2REWA

Crystal structure of pparalpha ligand binding domain with bms-631707
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
269
structure length
255
Chain Sequence
ETADLKSLAKRIYEAYLKNFNMNKVKARVILSGPPFVIHDMETLCMAEKTLQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of Azetidinone Acids as Conformationally-Constrained Dual (alpha/gamma) PPAR Activators
rcsb
molecule keywords Peroxisome proliferator-activated receptor alpha
molecule tags Transcription
source organism Homo sapiens
total genus 102
structure length 255
sequence length 269
ec nomenclature
pdb deposition date 2007-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 2rewA00
4PWLA 2ZXNA 4XUHA 5DMFA 3X1IA 3ET0A 4OFRA 1YYEA 2PIVA 1UPVA 4RZGA 2AWHA 2JFAB 3LMPA 2FVJA 3GYTA 3UU7B 1DKFB 4OKXA 4J5XC 3DR1A 3VJSA 1N4HA 1S9PA 1T73A 2VV3A 3K8SA 1OVLA 4XLDA 2QXSA 4NUFA 3FC6B 4S0SA 5APHA 3AN4A 1Z5XE 3KPZA 2VSTA 2QW4A 2ZXMA 5KRMA 3E00A 4WLBA 5DWGA 3PBAA 3O1EA 2Q5PA 3PLZA 1SQNA 2VV4B 2ZNPA 3CDSA 3AZ1A 4RZFA 2R40A 1PQ6A 2HFPA 3GWSX 5DK9A 3IPUA 3VJTA 2QH6A 5AWKA 3HO0A 3OMQA 2ZFXA 3B65A 4JL4A 1YMTA 4M8HA 2BAWA 4Q13A 4RFWA 5EC9A 3ERTA 3KMGA 1XNNA 3HC6A 2Q5SA 5DZHA 5HJPA 1H9UA 1ERRA 3KYTA 1XP9A 5G3JA 3RLJA 4RZEA 4ZJRA 4IA7A 1MZNA 2ZLCA 2J14A 3D57A 2Q8SA 4KZMA 4PF3A 4XHDA 4PVUA 3ADUA 2Q59B 3DZUD 1XB7A 2BJ4A 1MV9A 2HCDA 3B0RA 4G20A 4OHAA 3OZJA 5DXBA 5GT4A 4G1YA 2PIRA 2AM9A 3R2AA 3R5NA 3HLVA 2GPPA 1RDTD 4MGDB 1NYXA 4FHIA 5DY8A 5KD9A 5DU5A 2OVMA 3GN8A 5FQRA 1NHZA 5KRAA 5AAUA 4IA2A 1NAVA 3KMZA 3W0AA 4DM8A 5L11A 4IS8A 2POGA 2GL8A 3H52A 4REFA 2GP7A 3X36A 3W0IA 4RUPA 3OSIA 4PPPA 1T7TA 3P8XA 3ZR7A 2J7XA 2ZMIA 3OKHA 3VHVA 4OZTU 1X7EA 4TV1A 5A86A 3R29A 4E4KA 2NV7A 2GIUA 3HM1A 2ZMHA 2B50A 2ZK0A 3HODA 4PRGA 2ZK3A 2AAXA 3W0HA 1XV9B 2P7ZA 3B0QA 2AA2A 2REWA 2ZKCA 2XYXA 3IPQA 4REEA 3WGPA 4WQPA 5KROA 1FCXA 3DCUA 3KFCA 4MG7B 1NQ2A 2PIPL 3FALB 4IW8A 3K6PA 3ADVA 3L3XA 4JYIA 3WJ4A 1M2ZA 4IWCA 1RJKA 4RUOX 2QA8B 3B1MA 2AX7A 5AAVA 3FLIA 5B41A 3G8IA 4X1FA 4ZJWA 3V3QA 5IZ0A 1Q4XA 4UDCA 4RMDA 5C4TA 3V3EA 5DKGA 2HBHA 4ZOMA 2VV1B 1UHLA 3WWRA 1RK3A 4QE8A 1ILGA 1GWXA 2VV2A 4S0TA 5KRFA 3W0YA 1XDKA 3OS8A 4NIEA 3OMKA 3V4AA 2Q60A 3H0AA 3A2IA 4MGAB 4JAZA 4ZNWA 5DYBA 5AK2A 4LNWA 2PIUA 4ZO1X 4IU7A 5FQTA 5K13A 1PDUA 3F5CB 3B66A 3KWYA 5DZ1A 4POJA 1U3QA 3ET1A 4FGYA 1XIUA 2IOKA 5G5WA 5HYKA 5HZCA 2PIWA 2I4ZA 4S15A 2Q5GA 5DP0A 2R40D 3BC5A 2G0HA 4LSJA 5AZTA 3UP3A 3W5TA 4Q0AC 4YNKA 5JJMB 1T7RA 3AN3A 3VRVA 3B5RA 5C4UA 3UUDB 3D90A 1GS4A 4O8FA 1I7GA 4IV4A 1HJ1A 1XVPA 3RLLA 2LBDA 1T7FA 2ACLA 3VTCA 5DZIA 3IXPD 4N1YA 4OARA 3VSPA 4OC7A 3AZ2A 1PQCA 3E7CA 4RMCA 2W8YA 4UDAA 4OZRU 5L7HA 3CDPA 5KCFA 3UP0A 4CSJA 5E0WA 5F9BA 2PNUA 5JY3A 2XHSA 4QE6A 2NXXA 3MNOA 3VTDA 3IMYA 4LTWA 4XI3A 2PIOA 5KCUA 3W5RA 1PK5A 3GBKA 3WTQA 1BSXA 1PQ9A 1M7WA 1PZLA 1ZGYA 2G0GA 4G2HA 2I0GA 4LNXA 3LBDA 3N00A 4P6XA 4Q50A 4Y29A 1YP0A 2I4JA 1K4WA 3OOFA 4YMQA 2NPAA 5DXEA 4E4QA 4RUJA 3VJHA 2O4JA 3MNEA 4HLWA 4OGHA 3D6DA 3Q95A 2PINA 2OVHA 5DVCA 4BCRA 2ZY0A 4MGBA 3FUGA 3OLFA 2Q7JA 3VT3A 3V9YA 5G45A 5JI0D 3B0WA 2QABA 1NQ0A 5DLRA 5APJA 2QPYA 5KYAA 3TKMA 3S9SA 5GICA 5AWJA 3MNPA 1QKUA 1Y0SA 2IOGA 3G0WA 1TFCA 3V49A 3R5MA 5KRIA 3CS4A 1I7IA 4IVWA 2PIQA 2A3IA 4L96A 1S19A 4MG8B 2ZXZA 3OSWA 5DXBB 2P7AA 5DMCA 4RWVA 2I4PA 4NB6A 2P15A 4HEEX 4R6SA 3QT0A 4OZTE 2QTUA 4PP6A 3W0GA 5DX3B 1FM9A 2Z4JA 5DSHA 2OM9A 5HCVA 2Q61A 3ADSA 1X7JA 2J4AA 1YOKA 5KRHA 4OFUA 1NRLA 1NQ1A 1ZKYA 2JFAA 3A78A 3H0AD 4ZNSA 3SP6A 2QMVA 3W0CA 3BQDA 2ZVTA 1DKFA 3WJ5A 1R20A 5DZ3A 4IQRA 3B68A 4UDBA 3VRWA 4NQAB 5DV8A 4WVDA 2HASA 1FCZA 4APUA 2XKWA 3KDUA 3FC6A 1NDEA 3HZFA 3M7RA 3G9EA 1K7LA 3A40X 3HC5A 2ZK5A 5GIDA 5DI7A 3VJIA 1I37A 4WHFA 3P88A 2ZNQA 1FM6A 3A2HA 4A4WA 2VV4A 1X78A 1XJ7A 3OGTA 5DRJA 4OEAA 5SYZA 3TKCA 4N73A 2HB8A 5EJVA 1YOWA 5DWEA 4OJBA 2GTKA 3ZRAA 2NXXE 5FQVA 3FXVA 2JJ3A 5DUHA 2PRGA 4JGVA 5C4OA 1XLSE 1YJEA 5E14A 1YUCA 2PIXA 1T63A 3AZ3A 3ILZA 4IA3A 4R06A 2GPOA 4OILA 1S0XA 2R6YA 4OKBA 2QGTA 3AUQA 2Q59A 5KRCA 2G44A 3L0JA 4MG6A 3ADTA 2QZOA 2Q3YA 3W5PA 5EI1A 2B23A 4N8RA 2AA6A 2YJDA 3UUAB 1EXXA 1I38A 4RE8A 4DORA 5ICKA 1T65A 4EM9A 4UDDA 4OZRE 2YLYA 3GD2A 1ZEOA 4RAKA 5E0XA 3WT5A 5DKEA 2EWPA 2Q6RA 5DV6A 2Z4BA 1IE9A 3R8IA 3VT9A 3SP9A 3L1BA 2Q7IA 3X31A 2H79A 4OIUA 1ZUCA 4QL8A 1T7MA 3K22A 4G1DA 1QKTA 1X76A 2Q7KA 1XVPB 3HVLA 3OS8C 5DXQA 5LWPA 3E00D 2ACLB 5DUEA 1A52A 4IVYA 4KZJA 4RMEA 1KKQA 1XV9A 4ZNHA 3ADXA 3AFRA 5M96A 3B67A 3ERDA 4JYHA 4MG7A 4ZO1B 3D24A 4OIVA 1GWQA 2VSRA 1R1KA 2AX9A 4JYGA 1RKHA 3KMRA 4ZNUA 2QA8A 1FM9D 4MGCA 3DZUA 4IWFA 3EYBA 3G8OA 4TUZB 1G1UA 4WPFA 3VRUA 4OEZA 2AO6A 4YT1A 1S0ZA 5EITA 1ILHA 3OOKA 3P89A 3WMHA 4X1GA 2VV1A 5C4SA 2ZLAA 3AX8A 1XOWA 2ZMJA 3A3ZX 3OLSA 1HG4A 3OMPA 2AB2A 3VT7A 3VI8A 2QXMA 3NOAA 3CS8A 3WT7A 3B0TA 5DUGA 1XLSA 3WT6A 4K4JA 2GWXA 3DY6A 1VJBA 1N83A 5HYRA 4MGBB 5G43A 3DZYA 1OVLB 4ZI1A 1PRGA 3F5CA 1U3RA 1FM6D 5KYJA 1U3SA 3OMOA 1K74A 2XYWA 4XAOA 3L0LA 4OH5A 1G2NA 2OCFA 3KDTA 2NW4A 2AYRA 4ONIA 2ATHA 1EXAA 3PEQA 5JJMA 3VT5A 3JZBA 3AUNA 1UPWA 3OS9A 1L2IA 1WM0X 2AMBA 5DXPA 4A4VA 5DXGA 3OZ0A 3UUDA 2YLQA 1UOMA 4P6WA 2FAIA 2QA6A 2HAMA 2ZNOA 4E2JA 3OKIA 3PRGA 5E7VA 4DK7A 1FBYA 3VT8A 4J26A 3ADWA 3AURA 3B3KA 5HJPB 4J5WA 2AXAA 2JF9A 3K23A 1T76A 1ZDUA 5DZ0A 1NUOA 2YHDA 4J5XA 5KCTA 3GYUA 5L7EA 4IV2A 3U9QA 3A9EA 5DWLA 2P1UA 3W5QA 2BJ4B 1OSHA 4PLEA 4MG9A 3UVVA 4J5WC 1ZDTA 5KCEA 1XZXX 5DYDA 3ET2A 2B1VA 5GIEA 5L7GA 5LGAA 1QKMA 2AX6A 2Q6SA 2GPVA 2XYJA 5AVIA 4FN9A 3VT6A 3X1HA 4B7WA 2P1VA 4J24A 1YY4A 2ZK4A 2PJLA 4MG5A 3CLDA 3FS1A 4OK1A 5DWJA 5DRMA 1SR7A 3FEIA 4OH6A 3SZ1A 1TXIA 4KZIA 1N46A 1Y9RA 5DL4A 3UU7A 5E1CA 2I0JA 5DVSA 4G1ZA 2ZBSA 4PLDA 4L98A 3FEJA 4DQMA 4TV1B 4R2UA 3R8DA 1T5ZA 3F7DA 4NY9A 1M13A 5DV3A 3V9TA 4ZNVA 2GPUA 2Q1HA 2R6WA 5G42A 1P93A 2E2RA 1YINA 3FURA 5EGVA 1XP6A 5AYGA 3RVFA 1XPCA 2J7YA 3IXPA 3E94A 4FNEA 4G21A 4OLMA 5CJ6A 3DCTA 4OKTA 1FD0A 3OMMA 5KRKA 1KV6A 1R1KD 1G5YA 5AVLA 4MG8A 4M8EA 5KCWA 4G2IA 3IA6A 5ACCA 2HARA 2QZOB 4ITEA 4MDDA 1P8DA 2VV0A 3GWXA 3VHUA 4DOSA 4OEYA 5AAVB 1Z5XU 3A2JA 1U9EA 5HJSA 4WHGA 3RUUA 5DX3A 3DZYD 2P54A 2YFEA 3ZRBA 2B1ZA 2HWQA 2Q6JA 3CS6A 1YA3A 3RUTA 1UHLB 1YIMA 2Q7LA 1Z95A 1SKXA 4N5GA 1R6GA 1XDKB 5EHJA 4LBDA 1QKNA 3NSQA 1SJ0A 3L03A 5E15A 3WFGA 3PCUA 4MGDA 5IAWA 5B5BA 5KCCA 4IW6A 3CWDA 3JZCA 2QNVA 5DXRA 5KCDA 2P4YA 1K74D 4POHA 1X7BA 2V0VA 1RKGA 1XNXA 3OAPA 5DKSA 1NQ7A 1OT7A 2P1TA 5DIEA 4OJ9A 1EREA 4S14A 2V7CA 1LV2A 3OLLA 4FHHA 2YJAB 4OEDA 2AA7A 4QK4A 2OAXA 4DMAA 4YPQA 2PITA 1LBDA 3D5FA 3O1DA 4PPSA 2P7GA 2AX8A 4IUIA 2YATA 3ZQTA 4ZN9A 1S9QA 2ZASA 1FCYA 3CJWA 1G50A 1XQ3A 5KRJA 5KR9A 4F9MA 2QE4A 2Q1VA 2YLPA 2ZNNA 5DIGA 2HWRA 2ZK2A 5E19A 5G44A 3WFFA 3P0UA 2QR9A 2YLOA 1ZH7A 4ZNTA 1R5KA 4PP3A 2QGWA 5IXKA 3BEJA 3CQVA 3NSPA 1DB1A 2OUZA 4XT9A 3VRTA 2ZL9A 1MVCA 3ET3A 3FALA 4OKWA 3W0JA 2F4BA 2H77A 3OSAA 4ZN7A 1NAXA 4IA1A 1XP1A 3T03A 4K6IA 3UUCA 2HB7A 1T79A 5G46A 1T74A 3UUAA 4A2JA 2HC4A 2ABIA 1GWRA 1XAPA 4XTAA 1IE8A 1RDTA 2G5OA 3V9VA 1OSVA 2OZ7A 2ZK6A 1KNUA 1R20D 3HQ5A 4PP5A 2POBA 5AZVA 3L3ZA 2AMAA 3IPSA 5APKA 3PO9A 2QSEA 3CTBA 1E3KA 4MGAA 3Q95B 2AA5A 2HVCA 5DXKA 5DTVA 2ZK1A 5I4VA 1PCGA 4XUMA 3TY0A 3R8AA 4K7AA 5H1EA 3GZ9A 2IHQA 3VSOA 4CI4A 3KBAA 5FQPA 5DWIA 2O4RA 3RY9A 3VT4A 1ZAFA 3L0EA 5DIDA 2FSZA 2Q70A 4ITFA 4DK8A 2O9IA 3A9EB 5KRLA 3DT3A 3VN2A 4EMAA 1A28A 5DXMA 5FQSA 1Y0XX 4MG9B 3UVVB 1XQCA 4PXMA 4QM0A 5DKBA 3VHWA 4DM6A 4QJRA 1X7RA 5ETHA 4CI5A 4OJ4A 5DVVA 1E3GA 4TUZA 3VTBA 1L2JA 3TX7B 2PKLA
chains in the Genus database with same CATH superfamily
4PWLA 2ZXNA 4XUHA 5DMFA 3X1IA 3ET0A 4OFRA 1YYEA 2PIVA 1UPVA 4RZGA 2AWHA 2JFAB 3LMPA 2FVJA 3GYTA 3UU7B 1DKFB 4OKXA 4J5XC 3DR1A 3VJSA 1N4HA 1S9PA 1T73A 2VV3A 3K8SA 1OVLA 4XLDA 2QXSA 4NUFA 3FC6B 4S0SA 5APHA 3AN4A 1Z5XE 3KPZA 2VSTA 2QW4A 2ZXMA 5KRMA 3E00A 4WLBA 5DWGA 3PBAA 3O1EA 2Q5PA 3PLZA 1SQNA 2VV4B 2ZNPA 3CDSA 3AZ1A 4RZFA 2R40A 1PQ6A 2HFPA 3GWSX 5DK9A 3IPUA 3VJTA 2QH6A 5AWKA 3HO0A 3OMQA 2ZFXA 3B65A 4JL4A 1YMTA 4M8HA 2BAWA 4Q13A 4RFWA 5EC9A 3ERTA 3KMGA 1XNNA 3HC6A 2Q5SA 5DZHA 5HJPA 1H9UA 1ERRA 3KYTA 1XP9A 5G3JA 3RLJA 4RZEA 4ZJRA 4IA7A 1MZNA 2ZLCA 2J14A 3D57A 2Q8SA 4KZMA 4PF3A 4XHDA 4PVUA 3ADUA 2Q59B 3DZUD 1XB7A 2BJ4A 1MV9A 2HCDA 3B0RA 4G20A 4OHAA 3OZJA 5DXBA 5GT4A 4G1YA 2PIRA 2AM9A 3R2AA 3R5NA 3HLVA 2GPPA 1RDTD 4MGDB 1NYXA 4FHIA 5DY8A 5KD9A 5DU5A 2OVMA 3GN8A 5FQRA 1NHZA 5KRAA 5AAUA 4IA2A 1NAVA 3KMZA 3W0AA 4DM8A 5L11A 4IS8A 2POGA 2GL8A 3H52A 4REFA 2GP7A 3X36A 3W0IA 4RUPA 3OSIA 4PPPA 1T7TA 3P8XA 3ZR7A 2J7XA 2ZMIA 3OKHA 3VHVA 4OZTU 1X7EA 4TV1A 5A86A 3R29A 4E4KA 2NV7A 2GIUA 3HM1A 2ZMHA 2B50A 2ZK0A 3HODA 4PRGA 2ZK3A 2AAXA 3W0HA 1XV9B 2P7ZA 3B0QA 2AA2A 2REWA 2ZKCA 2XYXA 3IPQA 4REEA 3WGPA 4WQPA 5KROA 1FCXA 3DCUA 3KFCA 4MG7B 1NQ2A 2PIPL 3FALB 4IW8A 3K6PA 3ADVA 3L3XA 4JYIA 3WJ4A 1M2ZA 4IWCA 1RJKA 4RUOX 2QA8B 3B1MA 2AX7A 5AAVA 3FLIA 5B41A 3G8IA 4X1FA 4ZJWA 3V3QA 5IZ0A 1Q4XA 4UDCA 4RMDA 5C4TA 3V3EA 5DKGA 2HBHA 4ZOMA 2VV1B 1UHLA 3WWRA 1RK3A 4QE8A 1ILGA 1GWXA 2VV2A 4S0TA 5KRFA 3W0YA 1XDKA 3OS8A 4NIEA 3OMKA 3V4AA 2Q60A 3H0AA 3A2IA 4MGAB 4JAZA 4ZNWA 5DYBA 5AK2A 4LNWA 2PIUA 4ZO1X 4IU7A 5FQTA 5K13A 1PDUA 3F5CB 3B66A 3KWYA 5DZ1A 4POJA 1U3QA 3ET1A 4FGYA 1XIUA 2IOKA 5G5WA 5HYKA 5HZCA 2PIWA 2I4ZA 4S15A 2Q5GA 5DP0A 2R40D 3BC5A 2G0HA 4LSJA 5AZTA 3UP3A 3W5TA 4Q0AC 4YNKA 5JJMB 1T7RA 3AN3A 3VRVA 3B5RA 5C4UA 3UUDB 3D90A 1GS4A 4O8FA 1I7GA 4IV4A 1HJ1A 1XVPA 3RLLA 2LBDA 1T7FA 2ACLA 3VTCA 5DZIA 3IXPD 4N1YA 4OARA 3VSPA 4OC7A 3AZ2A 1PQCA 3E7CA 4RMCA 2W8YA 4UDAA 4OZRU 5L7HA 3CDPA 5KCFA 3UP0A 4CSJA 5E0WA 5F9BA 2PNUA 5JY3A 2XHSA 4QE6A 2NXXA 3MNOA 3VTDA 3IMYA 4LTWA 4XI3A 2PIOA 5KCUA 3W5RA 1PK5A 3GBKA 3WTQA 1BSXA 1PQ9A 1M7WA 1PZLA 1ZGYA 2G0GA 4G2HA 2I0GA 4LNXA 3LBDA 3N00A 4P6XA 4Q50A 4Y29A 1YP0A 2I4JA 1K4WA 3OOFA 4YMQA 2NPAA 5DXEA 4E4QA 4RUJA 3VJHA 2O4JA 3MNEA 4HLWA 4OGHA 3D6DA 3Q95A 2PINA 2OVHA 5DVCA 4BCRA 2ZY0A 4MGBA 3FUGA 3OLFA 2Q7JA 3VT3A 3V9YA 5G45A 5JI0D 3B0WA 2QABA 1NQ0A 5DLRA 5APJA 2QPYA 5KYAA 3TKMA 3S9SA 5GICA 5AWJA 3MNPA 1QKUA 1Y0SA 2IOGA 3G0WA 1TFCA 3V49A 3R5MA 5KRIA 3CS4A 1I7IA 4IVWA 2PIQA 2A3IA 4L96A 1S19A 4MG8B 2ZXZA 3OSWA 5DXBB 2P7AA 5DMCA 4RWVA 2I4PA 4NB6A 2P15A 4HEEX 4R6SA 3QT0A 4OZTE 2QTUA 4PP6A 3W0GA 5DX3B 1FM9A 2Z4JA 5DSHA 2OM9A 5HCVA 2Q61A 3ADSA 1X7JA 2J4AA 1YOKA 5KRHA 4OFUA 1NRLA 1NQ1A 1ZKYA 2JFAA 3A78A 3H0AD 4ZNSA 3SP6A 2QMVA 3W0CA 3BQDA 2ZVTA 1DKFA 3WJ5A 1R20A 5DZ3A 4IQRA 3B68A 4UDBA 3VRWA 4NQAB 5DV8A 4WVDA 2HASA 1FCZA 4APUA 2XKWA 3KDUA 3FC6A 1NDEA 3HZFA 3M7RA 3G9EA 1K7LA 3A40X 3HC5A 2ZK5A 5GIDA 5DI7A 3VJIA 1I37A 4WHFA 3P88A 2ZNQA 1FM6A 3A2HA 4A4WA 2VV4A 1X78A 1XJ7A 3OGTA 5DRJA 4OEAA 5SYZA 3TKCA 4N73A 2HB8A 5EJVA 1YOWA 5DWEA 4OJBA 2GTKA 3ZRAA 2NXXE 5FQVA 3FXVA 2JJ3A 5DUHA 2PRGA 4JGVA 5C4OA 1XLSE 1YJEA 5E14A 1YUCA 2PIXA 1T63A 3AZ3A 3ILZA 4IA3A 4R06A 2GPOA 4OILA 1S0XA 2R6YA 4OKBA 2QGTA 3AUQA 2Q59A 5KRCA 2G44A 3L0JA 4MG6A 3ADTA 2QZOA 2Q3YA 3W5PA 5EI1A 2B23A 4N8RA 2AA6A 2YJDA 3UUAB 1EXXA 1I38A 4RE8A 4DORA 5ICKA 1T65A 4EM9A 4UDDA 4OZRE 2YLYA 3GD2A 1ZEOA 4RAKA 5E0XA 3WT5A 5DKEA 2EWPA 2Q6RA 5DV6A 2Z4BA 1IE9A 3R8IA 3VT9A 3SP9A 3L1BA 2Q7IA 3X31A 2H79A 4OIUA 1ZUCA 4QL8A 1T7MA 3K22A 4G1DA 1QKTA 1X76A 2Q7KA 1XVPB 3HVLA 3OS8C 5DXQA 5LWPA 3E00D 2ACLB 5DUEA 1A52A 4IVYA 4KZJA 4RMEA 1KKQA 1XV9A 4ZNHA 3ADXA 3AFRA 5M96A 3B67A 3ERDA 4JYHA 4MG7A 4ZO1B 3D24A 4OIVA 1GWQA 2VSRA 1R1KA 2AX9A 4JYGA 1RKHA 3KMRA 4ZNUA 2QA8A 1FM9D 4MGCA 3DZUA 4IWFA 3EYBA 3G8OA 4TUZB 1G1UA 4WPFA 3VRUA 4OEZA 2AO6A 4YT1A 1S0ZA 5EITA 1ILHA 3OOKA 3P89A 3WMHA 4X1GA 2VV1A 5C4SA 2ZLAA 3AX8A 1XOWA 2ZMJA 3A3ZX 3OLSA 1HG4A 3OMPA 2AB2A 3VT7A 3VI8A 2QXMA 3NOAA 3CS8A 3WT7A 3B0TA 5DUGA 1XLSA 3WT6A 4K4JA 2GWXA 3DY6A 1VJBA 1N83A 5HYRA 4MGBB 5G43A 3DZYA 1OVLB 4ZI1A 1PRGA 3F5CA 1U3RA 1FM6D 5KYJA 1U3SA 3OMOA 1K74A 2XYWA 4XAOA 3L0LA 4OH5A 1G2NA 2OCFA 3KDTA 2NW4A 2AYRA 4ONIA 2ATHA 1EXAA 3PEQA 5JJMA 3VT5A 3JZBA 3AUNA 1UPWA 3OS9A 1L2IA 1WM0X 2AMBA 5DXPA 4A4VA 5DXGA 3OZ0A 3UUDA 2YLQA 1UOMA 4P6WA 2FAIA 2QA6A 2HAMA 2ZNOA 4E2JA 3OKIA 3PRGA 5E7VA 4DK7A 1FBYA 3VT8A 4J26A 3ADWA 3AURA 3B3KA 5HJPB 4J5WA 2AXAA 2JF9A 3K23A 1T76A 1ZDUA 5DZ0A 1NUOA 2YHDA 4J5XA 5KCTA 3GYUA 5L7EA 4IV2A 3U9QA 3A9EA 5DWLA 2P1UA 3W5QA 2BJ4B 1OSHA 4PLEA 4MG9A 3UVVA 4J5WC 1ZDTA 5KCEA 1XZXX 5DYDA 3ET2A 2B1VA 5GIEA 5L7GA 5LGAA 1QKMA 2AX6A 2Q6SA 2GPVA 2XYJA 5AVIA 4FN9A 3VT6A 3X1HA 4B7WA 2P1VA 4J24A 1YY4A 2ZK4A 2PJLA 4MG5A 3CLDA 3FS1A 4OK1A 5DWJA 5DRMA 1SR7A 3FEIA 4OH6A 3SZ1A 1TXIA 4KZIA 1N46A 1Y9RA 5DL4A 3UU7A 5E1CA 2I0JA 5DVSA 4G1ZA 2ZBSA 4PLDA 4L98A 3FEJA 4DQMA 4TV1B 4R2UA 3R8DA 1T5ZA 3F7DA 4NY9A 1M13A 5DV3A 3V9TA 4ZNVA 2GPUA 2Q1HA 2R6WA 5G42A 1P93A 2E2RA 1YINA 3FURA 5EGVA 1XP6A 5AYGA 3RVFA 1XPCA 2J7YA 3IXPA 3E94A 4FNEA 4G21A 4OLMA 5CJ6A 3DCTA 4OKTA 1FD0A 3OMMA 5KRKA 1KV6A 1R1KD 1G5YA 5AVLA 4MG8A 4M8EA 5KCWA 4G2IA 3IA6A 5ACCA 2HARA 2QZOB 4ITEA 4MDDA 1P8DA 2VV0A 3GWXA 3VHUA 4DOSA 4OEYA 5AAVB 1Z5XU 3A2JA 1U9EA 5HJSA 4WHGA 3RUUA 5DX3A 3DZYD 2P54A 2YFEA 3ZRBA 2B1ZA 2HWQA 2Q6JA 3CS6A 1YA3A 3RUTA 1UHLB 1YIMA 2Q7LA 1Z95A 1SKXA 4N5GA 1R6GA 1XDKB 5EHJA 4LBDA 1QKNA 3NSQA 1SJ0A 3L03A 5E15A 3WFGA 3PCUA 4MGDA 5IAWA 5B5BA 5KCCA 4IW6A 3CWDA 3JZCA 2QNVA 5DXRA 5KCDA 2P4YA 1K74D 4POHA 1X7BA 2V0VA 1RKGA 1XNXA 3OAPA 5DKSA 1NQ7A 1OT7A 2P1TA 5DIEA 4OJ9A 1EREA 4S14A 2V7CA 1LV2A 3OLLA 4FHHA 2YJAB 4OEDA 2AA7A 4QK4A 2OAXA 4DMAA 4YPQA 2PITA 1LBDA 3D5FA 3O1DA 4PPSA 2P7GA 2AX8A 4IUIA 2YATA 3ZQTA 4ZN9A 1S9QA 2ZASA 1FCYA 3CJWA 1G50A 1XQ3A 5KRJA 5KR9A 4F9MA 2QE4A 2Q1VA 2YLPA 2ZNNA 5DIGA 2HWRA 2ZK2A 5E19A 5G44A 3WFFA 3P0UA 2QR9A 2YLOA 1ZH7A 4ZNTA 1R5KA 4PP3A 2QGWA 5IXKA 3BEJA 3CQVA 3NSPA 1DB1A 2OUZA 4XT9A 3VRTA 2ZL9A 1MVCA 3ET3A 3FALA 4OKWA 3W0JA 2F4BA 2H77A 3OSAA 4ZN7A 1NAXA 4IA1A 1XP1A 3T03A 4K6IA 3UUCA 2HB7A 1T79A 5G46A 1T74A 3UUAA 4A2JA 2HC4A 2ABIA 1GWRA 1XAPA 4XTAA 1IE8A 1RDTA 2G5OA 3V9VA 1OSVA 2OZ7A 2ZK6A 1KNUA 1R20D 3HQ5A 4PP5A 2POBA 5AZVA 3L3ZA 2AMAA 3IPSA 5APKA 3PO9A 2QSEA 3CTBA 1E3KA 4MGAA 3Q95B 2AA5A 2HVCA 5DXKA 5DTVA 2ZK1A 5I4VA 1PCGA 4XUMA 3TY0A 3R8AA 4K7AA 5H1EA 3GZ9A 2IHQA 3VSOA 4CI4A 3KBAA 5FQPA 5DWIA 2O4RA 3RY9A 3VT4A 1ZAFA 3L0EA 5DIDA 2FSZA 2Q70A 4ITFA 4DK8A 2O9IA 3A9EB 5KRLA 3DT3A 3VN2A 4EMAA 1A28A 5DXMA 5FQSA 1Y0XX 4MG9B 3UVVB 1XQCA 4PXMA 4QM0A 5DKBA 3VHWA 4DM6A 4QJRA 1X7RA 5ETHA 4CI5A 4OJ4A 5DVVA 1E3GA 4TUZA 3VTBA 1L2JA 3TX7B 2PKLA
chains in the Genus database with same CATH topology
4PWLA 2ZXNA 4XUHA 5DMFA 3X1IA 3ET0A 4OFRA 1YYEA 2PIVA 1UPVA 4RZGA 2AWHA 2JFAB 3LMPA 2FVJA 3GYTA 3UU7B 1DKFB 4OKXA 4J5XC 3DR1A 3VJSA 1N4HA 1S9PA 1T73A 2VV3A 3K8SA 1OVLA 4XLDA 2QXSA 4NUFA 3FC6B 4S0SA 5APHA 3AN4A 1Z5XE 3KPZA 2VSTA 2QW4A 2ZXMA 5KRMA 3E00A 4WLBA 5DWGA 3PBAA 3O1EA 2Q5PA 3PLZA 1SQNA 2VV4B 2ZNPA 3CDSA 3AZ1A 4RZFA 2R40A 1PQ6A 2HFPA 3GWSX 5DK9A 3IPUA 3VJTA 2QH6A 5AWKA 3HO0A 3OMQA 2ZFXA 3B65A 4JL4A 1YMTA 4M8HA 2BAWA 4Q13A 4RFWA 5EC9A 3ERTA 3KMGA 1XNNA 3HC6A 2Q5SA 5DZHA 5HJPA 1H9UA 1ERRA 3KYTA 1XP9A 5G3JA 3RLJA 4RZEA 4ZJRA 4IA7A 1MZNA 2ZLCA 2J14A 3D57A 2Q8SA 4KZMA 4PF3A 4XHDA 4PVUA 3ADUA 2Q59B 3DZUD 1XB7A 2BJ4A 1MV9A 2HCDA 3B0RA 4G20A 4OHAA 3OZJA 5DXBA 5GT4A 4G1YA 2PIRA 2AM9A 3R2AA 3R5NA 3HLVA 2GPPA 1RDTD 4MGDB 1NYXA 4FHIA 5DY8A 5KD9A 5DU5A 2OVMA 3GN8A 5FQRA 1NHZA 5KRAA 5AAUA 4IA2A 1NAVA 3KMZA 3W0AA 4DM8A 5L11A 4IS8A 2POGA 2GL8A 3H52A 4REFA 2GP7A 3X36A 3W0IA 4RUPA 3OSIA 4PPPA 1T7TA 3P8XA 3ZR7A 2J7XA 2ZMIA 3OKHA 3VHVA 4OZTU 1X7EA 4TV1A 5A86A 3R29A 4E4KA 2NV7A 2GIUA 3HM1A 2ZMHA 2B50A 2ZK0A 3HODA 4PRGA 2ZK3A 2AAXA 3W0HA 1XV9B 2P7ZA 3B0QA 2AA2A 2REWA 2ZKCA 2XYXA 3IPQA 4REEA 3WGPA 4WQPA 5KROA 1FCXA 3DCUA 3KFCA 4MG7B 1NQ2A 2PIPL 3FALB 4IW8A 3K6PA 3ADVA 3L3XA 4JYIA 3WJ4A 1M2ZA 4IWCA 1RJKA 4RUOX 2QA8B 3B1MA 2AX7A 5AAVA 3FLIA 5B41A 3G8IA 4X1FA 4ZJWA 3V3QA 5IZ0A 1Q4XA 4UDCA 4RMDA 5C4TA 3V3EA 5DKGA 2HBHA 4ZOMA 2VV1B 1UHLA 3WWRA 1RK3A 4QE8A 1ILGA 1GWXA 2VV2A 4S0TA 5KRFA 3W0YA 1XDKA 3OS8A 4NIEA 3OMKA 3V4AA 2Q60A 3H0AA 3A2IA 4MGAB 4JAZA 4ZNWA 5DYBA 5AK2A 4LNWA 2PIUA 4ZO1X 4IU7A 5FQTA 5K13A 1PDUA 3F5CB 3B66A 3KWYA 5DZ1A 4POJA 1U3QA 3ET1A 4FGYA 1XIUA 2IOKA 5G5WA 5HYKA 5HZCA 2PIWA 2I4ZA 4S15A 2Q5GA 5DP0A 2R40D 3BC5A 2G0HA 4LSJA 5AZTA 3UP3A 3W5TA 4Q0AC 4YNKA 5JJMB 1T7RA 3AN3A 3VRVA 3B5RA 5C4UA 3UUDB 3D90A 1GS4A 4O8FA 1I7GA 4IV4A 1HJ1A 1XVPA 3RLLA 2LBDA 1T7FA 2ACLA 3VTCA 5DZIA 3IXPD 4N1YA 4OARA 3VSPA 4OC7A 3AZ2A 1PQCA 3E7CA 4RMCA 2W8YA 4UDAA 4OZRU 5L7HA 3CDPA 5KCFA 3UP0A 4CSJA 5E0WA 5F9BA 2PNUA 5JY3A 2XHSA 4QE6A 2NXXA 3MNOA 3VTDA 3IMYA 4LTWA 4XI3A 2PIOA 5KCUA 3W5RA 1PK5A 3GBKA 3WTQA 1BSXA 1PQ9A 1M7WA 1PZLA 1ZGYA 2G0GA 4G2HA 2I0GA 4LNXA 3LBDA 3N00A 4P6XA 4Q50A 4Y29A 1YP0A 2I4JA 1K4WA 3OOFA 4YMQA 2NPAA 5DXEA 4E4QA 4RUJA 3VJHA 2O4JA 3MNEA 4HLWA 4OGHA 3D6DA 3Q95A 2PINA 2OVHA 5DVCA 4BCRA 2ZY0A 4MGBA 3FUGA 3OLFA 2Q7JA 3VT3A 3V9YA 5G45A 5JI0D 3B0WA 2QABA 1NQ0A 5DLRA 5APJA 2QPYA 5KYAA 3TKMA 3S9SA 5GICA 5AWJA 3MNPA 1QKUA 1Y0SA 2IOGA 3G0WA 1TFCA 3V49A 3R5MA 5KRIA 3CS4A 1I7IA 4IVWA 2PIQA 2A3IA 4L96A 1S19A 4MG8B 2ZXZA 3OSWA 5DXBB 2P7AA 5DMCA 4RWVA 2I4PA 4NB6A 2P15A 4HEEX 4R6SA 3QT0A 4OZTE 2QTUA 4PP6A 3W0GA 5DX3B 1FM9A 2Z4JA 5DSHA 2OM9A 5HCVA 2Q61A 3ADSA 1X7JA 2J4AA 1YOKA 5KRHA 4OFUA 1NRLA 1NQ1A 1ZKYA 2JFAA 3A78A 3H0AD 4ZNSA 3SP6A 2QMVA 3W0CA 3BQDA 2ZVTA 1DKFA 3WJ5A 1R20A 5DZ3A 4IQRA 3B68A 4UDBA 3VRWA 4NQAB 5DV8A 4WVDA 2HASA 1FCZA 4APUA 2XKWA 3KDUA 3FC6A 1NDEA 3HZFA 3M7RA 3G9EA 1K7LA 3A40X 3HC5A 2ZK5A 5GIDA 5DI7A 3VJIA 1I37A 4WHFA 3P88A 2ZNQA 1FM6A 3A2HA 4A4WA 2VV4A 1X78A 1XJ7A 3OGTA 5DRJA 4OEAA 5SYZA 3TKCA 4N73A 2HB8A 5EJVA 1YOWA 5DWEA 4OJBA 2GTKA 3ZRAA 2NXXE 5FQVA 3FXVA 2JJ3A 5DUHA 2PRGA 4JGVA 5C4OA 1XLSE 1YJEA 5E14A 1YUCA 2PIXA 1T63A 3AZ3A 3ILZA 4IA3A 4R06A 2GPOA 4OILA 1S0XA 2R6YA 4OKBA 2QGTA 3AUQA 2Q59A 5KRCA 2G44A 3L0JA 4MG6A 3ADTA 2QZOA 2Q3YA 3W5PA 5EI1A 2B23A 4N8RA 2AA6A 2YJDA 3UUAB 1EXXA 1I38A 4RE8A 4DORA 5ICKA 1T65A 4EM9A 4UDDA 4OZRE 2YLYA 3GD2A 1ZEOA 4RAKA 5E0XA 3WT5A 5DKEA 2EWPA 2Q6RA 5DV6A 2Z4BA 1IE9A 3R8IA 3VT9A 3SP9A 3L1BA 2Q7IA 3X31A 2H79A 4OIUA 1ZUCA 4QL8A 1T7MA 3K22A 4G1DA 1QKTA 1X76A 2Q7KA 1XVPB 3HVLA 3OS8C 5DXQA 5LWPA 3E00D 2ACLB 5DUEA 1A52A 4IVYA 4KZJA 4RMEA 1KKQA 1XV9A 4ZNHA 3ADXA 3AFRA 5M96A 3B67A 3ERDA 4JYHA 4MG7A 4ZO1B 3D24A 4OIVA 1GWQA 2VSRA 1R1KA 2AX9A 4JYGA 1RKHA 3KMRA 4ZNUA 2QA8A 1FM9D 4MGCA 3DZUA 4IWFA 3EYBA 3G8OA 4TUZB 1G1UA 4WPFA 3VRUA 4OEZA 2AO6A 4YT1A 1S0ZA 5EITA 1ILHA 3OOKA 3P89A 3WMHA 4X1GA 2VV1A 5C4SA 2ZLAA 3AX8A 1XOWA 2ZMJA 3A3ZX 3OLSA 1HG4A 3OMPA 2AB2A 3VT7A 3VI8A 2QXMA 3NOAA 3CS8A 3WT7A 3B0TA 5DUGA 1XLSA 3WT6A 4K4JA 2GWXA 3DY6A 1VJBA 1N83A 5HYRA 4MGBB 5G43A 3DZYA 1OVLB 4ZI1A 1PRGA 3F5CA 1U3RA 1FM6D 5KYJA 1U3SA 3OMOA 1K74A 2XYWA 4XAOA 3L0LA 4OH5A 1G2NA 2OCFA 3KDTA 2NW4A 2AYRA 4ONIA 2ATHA 1EXAA 3PEQA 5JJMA 3VT5A 3JZBA 3AUNA 1UPWA 3OS9A 1L2IA 1WM0X 2AMBA 5DXPA 4A4VA 5DXGA 3OZ0A 3UUDA 2YLQA 1UOMA 4P6WA 2FAIA 2QA6A 2HAMA 2ZNOA 4E2JA 3OKIA 3PRGA 5E7VA 4DK7A 1FBYA 3VT8A 4J26A 3ADWA 3AURA 3B3KA 5HJPB 4J5WA 2AXAA 2JF9A 3K23A 1T76A 1ZDUA 5DZ0A 1NUOA 2YHDA 4J5XA 5KCTA 3GYUA 5L7EA 4IV2A 3U9QA 3A9EA 5DWLA 2P1UA 3W5QA 2BJ4B 1OSHA 4PLEA 4MG9A 3UVVA 4J5WC 1ZDTA 5KCEA 1XZXX 5DYDA 3ET2A 2B1VA 5GIEA 5L7GA 5LGAA 1QKMA 2AX6A 2Q6SA 2GPVA 2XYJA 5AVIA 4FN9A 3VT6A 3X1HA 4B7WA 2P1VA 4J24A 1YY4A 2ZK4A 2PJLA 4MG5A 3CLDA 3FS1A 4OK1A 5DWJA 5DRMA 1SR7A 3FEIA 4OH6A 3SZ1A 1TXIA 4KZIA 1N46A 1Y9RA 5DL4A 3UU7A 5E1CA 2I0JA 5DVSA 4G1ZA 2ZBSA 4PLDA 4L98A 3FEJA 4DQMA 4TV1B 4R2UA 3R8DA 1T5ZA 3F7DA 4NY9A 1M13A 5DV3A 3V9TA 4ZNVA 2GPUA 2Q1HA 2R6WA 5G42A 1P93A 2E2RA 1YINA 3FURA 5EGVA 1XP6A 5AYGA 3RVFA 1XPCA 2J7YA 3IXPA 3E94A 4FNEA 4G21A 4OLMA 5CJ6A 3DCTA 4OKTA 1FD0A 3OMMA 5KRKA 1KV6A 1R1KD 1G5YA 5AVLA 4MG8A 4M8EA 5KCWA 4G2IA 3IA6A 5ACCA 2HARA 2QZOB 4ITEA 4MDDA 1P8DA 2VV0A 3GWXA 3VHUA 4DOSA 4OEYA 5AAVB 1Z5XU 3A2JA 1U9EA 5HJSA 4WHGA 3RUUA 5DX3A 3DZYD 2P54A 2YFEA 3ZRBA 2B1ZA 2HWQA 2Q6JA 3CS6A 1YA3A 3RUTA 1UHLB 1YIMA 2Q7LA 1Z95A 1SKXA 4N5GA 1R6GA 1XDKB 5EHJA 4LBDA 1QKNA 3NSQA 1SJ0A 3L03A 5E15A 3WFGA 3PCUA 4MGDA 5IAWA 5B5BA 5KCCA 4IW6A 3CWDA 3JZCA 2QNVA 5DXRA 5KCDA 2P4YA 1K74D 4POHA 1X7BA 2V0VA 1RKGA 1XNXA 3OAPA 5DKSA 1NQ7A 1OT7A 2P1TA 5DIEA 4OJ9A 1EREA 4S14A 2V7CA 1LV2A 3OLLA 4FHHA 2YJAB 4OEDA 2AA7A 4QK4A 2OAXA 4DMAA 4YPQA 2PITA 1LBDA 3D5FA 3O1DA 4PPSA 2P7GA 2AX8A 4IUIA 2YATA 3ZQTA 4ZN9A 1S9QA 2ZASA 1FCYA 3CJWA 1G50A 1XQ3A 5KRJA 5KR9A 4F9MA 2QE4A 2Q1VA 2YLPA 2ZNNA 5DIGA 2HWRA 2ZK2A 5E19A 5G44A 3WFFA 3P0UA 2QR9A 2YLOA 1ZH7A 4ZNTA 1R5KA 4PP3A 2QGWA 5IXKA 3BEJA 3CQVA 3NSPA 1DB1A 2OUZA 4XT9A 3VRTA 2ZL9A 1MVCA 3ET3A 3FALA 4OKWA 3W0JA 2F4BA 2H77A 3OSAA 4ZN7A 1NAXA 4IA1A 1XP1A 3T03A 4K6IA 3UUCA 2HB7A 1T79A 5G46A 1T74A 3UUAA 4A2JA 2HC4A 2ABIA 1GWRA 1XAPA 4XTAA 1IE8A 1RDTA 2G5OA 3V9VA 1OSVA 2OZ7A 2ZK6A 1KNUA 1R20D 3HQ5A 4PP5A 2POBA 5AZVA 3L3ZA 2AMAA 3IPSA 5APKA 3PO9A 2QSEA 3CTBA 1E3KA 4MGAA 3Q95B 2AA5A 2HVCA 5DXKA 5DTVA 2ZK1A 5I4VA 1PCGA 4XUMA 3TY0A 3R8AA 4K7AA 5H1EA 3GZ9A 2IHQA 3VSOA 4CI4A 3KBAA 5FQPA 5DWIA 2O4RA 3RY9A 3VT4A 1ZAFA 3L0EA 5DIDA 2FSZA 2Q70A 4ITFA 4DK8A 2O9IA 3A9EB 5KRLA 3DT3A 3VN2A 4EMAA 1A28A 5DXMA 5FQSA 1Y0XX 4MG9B 3UVVB 1XQCA 4PXMA 4QM0A 5DKBA 3VHWA 4DM6A 4QJRA 1X7RA 5ETHA 4CI5A 4OJ4A 5DVVA 1E3GA 4TUZA 3VTBA 1L2JA 3TX7B 2PKLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PWL A;  2ZXN A;  4XUH A;  5DMF A;  3X1I A;  3ET0 A;  4OFR A;  1YYE A;  2PIV A;  1UPV A;  4RZG A;  2AWH A;  2JFA B;  3LMP A;  2FVJ A;  3GYT A;  3UU7 B;  1DKF B;  4OKX A;  4J5X C;  3DR1 A;  3VJS A;  1N4H A;  1S9P A;  1T73 A;  2VV3 A;  3K8S A;  1OVL A;  4XLD A;  2QXS A;  4NUF A;  3FC6 B;  4S0S A;  5APH A;  3AN4 A;  1Z5X E;  3KPZ A;  2VST A;  2QW4 A;  2ZXM A;  5KRM A;  3E00 A;  4WLB A;  5DWG A;  3PBA A;  3O1E A;  2Q5P A;  3PLZ A;  1SQN A;  2VV4 B;  2ZNP A;  3CDS A;  3AZ1 A;  4RZF A;  2R40 A;  1PQ6 A;  2HFP A;  3GWS X;  5DK9 A;  3IPU A;  3VJT A;  2QH6 A;  5AWK A;  3HO0 A;  3OMQ A;  2ZFX A;  3B65 A;  4JL4 A;  1YMT A;  4M8H A;  2BAW A;  4Q13 A;  4RFW A;  5EC9 A;  3ERT A;  3KMG A;  1XNN A;  3HC6 A;  2Q5S A;  5DZH A;  5HJP A;  1H9U A;  1ERR A;  3KYT A;  1XP9 A;  5G3J A;  3RLJ A;  4RZE A;  4ZJR A;  4IA7 A;  1MZN A;  2ZLC A;  2J14 A;  3D57 A;  2Q8S A;  4KZM A;  4PF3 A;  4XHD A;  4PVU A;  3ADU A;  2Q59 B;  3DZU D;  1XB7 A;  2BJ4 A;  1MV9 A;  2HCD A;  3B0R A;  4G20 A;  4OHA A;  3OZJ A;  5DXB A;  5GT4 A;  4G1Y A;  2PIR A;  2AM9 A;  3R2A A;  3R5N A;  3HLV A;  2GPP A;  1RDT D;  4MGD B;  1NYX A;  4FHI A;  5DY8 A;  5KD9 A;  5DU5 A;  2OVM A;  3GN8 A;  5FQR A;  1NHZ A;  5KRA A;  5AAU A;  4IA2 A;  1NAV A;  3KMZ A;  3W0A A;  4DM8 A;  5L11 A;  4IS8 A;  2POG A;  2GL8 A;  3H52 A;  4REF A;  2GP7 A;  3X36 A;  3W0I A;  4RUP A;  3OSI A;  4PPP A;  1T7T A;  3P8X A;  3ZR7 A;  2J7X A;  2ZMI A;  3OKH A;  3VHV A;  4OZT U;  1X7E A;  4TV1 A;  5A86 A;  3R29 A;  4E4K A;  2NV7 A;  2GIU A;  3HM1 A;  2ZMH A;  2B50 A;  2ZK0 A;  3HOD A;  4PRG A;  2ZK3 A;  2AAX A;  3W0H A;  1XV9 B;  2P7Z A;  3B0Q A;  2AA2 A;  2REW A;  2ZKC A;  2XYX A;  3IPQ A;  4REE A;  3WGP A;  4WQP A;  5KRO A;  1FCX A;  3DCU A;  3KFC A;  4MG7 B;  1NQ2 A;  2PIP L;  3FAL B;  4IW8 A;  3K6P A;  3ADV A;  3L3X A;  4JYI A;  3WJ4 A;  1M2Z A;  4IWC A;  1RJK A;  4RUO X;  2QA8 B;  3B1M A;  2AX7 A;  5AAV A;  3FLI A;  5B41 A;  3G8I A;  4X1F A;  4ZJW A;  3V3Q A;  5IZ0 A;  1Q4X A;  4UDC A;  4RMD A;  5C4T A;  3V3E A;  5DKG A;  2HBH A;  4ZOM A;  2VV1 B;  1UHL A;  3WWR A;  1RK3 A;  4QE8 A;  1ILG A;  1GWX A;  2VV2 A;  4S0T A;  5KRF A;  3W0Y A;  1XDK A;  3OS8 A;  4NIE A;  3OMK A;  3V4A A;  2Q60 A;  3H0A A;  3A2I A;  4MGA B;  4JAZ A;  4ZNW A;  5DYB A;  5AK2 A;  4LNW A;  2PIU A;  4ZO1 X;  4IU7 A;  5FQT A;  5K13 A;  1PDU A;  3F5C B;  3B66 A;  3KWY A;  5DZ1 A;  4POJ A;  1U3Q A;  3ET1 A;  4FGY A;  1XIU A;  2IOK A;  5G5W A;  5HYK A;  5HZC A;  2PIW A;  2I4Z A;  4S15 A;  2Q5G A;  5DP0 A;  2R40 D;  3BC5 A;  2G0H A;  4LSJ A;  5AZT A;  3UP3 A;  3W5T A;  4Q0A C;  4YNK A;  5JJM B;  1T7R A;  3AN3 A;  3VRV A;  3B5R A;  5C4U A;  3UUD B;  3D90 A;  1GS4 A;  4O8F A;  1I7G A;  4IV4 A;  1HJ1 A;  1XVP A;  3RLL A;  2LBD A;  1T7F A;  2ACL A;  3VTC A;  5DZI A;  3IXP D;  4N1Y A;  4OAR A;  3VSP A;  4OC7 A;  3AZ2 A;  1PQC A;  3E7C A;  4RMC A;  2W8Y A;  4UDA A;  4OZR U;  5L7H A;  3CDP A;  5KCF A;  3UP0 A;  4CSJ A;  5E0W A;  5F9B A;  2PNU A;  5JY3 A;  2XHS A;  4QE6 A;  2NXX A;  3MNO A;  3VTD A;  3IMY A;  4LTW A;  4XI3 A;  2PIO A;  5KCU A;  3W5R A;  1PK5 A;  3GBK A;  3WTQ A;  1BSX A;  1PQ9 A;  1M7W A;  1PZL A;  1ZGY A;  2G0G A;  4G2H A;  2I0G A;  4LNX A;  3LBD A;  3N00 A;  4P6X A;  4Q50 A;  4Y29 A;  1YP0 A;  2I4J A;  1K4W A;  3OOF A;  4YMQ A;  2NPA A;  5DXE A;  4E4Q A;  4RUJ A;  3VJH A;  2O4J A;  3MNE A;  4HLW A;  4OGH A;  3D6D A;  3Q95 A;  2PIN A;  2OVH A;  5DVC A;  4BCR A;  2ZY0 A;  4MGB A;  3FUG A;  3OLF A;  2Q7J A;  3VT3 A;  3V9Y A;  5G45 A;  5JI0 D;  3B0W A;  2QAB A;  1NQ0 A;  5DLR A;  5APJ A;  2QPY A;  5KYA A;  3TKM A;  3S9S A;  5GIC A;  5AWJ A;  3MNP A;  1QKU A;  1Y0S A;  2IOG A;  3G0W A;  1TFC A;  3V49 A;  3R5M A;  5KRI A;  3CS4 A;  1I7I A;  4IVW A;  2PIQ A;  2A3I A;  4L96 A;  1S19 A;  4MG8 B;  2ZXZ A;  3OSW A;  5DXB B;  2P7A A;  5DMC A;  4RWV A;  2I4P A;  4NB6 A;  2P15 A;  4HEE X;  4R6S A;  3QT0 A;  4OZT E;  2QTU A;  4PP6 A;  3W0G A;  5DX3 B;  1FM9 A;  2Z4J A;  5DSH A;  2OM9 A;  5HCV A;  2Q61 A;  3ADS A;  1X7J A;  2J4A A;  1YOK A;  5KRH A;  4OFU A;  1NRL A;  1NQ1 A;  1ZKY A;  2JFA A;  3A78 A;  3H0A D;  4ZNS A;  3SP6 A;  2QMV A;  3W0C A;  3BQD A;  2ZVT A;  1DKF A;  3WJ5 A;  1R20 A;  5DZ3 A;  4IQR A;  3B68 A;  4UDB A;  3VRW A;  4NQA B;  5DV8 A;  4WVD A;  2HAS A;  1FCZ A;  4APU A;  2XKW A;  3KDU A;  3FC6 A;  1NDE A;  3HZF A;  3M7R A;  3G9E A;  1K7L A;  3A40 X;  3HC5 A;  2ZK5 A;  5GID A;  5DI7 A;  3VJI A;  1I37 A;  4WHF A;  3P88 A;  2ZNQ A;  1FM6 A;  3A2H A;  4A4W A;  2VV4 A;  1X78 A;  1XJ7 A;  3OGT A;  5DRJ A;  4OEA A;  5SYZ A;  3TKC A;  4N73 A;  2HB8 A;  5EJV A;  1YOW A;  5DWE A;  4OJB A;  2GTK A;  3ZRA A;  2NXX E;  5FQV A;  3FXV A;  2JJ3 A;  5DUH A;  2PRG A;  4JGV A;  5C4O A;  1XLS E;  1YJE A;  5E14 A;  1YUC A;  2PIX A;  1T63 A;  3AZ3 A;  3ILZ A;  4IA3 A;  4R06 A;  2GPO A;  4OIL A;  1S0X A;  2R6Y A;  4OKB A;  2QGT A;  3AUQ A;  2Q59 A;  5KRC A;  2G44 A;  3L0J A;  4MG6 A;  3ADT A;  2QZO A;  2Q3Y A;  3W5P A;  5EI1 A;  2B23 A;  4N8R A;  2AA6 A;  2YJD A;  3UUA B;  1EXX A;  1I38 A;  4RE8 A;  4DOR A;  5ICK A;  1T65 A;  4EM9 A;  4UDD A;  4OZR E;  2YLY A;  3GD2 A;  1ZEO A;  4RAK A;  5E0X A;  3WT5 A;  5DKE A;  2EWP A;  2Q6R A;  5DV6 A;  2Z4B A;  1IE9 A;  3R8I A;  3VT9 A;  3SP9 A;  3L1B A;  2Q7I A;  3X31 A;  2H79 A;  4OIU A;  1ZUC A;  4QL8 A;  1T7M A;  3K22 A;  4G1D A;  1QKT A;  1X76 A;  2Q7K A;  1XVP B;  3HVL A;  3OS8 C;  5DXQ A;  5LWP A;  3E00 D;  2ACL B;  5DUE A;  1A52 A;  4IVY A;  4KZJ A;  4RME A;  1KKQ A;  1XV9 A;  4ZNH A;  3ADX A;  3AFR A;  5M96 A;  3B67 A;  3ERD A;  4JYH A;  4MG7 A;  4ZO1 B;  3D24 A;  4OIV A;  1GWQ A;  2VSR A;  1R1K A;  2AX9 A;  4JYG A;  1RKH A;  3KMR A;  4ZNU A;  2QA8 A;  1FM9 D;  4MGC A;  3DZU A;  4IWF A;  3EYB A;  3G8O A;  4TUZ B;  1G1U A;  4WPF A;  3VRU A;  4OEZ A;  2AO6 A;  4YT1 A;  1S0Z A;  5EIT A;  1ILH A;  3OOK A;  3P89 A;  3WMH A;  4X1G A;  2VV1 A;  5C4S A;  2ZLA A;  3AX8 A;  1XOW A;  2ZMJ A;  3A3Z X;  3OLS A;  1HG4 A;  3OMP A;  2AB2 A;  3VT7 A;  3VI8 A;  2QXM A;  3NOA A;  3CS8 A;  3WT7 A;  3B0T A;  5DUG A;  1XLS A;  3WT6 A;  4K4J A;  2GWX A;  3DY6 A;  1VJB A;  1N83 A;  5HYR A;  4MGB B;  5G43 A;  3DZY A;  1OVL B;  4ZI1 A;  1PRG A;  3F5C A;  1U3R A;  1FM6 D;  5KYJ A;  1U3S A;  3OMO A;  1K74 A;  2XYW A;  4XAO A;  3L0L A;  4OH5 A;  1G2N A;  2OCF A;  3KDT A;  2NW4 A;  2AYR A;  4ONI A;  2ATH A;  1EXA A;  3PEQ A;  5JJM A;  3VT5 A;  3JZB A;  3AUN A;  1UPW A;  3OS9 A;  1L2I A;  1WM0 X;  2AMB A;  5DXP A;  4A4V A;  5DXG A;  3OZ0 A;  3UUD A;  2YLQ A;  1UOM A;  4P6W A;  2FAI A;  2QA6 A;  2HAM A;  2ZNO A;  4E2J A;  3OKI A;  3PRG A;  5E7V A;  4DK7 A;  1FBY A;  3VT8 A;  4J26 A;  3ADW A;  3AUR A;  3B3K A;  5HJP B;  4J5W A;  2AXA A;  2JF9 A;  3K23 A;  1T76 A;  1ZDU A;  5DZ0 A;  1NUO A;  2YHD A;  4J5X A;  5KCT A;  3GYU A;  5L7E A;  4IV2 A;  3U9Q A;  3A9E A;  5DWL A;  2P1U A;  3W5Q A;  2BJ4 B;  1OSH A;  4PLE A;  4MG9 A;  3UVV A;  4J5W C;  1ZDT A;  5KCE A;  1XZX X;  5DYD A;  3ET2 A;  2B1V A;  5GIE A;  5L7G A;  5LGA A;  1QKM A;  2AX6 A;  2Q6S A;  2GPV A;  2XYJ A;  5AVI A;  4FN9 A;  3VT6 A;  3X1H A;  4B7W A;  2P1V A;  4J24 A;  1YY4 A;  2ZK4 A;  2PJL A;  4MG5 A;  3CLD A;  3FS1 A;  4OK1 A;  5DWJ A;  5DRM A;  1SR7 A;  3FEI A;  4OH6 A;  3SZ1 A;  1TXI A;  4KZI A;  1N46 A;  1Y9R A;  5DL4 A;  3UU7 A;  5E1C A;  2I0J A;  5DVS A;  4G1Z A;  2ZBS A;  4PLD A;  4L98 A;  3FEJ A;  4DQM A;  4TV1 B;  4R2U A;  3R8D A;  1T5Z A;  3F7D A;  4NY9 A;  1M13 A;  5DV3 A;  3V9T A;  4ZNV A;  2GPU A;  2Q1H A;  2R6W A;  5G42 A;  1P93 A;  2E2R A;  1YIN A;  3FUR A;  5EGV A;  1XP6 A;  5AYG A;  3RVF A;  1XPC A;  2J7Y A;  3IXP A;  3E94 A;  4FNE A;  4G21 A;  4OLM A;  5CJ6 A;  3DCT A;  4OKT A;  1FD0 A;  3OMM A;  5KRK A;  1KV6 A;  1R1K D;  1G5Y A;  5AVL A;  4MG8 A;  4M8E A;  5KCW A;  4G2I A;  3IA6 A;  5ACC A;  2HAR A;  2QZO B;  4ITE A;  4MDD A;  1P8D A;  2VV0 A;  3GWX A;  3VHU A;  4DOS A;  4OEY A;  5AAV B;  1Z5X U;  3A2J A;  1U9E A;  5HJS A;  4WHG A;  3RUU A;  5DX3 A;  3DZY D;  2P54 A;  2YFE A;  3ZRB A;  2B1Z A;  2HWQ A;  2Q6J A;  3CS6 A;  1YA3 A;  3RUT A;  1UHL B;  1YIM A;  2Q7L A;  1Z95 A;  1SKX A;  4N5G A;  1R6G A;  1XDK B;  5EHJ A;  4LBD A;  1QKN A;  3NSQ A;  1SJ0 A;  3L03 A;  5E15 A;  3WFG A;  3PCU A;  4MGD A;  5IAW A;  5B5B A;  5KCC A;  4IW6 A;  3CWD A;  3JZC A;  2QNV A;  5DXR A;  5KCD A;  2P4Y A;  1K74 D;  4POH A;  1X7B A;  2V0V A;  1RKG A;  1XNX A;  3OAP A;  5DKS A;  1NQ7 A;  1OT7 A;  2P1T A;  5DIE A;  4OJ9 A;  1ERE A;  4S14 A;  2V7C A;  1LV2 A;  3OLL A;  4FHH A;  2YJA B;  4OED A;  2AA7 A;  4QK4 A;  2OAX A;  4DMA A;  4YPQ A;  2PIT A;  1LBD A;  3D5F A;  3O1D A;  4PPS A;  2P7G A;  2AX8 A;  4IUI A;  2YAT A;  3ZQT A;  4ZN9 A;  1S9Q A;  2ZAS A;  1FCY A;  3CJW A;  1G50 A;  1XQ3 A;  5KRJ A;  5KR9 A;  4F9M A;  2QE4 A;  2Q1V A;  2YLP A;  2ZNN A;  5DIG A;  2HWR A;  2ZK2 A;  5E19 A;  5G44 A;  3WFF A;  3P0U A;  2QR9 A;  2YLO A;  1ZH7 A;  4ZNT A;  1R5K A;  4PP3 A;  2QGW A;  5IXK A;  3BEJ A;  3CQV A;  3NSP A;  1DB1 A;  2OUZ A;  4XT9 A;  3VRT A;  2ZL9 A;  1MVC A;  3ET3 A;  3FAL A;  4OKW A;  3W0J A;  2F4B A;  2H77 A;  3OSA A;  4ZN7 A;  1NAX A;  4IA1 A;  1XP1 A;  3T03 A;  4K6I A;  3UUC A;  2HB7 A;  1T79 A;  5G46 A;  1T74 A;  3UUA A;  4A2J A;  2HC4 A;  2ABI A;  1GWR A;  1XAP A;  4XTA A;  1IE8 A;  1RDT A;  2G5O A;  3V9V A;  1OSV A;  2OZ7 A;  2ZK6 A;  1KNU A;  1R20 D;  3HQ5 A;  4PP5 A;  2POB A;  5AZV A;  3L3Z A;  2AMA A;  3IPS A;  5APK A;  3PO9 A;  2QSE A;  3CTB A;  1E3K A;  4MGA A;  3Q95 B;  2AA5 A;  2HVC A;  5DXK A;  5DTV A;  2ZK1 A;  5I4V A;  1PCG A;  4XUM A;  3TY0 A;  3R8A A;  4K7A A;  5H1E A;  3GZ9 A;  2IHQ A;  3VSO A;  4CI4 A;  3KBA A;  5FQP A;  5DWI A;  2O4R A;  3RY9 A;  3VT4 A;  1ZAF A;  3L0E A;  5DID A;  2FSZ A;  2Q70 A;  4ITF A;  4DK8 A;  2O9I A;  3A9E B;  5KRL A;  3DT3 A;  3VN2 A;  4EMA A;  1A28 A;  5DXM A;  5FQS A;  1Y0X X;  4MG9 B;  3UVV B;  1XQC A;  4PXM A;  4QM0 A;  5DKB A;  3VHW A;  4DM6 A;  4QJR A;  1X7R A;  5ETH A;  4CI5 A;  4OJ4 A;  5DVV A;  1E3G A;  4TUZ A;  3VTB A;  1L2J A;  3TX7 B;  2PKL A; 
#chains in the Genus database with same CATH topology
 4PWL A;  2ZXN A;  4XUH A;  5DMF A;  3X1I A;  3ET0 A;  4OFR A;  1YYE A;  2PIV A;  1UPV A;  4RZG A;  2AWH A;  2JFA B;  3LMP A;  2FVJ A;  3GYT A;  3UU7 B;  1DKF B;  4OKX A;  4J5X C;  3DR1 A;  3VJS A;  1N4H A;  1S9P A;  1T73 A;  2VV3 A;  3K8S A;  1OVL A;  4XLD A;  2QXS A;  4NUF A;  3FC6 B;  4S0S A;  5APH A;  3AN4 A;  1Z5X E;  3KPZ A;  2VST A;  2QW4 A;  2ZXM A;  5KRM A;  3E00 A;  4WLB A;  5DWG A;  3PBA A;  3O1E A;  2Q5P A;  3PLZ A;  1SQN A;  2VV4 B;  2ZNP A;  3CDS A;  3AZ1 A;  4RZF A;  2R40 A;  1PQ6 A;  2HFP A;  3GWS X;  5DK9 A;  3IPU A;  3VJT A;  2QH6 A;  5AWK A;  3HO0 A;  3OMQ A;  2ZFX A;  3B65 A;  4JL4 A;  1YMT A;  4M8H A;  2BAW A;  4Q13 A;  4RFW A;  5EC9 A;  3ERT A;  3KMG A;  1XNN A;  3HC6 A;  2Q5S A;  5DZH A;  5HJP A;  1H9U A;  1ERR A;  3KYT A;  1XP9 A;  5G3J A;  3RLJ A;  4RZE A;  4ZJR A;  4IA7 A;  1MZN A;  2ZLC A;  2J14 A;  3D57 A;  2Q8S A;  4KZM A;  4PF3 A;  4XHD A;  4PVU A;  3ADU A;  2Q59 B;  3DZU D;  1XB7 A;  2BJ4 A;  1MV9 A;  2HCD A;  3B0R A;  4G20 A;  4OHA A;  3OZJ A;  5DXB A;  5GT4 A;  4G1Y A;  2PIR A;  2AM9 A;  3R2A A;  3R5N A;  3HLV A;  2GPP A;  1RDT D;  4MGD B;  1NYX A;  4FHI A;  5DY8 A;  5KD9 A;  5DU5 A;  2OVM A;  3GN8 A;  5FQR A;  1NHZ A;  5KRA A;  5AAU A;  4IA2 A;  1NAV A;  3KMZ A;  3W0A A;  4DM8 A;  5L11 A;  4IS8 A;  2POG A;  2GL8 A;  3H52 A;  4REF A;  2GP7 A;  3X36 A;  3W0I A;  4RUP A;  3OSI A;  4PPP A;  1T7T A;  3P8X A;  3ZR7 A;  2J7X A;  2ZMI A;  3OKH A;  3VHV A;  4OZT U;  1X7E A;  4TV1 A;  5A86 A;  3R29 A;  4E4K A;  2NV7 A;  2GIU A;  3HM1 A;  2ZMH A;  2B50 A;  2ZK0 A;  3HOD A;  4PRG A;  2ZK3 A;  2AAX A;  3W0H A;  1XV9 B;  2P7Z A;  3B0Q A;  2AA2 A;  2REW A;  2ZKC A;  2XYX A;  3IPQ A;  4REE A;  3WGP A;  4WQP A;  5KRO A;  1FCX A;  3DCU A;  3KFC A;  4MG7 B;  1NQ2 A;  2PIP L;  3FAL B;  4IW8 A;  3K6P A;  3ADV A;  3L3X A;  4JYI A;  3WJ4 A;  1M2Z A;  4IWC A;  1RJK A;  4RUO X;  2QA8 B;  3B1M A;  2AX7 A;  5AAV A;  3FLI A;  5B41 A;  3G8I A;  4X1F A;  4ZJW A;  3V3Q A;  5IZ0 A;  1Q4X A;  4UDC A;  4RMD A;  5C4T A;  3V3E A;  5DKG A;  2HBH A;  4ZOM A;  2VV1 B;  1UHL A;  3WWR A;  1RK3 A;  4QE8 A;  1ILG A;  1GWX A;  2VV2 A;  4S0T A;  5KRF A;  3W0Y A;  1XDK A;  3OS8 A;  4NIE A;  3OMK A;  3V4A A;  2Q60 A;  3H0A A;  3A2I A;  4MGA B;  4JAZ A;  4ZNW A;  5DYB A;  5AK2 A;  4LNW A;  2PIU A;  4ZO1 X;  4IU7 A;  5FQT A;  5K13 A;  1PDU A;  3F5C B;  3B66 A;  3KWY A;  5DZ1 A;  4POJ A;  1U3Q A;  3ET1 A;  4FGY A;  1XIU A;  2IOK A;  5G5W A;  5HYK A;  5HZC A;  2PIW A;  2I4Z A;  4S15 A;  2Q5G A;  5DP0 A;  2R40 D;  3BC5 A;  2G0H A;  4LSJ A;  5AZT A;  3UP3 A;  3W5T A;  4Q0A C;  4YNK A;  5JJM B;  1T7R A;  3AN3 A;  3VRV A;  3B5R A;  5C4U A;  3UUD B;  3D90 A;  1GS4 A;  4O8F A;  1I7G A;  4IV4 A;  1HJ1 A;  1XVP A;  3RLL A;  2LBD A;  1T7F A;  2ACL A;  3VTC A;  5DZI A;  3IXP D;  4N1Y A;  4OAR A;  3VSP A;  4OC7 A;  3AZ2 A;  1PQC A;  3E7C A;  4RMC A;  2W8Y A;  4UDA A;  4OZR U;  5L7H A;  3CDP A;  5KCF A;  3UP0 A;  4CSJ A;  5E0W A;  5F9B A;  2PNU A;  5JY3 A;  2XHS A;  4QE6 A;  2NXX A;  3MNO A;  3VTD A;  3IMY A;  4LTW A;  4XI3 A;  2PIO A;  5KCU A;  3W5R A;  1PK5 A;  3GBK A;  3WTQ A;  1BSX A;  1PQ9 A;  1M7W A;  1PZL A;  1ZGY A;  2G0G A;  4G2H A;  2I0G A;  4LNX A;  3LBD A;  3N00 A;  4P6X A;  4Q50 A;  4Y29 A;  1YP0 A;  2I4J A;  1K4W A;  3OOF A;  4YMQ A;  2NPA A;  5DXE A;  4E4Q A;  4RUJ A;  3VJH A;  2O4J A;  3MNE A;  4HLW A;  4OGH A;  3D6D A;  3Q95 A;  2PIN A;  2OVH A;  5DVC A;  4BCR A;  2ZY0 A;  4MGB A;  3FUG A;  3OLF A;  2Q7J A;  3VT3 A;  3V9Y A;  5G45 A;  5JI0 D;  3B0W A;  2QAB A;  1NQ0 A;  5DLR A;  5APJ A;  2QPY A;  5KYA A;  3TKM A;  3S9S A;  5GIC A;  5AWJ A;  3MNP A;  1QKU A;  1Y0S A;  2IOG A;  3G0W A;  1TFC A;  3V49 A;  3R5M A;  5KRI A;  3CS4 A;  1I7I A;  4IVW A;  2PIQ A;  2A3I A;  4L96 A;  1S19 A;  4MG8 B;  2ZXZ A;  3OSW A;  5DXB B;  2P7A A;  5DMC A;  4RWV A;  2I4P A;  4NB6 A;  2P15 A;  4HEE X;  4R6S A;  3QT0 A;  4OZT E;  2QTU A;  4PP6 A;  3W0G A;  5DX3 B;  1FM9 A;  2Z4J A;  5DSH A;  2OM9 A;  5HCV A;  2Q61 A;  3ADS A;  1X7J A;  2J4A A;  1YOK A;  5KRH A;  4OFU A;  1NRL A;  1NQ1 A;  1ZKY A;  2JFA A;  3A78 A;  3H0A D;  4ZNS A;  3SP6 A;  2QMV A;  3W0C A;  3BQD A;  2ZVT A;  1DKF A;  3WJ5 A;  1R20 A;  5DZ3 A;  4IQR A;  3B68 A;  4UDB A;  3VRW A;  4NQA B;  5DV8 A;  4WVD A;  2HAS A;  1FCZ A;  4APU A;  2XKW A;  3KDU A;  3FC6 A;  1NDE A;  3HZF A;  3M7R A;  3G9E A;  1K7L A;  3A40 X;  3HC5 A;  2ZK5 A;  5GID A;  5DI7 A;  3VJI A;  1I37 A;  4WHF A;  3P88 A;  2ZNQ A;  1FM6 A;  3A2H A;  4A4W A;  2VV4 A;  1X78 A;  1XJ7 A;  3OGT A;  5DRJ A;  4OEA A;  5SYZ A;  3TKC A;  4N73 A;  2HB8 A;  5EJV A;  1YOW A;  5DWE A;  4OJB A;  2GTK A;  3ZRA A;  2NXX E;  5FQV A;  3FXV A;  2JJ3 A;  5DUH A;  2PRG A;  4JGV A;  5C4O A;  1XLS E;  1YJE A;  5E14 A;  1YUC A;  2PIX A;  1T63 A;  3AZ3 A;  3ILZ A;  4IA3 A;  4R06 A;  2GPO A;  4OIL A;  1S0X A;  2R6Y A;  4OKB A;  2QGT A;  3AUQ A;  2Q59 A;  5KRC A;  2G44 A;  3L0J A;  4MG6 A;  3ADT A;  2QZO A;  2Q3Y A;  3W5P A;  5EI1 A;  2B23 A;  4N8R A;  2AA6 A;  2YJD A;  3UUA B;  1EXX A;  1I38 A;  4RE8 A;  4DOR A;  5ICK A;  1T65 A;  4EM9 A;  4UDD A;  4OZR E;  2YLY A;  3GD2 A;  1ZEO A;  4RAK A;  5E0X A;  3WT5 A;  5DKE A;  2EWP A;  2Q6R A;  5DV6 A;  2Z4B A;  1IE9 A;  3R8I A;  3VT9 A;  3SP9 A;  3L1B A;  2Q7I A;  3X31 A;  2H79 A;  4OIU A;  1ZUC A;  4QL8 A;  1T7M A;  3K22 A;  4G1D A;  1QKT A;  1X76 A;  2Q7K A;  1XVP B;  3HVL A;  3OS8 C;  5DXQ A;  5LWP A;  3E00 D;  2ACL B;  5DUE A;  1A52 A;  4IVY A;  4KZJ A;  4RME A;  1KKQ A;  1XV9 A;  4ZNH A;  3ADX A;  3AFR A;  5M96 A;  3B67 A;  3ERD A;  4JYH A;  4MG7 A;  4ZO1 B;  3D24 A;  4OIV A;  1GWQ A;  2VSR A;  1R1K A;  2AX9 A;  4JYG A;  1RKH A;  3KMR A;  4ZNU A;  2QA8 A;  1FM9 D;  4MGC A;  3DZU A;  4IWF A;  3EYB A;  3G8O A;  4TUZ B;  1G1U A;  4WPF A;  3VRU A;  4OEZ A;  2AO6 A;  4YT1 A;  1S0Z A;  5EIT A;  1ILH A;  3OOK A;  3P89 A;  3WMH A;  4X1G A;  2VV1 A;  5C4S A;  2ZLA A;  3AX8 A;  1XOW A;  2ZMJ A;  3A3Z X;  3OLS A;  1HG4 A;  3OMP A;  2AB2 A;  3VT7 A;  3VI8 A;  2QXM A;  3NOA A;  3CS8 A;  3WT7 A;  3B0T A;  5DUG A;  1XLS A;  3WT6 A;  4K4J A;  2GWX A;  3DY6 A;  1VJB A;  1N83 A;  5HYR A;  4MGB B;  5G43 A;  3DZY A;  1OVL B;  4ZI1 A;  1PRG A;  3F5C A;  1U3R A;  1FM6 D;  5KYJ A;  1U3S A;  3OMO A;  1K74 A;  2XYW A;  4XAO A;  3L0L A;  4OH5 A;  1G2N A;  2OCF A;  3KDT A;  2NW4 A;  2AYR A;  4ONI A;  2ATH A;  1EXA A;  3PEQ A;  5JJM A;  3VT5 A;  3JZB A;  3AUN A;  1UPW A;  3OS9 A;  1L2I A;  1WM0 X;  2AMB A;  5DXP A;  4A4V A;  5DXG A;  3OZ0 A;  3UUD A;  2YLQ A;  1UOM A;  4P6W A;  2FAI A;  2QA6 A;  2HAM A;  2ZNO A;  4E2J A;  3OKI A;  3PRG A;  5E7V A;  4DK7 A;  1FBY A;  3VT8 A;  4J26 A;  3ADW A;  3AUR A;  3B3K A;  5HJP B;  4J5W A;  2AXA A;  2JF9 A;  3K23 A;  1T76 A;  1ZDU A;  5DZ0 A;  1NUO A;  2YHD A;  4J5X A;  5KCT A;  3GYU A;  5L7E A;  4IV2 A;  3U9Q A;  3A9E A;  5DWL A;  2P1U A;  3W5Q A;  2BJ4 B;  1OSH A;  4PLE A;  4MG9 A;  3UVV A;  4J5W C;  1ZDT A;  5KCE A;  1XZX X;  5DYD A;  3ET2 A;  2B1V A;  5GIE A;  5L7G A;  5LGA A;  1QKM A;  2AX6 A;  2Q6S A;  2GPV A;  2XYJ A;  5AVI A;  4FN9 A;  3VT6 A;  3X1H A;  4B7W A;  2P1V A;  4J24 A;  1YY4 A;  2ZK4 A;  2PJL A;  4MG5 A;  3CLD A;  3FS1 A;  4OK1 A;  5DWJ A;  5DRM A;  1SR7 A;  3FEI A;  4OH6 A;  3SZ1 A;  1TXI A;  4KZI A;  1N46 A;  1Y9R A;  5DL4 A;  3UU7 A;  5E1C A;  2I0J A;  5DVS A;  4G1Z A;  2ZBS A;  4PLD A;  4L98 A;  3FEJ A;  4DQM A;  4TV1 B;  4R2U A;  3R8D A;  1T5Z A;  3F7D A;  4NY9 A;  1M13 A;  5DV3 A;  3V9T A;  4ZNV A;  2GPU A;  2Q1H A;  2R6W A;  5G42 A;  1P93 A;  2E2R A;  1YIN A;  3FUR A;  5EGV A;  1XP6 A;  5AYG A;  3RVF A;  1XPC A;  2J7Y A;  3IXP A;  3E94 A;  4FNE A;  4G21 A;  4OLM A;  5CJ6 A;  3DCT A;  4OKT A;  1FD0 A;  3OMM A;  5KRK A;  1KV6 A;  1R1K D;  1G5Y A;  5AVL A;  4MG8 A;  4M8E A;  5KCW A;  4G2I A;  3IA6 A;  5ACC A;  2HAR A;  2QZO B;  4ITE A;  4MDD A;  1P8D A;  2VV0 A;  3GWX A;  3VHU A;  4DOS A;  4OEY A;  5AAV B;  1Z5X U;  3A2J A;  1U9E A;  5HJS A;  4WHG A;  3RUU A;  5DX3 A;  3DZY D;  2P54 A;  2YFE A;  3ZRB A;  2B1Z A;  2HWQ A;  2Q6J A;  3CS6 A;  1YA3 A;  3RUT A;  1UHL B;  1YIM A;  2Q7L A;  1Z95 A;  1SKX A;  4N5G A;  1R6G A;  1XDK B;  5EHJ A;  4LBD A;  1QKN A;  3NSQ A;  1SJ0 A;  3L03 A;  5E15 A;  3WFG A;  3PCU A;  4MGD A;  5IAW A;  5B5B A;  5KCC A;  4IW6 A;  3CWD A;  3JZC A;  2QNV A;  5DXR A;  5KCD A;  2P4Y A;  1K74 D;  4POH A;  1X7B A;  2V0V A;  1RKG A;  1XNX A;  3OAP A;  5DKS A;  1NQ7 A;  1OT7 A;  2P1T A;  5DIE A;  4OJ9 A;  1ERE A;  4S14 A;  2V7C A;  1LV2 A;  3OLL A;  4FHH A;  2YJA B;  4OED A;  2AA7 A;  4QK4 A;  2OAX A;  4DMA A;  4YPQ A;  2PIT A;  1LBD A;  3D5F A;  3O1D A;  4PPS A;  2P7G A;  2AX8 A;  4IUI A;  2YAT A;  3ZQT A;  4ZN9 A;  1S9Q A;  2ZAS A;  1FCY A;  3CJW A;  1G50 A;  1XQ3 A;  5KRJ A;  5KR9 A;  4F9M A;  2QE4 A;  2Q1V A;  2YLP A;  2ZNN A;  5DIG A;  2HWR A;  2ZK2 A;  5E19 A;  5G44 A;  3WFF A;  3P0U A;  2QR9 A;  2YLO A;  1ZH7 A;  4ZNT A;  1R5K A;  4PP3 A;  2QGW A;  5IXK A;  3BEJ A;  3CQV A;  3NSP A;  1DB1 A;  2OUZ A;  4XT9 A;  3VRT A;  2ZL9 A;  1MVC A;  3ET3 A;  3FAL A;  4OKW A;  3W0J A;  2F4B A;  2H77 A;  3OSA A;  4ZN7 A;  1NAX A;  4IA1 A;  1XP1 A;  3T03 A;  4K6I A;  3UUC A;  2HB7 A;  1T79 A;  5G46 A;  1T74 A;  3UUA A;  4A2J A;  2HC4 A;  2ABI A;  1GWR A;  1XAP A;  4XTA A;  1IE8 A;  1RDT A;  2G5O A;  3V9V A;  1OSV A;  2OZ7 A;  2ZK6 A;  1KNU A;  1R20 D;  3HQ5 A;  4PP5 A;  2POB A;  5AZV A;  3L3Z A;  2AMA A;  3IPS A;  5APK A;  3PO9 A;  2QSE A;  3CTB A;  1E3K A;  4MGA A;  3Q95 B;  2AA5 A;  2HVC A;  5DXK A;  5DTV A;  2ZK1 A;  5I4V A;  1PCG A;  4XUM A;  3TY0 A;  3R8A A;  4K7A A;  5H1E A;  3GZ9 A;  2IHQ A;  3VSO A;  4CI4 A;  3KBA A;  5FQP A;  5DWI A;  2O4R A;  3RY9 A;  3VT4 A;  1ZAF A;  3L0E A;  5DID A;  2FSZ A;  2Q70 A;  4ITF A;  4DK8 A;  2O9I A;  3A9E B;  5KRL A;  3DT3 A;  3VN2 A;  4EMA A;  1A28 A;  5DXM A;  5FQS A;  1Y0X X;  4MG9 B;  3UVV B;  1XQC A;  4PXM A;  4QM0 A;  5DKB A;  3VHW A;  4DM6 A;  4QJR A;  1X7R A;  5ETH A;  4CI5 A;  4OJ4 A;  5DVV A;  1E3G A;  4TUZ A;  3VTB A;  1L2J A;  3TX7 B;  2PKL A; 
#chains in the Genus database with same CATH homology
 4PWL A;  2ZXN A;  4XUH A;  5DMF A;  3X1I A;  3ET0 A;  4OFR A;  1YYE A;  2PIV A;  1UPV A;  4RZG A;  2AWH A;  2JFA B;  3LMP A;  2FVJ A;  3GYT A;  3UU7 B;  1DKF B;  4OKX A;  4J5X C;  3DR1 A;  3VJS A;  1N4H A;  1S9P A;  1T73 A;  2VV3 A;  3K8S A;  1OVL A;  4XLD A;  2QXS A;  4NUF A;  3FC6 B;  4S0S A;  5APH A;  3AN4 A;  1Z5X E;  3KPZ A;  2VST A;  2QW4 A;  2ZXM A;  5KRM A;  3E00 A;  4WLB A;  5DWG A;  3PBA A;  3O1E A;  2Q5P A;  3PLZ A;  1SQN A;  2VV4 B;  2ZNP A;  3CDS A;  3AZ1 A;  4RZF A;  2R40 A;  1PQ6 A;  2HFP A;  3GWS X;  5DK9 A;  3IPU A;  3VJT A;  2QH6 A;  5AWK A;  3HO0 A;  3OMQ A;  2ZFX A;  3B65 A;  4JL4 A;  1YMT A;  4M8H A;  2BAW A;  4Q13 A;  4RFW A;  5EC9 A;  3ERT A;  3KMG A;  1XNN A;  3HC6 A;  2Q5S A;  5DZH A;  5HJP A;  1H9U A;  1ERR A;  3KYT A;  1XP9 A;  5G3J A;  3RLJ A;  4RZE A;  4ZJR A;  4IA7 A;  1MZN A;  2ZLC A;  2J14 A;  3D57 A;  2Q8S A;  4KZM A;  4PF3 A;  4XHD A;  4PVU A;  3ADU A;  2Q59 B;  3DZU D;  1XB7 A;  2BJ4 A;  1MV9 A;  2HCD A;  3B0R A;  4G20 A;  4OHA A;  3OZJ A;  5DXB A;  5GT4 A;  4G1Y A;  2PIR A;  2AM9 A;  3R2A A;  3R5N A;  3HLV A;  2GPP A;  1RDT D;  4MGD B;  1NYX A;  4FHI A;  5DY8 A;  5KD9 A;  5DU5 A;  2OVM A;  3GN8 A;  5FQR A;  1NHZ A;  5KRA A;  5AAU A;  4IA2 A;  1NAV A;  3KMZ A;  3W0A A;  4DM8 A;  5L11 A;  4IS8 A;  2POG A;  2GL8 A;  3H52 A;  4REF A;  2GP7 A;  3X36 A;  3W0I A;  4RUP A;  3OSI A;  4PPP A;  1T7T A;  3P8X A;  3ZR7 A;  2J7X A;  2ZMI A;  3OKH A;  3VHV A;  4OZT U;  1X7E A;  4TV1 A;  5A86 A;  3R29 A;  4E4K A;  2NV7 A;  2GIU A;  3HM1 A;  2ZMH A;  2B50 A;  2ZK0 A;  3HOD A;  4PRG A;  2ZK3 A;  2AAX A;  3W0H A;  1XV9 B;  2P7Z A;  3B0Q A;  2AA2 A;  2REW A;  2ZKC A;  2XYX A;  3IPQ A;  4REE A;  3WGP A;  4WQP A;  5KRO A;  1FCX A;  3DCU A;  3KFC A;  4MG7 B;  1NQ2 A;  2PIP L;  3FAL B;  4IW8 A;  3K6P A;  3ADV A;  3L3X A;  4JYI A;  3WJ4 A;  1M2Z A;  4IWC A;  1RJK A;  4RUO X;  2QA8 B;  3B1M A;  2AX7 A;  5AAV A;  3FLI A;  5B41 A;  3G8I A;  4X1F A;  4ZJW A;  3V3Q A;  5IZ0 A;  1Q4X A;  4UDC A;  4RMD A;  5C4T A;  3V3E A;  5DKG A;  2HBH A;  4ZOM A;  2VV1 B;  1UHL A;  3WWR A;  1RK3 A;  4QE8 A;  1ILG A;  1GWX A;  2VV2 A;  4S0T A;  5KRF A;  3W0Y A;  1XDK A;  3OS8 A;  4NIE A;  3OMK A;  3V4A A;  2Q60 A;  3H0A A;  3A2I A;  4MGA B;  4JAZ A;  4ZNW A;  5DYB A;  5AK2 A;  4LNW A;  2PIU A;  4ZO1 X;  4IU7 A;  5FQT A;  5K13 A;  1PDU A;  3F5C B;  3B66 A;  3KWY A;  5DZ1 A;  4POJ A;  1U3Q A;  3ET1 A;  4FGY A;  1XIU A;  2IOK A;  5G5W A;  5HYK A;  5HZC A;  2PIW A;  2I4Z A;  4S15 A;  2Q5G A;  5DP0 A;  2R40 D;  3BC5 A;  2G0H A;  4LSJ A;  5AZT A;  3UP3 A;  3W5T A;  4Q0A C;  4YNK A;  5JJM B;  1T7R A;  3AN3 A;  3VRV A;  3B5R A;  5C4U A;  3UUD B;  3D90 A;  1GS4 A;  4O8F A;  1I7G A;  4IV4 A;  1HJ1 A;  1XVP A;  3RLL A;  2LBD A;  1T7F A;  2ACL A;  3VTC A;  5DZI A;  3IXP D;  4N1Y A;  4OAR A;  3VSP A;  4OC7 A;  3AZ2 A;  1PQC A;  3E7C A;  4RMC A;  2W8Y A;  4UDA A;  4OZR U;  5L7H A;  3CDP A;  5KCF A;  3UP0 A;  4CSJ A;  5E0W A;  5F9B A;  2PNU A;  5JY3 A;  2XHS A;  4QE6 A;  2NXX A;  3MNO A;  3VTD A;  3IMY A;  4LTW A;  4XI3 A;  2PIO A;  5KCU A;  3W5R A;  1PK5 A;  3GBK A;  3WTQ A;  1BSX A;  1PQ9 A;  1M7W A;  1PZL A;  1ZGY A;  2G0G A;  4G2H A;  2I0G A;  4LNX A;  3LBD A;  3N00 A;  4P6X A;  4Q50 A;  4Y29 A;  1YP0 A;  2I4J A;  1K4W A;  3OOF A;  4YMQ A;  2NPA A;  5DXE A;  4E4Q A;  4RUJ A;  3VJH A;  2O4J A;  3MNE A;  4HLW A;  4OGH A;  3D6D A;  3Q95 A;  2PIN A;  2OVH A;  5DVC A;  4BCR A;  2ZY0 A;  4MGB A;  3FUG A;  3OLF A;  2Q7J A;  3VT3 A;  3V9Y A;  5G45 A;  5JI0 D;  3B0W A;  2QAB A;  1NQ0 A;  5DLR A;  5APJ A;  2QPY A;  5KYA A;  3TKM A;  3S9S A;  5GIC A;  5AWJ A;  3MNP A;  1QKU A;  1Y0S A;  2IOG A;  3G0W A;  1TFC A;  3V49 A;  3R5M A;  5KRI A;  3CS4 A;  1I7I A;  4IVW A;  2PIQ A;  2A3I A;  4L96 A;  1S19 A;  4MG8 B;  2ZXZ A;  3OSW A;  5DXB B;  2P7A A;  5DMC A;  4RWV A;  2I4P A;  4NB6 A;  2P15 A;  4HEE X;  4R6S A;  3QT0 A;  4OZT E;  2QTU A;  4PP6 A;  3W0G A;  5DX3 B;  1FM9 A;  2Z4J A;  5DSH A;  2OM9 A;  5HCV A;  2Q61 A;  3ADS A;  1X7J A;  2J4A A;  1YOK A;  5KRH A;  4OFU A;  1NRL A;  1NQ1 A;  1ZKY A;  2JFA A;  3A78 A;  3H0A D;  4ZNS A;  3SP6 A;  2QMV A;  3W0C A;  3BQD A;  2ZVT A;  1DKF A;  3WJ5 A;  1R20 A;  5DZ3 A;  4IQR A;  3B68 A;  4UDB A;  3VRW A;  4NQA B;  5DV8 A;  4WVD A;  2HAS A;  1FCZ A;  4APU A;  2XKW A;  3KDU A;  3FC6 A;  1NDE A;  3HZF A;  3M7R A;  3G9E A;  1K7L A;  3A40 X;  3HC5 A;  2ZK5 A;  5GID A;  5DI7 A;  3VJI A;  1I37 A;  4WHF A;  3P88 A;  2ZNQ A;  1FM6 A;  3A2H A;  4A4W A;  2VV4 A;  1X78 A;  1XJ7 A;  3OGT A;  5DRJ A;  4OEA A;  5SYZ A;  3TKC A;  4N73 A;  2HB8 A;  5EJV A;  1YOW A;  5DWE A;  4OJB A;  2GTK A;  3ZRA A;  2NXX E;  5FQV A;  3FXV A;  2JJ3 A;  5DUH A;  2PRG A;  4JGV A;  5C4O A;  1XLS E;  1YJE A;  5E14 A;  1YUC A;  2PIX A;  1T63 A;  3AZ3 A;  3ILZ A;  4IA3 A;  4R06 A;  2GPO A;  4OIL A;  1S0X A;  2R6Y A;  4OKB A;  2QGT A;  3AUQ A;  2Q59 A;  5KRC A;  2G44 A;  3L0J A;  4MG6 A;  3ADT A;  2QZO A;  2Q3Y A;  3W5P A;  5EI1 A;  2B23 A;  4N8R A;  2AA6 A;  2YJD A;  3UUA B;  1EXX A;  1I38 A;  4RE8 A;  4DOR A;  5ICK A;  1T65 A;  4EM9 A;  4UDD A;  4OZR E;  2YLY A;  3GD2 A;  1ZEO A;  4RAK A;  5E0X A;  3WT5 A;  5DKE A;  2EWP A;  2Q6R A;  5DV6 A;  2Z4B A;  1IE9 A;  3R8I A;  3VT9 A;  3SP9 A;  3L1B A;  2Q7I A;  3X31 A;  2H79 A;  4OIU A;  1ZUC A;  4QL8 A;  1T7M A;  3K22 A;  4G1D A;  1QKT A;  1X76 A;  2Q7K A;  1XVP B;  3HVL A;  3OS8 C;  5DXQ A;  5LWP A;  3E00 D;  2ACL B;  5DUE A;  1A52 A;  4IVY A;  4KZJ A;  4RME A;  1KKQ A;  1XV9 A;  4ZNH A;  3ADX A;  3AFR A;  5M96 A;  3B67 A;  3ERD A;  4JYH A;  4MG7 A;  4ZO1 B;  3D24 A;  4OIV A;  1GWQ A;  2VSR A;  1R1K A;  2AX9 A;  4JYG A;  1RKH A;  3KMR A;  4ZNU A;  2QA8 A;  1FM9 D;  4MGC A;  3DZU A;  4IWF A;  3EYB A;  3G8O A;  4TUZ B;  1G1U A;  4WPF A;  3VRU A;  4OEZ A;  2AO6 A;  4YT1 A;  1S0Z A;  5EIT A;  1ILH A;  3OOK A;  3P89 A;  3WMH A;  4X1G A;  2VV1 A;  5C4S A;  2ZLA A;  3AX8 A;  1XOW A;  2ZMJ A;  3A3Z X;  3OLS A;  1HG4 A;  3OMP A;  2AB2 A;  3VT7 A;  3VI8 A;  2QXM A;  3NOA A;  3CS8 A;  3WT7 A;  3B0T A;  5DUG A;  1XLS A;  3WT6 A;  4K4J A;  2GWX A;  3DY6 A;  1VJB A;  1N83 A;  5HYR A;  4MGB B;  5G43 A;  3DZY A;  1OVL B;  4ZI1 A;  1PRG A;  3F5C A;  1U3R A;  1FM6 D;  5KYJ A;  1U3S A;  3OMO A;  1K74 A;  2XYW A;  4XAO A;  3L0L A;  4OH5 A;  1G2N A;  2OCF A;  3KDT A;  2NW4 A;  2AYR A;  4ONI A;  2ATH A;  1EXA A;  3PEQ A;  5JJM A;  3VT5 A;  3JZB A;  3AUN A;  1UPW A;  3OS9 A;  1L2I A;  1WM0 X;  2AMB A;  5DXP A;  4A4V A;  5DXG A;  3OZ0 A;  3UUD A;  2YLQ A;  1UOM A;  4P6W A;  2FAI A;  2QA6 A;  2HAM A;  2ZNO A;  4E2J A;  3OKI A;  3PRG A;  5E7V A;  4DK7 A;  1FBY A;  3VT8 A;  4J26 A;  3ADW A;  3AUR A;  3B3K A;  5HJP B;  4J5W A;  2AXA A;  2JF9 A;  3K23 A;  1T76 A;  1ZDU A;  5DZ0 A;  1NUO A;  2YHD A;  4J5X A;  5KCT A;  3GYU A;  5L7E A;  4IV2 A;  3U9Q A;  3A9E A;  5DWL A;  2P1U A;  3W5Q A;  2BJ4 B;  1OSH A;  4PLE A;  4MG9 A;  3UVV A;  4J5W C;  1ZDT A;  5KCE A;  1XZX X;  5DYD A;  3ET2 A;  2B1V A;  5GIE A;  5L7G A;  5LGA A;  1QKM A;  2AX6 A;  2Q6S A;  2GPV A;  2XYJ A;  5AVI A;  4FN9 A;  3VT6 A;  3X1H A;  4B7W A;  2P1V A;  4J24 A;  1YY4 A;  2ZK4 A;  2PJL A;  4MG5 A;  3CLD A;  3FS1 A;  4OK1 A;  5DWJ A;  5DRM A;  1SR7 A;  3FEI A;  4OH6 A;  3SZ1 A;  1TXI A;  4KZI A;  1N46 A;  1Y9R A;  5DL4 A;  3UU7 A;  5E1C A;  2I0J A;  5DVS A;  4G1Z A;  2ZBS A;  4PLD A;  4L98 A;  3FEJ A;  4DQM A;  4TV1 B;  4R2U A;  3R8D A;  1T5Z A;  3F7D A;  4NY9 A;  1M13 A;  5DV3 A;  3V9T A;  4ZNV A;  2GPU A;  2Q1H A;  2R6W A;  5G42 A;  1P93 A;  2E2R A;  1YIN A;  3FUR A;  5EGV A;  1XP6 A;  5AYG A;  3RVF A;  1XPC A;  2J7Y A;  3IXP A;  3E94 A;  4FNE A;  4G21 A;  4OLM A;  5CJ6 A;  3DCT A;  4OKT A;  1FD0 A;  3OMM A;  5KRK A;  1KV6 A;  1R1K D;  1G5Y A;  5AVL A;  4MG8 A;  4M8E A;  5KCW A;  4G2I A;  3IA6 A;  5ACC A;  2HAR A;  2QZO B;  4ITE A;  4MDD A;  1P8D A;  2VV0 A;  3GWX A;  3VHU A;  4DOS A;  4OEY A;  5AAV B;  1Z5X U;  3A2J A;  1U9E A;  5HJS A;  4WHG A;  3RUU A;  5DX3 A;  3DZY D;  2P54 A;  2YFE A;  3ZRB A;  2B1Z A;  2HWQ A;  2Q6J A;  3CS6 A;  1YA3 A;  3RUT A;  1UHL B;  1YIM A;  2Q7L A;  1Z95 A;  1SKX A;  4N5G A;  1R6G A;  1XDK B;  5EHJ A;  4LBD A;  1QKN A;  3NSQ A;  1SJ0 A;  3L03 A;  5E15 A;  3WFG A;  3PCU A;  4MGD A;  5IAW A;  5B5B A;  5KCC A;  4IW6 A;  3CWD A;  3JZC A;  2QNV A;  5DXR A;  5KCD A;  2P4Y A;  1K74 D;  4POH A;  1X7B A;  2V0V A;  1RKG A;  1XNX A;  3OAP A;  5DKS A;  1NQ7 A;  1OT7 A;  2P1T A;  5DIE A;  4OJ9 A;  1ERE A;  4S14 A;  2V7C A;  1LV2 A;  3OLL A;  4FHH A;  2YJA B;  4OED A;  2AA7 A;  4QK4 A;  2OAX A;  4DMA A;  4YPQ A;  2PIT A;  1LBD A;  3D5F A;  3O1D A;  4PPS A;  2P7G A;  2AX8 A;  4IUI A;  2YAT A;  3ZQT A;  4ZN9 A;  1S9Q A;  2ZAS A;  1FCY A;  3CJW A;  1G50 A;  1XQ3 A;  5KRJ A;  5KR9 A;  4F9M A;  2QE4 A;  2Q1V A;  2YLP A;  2ZNN A;  5DIG A;  2HWR A;  2ZK2 A;  5E19 A;  5G44 A;  3WFF A;  3P0U A;  2QR9 A;  2YLO A;  1ZH7 A;  4ZNT A;  1R5K A;  4PP3 A;  2QGW A;  5IXK A;  3BEJ A;  3CQV A;  3NSP A;  1DB1 A;  2OUZ A;  4XT9 A;  3VRT A;  2ZL9 A;  1MVC A;  3ET3 A;  3FAL A;  4OKW A;  3W0J A;  2F4B A;  2H77 A;  3OSA A;  4ZN7 A;  1NAX A;  4IA1 A;  1XP1 A;  3T03 A;  4K6I A;  3UUC A;  2HB7 A;  1T79 A;  5G46 A;  1T74 A;  3UUA A;  4A2J A;  2HC4 A;  2ABI A;  1GWR A;  1XAP A;  4XTA A;  1IE8 A;  1RDT A;  2G5O A;  3V9V A;  1OSV A;  2OZ7 A;  2ZK6 A;  1KNU A;  1R20 D;  3HQ5 A;  4PP5 A;  2POB A;  5AZV A;  3L3Z A;  2AMA A;  3IPS A;  5APK A;  3PO9 A;  2QSE A;  3CTB A;  1E3K A;  4MGA A;  3Q95 B;  2AA5 A;  2HVC A;  5DXK A;  5DTV A;  2ZK1 A;  5I4V A;  1PCG A;  4XUM A;  3TY0 A;  3R8A A;  4K7A A;  5H1E A;  3GZ9 A;  2IHQ A;  3VSO A;  4CI4 A;  3KBA A;  5FQP A;  5DWI A;  2O4R A;  3RY9 A;  3VT4 A;  1ZAF A;  3L0E A;  5DID A;  2FSZ A;  2Q70 A;  4ITF A;  4DK8 A;  2O9I A;  3A9E B;  5KRL A;  3DT3 A;  3VN2 A;  4EMA A;  1A28 A;  5DXM A;  5FQS A;  1Y0X X;  4MG9 B;  3UVV B;  1XQC A;  4PXM A;  4QM0 A;  5DKB A;  3VHW A;  4DM6 A;  4QJR A;  1X7R A;  5ETH A;  4CI5 A;  4OJ4 A;  5DVV A;  1E3G A;  4TUZ A;  3VTB A;  1L2J A;  3TX7 B;  2PKL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...