2GPOA

Estrogen related receptor-gamma ligand binding domain complexed with a synthetic peptide from rip140
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
224
structure length
224
Chain Sequence
NKIVSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLEAKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title X-ray crystal structures of the estrogen-related receptor-gamma ligand binding domain in three functional states reveal the molecular basis of small molecule regulation.
pubmed doi rcsb
molecule keywords Estrogen-related receptor gamma
molecule tags Transcription
source organism Homo sapiens
total genus 88
structure length 224
sequence length 224
ec nomenclature
pdb deposition date 2006-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 2gpoA00
4DOSA 3ZRBA 5DRJA 2VV3A 1K74A 1XJ7A 3FLIA 2ZVTA 2AX9A 5KD9A 3L1BA 3DZYD 5CJ6A 3B65A 1I7GA 4X1FA 5DXEA 4MGDA 1GWXA 2QMVA 3B68A 5DL4A 5DXGA 1R1KD 1XNNA 5DU5A 4OFRA 2ZNQA 5DMCA 3R8DA 1PQ9A 4IA1A 2BAWA 4XTAA 5EJVA 4MGDB 3CQVA 3RUTA 1R6GA 1SJ0A 1PQCA 3ADTA 3OOKA 4RMEA 4M8HA 5AZVA 5G46A 4OHAA 1X7BA 2PIRA 4OEZA 1K74D 3ZRAA 5KYJA 5L11A 3GWXA 3LMPA 2W8YA 4QJRA 4ZJWA 5AYGA 3W0CA 5IAWA 1YOKA 5G43A 1YUCA 4ZNWA 1XV9A 2YLOA 2V7CA 2HC4A 1T7FA 5DZ1A 2B23A 5AAUA 4KZIA 1NAXA 2IOGA 1XV9B 4YT1A 1KNUA 2QTUA 1PCGA 2XYXA 4OFUA 5DWGA 2GPOA 5DK9A 5GICA 4REFA 5KCUA 3W5PA 1QKTA 2P1TA 3VT3A 3ET3A 4G1YA 4OJ4A 3V4AA 4XUMA 4P6WA 4UDBA 4ZN7A 1XNXA 4EM9A 4LNWA 5KRLA 5G45A 2AA6A 2P15A 2POBA 3K22A 2XYJA 4L98A 1S0ZA 3F5CA 1T7TA 4BCRA 5DI7A 3P88A 4NUFA 2PIXA 3A40X 2G0GA 3WGPA 4IS8A 3UU7A 1QKUA 2PIUA 3F5CB 3OOFA 2YJAB 4RUJA 5HJPA 2PINA 3UU7B 2E2RA 2HFPA 5C4OA 4ZNVA 5G5WA 2PNUA 1T73A 3E00A 5HJPB 2NW4A 3VT9A 3L0JA 3MNEA 4MGCA 1EREA 4DK7A 1E3KA 3IMYA 4J5WA 4LSJA 3WT7A 2B1VA 4OC7A 5LGAA 2YLPA 3X1HA 2OAXA 4OKWA 3B0WA 5DTVA 2Q70A 4A4VA 5DMFA 3W0IA 3DY6A 4DORA 2HWQA 5DWLA 3WWRA 3E00D 3ILZA 2QABA 4QE8A 4XAOA 3MNOA 1FCZA 1YIMA 1YJEA 4J26A 3VRTA 1KV6A 4DK8A 1KKQA 4HLWA 2QE4A 5DXPA 3L0LA 5E7VA 1T63A 4CSJA 3A3ZX 3P8XA 2Q1HA 2FVJA 2GTKA 4ZO1X 5E0WA 2AM9A 3OLSA 1YYEA 4E2JA 4NQAB 1YP0A 3OMMA 5FQRA 3FC6A 3E7CA 2I4JA 2YJDA 3SZ1A 1UHLA 3FALA 1LV2A 3K23A 3OZ0A 1YA3A 2PRGA 1QKNA 2Q6JA 3FC6B 1NUOA 3PCUA 4OZTE 1YINA 2GPVA 2R6WA 1UHLB 3FALB 4G1ZA 5DIDA 3HQ5A 1T74A 2ACLA 4MGAA 1H9UA 2HB7A 4OKBA 3OMKA 3VT6A 3VJSA 1X76A 3VJIA 2ZK6A 3G8OA 3MNPA 1E3GA 2ACLB 3AURA 2LBDA 3WT5A 4RMCA 5KCEA 4MGAB 4CI4A 3CS8A 2IHQA 2J7XA 3DCUA 5DVCA 1PDUA 5DKSA 1XVPA 4ZNSA 4OH5A 4ZO1B 3V9TA 5HYRA 3LBDA 3OMQA 4OEYA 2R6YA 3B1MA 1XVPB 3UUAA 5E14A 2QSEA 4OEDA 5DYDA 5C4SA 1M7WA 4OKXA 4LBDA 1NYXA 3VJTA 3UVVA 3KBAA 3UUAB 1T5ZA 2HVCA 5APKA 3X36A 2A3IA 1FM6A 3OGTA 2F4BA 1FCYA 1PRGA 3UVVB 4JYHA 4PP3A 2IOKA 3Q95A 1XP1A 2ZXNA 2G0HA 2ATHA 2VV4A 4K7AA 5AK2A 1L2IA 3F7DA 5DV8A 5G44A 1SKXA 2V0VA 1Y9RA 3L3XA 3VTCA 2I4PA 3W0AA 3IPUA 2AYRA 3Q95B 1U9EA 2PIOA 2ZMIA 5DXQA 5C4UA 1R20A 2VV4B 4ZNHA 3U9QA 4E4KA 2Q7LA 2ZY0A 4L96A 1FM6D 2ZK2A 2ZKCA 5DWJA 5E19A 5ETHA 2Q7IA 5DRMA 5K13A 3UP0A 3K6PA 4DM8A 3VSOA 1NHZA 1XLSE 1L2JA 2HBHA 4PP6A 5DXBA 1U3QA 2HARA 1OT7A 3BC5A 3D6DA 5DP0A 4M8EA 5E1CA 1ZDUA 5GIEA 1S0XA 1DB1A 3BQDA 3W0GA 5LWPA 5DXBB 5DKBA 1R20D 4QK4A 2YLQA 2QXSA 1GWQA 1R5KA 3IPSA 3W0JA 4OH6A 5APHA 1GWRA 1XAPA 5GIDA 2EWPA 4N73A 5KCFA 2Q5SA 2ZXMA 3AN3A 2FAIA 3HZFA 3HC5A 2AX6A 1I7IA 5AVIA 3RY9A 4O8FA 3FEJA 3ET1A 3VRWA 4PWLA 2QPYA 1S9QA 2NV7A 5KRHA 3GZ9A 2J7YA 3K8SA 1T76A 2YFEA 3OSAA 3IA6A 3KWYA 3GYTA 2REWA 3ET0A 4OEAA 5DY8A 4PRGA 3ADXA 1Y0XX 4IA2A 5KCTA 2NXXE 4PPPA 5DV6A 3B66A 1ZKYA 3T03A 2AB2A 4JL4A 3WFGA 2VSTA 2P1VA 3WFFA 4ZNTA 2P1UA 3E94A 5SYZA 3GBKA 5KRJA 1RJKA 1LBDA 4XLDA 3VT7A 1G50A 3AX8A 1XOWA 1ZUCA 2P7GA 1XLSA 2Q8SA 2ZL9A 4OLMA 4XUHA 4ZOMA 1FCXA 5DZ3A 5HJSA 5KROA 5DWEA 3GYUA 3VJHA 3NOAA 4PVUA 1OSVA 3HLVA 5KR9A 5L7GA 3S9SA 3FEIA 4OZRU 4OKTA 4OZTU 4IVWA 2J4AA 2QH6A 1HJ1A 1YOWA 2ZLCA 3A9EA 2XYWA 5KCDA 5DKGA 3OS8A 2BJ4A 3AN4A 1EXXA 4PPSA 4MG9A 3WT6A 3A9EB 4JYGA 2Q6RA 2HCDA 3KPZA 5DUEA 2PKLA 2BJ4B 3GWSX 4MG9B 2B50A 4LTWA 1OSHA 5EI1A 5DZ0A 5H1EA 2ZK0A 1ILHA 3V9YA 1NQ1A 4ZI1A 2Q6SA 1N46A 3KDTA 4RWVA 2AWHA 2G44A 2YATA 3HO0A 3P89A 4R2UA 3BEJA 2NXXA 3AZ2A 1NQ0A 1QKMA 4PLDA 3VTBA 3KMGA 1T79A 2H79A 4G21A 4ITFA 3DT3A 3IPQA 3RUUA 1MZNA 4REEA 2VV1A 4OJBA 4OZRE 3H52A 4KZMA 4OK1A 4TUZA 2B1ZA 5DUGA 3VN2A 4G2HA 4S0TA 3UUDA 3R5MA 2VV1B 3OMPA 5AVLA 3FS1A 4TUZB 5DWIA 4DQMA 5DIEA 3TX7B 1N4HA 2Q3YA 2AA7A 4WQPA 3UUDB 2O4RA 3AZ3A 3D24A 4EMAA 1DKFA 2Q7KA 3VT4A 3D57A 1A52A 3OAPA 3OLLA 2QW4A 5B41A 2H77A 1P8DA 2ZFXA 5C4TA 3QT0A 2PIVA 5A86A 4XHDA 5B5BA 2PIWA 5L7HA 3V3EA 1DKFB 3FURA 4IWCA 1PQ6A 2P7ZA 4IV2A 1T7RA 4IA3A 4RAKA 2JFAA 4WVDA 1S9PA 2QZOA 4OIVA 5DVSA 3DR1A 4J5XA 1ZAFA 3AUNA 5KRCA 3CJWA 5APJA 3VTDA 1T65A 1ERRA 4QM0A 4X1GA 2JFAB 5DUHA 2QZOB 3VHVA 4IQRA 1SQNA 2GWXA 2P54A 3JZCA 3KYTA 4ITEA 3DZUA 1SR7A 4N1YA 5FQTA 2OUZA 3FUGA 1RK3A 1XQCA 5L7EA 4K6IA 2J14A 2ZNPA 1IE9A 2YHDA 3PLZA 4JAZA 4Q50A 5FQVA 5AWKA 3W5QA 3HC6A 3V9VA 3IXPA 1X7JA 2PIPL 3VSPA 2ZLAA 5EITA 1TXIA 2OVMA 2GPPA 3R29A 1U3RA 4MG7A 4WHFA 3VT8A 1Z5XU 1RKHA 3A2IA 4S0SA 5AAVA 4FHIA 2ZNOA 3DZUD 1G5YA 2QNVA 4MG7B 3PO9A 4P6XA 3B0RA 5AAVB 3JZBA 3O1EA 4PP5A 5KCWA 3B0QA 4Q0AC 2OM9A 5KRMA 1FD0A 1XDKA 3B0TA 1BSXA 3IXPD 2YLYA 5HZCA 5FQPA 3W5TA 2QR9A 5KRIA 2VV0A 5DYBA 3EYBA 4IVYA 5EGVA 2HAMA 1NRLA 1K7LA 2NPAA 1XDKB 2Q7JA 3RVFA 1ZDTA 5DXRA 2VSRA 2I0JA 2JF9A 3RLJA 1VJBA 5KRAA 1Y0SA 3PEQA 1YY4A 4IU7A 1X7EA 4XI3A 3SP9A 4OIUA 4NY9A 2JJ3A 3G8IA 3OKHA 4FN9A 2QGWA 3ADSA 1MVCA 1S19A 4WHGA 4OGHA 3PBAA 4R06A 3CLDA 5JI0D 3X31A 3CTBA 4POJA 3W0YA 4WPFA 2XKWA 1MV9A 1Z5XE 3D5FA 3CS6A 2VV2A 3ADWA 4MG8A 2ZXZA 3OLFA 1I37A 2G5OA 2AMAA 3AZ1A 2HB8A 3B5RA 3GD2A 3ERDA 3HM1A 4IW6A 3L3ZA 4ZNUA 2AX8A 2XHSA 4MG8B 2P7AA 4PLEA 5HCVA 5AZTA 4DM6A 1A28A 3FXVA 4K4JA 3WTQA 5ACCA 3WJ5A 1UOMA 2POGA 4DMAA 5I4VA 2ABIA 2Q61A 2PJLA 2Q1VA 4PF3A 3VI8A 4A2JA 4IW8A 3UP3A 4IA7A 2OVHA 1M2ZA 2P4YA 3A2JA 1RKGA 4RUOX 3CWDA 2GL8A 1N83A 3L03A 3P0UA 4RUPA 3KDUA 3R8IA 4YPQA 4TV1A 1I38A 3DCTA 3O1DA 2ZMHA 4S14A 3V3QA 3OSIA 2I4ZA 5KCCA 2HWRA 4KZJA 3CS4A 3SP6A 4TV1B 3ADVA 2Q5PA 3AFRA 3TKMA 1FBYA 5DKEA 3KMZA 3VRUA 1X7RA 3G9EA 1XPCA 4NB6A 3HVLA 1U3SA 3UUCA 3GN8A 3M7RA 2AMBA 2OCFA 5DZIA 1NAVA 4MDDA 1Z95A 4OILA 4OJ9A 4RMDA 4S15A 4UDCA 2QGTA 2PIQA 1G2NA 4FGYA 3VT5A 2AA2A 5DSHA 5IZ0A 3OKIA 4FHHA 4JYIA 5DVVA 5FQSA 3VHWA 2QXMA 2ZBSA 3G0WA 4RZFA 5DV3A 5EC9A 4JGVA 5M96A 3R8AA 5JJMA 4WLBA 1ILGA 2HASA 3A78A 1Q4XA 2AO6A 2I0GA 2PITA 2ZMJA 3OS9A 3R5NA 3D90A 5JJMB 1G1UA 4J24A 1X78A 3X1IA 1NQ7A 4MG6A 3H0AA 5DXMA 1UPWA 1OVLA 3OZJA 3ZR7A 4YMQA 4RZGA 5DZHA 3OS8C 4YNKA 5ICKA 3WMHA 2AXAA 1M13A 2O9IA 3KFCA 4RFWA 1OVLB 3NSPA 3ET2A 1XB7A 4J5WC 3ZQTA 5DIGA 4APUA 5EHJA 4Y29A 5KRKA 1FM9A 5KRFA 4LNXA 4Q13A 1PZLA 3AUQA 2ZASA 4IV4A 4MGBA 5G42A 3RLLA 2QA6A 3H0AD 3NSQA 4N8RA 2Q59A 4R6SA 5DXKA 4G1DA 2Z4BA 5JY3A 1WM0X 4QE6A 2O4JA 1XQ3A 1RDTA 3CDSA 4MGBB 3B3KA 4POHA 3TKCA 3WJ4A 1EXAA 1IE8A 3A2HA 3KMRA 1ZGYA 2Q59B 3L0EA 1HG4A 4ZN9A 4IUIA 3V49A 2AAXA 4HEEX 2Z4JA 1FM9D 4UDAA 1XIUA 4G20A 4ONIA 4RZEA 2AA5A 4G2IA 3HODA 4OARA 5HYKA 3ERTA 2Q60A 2QA8A 2ZNNA 4IWFA 1XP6A 4PXMA 5G3JA 5E0XA 2GP7A 4XT9A 2AX7A 1RDTD 2GIUA 4QL8A 4B7WA 1XP9A 3W5RA 2QA8B 1UPVA 2Q5GA 5DLRA 3VRVA 5F9BA 3R2AA 1P93A 3B67A 3OSWA 1TFCA 2R40A 2ZK5A 1NQ2A 1XZXX 3N00A 4A4WA 5DX3A 3TY0A 3VHUA 1ZEOA 4FNEA 3W0HA 1T7MA 3OMOA 5GT4A 1ZH7A 4F9MA 1K4WA 1PK5A 2ZK1A 5E15A 1GS4A 2ZK3A 5DX3B 3PRGA 4N5GA 4UDDA 5AWJA 4CI5A 3DZYA 3ADUA 4NIEA 4E4QA 2GPUA 4J5XC 5KYAA 4ZJRA 5IXKA 1R1KA 2FSZA 2OZ7A 3CDPA 4RE8A 4MG5A 2R40D 1NDEA 1YMTA 2ZK4A
chains in the Genus database with same CATH superfamily
4DOSA 3ZRBA 5DRJA 2VV3A 1K74A 1XJ7A 3FLIA 2ZVTA 2AX9A 5KD9A 3L1BA 3DZYD 5CJ6A 3B65A 1I7GA 4X1FA 5DXEA 4MGDA 1GWXA 2QMVA 3B68A 5DL4A 5DXGA 1R1KD 1XNNA 5DU5A 4OFRA 2ZNQA 5DMCA 3R8DA 1PQ9A 4IA1A 2BAWA 4XTAA 5EJVA 4MGDB 3CQVA 3RUTA 1R6GA 1SJ0A 1PQCA 3ADTA 3OOKA 4RMEA 4M8HA 5AZVA 5G46A 4OHAA 1X7BA 2PIRA 4OEZA 1K74D 3ZRAA 5KYJA 5L11A 3GWXA 3LMPA 2W8YA 4QJRA 4ZJWA 5AYGA 3W0CA 5IAWA 1YOKA 5G43A 1YUCA 4ZNWA 1XV9A 2YLOA 2V7CA 2HC4A 1T7FA 5DZ1A 2B23A 5AAUA 4KZIA 1NAXA 2IOGA 1XV9B 4YT1A 1KNUA 2QTUA 1PCGA 2XYXA 4OFUA 5DWGA 2GPOA 5DK9A 5GICA 4REFA 5KCUA 3W5PA 1QKTA 2P1TA 3VT3A 3ET3A 4G1YA 4OJ4A 3V4AA 4XUMA 4P6WA 4UDBA 4ZN7A 1XNXA 4EM9A 4LNWA 5KRLA 5G45A 2AA6A 2P15A 2POBA 3K22A 2XYJA 4L98A 1S0ZA 3F5CA 1T7TA 4BCRA 5DI7A 3P88A 4NUFA 2PIXA 3A40X 2G0GA 3WGPA 4IS8A 3UU7A 1QKUA 2PIUA 3F5CB 3OOFA 2YJAB 4RUJA 5HJPA 2PINA 3UU7B 2E2RA 2HFPA 5C4OA 4ZNVA 5G5WA 2PNUA 1T73A 3E00A 5HJPB 2NW4A 3VT9A 3L0JA 3MNEA 4MGCA 1EREA 4DK7A 1E3KA 3IMYA 4J5WA 4LSJA 3WT7A 2B1VA 4OC7A 5LGAA 2YLPA 3X1HA 2OAXA 4OKWA 3B0WA 5DTVA 2Q70A 4A4VA 5DMFA 3W0IA 3DY6A 4DORA 2HWQA 5DWLA 3WWRA 3E00D 3ILZA 2QABA 4QE8A 4XAOA 3MNOA 1FCZA 1YIMA 1YJEA 4J26A 3VRTA 1KV6A 4DK8A 1KKQA 4HLWA 2QE4A 5DXPA 3L0LA 5E7VA 1T63A 4CSJA 3A3ZX 3P8XA 2Q1HA 2FVJA 2GTKA 4ZO1X 5E0WA 2AM9A 3OLSA 1YYEA 4E2JA 4NQAB 1YP0A 3OMMA 5FQRA 3FC6A 3E7CA 2I4JA 2YJDA 3SZ1A 1UHLA 3FALA 1LV2A 3K23A 3OZ0A 1YA3A 2PRGA 1QKNA 2Q6JA 3FC6B 1NUOA 3PCUA 4OZTE 1YINA 2GPVA 2R6WA 1UHLB 3FALB 4G1ZA 5DIDA 3HQ5A 1T74A 2ACLA 4MGAA 1H9UA 2HB7A 4OKBA 3OMKA 3VT6A 3VJSA 1X76A 3VJIA 2ZK6A 3G8OA 3MNPA 1E3GA 2ACLB 3AURA 2LBDA 3WT5A 4RMCA 5KCEA 4MGAB 4CI4A 3CS8A 2IHQA 2J7XA 3DCUA 5DVCA 1PDUA 5DKSA 1XVPA 4ZNSA 4OH5A 4ZO1B 3V9TA 5HYRA 3LBDA 3OMQA 4OEYA 2R6YA 3B1MA 1XVPB 3UUAA 5E14A 2QSEA 4OEDA 5DYDA 5C4SA 1M7WA 4OKXA 4LBDA 1NYXA 3VJTA 3UVVA 3KBAA 3UUAB 1T5ZA 2HVCA 5APKA 3X36A 2A3IA 1FM6A 3OGTA 2F4BA 1FCYA 1PRGA 3UVVB 4JYHA 4PP3A 2IOKA 3Q95A 1XP1A 2ZXNA 2G0HA 2ATHA 2VV4A 4K7AA 5AK2A 1L2IA 3F7DA 5DV8A 5G44A 1SKXA 2V0VA 1Y9RA 3L3XA 3VTCA 2I4PA 3W0AA 3IPUA 2AYRA 3Q95B 1U9EA 2PIOA 2ZMIA 5DXQA 5C4UA 1R20A 2VV4B 4ZNHA 3U9QA 4E4KA 2Q7LA 2ZY0A 4L96A 1FM6D 2ZK2A 2ZKCA 5DWJA 5E19A 5ETHA 2Q7IA 5DRMA 5K13A 3UP0A 3K6PA 4DM8A 3VSOA 1NHZA 1XLSE 1L2JA 2HBHA 4PP6A 5DXBA 1U3QA 2HARA 1OT7A 3BC5A 3D6DA 5DP0A 4M8EA 5E1CA 1ZDUA 5GIEA 1S0XA 1DB1A 3BQDA 3W0GA 5LWPA 5DXBB 5DKBA 1R20D 4QK4A 2YLQA 2QXSA 1GWQA 1R5KA 3IPSA 3W0JA 4OH6A 5APHA 1GWRA 1XAPA 5GIDA 2EWPA 4N73A 5KCFA 2Q5SA 2ZXMA 3AN3A 2FAIA 3HZFA 3HC5A 2AX6A 1I7IA 5AVIA 3RY9A 4O8FA 3FEJA 3ET1A 3VRWA 4PWLA 2QPYA 1S9QA 2NV7A 5KRHA 3GZ9A 2J7YA 3K8SA 1T76A 2YFEA 3OSAA 3IA6A 3KWYA 3GYTA 2REWA 3ET0A 4OEAA 5DY8A 4PRGA 3ADXA 1Y0XX 4IA2A 5KCTA 2NXXE 4PPPA 5DV6A 3B66A 1ZKYA 3T03A 2AB2A 4JL4A 3WFGA 2VSTA 2P1VA 3WFFA 4ZNTA 2P1UA 3E94A 5SYZA 3GBKA 5KRJA 1RJKA 1LBDA 4XLDA 3VT7A 1G50A 3AX8A 1XOWA 1ZUCA 2P7GA 1XLSA 2Q8SA 2ZL9A 4OLMA 4XUHA 4ZOMA 1FCXA 5DZ3A 5HJSA 5KROA 5DWEA 3GYUA 3VJHA 3NOAA 4PVUA 1OSVA 3HLVA 5KR9A 5L7GA 3S9SA 3FEIA 4OZRU 4OKTA 4OZTU 4IVWA 2J4AA 2QH6A 1HJ1A 1YOWA 2ZLCA 3A9EA 2XYWA 5KCDA 5DKGA 3OS8A 2BJ4A 3AN4A 1EXXA 4PPSA 4MG9A 3WT6A 3A9EB 4JYGA 2Q6RA 2HCDA 3KPZA 5DUEA 2PKLA 2BJ4B 3GWSX 4MG9B 2B50A 4LTWA 1OSHA 5EI1A 5DZ0A 5H1EA 2ZK0A 1ILHA 3V9YA 1NQ1A 4ZI1A 2Q6SA 1N46A 3KDTA 4RWVA 2AWHA 2G44A 2YATA 3HO0A 3P89A 4R2UA 3BEJA 2NXXA 3AZ2A 1NQ0A 1QKMA 4PLDA 3VTBA 3KMGA 1T79A 2H79A 4G21A 4ITFA 3DT3A 3IPQA 3RUUA 1MZNA 4REEA 2VV1A 4OJBA 4OZRE 3H52A 4KZMA 4OK1A 4TUZA 2B1ZA 5DUGA 3VN2A 4G2HA 4S0TA 3UUDA 3R5MA 2VV1B 3OMPA 5AVLA 3FS1A 4TUZB 5DWIA 4DQMA 5DIEA 3TX7B 1N4HA 2Q3YA 2AA7A 4WQPA 3UUDB 2O4RA 3AZ3A 3D24A 4EMAA 1DKFA 2Q7KA 3VT4A 3D57A 1A52A 3OAPA 3OLLA 2QW4A 5B41A 2H77A 1P8DA 2ZFXA 5C4TA 3QT0A 2PIVA 5A86A 4XHDA 5B5BA 2PIWA 5L7HA 3V3EA 1DKFB 3FURA 4IWCA 1PQ6A 2P7ZA 4IV2A 1T7RA 4IA3A 4RAKA 2JFAA 4WVDA 1S9PA 2QZOA 4OIVA 5DVSA 3DR1A 4J5XA 1ZAFA 3AUNA 5KRCA 3CJWA 5APJA 3VTDA 1T65A 1ERRA 4QM0A 4X1GA 2JFAB 5DUHA 2QZOB 3VHVA 4IQRA 1SQNA 2GWXA 2P54A 3JZCA 3KYTA 4ITEA 3DZUA 1SR7A 4N1YA 5FQTA 2OUZA 3FUGA 1RK3A 1XQCA 5L7EA 4K6IA 2J14A 2ZNPA 1IE9A 2YHDA 3PLZA 4JAZA 4Q50A 5FQVA 5AWKA 3W5QA 3HC6A 3V9VA 3IXPA 1X7JA 2PIPL 3VSPA 2ZLAA 5EITA 1TXIA 2OVMA 2GPPA 3R29A 1U3RA 4MG7A 4WHFA 3VT8A 1Z5XU 1RKHA 3A2IA 4S0SA 5AAVA 4FHIA 2ZNOA 3DZUD 1G5YA 2QNVA 4MG7B 3PO9A 4P6XA 3B0RA 5AAVB 3JZBA 3O1EA 4PP5A 5KCWA 3B0QA 4Q0AC 2OM9A 5KRMA 1FD0A 1XDKA 3B0TA 1BSXA 3IXPD 2YLYA 5HZCA 5FQPA 3W5TA 2QR9A 5KRIA 2VV0A 5DYBA 3EYBA 4IVYA 5EGVA 2HAMA 1NRLA 1K7LA 2NPAA 1XDKB 2Q7JA 3RVFA 1ZDTA 5DXRA 2VSRA 2I0JA 2JF9A 3RLJA 1VJBA 5KRAA 1Y0SA 3PEQA 1YY4A 4IU7A 1X7EA 4XI3A 3SP9A 4OIUA 4NY9A 2JJ3A 3G8IA 3OKHA 4FN9A 2QGWA 3ADSA 1MVCA 1S19A 4WHGA 4OGHA 3PBAA 4R06A 3CLDA 5JI0D 3X31A 3CTBA 4POJA 3W0YA 4WPFA 2XKWA 1MV9A 1Z5XE 3D5FA 3CS6A 2VV2A 3ADWA 4MG8A 2ZXZA 3OLFA 1I37A 2G5OA 2AMAA 3AZ1A 2HB8A 3B5RA 3GD2A 3ERDA 3HM1A 4IW6A 3L3ZA 4ZNUA 2AX8A 2XHSA 4MG8B 2P7AA 4PLEA 5HCVA 5AZTA 4DM6A 1A28A 3FXVA 4K4JA 3WTQA 5ACCA 3WJ5A 1UOMA 2POGA 4DMAA 5I4VA 2ABIA 2Q61A 2PJLA 2Q1VA 4PF3A 3VI8A 4A2JA 4IW8A 3UP3A 4IA7A 2OVHA 1M2ZA 2P4YA 3A2JA 1RKGA 4RUOX 3CWDA 2GL8A 1N83A 3L03A 3P0UA 4RUPA 3KDUA 3R8IA 4YPQA 4TV1A 1I38A 3DCTA 3O1DA 2ZMHA 4S14A 3V3QA 3OSIA 2I4ZA 5KCCA 2HWRA 4KZJA 3CS4A 3SP6A 4TV1B 3ADVA 2Q5PA 3AFRA 3TKMA 1FBYA 5DKEA 3KMZA 3VRUA 1X7RA 3G9EA 1XPCA 4NB6A 3HVLA 1U3SA 3UUCA 3GN8A 3M7RA 2AMBA 2OCFA 5DZIA 1NAVA 4MDDA 1Z95A 4OILA 4OJ9A 4RMDA 4S15A 4UDCA 2QGTA 2PIQA 1G2NA 4FGYA 3VT5A 2AA2A 5DSHA 5IZ0A 3OKIA 4FHHA 4JYIA 5DVVA 5FQSA 3VHWA 2QXMA 2ZBSA 3G0WA 4RZFA 5DV3A 5EC9A 4JGVA 5M96A 3R8AA 5JJMA 4WLBA 1ILGA 2HASA 3A78A 1Q4XA 2AO6A 2I0GA 2PITA 2ZMJA 3OS9A 3R5NA 3D90A 5JJMB 1G1UA 4J24A 1X78A 3X1IA 1NQ7A 4MG6A 3H0AA 5DXMA 1UPWA 1OVLA 3OZJA 3ZR7A 4YMQA 4RZGA 5DZHA 3OS8C 4YNKA 5ICKA 3WMHA 2AXAA 1M13A 2O9IA 3KFCA 4RFWA 1OVLB 3NSPA 3ET2A 1XB7A 4J5WC 3ZQTA 5DIGA 4APUA 5EHJA 4Y29A 5KRKA 1FM9A 5KRFA 4LNXA 4Q13A 1PZLA 3AUQA 2ZASA 4IV4A 4MGBA 5G42A 3RLLA 2QA6A 3H0AD 3NSQA 4N8RA 2Q59A 4R6SA 5DXKA 4G1DA 2Z4BA 5JY3A 1WM0X 4QE6A 2O4JA 1XQ3A 1RDTA 3CDSA 4MGBB 3B3KA 4POHA 3TKCA 3WJ4A 1EXAA 1IE8A 3A2HA 3KMRA 1ZGYA 2Q59B 3L0EA 1HG4A 4ZN9A 4IUIA 3V49A 2AAXA 4HEEX 2Z4JA 1FM9D 4UDAA 1XIUA 4G20A 4ONIA 4RZEA 2AA5A 4G2IA 3HODA 4OARA 5HYKA 3ERTA 2Q60A 2QA8A 2ZNNA 4IWFA 1XP6A 4PXMA 5G3JA 5E0XA 2GP7A 4XT9A 2AX7A 1RDTD 2GIUA 4QL8A 4B7WA 1XP9A 3W5RA 2QA8B 1UPVA 2Q5GA 5DLRA 3VRVA 5F9BA 3R2AA 1P93A 3B67A 3OSWA 1TFCA 2R40A 2ZK5A 1NQ2A 1XZXX 3N00A 4A4WA 5DX3A 3TY0A 3VHUA 1ZEOA 4FNEA 3W0HA 1T7MA 3OMOA 5GT4A 1ZH7A 4F9MA 1K4WA 1PK5A 2ZK1A 5E15A 1GS4A 2ZK3A 5DX3B 3PRGA 4N5GA 4UDDA 5AWJA 4CI5A 3DZYA 3ADUA 4NIEA 4E4QA 2GPUA 4J5XC 5KYAA 4ZJRA 5IXKA 1R1KA 2FSZA 2OZ7A 3CDPA 4RE8A 4MG5A 2R40D 1NDEA 1YMTA 2ZK4A
chains in the Genus database with same CATH topology
4DOSA 3ZRBA 5DRJA 2VV3A 1K74A 1XJ7A 3FLIA 2ZVTA 2AX9A 5KD9A 3L1BA 3DZYD 5CJ6A 3B65A 1I7GA 4X1FA 5DXEA 4MGDA 1GWXA 2QMVA 3B68A 5DL4A 5DXGA 1R1KD 1XNNA 5DU5A 4OFRA 2ZNQA 5DMCA 3R8DA 1PQ9A 4IA1A 2BAWA 4XTAA 5EJVA 4MGDB 3CQVA 3RUTA 1R6GA 1SJ0A 1PQCA 3ADTA 3OOKA 4RMEA 4M8HA 5AZVA 5G46A 4OHAA 1X7BA 2PIRA 4OEZA 1K74D 3ZRAA 5KYJA 5L11A 3GWXA 3LMPA 2W8YA 4QJRA 4ZJWA 5AYGA 3W0CA 5IAWA 1YOKA 5G43A 1YUCA 4ZNWA 1XV9A 2YLOA 2V7CA 2HC4A 1T7FA 5DZ1A 2B23A 5AAUA 4KZIA 1NAXA 2IOGA 1XV9B 4YT1A 1KNUA 2QTUA 1PCGA 2XYXA 4OFUA 5DWGA 2GPOA 5DK9A 5GICA 4REFA 5KCUA 3W5PA 1QKTA 2P1TA 3VT3A 3ET3A 4G1YA 4OJ4A 3V4AA 4XUMA 4P6WA 4UDBA 4ZN7A 1XNXA 4EM9A 4LNWA 5KRLA 5G45A 2AA6A 2P15A 2POBA 3K22A 2XYJA 4L98A 1S0ZA 3F5CA 1T7TA 4BCRA 5DI7A 3P88A 4NUFA 2PIXA 3A40X 2G0GA 3WGPA 4IS8A 3UU7A 1QKUA 2PIUA 3F5CB 3OOFA 2YJAB 4RUJA 5HJPA 2PINA 3UU7B 2E2RA 2HFPA 5C4OA 4ZNVA 5G5WA 2PNUA 1T73A 3E00A 5HJPB 2NW4A 3VT9A 3L0JA 3MNEA 4MGCA 1EREA 4DK7A 1E3KA 3IMYA 4J5WA 4LSJA 3WT7A 2B1VA 4OC7A 5LGAA 2YLPA 3X1HA 2OAXA 4OKWA 3B0WA 5DTVA 2Q70A 4A4VA 5DMFA 3W0IA 3DY6A 4DORA 2HWQA 5DWLA 3WWRA 3E00D 3ILZA 2QABA 4QE8A 4XAOA 3MNOA 1FCZA 1YIMA 1YJEA 4J26A 3VRTA 1KV6A 4DK8A 1KKQA 4HLWA 2QE4A 5DXPA 3L0LA 5E7VA 1T63A 4CSJA 3A3ZX 3P8XA 2Q1HA 2FVJA 2GTKA 4ZO1X 5E0WA 2AM9A 3OLSA 1YYEA 4E2JA 4NQAB 1YP0A 3OMMA 5FQRA 3FC6A 3E7CA 2I4JA 2YJDA 3SZ1A 1UHLA 3FALA 1LV2A 3K23A 3OZ0A 1YA3A 2PRGA 1QKNA 2Q6JA 3FC6B 1NUOA 3PCUA 4OZTE 1YINA 2GPVA 2R6WA 1UHLB 3FALB 4G1ZA 5DIDA 3HQ5A 1T74A 2ACLA 4MGAA 1H9UA 2HB7A 4OKBA 3OMKA 3VT6A 3VJSA 1X76A 3VJIA 2ZK6A 3G8OA 3MNPA 1E3GA 2ACLB 3AURA 2LBDA 3WT5A 4RMCA 5KCEA 4MGAB 4CI4A 3CS8A 2IHQA 2J7XA 3DCUA 5DVCA 1PDUA 5DKSA 1XVPA 4ZNSA 4OH5A 4ZO1B 3V9TA 5HYRA 3LBDA 3OMQA 4OEYA 2R6YA 3B1MA 1XVPB 3UUAA 5E14A 2QSEA 4OEDA 5DYDA 5C4SA 1M7WA 4OKXA 4LBDA 1NYXA 3VJTA 3UVVA 3KBAA 3UUAB 1T5ZA 2HVCA 5APKA 3X36A 2A3IA 1FM6A 3OGTA 2F4BA 1FCYA 1PRGA 3UVVB 4JYHA 4PP3A 2IOKA 3Q95A 1XP1A 2ZXNA 2G0HA 2ATHA 2VV4A 4K7AA 5AK2A 1L2IA 3F7DA 5DV8A 5G44A 1SKXA 2V0VA 1Y9RA 3L3XA 3VTCA 2I4PA 3W0AA 3IPUA 2AYRA 3Q95B 1U9EA 2PIOA 2ZMIA 5DXQA 5C4UA 1R20A 2VV4B 4ZNHA 3U9QA 4E4KA 2Q7LA 2ZY0A 4L96A 1FM6D 2ZK2A 2ZKCA 5DWJA 5E19A 5ETHA 2Q7IA 5DRMA 5K13A 3UP0A 3K6PA 4DM8A 3VSOA 1NHZA 1XLSE 1L2JA 2HBHA 4PP6A 5DXBA 1U3QA 2HARA 1OT7A 3BC5A 3D6DA 5DP0A 4M8EA 5E1CA 1ZDUA 5GIEA 1S0XA 1DB1A 3BQDA 3W0GA 5LWPA 5DXBB 5DKBA 1R20D 4QK4A 2YLQA 2QXSA 1GWQA 1R5KA 3IPSA 3W0JA 4OH6A 5APHA 1GWRA 1XAPA 5GIDA 2EWPA 4N73A 5KCFA 2Q5SA 2ZXMA 3AN3A 2FAIA 3HZFA 3HC5A 2AX6A 1I7IA 5AVIA 3RY9A 4O8FA 3FEJA 3ET1A 3VRWA 4PWLA 2QPYA 1S9QA 2NV7A 5KRHA 3GZ9A 2J7YA 3K8SA 1T76A 2YFEA 3OSAA 3IA6A 3KWYA 3GYTA 2REWA 3ET0A 4OEAA 5DY8A 4PRGA 3ADXA 1Y0XX 4IA2A 5KCTA 2NXXE 4PPPA 5DV6A 3B66A 1ZKYA 3T03A 2AB2A 4JL4A 3WFGA 2VSTA 2P1VA 3WFFA 4ZNTA 2P1UA 3E94A 5SYZA 3GBKA 5KRJA 1RJKA 1LBDA 4XLDA 3VT7A 1G50A 3AX8A 1XOWA 1ZUCA 2P7GA 1XLSA 2Q8SA 2ZL9A 4OLMA 4XUHA 4ZOMA 1FCXA 5DZ3A 5HJSA 5KROA 5DWEA 3GYUA 3VJHA 3NOAA 4PVUA 1OSVA 3HLVA 5KR9A 5L7GA 3S9SA 3FEIA 4OZRU 4OKTA 4OZTU 4IVWA 2J4AA 2QH6A 1HJ1A 1YOWA 2ZLCA 3A9EA 2XYWA 5KCDA 5DKGA 3OS8A 2BJ4A 3AN4A 1EXXA 4PPSA 4MG9A 3WT6A 3A9EB 4JYGA 2Q6RA 2HCDA 3KPZA 5DUEA 2PKLA 2BJ4B 3GWSX 4MG9B 2B50A 4LTWA 1OSHA 5EI1A 5DZ0A 5H1EA 2ZK0A 1ILHA 3V9YA 1NQ1A 4ZI1A 2Q6SA 1N46A 3KDTA 4RWVA 2AWHA 2G44A 2YATA 3HO0A 3P89A 4R2UA 3BEJA 2NXXA 3AZ2A 1NQ0A 1QKMA 4PLDA 3VTBA 3KMGA 1T79A 2H79A 4G21A 4ITFA 3DT3A 3IPQA 3RUUA 1MZNA 4REEA 2VV1A 4OJBA 4OZRE 3H52A 4KZMA 4OK1A 4TUZA 2B1ZA 5DUGA 3VN2A 4G2HA 4S0TA 3UUDA 3R5MA 2VV1B 3OMPA 5AVLA 3FS1A 4TUZB 5DWIA 4DQMA 5DIEA 3TX7B 1N4HA 2Q3YA 2AA7A 4WQPA 3UUDB 2O4RA 3AZ3A 3D24A 4EMAA 1DKFA 2Q7KA 3VT4A 3D57A 1A52A 3OAPA 3OLLA 2QW4A 5B41A 2H77A 1P8DA 2ZFXA 5C4TA 3QT0A 2PIVA 5A86A 4XHDA 5B5BA 2PIWA 5L7HA 3V3EA 1DKFB 3FURA 4IWCA 1PQ6A 2P7ZA 4IV2A 1T7RA 4IA3A 4RAKA 2JFAA 4WVDA 1S9PA 2QZOA 4OIVA 5DVSA 3DR1A 4J5XA 1ZAFA 3AUNA 5KRCA 3CJWA 5APJA 3VTDA 1T65A 1ERRA 4QM0A 4X1GA 2JFAB 5DUHA 2QZOB 3VHVA 4IQRA 1SQNA 2GWXA 2P54A 3JZCA 3KYTA 4ITEA 3DZUA 1SR7A 4N1YA 5FQTA 2OUZA 3FUGA 1RK3A 1XQCA 5L7EA 4K6IA 2J14A 2ZNPA 1IE9A 2YHDA 3PLZA 4JAZA 4Q50A 5FQVA 5AWKA 3W5QA 3HC6A 3V9VA 3IXPA 1X7JA 2PIPL 3VSPA 2ZLAA 5EITA 1TXIA 2OVMA 2GPPA 3R29A 1U3RA 4MG7A 4WHFA 3VT8A 1Z5XU 1RKHA 3A2IA 4S0SA 5AAVA 4FHIA 2ZNOA 3DZUD 1G5YA 2QNVA 4MG7B 3PO9A 4P6XA 3B0RA 5AAVB 3JZBA 3O1EA 4PP5A 5KCWA 3B0QA 4Q0AC 2OM9A 5KRMA 1FD0A 1XDKA 3B0TA 1BSXA 3IXPD 2YLYA 5HZCA 5FQPA 3W5TA 2QR9A 5KRIA 2VV0A 5DYBA 3EYBA 4IVYA 5EGVA 2HAMA 1NRLA 1K7LA 2NPAA 1XDKB 2Q7JA 3RVFA 1ZDTA 5DXRA 2VSRA 2I0JA 2JF9A 3RLJA 1VJBA 5KRAA 1Y0SA 3PEQA 1YY4A 4IU7A 1X7EA 4XI3A 3SP9A 4OIUA 4NY9A 2JJ3A 3G8IA 3OKHA 4FN9A 2QGWA 3ADSA 1MVCA 1S19A 4WHGA 4OGHA 3PBAA 4R06A 3CLDA 5JI0D 3X31A 3CTBA 4POJA 3W0YA 4WPFA 2XKWA 1MV9A 1Z5XE 3D5FA 3CS6A 2VV2A 3ADWA 4MG8A 2ZXZA 3OLFA 1I37A 2G5OA 2AMAA 3AZ1A 2HB8A 3B5RA 3GD2A 3ERDA 3HM1A 4IW6A 3L3ZA 4ZNUA 2AX8A 2XHSA 4MG8B 2P7AA 4PLEA 5HCVA 5AZTA 4DM6A 1A28A 3FXVA 4K4JA 3WTQA 5ACCA 3WJ5A 1UOMA 2POGA 4DMAA 5I4VA 2ABIA 2Q61A 2PJLA 2Q1VA 4PF3A 3VI8A 4A2JA 4IW8A 3UP3A 4IA7A 2OVHA 1M2ZA 2P4YA 3A2JA 1RKGA 4RUOX 3CWDA 2GL8A 1N83A 3L03A 3P0UA 4RUPA 3KDUA 3R8IA 4YPQA 4TV1A 1I38A 3DCTA 3O1DA 2ZMHA 4S14A 3V3QA 3OSIA 2I4ZA 5KCCA 2HWRA 4KZJA 3CS4A 3SP6A 4TV1B 3ADVA 2Q5PA 3AFRA 3TKMA 1FBYA 5DKEA 3KMZA 3VRUA 1X7RA 3G9EA 1XPCA 4NB6A 3HVLA 1U3SA 3UUCA 3GN8A 3M7RA 2AMBA 2OCFA 5DZIA 1NAVA 4MDDA 1Z95A 4OILA 4OJ9A 4RMDA 4S15A 4UDCA 2QGTA 2PIQA 1G2NA 4FGYA 3VT5A 2AA2A 5DSHA 5IZ0A 3OKIA 4FHHA 4JYIA 5DVVA 5FQSA 3VHWA 2QXMA 2ZBSA 3G0WA 4RZFA 5DV3A 5EC9A 4JGVA 5M96A 3R8AA 5JJMA 4WLBA 1ILGA 2HASA 3A78A 1Q4XA 2AO6A 2I0GA 2PITA 2ZMJA 3OS9A 3R5NA 3D90A 5JJMB 1G1UA 4J24A 1X78A 3X1IA 1NQ7A 4MG6A 3H0AA 5DXMA 1UPWA 1OVLA 3OZJA 3ZR7A 4YMQA 4RZGA 5DZHA 3OS8C 4YNKA 5ICKA 3WMHA 2AXAA 1M13A 2O9IA 3KFCA 4RFWA 1OVLB 3NSPA 3ET2A 1XB7A 4J5WC 3ZQTA 5DIGA 4APUA 5EHJA 4Y29A 5KRKA 1FM9A 5KRFA 4LNXA 4Q13A 1PZLA 3AUQA 2ZASA 4IV4A 4MGBA 5G42A 3RLLA 2QA6A 3H0AD 3NSQA 4N8RA 2Q59A 4R6SA 5DXKA 4G1DA 2Z4BA 5JY3A 1WM0X 4QE6A 2O4JA 1XQ3A 1RDTA 3CDSA 4MGBB 3B3KA 4POHA 3TKCA 3WJ4A 1EXAA 1IE8A 3A2HA 3KMRA 1ZGYA 2Q59B 3L0EA 1HG4A 4ZN9A 4IUIA 3V49A 2AAXA 4HEEX 2Z4JA 1FM9D 4UDAA 1XIUA 4G20A 4ONIA 4RZEA 2AA5A 4G2IA 3HODA 4OARA 5HYKA 3ERTA 2Q60A 2QA8A 2ZNNA 4IWFA 1XP6A 4PXMA 5G3JA 5E0XA 2GP7A 4XT9A 2AX7A 1RDTD 2GIUA 4QL8A 4B7WA 1XP9A 3W5RA 2QA8B 1UPVA 2Q5GA 5DLRA 3VRVA 5F9BA 3R2AA 1P93A 3B67A 3OSWA 1TFCA 2R40A 2ZK5A 1NQ2A 1XZXX 3N00A 4A4WA 5DX3A 3TY0A 3VHUA 1ZEOA 4FNEA 3W0HA 1T7MA 3OMOA 5GT4A 1ZH7A 4F9MA 1K4WA 1PK5A 2ZK1A 5E15A 1GS4A 2ZK3A 5DX3B 3PRGA 4N5GA 4UDDA 5AWJA 4CI5A 3DZYA 3ADUA 4NIEA 4E4QA 2GPUA 4J5XC 5KYAA 4ZJRA 5IXKA 1R1KA 2FSZA 2OZ7A 3CDPA 4RE8A 4MG5A 2R40D 1NDEA 1YMTA 2ZK4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DOS A;  3ZRB A;  5DRJ A;  2VV3 A;  1K74 A;  1XJ7 A;  3FLI A;  2ZVT A;  2AX9 A;  5KD9 A;  3L1B A;  3DZY D;  5CJ6 A;  3B65 A;  1I7G A;  4X1F A;  5DXE A;  4MGD A;  1GWX A;  2QMV A;  3B68 A;  5DL4 A;  5DXG A;  1R1K D;  1XNN A;  5DU5 A;  4OFR A;  2ZNQ A;  5DMC A;  3R8D A;  1PQ9 A;  4IA1 A;  2BAW A;  4XTA A;  5EJV A;  4MGD B;  3CQV A;  3RUT A;  1R6G A;  1SJ0 A;  1PQC A;  3ADT A;  3OOK A;  4RME A;  4M8H A;  5AZV A;  5G46 A;  4OHA A;  1X7B A;  2PIR A;  4OEZ A;  1K74 D;  3ZRA A;  5KYJ A;  5L11 A;  3GWX A;  3LMP A;  2W8Y A;  4QJR A;  4ZJW A;  5AYG A;  3W0C A;  5IAW A;  1YOK A;  5G43 A;  1YUC A;  4ZNW A;  1XV9 A;  2YLO A;  2V7C A;  2HC4 A;  1T7F A;  5DZ1 A;  2B23 A;  5AAU A;  4KZI A;  1NAX A;  2IOG A;  1XV9 B;  4YT1 A;  1KNU A;  2QTU A;  1PCG A;  2XYX A;  4OFU A;  5DWG A;  2GPO A;  5DK9 A;  5GIC A;  4REF A;  5KCU A;  3W5P A;  1QKT A;  2P1T A;  3VT3 A;  3ET3 A;  4G1Y A;  4OJ4 A;  3V4A A;  4XUM A;  4P6W A;  4UDB A;  4ZN7 A;  1XNX A;  4EM9 A;  4LNW A;  5KRL A;  5G45 A;  2AA6 A;  2P15 A;  2POB A;  3K22 A;  2XYJ A;  4L98 A;  1S0Z A;  3F5C A;  1T7T A;  4BCR A;  5DI7 A;  3P88 A;  4NUF A;  2PIX A;  3A40 X;  2G0G A;  3WGP A;  4IS8 A;  3UU7 A;  1QKU A;  2PIU A;  3F5C B;  3OOF A;  2YJA B;  4RUJ A;  5HJP A;  2PIN A;  3UU7 B;  2E2R A;  2HFP A;  5C4O A;  4ZNV A;  5G5W A;  2PNU A;  1T73 A;  3E00 A;  5HJP B;  2NW4 A;  3VT9 A;  3L0J A;  3MNE A;  4MGC A;  1ERE A;  4DK7 A;  1E3K A;  3IMY A;  4J5W A;  4LSJ A;  3WT7 A;  2B1V A;  4OC7 A;  5LGA A;  2YLP A;  3X1H A;  2OAX A;  4OKW A;  3B0W A;  5DTV A;  2Q70 A;  4A4V A;  5DMF A;  3W0I A;  3DY6 A;  4DOR A;  2HWQ A;  5DWL A;  3WWR A;  3E00 D;  3ILZ A;  2QAB A;  4QE8 A;  4XAO A;  3MNO A;  1FCZ A;  1YIM A;  1YJE A;  4J26 A;  3VRT A;  1KV6 A;  4DK8 A;  1KKQ A;  4HLW A;  2QE4 A;  5DXP A;  3L0L A;  5E7V A;  1T63 A;  4CSJ A;  3A3Z X;  3P8X A;  2Q1H A;  2FVJ A;  2GTK A;  4ZO1 X;  5E0W A;  2AM9 A;  3OLS A;  1YYE A;  4E2J A;  4NQA B;  1YP0 A;  3OMM A;  5FQR A;  3FC6 A;  3E7C A;  2I4J A;  2YJD A;  3SZ1 A;  1UHL A;  3FAL A;  1LV2 A;  3K23 A;  3OZ0 A;  1YA3 A;  2PRG A;  1QKN A;  2Q6J A;  3FC6 B;  1NUO A;  3PCU A;  4OZT E;  1YIN A;  2GPV A;  2R6W A;  1UHL B;  3FAL B;  4G1Z A;  5DID A;  3HQ5 A;  1T74 A;  2ACL A;  4MGA A;  1H9U A;  2HB7 A;  4OKB A;  3OMK A;  3VT6 A;  3VJS A;  1X76 A;  3VJI A;  2ZK6 A;  3G8O A;  3MNP A;  1E3G A;  2ACL B;  3AUR A;  2LBD A;  3WT5 A;  4RMC A;  5KCE A;  4MGA B;  4CI4 A;  3CS8 A;  2IHQ A;  2J7X A;  3DCU A;  5DVC A;  1PDU A;  5DKS A;  1XVP A;  4ZNS A;  4OH5 A;  4ZO1 B;  3V9T A;  5HYR A;  3LBD A;  3OMQ A;  4OEY A;  2R6Y A;  3B1M A;  1XVP B;  3UUA A;  5E14 A;  2QSE A;  4OED A;  5DYD A;  5C4S A;  1M7W A;  4OKX A;  4LBD A;  1NYX A;  3VJT A;  3UVV A;  3KBA A;  3UUA B;  1T5Z A;  2HVC A;  5APK A;  3X36 A;  2A3I A;  1FM6 A;  3OGT A;  2F4B A;  1FCY A;  1PRG A;  3UVV B;  4JYH A;  4PP3 A;  2IOK A;  3Q95 A;  1XP1 A;  2ZXN A;  2G0H A;  2ATH A;  2VV4 A;  4K7A A;  5AK2 A;  1L2I A;  3F7D A;  5DV8 A;  5G44 A;  1SKX A;  2V0V A;  1Y9R A;  3L3X A;  3VTC A;  2I4P A;  3W0A A;  3IPU A;  2AYR A;  3Q95 B;  1U9E A;  2PIO A;  2ZMI A;  5DXQ A;  5C4U A;  1R20 A;  2VV4 B;  4ZNH A;  3U9Q A;  4E4K A;  2Q7L A;  2ZY0 A;  4L96 A;  1FM6 D;  2ZK2 A;  2ZKC A;  5DWJ A;  5E19 A;  5ETH A;  2Q7I A;  5DRM A;  5K13 A;  3UP0 A;  3K6P A;  4DM8 A;  3VSO A;  1NHZ A;  1XLS E;  1L2J A;  2HBH A;  4PP6 A;  5DXB A;  1U3Q A;  2HAR A;  1OT7 A;  3BC5 A;  3D6D A;  5DP0 A;  4M8E A;  5E1C A;  1ZDU A;  5GIE A;  1S0X A;  1DB1 A;  3BQD A;  3W0G A;  5LWP A;  5DXB B;  5DKB A;  1R20 D;  4QK4 A;  2YLQ A;  2QXS A;  1GWQ A;  1R5K A;  3IPS A;  3W0J A;  4OH6 A;  5APH A;  1GWR A;  1XAP A;  5GID A;  2EWP A;  4N73 A;  5KCF A;  2Q5S A;  2ZXM A;  3AN3 A;  2FAI A;  3HZF A;  3HC5 A;  2AX6 A;  1I7I A;  5AVI A;  3RY9 A;  4O8F A;  3FEJ A;  3ET1 A;  3VRW A;  4PWL A;  2QPY A;  1S9Q A;  2NV7 A;  5KRH A;  3GZ9 A;  2J7Y A;  3K8S A;  1T76 A;  2YFE A;  3OSA A;  3IA6 A;  3KWY A;  3GYT A;  2REW A;  3ET0 A;  4OEA A;  5DY8 A;  4PRG A;  3ADX A;  1Y0X X;  4IA2 A;  5KCT A;  2NXX E;  4PPP A;  5DV6 A;  3B66 A;  1ZKY A;  3T03 A;  2AB2 A;  4JL4 A;  3WFG A;  2VST A;  2P1V A;  3WFF A;  4ZNT A;  2P1U A;  3E94 A;  5SYZ A;  3GBK A;  5KRJ A;  1RJK A;  1LBD A;  4XLD A;  3VT7 A;  1G50 A;  3AX8 A;  1XOW A;  1ZUC A;  2P7G A;  1XLS A;  2Q8S A;  2ZL9 A;  4OLM A;  4XUH A;  4ZOM A;  1FCX A;  5DZ3 A;  5HJS A;  5KRO A;  5DWE A;  3GYU A;  3VJH A;  3NOA A;  4PVU A;  1OSV A;  3HLV A;  5KR9 A;  5L7G A;  3S9S A;  3FEI A;  4OZR U;  4OKT A;  4OZT U;  4IVW A;  2J4A A;  2QH6 A;  1HJ1 A;  1YOW A;  2ZLC A;  3A9E A;  2XYW A;  5KCD A;  5DKG A;  3OS8 A;  2BJ4 A;  3AN4 A;  1EXX A;  4PPS A;  4MG9 A;  3WT6 A;  3A9E B;  4JYG A;  2Q6R A;  2HCD A;  3KPZ A;  5DUE A;  2PKL A;  2BJ4 B;  3GWS X;  4MG9 B;  2B50 A;  4LTW A;  1OSH A;  5EI1 A;  5DZ0 A;  5H1E A;  2ZK0 A;  1ILH A;  3V9Y A;  1NQ1 A;  4ZI1 A;  2Q6S A;  1N46 A;  3KDT A;  4RWV A;  2AWH A;  2G44 A;  2YAT A;  3HO0 A;  3P89 A;  4R2U A;  3BEJ A;  2NXX A;  3AZ2 A;  1NQ0 A;  1QKM A;  4PLD A;  3VTB A;  3KMG A;  1T79 A;  2H79 A;  4G21 A;  4ITF A;  3DT3 A;  3IPQ A;  3RUU A;  1MZN A;  4REE A;  2VV1 A;  4OJB A;  4OZR E;  3H52 A;  4KZM A;  4OK1 A;  4TUZ A;  2B1Z A;  5DUG A;  3VN2 A;  4G2H A;  4S0T A;  3UUD A;  3R5M A;  2VV1 B;  3OMP A;  5AVL A;  3FS1 A;  4TUZ B;  5DWI A;  4DQM A;  5DIE A;  3TX7 B;  1N4H A;  2Q3Y A;  2AA7 A;  4WQP A;  3UUD B;  2O4R A;  3AZ3 A;  3D24 A;  4EMA A;  1DKF A;  2Q7K A;  3VT4 A;  3D57 A;  1A52 A;  3OAP A;  3OLL A;  2QW4 A;  5B41 A;  2H77 A;  1P8D A;  2ZFX A;  5C4T A;  3QT0 A;  2PIV A;  5A86 A;  4XHD A;  5B5B A;  2PIW A;  5L7H A;  3V3E A;  1DKF B;  3FUR A;  4IWC A;  1PQ6 A;  2P7Z A;  4IV2 A;  1T7R A;  4IA3 A;  4RAK A;  2JFA A;  4WVD A;  1S9P A;  2QZO A;  4OIV A;  5DVS A;  3DR1 A;  4J5X A;  1ZAF A;  3AUN A;  5KRC A;  3CJW A;  5APJ A;  3VTD A;  1T65 A;  1ERR A;  4QM0 A;  4X1G A;  2JFA B;  5DUH A;  2QZO B;  3VHV A;  4IQR A;  1SQN A;  2GWX A;  2P54 A;  3JZC A;  3KYT A;  4ITE A;  3DZU A;  1SR7 A;  4N1Y A;  5FQT A;  2OUZ A;  3FUG A;  1RK3 A;  1XQC A;  5L7E A;  4K6I A;  2J14 A;  2ZNP A;  1IE9 A;  2YHD A;  3PLZ A;  4JAZ A;  4Q50 A;  5FQV A;  5AWK A;  3W5Q A;  3HC6 A;  3V9V A;  3IXP A;  1X7J A;  2PIP L;  3VSP A;  2ZLA A;  5EIT A;  1TXI A;  2OVM A;  2GPP A;  3R29 A;  1U3R A;  4MG7 A;  4WHF A;  3VT8 A;  1Z5X U;  1RKH A;  3A2I A;  4S0S A;  5AAV A;  4FHI A;  2ZNO A;  3DZU D;  1G5Y A;  2QNV A;  4MG7 B;  3PO9 A;  4P6X A;  3B0R A;  5AAV B;  3JZB A;  3O1E A;  4PP5 A;  5KCW A;  3B0Q A;  4Q0A C;  2OM9 A;  5KRM A;  1FD0 A;  1XDK A;  3B0T A;  1BSX A;  3IXP D;  2YLY A;  5HZC A;  5FQP A;  3W5T A;  2QR9 A;  5KRI A;  2VV0 A;  5DYB A;  3EYB A;  4IVY A;  5EGV A;  2HAM A;  1NRL A;  1K7L A;  2NPA A;  1XDK B;  2Q7J A;  3RVF A;  1ZDT A;  5DXR A;  2VSR A;  2I0J A;  2JF9 A;  3RLJ A;  1VJB A;  5KRA A;  1Y0S A;  3PEQ A;  1YY4 A;  4IU7 A;  1X7E A;  4XI3 A;  3SP9 A;  4OIU A;  4NY9 A;  2JJ3 A;  3G8I A;  3OKH A;  4FN9 A;  2QGW A;  3ADS A;  1MVC A;  1S19 A;  4WHG A;  4OGH A;  3PBA A;  4R06 A;  3CLD A;  5JI0 D;  3X31 A;  3CTB A;  4POJ A;  3W0Y A;  4WPF A;  2XKW A;  1MV9 A;  1Z5X E;  3D5F A;  3CS6 A;  2VV2 A;  3ADW A;  4MG8 A;  2ZXZ A;  3OLF A;  1I37 A;  2G5O A;  2AMA A;  3AZ1 A;  2HB8 A;  3B5R A;  3GD2 A;  3ERD A;  3HM1 A;  4IW6 A;  3L3Z A;  4ZNU A;  2AX8 A;  2XHS A;  4MG8 B;  2P7A A;  4PLE A;  5HCV A;  5AZT A;  4DM6 A;  1A28 A;  3FXV A;  4K4J A;  3WTQ A;  5ACC A;  3WJ5 A;  1UOM A;  2POG A;  4DMA A;  5I4V A;  2ABI A;  2Q61 A;  2PJL A;  2Q1V A;  4PF3 A;  3VI8 A;  4A2J A;  4IW8 A;  3UP3 A;  4IA7 A;  2OVH A;  1M2Z A;  2P4Y A;  3A2J A;  1RKG A;  4RUO X;  3CWD A;  2GL8 A;  1N83 A;  3L03 A;  3P0U A;  4RUP A;  3KDU A;  3R8I A;  4YPQ A;  4TV1 A;  1I38 A;  3DCT A;  3O1D A;  2ZMH A;  4S14 A;  3V3Q A;  3OSI A;  2I4Z A;  5KCC A;  2HWR A;  4KZJ A;  3CS4 A;  3SP6 A;  4TV1 B;  3ADV A;  2Q5P A;  3AFR A;  3TKM A;  1FBY A;  5DKE A;  3KMZ A;  3VRU A;  1X7R A;  3G9E A;  1XPC A;  4NB6 A;  3HVL A;  1U3S A;  3UUC A;  3GN8 A;  3M7R A;  2AMB A;  2OCF A;  5DZI A;  1NAV A;  4MDD A;  1Z95 A;  4OIL A;  4OJ9 A;  4RMD A;  4S15 A;  4UDC A;  2QGT A;  2PIQ A;  1G2N A;  4FGY A;  3VT5 A;  2AA2 A;  5DSH A;  5IZ0 A;  3OKI A;  4FHH A;  4JYI A;  5DVV A;  5FQS A;  3VHW A;  2QXM A;  2ZBS A;  3G0W A;  4RZF A;  5DV3 A;  5EC9 A;  4JGV A;  5M96 A;  3R8A A;  5JJM A;  4WLB A;  1ILG A;  2HAS A;  3A78 A;  1Q4X A;  2AO6 A;  2I0G A;  2PIT A;  2ZMJ A;  3OS9 A;  3R5N A;  3D90 A;  5JJM B;  1G1U A;  4J24 A;  1X78 A;  3X1I A;  1NQ7 A;  4MG6 A;  3H0A A;  5DXM A;  1UPW A;  1OVL A;  3OZJ A;  3ZR7 A;  4YMQ A;  4RZG A;  5DZH A;  3OS8 C;  4YNK A;  5ICK A;  3WMH A;  2AXA A;  1M13 A;  2O9I A;  3KFC A;  4RFW A;  1OVL B;  3NSP A;  3ET2 A;  1XB7 A;  4J5W C;  3ZQT A;  5DIG A;  4APU A;  5EHJ A;  4Y29 A;  5KRK A;  1FM9 A;  5KRF A;  4LNX A;  4Q13 A;  1PZL A;  3AUQ A;  2ZAS A;  4IV4 A;  4MGB A;  5G42 A;  3RLL A;  2QA6 A;  3H0A D;  3NSQ A;  4N8R A;  2Q59 A;  4R6S A;  5DXK A;  4G1D A;  2Z4B A;  5JY3 A;  1WM0 X;  4QE6 A;  2O4J A;  1XQ3 A;  1RDT A;  3CDS A;  4MGB B;  3B3K A;  4POH A;  3TKC A;  3WJ4 A;  1EXA A;  1IE8 A;  3A2H A;  3KMR A;  1ZGY A;  2Q59 B;  3L0E A;  1HG4 A;  4ZN9 A;  4IUI A;  3V49 A;  2AAX A;  4HEE X;  2Z4J A;  1FM9 D;  4UDA A;  1XIU A;  4G20 A;  4ONI A;  4RZE A;  2AA5 A;  4G2I A;  3HOD A;  4OAR A;  5HYK A;  3ERT A;  2Q60 A;  2QA8 A;  2ZNN A;  4IWF A;  1XP6 A;  4PXM A;  5G3J A;  5E0X A;  2GP7 A;  4XT9 A;  2AX7 A;  1RDT D;  2GIU A;  4QL8 A;  4B7W A;  1XP9 A;  3W5R A;  2QA8 B;  1UPV A;  2Q5G A;  5DLR A;  3VRV A;  5F9B A;  3R2A A;  1P93 A;  3B67 A;  3OSW A;  1TFC A;  2R40 A;  2ZK5 A;  1NQ2 A;  1XZX X;  3N00 A;  4A4W A;  5DX3 A;  3TY0 A;  3VHU A;  1ZEO A;  4FNE A;  3W0H A;  1T7M A;  3OMO A;  5GT4 A;  1ZH7 A;  4F9M A;  1K4W A;  1PK5 A;  2ZK1 A;  5E15 A;  1GS4 A;  2ZK3 A;  5DX3 B;  3PRG A;  4N5G A;  4UDD A;  5AWJ A;  4CI5 A;  3DZY A;  3ADU A;  4NIE A;  4E4Q A;  2GPU A;  4J5X C;  5KYA A;  4ZJR A;  5IXK A;  1R1K A;  2FSZ A;  2OZ7 A;  3CDP A;  4RE8 A;  4MG5 A;  2R40 D;  1NDE A;  1YMT A;  2ZK4 A; 
#chains in the Genus database with same CATH topology
 4DOS A;  3ZRB A;  5DRJ A;  2VV3 A;  1K74 A;  1XJ7 A;  3FLI A;  2ZVT A;  2AX9 A;  5KD9 A;  3L1B A;  3DZY D;  5CJ6 A;  3B65 A;  1I7G A;  4X1F A;  5DXE A;  4MGD A;  1GWX A;  2QMV A;  3B68 A;  5DL4 A;  5DXG A;  1R1K D;  1XNN A;  5DU5 A;  4OFR A;  2ZNQ A;  5DMC A;  3R8D A;  1PQ9 A;  4IA1 A;  2BAW A;  4XTA A;  5EJV A;  4MGD B;  3CQV A;  3RUT A;  1R6G A;  1SJ0 A;  1PQC A;  3ADT A;  3OOK A;  4RME A;  4M8H A;  5AZV A;  5G46 A;  4OHA A;  1X7B A;  2PIR A;  4OEZ A;  1K74 D;  3ZRA A;  5KYJ A;  5L11 A;  3GWX A;  3LMP A;  2W8Y A;  4QJR A;  4ZJW A;  5AYG A;  3W0C A;  5IAW A;  1YOK A;  5G43 A;  1YUC A;  4ZNW A;  1XV9 A;  2YLO A;  2V7C A;  2HC4 A;  1T7F A;  5DZ1 A;  2B23 A;  5AAU A;  4KZI A;  1NAX A;  2IOG A;  1XV9 B;  4YT1 A;  1KNU A;  2QTU A;  1PCG A;  2XYX A;  4OFU A;  5DWG A;  2GPO A;  5DK9 A;  5GIC A;  4REF A;  5KCU A;  3W5P A;  1QKT A;  2P1T A;  3VT3 A;  3ET3 A;  4G1Y A;  4OJ4 A;  3V4A A;  4XUM A;  4P6W A;  4UDB A;  4ZN7 A;  1XNX A;  4EM9 A;  4LNW A;  5KRL A;  5G45 A;  2AA6 A;  2P15 A;  2POB A;  3K22 A;  2XYJ A;  4L98 A;  1S0Z A;  3F5C A;  1T7T A;  4BCR A;  5DI7 A;  3P88 A;  4NUF A;  2PIX A;  3A40 X;  2G0G A;  3WGP A;  4IS8 A;  3UU7 A;  1QKU A;  2PIU A;  3F5C B;  3OOF A;  2YJA B;  4RUJ A;  5HJP A;  2PIN A;  3UU7 B;  2E2R A;  2HFP A;  5C4O A;  4ZNV A;  5G5W A;  2PNU A;  1T73 A;  3E00 A;  5HJP B;  2NW4 A;  3VT9 A;  3L0J A;  3MNE A;  4MGC A;  1ERE A;  4DK7 A;  1E3K A;  3IMY A;  4J5W A;  4LSJ A;  3WT7 A;  2B1V A;  4OC7 A;  5LGA A;  2YLP A;  3X1H A;  2OAX A;  4OKW A;  3B0W A;  5DTV A;  2Q70 A;  4A4V A;  5DMF A;  3W0I A;  3DY6 A;  4DOR A;  2HWQ A;  5DWL A;  3WWR A;  3E00 D;  3ILZ A;  2QAB A;  4QE8 A;  4XAO A;  3MNO A;  1FCZ A;  1YIM A;  1YJE A;  4J26 A;  3VRT A;  1KV6 A;  4DK8 A;  1KKQ A;  4HLW A;  2QE4 A;  5DXP A;  3L0L A;  5E7V A;  1T63 A;  4CSJ A;  3A3Z X;  3P8X A;  2Q1H A;  2FVJ A;  2GTK A;  4ZO1 X;  5E0W A;  2AM9 A;  3OLS A;  1YYE A;  4E2J A;  4NQA B;  1YP0 A;  3OMM A;  5FQR A;  3FC6 A;  3E7C A;  2I4J A;  2YJD A;  3SZ1 A;  1UHL A;  3FAL A;  1LV2 A;  3K23 A;  3OZ0 A;  1YA3 A;  2PRG A;  1QKN A;  2Q6J A;  3FC6 B;  1NUO A;  3PCU A;  4OZT E;  1YIN A;  2GPV A;  2R6W A;  1UHL B;  3FAL B;  4G1Z A;  5DID A;  3HQ5 A;  1T74 A;  2ACL A;  4MGA A;  1H9U A;  2HB7 A;  4OKB A;  3OMK A;  3VT6 A;  3VJS A;  1X76 A;  3VJI A;  2ZK6 A;  3G8O A;  3MNP A;  1E3G A;  2ACL B;  3AUR A;  2LBD A;  3WT5 A;  4RMC A;  5KCE A;  4MGA B;  4CI4 A;  3CS8 A;  2IHQ A;  2J7X A;  3DCU A;  5DVC A;  1PDU A;  5DKS A;  1XVP A;  4ZNS A;  4OH5 A;  4ZO1 B;  3V9T A;  5HYR A;  3LBD A;  3OMQ A;  4OEY A;  2R6Y A;  3B1M A;  1XVP B;  3UUA A;  5E14 A;  2QSE A;  4OED A;  5DYD A;  5C4S A;  1M7W A;  4OKX A;  4LBD A;  1NYX A;  3VJT A;  3UVV A;  3KBA A;  3UUA B;  1T5Z A;  2HVC A;  5APK A;  3X36 A;  2A3I A;  1FM6 A;  3OGT A;  2F4B A;  1FCY A;  1PRG A;  3UVV B;  4JYH A;  4PP3 A;  2IOK A;  3Q95 A;  1XP1 A;  2ZXN A;  2G0H A;  2ATH A;  2VV4 A;  4K7A A;  5AK2 A;  1L2I A;  3F7D A;  5DV8 A;  5G44 A;  1SKX A;  2V0V A;  1Y9R A;  3L3X A;  3VTC A;  2I4P A;  3W0A A;  3IPU A;  2AYR A;  3Q95 B;  1U9E A;  2PIO A;  2ZMI A;  5DXQ A;  5C4U A;  1R20 A;  2VV4 B;  4ZNH A;  3U9Q A;  4E4K A;  2Q7L A;  2ZY0 A;  4L96 A;  1FM6 D;  2ZK2 A;  2ZKC A;  5DWJ A;  5E19 A;  5ETH A;  2Q7I A;  5DRM A;  5K13 A;  3UP0 A;  3K6P A;  4DM8 A;  3VSO A;  1NHZ A;  1XLS E;  1L2J A;  2HBH A;  4PP6 A;  5DXB A;  1U3Q A;  2HAR A;  1OT7 A;  3BC5 A;  3D6D A;  5DP0 A;  4M8E A;  5E1C A;  1ZDU A;  5GIE A;  1S0X A;  1DB1 A;  3BQD A;  3W0G A;  5LWP A;  5DXB B;  5DKB A;  1R20 D;  4QK4 A;  2YLQ A;  2QXS A;  1GWQ A;  1R5K A;  3IPS A;  3W0J A;  4OH6 A;  5APH A;  1GWR A;  1XAP A;  5GID A;  2EWP A;  4N73 A;  5KCF A;  2Q5S A;  2ZXM A;  3AN3 A;  2FAI A;  3HZF A;  3HC5 A;  2AX6 A;  1I7I A;  5AVI A;  3RY9 A;  4O8F A;  3FEJ A;  3ET1 A;  3VRW A;  4PWL A;  2QPY A;  1S9Q A;  2NV7 A;  5KRH A;  3GZ9 A;  2J7Y A;  3K8S A;  1T76 A;  2YFE A;  3OSA A;  3IA6 A;  3KWY A;  3GYT A;  2REW A;  3ET0 A;  4OEA A;  5DY8 A;  4PRG A;  3ADX A;  1Y0X X;  4IA2 A;  5KCT A;  2NXX E;  4PPP A;  5DV6 A;  3B66 A;  1ZKY A;  3T03 A;  2AB2 A;  4JL4 A;  3WFG A;  2VST A;  2P1V A;  3WFF A;  4ZNT A;  2P1U A;  3E94 A;  5SYZ A;  3GBK A;  5KRJ A;  1RJK A;  1LBD A;  4XLD A;  3VT7 A;  1G50 A;  3AX8 A;  1XOW A;  1ZUC A;  2P7G A;  1XLS A;  2Q8S A;  2ZL9 A;  4OLM A;  4XUH A;  4ZOM A;  1FCX A;  5DZ3 A;  5HJS A;  5KRO A;  5DWE A;  3GYU A;  3VJH A;  3NOA A;  4PVU A;  1OSV A;  3HLV A;  5KR9 A;  5L7G A;  3S9S A;  3FEI A;  4OZR U;  4OKT A;  4OZT U;  4IVW A;  2J4A A;  2QH6 A;  1HJ1 A;  1YOW A;  2ZLC A;  3A9E A;  2XYW A;  5KCD A;  5DKG A;  3OS8 A;  2BJ4 A;  3AN4 A;  1EXX A;  4PPS A;  4MG9 A;  3WT6 A;  3A9E B;  4JYG A;  2Q6R A;  2HCD A;  3KPZ A;  5DUE A;  2PKL A;  2BJ4 B;  3GWS X;  4MG9 B;  2B50 A;  4LTW A;  1OSH A;  5EI1 A;  5DZ0 A;  5H1E A;  2ZK0 A;  1ILH A;  3V9Y A;  1NQ1 A;  4ZI1 A;  2Q6S A;  1N46 A;  3KDT A;  4RWV A;  2AWH A;  2G44 A;  2YAT A;  3HO0 A;  3P89 A;  4R2U A;  3BEJ A;  2NXX A;  3AZ2 A;  1NQ0 A;  1QKM A;  4PLD A;  3VTB A;  3KMG A;  1T79 A;  2H79 A;  4G21 A;  4ITF A;  3DT3 A;  3IPQ A;  3RUU A;  1MZN A;  4REE A;  2VV1 A;  4OJB A;  4OZR E;  3H52 A;  4KZM A;  4OK1 A;  4TUZ A;  2B1Z A;  5DUG A;  3VN2 A;  4G2H A;  4S0T A;  3UUD A;  3R5M A;  2VV1 B;  3OMP A;  5AVL A;  3FS1 A;  4TUZ B;  5DWI A;  4DQM A;  5DIE A;  3TX7 B;  1N4H A;  2Q3Y A;  2AA7 A;  4WQP A;  3UUD B;  2O4R A;  3AZ3 A;  3D24 A;  4EMA A;  1DKF A;  2Q7K A;  3VT4 A;  3D57 A;  1A52 A;  3OAP A;  3OLL A;  2QW4 A;  5B41 A;  2H77 A;  1P8D A;  2ZFX A;  5C4T A;  3QT0 A;  2PIV A;  5A86 A;  4XHD A;  5B5B A;  2PIW A;  5L7H A;  3V3E A;  1DKF B;  3FUR A;  4IWC A;  1PQ6 A;  2P7Z A;  4IV2 A;  1T7R A;  4IA3 A;  4RAK A;  2JFA A;  4WVD A;  1S9P A;  2QZO A;  4OIV A;  5DVS A;  3DR1 A;  4J5X A;  1ZAF A;  3AUN A;  5KRC A;  3CJW A;  5APJ A;  3VTD A;  1T65 A;  1ERR A;  4QM0 A;  4X1G A;  2JFA B;  5DUH A;  2QZO B;  3VHV A;  4IQR A;  1SQN A;  2GWX A;  2P54 A;  3JZC A;  3KYT A;  4ITE A;  3DZU A;  1SR7 A;  4N1Y A;  5FQT A;  2OUZ A;  3FUG A;  1RK3 A;  1XQC A;  5L7E A;  4K6I A;  2J14 A;  2ZNP A;  1IE9 A;  2YHD A;  3PLZ A;  4JAZ A;  4Q50 A;  5FQV A;  5AWK A;  3W5Q A;  3HC6 A;  3V9V A;  3IXP A;  1X7J A;  2PIP L;  3VSP A;  2ZLA A;  5EIT A;  1TXI A;  2OVM A;  2GPP A;  3R29 A;  1U3R A;  4MG7 A;  4WHF A;  3VT8 A;  1Z5X U;  1RKH A;  3A2I A;  4S0S A;  5AAV A;  4FHI A;  2ZNO A;  3DZU D;  1G5Y A;  2QNV A;  4MG7 B;  3PO9 A;  4P6X A;  3B0R A;  5AAV B;  3JZB A;  3O1E A;  4PP5 A;  5KCW A;  3B0Q A;  4Q0A C;  2OM9 A;  5KRM A;  1FD0 A;  1XDK A;  3B0T A;  1BSX A;  3IXP D;  2YLY A;  5HZC A;  5FQP A;  3W5T A;  2QR9 A;  5KRI A;  2VV0 A;  5DYB A;  3EYB A;  4IVY A;  5EGV A;  2HAM A;  1NRL A;  1K7L A;  2NPA A;  1XDK B;  2Q7J A;  3RVF A;  1ZDT A;  5DXR A;  2VSR A;  2I0J A;  2JF9 A;  3RLJ A;  1VJB A;  5KRA A;  1Y0S A;  3PEQ A;  1YY4 A;  4IU7 A;  1X7E A;  4XI3 A;  3SP9 A;  4OIU A;  4NY9 A;  2JJ3 A;  3G8I A;  3OKH A;  4FN9 A;  2QGW A;  3ADS A;  1MVC A;  1S19 A;  4WHG A;  4OGH A;  3PBA A;  4R06 A;  3CLD A;  5JI0 D;  3X31 A;  3CTB A;  4POJ A;  3W0Y A;  4WPF A;  2XKW A;  1MV9 A;  1Z5X E;  3D5F A;  3CS6 A;  2VV2 A;  3ADW A;  4MG8 A;  2ZXZ A;  3OLF A;  1I37 A;  2G5O A;  2AMA A;  3AZ1 A;  2HB8 A;  3B5R A;  3GD2 A;  3ERD A;  3HM1 A;  4IW6 A;  3L3Z A;  4ZNU A;  2AX8 A;  2XHS A;  4MG8 B;  2P7A A;  4PLE A;  5HCV A;  5AZT A;  4DM6 A;  1A28 A;  3FXV A;  4K4J A;  3WTQ A;  5ACC A;  3WJ5 A;  1UOM A;  2POG A;  4DMA A;  5I4V A;  2ABI A;  2Q61 A;  2PJL A;  2Q1V A;  4PF3 A;  3VI8 A;  4A2J A;  4IW8 A;  3UP3 A;  4IA7 A;  2OVH A;  1M2Z A;  2P4Y A;  3A2J A;  1RKG A;  4RUO X;  3CWD A;  2GL8 A;  1N83 A;  3L03 A;  3P0U A;  4RUP A;  3KDU A;  3R8I A;  4YPQ A;  4TV1 A;  1I38 A;  3DCT A;  3O1D A;  2ZMH A;  4S14 A;  3V3Q A;  3OSI A;  2I4Z A;  5KCC A;  2HWR A;  4KZJ A;  3CS4 A;  3SP6 A;  4TV1 B;  3ADV A;  2Q5P A;  3AFR A;  3TKM A;  1FBY A;  5DKE A;  3KMZ A;  3VRU A;  1X7R A;  3G9E A;  1XPC A;  4NB6 A;  3HVL A;  1U3S A;  3UUC A;  3GN8 A;  3M7R A;  2AMB A;  2OCF A;  5DZI A;  1NAV A;  4MDD A;  1Z95 A;  4OIL A;  4OJ9 A;  4RMD A;  4S15 A;  4UDC A;  2QGT A;  2PIQ A;  1G2N A;  4FGY A;  3VT5 A;  2AA2 A;  5DSH A;  5IZ0 A;  3OKI A;  4FHH A;  4JYI A;  5DVV A;  5FQS A;  3VHW A;  2QXM A;  2ZBS A;  3G0W A;  4RZF A;  5DV3 A;  5EC9 A;  4JGV A;  5M96 A;  3R8A A;  5JJM A;  4WLB A;  1ILG A;  2HAS A;  3A78 A;  1Q4X A;  2AO6 A;  2I0G A;  2PIT A;  2ZMJ A;  3OS9 A;  3R5N A;  3D90 A;  5JJM B;  1G1U A;  4J24 A;  1X78 A;  3X1I A;  1NQ7 A;  4MG6 A;  3H0A A;  5DXM A;  1UPW A;  1OVL A;  3OZJ A;  3ZR7 A;  4YMQ A;  4RZG A;  5DZH A;  3OS8 C;  4YNK A;  5ICK A;  3WMH A;  2AXA A;  1M13 A;  2O9I A;  3KFC A;  4RFW A;  1OVL B;  3NSP A;  3ET2 A;  1XB7 A;  4J5W C;  3ZQT A;  5DIG A;  4APU A;  5EHJ A;  4Y29 A;  5KRK A;  1FM9 A;  5KRF A;  4LNX A;  4Q13 A;  1PZL A;  3AUQ A;  2ZAS A;  4IV4 A;  4MGB A;  5G42 A;  3RLL A;  2QA6 A;  3H0A D;  3NSQ A;  4N8R A;  2Q59 A;  4R6S A;  5DXK A;  4G1D A;  2Z4B A;  5JY3 A;  1WM0 X;  4QE6 A;  2O4J A;  1XQ3 A;  1RDT A;  3CDS A;  4MGB B;  3B3K A;  4POH A;  3TKC A;  3WJ4 A;  1EXA A;  1IE8 A;  3A2H A;  3KMR A;  1ZGY A;  2Q59 B;  3L0E A;  1HG4 A;  4ZN9 A;  4IUI A;  3V49 A;  2AAX A;  4HEE X;  2Z4J A;  1FM9 D;  4UDA A;  1XIU A;  4G20 A;  4ONI A;  4RZE A;  2AA5 A;  4G2I A;  3HOD A;  4OAR A;  5HYK A;  3ERT A;  2Q60 A;  2QA8 A;  2ZNN A;  4IWF A;  1XP6 A;  4PXM A;  5G3J A;  5E0X A;  2GP7 A;  4XT9 A;  2AX7 A;  1RDT D;  2GIU A;  4QL8 A;  4B7W A;  1XP9 A;  3W5R A;  2QA8 B;  1UPV A;  2Q5G A;  5DLR A;  3VRV A;  5F9B A;  3R2A A;  1P93 A;  3B67 A;  3OSW A;  1TFC A;  2R40 A;  2ZK5 A;  1NQ2 A;  1XZX X;  3N00 A;  4A4W A;  5DX3 A;  3TY0 A;  3VHU A;  1ZEO A;  4FNE A;  3W0H A;  1T7M A;  3OMO A;  5GT4 A;  1ZH7 A;  4F9M A;  1K4W A;  1PK5 A;  2ZK1 A;  5E15 A;  1GS4 A;  2ZK3 A;  5DX3 B;  3PRG A;  4N5G A;  4UDD A;  5AWJ A;  4CI5 A;  3DZY A;  3ADU A;  4NIE A;  4E4Q A;  2GPU A;  4J5X C;  5KYA A;  4ZJR A;  5IXK A;  1R1K A;  2FSZ A;  2OZ7 A;  3CDP A;  4RE8 A;  4MG5 A;  2R40 D;  1NDE A;  1YMT A;  2ZK4 A; 
#chains in the Genus database with same CATH homology
 4DOS A;  3ZRB A;  5DRJ A;  2VV3 A;  1K74 A;  1XJ7 A;  3FLI A;  2ZVT A;  2AX9 A;  5KD9 A;  3L1B A;  3DZY D;  5CJ6 A;  3B65 A;  1I7G A;  4X1F A;  5DXE A;  4MGD A;  1GWX A;  2QMV A;  3B68 A;  5DL4 A;  5DXG A;  1R1K D;  1XNN A;  5DU5 A;  4OFR A;  2ZNQ A;  5DMC A;  3R8D A;  1PQ9 A;  4IA1 A;  2BAW A;  4XTA A;  5EJV A;  4MGD B;  3CQV A;  3RUT A;  1R6G A;  1SJ0 A;  1PQC A;  3ADT A;  3OOK A;  4RME A;  4M8H A;  5AZV A;  5G46 A;  4OHA A;  1X7B A;  2PIR A;  4OEZ A;  1K74 D;  3ZRA A;  5KYJ A;  5L11 A;  3GWX A;  3LMP A;  2W8Y A;  4QJR A;  4ZJW A;  5AYG A;  3W0C A;  5IAW A;  1YOK A;  5G43 A;  1YUC A;  4ZNW A;  1XV9 A;  2YLO A;  2V7C A;  2HC4 A;  1T7F A;  5DZ1 A;  2B23 A;  5AAU A;  4KZI A;  1NAX A;  2IOG A;  1XV9 B;  4YT1 A;  1KNU A;  2QTU A;  1PCG A;  2XYX A;  4OFU A;  5DWG A;  2GPO A;  5DK9 A;  5GIC A;  4REF A;  5KCU A;  3W5P A;  1QKT A;  2P1T A;  3VT3 A;  3ET3 A;  4G1Y A;  4OJ4 A;  3V4A A;  4XUM A;  4P6W A;  4UDB A;  4ZN7 A;  1XNX A;  4EM9 A;  4LNW A;  5KRL A;  5G45 A;  2AA6 A;  2P15 A;  2POB A;  3K22 A;  2XYJ A;  4L98 A;  1S0Z A;  3F5C A;  1T7T A;  4BCR A;  5DI7 A;  3P88 A;  4NUF A;  2PIX A;  3A40 X;  2G0G A;  3WGP A;  4IS8 A;  3UU7 A;  1QKU A;  2PIU A;  3F5C B;  3OOF A;  2YJA B;  4RUJ A;  5HJP A;  2PIN A;  3UU7 B;  2E2R A;  2HFP A;  5C4O A;  4ZNV A;  5G5W A;  2PNU A;  1T73 A;  3E00 A;  5HJP B;  2NW4 A;  3VT9 A;  3L0J A;  3MNE A;  4MGC A;  1ERE A;  4DK7 A;  1E3K A;  3IMY A;  4J5W A;  4LSJ A;  3WT7 A;  2B1V A;  4OC7 A;  5LGA A;  2YLP A;  3X1H A;  2OAX A;  4OKW A;  3B0W A;  5DTV A;  2Q70 A;  4A4V A;  5DMF A;  3W0I A;  3DY6 A;  4DOR A;  2HWQ A;  5DWL A;  3WWR A;  3E00 D;  3ILZ A;  2QAB A;  4QE8 A;  4XAO A;  3MNO A;  1FCZ A;  1YIM A;  1YJE A;  4J26 A;  3VRT A;  1KV6 A;  4DK8 A;  1KKQ A;  4HLW A;  2QE4 A;  5DXP A;  3L0L A;  5E7V A;  1T63 A;  4CSJ A;  3A3Z X;  3P8X A;  2Q1H A;  2FVJ A;  2GTK A;  4ZO1 X;  5E0W A;  2AM9 A;  3OLS A;  1YYE A;  4E2J A;  4NQA B;  1YP0 A;  3OMM A;  5FQR A;  3FC6 A;  3E7C A;  2I4J A;  2YJD A;  3SZ1 A;  1UHL A;  3FAL A;  1LV2 A;  3K23 A;  3OZ0 A;  1YA3 A;  2PRG A;  1QKN A;  2Q6J A;  3FC6 B;  1NUO A;  3PCU A;  4OZT E;  1YIN A;  2GPV A;  2R6W A;  1UHL B;  3FAL B;  4G1Z A;  5DID A;  3HQ5 A;  1T74 A;  2ACL A;  4MGA A;  1H9U A;  2HB7 A;  4OKB A;  3OMK A;  3VT6 A;  3VJS A;  1X76 A;  3VJI A;  2ZK6 A;  3G8O A;  3MNP A;  1E3G A;  2ACL B;  3AUR A;  2LBD A;  3WT5 A;  4RMC A;  5KCE A;  4MGA B;  4CI4 A;  3CS8 A;  2IHQ A;  2J7X A;  3DCU A;  5DVC A;  1PDU A;  5DKS A;  1XVP A;  4ZNS A;  4OH5 A;  4ZO1 B;  3V9T A;  5HYR A;  3LBD A;  3OMQ A;  4OEY A;  2R6Y A;  3B1M A;  1XVP B;  3UUA A;  5E14 A;  2QSE A;  4OED A;  5DYD A;  5C4S A;  1M7W A;  4OKX A;  4LBD A;  1NYX A;  3VJT A;  3UVV A;  3KBA A;  3UUA B;  1T5Z A;  2HVC A;  5APK A;  3X36 A;  2A3I A;  1FM6 A;  3OGT A;  2F4B A;  1FCY A;  1PRG A;  3UVV B;  4JYH A;  4PP3 A;  2IOK A;  3Q95 A;  1XP1 A;  2ZXN A;  2G0H A;  2ATH A;  2VV4 A;  4K7A A;  5AK2 A;  1L2I A;  3F7D A;  5DV8 A;  5G44 A;  1SKX A;  2V0V A;  1Y9R A;  3L3X A;  3VTC A;  2I4P A;  3W0A A;  3IPU A;  2AYR A;  3Q95 B;  1U9E A;  2PIO A;  2ZMI A;  5DXQ A;  5C4U A;  1R20 A;  2VV4 B;  4ZNH A;  3U9Q A;  4E4K A;  2Q7L A;  2ZY0 A;  4L96 A;  1FM6 D;  2ZK2 A;  2ZKC A;  5DWJ A;  5E19 A;  5ETH A;  2Q7I A;  5DRM A;  5K13 A;  3UP0 A;  3K6P A;  4DM8 A;  3VSO A;  1NHZ A;  1XLS E;  1L2J A;  2HBH A;  4PP6 A;  5DXB A;  1U3Q A;  2HAR A;  1OT7 A;  3BC5 A;  3D6D A;  5DP0 A;  4M8E A;  5E1C A;  1ZDU A;  5GIE A;  1S0X A;  1DB1 A;  3BQD A;  3W0G A;  5LWP A;  5DXB B;  5DKB A;  1R20 D;  4QK4 A;  2YLQ A;  2QXS A;  1GWQ A;  1R5K A;  3IPS A;  3W0J A;  4OH6 A;  5APH A;  1GWR A;  1XAP A;  5GID A;  2EWP A;  4N73 A;  5KCF A;  2Q5S A;  2ZXM A;  3AN3 A;  2FAI A;  3HZF A;  3HC5 A;  2AX6 A;  1I7I A;  5AVI A;  3RY9 A;  4O8F A;  3FEJ A;  3ET1 A;  3VRW A;  4PWL A;  2QPY A;  1S9Q A;  2NV7 A;  5KRH A;  3GZ9 A;  2J7Y A;  3K8S A;  1T76 A;  2YFE A;  3OSA A;  3IA6 A;  3KWY A;  3GYT A;  2REW A;  3ET0 A;  4OEA A;  5DY8 A;  4PRG A;  3ADX A;  1Y0X X;  4IA2 A;  5KCT A;  2NXX E;  4PPP A;  5DV6 A;  3B66 A;  1ZKY A;  3T03 A;  2AB2 A;  4JL4 A;  3WFG A;  2VST A;  2P1V A;  3WFF A;  4ZNT A;  2P1U A;  3E94 A;  5SYZ A;  3GBK A;  5KRJ A;  1RJK A;  1LBD A;  4XLD A;  3VT7 A;  1G50 A;  3AX8 A;  1XOW A;  1ZUC A;  2P7G A;  1XLS A;  2Q8S A;  2ZL9 A;  4OLM A;  4XUH A;  4ZOM A;  1FCX A;  5DZ3 A;  5HJS A;  5KRO A;  5DWE A;  3GYU A;  3VJH A;  3NOA A;  4PVU A;  1OSV A;  3HLV A;  5KR9 A;  5L7G A;  3S9S A;  3FEI A;  4OZR U;  4OKT A;  4OZT U;  4IVW A;  2J4A A;  2QH6 A;  1HJ1 A;  1YOW A;  2ZLC A;  3A9E A;  2XYW A;  5KCD A;  5DKG A;  3OS8 A;  2BJ4 A;  3AN4 A;  1EXX A;  4PPS A;  4MG9 A;  3WT6 A;  3A9E B;  4JYG A;  2Q6R A;  2HCD A;  3KPZ A;  5DUE A;  2PKL A;  2BJ4 B;  3GWS X;  4MG9 B;  2B50 A;  4LTW A;  1OSH A;  5EI1 A;  5DZ0 A;  5H1E A;  2ZK0 A;  1ILH A;  3V9Y A;  1NQ1 A;  4ZI1 A;  2Q6S A;  1N46 A;  3KDT A;  4RWV A;  2AWH A;  2G44 A;  2YAT A;  3HO0 A;  3P89 A;  4R2U A;  3BEJ A;  2NXX A;  3AZ2 A;  1NQ0 A;  1QKM A;  4PLD A;  3VTB A;  3KMG A;  1T79 A;  2H79 A;  4G21 A;  4ITF A;  3DT3 A;  3IPQ A;  3RUU A;  1MZN A;  4REE A;  2VV1 A;  4OJB A;  4OZR E;  3H52 A;  4KZM A;  4OK1 A;  4TUZ A;  2B1Z A;  5DUG A;  3VN2 A;  4G2H A;  4S0T A;  3UUD A;  3R5M A;  2VV1 B;  3OMP A;  5AVL A;  3FS1 A;  4TUZ B;  5DWI A;  4DQM A;  5DIE A;  3TX7 B;  1N4H A;  2Q3Y A;  2AA7 A;  4WQP A;  3UUD B;  2O4R A;  3AZ3 A;  3D24 A;  4EMA A;  1DKF A;  2Q7K A;  3VT4 A;  3D57 A;  1A52 A;  3OAP A;  3OLL A;  2QW4 A;  5B41 A;  2H77 A;  1P8D A;  2ZFX A;  5C4T A;  3QT0 A;  2PIV A;  5A86 A;  4XHD A;  5B5B A;  2PIW A;  5L7H A;  3V3E A;  1DKF B;  3FUR A;  4IWC A;  1PQ6 A;  2P7Z A;  4IV2 A;  1T7R A;  4IA3 A;  4RAK A;  2JFA A;  4WVD A;  1S9P A;  2QZO A;  4OIV A;  5DVS A;  3DR1 A;  4J5X A;  1ZAF A;  3AUN A;  5KRC A;  3CJW A;  5APJ A;  3VTD A;  1T65 A;  1ERR A;  4QM0 A;  4X1G A;  2JFA B;  5DUH A;  2QZO B;  3VHV A;  4IQR A;  1SQN A;  2GWX A;  2P54 A;  3JZC A;  3KYT A;  4ITE A;  3DZU A;  1SR7 A;  4N1Y A;  5FQT A;  2OUZ A;  3FUG A;  1RK3 A;  1XQC A;  5L7E A;  4K6I A;  2J14 A;  2ZNP A;  1IE9 A;  2YHD A;  3PLZ A;  4JAZ A;  4Q50 A;  5FQV A;  5AWK A;  3W5Q A;  3HC6 A;  3V9V A;  3IXP A;  1X7J A;  2PIP L;  3VSP A;  2ZLA A;  5EIT A;  1TXI A;  2OVM A;  2GPP A;  3R29 A;  1U3R A;  4MG7 A;  4WHF A;  3VT8 A;  1Z5X U;  1RKH A;  3A2I A;  4S0S A;  5AAV A;  4FHI A;  2ZNO A;  3DZU D;  1G5Y A;  2QNV A;  4MG7 B;  3PO9 A;  4P6X A;  3B0R A;  5AAV B;  3JZB A;  3O1E A;  4PP5 A;  5KCW A;  3B0Q A;  4Q0A C;  2OM9 A;  5KRM A;  1FD0 A;  1XDK A;  3B0T A;  1BSX A;  3IXP D;  2YLY A;  5HZC A;  5FQP A;  3W5T A;  2QR9 A;  5KRI A;  2VV0 A;  5DYB A;  3EYB A;  4IVY A;  5EGV A;  2HAM A;  1NRL A;  1K7L A;  2NPA A;  1XDK B;  2Q7J A;  3RVF A;  1ZDT A;  5DXR A;  2VSR A;  2I0J A;  2JF9 A;  3RLJ A;  1VJB A;  5KRA A;  1Y0S A;  3PEQ A;  1YY4 A;  4IU7 A;  1X7E A;  4XI3 A;  3SP9 A;  4OIU A;  4NY9 A;  2JJ3 A;  3G8I A;  3OKH A;  4FN9 A;  2QGW A;  3ADS A;  1MVC A;  1S19 A;  4WHG A;  4OGH A;  3PBA A;  4R06 A;  3CLD A;  5JI0 D;  3X31 A;  3CTB A;  4POJ A;  3W0Y A;  4WPF A;  2XKW A;  1MV9 A;  1Z5X E;  3D5F A;  3CS6 A;  2VV2 A;  3ADW A;  4MG8 A;  2ZXZ A;  3OLF A;  1I37 A;  2G5O A;  2AMA A;  3AZ1 A;  2HB8 A;  3B5R A;  3GD2 A;  3ERD A;  3HM1 A;  4IW6 A;  3L3Z A;  4ZNU A;  2AX8 A;  2XHS A;  4MG8 B;  2P7A A;  4PLE A;  5HCV A;  5AZT A;  4DM6 A;  1A28 A;  3FXV A;  4K4J A;  3WTQ A;  5ACC A;  3WJ5 A;  1UOM A;  2POG A;  4DMA A;  5I4V A;  2ABI A;  2Q61 A;  2PJL A;  2Q1V A;  4PF3 A;  3VI8 A;  4A2J A;  4IW8 A;  3UP3 A;  4IA7 A;  2OVH A;  1M2Z A;  2P4Y A;  3A2J A;  1RKG A;  4RUO X;  3CWD A;  2GL8 A;  1N83 A;  3L03 A;  3P0U A;  4RUP A;  3KDU A;  3R8I A;  4YPQ A;  4TV1 A;  1I38 A;  3DCT A;  3O1D A;  2ZMH A;  4S14 A;  3V3Q A;  3OSI A;  2I4Z A;  5KCC A;  2HWR A;  4KZJ A;  3CS4 A;  3SP6 A;  4TV1 B;  3ADV A;  2Q5P A;  3AFR A;  3TKM A;  1FBY A;  5DKE A;  3KMZ A;  3VRU A;  1X7R A;  3G9E A;  1XPC A;  4NB6 A;  3HVL A;  1U3S A;  3UUC A;  3GN8 A;  3M7R A;  2AMB A;  2OCF A;  5DZI A;  1NAV A;  4MDD A;  1Z95 A;  4OIL A;  4OJ9 A;  4RMD A;  4S15 A;  4UDC A;  2QGT A;  2PIQ A;  1G2N A;  4FGY A;  3VT5 A;  2AA2 A;  5DSH A;  5IZ0 A;  3OKI A;  4FHH A;  4JYI A;  5DVV A;  5FQS A;  3VHW A;  2QXM A;  2ZBS A;  3G0W A;  4RZF A;  5DV3 A;  5EC9 A;  4JGV A;  5M96 A;  3R8A A;  5JJM A;  4WLB A;  1ILG A;  2HAS A;  3A78 A;  1Q4X A;  2AO6 A;  2I0G A;  2PIT A;  2ZMJ A;  3OS9 A;  3R5N A;  3D90 A;  5JJM B;  1G1U A;  4J24 A;  1X78 A;  3X1I A;  1NQ7 A;  4MG6 A;  3H0A A;  5DXM A;  1UPW A;  1OVL A;  3OZJ A;  3ZR7 A;  4YMQ A;  4RZG A;  5DZH A;  3OS8 C;  4YNK A;  5ICK A;  3WMH A;  2AXA A;  1M13 A;  2O9I A;  3KFC A;  4RFW A;  1OVL B;  3NSP A;  3ET2 A;  1XB7 A;  4J5W C;  3ZQT A;  5DIG A;  4APU A;  5EHJ A;  4Y29 A;  5KRK A;  1FM9 A;  5KRF A;  4LNX A;  4Q13 A;  1PZL A;  3AUQ A;  2ZAS A;  4IV4 A;  4MGB A;  5G42 A;  3RLL A;  2QA6 A;  3H0A D;  3NSQ A;  4N8R A;  2Q59 A;  4R6S A;  5DXK A;  4G1D A;  2Z4B A;  5JY3 A;  1WM0 X;  4QE6 A;  2O4J A;  1XQ3 A;  1RDT A;  3CDS A;  4MGB B;  3B3K A;  4POH A;  3TKC A;  3WJ4 A;  1EXA A;  1IE8 A;  3A2H A;  3KMR A;  1ZGY A;  2Q59 B;  3L0E A;  1HG4 A;  4ZN9 A;  4IUI A;  3V49 A;  2AAX A;  4HEE X;  2Z4J A;  1FM9 D;  4UDA A;  1XIU A;  4G20 A;  4ONI A;  4RZE A;  2AA5 A;  4G2I A;  3HOD A;  4OAR A;  5HYK A;  3ERT A;  2Q60 A;  2QA8 A;  2ZNN A;  4IWF A;  1XP6 A;  4PXM A;  5G3J A;  5E0X A;  2GP7 A;  4XT9 A;  2AX7 A;  1RDT D;  2GIU A;  4QL8 A;  4B7W A;  1XP9 A;  3W5R A;  2QA8 B;  1UPV A;  2Q5G A;  5DLR A;  3VRV A;  5F9B A;  3R2A A;  1P93 A;  3B67 A;  3OSW A;  1TFC A;  2R40 A;  2ZK5 A;  1NQ2 A;  1XZX X;  3N00 A;  4A4W A;  5DX3 A;  3TY0 A;  3VHU A;  1ZEO A;  4FNE A;  3W0H A;  1T7M A;  3OMO A;  5GT4 A;  1ZH7 A;  4F9M A;  1K4W A;  1PK5 A;  2ZK1 A;  5E15 A;  1GS4 A;  2ZK3 A;  5DX3 B;  3PRG A;  4N5G A;  4UDD A;  5AWJ A;  4CI5 A;  3DZY A;  3ADU A;  4NIE A;  4E4Q A;  2GPU A;  4J5X C;  5KYA A;  4ZJR A;  5IXK A;  1R1K A;  2FSZ A;  2OZ7 A;  3CDP A;  4RE8 A;  4MG5 A;  2R40 D;  1NDE A;  1YMT A;  2ZK4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...