4OJBA 1OSHA 4QJRA 5DIGA 2Q7LA 2P4YA 1G2NA 2AYRA 2QZOB 3A2JA 3CWDA 1EREA 1UHLB 2QTUA 4YT1A 3VRVA 1PCGA 1T76A 4ZO1B 2B1VA 5E7VA 1S9PA 5AVLA 3ZRBA 2HB8A 3ERDA 2YLQA 4CSJA 5HZCA 3LBDA 2HC4A 2VSRA 4J5XC 3HQ5A 4R2UA 5CJ6A 2QA8B 2Z4JA 5I4VA 1BSXA 4PPSA 4RMEA 3P89A 2HWRA 3WWRA 5EGVA 4DK7A 3PRGA 5E19A 4IA7A 1XNNA 3KDTA 4OZTE 1SKXA 5G46A 3A9EA 3FLIA 5EITA 3X1IA 4S15A 5L7EA 4G20A 3NSQA 3FURA 2AMBA 2OZ7A 4QL8A 1R1KA 4S0TA 5KCDA 4RFWA 1XV9A 4MGAA 1RDTD 3Q95A 4WVDA 1XIUA 2QW4A 3L3ZA 4WPFA 5DKBA 3RUTA 2HCDA 3VT8A 2ZASA 1SQNA 1K74D 5G3JA 2G44A 2J7YA 2VV1A 3VSOA 3CS8A 5DK9A 4DMAA 1YYEA 2QABA 2ZKCA 5AAUA 1P93A 2P1TA 1QKMA 3B0TA 2AB2A 3B65A 4NB6A 3GWSX 1MZNA 2F4BA 4RMDA 2POBA 3L0EA 3OLFA 3UUAA 4F9MA 1YINA 3OGTA 4G21A 2O9IA 5DSHA 1NHZA 3W5PA 2ZLCA 5DWEA 4DOSA 1NYXA 5E0WA 2OUZA 4R6SA 4TV1B 4OLMA 2ACLB 1RJKA 2ZK6A 5DRJA 2AX9A 3L0JA 5HJSA 4ZJWA 5KRHA 2NXXA 1L2JA 4UDCA 1G50A 1XP9A 3V9YA 1FBYA 5ICKA 5DZHA 2NV7A 2QXMA 2AX6A 4PLDA 2FVJA 4KZIA 3A3ZX 4RUPA 4APUA 1M7WA 4ZNVA 1XJ7A 1HG4A 3GN8A 2VV0A 3R2AA 3W0YA 3B67A 4LNXA 3W5QA 4CI4A 1PZLA 2YATA 2Q59B 4N73A 1IE9A 1Y0XX 3B68A 1XLSA 1XVPA 3UVVB 2Q7JA 5KCWA 3KBAA 4RZGA 3GYUA 3IPSA 3ZRAA 1Q4XA 2NPAA 1DB1A 2QGWA 2B23A 2ZXZA 1XAPA 3B0WA 3ET2A 4XHDA 2B1ZA 2HB7A 2Q6SA 3V9TA 5AWJA 4OEYA 5G45A 5DXEA 2O4RA 1YMTA 2YLPA 3AUNA 3KMGA 5KR9A 5KCTA 3A2IA 2P54A 2Q5PA 3L0LA 2PINA 5GIDA 1FD0A 5GT4A 3HLVA 1E3GA 2VV4B 1T73A 3OMKA 2Q7KA 2QPYA 1S19A 4MDDA 4NQAB 4MG5A 1S0XA 4WHGA 1R20D 3L03A 3VT4A 5DL4A 3WJ5A 3UUDB 1FCXA 2ZXNA 4JGVA 5JY3A 2AA5A 3BEJA 3A9EB 3FC6B 1G5YA 2ZNOA 3W5TA 5AAVB 3K6PA 2ZK1A 5APKA 3DCTA 1PQCA 2GIUA 3VHWA 3A78A 4A2JA 5H1EA 4MGAB 2ZK5A 5DWLA 2GPOA 5AVIA 3HODA 3VRWA 1ERRA 1H9UA 3AURA 3JZBA 4G2IA 4MG9B 1XP1A 3P88A 2VV1B 2ZNPA 1NRLA 4P6WA 3PEQA 2ZMIA 1YA3A 3NOAA 4EM9A 3VTDA 4FHHA 5JJMA 1T79A 4DK8A 4DQMA 1FM9A 3T03A 3R8AA 1PQ9A 2G0GA 1S9QA 2OAXA 3OZ0A 1KKQA 5DLRA 4RAKA 2I0JA 2AMAA 4OKBA 4PP5A 5DZ3A 4IUIA 5DWJA 1T63A 3ET0A 3G8IA 2V0VA 3CQVA 3V9VA 2IOGA 4J5WC 2ZXMA 1UPVA 4XT9A 4UDAA 3VTBA 1OVLA 2AM9A 5JI0D 4JYGA 2XYXA 3TKCA 5KCEA 4L96A 3PBAA 3G0WA 3H52A 3KWYA 3OMQA 2BAWA 3E00D 2YJAB 1YIMA 2YLOA 4OZRE 1Z5XE 2PIUA 4RE8A 5DTVA 4FGYA 5DYBA 2P1UA 5KRMA 5FQPA 5G43A 5DWGA 3DT3A 2GWXA 1RK3A 3L3XA 3OZJA 4MG8A 4X1GA 5E15A 3VRUA 4R06A 1T74A 3D5FA 4LSJA 4OJ9A 5DUGA 4UDDA 2NW4A 1NQ2A 3LMPA 4IU7A 2AX8A 4OKXA 5E1CA 4ZO1X 5DY8A 3R5NA 2G0HA 5AK2A 5L7HA 1RKHA 4ZNUA 4XUHA 3W0IA 4B7WA 1NAVA 2I4ZA 5DXMA 4M8HA 3GD2A 4G2HA 3H0AD 2ZK3A 3DCUA 3DZUD 3TKMA 2OM9A 5DZ1A 3TY0A 4FNEA 4JYHA 3VSPA 5KRKA 3KMRA 5M96A 2AO6A 4N8RA 3L1BA 2J14A 5DX3A 2AWHA 1SR7A 1NQ1A 2ZK2A 4JL4A 5SYZA 1M13A 2Q8SA 4MG7B 5DUHA 3V3QA 2ZK0A 5AWKA 4PXMA 5FQSA 2FSZA 3OSIA 2ZMHA 3KPZA 1ZH7A 3KYTA 4IVWA 5HJPA 1QKNA 4Q50A 5A86A 3ADTA 4PP3A 3MNPA 3AFRA 5DXBB 2BJ4A 5DXGA 3IXPA 5DVCA 5C4OA 4WHFA 5DZIA 1XPCA 1M2ZA 1T5ZA 1VJBA 1XZXX 1YP0A 4Q13A 2ZFXA 2QNVA 3RUUA 5DVSA 5LGAA 4E2JA 3OLLA 1UPWA 4XAOA 2POGA 1ILHA 3CDSA 2VV3A 1XDKA 3OSWA 4K7AA 2QXSA 4DM8A 4BCRA 5DV3A 1ZGYA 2ZK4A 5EC9A 3WMHA 5DV6A 3DZYD 3PO9A 1A28A 4ZNSA 2R6YA 3CTBA 3VT5A 2B50A 2IHQA 2ZLAA 2HBHA 4PP6A 5DP0A 5AZVA 4POHA 3RVFA 3V4AA 5DWIA 3OS8C 5HCVA 2GTKA 2XKWA 1R1KD 4TUZB 1I7IA 1MV9A 1WM0X 5DYDA 3V3EA 3G8OA 4MGDB 2J4AA 3N00A 4XUMA 2PIVA 3B0RA 5DZ0A 4OKTA 4J26A 3B1MA 5EJVA 4MGBB 2P1VA 1X7BA 3ADXA 4RUJA 3CS6A 4PRGA 3VJTA 5DVVA 5DXRA 1Y9RA 4JAZA 3KDUA 2PIRA 2XYWA 2AAXA 3A40X 2QZOA 2Q6RA 3K8SA 2Q5SA 3GZ9A 2O4JA 1DKFA 3KFCA 3D24A 3PLZA 4RUOX 2PIPL 3VN2A 1FCYA 4Y29A 2IOKA 2ZVTA 5EI1A 5FQVA 1NQ7A 2QA8A 3D90A 2PIXA 3OMMA 4QE8A 4E4QA 3WT5A 4OH5A 3GBKA 1EXAA 3VT9A 4OFRA 1FM6D 5EHJA 5F9BA 1PRGA 5HYKA 3AZ2A 3B5RA 4OEAA 4XLDA 1U3RA 5IAWA 3UU7A 1XV9B 1GS4A 3R5MA 2Z4BA 3Q95B 3WJ4A 3P0UA 4LBDA 3AN3A 2AA6A
chains in the Genus database with same CATH superfamily
3B3KA 4XTAA 1PK5A 1X7EA 3HO0A 2ZNQA 3ILZA 3FS1A 2REWA 5DI7A 5APHA 2V7CA 2JJ3A 5ETHA 3R29A 4PLEA 4QE6A 3PCUA 3RLJA 2HVCA 2Q61A 4MGCA 3W5RA 1UOMA 2BJ4B 1I7GA 5KRJA 3BQDA 2ZBSA 5B5BA 2PIQA 3UUAB 1R6GA 2R6WA 4ZJRA 2GP7A 3VTCA 3B0QA 3FEIA 5DXKA 4FN9A 4YMQA 1A52A 2OVHA 1XOWA 2AA2A 1YUCA 5C4SA 3AN4A 1G1UA 2PIWA 1U3QA 3OMOA 4ZN9A 2PRGA 2P7ZA 4ZNWA 3V49A 2I0GA 4PVUA 2ACLA 2JF9A 3HC6A 5HYRA 5L11A 2G5OA 2PITA 3IMYA 5KRLA 2AXAA 2LBDA 4ZOMA 1XQ3A 3ADSA 4KZMA 4QM0A 4OILA 4ZI1A 2R40D 3HVLA 3H0AA 4P6XA 2GPVA 4OHAA 3P8XA 4RWVA 4Q0AC 1XVPB 5APJA 1RDTA 5FQRA 3RY9A 2Q59A 1K74A 4OKWA 4REFA 3ZR7A 3NSPA 1QKTA 3S9SA 3CLDA 3FALA 2Q3YA 3OKIA 3VJIA 2J7XA 1MVCA 1NQ0A 1FM9D 2QE4A 3O1DA 2Q60A 3OS9A 1NAXA 1YOKA 3M7RA 3VJSA 3ZQTA 1X76A 2QSEA 5DUEA 3W0JA 3UP0A 1DKFB 3SP6A 5K13A 1GWQA 4DORA 1TFCA 2ZL9A 4PPPA 4EMAA 1RKGA 2VV4A 4OZTU 1N4HA 1T7RA 4XI3A 5L7GA 4LTWA 3IPQA 2Q6JA 5DU5A 5DV8A 4OIUA 1ZKYA 2OVMA 4S14A 2JFAA 2ZMJA 4ZN7A 1LV2A 2ZY0A 3DZYA 1TXIA 2PKLA 4RMCA 5GICA 3UUDA 2YFEA 4FHIA 5DKEA 3R8IA 3OAPA 2QA6A 4M8EA 4NIEA 3FC6A 3UU7B 1GWRA 4A4VA 5AAVA 3SP9A 1X7JA 3A2HA 3ADUA 2QMVA 3IPUA 2YHDA 3IA6A 3G9EA 2A3IA 3F7DA 2I4PA 4PF3A 3WFGA 3MNEA 2H79A 3W0GA 2GPPA 3OMPA 4G1YA 4MG9A 4OGHA 3UUCA 5JJMB 2W8YA 5KRFA 4OFUA 1NDEA 5DRMA 1OSVA 1XNXA 4IWCA 5DIDA 3VJHA 5GIEA 4X1FA 4ZNHA 4OH6A 1T7MA 2Q1VA 3VHUA 2I4JA 4OC7A 2QGTA 3E7CA 4PWLA 5KROA 1U3SA 1Y0SA 1P8DA 5DMCA 1LBDA 1N46A 3D57A 2NXXE 5DKGA 3VRTA 2AA7A 3VHVA 5DXPA 4ONIA 1YOWA 1OT7A 5IXKA 1XP6A 1R20A 3HZFA 4J5WA 1OVLB 4CI5A 5HJPB 3ET3A 5KCFA 4IW6A 5KCCA 5DXQA 4OEZA 2Q1HA 3FEJA 3F5CA 5B41A 4IVYA 2YJDA 1E3KA 3CJWA 4HLWA 4J24A 3ET1A 4O8FA 4POJA 4YPQA 2PIOA 5KRIA 4IA3A 1FM6A 3EYBA 4OEDA 3W0CA 1XLSE 2HARA 2Q7IA 4IA1A 2GL8A 5DIEA 3JZCA 3IXPD 4ITEA 4MG8B 5AYGA 4OJ4A 1T7TA 1UHLA 1ZAFA 1ILGA 1Z95A 1N83A 4J5XA 3BC5A 1YJEA 4K4JA 2HWQA 2VV2A 3RLLA 4JYIA 4KZJA 4MG6A 4WQPA 3K22A 3B66A 1I37A 1KV6A 3FALB 3X36A 2XYJA 3D6DA 5IZ0A 3UP3A 4DM6A 4RZEA 2HASA 1S0ZA 4IS8A 4ZNTA 3OOKA 5KYAA 4NY9A 4YNKA 3K23A 2VSTA 1T7FA 3MNOA 5G5WA 4IWFA 3VT6A 3AZ3A 1QKUA 1ZDUA 3E94A 4REEA 2QH6A 5DX3B 3WT7A 2Q5GA 5E14A 3W0HA 5DMFA 4S0SA 2XHSA 2PNUA 1XB7A 3AZ1A 4UDBA 3QT0A 2AX7A 2JFAB 3O1EA 5KRAA 2HAMA 3WFFA 5LWPA 1R5KA 4MG7A 4ITFA 4IW8A 3ERTA 3R8DA 2P7GA 3AUQA 3X1HA 5KRCA 3DY6A 1HJ1A 2EWPA 2FAIA 3TX7B 3E00A 4RZFA 2PJLA 4N5GA 2R40A 3HM1A 1YY4A 1PQ6A 2QR9A 1IE8A 4K6IA 1NUOA 4WLBA 5DXBA 4NUFA 1ZDTA 1ZUCA 4QK4A 5E0XA 5FQTA 5G44A 3OSAA 3SZ1A 3ADVA 3DR1A 3HC5A 1GWXA 1XDKB 2OCFA 3OLSA 2E2RA 1FCZA 3WT6A 5ACCA 5KYJA 1X78A 4TV1A 3VI8A 1XQCA 2P7AA 4IA2A 2P15A 3OKHA 4L98A 5C4UA 2Q70A 5KCUA 3FUGA 5DKSA 2ZNNA 3GYTA 3CS4A 3GWXA 3W0AA 1L2IA 3ADWA 2ABIA 3KMZA 1K4WA 1X7RA 4IV4A 4IV2A 1U9EA 4HEEX 2YLYA 2H77A 1SJ0A 3VT7A 3VT3A 4A4WA 4OARA 3DZUA 4N1YA 3OS8A 3WGPA 4G1ZA 4LNWA 1PDUA 5AZTA 5G42A 3FXVA 4TUZA 1T65A 3X31A 3AX8A 1ZEOA 2GPUA 4OZRU 4MGDA 3UVVA 3F5CB 1Z5XU 4OK1A 3WTQA 5KD9A 1K7LA 4OIVA 4E4KA 4IQRA 3U9QA 1I38A 3CDPA 2HFPA 5C4TA 1EXXA 1KNUA 4G1DA 4MGBA 2ATHA 3OOFA 4OJBA 1OSHA 4QJRA 5DIGA 2Q7LA 2P4YA 1G2NA 2AYRA 2QZOB 3A2JA 3CWDA 1EREA 1UHLB 2QTUA 4YT1A 3VRVA 1PCGA 1T76A 4ZO1B 2B1VA 5E7VA 1S9PA 5AVLA 3ZRBA 2HB8A 3ERDA 2YLQA 4CSJA 5HZCA 3LBDA 2HC4A 2VSRA 4J5XC 3HQ5A 4R2UA 5CJ6A 2QA8B 2Z4JA 5I4VA 1BSXA 4PPSA 4RMEA 3P89A 2HWRA 3WWRA 5EGVA 4DK7A 3PRGA 5E19A 4IA7A 1XNNA 3KDTA 4OZTE 1SKXA 5G46A 3A9EA 3FLIA 5EITA 3X1IA 4S15A 5L7EA 4G20A 3NSQA 3FURA 2AMBA 2OZ7A 4QL8A 1R1KA 4S0TA 5KCDA 4RFWA 1XV9A 4MGAA 1RDTD 3Q95A 4WVDA 1XIUA 2QW4A 3L3ZA 4WPFA 5DKBA 3RUTA 2HCDA 3VT8A 2ZASA 1SQNA 1K74D 5G3JA 2G44A 2J7YA 2VV1A 3VSOA 3CS8A 5DK9A 4DMAA 1YYEA 2QABA 2ZKCA 5AAUA 1P93A 2P1TA 1QKMA 3B0TA 2AB2A 3B65A 4NB6A 3GWSX 1MZNA 2F4BA 4RMDA 2POBA 3L0EA 3OLFA 3UUAA 4F9MA 1YINA 3OGTA 4G21A 2O9IA 5DSHA 1NHZA 3W5PA 2ZLCA 5DWEA 4DOSA 1NYXA 5E0WA 2OUZA 4R6SA 4TV1B 4OLMA 2ACLB 1RJKA 2ZK6A 5DRJA 2AX9A 3L0JA 5HJSA 4ZJWA 5KRHA 2NXXA 1L2JA 4UDCA 1G50A 1XP9A 3V9YA 1FBYA 5ICKA 5DZHA 2NV7A 2QXMA 2AX6A 4PLDA 2FVJA 4KZIA 3A3ZX 4RUPA 4APUA 1M7WA 4ZNVA 1XJ7A 1HG4A 3GN8A 2VV0A 3R2AA 3W0YA 3B67A 4LNXA 3W5QA 4CI4A 1PZLA 2YATA 2Q59B 4N73A 1IE9A 1Y0XX 3B68A 1XLSA 1XVPA 3UVVB 2Q7JA 5KCWA 3KBAA 4RZGA 3GYUA 3IPSA 3ZRAA 1Q4XA 2NPAA 1DB1A 2QGWA 2B23A 2ZXZA 1XAPA 3B0WA 3ET2A 4XHDA 2B1ZA 2HB7A 2Q6SA 3V9TA 5AWJA 4OEYA 5G45A 5DXEA 2O4RA 1YMTA 2YLPA 3AUNA 3KMGA 5KR9A 5KCTA 3A2IA 2P54A 2Q5PA 3L0LA 2PINA 5GIDA 1FD0A 5GT4A 3HLVA 1E3GA 2VV4B 1T73A 3OMKA 2Q7KA 2QPYA 1S19A 4MDDA 4NQAB 4MG5A 1S0XA 4WHGA 1R20D 3L03A 3VT4A 5DL4A 3WJ5A 3UUDB 1FCXA 2ZXNA 4JGVA 5JY3A 2AA5A 3BEJA 3A9EB 3FC6B 1G5YA 2ZNOA 3W5TA 5AAVB 3K6PA 2ZK1A 5APKA 3DCTA 1PQCA 2GIUA 3VHWA 3A78A 4A2JA 5H1EA 4MGAB 2ZK5A 5DWLA 2GPOA 5AVIA 3HODA 3VRWA 1ERRA 1H9UA 3AURA 3JZBA 4G2IA 4MG9B 1XP1A 3P88A 2VV1B 2ZNPA 1NRLA 4P6WA 3PEQA 2ZMIA 1YA3A 3NOAA 4EM9A 3VTDA 4FHHA 5JJMA 1T79A 4DK8A 4DQMA 1FM9A 3T03A 3R8AA 1PQ9A 2G0GA 1S9QA 2OAXA 3OZ0A 1KKQA 5DLRA 4RAKA 2I0JA 2AMAA 4OKBA 4PP5A 5DZ3A 4IUIA 5DWJA 1T63A 3ET0A 3G8IA 2V0VA 3CQVA 3V9VA 2IOGA 4J5WC 2ZXMA 1UPVA 4XT9A 4UDAA 3VTBA 1OVLA 2AM9A 5JI0D 4JYGA 2XYXA 3TKCA 5KCEA 4L96A 3PBAA 3G0WA 3H52A 3KWYA 3OMQA 2BAWA 3E00D 2YJAB 1YIMA 2YLOA 4OZRE 1Z5XE 2PIUA 4RE8A 5DTVA 4FGYA 5DYBA 2P1UA 5KRMA 5FQPA 5G43A 5DWGA 3DT3A 2GWXA 1RK3A 3L3XA 3OZJA 4MG8A 4X1GA 5E15A 3VRUA 4R06A 1T74A 3D5FA 4LSJA 4OJ9A 5DUGA 4UDDA 2NW4A 1NQ2A 3LMPA 4IU7A 2AX8A 4OKXA 5E1CA 4ZO1X 5DY8A 3R5NA 2G0HA 5AK2A 5L7HA 1RKHA 4ZNUA 4XUHA 3W0IA 4B7WA 1NAVA 2I4ZA 5DXMA 4M8HA 3GD2A 4G2HA 3H0AD 2ZK3A 3DCUA 3DZUD 3TKMA 2OM9A 5DZ1A 3TY0A 4FNEA 4JYHA 3VSPA 5KRKA 3KMRA 5M96A 2AO6A 4N8RA 3L1BA 2J14A 5DX3A 2AWHA 1SR7A 1NQ1A 2ZK2A 4JL4A 5SYZA 1M13A 2Q8SA 4MG7B 5DUHA 3V3QA 2ZK0A 5AWKA 4PXMA 5FQSA 2FSZA 3OSIA 2ZMHA 3KPZA 1ZH7A 3KYTA 4IVWA 5HJPA 1QKNA 4Q50A 5A86A 3ADTA 4PP3A 3MNPA 3AFRA 5DXBB 2BJ4A 5DXGA 3IXPA 5DVCA 5C4OA 4WHFA 5DZIA 1XPCA 1M2ZA 1T5ZA 1VJBA 1XZXX 1YP0A 4Q13A 2ZFXA 2QNVA 3RUUA 5DVSA 5LGAA 4E2JA 3OLLA 1UPWA 4XAOA 2POGA 1ILHA 3CDSA 2VV3A 1XDKA 3OSWA 4K7AA 2QXSA 4DM8A 4BCRA 5DV3A 1ZGYA 2ZK4A 5EC9A 3WMHA 5DV6A 3DZYD 3PO9A 1A28A 4ZNSA 2R6YA 3CTBA 3VT5A 2B50A 2IHQA 2ZLAA 2HBHA 4PP6A 5DP0A 5AZVA 4POHA 3RVFA 3V4AA 5DWIA 3OS8C 5HCVA 2GTKA 2XKWA 1R1KD 4TUZB 1I7IA 1MV9A 1WM0X 5DYDA 3V3EA 3G8OA 4MGDB 2J4AA 3N00A 4XUMA 2PIVA 3B0RA 5DZ0A 4OKTA 4J26A 3B1MA 5EJVA 4MGBB 2P1VA 1X7BA 3ADXA 4RUJA 3CS6A 4PRGA 3VJTA 5DVVA 5DXRA 1Y9RA 4JAZA 3KDUA 2PIRA 2XYWA 2AAXA 3A40X 2QZOA 2Q6RA 3K8SA 2Q5SA 3GZ9A 2O4JA 1DKFA 3KFCA 3D24A 3PLZA 4RUOX 2PIPL 3VN2A 1FCYA 4Y29A 2IOKA 2ZVTA 5EI1A 5FQVA 1NQ7A 2QA8A 3D90A 2PIXA 3OMMA 4QE8A 4E4QA 3WT5A 4OH5A 3GBKA 1EXAA 3VT9A 4OFRA 1FM6D 5EHJA 5F9BA 1PRGA 5HYKA 3AZ2A 3B5RA 4OEAA 4XLDA 1U3RA 5IAWA 3UU7A 1XV9B 1GS4A 3R5MA 2Z4BA 3Q95B 3WJ4A 3P0UA 4LBDA 3AN3A 2AA6A
chains in the Genus database with same CATH topology
3B3KA 4XTAA 1PK5A 1X7EA 3HO0A 2ZNQA 3ILZA 3FS1A 2REWA 5DI7A 5APHA 2V7CA 2JJ3A 5ETHA 3R29A 4PLEA 4QE6A 3PCUA 3RLJA 2HVCA 2Q61A 4MGCA 3W5RA 1UOMA 2BJ4B 1I7GA 5KRJA 3BQDA 2ZBSA 5B5BA 2PIQA 3UUAB 1R6GA 2R6WA 4ZJRA 2GP7A 3VTCA 3B0QA 3FEIA 5DXKA 4FN9A 4YMQA 1A52A 2OVHA 1XOWA 2AA2A 1YUCA 5C4SA 3AN4A 1G1UA 2PIWA 1U3QA 3OMOA 4ZN9A 2PRGA 2P7ZA 4ZNWA 3V49A 2I0GA 4PVUA 2ACLA 2JF9A 3HC6A 5HYRA 5L11A 2G5OA 2PITA 3IMYA 5KRLA 2AXAA 2LBDA 4ZOMA 1XQ3A 3ADSA 4KZMA 4QM0A 4OILA 4ZI1A 2R40D 3HVLA 3H0AA 4P6XA 2GPVA 4OHAA 3P8XA 4RWVA 4Q0AC 1XVPB 5APJA 1RDTA 5FQRA 3RY9A 2Q59A 1K74A 4OKWA 4REFA 3ZR7A 3NSPA 1QKTA 3S9SA 3CLDA 3FALA 2Q3YA 3OKIA 3VJIA 2J7XA 1MVCA 1NQ0A 1FM9D 2QE4A 3O1DA 2Q60A 3OS9A 1NAXA 1YOKA 3M7RA 3VJSA 3ZQTA 1X76A 2QSEA 5DUEA 3W0JA 3UP0A 1DKFB 3SP6A 5K13A 1GWQA 4DORA 1TFCA 2ZL9A 4PPPA 4EMAA 1RKGA 2VV4A 4OZTU 1N4HA 1T7RA 4XI3A 5L7GA 4LTWA 3IPQA 2Q6JA 5DU5A 5DV8A 4OIUA 1ZKYA 2OVMA 4S14A 2JFAA 2ZMJA 4ZN7A 1LV2A 2ZY0A 3DZYA 1TXIA 2PKLA 4RMCA 5GICA 3UUDA 2YFEA 4FHIA 5DKEA 3R8IA 3OAPA 2QA6A 4M8EA 4NIEA 3FC6A 3UU7B 1GWRA 4A4VA 5AAVA 3SP9A 1X7JA 3A2HA 3ADUA 2QMVA 3IPUA 2YHDA 3IA6A 3G9EA 2A3IA 3F7DA 2I4PA 4PF3A 3WFGA 3MNEA 2H79A 3W0GA 2GPPA 3OMPA 4G1YA 4MG9A 4OGHA 3UUCA 5JJMB 2W8YA 5KRFA 4OFUA 1NDEA 5DRMA 1OSVA 1XNXA 4IWCA 5DIDA 3VJHA 5GIEA 4X1FA 4ZNHA 4OH6A 1T7MA 2Q1VA 3VHUA 2I4JA 4OC7A 2QGTA 3E7CA 4PWLA 5KROA 1U3SA 1Y0SA 1P8DA 5DMCA 1LBDA 1N46A 3D57A 2NXXE 5DKGA 3VRTA 2AA7A 3VHVA 5DXPA 4ONIA 1YOWA 1OT7A 5IXKA 1XP6A 1R20A 3HZFA 4J5WA 1OVLB 4CI5A 5HJPB 3ET3A 5KCFA 4IW6A 5KCCA 5DXQA 4OEZA 2Q1HA 3FEJA 3F5CA 5B41A 4IVYA 2YJDA 1E3KA 3CJWA 4HLWA 4J24A 3ET1A 4O8FA 4POJA 4YPQA 2PIOA 5KRIA 4IA3A 1FM6A 3EYBA 4OEDA 3W0CA 1XLSE 2HARA 2Q7IA 4IA1A 2GL8A 5DIEA 3JZCA 3IXPD 4ITEA 4MG8B 5AYGA 4OJ4A 1T7TA 1UHLA 1ZAFA 1ILGA 1Z95A 1N83A 4J5XA 3BC5A 1YJEA 4K4JA 2HWQA 2VV2A 3RLLA 4JYIA 4KZJA 4MG6A 4WQPA 3K22A 3B66A 1I37A 1KV6A 3FALB 3X36A 2XYJA 3D6DA 5IZ0A 3UP3A 4DM6A 4RZEA 2HASA 1S0ZA 4IS8A 4ZNTA 3OOKA 5KYAA 4NY9A 4YNKA 3K23A 2VSTA 1T7FA 3MNOA 5G5WA 4IWFA 3VT6A 3AZ3A 1QKUA 1ZDUA 3E94A 4REEA 2QH6A 5DX3B 3WT7A 2Q5GA 5E14A 3W0HA 5DMFA 4S0SA 2XHSA 2PNUA 1XB7A 3AZ1A 4UDBA 3QT0A 2AX7A 2JFAB 3O1EA 5KRAA 2HAMA 3WFFA 5LWPA 1R5KA 4MG7A 4ITFA 4IW8A 3ERTA 3R8DA 2P7GA 3AUQA 3X1HA 5KRCA 3DY6A 1HJ1A 2EWPA 2FAIA 3TX7B 3E00A 4RZFA 2PJLA 4N5GA 2R40A 3HM1A 1YY4A 1PQ6A 2QR9A 1IE8A 4K6IA 1NUOA 4WLBA 5DXBA 4NUFA 1ZDTA 1ZUCA 4QK4A 5E0XA 5FQTA 5G44A 3OSAA 3SZ1A 3ADVA 3DR1A 3HC5A 1GWXA 1XDKB 2OCFA 3OLSA 2E2RA 1FCZA 3WT6A 5ACCA 5KYJA 1X78A 4TV1A 3VI8A 1XQCA 2P7AA 4IA2A 2P15A 3OKHA 4L98A 5C4UA 2Q70A 5KCUA 3FUGA 5DKSA 2ZNNA 3GYTA 3CS4A 3GWXA 3W0AA 1L2IA 3ADWA 2ABIA 3KMZA 1K4WA 1X7RA 4IV4A 4IV2A 1U9EA 4HEEX 2YLYA 2H77A 1SJ0A 3VT7A 3VT3A 4A4WA 4OARA 3DZUA 4N1YA 3OS8A 3WGPA 4G1ZA 4LNWA 1PDUA 5AZTA 5G42A 3FXVA 4TUZA 1T65A 3X31A 3AX8A 1ZEOA 2GPUA 4OZRU 4MGDA 3UVVA 3F5CB 1Z5XU 4OK1A 3WTQA 5KD9A 1K7LA 4OIVA 4E4KA 4IQRA 3U9QA 1I38A 3CDPA 2HFPA 5C4TA 1EXXA 1KNUA 4G1DA 4MGBA 2ATHA 3OOFA 4OJBA 1OSHA 4QJRA 5DIGA 2Q7LA 2P4YA 1G2NA 2AYRA 2QZOB 3A2JA 3CWDA 1EREA 1UHLB 2QTUA 4YT1A 3VRVA 1PCGA 1T76A 4ZO1B 2B1VA 5E7VA 1S9PA 5AVLA 3ZRBA 2HB8A 3ERDA 2YLQA 4CSJA 5HZCA 3LBDA 2HC4A 2VSRA 4J5XC 3HQ5A 4R2UA 5CJ6A 2QA8B 2Z4JA 5I4VA 1BSXA 4PPSA 4RMEA 3P89A 2HWRA 3WWRA 5EGVA 4DK7A 3PRGA 5E19A 4IA7A 1XNNA 3KDTA 4OZTE 1SKXA 5G46A 3A9EA 3FLIA 5EITA 3X1IA 4S15A 5L7EA 4G20A 3NSQA 3FURA 2AMBA 2OZ7A 4QL8A 1R1KA 4S0TA 5KCDA 4RFWA 1XV9A 4MGAA 1RDTD 3Q95A 4WVDA 1XIUA 2QW4A 3L3ZA 4WPFA 5DKBA 3RUTA 2HCDA 3VT8A 2ZASA 1SQNA 1K74D 5G3JA 2G44A 2J7YA 2VV1A 3VSOA 3CS8A 5DK9A 4DMAA 1YYEA 2QABA 2ZKCA 5AAUA 1P93A 2P1TA 1QKMA 3B0TA 2AB2A 3B65A 4NB6A 3GWSX 1MZNA 2F4BA 4RMDA 2POBA 3L0EA 3OLFA 3UUAA 4F9MA 1YINA 3OGTA 4G21A 2O9IA 5DSHA 1NHZA 3W5PA 2ZLCA 5DWEA 4DOSA 1NYXA 5E0WA 2OUZA 4R6SA 4TV1B 4OLMA 2ACLB 1RJKA 2ZK6A 5DRJA 2AX9A 3L0JA 5HJSA 4ZJWA 5KRHA 2NXXA 1L2JA 4UDCA 1G50A 1XP9A 3V9YA 1FBYA 5ICKA 5DZHA 2NV7A 2QXMA 2AX6A 4PLDA 2FVJA 4KZIA 3A3ZX 4RUPA 4APUA 1M7WA 4ZNVA 1XJ7A 1HG4A 3GN8A 2VV0A 3R2AA 3W0YA 3B67A 4LNXA 3W5QA 4CI4A 1PZLA 2YATA 2Q59B 4N73A 1IE9A 1Y0XX 3B68A 1XLSA 1XVPA 3UVVB 2Q7JA 5KCWA 3KBAA 4RZGA 3GYUA 3IPSA 3ZRAA 1Q4XA 2NPAA 1DB1A 2QGWA 2B23A 2ZXZA 1XAPA 3B0WA 3ET2A 4XHDA 2B1ZA 2HB7A 2Q6SA 3V9TA 5AWJA 4OEYA 5G45A 5DXEA 2O4RA 1YMTA 2YLPA 3AUNA 3KMGA 5KR9A 5KCTA 3A2IA 2P54A 2Q5PA 3L0LA 2PINA 5GIDA 1FD0A 5GT4A 3HLVA 1E3GA 2VV4B 1T73A 3OMKA 2Q7KA 2QPYA 1S19A 4MDDA 4NQAB 4MG5A 1S0XA 4WHGA 1R20D 3L03A 3VT4A 5DL4A 3WJ5A 3UUDB 1FCXA 2ZXNA 4JGVA 5JY3A 2AA5A 3BEJA 3A9EB 3FC6B 1G5YA 2ZNOA 3W5TA 5AAVB 3K6PA 2ZK1A 5APKA 3DCTA 1PQCA 2GIUA 3VHWA 3A78A 4A2JA 5H1EA 4MGAB 2ZK5A 5DWLA 2GPOA 5AVIA 3HODA 3VRWA 1ERRA 1H9UA 3AURA 3JZBA 4G2IA 4MG9B 1XP1A 3P88A 2VV1B 2ZNPA 1NRLA 4P6WA 3PEQA 2ZMIA 1YA3A 3NOAA 4EM9A 3VTDA 4FHHA 5JJMA 1T79A 4DK8A 4DQMA 1FM9A 3T03A 3R8AA 1PQ9A 2G0GA 1S9QA 2OAXA 3OZ0A 1KKQA 5DLRA 4RAKA 2I0JA 2AMAA 4OKBA 4PP5A 5DZ3A 4IUIA 5DWJA 1T63A 3ET0A 3G8IA 2V0VA 3CQVA 3V9VA 2IOGA 4J5WC 2ZXMA 1UPVA 4XT9A 4UDAA 3VTBA 1OVLA 2AM9A 5JI0D 4JYGA 2XYXA 3TKCA 5KCEA 4L96A 3PBAA 3G0WA 3H52A 3KWYA 3OMQA 2BAWA 3E00D 2YJAB 1YIMA 2YLOA 4OZRE 1Z5XE 2PIUA 4RE8A 5DTVA 4FGYA 5DYBA 2P1UA 5KRMA 5FQPA 5G43A 5DWGA 3DT3A 2GWXA 1RK3A 3L3XA 3OZJA 4MG8A 4X1GA 5E15A 3VRUA 4R06A 1T74A 3D5FA 4LSJA 4OJ9A 5DUGA 4UDDA 2NW4A 1NQ2A 3LMPA 4IU7A 2AX8A 4OKXA 5E1CA 4ZO1X 5DY8A 3R5NA 2G0HA 5AK2A 5L7HA 1RKHA 4ZNUA 4XUHA 3W0IA 4B7WA 1NAVA 2I4ZA 5DXMA 4M8HA 3GD2A 4G2HA 3H0AD 2ZK3A 3DCUA 3DZUD 3TKMA 2OM9A 5DZ1A 3TY0A 4FNEA 4JYHA 3VSPA 5KRKA 3KMRA 5M96A 2AO6A 4N8RA 3L1BA 2J14A 5DX3A 2AWHA 1SR7A 1NQ1A 2ZK2A 4JL4A 5SYZA 1M13A 2Q8SA 4MG7B 5DUHA 3V3QA 2ZK0A 5AWKA 4PXMA 5FQSA 2FSZA 3OSIA 2ZMHA 3KPZA 1ZH7A 3KYTA 4IVWA 5HJPA 1QKNA 4Q50A 5A86A 3ADTA 4PP3A 3MNPA 3AFRA 5DXBB 2BJ4A 5DXGA 3IXPA 5DVCA 5C4OA 4WHFA 5DZIA 1XPCA 1M2ZA 1T5ZA 1VJBA 1XZXX 1YP0A 4Q13A 2ZFXA 2QNVA 3RUUA 5DVSA 5LGAA 4E2JA 3OLLA 1UPWA 4XAOA 2POGA 1ILHA 3CDSA 2VV3A 1XDKA 3OSWA 4K7AA 2QXSA 4DM8A 4BCRA 5DV3A 1ZGYA 2ZK4A 5EC9A 3WMHA 5DV6A 3DZYD 3PO9A 1A28A 4ZNSA 2R6YA 3CTBA 3VT5A 2B50A 2IHQA 2ZLAA 2HBHA 4PP6A 5DP0A 5AZVA 4POHA 3RVFA 3V4AA 5DWIA 3OS8C 5HCVA 2GTKA 2XKWA 1R1KD 4TUZB 1I7IA 1MV9A 1WM0X 5DYDA 3V3EA 3G8OA 4MGDB 2J4AA 3N00A 4XUMA 2PIVA 3B0RA 5DZ0A 4OKTA 4J26A 3B1MA 5EJVA 4MGBB 2P1VA 1X7BA 3ADXA 4RUJA 3CS6A 4PRGA 3VJTA 5DVVA 5DXRA 1Y9RA 4JAZA 3KDUA 2PIRA 2XYWA 2AAXA 3A40X 2QZOA 2Q6RA 3K8SA 2Q5SA 3GZ9A 2O4JA 1DKFA 3KFCA 3D24A 3PLZA 4RUOX 2PIPL 3VN2A 1FCYA 4Y29A 2IOKA 2ZVTA 5EI1A 5FQVA 1NQ7A 2QA8A 3D90A 2PIXA 3OMMA 4QE8A 4E4QA 3WT5A 4OH5A 3GBKA 1EXAA 3VT9A 4OFRA 1FM6D 5EHJA 5F9BA 1PRGA 5HYKA 3AZ2A 3B5RA 4OEAA 4XLDA 1U3RA 5IAWA 3UU7A 1XV9B 1GS4A 3R5MA 2Z4BA 3Q95B 3WJ4A 3P0UA 4LBDA 3AN3A 2AA6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B3K A;  4XTA A;  1PK5 A;  1X7E A;  3HO0 A;  2ZNQ A;  3ILZ A;  3FS1 A;  2REW A;  5DI7 A;  5APH A;  2V7C A;  2JJ3 A;  5ETH A;  3R29 A;  4PLE A;  4QE6 A;  3PCU A;  3RLJ A;  2HVC A;  2Q61 A;  4MGC A;  3W5R A;  1UOM A;  2BJ4 B;  1I7G A;  5KRJ A;  3BQD A;  2ZBS A;  5B5B A;  2PIQ A;  3UUA B;  1R6G A;  2R6W A;  4ZJR A;  2GP7 A;  3VTC A;  3B0Q A;  3FEI A;  5DXK A;  4FN9 A;  4YMQ A;  1A52 A;  2OVH A;  1XOW A;  2AA2 A;  1YUC A;  5C4S A;  3AN4 A;  1G1U A;  2PIW A;  1U3Q A;  3OMO A;  4ZN9 A;  2PRG A;  2P7Z A;  4ZNW A;  3V49 A;  2I0G A;  4PVU A;  2ACL A;  2JF9 A;  3HC6 A;  5HYR A;  5L11 A;  2G5O A;  2PIT A;  3IMY A;  5KRL A;  2AXA A;  2LBD A;  4ZOM A;  1XQ3 A;  3ADS A;  4KZM A;  4QM0 A;  4OIL A;  4ZI1 A;  2R40 D;  3HVL A;  3H0A A;  4P6X A;  2GPV A;  4OHA A;  3P8X A;  4RWV A;  4Q0A C;  1XVP B;  5APJ A;  1RDT A;  5FQR A;  3RY9 A;  2Q59 A;  1K74 A;  4OKW A;  4REF A;  3ZR7 A;  3NSP A;  1QKT A;  3S9S A;  3CLD A;  3FAL A;  2Q3Y A;  3OKI A;  3VJI A;  2J7X A;  1MVC A;  1NQ0 A;  1FM9 D;  2QE4 A;  3O1D A;  2Q60 A;  3OS9 A;  1NAX A;  1YOK A;  3M7R A;  3VJS A;  3ZQT A;  1X76 A;  2QSE A;  5DUE A;  3W0J A;  3UP0 A;  1DKF B;  3SP6 A;  5K13 A;  1GWQ A;  4DOR A;  1TFC A;  2ZL9 A;  4PPP A;  4EMA A;  1RKG A;  2VV4 A;  4OZT U;  1N4H A;  1T7R A;  4XI3 A;  5L7G A;  4LTW A;  3IPQ A;  2Q6J A;  5DU5 A;  5DV8 A;  4OIU A;  1ZKY A;  2OVM A;  4S14 A;  2JFA A;  2ZMJ A;  4ZN7 A;  1LV2 A;  2ZY0 A;  3DZY A;  1TXI A;  2PKL A;  4RMC A;  5GIC A;  3UUD A;  2YFE A;  4FHI A;  5DKE A;  3R8I A;  3OAP A;  2QA6 A;  4M8E A;  4NIE A;  3FC6 A;  3UU7 B;  1GWR A;  4A4V A;  5AAV A;  3SP9 A;  1X7J A;  3A2H A;  3ADU A;  2QMV A;  3IPU A;  2YHD A;  3IA6 A;  3G9E A;  2A3I A;  3F7D A;  2I4P A;  4PF3 A;  3WFG A;  3MNE A;  2H79 A;  3W0G A;  2GPP A;  3OMP A;  4G1Y A;  4MG9 A;  4OGH A;  3UUC A;  5JJM B;  2W8Y A;  5KRF A;  4OFU A;  1NDE A;  5DRM A;  1OSV A;  1XNX A;  4IWC A;  5DID A;  3VJH A;  5GIE A;  4X1F A;  4ZNH A;  4OH6 A;  1T7M A;  2Q1V A;  3VHU A;  2I4J A;  4OC7 A;  2QGT A;  3E7C A;  4PWL A;  5KRO A;  1U3S A;  1Y0S A;  1P8D A;  5DMC A;  1LBD A;  1N46 A;  3D57 A;  2NXX E;  5DKG A;  3VRT A;  2AA7 A;  3VHV A;  5DXP A;  4ONI A;  1YOW A;  1OT7 A;  5IXK A;  1XP6 A;  1R20 A;  3HZF A;  4J5W A;  1OVL B;  4CI5 A;  5HJP B;  3ET3 A;  5KCF A;  4IW6 A;  5KCC A;  5DXQ A;  4OEZ A;  2Q1H A;  3FEJ A;  3F5C A;  5B41 A;  4IVY A;  2YJD A;  1E3K A;  3CJW A;  4HLW A;  4J24 A;  3ET1 A;  4O8F A;  4POJ A;  4YPQ A;  2PIO A;  5KRI A;  4IA3 A;  1FM6 A;  3EYB A;  4OED A;  3W0C A;  1XLS E;  2HAR A;  2Q7I A;  4IA1 A;  2GL8 A;  5DIE A;  3JZC A;  3IXP D;  4ITE A;  4MG8 B;  5AYG A;  4OJ4 A;  1T7T A;  1UHL A;  1ZAF A;  1ILG A;  1Z95 A;  1N83 A;  4J5X A;  3BC5 A;  1YJE A;  4K4J A;  2HWQ A;  2VV2 A;  3RLL A;  4JYI A;  4KZJ A;  4MG6 A;  4WQP A;  3K22 A;  3B66 A;  1I37 A;  1KV6 A;  3FAL B;  3X36 A;  2XYJ A;  3D6D A;  5IZ0 A;  3UP3 A;  4DM6 A;  4RZE A;  2HAS A;  1S0Z A;  4IS8 A;  4ZNT A;  3OOK A;  5KYA A;  4NY9 A;  4YNK A;  3K23 A;  2VST A;  1T7F A;  3MNO A;  5G5W A;  4IWF A;  3VT6 A;  3AZ3 A;  1QKU A;  1ZDU A;  3E94 A;  4REE A;  2QH6 A;  5DX3 B;  3WT7 A;  2Q5G A;  5E14 A;  3W0H A;  5DMF A;  4S0S A;  2XHS A;  2PNU A;  1XB7 A;  3AZ1 A;  4UDB A;  3QT0 A;  2AX7 A;  2JFA B;  3O1E A;  5KRA A;  2HAM A;  3WFF A;  5LWP A;  1R5K A;  4MG7 A;  4ITF A;  4IW8 A;  3ERT A;  3R8D A;  2P7G A;  3AUQ A;  3X1H A;  5KRC A;  3DY6 A;  1HJ1 A;  2EWP A;  2FAI A;  3TX7 B;  3E00 A;  4RZF A;  2PJL A;  4N5G A;  2R40 A;  3HM1 A;  1YY4 A;  1PQ6 A;  2QR9 A;  1IE8 A;  4K6I A;  1NUO A;  4WLB A;  5DXB A;  4NUF A;  1ZDT A;  1ZUC A;  4QK4 A;  5E0X A;  5FQT A;  5G44 A;  3OSA A;  3SZ1 A;  3ADV A;  3DR1 A;  3HC5 A;  1GWX A;  1XDK B;  2OCF A;  3OLS A;  2E2R A;  1FCZ A;  3WT6 A;  5ACC A;  5KYJ A;  1X78 A;  4TV1 A;  3VI8 A;  1XQC A;  2P7A A;  4IA2 A;  2P15 A;  3OKH A;  4L98 A;  5C4U A;  2Q70 A;  5KCU A;  3FUG A;  5DKS A;  2ZNN A;  3GYT A;  3CS4 A;  3GWX A;  3W0A A;  1L2I A;  3ADW A;  2ABI A;  3KMZ A;  1K4W A;  1X7R A;  4IV4 A;  4IV2 A;  1U9E A;  4HEE X;  2YLY A;  2H77 A;  1SJ0 A;  3VT7 A;  3VT3 A;  4A4W A;  4OAR A;  3DZU A;  4N1Y A;  3OS8 A;  3WGP A;  4G1Z A;  4LNW A;  1PDU A;  5AZT A;  5G42 A;  3FXV A;  4TUZ A;  1T65 A;  3X31 A;  3AX8 A;  1ZEO A;  2GPU A;  4OZR U;  4MGD A;  3UVV A;  3F5C B;  1Z5X U;  4OK1 A;  3WTQ A;  5KD9 A;  1K7L A;  4OIV A;  4E4K A;  4IQR A;  3U9Q A;  1I38 A;  3CDP A;  2HFP A;  5C4T A;  1EXX A;  1KNU A;  4G1D A;  4MGB A;  2ATH A;  3OOF A;  4OJB A;  1OSH A;  4QJR A;  5DIG A;  2Q7L A;  2P4Y A;  1G2N A;  2AYR A;  2QZO B;  3A2J A;  3CWD A;  1ERE A;  1UHL B;  2QTU A;  4YT1 A;  3VRV A;  1PCG A;  1T76 A;  4ZO1 B;  2B1V A;  5E7V A;  1S9P A;  5AVL A;  3ZRB A;  2HB8 A;  3ERD A;  2YLQ A;  4CSJ A;  5HZC A;  3LBD A;  2HC4 A;  2VSR A;  4J5X C;  3HQ5 A;  4R2U A;  5CJ6 A;  2QA8 B;  2Z4J A;  5I4V A;  1BSX A;  4PPS A;  4RME A;  3P89 A;  2HWR A;  3WWR A;  5EGV A;  4DK7 A;  3PRG A;  5E19 A;  4IA7 A;  1XNN A;  3KDT A;  4OZT E;  1SKX A;  5G46 A;  3A9E A;  3FLI A;  5EIT A;  3X1I A;  4S15 A;  5L7E A;  4G20 A;  3NSQ A;  3FUR A;  2AMB A;  2OZ7 A;  4QL8 A;  1R1K A;  4S0T A;  5KCD A;  4RFW A;  1XV9 A;  4MGA A;  1RDT D;  3Q95 A;  4WVD A;  1XIU A;  2QW4 A;  3L3Z A;  4WPF A;  5DKB A;  3RUT A;  2HCD A;  3VT8 A;  2ZAS A;  1SQN A;  1K74 D;  5G3J A;  2G44 A;  2J7Y A;  2VV1 A;  3VSO A;  3CS8 A;  5DK9 A;  4DMA A;  1YYE A;  2QAB A;  2ZKC A;  5AAU A;  1P93 A;  2P1T A;  1QKM A;  3B0T A;  2AB2 A;  3B65 A;  4NB6 A;  3GWS X;  1MZN A;  2F4B A;  4RMD A;  2POB A;  3L0E A;  3OLF A;  3UUA A;  4F9M A;  1YIN A;  3OGT A;  4G21 A;  2O9I A;  5DSH A;  1NHZ A;  3W5P A;  2ZLC A;  5DWE A;  4DOS A;  1NYX A;  5E0W A;  2OUZ A;  4R6S A;  4TV1 B;  4OLM A;  2ACL B;  1RJK A;  2ZK6 A;  5DRJ A;  2AX9 A;  3L0J A;  5HJS A;  4ZJW A;  5KRH A;  2NXX A;  1L2J A;  4UDC A;  1G50 A;  1XP9 A;  3V9Y A;  1FBY A;  5ICK A;  5DZH A;  2NV7 A;  2QXM A;  2AX6 A;  4PLD A;  2FVJ A;  4KZI A;  3A3Z X;  4RUP A;  4APU A;  1M7W A;  4ZNV A;  1XJ7 A;  1HG4 A;  3GN8 A;  2VV0 A;  3R2A A;  3W0Y A;  3B67 A;  4LNX A;  3W5Q A;  4CI4 A;  1PZL A;  2YAT A;  2Q59 B;  4N73 A;  1IE9 A;  1Y0X X;  3B68 A;  1XLS A;  1XVP A;  3UVV B;  2Q7J A;  5KCW A;  3KBA A;  4RZG A;  3GYU A;  3IPS A;  3ZRA A;  1Q4X A;  2NPA A;  1DB1 A;  2QGW A;  2B23 A;  2ZXZ A;  1XAP A;  3B0W A;  3ET2 A;  4XHD A;  2B1Z A;  2HB7 A;  2Q6S A;  3V9T A;  5AWJ A;  4OEY A;  5G45 A;  5DXE A;  2O4R A;  1YMT A;  2YLP A;  3AUN A;  3KMG A;  5KR9 A;  5KCT A;  3A2I A;  2P54 A;  2Q5P A;  3L0L A;  2PIN A;  5GID A;  1FD0 A;  5GT4 A;  3HLV A;  1E3G A;  2VV4 B;  1T73 A;  3OMK A;  2Q7K A;  2QPY A;  1S19 A;  4MDD A;  4NQA B;  4MG5 A;  1S0X A;  4WHG A;  1R20 D;  3L03 A;  3VT4 A;  5DL4 A;  3WJ5 A;  3UUD B;  1FCX A;  2ZXN A;  4JGV A;  5JY3 A;  2AA5 A;  3BEJ A;  3A9E B;  3FC6 B;  1G5Y A;  2ZNO A;  3W5T A;  5AAV B;  3K6P A;  2ZK1 A;  5APK A;  3DCT A;  1PQC A;  2GIU A;  3VHW A;  3A78 A;  4A2J A;  5H1E A;  4MGA B;  2ZK5 A;  5DWL A;  2GPO A;  5AVI A;  3HOD A;  3VRW A;  1ERR A;  1H9U A;  3AUR A;  3JZB A;  4G2I A;  4MG9 B;  1XP1 A;  3P88 A;  2VV1 B;  2ZNP A;  1NRL A;  4P6W A;  3PEQ A;  2ZMI A;  1YA3 A;  3NOA A;  4EM9 A;  3VTD A;  4FHH A;  5JJM A;  1T79 A;  4DK8 A;  4DQM A;  1FM9 A;  3T03 A;  3R8A A;  1PQ9 A;  2G0G A;  1S9Q A;  2OAX A;  3OZ0 A;  1KKQ A;  5DLR A;  4RAK A;  2I0J A;  2AMA A;  4OKB A;  4PP5 A;  5DZ3 A;  4IUI A;  5DWJ A;  1T63 A;  3ET0 A;  3G8I A;  2V0V A;  3CQV A;  3V9V A;  2IOG A;  4J5W C;  2ZXM A;  1UPV A;  4XT9 A;  4UDA A;  3VTB A;  1OVL A;  2AM9 A;  5JI0 D;  4JYG A;  2XYX A;  3TKC A;  5KCE A;  4L96 A;  3PBA A;  3G0W A;  3H52 A;  3KWY A;  3OMQ A;  2BAW A;  3E00 D;  2YJA B;  1YIM A;  2YLO A;  4OZR E;  1Z5X E;  2PIU A;  4RE8 A;  5DTV A;  4FGY A;  5DYB A;  2P1U A;  5KRM A;  5FQP A;  5G43 A;  5DWG A;  3DT3 A;  2GWX A;  1RK3 A;  3L3X A;  3OZJ A;  4MG8 A;  4X1G A;  5E15 A;  3VRU A;  4R06 A;  1T74 A;  3D5F A;  4LSJ A;  4OJ9 A;  5DUG A;  4UDD A;  2NW4 A;  1NQ2 A;  3LMP A;  4IU7 A;  2AX8 A;  4OKX A;  5E1C A;  4ZO1 X;  5DY8 A;  3R5N A;  2G0H A;  5AK2 A;  5L7H A;  1RKH A;  4ZNU A;  4XUH A;  3W0I A;  4B7W A;  1NAV A;  2I4Z A;  5DXM A;  4M8H A;  3GD2 A;  4G2H A;  3H0A D;  2ZK3 A;  3DCU A;  3DZU D;  3TKM A;  2OM9 A;  5DZ1 A;  3TY0 A;  4FNE A;  4JYH A;  3VSP A;  5KRK A;  3KMR A;  5M96 A;  2AO6 A;  4N8R A;  3L1B A;  2J14 A;  5DX3 A;  2AWH A;  1SR7 A;  1NQ1 A;  2ZK2 A;  4JL4 A;  5SYZ A;  1M13 A;  2Q8S A;  4MG7 B;  5DUH A;  3V3Q A;  2ZK0 A;  5AWK A;  4PXM A;  5FQS A;  2FSZ A;  3OSI A;  2ZMH A;  3KPZ A;  1ZH7 A;  3KYT A;  4IVW A;  5HJP A;  1QKN A;  4Q50 A;  5A86 A;  3ADT A;  4PP3 A;  3MNP A;  3AFR A;  5DXB B;  2BJ4 A;  5DXG A;  3IXP A;  5DVC A;  5C4O A;  4WHF A;  5DZI A;  1XPC A;  1M2Z A;  1T5Z A;  1VJB A;  1XZX X;  1YP0 A;  4Q13 A;  2ZFX A;  2QNV A;  3RUU A;  5DVS A;  5LGA A;  4E2J A;  3OLL A;  1UPW A;  4XAO A;  2POG A;  1ILH A;  3CDS A;  2VV3 A;  1XDK A;  3OSW A;  4K7A A;  2QXS A;  4DM8 A;  4BCR A;  5DV3 A;  1ZGY A;  2ZK4 A;  5EC9 A;  3WMH A;  5DV6 A;  3DZY D;  3PO9 A;  1A28 A;  4ZNS A;  2R6Y A;  3CTB A;  3VT5 A;  2B50 A;  2IHQ A;  2ZLA A;  2HBH A;  4PP6 A;  5DP0 A;  5AZV A;  4POH A;  3RVF A;  3V4A A;  5DWI A;  3OS8 C;  5HCV A;  2GTK A;  2XKW A;  1R1K D;  4TUZ B;  1I7I A;  1MV9 A;  1WM0 X;  5DYD A;  3V3E A;  3G8O A;  4MGD B;  2J4A A;  3N00 A;  4XUM A;  2PIV A;  3B0R A;  5DZ0 A;  4OKT A;  4J26 A;  3B1M A;  5EJV A;  4MGB B;  2P1V A;  1X7B A;  3ADX A;  4RUJ A;  3CS6 A;  4PRG A;  3VJT A;  5DVV A;  5DXR A;  1Y9R A;  4JAZ A;  3KDU A;  2PIR A;  2XYW A;  2AAX A;  3A40 X;  2QZO A;  2Q6R A;  3K8S A;  2Q5S A;  3GZ9 A;  2O4J A;  1DKF A;  3KFC A;  3D24 A;  3PLZ A;  4RUO X;  2PIP L;  3VN2 A;  1FCY A;  4Y29 A;  2IOK A;  2ZVT A;  5EI1 A;  5FQV A;  1NQ7 A;  2QA8 A;  3D90 A;  2PIX A;  3OMM A;  4QE8 A;  4E4Q A;  3WT5 A;  4OH5 A;  3GBK A;  1EXA A;  3VT9 A;  4OFR A;  1FM6 D;  5EHJ A;  5F9B A;  1PRG A;  5HYK A;  3AZ2 A;  3B5R A;  4OEA A;  4XLD A;  1U3R A;  5IAW A;  3UU7 A;  1XV9 B;  1GS4 A;  3R5M A;  2Z4B A;  3Q95 B;  3WJ4 A;  3P0U A;  4LBD A;  3AN3 A;  2AA6 A; 
#chains in the Genus database with same CATH topology
 3B3K A;  4XTA A;  1PK5 A;  1X7E A;  3HO0 A;  2ZNQ A;  3ILZ A;  3FS1 A;  2REW A;  5DI7 A;  5APH A;  2V7C A;  2JJ3 A;  5ETH A;  3R29 A;  4PLE A;  4QE6 A;  3PCU A;  3RLJ A;  2HVC A;  2Q61 A;  4MGC A;  3W5R A;  1UOM A;  2BJ4 B;  1I7G A;  5KRJ A;  3BQD A;  2ZBS A;  5B5B A;  2PIQ A;  3UUA B;  1R6G A;  2R6W A;  4ZJR A;  2GP7 A;  3VTC A;  3B0Q A;  3FEI A;  5DXK A;  4FN9 A;  4YMQ A;  1A52 A;  2OVH A;  1XOW A;  2AA2 A;  1YUC A;  5C4S A;  3AN4 A;  1G1U A;  2PIW A;  1U3Q A;  3OMO A;  4ZN9 A;  2PRG A;  2P7Z A;  4ZNW A;  3V49 A;  2I0G A;  4PVU A;  2ACL A;  2JF9 A;  3HC6 A;  5HYR A;  5L11 A;  2G5O A;  2PIT A;  3IMY A;  5KRL A;  2AXA A;  2LBD A;  4ZOM A;  1XQ3 A;  3ADS A;  4KZM A;  4QM0 A;  4OIL A;  4ZI1 A;  2R40 D;  3HVL A;  3H0A A;  4P6X A;  2GPV A;  4OHA A;  3P8X A;  4RWV A;  4Q0A C;  1XVP B;  5APJ A;  1RDT A;  5FQR A;  3RY9 A;  2Q59 A;  1K74 A;  4OKW A;  4REF A;  3ZR7 A;  3NSP A;  1QKT A;  3S9S A;  3CLD A;  3FAL A;  2Q3Y A;  3OKI A;  3VJI A;  2J7X A;  1MVC A;  1NQ0 A;  1FM9 D;  2QE4 A;  3O1D A;  2Q60 A;  3OS9 A;  1NAX A;  1YOK A;  3M7R A;  3VJS A;  3ZQT A;  1X76 A;  2QSE A;  5DUE A;  3W0J A;  3UP0 A;  1DKF B;  3SP6 A;  5K13 A;  1GWQ A;  4DOR A;  1TFC A;  2ZL9 A;  4PPP A;  4EMA A;  1RKG A;  2VV4 A;  4OZT U;  1N4H A;  1T7R A;  4XI3 A;  5L7G A;  4LTW A;  3IPQ A;  2Q6J A;  5DU5 A;  5DV8 A;  4OIU A;  1ZKY A;  2OVM A;  4S14 A;  2JFA A;  2ZMJ A;  4ZN7 A;  1LV2 A;  2ZY0 A;  3DZY A;  1TXI A;  2PKL A;  4RMC A;  5GIC A;  3UUD A;  2YFE A;  4FHI A;  5DKE A;  3R8I A;  3OAP A;  2QA6 A;  4M8E A;  4NIE A;  3FC6 A;  3UU7 B;  1GWR A;  4A4V A;  5AAV A;  3SP9 A;  1X7J A;  3A2H A;  3ADU A;  2QMV A;  3IPU A;  2YHD A;  3IA6 A;  3G9E A;  2A3I A;  3F7D A;  2I4P A;  4PF3 A;  3WFG A;  3MNE A;  2H79 A;  3W0G A;  2GPP A;  3OMP A;  4G1Y A;  4MG9 A;  4OGH A;  3UUC A;  5JJM B;  2W8Y A;  5KRF A;  4OFU A;  1NDE A;  5DRM A;  1OSV A;  1XNX A;  4IWC A;  5DID A;  3VJH A;  5GIE A;  4X1F A;  4ZNH A;  4OH6 A;  1T7M A;  2Q1V A;  3VHU A;  2I4J A;  4OC7 A;  2QGT A;  3E7C A;  4PWL A;  5KRO A;  1U3S A;  1Y0S A;  1P8D A;  5DMC A;  1LBD A;  1N46 A;  3D57 A;  2NXX E;  5DKG A;  3VRT A;  2AA7 A;  3VHV A;  5DXP A;  4ONI A;  1YOW A;  1OT7 A;  5IXK A;  1XP6 A;  1R20 A;  3HZF A;  4J5W A;  1OVL B;  4CI5 A;  5HJP B;  3ET3 A;  5KCF A;  4IW6 A;  5KCC A;  5DXQ A;  4OEZ A;  2Q1H A;  3FEJ A;  3F5C A;  5B41 A;  4IVY A;  2YJD A;  1E3K A;  3CJW A;  4HLW A;  4J24 A;  3ET1 A;  4O8F A;  4POJ A;  4YPQ A;  2PIO A;  5KRI A;  4IA3 A;  1FM6 A;  3EYB A;  4OED A;  3W0C A;  1XLS E;  2HAR A;  2Q7I A;  4IA1 A;  2GL8 A;  5DIE A;  3JZC A;  3IXP D;  4ITE A;  4MG8 B;  5AYG A;  4OJ4 A;  1T7T A;  1UHL A;  1ZAF A;  1ILG A;  1Z95 A;  1N83 A;  4J5X A;  3BC5 A;  1YJE A;  4K4J A;  2HWQ A;  2VV2 A;  3RLL A;  4JYI A;  4KZJ A;  4MG6 A;  4WQP A;  3K22 A;  3B66 A;  1I37 A;  1KV6 A;  3FAL B;  3X36 A;  2XYJ A;  3D6D A;  5IZ0 A;  3UP3 A;  4DM6 A;  4RZE A;  2HAS A;  1S0Z A;  4IS8 A;  4ZNT A;  3OOK A;  5KYA A;  4NY9 A;  4YNK A;  3K23 A;  2VST A;  1T7F A;  3MNO A;  5G5W A;  4IWF A;  3VT6 A;  3AZ3 A;  1QKU A;  1ZDU A;  3E94 A;  4REE A;  2QH6 A;  5DX3 B;  3WT7 A;  2Q5G A;  5E14 A;  3W0H A;  5DMF A;  4S0S A;  2XHS A;  2PNU A;  1XB7 A;  3AZ1 A;  4UDB A;  3QT0 A;  2AX7 A;  2JFA B;  3O1E A;  5KRA A;  2HAM A;  3WFF A;  5LWP A;  1R5K A;  4MG7 A;  4ITF A;  4IW8 A;  3ERT A;  3R8D A;  2P7G A;  3AUQ A;  3X1H A;  5KRC A;  3DY6 A;  1HJ1 A;  2EWP A;  2FAI A;  3TX7 B;  3E00 A;  4RZF A;  2PJL A;  4N5G A;  2R40 A;  3HM1 A;  1YY4 A;  1PQ6 A;  2QR9 A;  1IE8 A;  4K6I A;  1NUO A;  4WLB A;  5DXB A;  4NUF A;  1ZDT A;  1ZUC A;  4QK4 A;  5E0X A;  5FQT A;  5G44 A;  3OSA A;  3SZ1 A;  3ADV A;  3DR1 A;  3HC5 A;  1GWX A;  1XDK B;  2OCF A;  3OLS A;  2E2R A;  1FCZ A;  3WT6 A;  5ACC A;  5KYJ A;  1X78 A;  4TV1 A;  3VI8 A;  1XQC A;  2P7A A;  4IA2 A;  2P15 A;  3OKH A;  4L98 A;  5C4U A;  2Q70 A;  5KCU A;  3FUG A;  5DKS A;  2ZNN A;  3GYT A;  3CS4 A;  3GWX A;  3W0A A;  1L2I A;  3ADW A;  2ABI A;  3KMZ A;  1K4W A;  1X7R A;  4IV4 A;  4IV2 A;  1U9E A;  4HEE X;  2YLY A;  2H77 A;  1SJ0 A;  3VT7 A;  3VT3 A;  4A4W A;  4OAR A;  3DZU A;  4N1Y A;  3OS8 A;  3WGP A;  4G1Z A;  4LNW A;  1PDU A;  5AZT A;  5G42 A;  3FXV A;  4TUZ A;  1T65 A;  3X31 A;  3AX8 A;  1ZEO A;  2GPU A;  4OZR U;  4MGD A;  3UVV A;  3F5C B;  1Z5X U;  4OK1 A;  3WTQ A;  5KD9 A;  1K7L A;  4OIV A;  4E4K A;  4IQR A;  3U9Q A;  1I38 A;  3CDP A;  2HFP A;  5C4T A;  1EXX A;  1KNU A;  4G1D A;  4MGB A;  2ATH A;  3OOF A;  4OJB A;  1OSH A;  4QJR A;  5DIG A;  2Q7L A;  2P4Y A;  1G2N A;  2AYR A;  2QZO B;  3A2J A;  3CWD A;  1ERE A;  1UHL B;  2QTU A;  4YT1 A;  3VRV A;  1PCG A;  1T76 A;  4ZO1 B;  2B1V A;  5E7V A;  1S9P A;  5AVL A;  3ZRB A;  2HB8 A;  3ERD A;  2YLQ A;  4CSJ A;  5HZC A;  3LBD A;  2HC4 A;  2VSR A;  4J5X C;  3HQ5 A;  4R2U A;  5CJ6 A;  2QA8 B;  2Z4J A;  5I4V A;  1BSX A;  4PPS A;  4RME A;  3P89 A;  2HWR A;  3WWR A;  5EGV A;  4DK7 A;  3PRG A;  5E19 A;  4IA7 A;  1XNN A;  3KDT A;  4OZT E;  1SKX A;  5G46 A;  3A9E A;  3FLI A;  5EIT A;  3X1I A;  4S15 A;  5L7E A;  4G20 A;  3NSQ A;  3FUR A;  2AMB A;  2OZ7 A;  4QL8 A;  1R1K A;  4S0T A;  5KCD A;  4RFW A;  1XV9 A;  4MGA A;  1RDT D;  3Q95 A;  4WVD A;  1XIU A;  2QW4 A;  3L3Z A;  4WPF A;  5DKB A;  3RUT A;  2HCD A;  3VT8 A;  2ZAS A;  1SQN A;  1K74 D;  5G3J A;  2G44 A;  2J7Y A;  2VV1 A;  3VSO A;  3CS8 A;  5DK9 A;  4DMA A;  1YYE A;  2QAB A;  2ZKC A;  5AAU A;  1P93 A;  2P1T A;  1QKM A;  3B0T A;  2AB2 A;  3B65 A;  4NB6 A;  3GWS X;  1MZN A;  2F4B A;  4RMD A;  2POB A;  3L0E A;  3OLF A;  3UUA A;  4F9M A;  1YIN A;  3OGT A;  4G21 A;  2O9I A;  5DSH A;  1NHZ A;  3W5P A;  2ZLC A;  5DWE A;  4DOS A;  1NYX A;  5E0W A;  2OUZ A;  4R6S A;  4TV1 B;  4OLM A;  2ACL B;  1RJK A;  2ZK6 A;  5DRJ A;  2AX9 A;  3L0J A;  5HJS A;  4ZJW A;  5KRH A;  2NXX A;  1L2J A;  4UDC A;  1G50 A;  1XP9 A;  3V9Y A;  1FBY A;  5ICK A;  5DZH A;  2NV7 A;  2QXM A;  2AX6 A;  4PLD A;  2FVJ A;  4KZI A;  3A3Z X;  4RUP A;  4APU A;  1M7W A;  4ZNV A;  1XJ7 A;  1HG4 A;  3GN8 A;  2VV0 A;  3R2A A;  3W0Y A;  3B67 A;  4LNX A;  3W5Q A;  4CI4 A;  1PZL A;  2YAT A;  2Q59 B;  4N73 A;  1IE9 A;  1Y0X X;  3B68 A;  1XLS A;  1XVP A;  3UVV B;  2Q7J A;  5KCW A;  3KBA A;  4RZG A;  3GYU A;  3IPS A;  3ZRA A;  1Q4X A;  2NPA A;  1DB1 A;  2QGW A;  2B23 A;  2ZXZ A;  1XAP A;  3B0W A;  3ET2 A;  4XHD A;  2B1Z A;  2HB7 A;  2Q6S A;  3V9T A;  5AWJ A;  4OEY A;  5G45 A;  5DXE A;  2O4R A;  1YMT A;  2YLP A;  3AUN A;  3KMG A;  5KR9 A;  5KCT A;  3A2I A;  2P54 A;  2Q5P A;  3L0L A;  2PIN A;  5GID A;  1FD0 A;  5GT4 A;  3HLV A;  1E3G A;  2VV4 B;  1T73 A;  3OMK A;  2Q7K A;  2QPY A;  1S19 A;  4MDD A;  4NQA B;  4MG5 A;  1S0X A;  4WHG A;  1R20 D;  3L03 A;  3VT4 A;  5DL4 A;  3WJ5 A;  3UUD B;  1FCX A;  2ZXN A;  4JGV A;  5JY3 A;  2AA5 A;  3BEJ A;  3A9E B;  3FC6 B;  1G5Y A;  2ZNO A;  3W5T A;  5AAV B;  3K6P A;  2ZK1 A;  5APK A;  3DCT A;  1PQC A;  2GIU A;  3VHW A;  3A78 A;  4A2J A;  5H1E A;  4MGA B;  2ZK5 A;  5DWL A;  2GPO A;  5AVI A;  3HOD A;  3VRW A;  1ERR A;  1H9U A;  3AUR A;  3JZB A;  4G2I A;  4MG9 B;  1XP1 A;  3P88 A;  2VV1 B;  2ZNP A;  1NRL A;  4P6W A;  3PEQ A;  2ZMI A;  1YA3 A;  3NOA A;  4EM9 A;  3VTD A;  4FHH A;  5JJM A;  1T79 A;  4DK8 A;  4DQM A;  1FM9 A;  3T03 A;  3R8A A;  1PQ9 A;  2G0G A;  1S9Q A;  2OAX A;  3OZ0 A;  1KKQ A;  5DLR A;  4RAK A;  2I0J A;  2AMA A;  4OKB A;  4PP5 A;  5DZ3 A;  4IUI A;  5DWJ A;  1T63 A;  3ET0 A;  3G8I A;  2V0V A;  3CQV A;  3V9V A;  2IOG A;  4J5W C;  2ZXM A;  1UPV A;  4XT9 A;  4UDA A;  3VTB A;  1OVL A;  2AM9 A;  5JI0 D;  4JYG A;  2XYX A;  3TKC A;  5KCE A;  4L96 A;  3PBA A;  3G0W A;  3H52 A;  3KWY A;  3OMQ A;  2BAW A;  3E00 D;  2YJA B;  1YIM A;  2YLO A;  4OZR E;  1Z5X E;  2PIU A;  4RE8 A;  5DTV A;  4FGY A;  5DYB A;  2P1U A;  5KRM A;  5FQP A;  5G43 A;  5DWG A;  3DT3 A;  2GWX A;  1RK3 A;  3L3X A;  3OZJ A;  4MG8 A;  4X1G A;  5E15 A;  3VRU A;  4R06 A;  1T74 A;  3D5F A;  4LSJ A;  4OJ9 A;  5DUG A;  4UDD A;  2NW4 A;  1NQ2 A;  3LMP A;  4IU7 A;  2AX8 A;  4OKX A;  5E1C A;  4ZO1 X;  5DY8 A;  3R5N A;  2G0H A;  5AK2 A;  5L7H A;  1RKH A;  4ZNU A;  4XUH A;  3W0I A;  4B7W A;  1NAV A;  2I4Z A;  5DXM A;  4M8H A;  3GD2 A;  4G2H A;  3H0A D;  2ZK3 A;  3DCU A;  3DZU D;  3TKM A;  2OM9 A;  5DZ1 A;  3TY0 A;  4FNE A;  4JYH A;  3VSP A;  5KRK A;  3KMR A;  5M96 A;  2AO6 A;  4N8R A;  3L1B A;  2J14 A;  5DX3 A;  2AWH A;  1SR7 A;  1NQ1 A;  2ZK2 A;  4JL4 A;  5SYZ A;  1M13 A;  2Q8S A;  4MG7 B;  5DUH A;  3V3Q A;  2ZK0 A;  5AWK A;  4PXM A;  5FQS A;  2FSZ A;  3OSI A;  2ZMH A;  3KPZ A;  1ZH7 A;  3KYT A;  4IVW A;  5HJP A;  1QKN A;  4Q50 A;  5A86 A;  3ADT A;  4PP3 A;  3MNP A;  3AFR A;  5DXB B;  2BJ4 A;  5DXG A;  3IXP A;  5DVC A;  5C4O A;  4WHF A;  5DZI A;  1XPC A;  1M2Z A;  1T5Z A;  1VJB A;  1XZX X;  1YP0 A;  4Q13 A;  2ZFX A;  2QNV A;  3RUU A;  5DVS A;  5LGA A;  4E2J A;  3OLL A;  1UPW A;  4XAO A;  2POG A;  1ILH A;  3CDS A;  2VV3 A;  1XDK A;  3OSW A;  4K7A A;  2QXS A;  4DM8 A;  4BCR A;  5DV3 A;  1ZGY A;  2ZK4 A;  5EC9 A;  3WMH A;  5DV6 A;  3DZY D;  3PO9 A;  1A28 A;  4ZNS A;  2R6Y A;  3CTB A;  3VT5 A;  2B50 A;  2IHQ A;  2ZLA A;  2HBH A;  4PP6 A;  5DP0 A;  5AZV A;  4POH A;  3RVF A;  3V4A A;  5DWI A;  3OS8 C;  5HCV A;  2GTK A;  2XKW A;  1R1K D;  4TUZ B;  1I7I A;  1MV9 A;  1WM0 X;  5DYD A;  3V3E A;  3G8O A;  4MGD B;  2J4A A;  3N00 A;  4XUM A;  2PIV A;  3B0R A;  5DZ0 A;  4OKT A;  4J26 A;  3B1M A;  5EJV A;  4MGB B;  2P1V A;  1X7B A;  3ADX A;  4RUJ A;  3CS6 A;  4PRG A;  3VJT A;  5DVV A;  5DXR A;  1Y9R A;  4JAZ A;  3KDU A;  2PIR A;  2XYW A;  2AAX A;  3A40 X;  2QZO A;  2Q6R A;  3K8S A;  2Q5S A;  3GZ9 A;  2O4J A;  1DKF A;  3KFC A;  3D24 A;  3PLZ A;  4RUO X;  2PIP L;  3VN2 A;  1FCY A;  4Y29 A;  2IOK A;  2ZVT A;  5EI1 A;  5FQV A;  1NQ7 A;  2QA8 A;  3D90 A;  2PIX A;  3OMM A;  4QE8 A;  4E4Q A;  3WT5 A;  4OH5 A;  3GBK A;  1EXA A;  3VT9 A;  4OFR A;  1FM6 D;  5EHJ A;  5F9B A;  1PRG A;  5HYK A;  3AZ2 A;  3B5R A;  4OEA A;  4XLD A;  1U3R A;  5IAW A;  3UU7 A;  1XV9 B;  1GS4 A;  3R5M A;  2Z4B A;  3Q95 B;  3WJ4 A;  3P0U A;  4LBD A;  3AN3 A;  2AA6 A; 
#chains in the Genus database with same CATH homology
 3B3K A;  4XTA A;  1PK5 A;  1X7E A;  3HO0 A;  2ZNQ A;  3ILZ A;  3FS1 A;  2REW A;  5DI7 A;  5APH A;  2V7C A;  2JJ3 A;  5ETH A;  3R29 A;  4PLE A;  4QE6 A;  3PCU A;  3RLJ A;  2HVC A;  2Q61 A;  4MGC A;  3W5R A;  1UOM A;  2BJ4 B;  1I7G A;  5KRJ A;  3BQD A;  2ZBS A;  5B5B A;  2PIQ A;  3UUA B;  1R6G A;  2R6W A;  4ZJR A;  2GP7 A;  3VTC A;  3B0Q A;  3FEI A;  5DXK A;  4FN9 A;  4YMQ A;  1A52 A;  2OVH A;  1XOW A;  2AA2 A;  1YUC A;  5C4S A;  3AN4 A;  1G1U A;  2PIW A;  1U3Q A;  3OMO A;  4ZN9 A;  2PRG A;  2P7Z A;  4ZNW A;  3V49 A;  2I0G A;  4PVU A;  2ACL A;  2JF9 A;  3HC6 A;  5HYR A;  5L11 A;  2G5O A;  2PIT A;  3IMY A;  5KRL A;  2AXA A;  2LBD A;  4ZOM A;  1XQ3 A;  3ADS A;  4KZM A;  4QM0 A;  4OIL A;  4ZI1 A;  2R40 D;  3HVL A;  3H0A A;  4P6X A;  2GPV A;  4OHA A;  3P8X A;  4RWV A;  4Q0A C;  1XVP B;  5APJ A;  1RDT A;  5FQR A;  3RY9 A;  2Q59 A;  1K74 A;  4OKW A;  4REF A;  3ZR7 A;  3NSP A;  1QKT A;  3S9S A;  3CLD A;  3FAL A;  2Q3Y A;  3OKI A;  3VJI A;  2J7X A;  1MVC A;  1NQ0 A;  1FM9 D;  2QE4 A;  3O1D A;  2Q60 A;  3OS9 A;  1NAX A;  1YOK A;  3M7R A;  3VJS A;  3ZQT A;  1X76 A;  2QSE A;  5DUE A;  3W0J A;  3UP0 A;  1DKF B;  3SP6 A;  5K13 A;  1GWQ A;  4DOR A;  1TFC A;  2ZL9 A;  4PPP A;  4EMA A;  1RKG A;  2VV4 A;  4OZT U;  1N4H A;  1T7R A;  4XI3 A;  5L7G A;  4LTW A;  3IPQ A;  2Q6J A;  5DU5 A;  5DV8 A;  4OIU A;  1ZKY A;  2OVM A;  4S14 A;  2JFA A;  2ZMJ A;  4ZN7 A;  1LV2 A;  2ZY0 A;  3DZY A;  1TXI A;  2PKL A;  4RMC A;  5GIC A;  3UUD A;  2YFE A;  4FHI A;  5DKE A;  3R8I A;  3OAP A;  2QA6 A;  4M8E A;  4NIE A;  3FC6 A;  3UU7 B;  1GWR A;  4A4V A;  5AAV A;  3SP9 A;  1X7J A;  3A2H A;  3ADU A;  2QMV A;  3IPU A;  2YHD A;  3IA6 A;  3G9E A;  2A3I A;  3F7D A;  2I4P A;  4PF3 A;  3WFG A;  3MNE A;  2H79 A;  3W0G A;  2GPP A;  3OMP A;  4G1Y A;  4MG9 A;  4OGH A;  3UUC A;  5JJM B;  2W8Y A;  5KRF A;  4OFU A;  1NDE A;  5DRM A;  1OSV A;  1XNX A;  4IWC A;  5DID A;  3VJH A;  5GIE A;  4X1F A;  4ZNH A;  4OH6 A;  1T7M A;  2Q1V A;  3VHU A;  2I4J A;  4OC7 A;  2QGT A;  3E7C A;  4PWL A;  5KRO A;  1U3S A;  1Y0S A;  1P8D A;  5DMC A;  1LBD A;  1N46 A;  3D57 A;  2NXX E;  5DKG A;  3VRT A;  2AA7 A;  3VHV A;  5DXP A;  4ONI A;  1YOW A;  1OT7 A;  5IXK A;  1XP6 A;  1R20 A;  3HZF A;  4J5W A;  1OVL B;  4CI5 A;  5HJP B;  3ET3 A;  5KCF A;  4IW6 A;  5KCC A;  5DXQ A;  4OEZ A;  2Q1H A;  3FEJ A;  3F5C A;  5B41 A;  4IVY A;  2YJD A;  1E3K A;  3CJW A;  4HLW A;  4J24 A;  3ET1 A;  4O8F A;  4POJ A;  4YPQ A;  2PIO A;  5KRI A;  4IA3 A;  1FM6 A;  3EYB A;  4OED A;  3W0C A;  1XLS E;  2HAR A;  2Q7I A;  4IA1 A;  2GL8 A;  5DIE A;  3JZC A;  3IXP D;  4ITE A;  4MG8 B;  5AYG A;  4OJ4 A;  1T7T A;  1UHL A;  1ZAF A;  1ILG A;  1Z95 A;  1N83 A;  4J5X A;  3BC5 A;  1YJE A;  4K4J A;  2HWQ A;  2VV2 A;  3RLL A;  4JYI A;  4KZJ A;  4MG6 A;  4WQP A;  3K22 A;  3B66 A;  1I37 A;  1KV6 A;  3FAL B;  3X36 A;  2XYJ A;  3D6D A;  5IZ0 A;  3UP3 A;  4DM6 A;  4RZE A;  2HAS A;  1S0Z A;  4IS8 A;  4ZNT A;  3OOK A;  5KYA A;  4NY9 A;  4YNK A;  3K23 A;  2VST A;  1T7F A;  3MNO A;  5G5W A;  4IWF A;  3VT6 A;  3AZ3 A;  1QKU A;  1ZDU A;  3E94 A;  4REE A;  2QH6 A;  5DX3 B;  3WT7 A;  2Q5G A;  5E14 A;  3W0H A;  5DMF A;  4S0S A;  2XHS A;  2PNU A;  1XB7 A;  3AZ1 A;  4UDB A;  3QT0 A;  2AX7 A;  2JFA B;  3O1E A;  5KRA A;  2HAM A;  3WFF A;  5LWP A;  1R5K A;  4MG7 A;  4ITF A;  4IW8 A;  3ERT A;  3R8D A;  2P7G A;  3AUQ A;  3X1H A;  5KRC A;  3DY6 A;  1HJ1 A;  2EWP A;  2FAI A;  3TX7 B;  3E00 A;  4RZF A;  2PJL A;  4N5G A;  2R40 A;  3HM1 A;  1YY4 A;  1PQ6 A;  2QR9 A;  1IE8 A;  4K6I A;  1NUO A;  4WLB A;  5DXB A;  4NUF A;  1ZDT A;  1ZUC A;  4QK4 A;  5E0X A;  5FQT A;  5G44 A;  3OSA A;  3SZ1 A;  3ADV A;  3DR1 A;  3HC5 A;  1GWX A;  1XDK B;  2OCF A;  3OLS A;  2E2R A;  1FCZ A;  3WT6 A;  5ACC A;  5KYJ A;  1X78 A;  4TV1 A;  3VI8 A;  1XQC A;  2P7A A;  4IA2 A;  2P15 A;  3OKH A;  4L98 A;  5C4U A;  2Q70 A;  5KCU A;  3FUG A;  5DKS A;  2ZNN A;  3GYT A;  3CS4 A;  3GWX A;  3W0A A;  1L2I A;  3ADW A;  2ABI A;  3KMZ A;  1K4W A;  1X7R A;  4IV4 A;  4IV2 A;  1U9E A;  4HEE X;  2YLY A;  2H77 A;  1SJ0 A;  3VT7 A;  3VT3 A;  4A4W A;  4OAR A;  3DZU A;  4N1Y A;  3OS8 A;  3WGP A;  4G1Z A;  4LNW A;  1PDU A;  5AZT A;  5G42 A;  3FXV A;  4TUZ A;  1T65 A;  3X31 A;  3AX8 A;  1ZEO A;  2GPU A;  4OZR U;  4MGD A;  3UVV A;  3F5C B;  1Z5X U;  4OK1 A;  3WTQ A;  5KD9 A;  1K7L A;  4OIV A;  4E4K A;  4IQR A;  3U9Q A;  1I38 A;  3CDP A;  2HFP A;  5C4T A;  1EXX A;  1KNU A;  4G1D A;  4MGB A;  2ATH A;  3OOF A;  4OJB A;  1OSH A;  4QJR A;  5DIG A;  2Q7L A;  2P4Y A;  1G2N A;  2AYR A;  2QZO B;  3A2J A;  3CWD A;  1ERE A;  1UHL B;  2QTU A;  4YT1 A;  3VRV A;  1PCG A;  1T76 A;  4ZO1 B;  2B1V A;  5E7V A;  1S9P A;  5AVL A;  3ZRB A;  2HB8 A;  3ERD A;  2YLQ A;  4CSJ A;  5HZC A;  3LBD A;  2HC4 A;  2VSR A;  4J5X C;  3HQ5 A;  4R2U A;  5CJ6 A;  2QA8 B;  2Z4J A;  5I4V A;  1BSX A;  4PPS A;  4RME A;  3P89 A;  2HWR A;  3WWR A;  5EGV A;  4DK7 A;  3PRG A;  5E19 A;  4IA7 A;  1XNN A;  3KDT A;  4OZT E;  1SKX A;  5G46 A;  3A9E A;  3FLI A;  5EIT A;  3X1I A;  4S15 A;  5L7E A;  4G20 A;  3NSQ A;  3FUR A;  2AMB A;  2OZ7 A;  4QL8 A;  1R1K A;  4S0T A;  5KCD A;  4RFW A;  1XV9 A;  4MGA A;  1RDT D;  3Q95 A;  4WVD A;  1XIU A;  2QW4 A;  3L3Z A;  4WPF A;  5DKB A;  3RUT A;  2HCD A;  3VT8 A;  2ZAS A;  1SQN A;  1K74 D;  5G3J A;  2G44 A;  2J7Y A;  2VV1 A;  3VSO A;  3CS8 A;  5DK9 A;  4DMA A;  1YYE A;  2QAB A;  2ZKC A;  5AAU A;  1P93 A;  2P1T A;  1QKM A;  3B0T A;  2AB2 A;  3B65 A;  4NB6 A;  3GWS X;  1MZN A;  2F4B A;  4RMD A;  2POB A;  3L0E A;  3OLF A;  3UUA A;  4F9M A;  1YIN A;  3OGT A;  4G21 A;  2O9I A;  5DSH A;  1NHZ A;  3W5P A;  2ZLC A;  5DWE A;  4DOS A;  1NYX A;  5E0W A;  2OUZ A;  4R6S A;  4TV1 B;  4OLM A;  2ACL B;  1RJK A;  2ZK6 A;  5DRJ A;  2AX9 A;  3L0J A;  5HJS A;  4ZJW A;  5KRH A;  2NXX A;  1L2J A;  4UDC A;  1G50 A;  1XP9 A;  3V9Y A;  1FBY A;  5ICK A;  5DZH A;  2NV7 A;  2QXM A;  2AX6 A;  4PLD A;  2FVJ A;  4KZI A;  3A3Z X;  4RUP A;  4APU A;  1M7W A;  4ZNV A;  1XJ7 A;  1HG4 A;  3GN8 A;  2VV0 A;  3R2A A;  3W0Y A;  3B67 A;  4LNX A;  3W5Q A;  4CI4 A;  1PZL A;  2YAT A;  2Q59 B;  4N73 A;  1IE9 A;  1Y0X X;  3B68 A;  1XLS A;  1XVP A;  3UVV B;  2Q7J A;  5KCW A;  3KBA A;  4RZG A;  3GYU A;  3IPS A;  3ZRA A;  1Q4X A;  2NPA A;  1DB1 A;  2QGW A;  2B23 A;  2ZXZ A;  1XAP A;  3B0W A;  3ET2 A;  4XHD A;  2B1Z A;  2HB7 A;  2Q6S A;  3V9T A;  5AWJ A;  4OEY A;  5G45 A;  5DXE A;  2O4R A;  1YMT A;  2YLP A;  3AUN A;  3KMG A;  5KR9 A;  5KCT A;  3A2I A;  2P54 A;  2Q5P A;  3L0L A;  2PIN A;  5GID A;  1FD0 A;  5GT4 A;  3HLV A;  1E3G A;  2VV4 B;  1T73 A;  3OMK A;  2Q7K A;  2QPY A;  1S19 A;  4MDD A;  4NQA B;  4MG5 A;  1S0X A;  4WHG A;  1R20 D;  3L03 A;  3VT4 A;  5DL4 A;  3WJ5 A;  3UUD B;  1FCX A;  2ZXN A;  4JGV A;  5JY3 A;  2AA5 A;  3BEJ A;  3A9E B;  3FC6 B;  1G5Y A;  2ZNO A;  3W5T A;  5AAV B;  3K6P A;  2ZK1 A;  5APK A;  3DCT A;  1PQC A;  2GIU A;  3VHW A;  3A78 A;  4A2J A;  5H1E A;  4MGA B;  2ZK5 A;  5DWL A;  2GPO A;  5AVI A;  3HOD A;  3VRW A;  1ERR A;  1H9U A;  3AUR A;  3JZB A;  4G2I A;  4MG9 B;  1XP1 A;  3P88 A;  2VV1 B;  2ZNP A;  1NRL A;  4P6W A;  3PEQ A;  2ZMI A;  1YA3 A;  3NOA A;  4EM9 A;  3VTD A;  4FHH A;  5JJM A;  1T79 A;  4DK8 A;  4DQM A;  1FM9 A;  3T03 A;  3R8A A;  1PQ9 A;  2G0G A;  1S9Q A;  2OAX A;  3OZ0 A;  1KKQ A;  5DLR A;  4RAK A;  2I0J A;  2AMA A;  4OKB A;  4PP5 A;  5DZ3 A;  4IUI A;  5DWJ A;  1T63 A;  3ET0 A;  3G8I A;  2V0V A;  3CQV A;  3V9V A;  2IOG A;  4J5W C;  2ZXM A;  1UPV A;  4XT9 A;  4UDA A;  3VTB A;  1OVL A;  2AM9 A;  5JI0 D;  4JYG A;  2XYX A;  3TKC A;  5KCE A;  4L96 A;  3PBA A;  3G0W A;  3H52 A;  3KWY A;  3OMQ A;  2BAW A;  3E00 D;  2YJA B;  1YIM A;  2YLO A;  4OZR E;  1Z5X E;  2PIU A;  4RE8 A;  5DTV A;  4FGY A;  5DYB A;  2P1U A;  5KRM A;  5FQP A;  5G43 A;  5DWG A;  3DT3 A;  2GWX A;  1RK3 A;  3L3X A;  3OZJ A;  4MG8 A;  4X1G A;  5E15 A;  3VRU A;  4R06 A;  1T74 A;  3D5F A;  4LSJ A;  4OJ9 A;  5DUG A;  4UDD A;  2NW4 A;  1NQ2 A;  3LMP A;  4IU7 A;  2AX8 A;  4OKX A;  5E1C A;  4ZO1 X;  5DY8 A;  3R5N A;  2G0H A;  5AK2 A;  5L7H A;  1RKH A;  4ZNU A;  4XUH A;  3W0I A;  4B7W A;  1NAV A;  2I4Z A;  5DXM A;  4M8H A;  3GD2 A;  4G2H A;  3H0A D;  2ZK3 A;  3DCU A;  3DZU D;  3TKM A;  2OM9 A;  5DZ1 A;  3TY0 A;  4FNE A;  4JYH A;  3VSP A;  5KRK A;  3KMR A;  5M96 A;  2AO6 A;  4N8R A;  3L1B A;  2J14 A;  5DX3 A;  2AWH A;  1SR7 A;  1NQ1 A;  2ZK2 A;  4JL4 A;  5SYZ A;  1M13 A;  2Q8S A;  4MG7 B;  5DUH A;  3V3Q A;  2ZK0 A;  5AWK A;  4PXM A;  5FQS A;  2FSZ A;  3OSI A;  2ZMH A;  3KPZ A;  1ZH7 A;  3KYT A;  4IVW A;  5HJP A;  1QKN A;  4Q50 A;  5A86 A;  3ADT A;  4PP3 A;  3MNP A;  3AFR A;  5DXB B;  2BJ4 A;  5DXG A;  3IXP A;  5DVC A;  5C4O A;  4WHF A;  5DZI A;  1XPC A;  1M2Z A;  1T5Z A;  1VJB A;  1XZX X;  1YP0 A;  4Q13 A;  2ZFX A;  2QNV A;  3RUU A;  5DVS A;  5LGA A;  4E2J A;  3OLL A;  1UPW A;  4XAO A;  2POG A;  1ILH A;  3CDS A;  2VV3 A;  1XDK A;  3OSW A;  4K7A A;  2QXS A;  4DM8 A;  4BCR A;  5DV3 A;  1ZGY A;  2ZK4 A;  5EC9 A;  3WMH A;  5DV6 A;  3DZY D;  3PO9 A;  1A28 A;  4ZNS A;  2R6Y A;  3CTB A;  3VT5 A;  2B50 A;  2IHQ A;  2ZLA A;  2HBH A;  4PP6 A;  5DP0 A;  5AZV A;  4POH A;  3RVF A;  3V4A A;  5DWI A;  3OS8 C;  5HCV A;  2GTK A;  2XKW A;  1R1K D;  4TUZ B;  1I7I A;  1MV9 A;  1WM0 X;  5DYD A;  3V3E A;  3G8O A;  4MGD B;  2J4A A;  3N00 A;  4XUM A;  2PIV A;  3B0R A;  5DZ0 A;  4OKT A;  4J26 A;  3B1M A;  5EJV A;  4MGB B;  2P1V A;  1X7B A;  3ADX A;  4RUJ A;  3CS6 A;  4PRG A;  3VJT A;  5DVV A;  5DXR A;  1Y9R A;  4JAZ A;  3KDU A;  2PIR A;  2XYW A;  2AAX A;  3A40 X;  2QZO A;  2Q6R A;  3K8S A;  2Q5S A;  3GZ9 A;  2O4J A;  1DKF A;  3KFC A;  3D24 A;  3PLZ A;  4RUO X;  2PIP L;  3VN2 A;  1FCY A;  4Y29 A;  2IOK A;  2ZVT A;  5EI1 A;  5FQV A;  1NQ7 A;  2QA8 A;  3D90 A;  2PIX A;  3OMM A;  4QE8 A;  4E4Q A;  3WT5 A;  4OH5 A;  3GBK A;  1EXA A;  3VT9 A;  4OFR A;  1FM6 D;  5EHJ A;  5F9B A;  1PRG A;  5HYK A;  3AZ2 A;  3B5R A;  4OEA A;  4XLD A;  1U3R A;  5IAW A;  3UU7 A;  1XV9 B;  1GS4 A;  3R5M A;  2Z4B A;  3Q95 B;  3WJ4 A;  3P0U A;  4LBD A;  3AN3 A;  2AA6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...