1ZAFA

Crystal structure of estrogen receptor beta complexed with 3-bromo-6-hydroxy-2-(4-hydroxy-phenyl)-inden-1-one
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
238
structure length
228
Chain Sequence
LSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMISWAKKIPGFVELSLFDQVRLLESCWMEVLMMGLMWRSIDHPGKLIFAPDLVLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVKAMILLNSAMDSSRKLAHLLNAVTDALVWVIAKSGISSQQQSMRLANLLMLLSHVRHASNKGMEHLLNMKCKNVVPVYDLLLEMLNAHVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Estrogen receptor ligands: design and synthesis of new 2-arylindene-1-ones
pubmed doi rcsb
molecule keywords Estrogen receptor beta
molecule tags Transcription/transferase
source organism Homo sapiens
total genus 89
structure length 228
sequence length 238
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 1zafA00
3VT9A 5GIEA 3RLLA 4NQAB 5KRFA 2AX6A 2FAIA 2HBHA 3OAPA 4OKXA 5EHJA 1X78A 1U3RA 1X7RA 2YLPA 2PNUA 3D24A 4NB6A 4QM0A 5DZHA 5APJA 4RUJA 1M7WA 5AYGA 5KCDA 4RE8A 5KRAA 2GPVA 2GL8A 1T73A 2GTKA 1XV9B 3M7RA 4G2HA 1N4HA 3A2HA 3NSPA 4IVYA 3CTBA 3OMPA 5L7GA 3DZUA 3SP9A 3ADVA 2QA6A 5AAVA 1Y0SA 5DY8A 5DVVA 3WJ5A 3G8IA 2I4PA 3OOFA 5AWKA 1L2JA 2AA5A 1E3KA 5KYAA 4ZJWA 1K74D 2ZNQA 2GWXA 1FM6D 1G50A 5DKSA 3VRVA 4JYIA 3OS9A 2QZOB 4REFA 2FVJA 3VJTA 1YIMA 3FEJA 1PCGA 3ADWA 3B68A 3IA6A 2QMVA 4ZI1A 3CS4A 5DZ1A 1T79A 3OZ0A 5JI0D 3OSIA 2IOKA 1T7MA 3FALB 3SZ1A 1U9EA 3AFRA 1X7EA 4PWLA 2AYRA 3W5QA 1XQ3A 3F7DA 2ZNOA 3W5PA 2VSRA 2VV3A 3LMPA 4MGAA 4G1DA 5DXRA 1R20A 2I4ZA 5DRJA 5G42A 5A86A 2GPPA 1P8DA 3G8OA 3PRGA 2PIOA 1NQ7A 3BEJA 5DZIA 2G5OA 5KCEA 1UPVA 2Q6RA 2ZK0A 5E0WA 1T74A 4S15A 3T03A 3VHVA 2YLQA 3HQ5A 4WQPA 5G3JA 3TKMA 3V4AA 1XV9A 1S19A 3A78A 3QT0A 1R5KA 4G2IA 2I0JA 1YY4A 2HASA 3VSPA 3KDTA 2Q70A 2AA7A 3FUGA 2ZLCA 5DWEA 1EREA 5DXBA 2QE4A 4UDCA 5DXEA 1NQ0A 2YJDA 4WHGA 4UDDA 5DV3A 3PLZA 5KRKA 2Q60A 2Q7KA 2QZOA 4FN9A 4PPPA 1ZUCA 2O9IA 5KCWA 3W0AA 3IMYA 1YOKA 1YP0A 3BQDA 2VV2A 5APHA 4RZEA 3MNPA 3FALA 4FHIA 3KMGA 2QNVA 4IA1A 4JAZA 1XNNA 2IOGA 4XUHA 2ZK2A 3W5TA 4MG9B 3AUQA 5DXQA 4WVDA 4ZNWA 2XKWA 4XTAA 1WM0X 2QABA 5C4TA 1YMTA 3AURA 4K4JA 3B66A 2ZXZA 3DZYA 3VT4A 2AM9A 3VJHA 4JGVA 5KRMA 1K7LA 1YOWA 4M8HA 4ZNTA 2AXAA 1X7JA 5EI1A 5DSHA 2PKLA 5EJVA 2Q8SA 5AK2A 1GS4A 2Q1VA 3OLSA 1DKFB 2NW4A 3AN3A 3R5MA 4G1YA 3NSQA 1BSXA 2ZXNA 1QKMA 1DB1A 4PRGA 4PP5A 4E4KA 5DWJA 5E1CA 5G46A 2Q7IA 1RJKA 2Q1HA 2VV1B 1R6GA 4DK7A 3WFGA 2F4BA 4PPSA 4OJBA 4L96A 5DUHA 4N5GA 5AWJA 5M96A 3VI8A 5EGVA 5DXGA 4ZJRA 4OZRE 4A4VA 5DWLA 2Q5GA 5DIDA 4OEYA 3VHWA 3ZRAA 3AZ3A 5LWPA 3DZUD 4WPFA 3GWSX 4MG9A 4OIVA 4X1GA 5B5BA 3UUCA 1G1UA 1ILGA 3K8SA 1ZGYA 4ZOMA 2QXSA 3CS6A 4DQMA 3E00A 5IAWA 4P6WA 5HYKA 4R06A 3JZBA 5HYRA 5KD9A 1ZDUA 5KYJA 4IWFA 1YYEA 3VT6A 2Q7LA 2XHSA 3HZFA 3RUUA 2V0VA 1MVCA 4RZFA 4XHDA 1DKFA 3RY9A 2E2RA 1ZEOA 4LSJA 3DCUA 4IUIA 5DVCA 4MGDB 3AZ1A 4ZNUA 3D6DA 5JJMB 2J7XA 1R20D 2A3IA 3O1DA 4HEEX 3WFFA 2VV1A 3L0JA 2I0GA 3D90A 3A2JA 1GWXA 3CS8A 1Y0XX 3P89A 1X76A 4ZN9A 5DP0A 1R1KA 1UOMA 3L0EA 4O8FA 3ZR7A 3MNOA 4OKTA 2BJ4B 5FQTA 5AZTA 3W0CA 2NV7A 5AVIA 4POJA 3K23A 5G5WA 1XIUA 3DCTA 1MZNA 1T7FA 1Z5XE 5EC9A 3PEQA 3KMZA 3H0AD 4PVUA 5DXBB 1A52A 2ATHA 4LNXA 3VJIA 3OLLA 5IZ0A 4OJ9A 1FBYA 4RMCA 3CWDA 4OEDA 1N83A 4ZNVA 2ZNPA 2GP7A 1MV9A 3B1MA 1NQ1A 1ZKYA 3V9YA 2ZK4A 3KMRA 3X1IA 3L03A 5DKGA 3OS8A 4OK1A 3HC5A 2YFEA 4PP6A 5DKEA 5KROA 5ETHA 3AN4A 2ABIA 4MGDA 5DXKA 3N00A 4J24A 2AX9A 5G44A 2HWRA 4OFRA 5JJMA 3B5RA 2NXXA 2ZL9A 1TXIA 3BC5A 3GZ9A 3U9QA 3OMOA 5B41A 3V49A 3DZYD 3F5CB 2I4JA 3AZ2A 4CSJA 2Z4JA 3JZCA 1KKQA 3W0IA 3VSOA 3UP0A 5K13A 2J4AA 2BJ4A 1T63A 1OSHA 3GYUA 3MNEA 3UVVB 5ACCA 2AX8A 3KPZA 2OCFA 2R6WA 2JJ3A 1RKHA 1XLSA 1ZDTA 4UDAA 1NDEA 5FQSA 5C4SA 2PJLA 2P7GA 3S9SA 2ZXMA 5AZVA 4ZNHA 2Q59A 3GYTA 1VJBA 3B0WA 3IPUA 2HWQA 5JY3A 4QE8A 2PINA 1IE9A 4OZRU 5KR9A 1SR7A 2ZY0A 4IVWA 4J5XC 3G9EA 3P88A 4ITEA 1RDTA 2YLYA 3IXPA 2ZMJA 3ET0A 4XT9A 1XP6A 3X36A 3ZRBA 5FQVA 3UUDB 5LGAA 3WT5A 3ERDA 4TUZB 2QR9A 4IA3A 5H1EA 1YA3A 3ET1A 3VRUA 4Q50A 1SQNA 3K6PA 1OSVA 4RMDA 1LV2A 4FGYA 3WMHA 5EITA 4DM6A 3CDPA 2AA6A 3W0JA 1GWQA 2Q6SA 1HG4A 2YATA 4OLMA 3F5CA 3HLVA 3OSWA 2P1VA 2QGWA 5DYBA 1I38A 5DV6A 3A2IA 2PIRA 5G43A 4OFUA 4R6SA 1E3GA 4LTWA 1SJ0A 3PBAA 3O1EA 4KZMA 1PRGA 2P1UA 5APKA 3WJ4A 2P4YA 4RUPA 3UVVA 2O4JA 4IW6A 2OAXA 3DR1A 2ZKCA 3CQVA 1PDUA 2R6YA 5L7EA 2R40A 1LBDA 1XJ7A 4ITFA 1QKTA 2AMAA 4ZO1X 5HJPB 2QW4A 3GBKA 2P7AA 1S9PA 3VTCA 4OEAA 1UHLB 3V9TA 3ADSA 2OVMA 3FS1A 5HJSA 4P6XA 3H52A 4MG7B 1G5YA 1OT7A 5SYZA 1I37A 3UUDA 1R1KD 5KRCA 3B0QA 2ZK3A 5DK9A 1Z5XU 1IE8A 4TV1B 3OMQA 4TUZA 1PZLA 4JYHA 2NXXE 4Q0AC 3X31A 4S0TA 4YPQA 2AB2A 2AMBA 5KRHA 3DT3A 5KRIA 3FURA 4ZO1B 2ZK1A 2QH6A 3KDUA 2AAXA 3LBDA 3OMMA 3W0HA 1XPCA 1XVPB 3HVLA 4LBDA 4Q13A 4Y29A 5HJPA 5DI7A 4FNEA 3VRWA 1T76A 3ILZA 5DIGA 3VJSA 5F9BA 4N1YA 3L3XA 3ZQTA 1XLSE 2H79A 3VT5A 1T7TA 3A3ZX 1NQ2A 2PIPL 2OM9A 2P1TA 4BCRA 1RKGA 2GIUA 2HVCA 3K22A 4POHA 2LBDA 4KZJA 1FD0A 5DZ0A 2AWHA 1PQ9A 4DMAA 4N8RA 2ACLB 2GPOA 3GWXA 3OOKA 4PLDA 3IPSA 2AO6A 1UHLA 2XYXA 2JFAB 1S9QA 4OZTU 3VTDA 1ILHA 1XZXX 2OUZA 4MG7A 4OHAA 4OEZA 4QL8A 4MG6A 5FQRA 3SP6A 4DM8A 4ZN7A 3CDSA 4XLDA 3TY0A 2Q61A 3DY6A 3G0WA 2VSTA 2QPYA 4PXMA 2ZVTA 4TV1A 2ZNNA 3V3QA 3VRTA 4EM9A 2Z4BA 1NHZA 1OVLA 3ET2A 5DIEA 3WT7A 2G0GA 2NPAA 1FCZA 3RUTA 5CJ6A 4G20A 2HAMA 1XP1A 1XVPA 2Q59B 2PIXA 5DV8A 3V3EA 5AAUA 5L7HA 2VV4A 2HB8A 2JF9A 1T65A 1Y9RA 3P0UA 2W8YA 2XYJA 3HODA 1NUOA 3Q95A 4ONIA 1RDTD 3IXPD 3VTBA 5DXMA 4K7AA 4NY9A 4RZGA 2P7ZA 2HCDA 2Q3YA 3W0GA 1RK3A 3KYTA 4IA2A 4J5WC 4S0SA 5DZ3A 4IWCA 3UU7A 3X1HA 4B7WA 4IV2A 3FEIA 2OVHA 1HJ1A 5DU5A 3FC6B 2ACLA 1XDKB 3GN8A 1XOWA 2ZASA 4F9MA 1YINA 4QJRA 2QSEA 3OSAA 3UUAB 1G2NA 2JFAA 3UP3A 5DRMA 3RLJA 1N46A 1KV6A 5E15A 2XYWA 1P93A 5KRJA 2YJAB 3L0LA 1S0XA 1XB7A 4NIEA 3OLFA 3OGTA 5FQPA 2O4RA 1KNUA 2FSZA 1YJEA 1FM9A 3ADXA 4OC7A 4OZTE 5DYDA 1M13A 3OKHA 2GPUA 4HLWA 1ZH7A 5E7VA 3W5RA 5KCTA 1XAPA 2R40D 4WLBA 3KFCA 5DLRA 5GICA 4JYGA 1M2ZA 1NRLA 2ZMIA 3CLDA 4E2JA 4QE6A 3R2AA 4X1FA 4DK8A 3R8DA 1K4WA 1L2IA 3FLIA 1SKXA 1U3QA 3V9VA 5E0XA 1PQCA 4WHFA 3KBAA 3L1BA 1PQ6A 4KZIA 3E94A 1Z95A 2QGTA 4J26A 4OKWA 4RFWA 3CJWA 4OGHA 5DUEA 3FC6A 1XDKA 5HCVA 1NAVA 1T7RA 2QA8B 2PIVA 1H9UA 3A9EB 4IQRA 3HO0A 5DMCA 2AA2A 1Q4XA 1FCYA 5GIDA 3UUAA 4OH6A 5DWGA 5DVSA 3OKIA 1I7IA 3E00D 4IA7A 2G44A 3H0AA 2OZ7A 1FCXA 1YUCA 3E7CA 4J5WA 4OKBA 5AVLA 1K74A 1PK5A 1T5ZA 4IV4A 4K6IA 1FM6A 2J7YA 3VT3A 5C4OA 2REWA 1QKUA 5E14A 4MG5A 4REEA 2ZFXA 4YMQA 2HC4A 5KCUA 3A40X 3OMKA 1X7BA 1TFCA 2Q6JA 2QXMA 3NOAA 3VT8A 5IXKA 3R8AA 2G0HA 3VT7A 4FHHA 4XAOA 4S14A 4DOSA 4QK4A 2ZK6A 2IHQA 4UDBA 4OILA 3VN2A 4IU7A 4PF3A 4OIUA 2PIWA 1XP9A 5DX3B 2YLOA 1ERRA 5DWIA 2B1ZA 3AX8A 1ZAFA 3R5NA 4DORA 2YHDA 4N73A 1QKNA 2J14A 2Q5PA 3D57A 4YNKA 2QTUA 4XI3A 1I7GA 1OVLB 3ADUA 1S0ZA 2QA8A 4MG8B 5DTVA 3A9EA 3WTQA 1XQCA 2ZBSA 3PCUA 5G45A 2PITA 2BAWA 3VHUA 3ET3A 4M8EA 1NAXA 2HFPA 4J5XA 5L11A 1GWRA 3KWYA 5KCCA 3OZJA 4IW8A 3TKCA 4MGBB 3D5FA 2VV4B 4JL4A 3R29A 3WWRA 2VV0A 2PIQA 3Q95B 4L98A 5DKBA 5DL4A 4YT1A 2ZLAA 4ZNSA 4LNWA 2Q7JA 3P8XA 3R8IA 3WGPA 2H77A 3ERTA 5ICKA 4OJ4A 3UU7B 3B67A 5KCFA 4G1ZA 4A2JA 5HZCA 3B3KA 5DUGA 2ZMHA 4PP3A 5DMFA 5I4VA 3HC6A 2B23A 4RUOX 3RVFA 4CI4A 2PRGA 3OS8C 3PO9A 3TX7B 5AAVB 4MGCA 5DXPA 5DX3A 1EXAA 3EYBA 4RWVA 2ZK5A 4CI5A 1EXXA 4NUFA 2P54A 3WT6A 4A4WA 4E4QA 2B1VA 2V7CA 2EWPA 2PIUA 5GT4A 1NYXA 2POBA 1XNXA 4IS8A 3L3ZA 4R2UA 2HB7A 3ADTA 4EMAA 3AUNA 1FM9D 3B0TA 2POGA 3GD2A 4MG8A 3B0RA 4APUA 5E19A 3IPQA 1A28A 5C4UA 2P15A 1U3SA 3HM1A 4OARA 4MDDA 2HARA 5KRLA 4MGBA 4G21A 4PLEA 3W0YA 2B50A 4XUMA 1UPWA 3B65A 4MGAB 2Q5SA 4OH5A 4RAKA 2AX7A 3FXVA 4RMEA
chains in the Genus database with same CATH superfamily
3VT9A 5GIEA 3RLLA 4NQAB 5KRFA 2AX6A 2FAIA 2HBHA 3OAPA 4OKXA 5EHJA 1X78A 1U3RA 1X7RA 2YLPA 2PNUA 3D24A 4NB6A 4QM0A 5DZHA 5APJA 4RUJA 1M7WA 5AYGA 5KCDA 4RE8A 5KRAA 2GPVA 2GL8A 1T73A 2GTKA 1XV9B 3M7RA 4G2HA 1N4HA 3A2HA 3NSPA 4IVYA 3CTBA 3OMPA 5L7GA 3DZUA 3SP9A 3ADVA 2QA6A 5AAVA 1Y0SA 5DY8A 5DVVA 3WJ5A 3G8IA 2I4PA 3OOFA 5AWKA 1L2JA 2AA5A 1E3KA 5KYAA 4ZJWA 1K74D 2ZNQA 2GWXA 1FM6D 1G50A 5DKSA 3VRVA 4JYIA 3OS9A 2QZOB 4REFA 2FVJA 3VJTA 1YIMA 3FEJA 1PCGA 3ADWA 3B68A 3IA6A 2QMVA 4ZI1A 3CS4A 5DZ1A 1T79A 3OZ0A 5JI0D 3OSIA 2IOKA 1T7MA 3FALB 3SZ1A 1U9EA 3AFRA 1X7EA 4PWLA 2AYRA 3W5QA 1XQ3A 3F7DA 2ZNOA 3W5PA 2VSRA 2VV3A 3LMPA 4MGAA 4G1DA 5DXRA 1R20A 2I4ZA 5DRJA 5G42A 5A86A 2GPPA 1P8DA 3G8OA 3PRGA 2PIOA 1NQ7A 3BEJA 5DZIA 2G5OA 5KCEA 1UPVA 2Q6RA 2ZK0A 5E0WA 1T74A 4S15A 3T03A 3VHVA 2YLQA 3HQ5A 4WQPA 5G3JA 3TKMA 3V4AA 1XV9A 1S19A 3A78A 3QT0A 1R5KA 4G2IA 2I0JA 1YY4A 2HASA 3VSPA 3KDTA 2Q70A 2AA7A 3FUGA 2ZLCA 5DWEA 1EREA 5DXBA 2QE4A 4UDCA 5DXEA 1NQ0A 2YJDA 4WHGA 4UDDA 5DV3A 3PLZA 5KRKA 2Q60A 2Q7KA 2QZOA 4FN9A 4PPPA 1ZUCA 2O9IA 5KCWA 3W0AA 3IMYA 1YOKA 1YP0A 3BQDA 2VV2A 5APHA 4RZEA 3MNPA 3FALA 4FHIA 3KMGA 2QNVA 4IA1A 4JAZA 1XNNA 2IOGA 4XUHA 2ZK2A 3W5TA 4MG9B 3AUQA 5DXQA 4WVDA 4ZNWA 2XKWA 4XTAA 1WM0X 2QABA 5C4TA 1YMTA 3AURA 4K4JA 3B66A 2ZXZA 3DZYA 3VT4A 2AM9A 3VJHA 4JGVA 5KRMA 1K7LA 1YOWA 4M8HA 4ZNTA 2AXAA 1X7JA 5EI1A 5DSHA 2PKLA 5EJVA 2Q8SA 5AK2A 1GS4A 2Q1VA 3OLSA 1DKFB 2NW4A 3AN3A 3R5MA 4G1YA 3NSQA 1BSXA 2ZXNA 1QKMA 1DB1A 4PRGA 4PP5A 4E4KA 5DWJA 5E1CA 5G46A 2Q7IA 1RJKA 2Q1HA 2VV1B 1R6GA 4DK7A 3WFGA 2F4BA 4PPSA 4OJBA 4L96A 5DUHA 4N5GA 5AWJA 5M96A 3VI8A 5EGVA 5DXGA 4ZJRA 4OZRE 4A4VA 5DWLA 2Q5GA 5DIDA 4OEYA 3VHWA 3ZRAA 3AZ3A 5LWPA 3DZUD 4WPFA 3GWSX 4MG9A 4OIVA 4X1GA 5B5BA 3UUCA 1G1UA 1ILGA 3K8SA 1ZGYA 4ZOMA 2QXSA 3CS6A 4DQMA 3E00A 5IAWA 4P6WA 5HYKA 4R06A 3JZBA 5HYRA 5KD9A 1ZDUA 5KYJA 4IWFA 1YYEA 3VT6A 2Q7LA 2XHSA 3HZFA 3RUUA 2V0VA 1MVCA 4RZFA 4XHDA 1DKFA 3RY9A 2E2RA 1ZEOA 4LSJA 3DCUA 4IUIA 5DVCA 4MGDB 3AZ1A 4ZNUA 3D6DA 5JJMB 2J7XA 1R20D 2A3IA 3O1DA 4HEEX 3WFFA 2VV1A 3L0JA 2I0GA 3D90A 3A2JA 1GWXA 3CS8A 1Y0XX 3P89A 1X76A 4ZN9A 5DP0A 1R1KA 1UOMA 3L0EA 4O8FA 3ZR7A 3MNOA 4OKTA 2BJ4B 5FQTA 5AZTA 3W0CA 2NV7A 5AVIA 4POJA 3K23A 5G5WA 1XIUA 3DCTA 1MZNA 1T7FA 1Z5XE 5EC9A 3PEQA 3KMZA 3H0AD 4PVUA 5DXBB 1A52A 2ATHA 4LNXA 3VJIA 3OLLA 5IZ0A 4OJ9A 1FBYA 4RMCA 3CWDA 4OEDA 1N83A 4ZNVA 2ZNPA 2GP7A 1MV9A 3B1MA 1NQ1A 1ZKYA 3V9YA 2ZK4A 3KMRA 3X1IA 3L03A 5DKGA 3OS8A 4OK1A 3HC5A 2YFEA 4PP6A 5DKEA 5KROA 5ETHA 3AN4A 2ABIA 4MGDA 5DXKA 3N00A 4J24A 2AX9A 5G44A 2HWRA 4OFRA 5JJMA 3B5RA 2NXXA 2ZL9A 1TXIA 3BC5A 3GZ9A 3U9QA 3OMOA 5B41A 3V49A 3DZYD 3F5CB 2I4JA 3AZ2A 4CSJA 2Z4JA 3JZCA 1KKQA 3W0IA 3VSOA 3UP0A 5K13A 2J4AA 2BJ4A 1T63A 1OSHA 3GYUA 3MNEA 3UVVB 5ACCA 2AX8A 3KPZA 2OCFA 2R6WA 2JJ3A 1RKHA 1XLSA 1ZDTA 4UDAA 1NDEA 5FQSA 5C4SA 2PJLA 2P7GA 3S9SA 2ZXMA 5AZVA 4ZNHA 2Q59A 3GYTA 1VJBA 3B0WA 3IPUA 2HWQA 5JY3A 4QE8A 2PINA 1IE9A 4OZRU 5KR9A 1SR7A 2ZY0A 4IVWA 4J5XC 3G9EA 3P88A 4ITEA 1RDTA 2YLYA 3IXPA 2ZMJA 3ET0A 4XT9A 1XP6A 3X36A 3ZRBA 5FQVA 3UUDB 5LGAA 3WT5A 3ERDA 4TUZB 2QR9A 4IA3A 5H1EA 1YA3A 3ET1A 3VRUA 4Q50A 1SQNA 3K6PA 1OSVA 4RMDA 1LV2A 4FGYA 3WMHA 5EITA 4DM6A 3CDPA 2AA6A 3W0JA 1GWQA 2Q6SA 1HG4A 2YATA 4OLMA 3F5CA 3HLVA 3OSWA 2P1VA 2QGWA 5DYBA 1I38A 5DV6A 3A2IA 2PIRA 5G43A 4OFUA 4R6SA 1E3GA 4LTWA 1SJ0A 3PBAA 3O1EA 4KZMA 1PRGA 2P1UA 5APKA 3WJ4A 2P4YA 4RUPA 3UVVA 2O4JA 4IW6A 2OAXA 3DR1A 2ZKCA 3CQVA 1PDUA 2R6YA 5L7EA 2R40A 1LBDA 1XJ7A 4ITFA 1QKTA 2AMAA 4ZO1X 5HJPB 2QW4A 3GBKA 2P7AA 1S9PA 3VTCA 4OEAA 1UHLB 3V9TA 3ADSA 2OVMA 3FS1A 5HJSA 4P6XA 3H52A 4MG7B 1G5YA 1OT7A 5SYZA 1I37A 3UUDA 1R1KD 5KRCA 3B0QA 2ZK3A 5DK9A 1Z5XU 1IE8A 4TV1B 3OMQA 4TUZA 1PZLA 4JYHA 2NXXE 4Q0AC 3X31A 4S0TA 4YPQA 2AB2A 2AMBA 5KRHA 3DT3A 5KRIA 3FURA 4ZO1B 2ZK1A 2QH6A 3KDUA 2AAXA 3LBDA 3OMMA 3W0HA 1XPCA 1XVPB 3HVLA 4LBDA 4Q13A 4Y29A 5HJPA 5DI7A 4FNEA 3VRWA 1T76A 3ILZA 5DIGA 3VJSA 5F9BA 4N1YA 3L3XA 3ZQTA 1XLSE 2H79A 3VT5A 1T7TA 3A3ZX 1NQ2A 2PIPL 2OM9A 2P1TA 4BCRA 1RKGA 2GIUA 2HVCA 3K22A 4POHA 2LBDA 4KZJA 1FD0A 5DZ0A 2AWHA 1PQ9A 4DMAA 4N8RA 2ACLB 2GPOA 3GWXA 3OOKA 4PLDA 3IPSA 2AO6A 1UHLA 2XYXA 2JFAB 1S9QA 4OZTU 3VTDA 1ILHA 1XZXX 2OUZA 4MG7A 4OHAA 4OEZA 4QL8A 4MG6A 5FQRA 3SP6A 4DM8A 4ZN7A 3CDSA 4XLDA 3TY0A 2Q61A 3DY6A 3G0WA 2VSTA 2QPYA 4PXMA 2ZVTA 4TV1A 2ZNNA 3V3QA 3VRTA 4EM9A 2Z4BA 1NHZA 1OVLA 3ET2A 5DIEA 3WT7A 2G0GA 2NPAA 1FCZA 3RUTA 5CJ6A 4G20A 2HAMA 1XP1A 1XVPA 2Q59B 2PIXA 5DV8A 3V3EA 5AAUA 5L7HA 2VV4A 2HB8A 2JF9A 1T65A 1Y9RA 3P0UA 2W8YA 2XYJA 3HODA 1NUOA 3Q95A 4ONIA 1RDTD 3IXPD 3VTBA 5DXMA 4K7AA 4NY9A 4RZGA 2P7ZA 2HCDA 2Q3YA 3W0GA 1RK3A 3KYTA 4IA2A 4J5WC 4S0SA 5DZ3A 4IWCA 3UU7A 3X1HA 4B7WA 4IV2A 3FEIA 2OVHA 1HJ1A 5DU5A 3FC6B 2ACLA 1XDKB 3GN8A 1XOWA 2ZASA 4F9MA 1YINA 4QJRA 2QSEA 3OSAA 3UUAB 1G2NA 2JFAA 3UP3A 5DRMA 3RLJA 1N46A 1KV6A 5E15A 2XYWA 1P93A 5KRJA 2YJAB 3L0LA 1S0XA 1XB7A 4NIEA 3OLFA 3OGTA 5FQPA 2O4RA 1KNUA 2FSZA 1YJEA 1FM9A 3ADXA 4OC7A 4OZTE 5DYDA 1M13A 3OKHA 2GPUA 4HLWA 1ZH7A 5E7VA 3W5RA 5KCTA 1XAPA 2R40D 4WLBA 3KFCA 5DLRA 5GICA 4JYGA 1M2ZA 1NRLA 2ZMIA 3CLDA 4E2JA 4QE6A 3R2AA 4X1FA 4DK8A 3R8DA 1K4WA 1L2IA 3FLIA 1SKXA 1U3QA 3V9VA 5E0XA 1PQCA 4WHFA 3KBAA 3L1BA 1PQ6A 4KZIA 3E94A 1Z95A 2QGTA 4J26A 4OKWA 4RFWA 3CJWA 4OGHA 5DUEA 3FC6A 1XDKA 5HCVA 1NAVA 1T7RA 2QA8B 2PIVA 1H9UA 3A9EB 4IQRA 3HO0A 5DMCA 2AA2A 1Q4XA 1FCYA 5GIDA 3UUAA 4OH6A 5DWGA 5DVSA 3OKIA 1I7IA 3E00D 4IA7A 2G44A 3H0AA 2OZ7A 1FCXA 1YUCA 3E7CA 4J5WA 4OKBA 5AVLA 1K74A 1PK5A 1T5ZA 4IV4A 4K6IA 1FM6A 2J7YA 3VT3A 5C4OA 2REWA 1QKUA 5E14A 4MG5A 4REEA 2ZFXA 4YMQA 2HC4A 5KCUA 3A40X 3OMKA 1X7BA 1TFCA 2Q6JA 2QXMA 3NOAA 3VT8A 5IXKA 3R8AA 2G0HA 3VT7A 4FHHA 4XAOA 4S14A 4DOSA 4QK4A 2ZK6A 2IHQA 4UDBA 4OILA 3VN2A 4IU7A 4PF3A 4OIUA 2PIWA 1XP9A 5DX3B 2YLOA 1ERRA 5DWIA 2B1ZA 3AX8A 1ZAFA 3R5NA 4DORA 2YHDA 4N73A 1QKNA 2J14A 2Q5PA 3D57A 4YNKA 2QTUA 4XI3A 1I7GA 1OVLB 3ADUA 1S0ZA 2QA8A 4MG8B 5DTVA 3A9EA 3WTQA 1XQCA 2ZBSA 3PCUA 5G45A 2PITA 2BAWA 3VHUA 3ET3A 4M8EA 1NAXA 2HFPA 4J5XA 5L11A 1GWRA 3KWYA 5KCCA 3OZJA 4IW8A 3TKCA 4MGBB 3D5FA 2VV4B 4JL4A 3R29A 3WWRA 2VV0A 2PIQA 3Q95B 4L98A 5DKBA 5DL4A 4YT1A 2ZLAA 4ZNSA 4LNWA 2Q7JA 3P8XA 3R8IA 3WGPA 2H77A 3ERTA 5ICKA 4OJ4A 3UU7B 3B67A 5KCFA 4G1ZA 4A2JA 5HZCA 3B3KA 5DUGA 2ZMHA 4PP3A 5DMFA 5I4VA 3HC6A 2B23A 4RUOX 3RVFA 4CI4A 2PRGA 3OS8C 3PO9A 3TX7B 5AAVB 4MGCA 5DXPA 5DX3A 1EXAA 3EYBA 4RWVA 2ZK5A 4CI5A 1EXXA 4NUFA 2P54A 3WT6A 4A4WA 4E4QA 2B1VA 2V7CA 2EWPA 2PIUA 5GT4A 1NYXA 2POBA 1XNXA 4IS8A 3L3ZA 4R2UA 2HB7A 3ADTA 4EMAA 3AUNA 1FM9D 3B0TA 2POGA 3GD2A 4MG8A 3B0RA 4APUA 5E19A 3IPQA 1A28A 5C4UA 2P15A 1U3SA 3HM1A 4OARA 4MDDA 2HARA 5KRLA 4MGBA 4G21A 4PLEA 3W0YA 2B50A 4XUMA 1UPWA 3B65A 4MGAB 2Q5SA 4OH5A 4RAKA 2AX7A 3FXVA 4RMEA
chains in the Genus database with same CATH topology
3VT9A 5GIEA 3RLLA 4NQAB 5KRFA 2AX6A 2FAIA 2HBHA 3OAPA 4OKXA 5EHJA 1X78A 1U3RA 1X7RA 2YLPA 2PNUA 3D24A 4NB6A 4QM0A 5DZHA 5APJA 4RUJA 1M7WA 5AYGA 5KCDA 4RE8A 5KRAA 2GPVA 2GL8A 1T73A 2GTKA 1XV9B 3M7RA 4G2HA 1N4HA 3A2HA 3NSPA 4IVYA 3CTBA 3OMPA 5L7GA 3DZUA 3SP9A 3ADVA 2QA6A 5AAVA 1Y0SA 5DY8A 5DVVA 3WJ5A 3G8IA 2I4PA 3OOFA 5AWKA 1L2JA 2AA5A 1E3KA 5KYAA 4ZJWA 1K74D 2ZNQA 2GWXA 1FM6D 1G50A 5DKSA 3VRVA 4JYIA 3OS9A 2QZOB 4REFA 2FVJA 3VJTA 1YIMA 3FEJA 1PCGA 3ADWA 3B68A 3IA6A 2QMVA 4ZI1A 3CS4A 5DZ1A 1T79A 3OZ0A 5JI0D 3OSIA 2IOKA 1T7MA 3FALB 3SZ1A 1U9EA 3AFRA 1X7EA 4PWLA 2AYRA 3W5QA 1XQ3A 3F7DA 2ZNOA 3W5PA 2VSRA 2VV3A 3LMPA 4MGAA 4G1DA 5DXRA 1R20A 2I4ZA 5DRJA 5G42A 5A86A 2GPPA 1P8DA 3G8OA 3PRGA 2PIOA 1NQ7A 3BEJA 5DZIA 2G5OA 5KCEA 1UPVA 2Q6RA 2ZK0A 5E0WA 1T74A 4S15A 3T03A 3VHVA 2YLQA 3HQ5A 4WQPA 5G3JA 3TKMA 3V4AA 1XV9A 1S19A 3A78A 3QT0A 1R5KA 4G2IA 2I0JA 1YY4A 2HASA 3VSPA 3KDTA 2Q70A 2AA7A 3FUGA 2ZLCA 5DWEA 1EREA 5DXBA 2QE4A 4UDCA 5DXEA 1NQ0A 2YJDA 4WHGA 4UDDA 5DV3A 3PLZA 5KRKA 2Q60A 2Q7KA 2QZOA 4FN9A 4PPPA 1ZUCA 2O9IA 5KCWA 3W0AA 3IMYA 1YOKA 1YP0A 3BQDA 2VV2A 5APHA 4RZEA 3MNPA 3FALA 4FHIA 3KMGA 2QNVA 4IA1A 4JAZA 1XNNA 2IOGA 4XUHA 2ZK2A 3W5TA 4MG9B 3AUQA 5DXQA 4WVDA 4ZNWA 2XKWA 4XTAA 1WM0X 2QABA 5C4TA 1YMTA 3AURA 4K4JA 3B66A 2ZXZA 3DZYA 3VT4A 2AM9A 3VJHA 4JGVA 5KRMA 1K7LA 1YOWA 4M8HA 4ZNTA 2AXAA 1X7JA 5EI1A 5DSHA 2PKLA 5EJVA 2Q8SA 5AK2A 1GS4A 2Q1VA 3OLSA 1DKFB 2NW4A 3AN3A 3R5MA 4G1YA 3NSQA 1BSXA 2ZXNA 1QKMA 1DB1A 4PRGA 4PP5A 4E4KA 5DWJA 5E1CA 5G46A 2Q7IA 1RJKA 2Q1HA 2VV1B 1R6GA 4DK7A 3WFGA 2F4BA 4PPSA 4OJBA 4L96A 5DUHA 4N5GA 5AWJA 5M96A 3VI8A 5EGVA 5DXGA 4ZJRA 4OZRE 4A4VA 5DWLA 2Q5GA 5DIDA 4OEYA 3VHWA 3ZRAA 3AZ3A 5LWPA 3DZUD 4WPFA 3GWSX 4MG9A 4OIVA 4X1GA 5B5BA 3UUCA 1G1UA 1ILGA 3K8SA 1ZGYA 4ZOMA 2QXSA 3CS6A 4DQMA 3E00A 5IAWA 4P6WA 5HYKA 4R06A 3JZBA 5HYRA 5KD9A 1ZDUA 5KYJA 4IWFA 1YYEA 3VT6A 2Q7LA 2XHSA 3HZFA 3RUUA 2V0VA 1MVCA 4RZFA 4XHDA 1DKFA 3RY9A 2E2RA 1ZEOA 4LSJA 3DCUA 4IUIA 5DVCA 4MGDB 3AZ1A 4ZNUA 3D6DA 5JJMB 2J7XA 1R20D 2A3IA 3O1DA 4HEEX 3WFFA 2VV1A 3L0JA 2I0GA 3D90A 3A2JA 1GWXA 3CS8A 1Y0XX 3P89A 1X76A 4ZN9A 5DP0A 1R1KA 1UOMA 3L0EA 4O8FA 3ZR7A 3MNOA 4OKTA 2BJ4B 5FQTA 5AZTA 3W0CA 2NV7A 5AVIA 4POJA 3K23A 5G5WA 1XIUA 3DCTA 1MZNA 1T7FA 1Z5XE 5EC9A 3PEQA 3KMZA 3H0AD 4PVUA 5DXBB 1A52A 2ATHA 4LNXA 3VJIA 3OLLA 5IZ0A 4OJ9A 1FBYA 4RMCA 3CWDA 4OEDA 1N83A 4ZNVA 2ZNPA 2GP7A 1MV9A 3B1MA 1NQ1A 1ZKYA 3V9YA 2ZK4A 3KMRA 3X1IA 3L03A 5DKGA 3OS8A 4OK1A 3HC5A 2YFEA 4PP6A 5DKEA 5KROA 5ETHA 3AN4A 2ABIA 4MGDA 5DXKA 3N00A 4J24A 2AX9A 5G44A 2HWRA 4OFRA 5JJMA 3B5RA 2NXXA 2ZL9A 1TXIA 3BC5A 3GZ9A 3U9QA 3OMOA 5B41A 3V49A 3DZYD 3F5CB 2I4JA 3AZ2A 4CSJA 2Z4JA 3JZCA 1KKQA 3W0IA 3VSOA 3UP0A 5K13A 2J4AA 2BJ4A 1T63A 1OSHA 3GYUA 3MNEA 3UVVB 5ACCA 2AX8A 3KPZA 2OCFA 2R6WA 2JJ3A 1RKHA 1XLSA 1ZDTA 4UDAA 1NDEA 5FQSA 5C4SA 2PJLA 2P7GA 3S9SA 2ZXMA 5AZVA 4ZNHA 2Q59A 3GYTA 1VJBA 3B0WA 3IPUA 2HWQA 5JY3A 4QE8A 2PINA 1IE9A 4OZRU 5KR9A 1SR7A 2ZY0A 4IVWA 4J5XC 3G9EA 3P88A 4ITEA 1RDTA 2YLYA 3IXPA 2ZMJA 3ET0A 4XT9A 1XP6A 3X36A 3ZRBA 5FQVA 3UUDB 5LGAA 3WT5A 3ERDA 4TUZB 2QR9A 4IA3A 5H1EA 1YA3A 3ET1A 3VRUA 4Q50A 1SQNA 3K6PA 1OSVA 4RMDA 1LV2A 4FGYA 3WMHA 5EITA 4DM6A 3CDPA 2AA6A 3W0JA 1GWQA 2Q6SA 1HG4A 2YATA 4OLMA 3F5CA 3HLVA 3OSWA 2P1VA 2QGWA 5DYBA 1I38A 5DV6A 3A2IA 2PIRA 5G43A 4OFUA 4R6SA 1E3GA 4LTWA 1SJ0A 3PBAA 3O1EA 4KZMA 1PRGA 2P1UA 5APKA 3WJ4A 2P4YA 4RUPA 3UVVA 2O4JA 4IW6A 2OAXA 3DR1A 2ZKCA 3CQVA 1PDUA 2R6YA 5L7EA 2R40A 1LBDA 1XJ7A 4ITFA 1QKTA 2AMAA 4ZO1X 5HJPB 2QW4A 3GBKA 2P7AA 1S9PA 3VTCA 4OEAA 1UHLB 3V9TA 3ADSA 2OVMA 3FS1A 5HJSA 4P6XA 3H52A 4MG7B 1G5YA 1OT7A 5SYZA 1I37A 3UUDA 1R1KD 5KRCA 3B0QA 2ZK3A 5DK9A 1Z5XU 1IE8A 4TV1B 3OMQA 4TUZA 1PZLA 4JYHA 2NXXE 4Q0AC 3X31A 4S0TA 4YPQA 2AB2A 2AMBA 5KRHA 3DT3A 5KRIA 3FURA 4ZO1B 2ZK1A 2QH6A 3KDUA 2AAXA 3LBDA 3OMMA 3W0HA 1XPCA 1XVPB 3HVLA 4LBDA 4Q13A 4Y29A 5HJPA 5DI7A 4FNEA 3VRWA 1T76A 3ILZA 5DIGA 3VJSA 5F9BA 4N1YA 3L3XA 3ZQTA 1XLSE 2H79A 3VT5A 1T7TA 3A3ZX 1NQ2A 2PIPL 2OM9A 2P1TA 4BCRA 1RKGA 2GIUA 2HVCA 3K22A 4POHA 2LBDA 4KZJA 1FD0A 5DZ0A 2AWHA 1PQ9A 4DMAA 4N8RA 2ACLB 2GPOA 3GWXA 3OOKA 4PLDA 3IPSA 2AO6A 1UHLA 2XYXA 2JFAB 1S9QA 4OZTU 3VTDA 1ILHA 1XZXX 2OUZA 4MG7A 4OHAA 4OEZA 4QL8A 4MG6A 5FQRA 3SP6A 4DM8A 4ZN7A 3CDSA 4XLDA 3TY0A 2Q61A 3DY6A 3G0WA 2VSTA 2QPYA 4PXMA 2ZVTA 4TV1A 2ZNNA 3V3QA 3VRTA 4EM9A 2Z4BA 1NHZA 1OVLA 3ET2A 5DIEA 3WT7A 2G0GA 2NPAA 1FCZA 3RUTA 5CJ6A 4G20A 2HAMA 1XP1A 1XVPA 2Q59B 2PIXA 5DV8A 3V3EA 5AAUA 5L7HA 2VV4A 2HB8A 2JF9A 1T65A 1Y9RA 3P0UA 2W8YA 2XYJA 3HODA 1NUOA 3Q95A 4ONIA 1RDTD 3IXPD 3VTBA 5DXMA 4K7AA 4NY9A 4RZGA 2P7ZA 2HCDA 2Q3YA 3W0GA 1RK3A 3KYTA 4IA2A 4J5WC 4S0SA 5DZ3A 4IWCA 3UU7A 3X1HA 4B7WA 4IV2A 3FEIA 2OVHA 1HJ1A 5DU5A 3FC6B 2ACLA 1XDKB 3GN8A 1XOWA 2ZASA 4F9MA 1YINA 4QJRA 2QSEA 3OSAA 3UUAB 1G2NA 2JFAA 3UP3A 5DRMA 3RLJA 1N46A 1KV6A 5E15A 2XYWA 1P93A 5KRJA 2YJAB 3L0LA 1S0XA 1XB7A 4NIEA 3OLFA 3OGTA 5FQPA 2O4RA 1KNUA 2FSZA 1YJEA 1FM9A 3ADXA 4OC7A 4OZTE 5DYDA 1M13A 3OKHA 2GPUA 4HLWA 1ZH7A 5E7VA 3W5RA 5KCTA 1XAPA 2R40D 4WLBA 3KFCA 5DLRA 5GICA 4JYGA 1M2ZA 1NRLA 2ZMIA 3CLDA 4E2JA 4QE6A 3R2AA 4X1FA 4DK8A 3R8DA 1K4WA 1L2IA 3FLIA 1SKXA 1U3QA 3V9VA 5E0XA 1PQCA 4WHFA 3KBAA 3L1BA 1PQ6A 4KZIA 3E94A 1Z95A 2QGTA 4J26A 4OKWA 4RFWA 3CJWA 4OGHA 5DUEA 3FC6A 1XDKA 5HCVA 1NAVA 1T7RA 2QA8B 2PIVA 1H9UA 3A9EB 4IQRA 3HO0A 5DMCA 2AA2A 1Q4XA 1FCYA 5GIDA 3UUAA 4OH6A 5DWGA 5DVSA 3OKIA 1I7IA 3E00D 4IA7A 2G44A 3H0AA 2OZ7A 1FCXA 1YUCA 3E7CA 4J5WA 4OKBA 5AVLA 1K74A 1PK5A 1T5ZA 4IV4A 4K6IA 1FM6A 2J7YA 3VT3A 5C4OA 2REWA 1QKUA 5E14A 4MG5A 4REEA 2ZFXA 4YMQA 2HC4A 5KCUA 3A40X 3OMKA 1X7BA 1TFCA 2Q6JA 2QXMA 3NOAA 3VT8A 5IXKA 3R8AA 2G0HA 3VT7A 4FHHA 4XAOA 4S14A 4DOSA 4QK4A 2ZK6A 2IHQA 4UDBA 4OILA 3VN2A 4IU7A 4PF3A 4OIUA 2PIWA 1XP9A 5DX3B 2YLOA 1ERRA 5DWIA 2B1ZA 3AX8A 1ZAFA 3R5NA 4DORA 2YHDA 4N73A 1QKNA 2J14A 2Q5PA 3D57A 4YNKA 2QTUA 4XI3A 1I7GA 1OVLB 3ADUA 1S0ZA 2QA8A 4MG8B 5DTVA 3A9EA 3WTQA 1XQCA 2ZBSA 3PCUA 5G45A 2PITA 2BAWA 3VHUA 3ET3A 4M8EA 1NAXA 2HFPA 4J5XA 5L11A 1GWRA 3KWYA 5KCCA 3OZJA 4IW8A 3TKCA 4MGBB 3D5FA 2VV4B 4JL4A 3R29A 3WWRA 2VV0A 2PIQA 3Q95B 4L98A 5DKBA 5DL4A 4YT1A 2ZLAA 4ZNSA 4LNWA 2Q7JA 3P8XA 3R8IA 3WGPA 2H77A 3ERTA 5ICKA 4OJ4A 3UU7B 3B67A 5KCFA 4G1ZA 4A2JA 5HZCA 3B3KA 5DUGA 2ZMHA 4PP3A 5DMFA 5I4VA 3HC6A 2B23A 4RUOX 3RVFA 4CI4A 2PRGA 3OS8C 3PO9A 3TX7B 5AAVB 4MGCA 5DXPA 5DX3A 1EXAA 3EYBA 4RWVA 2ZK5A 4CI5A 1EXXA 4NUFA 2P54A 3WT6A 4A4WA 4E4QA 2B1VA 2V7CA 2EWPA 2PIUA 5GT4A 1NYXA 2POBA 1XNXA 4IS8A 3L3ZA 4R2UA 2HB7A 3ADTA 4EMAA 3AUNA 1FM9D 3B0TA 2POGA 3GD2A 4MG8A 3B0RA 4APUA 5E19A 3IPQA 1A28A 5C4UA 2P15A 1U3SA 3HM1A 4OARA 4MDDA 2HARA 5KRLA 4MGBA 4G21A 4PLEA 3W0YA 2B50A 4XUMA 1UPWA 3B65A 4MGAB 2Q5SA 4OH5A 4RAKA 2AX7A 3FXVA 4RMEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VT9 A;  5GIE A;  3RLL A;  4NQA B;  5KRF A;  2AX6 A;  2FAI A;  2HBH A;  3OAP A;  4OKX A;  5EHJ A;  1X78 A;  1U3R A;  1X7R A;  2YLP A;  2PNU A;  3D24 A;  4NB6 A;  4QM0 A;  5DZH A;  5APJ A;  4RUJ A;  1M7W A;  5AYG A;  5KCD A;  4RE8 A;  5KRA A;  2GPV A;  2GL8 A;  1T73 A;  2GTK A;  1XV9 B;  3M7R A;  4G2H A;  1N4H A;  3A2H A;  3NSP A;  4IVY A;  3CTB A;  3OMP A;  5L7G A;  3DZU A;  3SP9 A;  3ADV A;  2QA6 A;  5AAV A;  1Y0S A;  5DY8 A;  5DVV A;  3WJ5 A;  3G8I A;  2I4P A;  3OOF A;  5AWK A;  1L2J A;  2AA5 A;  1E3K A;  5KYA A;  4ZJW A;  1K74 D;  2ZNQ A;  2GWX A;  1FM6 D;  1G50 A;  5DKS A;  3VRV A;  4JYI A;  3OS9 A;  2QZO B;  4REF A;  2FVJ A;  3VJT A;  1YIM A;  3FEJ A;  1PCG A;  3ADW A;  3B68 A;  3IA6 A;  2QMV A;  4ZI1 A;  3CS4 A;  5DZ1 A;  1T79 A;  3OZ0 A;  5JI0 D;  3OSI A;  2IOK A;  1T7M A;  3FAL B;  3SZ1 A;  1U9E A;  3AFR A;  1X7E A;  4PWL A;  2AYR A;  3W5Q A;  1XQ3 A;  3F7D A;  2ZNO A;  3W5P A;  2VSR A;  2VV3 A;  3LMP A;  4MGA A;  4G1D A;  5DXR A;  1R20 A;  2I4Z A;  5DRJ A;  5G42 A;  5A86 A;  2GPP A;  1P8D A;  3G8O A;  3PRG A;  2PIO A;  1NQ7 A;  3BEJ A;  5DZI A;  2G5O A;  5KCE A;  1UPV A;  2Q6R A;  2ZK0 A;  5E0W A;  1T74 A;  4S15 A;  3T03 A;  3VHV A;  2YLQ A;  3HQ5 A;  4WQP A;  5G3J A;  3TKM A;  3V4A A;  1XV9 A;  1S19 A;  3A78 A;  3QT0 A;  1R5K A;  4G2I A;  2I0J A;  1YY4 A;  2HAS A;  3VSP A;  3KDT A;  2Q70 A;  2AA7 A;  3FUG A;  2ZLC A;  5DWE A;  1ERE A;  5DXB A;  2QE4 A;  4UDC A;  5DXE A;  1NQ0 A;  2YJD A;  4WHG A;  4UDD A;  5DV3 A;  3PLZ A;  5KRK A;  2Q60 A;  2Q7K A;  2QZO A;  4FN9 A;  4PPP A;  1ZUC A;  2O9I A;  5KCW A;  3W0A A;  3IMY A;  1YOK A;  1YP0 A;  3BQD A;  2VV2 A;  5APH A;  4RZE A;  3MNP A;  3FAL A;  4FHI A;  3KMG A;  2QNV A;  4IA1 A;  4JAZ A;  1XNN A;  2IOG A;  4XUH A;  2ZK2 A;  3W5T A;  4MG9 B;  3AUQ A;  5DXQ A;  4WVD A;  4ZNW A;  2XKW A;  4XTA A;  1WM0 X;  2QAB A;  5C4T A;  1YMT A;  3AUR A;  4K4J A;  3B66 A;  2ZXZ A;  3DZY A;  3VT4 A;  2AM9 A;  3VJH A;  4JGV A;  5KRM A;  1K7L A;  1YOW A;  4M8H A;  4ZNT A;  2AXA A;  1X7J A;  5EI1 A;  5DSH A;  2PKL A;  5EJV A;  2Q8S A;  5AK2 A;  1GS4 A;  2Q1V A;  3OLS A;  1DKF B;  2NW4 A;  3AN3 A;  3R5M A;  4G1Y A;  3NSQ A;  1BSX A;  2ZXN A;  1QKM A;  1DB1 A;  4PRG A;  4PP5 A;  4E4K A;  5DWJ A;  5E1C A;  5G46 A;  2Q7I A;  1RJK A;  2Q1H A;  2VV1 B;  1R6G A;  4DK7 A;  3WFG A;  2F4B A;  4PPS A;  4OJB A;  4L96 A;  5DUH A;  4N5G A;  5AWJ A;  5M96 A;  3VI8 A;  5EGV A;  5DXG A;  4ZJR A;  4OZR E;  4A4V A;  5DWL A;  2Q5G A;  5DID A;  4OEY A;  3VHW A;  3ZRA A;  3AZ3 A;  5LWP A;  3DZU D;  4WPF A;  3GWS X;  4MG9 A;  4OIV A;  4X1G A;  5B5B A;  3UUC A;  1G1U A;  1ILG A;  3K8S A;  1ZGY A;  4ZOM A;  2QXS A;  3CS6 A;  4DQM A;  3E00 A;  5IAW A;  4P6W A;  5HYK A;  4R06 A;  3JZB A;  5HYR A;  5KD9 A;  1ZDU A;  5KYJ A;  4IWF A;  1YYE A;  3VT6 A;  2Q7L A;  2XHS A;  3HZF A;  3RUU A;  2V0V A;  1MVC A;  4RZF A;  4XHD A;  1DKF A;  3RY9 A;  2E2R A;  1ZEO A;  4LSJ A;  3DCU A;  4IUI A;  5DVC A;  4MGD B;  3AZ1 A;  4ZNU A;  3D6D A;  5JJM B;  2J7X A;  1R20 D;  2A3I A;  3O1D A;  4HEE X;  3WFF A;  2VV1 A;  3L0J A;  2I0G A;  3D90 A;  3A2J A;  1GWX A;  3CS8 A;  1Y0X X;  3P89 A;  1X76 A;  4ZN9 A;  5DP0 A;  1R1K A;  1UOM A;  3L0E A;  4O8F A;  3ZR7 A;  3MNO A;  4OKT A;  2BJ4 B;  5FQT A;  5AZT A;  3W0C A;  2NV7 A;  5AVI A;  4POJ A;  3K23 A;  5G5W A;  1XIU A;  3DCT A;  1MZN A;  1T7F A;  1Z5X E;  5EC9 A;  3PEQ A;  3KMZ A;  3H0A D;  4PVU A;  5DXB B;  1A52 A;  2ATH A;  4LNX A;  3VJI A;  3OLL A;  5IZ0 A;  4OJ9 A;  1FBY A;  4RMC A;  3CWD A;  4OED A;  1N83 A;  4ZNV A;  2ZNP A;  2GP7 A;  1MV9 A;  3B1M A;  1NQ1 A;  1ZKY A;  3V9Y A;  2ZK4 A;  3KMR A;  3X1I A;  3L03 A;  5DKG A;  3OS8 A;  4OK1 A;  3HC5 A;  2YFE A;  4PP6 A;  5DKE A;  5KRO A;  5ETH A;  3AN4 A;  2ABI A;  4MGD A;  5DXK A;  3N00 A;  4J24 A;  2AX9 A;  5G44 A;  2HWR A;  4OFR A;  5JJM A;  3B5R A;  2NXX A;  2ZL9 A;  1TXI A;  3BC5 A;  3GZ9 A;  3U9Q A;  3OMO A;  5B41 A;  3V49 A;  3DZY D;  3F5C B;  2I4J A;  3AZ2 A;  4CSJ A;  2Z4J A;  3JZC A;  1KKQ A;  3W0I A;  3VSO A;  3UP0 A;  5K13 A;  2J4A A;  2BJ4 A;  1T63 A;  1OSH A;  3GYU A;  3MNE A;  3UVV B;  5ACC A;  2AX8 A;  3KPZ A;  2OCF A;  2R6W A;  2JJ3 A;  1RKH A;  1XLS A;  1ZDT A;  4UDA A;  1NDE A;  5FQS A;  5C4S A;  2PJL A;  2P7G A;  3S9S A;  2ZXM A;  5AZV A;  4ZNH A;  2Q59 A;  3GYT A;  1VJB A;  3B0W A;  3IPU A;  2HWQ A;  5JY3 A;  4QE8 A;  2PIN A;  1IE9 A;  4OZR U;  5KR9 A;  1SR7 A;  2ZY0 A;  4IVW A;  4J5X C;  3G9E A;  3P88 A;  4ITE A;  1RDT A;  2YLY A;  3IXP A;  2ZMJ A;  3ET0 A;  4XT9 A;  1XP6 A;  3X36 A;  3ZRB A;  5FQV A;  3UUD B;  5LGA A;  3WT5 A;  3ERD A;  4TUZ B;  2QR9 A;  4IA3 A;  5H1E A;  1YA3 A;  3ET1 A;  3VRU A;  4Q50 A;  1SQN A;  3K6P A;  1OSV A;  4RMD A;  1LV2 A;  4FGY A;  3WMH A;  5EIT A;  4DM6 A;  3CDP A;  2AA6 A;  3W0J A;  1GWQ A;  2Q6S A;  1HG4 A;  2YAT A;  4OLM A;  3F5C A;  3HLV A;  3OSW A;  2P1V A;  2QGW A;  5DYB A;  1I38 A;  5DV6 A;  3A2I A;  2PIR A;  5G43 A;  4OFU A;  4R6S A;  1E3G A;  4LTW A;  1SJ0 A;  3PBA A;  3O1E A;  4KZM A;  1PRG A;  2P1U A;  5APK A;  3WJ4 A;  2P4Y A;  4RUP A;  3UVV A;  2O4J A;  4IW6 A;  2OAX A;  3DR1 A;  2ZKC A;  3CQV A;  1PDU A;  2R6Y A;  5L7E A;  2R40 A;  1LBD A;  1XJ7 A;  4ITF A;  1QKT A;  2AMA A;  4ZO1 X;  5HJP B;  2QW4 A;  3GBK A;  2P7A A;  1S9P A;  3VTC A;  4OEA A;  1UHL B;  3V9T A;  3ADS A;  2OVM A;  3FS1 A;  5HJS A;  4P6X A;  3H52 A;  4MG7 B;  1G5Y A;  1OT7 A;  5SYZ A;  1I37 A;  3UUD A;  1R1K D;  5KRC A;  3B0Q A;  2ZK3 A;  5DK9 A;  1Z5X U;  1IE8 A;  4TV1 B;  3OMQ A;  4TUZ A;  1PZL A;  4JYH A;  2NXX E;  4Q0A C;  3X31 A;  4S0T A;  4YPQ A;  2AB2 A;  2AMB A;  5KRH A;  3DT3 A;  5KRI A;  3FUR A;  4ZO1 B;  2ZK1 A;  2QH6 A;  3KDU A;  2AAX A;  3LBD A;  3OMM A;  3W0H A;  1XPC A;  1XVP B;  3HVL A;  4LBD A;  4Q13 A;  4Y29 A;  5HJP A;  5DI7 A;  4FNE A;  3VRW A;  1T76 A;  3ILZ A;  5DIG A;  3VJS A;  5F9B A;  4N1Y A;  3L3X A;  3ZQT A;  1XLS E;  2H79 A;  3VT5 A;  1T7T A;  3A3Z X;  1NQ2 A;  2PIP L;  2OM9 A;  2P1T A;  4BCR A;  1RKG A;  2GIU A;  2HVC A;  3K22 A;  4POH A;  2LBD A;  4KZJ A;  1FD0 A;  5DZ0 A;  2AWH A;  1PQ9 A;  4DMA A;  4N8R A;  2ACL B;  2GPO A;  3GWX A;  3OOK A;  4PLD A;  3IPS A;  2AO6 A;  1UHL A;  2XYX A;  2JFA B;  1S9Q A;  4OZT U;  3VTD A;  1ILH A;  1XZX X;  2OUZ A;  4MG7 A;  4OHA A;  4OEZ A;  4QL8 A;  4MG6 A;  5FQR A;  3SP6 A;  4DM8 A;  4ZN7 A;  3CDS A;  4XLD A;  3TY0 A;  2Q61 A;  3DY6 A;  3G0W A;  2VST A;  2QPY A;  4PXM A;  2ZVT A;  4TV1 A;  2ZNN A;  3V3Q A;  3VRT A;  4EM9 A;  2Z4B A;  1NHZ A;  1OVL A;  3ET2 A;  5DIE A;  3WT7 A;  2G0G A;  2NPA A;  1FCZ A;  3RUT A;  5CJ6 A;  4G20 A;  2HAM A;  1XP1 A;  1XVP A;  2Q59 B;  2PIX A;  5DV8 A;  3V3E A;  5AAU A;  5L7H A;  2VV4 A;  2HB8 A;  2JF9 A;  1T65 A;  1Y9R A;  3P0U A;  2W8Y A;  2XYJ A;  3HOD A;  1NUO A;  3Q95 A;  4ONI A;  1RDT D;  3IXP D;  3VTB A;  5DXM A;  4K7A A;  4NY9 A;  4RZG A;  2P7Z A;  2HCD A;  2Q3Y A;  3W0G A;  1RK3 A;  3KYT A;  4IA2 A;  4J5W C;  4S0S A;  5DZ3 A;  4IWC A;  3UU7 A;  3X1H A;  4B7W A;  4IV2 A;  3FEI A;  2OVH A;  1HJ1 A;  5DU5 A;  3FC6 B;  2ACL A;  1XDK B;  3GN8 A;  1XOW A;  2ZAS A;  4F9M A;  1YIN A;  4QJR A;  2QSE A;  3OSA A;  3UUA B;  1G2N A;  2JFA A;  3UP3 A;  5DRM A;  3RLJ A;  1N46 A;  1KV6 A;  5E15 A;  2XYW A;  1P93 A;  5KRJ A;  2YJA B;  3L0L A;  1S0X A;  1XB7 A;  4NIE A;  3OLF A;  3OGT A;  5FQP A;  2O4R A;  1KNU A;  2FSZ A;  1YJE A;  1FM9 A;  3ADX A;  4OC7 A;  4OZT E;  5DYD A;  1M13 A;  3OKH A;  2GPU A;  4HLW A;  1ZH7 A;  5E7V A;  3W5R A;  5KCT A;  1XAP A;  2R40 D;  4WLB A;  3KFC A;  5DLR A;  5GIC A;  4JYG A;  1M2Z A;  1NRL A;  2ZMI A;  3CLD A;  4E2J A;  4QE6 A;  3R2A A;  4X1F A;  4DK8 A;  3R8D A;  1K4W A;  1L2I A;  3FLI A;  1SKX A;  1U3Q A;  3V9V A;  5E0X A;  1PQC A;  4WHF A;  3KBA A;  3L1B A;  1PQ6 A;  4KZI A;  3E94 A;  1Z95 A;  2QGT A;  4J26 A;  4OKW A;  4RFW A;  3CJW A;  4OGH A;  5DUE A;  3FC6 A;  1XDK A;  5HCV A;  1NAV A;  1T7R A;  2QA8 B;  2PIV A;  1H9U A;  3A9E B;  4IQR A;  3HO0 A;  5DMC A;  2AA2 A;  1Q4X A;  1FCY A;  5GID A;  3UUA A;  4OH6 A;  5DWG A;  5DVS A;  3OKI A;  1I7I A;  3E00 D;  4IA7 A;  2G44 A;  3H0A A;  2OZ7 A;  1FCX A;  1YUC A;  3E7C A;  4J5W A;  4OKB A;  5AVL A;  1K74 A;  1PK5 A;  1T5Z A;  4IV4 A;  4K6I A;  1FM6 A;  2J7Y A;  3VT3 A;  5C4O A;  2REW A;  1QKU A;  5E14 A;  4MG5 A;  4REE A;  2ZFX A;  4YMQ A;  2HC4 A;  5KCU A;  3A40 X;  3OMK A;  1X7B A;  1TFC A;  2Q6J A;  2QXM A;  3NOA A;  3VT8 A;  5IXK A;  3R8A A;  2G0H A;  3VT7 A;  4FHH A;  4XAO A;  4S14 A;  4DOS A;  4QK4 A;  2ZK6 A;  2IHQ A;  4UDB A;  4OIL A;  3VN2 A;  4IU7 A;  4PF3 A;  4OIU A;  2PIW A;  1XP9 A;  5DX3 B;  2YLO A;  1ERR A;  5DWI A;  2B1Z A;  3AX8 A;  1ZAF A;  3R5N A;  4DOR A;  2YHD A;  4N73 A;  1QKN A;  2J14 A;  2Q5P A;  3D57 A;  4YNK A;  2QTU A;  4XI3 A;  1I7G A;  1OVL B;  3ADU A;  1S0Z A;  2QA8 A;  4MG8 B;  5DTV A;  3A9E A;  3WTQ A;  1XQC A;  2ZBS A;  3PCU A;  5G45 A;  2PIT A;  2BAW A;  3VHU A;  3ET3 A;  4M8E A;  1NAX A;  2HFP A;  4J5X A;  5L11 A;  1GWR A;  3KWY A;  5KCC A;  3OZJ A;  4IW8 A;  3TKC A;  4MGB B;  3D5F A;  2VV4 B;  4JL4 A;  3R29 A;  3WWR A;  2VV0 A;  2PIQ A;  3Q95 B;  4L98 A;  5DKB A;  5DL4 A;  4YT1 A;  2ZLA A;  4ZNS A;  4LNW A;  2Q7J A;  3P8X A;  3R8I A;  3WGP A;  2H77 A;  3ERT A;  5ICK A;  4OJ4 A;  3UU7 B;  3B67 A;  5KCF A;  4G1Z A;  4A2J A;  5HZC A;  3B3K A;  5DUG A;  2ZMH A;  4PP3 A;  5DMF A;  5I4V A;  3HC6 A;  2B23 A;  4RUO X;  3RVF A;  4CI4 A;  2PRG A;  3OS8 C;  3PO9 A;  3TX7 B;  5AAV B;  4MGC A;  5DXP A;  5DX3 A;  1EXA A;  3EYB A;  4RWV A;  2ZK5 A;  4CI5 A;  1EXX A;  4NUF A;  2P54 A;  3WT6 A;  4A4W A;  4E4Q A;  2B1V A;  2V7C A;  2EWP A;  2PIU A;  5GT4 A;  1NYX A;  2POB A;  1XNX A;  4IS8 A;  3L3Z A;  4R2U A;  2HB7 A;  3ADT A;  4EMA A;  3AUN A;  1FM9 D;  3B0T A;  2POG A;  3GD2 A;  4MG8 A;  3B0R A;  4APU A;  5E19 A;  3IPQ A;  1A28 A;  5C4U A;  2P15 A;  1U3S A;  3HM1 A;  4OAR A;  4MDD A;  2HAR A;  5KRL A;  4MGB A;  4G21 A;  4PLE A;  3W0Y A;  2B50 A;  4XUM A;  1UPW A;  3B65 A;  4MGA B;  2Q5S A;  4OH5 A;  4RAK A;  2AX7 A;  3FXV A;  4RME A; 
#chains in the Genus database with same CATH topology
 3VT9 A;  5GIE A;  3RLL A;  4NQA B;  5KRF A;  2AX6 A;  2FAI A;  2HBH A;  3OAP A;  4OKX A;  5EHJ A;  1X78 A;  1U3R A;  1X7R A;  2YLP A;  2PNU A;  3D24 A;  4NB6 A;  4QM0 A;  5DZH A;  5APJ A;  4RUJ A;  1M7W A;  5AYG A;  5KCD A;  4RE8 A;  5KRA A;  2GPV A;  2GL8 A;  1T73 A;  2GTK A;  1XV9 B;  3M7R A;  4G2H A;  1N4H A;  3A2H A;  3NSP A;  4IVY A;  3CTB A;  3OMP A;  5L7G A;  3DZU A;  3SP9 A;  3ADV A;  2QA6 A;  5AAV A;  1Y0S A;  5DY8 A;  5DVV A;  3WJ5 A;  3G8I A;  2I4P A;  3OOF A;  5AWK A;  1L2J A;  2AA5 A;  1E3K A;  5KYA A;  4ZJW A;  1K74 D;  2ZNQ A;  2GWX A;  1FM6 D;  1G50 A;  5DKS A;  3VRV A;  4JYI A;  3OS9 A;  2QZO B;  4REF A;  2FVJ A;  3VJT A;  1YIM A;  3FEJ A;  1PCG A;  3ADW A;  3B68 A;  3IA6 A;  2QMV A;  4ZI1 A;  3CS4 A;  5DZ1 A;  1T79 A;  3OZ0 A;  5JI0 D;  3OSI A;  2IOK A;  1T7M A;  3FAL B;  3SZ1 A;  1U9E A;  3AFR A;  1X7E A;  4PWL A;  2AYR A;  3W5Q A;  1XQ3 A;  3F7D A;  2ZNO A;  3W5P A;  2VSR A;  2VV3 A;  3LMP A;  4MGA A;  4G1D A;  5DXR A;  1R20 A;  2I4Z A;  5DRJ A;  5G42 A;  5A86 A;  2GPP A;  1P8D A;  3G8O A;  3PRG A;  2PIO A;  1NQ7 A;  3BEJ A;  5DZI A;  2G5O A;  5KCE A;  1UPV A;  2Q6R A;  2ZK0 A;  5E0W A;  1T74 A;  4S15 A;  3T03 A;  3VHV A;  2YLQ A;  3HQ5 A;  4WQP A;  5G3J A;  3TKM A;  3V4A A;  1XV9 A;  1S19 A;  3A78 A;  3QT0 A;  1R5K A;  4G2I A;  2I0J A;  1YY4 A;  2HAS A;  3VSP A;  3KDT A;  2Q70 A;  2AA7 A;  3FUG A;  2ZLC A;  5DWE A;  1ERE A;  5DXB A;  2QE4 A;  4UDC A;  5DXE A;  1NQ0 A;  2YJD A;  4WHG A;  4UDD A;  5DV3 A;  3PLZ A;  5KRK A;  2Q60 A;  2Q7K A;  2QZO A;  4FN9 A;  4PPP A;  1ZUC A;  2O9I A;  5KCW A;  3W0A A;  3IMY A;  1YOK A;  1YP0 A;  3BQD A;  2VV2 A;  5APH A;  4RZE A;  3MNP A;  3FAL A;  4FHI A;  3KMG A;  2QNV A;  4IA1 A;  4JAZ A;  1XNN A;  2IOG A;  4XUH A;  2ZK2 A;  3W5T A;  4MG9 B;  3AUQ A;  5DXQ A;  4WVD A;  4ZNW A;  2XKW A;  4XTA A;  1WM0 X;  2QAB A;  5C4T A;  1YMT A;  3AUR A;  4K4J A;  3B66 A;  2ZXZ A;  3DZY A;  3VT4 A;  2AM9 A;  3VJH A;  4JGV A;  5KRM A;  1K7L A;  1YOW A;  4M8H A;  4ZNT A;  2AXA A;  1X7J A;  5EI1 A;  5DSH A;  2PKL A;  5EJV A;  2Q8S A;  5AK2 A;  1GS4 A;  2Q1V A;  3OLS A;  1DKF B;  2NW4 A;  3AN3 A;  3R5M A;  4G1Y A;  3NSQ A;  1BSX A;  2ZXN A;  1QKM A;  1DB1 A;  4PRG A;  4PP5 A;  4E4K A;  5DWJ A;  5E1C A;  5G46 A;  2Q7I A;  1RJK A;  2Q1H A;  2VV1 B;  1R6G A;  4DK7 A;  3WFG A;  2F4B A;  4PPS A;  4OJB A;  4L96 A;  5DUH A;  4N5G A;  5AWJ A;  5M96 A;  3VI8 A;  5EGV A;  5DXG A;  4ZJR A;  4OZR E;  4A4V A;  5DWL A;  2Q5G A;  5DID A;  4OEY A;  3VHW A;  3ZRA A;  3AZ3 A;  5LWP A;  3DZU D;  4WPF A;  3GWS X;  4MG9 A;  4OIV A;  4X1G A;  5B5B A;  3UUC A;  1G1U A;  1ILG A;  3K8S A;  1ZGY A;  4ZOM A;  2QXS A;  3CS6 A;  4DQM A;  3E00 A;  5IAW A;  4P6W A;  5HYK A;  4R06 A;  3JZB A;  5HYR A;  5KD9 A;  1ZDU A;  5KYJ A;  4IWF A;  1YYE A;  3VT6 A;  2Q7L A;  2XHS A;  3HZF A;  3RUU A;  2V0V A;  1MVC A;  4RZF A;  4XHD A;  1DKF A;  3RY9 A;  2E2R A;  1ZEO A;  4LSJ A;  3DCU A;  4IUI A;  5DVC A;  4MGD B;  3AZ1 A;  4ZNU A;  3D6D A;  5JJM B;  2J7X A;  1R20 D;  2A3I A;  3O1D A;  4HEE X;  3WFF A;  2VV1 A;  3L0J A;  2I0G A;  3D90 A;  3A2J A;  1GWX A;  3CS8 A;  1Y0X X;  3P89 A;  1X76 A;  4ZN9 A;  5DP0 A;  1R1K A;  1UOM A;  3L0E A;  4O8F A;  3ZR7 A;  3MNO A;  4OKT A;  2BJ4 B;  5FQT A;  5AZT A;  3W0C A;  2NV7 A;  5AVI A;  4POJ A;  3K23 A;  5G5W A;  1XIU A;  3DCT A;  1MZN A;  1T7F A;  1Z5X E;  5EC9 A;  3PEQ A;  3KMZ A;  3H0A D;  4PVU A;  5DXB B;  1A52 A;  2ATH A;  4LNX A;  3VJI A;  3OLL A;  5IZ0 A;  4OJ9 A;  1FBY A;  4RMC A;  3CWD A;  4OED A;  1N83 A;  4ZNV A;  2ZNP A;  2GP7 A;  1MV9 A;  3B1M A;  1NQ1 A;  1ZKY A;  3V9Y A;  2ZK4 A;  3KMR A;  3X1I A;  3L03 A;  5DKG A;  3OS8 A;  4OK1 A;  3HC5 A;  2YFE A;  4PP6 A;  5DKE A;  5KRO A;  5ETH A;  3AN4 A;  2ABI A;  4MGD A;  5DXK A;  3N00 A;  4J24 A;  2AX9 A;  5G44 A;  2HWR A;  4OFR A;  5JJM A;  3B5R A;  2NXX A;  2ZL9 A;  1TXI A;  3BC5 A;  3GZ9 A;  3U9Q A;  3OMO A;  5B41 A;  3V49 A;  3DZY D;  3F5C B;  2I4J A;  3AZ2 A;  4CSJ A;  2Z4J A;  3JZC A;  1KKQ A;  3W0I A;  3VSO A;  3UP0 A;  5K13 A;  2J4A A;  2BJ4 A;  1T63 A;  1OSH A;  3GYU A;  3MNE A;  3UVV B;  5ACC A;  2AX8 A;  3KPZ A;  2OCF A;  2R6W A;  2JJ3 A;  1RKH A;  1XLS A;  1ZDT A;  4UDA A;  1NDE A;  5FQS A;  5C4S A;  2PJL A;  2P7G A;  3S9S A;  2ZXM A;  5AZV A;  4ZNH A;  2Q59 A;  3GYT A;  1VJB A;  3B0W A;  3IPU A;  2HWQ A;  5JY3 A;  4QE8 A;  2PIN A;  1IE9 A;  4OZR U;  5KR9 A;  1SR7 A;  2ZY0 A;  4IVW A;  4J5X C;  3G9E A;  3P88 A;  4ITE A;  1RDT A;  2YLY A;  3IXP A;  2ZMJ A;  3ET0 A;  4XT9 A;  1XP6 A;  3X36 A;  3ZRB A;  5FQV A;  3UUD B;  5LGA A;  3WT5 A;  3ERD A;  4TUZ B;  2QR9 A;  4IA3 A;  5H1E A;  1YA3 A;  3ET1 A;  3VRU A;  4Q50 A;  1SQN A;  3K6P A;  1OSV A;  4RMD A;  1LV2 A;  4FGY A;  3WMH A;  5EIT A;  4DM6 A;  3CDP A;  2AA6 A;  3W0J A;  1GWQ A;  2Q6S A;  1HG4 A;  2YAT A;  4OLM A;  3F5C A;  3HLV A;  3OSW A;  2P1V A;  2QGW A;  5DYB A;  1I38 A;  5DV6 A;  3A2I A;  2PIR A;  5G43 A;  4OFU A;  4R6S A;  1E3G A;  4LTW A;  1SJ0 A;  3PBA A;  3O1E A;  4KZM A;  1PRG A;  2P1U A;  5APK A;  3WJ4 A;  2P4Y A;  4RUP A;  3UVV A;  2O4J A;  4IW6 A;  2OAX A;  3DR1 A;  2ZKC A;  3CQV A;  1PDU A;  2R6Y A;  5L7E A;  2R40 A;  1LBD A;  1XJ7 A;  4ITF A;  1QKT A;  2AMA A;  4ZO1 X;  5HJP B;  2QW4 A;  3GBK A;  2P7A A;  1S9P A;  3VTC A;  4OEA A;  1UHL B;  3V9T A;  3ADS A;  2OVM A;  3FS1 A;  5HJS A;  4P6X A;  3H52 A;  4MG7 B;  1G5Y A;  1OT7 A;  5SYZ A;  1I37 A;  3UUD A;  1R1K D;  5KRC A;  3B0Q A;  2ZK3 A;  5DK9 A;  1Z5X U;  1IE8 A;  4TV1 B;  3OMQ A;  4TUZ A;  1PZL A;  4JYH A;  2NXX E;  4Q0A C;  3X31 A;  4S0T A;  4YPQ A;  2AB2 A;  2AMB A;  5KRH A;  3DT3 A;  5KRI A;  3FUR A;  4ZO1 B;  2ZK1 A;  2QH6 A;  3KDU A;  2AAX A;  3LBD A;  3OMM A;  3W0H A;  1XPC A;  1XVP B;  3HVL A;  4LBD A;  4Q13 A;  4Y29 A;  5HJP A;  5DI7 A;  4FNE A;  3VRW A;  1T76 A;  3ILZ A;  5DIG A;  3VJS A;  5F9B A;  4N1Y A;  3L3X A;  3ZQT A;  1XLS E;  2H79 A;  3VT5 A;  1T7T A;  3A3Z X;  1NQ2 A;  2PIP L;  2OM9 A;  2P1T A;  4BCR A;  1RKG A;  2GIU A;  2HVC A;  3K22 A;  4POH A;  2LBD A;  4KZJ A;  1FD0 A;  5DZ0 A;  2AWH A;  1PQ9 A;  4DMA A;  4N8R A;  2ACL B;  2GPO A;  3GWX A;  3OOK A;  4PLD A;  3IPS A;  2AO6 A;  1UHL A;  2XYX A;  2JFA B;  1S9Q A;  4OZT U;  3VTD A;  1ILH A;  1XZX X;  2OUZ A;  4MG7 A;  4OHA A;  4OEZ A;  4QL8 A;  4MG6 A;  5FQR A;  3SP6 A;  4DM8 A;  4ZN7 A;  3CDS A;  4XLD A;  3TY0 A;  2Q61 A;  3DY6 A;  3G0W A;  2VST A;  2QPY A;  4PXM A;  2ZVT A;  4TV1 A;  2ZNN A;  3V3Q A;  3VRT A;  4EM9 A;  2Z4B A;  1NHZ A;  1OVL A;  3ET2 A;  5DIE A;  3WT7 A;  2G0G A;  2NPA A;  1FCZ A;  3RUT A;  5CJ6 A;  4G20 A;  2HAM A;  1XP1 A;  1XVP A;  2Q59 B;  2PIX A;  5DV8 A;  3V3E A;  5AAU A;  5L7H A;  2VV4 A;  2HB8 A;  2JF9 A;  1T65 A;  1Y9R A;  3P0U A;  2W8Y A;  2XYJ A;  3HOD A;  1NUO A;  3Q95 A;  4ONI A;  1RDT D;  3IXP D;  3VTB A;  5DXM A;  4K7A A;  4NY9 A;  4RZG A;  2P7Z A;  2HCD A;  2Q3Y A;  3W0G A;  1RK3 A;  3KYT A;  4IA2 A;  4J5W C;  4S0S A;  5DZ3 A;  4IWC A;  3UU7 A;  3X1H A;  4B7W A;  4IV2 A;  3FEI A;  2OVH A;  1HJ1 A;  5DU5 A;  3FC6 B;  2ACL A;  1XDK B;  3GN8 A;  1XOW A;  2ZAS A;  4F9M A;  1YIN A;  4QJR A;  2QSE A;  3OSA A;  3UUA B;  1G2N A;  2JFA A;  3UP3 A;  5DRM A;  3RLJ A;  1N46 A;  1KV6 A;  5E15 A;  2XYW A;  1P93 A;  5KRJ A;  2YJA B;  3L0L A;  1S0X A;  1XB7 A;  4NIE A;  3OLF A;  3OGT A;  5FQP A;  2O4R A;  1KNU A;  2FSZ A;  1YJE A;  1FM9 A;  3ADX A;  4OC7 A;  4OZT E;  5DYD A;  1M13 A;  3OKH A;  2GPU A;  4HLW A;  1ZH7 A;  5E7V A;  3W5R A;  5KCT A;  1XAP A;  2R40 D;  4WLB A;  3KFC A;  5DLR A;  5GIC A;  4JYG A;  1M2Z A;  1NRL A;  2ZMI A;  3CLD A;  4E2J A;  4QE6 A;  3R2A A;  4X1F A;  4DK8 A;  3R8D A;  1K4W A;  1L2I A;  3FLI A;  1SKX A;  1U3Q A;  3V9V A;  5E0X A;  1PQC A;  4WHF A;  3KBA A;  3L1B A;  1PQ6 A;  4KZI A;  3E94 A;  1Z95 A;  2QGT A;  4J26 A;  4OKW A;  4RFW A;  3CJW A;  4OGH A;  5DUE A;  3FC6 A;  1XDK A;  5HCV A;  1NAV A;  1T7R A;  2QA8 B;  2PIV A;  1H9U A;  3A9E B;  4IQR A;  3HO0 A;  5DMC A;  2AA2 A;  1Q4X A;  1FCY A;  5GID A;  3UUA A;  4OH6 A;  5DWG A;  5DVS A;  3OKI A;  1I7I A;  3E00 D;  4IA7 A;  2G44 A;  3H0A A;  2OZ7 A;  1FCX A;  1YUC A;  3E7C A;  4J5W A;  4OKB A;  5AVL A;  1K74 A;  1PK5 A;  1T5Z A;  4IV4 A;  4K6I A;  1FM6 A;  2J7Y A;  3VT3 A;  5C4O A;  2REW A;  1QKU A;  5E14 A;  4MG5 A;  4REE A;  2ZFX A;  4YMQ A;  2HC4 A;  5KCU A;  3A40 X;  3OMK A;  1X7B A;  1TFC A;  2Q6J A;  2QXM A;  3NOA A;  3VT8 A;  5IXK A;  3R8A A;  2G0H A;  3VT7 A;  4FHH A;  4XAO A;  4S14 A;  4DOS A;  4QK4 A;  2ZK6 A;  2IHQ A;  4UDB A;  4OIL A;  3VN2 A;  4IU7 A;  4PF3 A;  4OIU A;  2PIW A;  1XP9 A;  5DX3 B;  2YLO A;  1ERR A;  5DWI A;  2B1Z A;  3AX8 A;  1ZAF A;  3R5N A;  4DOR A;  2YHD A;  4N73 A;  1QKN A;  2J14 A;  2Q5P A;  3D57 A;  4YNK A;  2QTU A;  4XI3 A;  1I7G A;  1OVL B;  3ADU A;  1S0Z A;  2QA8 A;  4MG8 B;  5DTV A;  3A9E A;  3WTQ A;  1XQC A;  2ZBS A;  3PCU A;  5G45 A;  2PIT A;  2BAW A;  3VHU A;  3ET3 A;  4M8E A;  1NAX A;  2HFP A;  4J5X A;  5L11 A;  1GWR A;  3KWY A;  5KCC A;  3OZJ A;  4IW8 A;  3TKC A;  4MGB B;  3D5F A;  2VV4 B;  4JL4 A;  3R29 A;  3WWR A;  2VV0 A;  2PIQ A;  3Q95 B;  4L98 A;  5DKB A;  5DL4 A;  4YT1 A;  2ZLA A;  4ZNS A;  4LNW A;  2Q7J A;  3P8X A;  3R8I A;  3WGP A;  2H77 A;  3ERT A;  5ICK A;  4OJ4 A;  3UU7 B;  3B67 A;  5KCF A;  4G1Z A;  4A2J A;  5HZC A;  3B3K A;  5DUG A;  2ZMH A;  4PP3 A;  5DMF A;  5I4V A;  3HC6 A;  2B23 A;  4RUO X;  3RVF A;  4CI4 A;  2PRG A;  3OS8 C;  3PO9 A;  3TX7 B;  5AAV B;  4MGC A;  5DXP A;  5DX3 A;  1EXA A;  3EYB A;  4RWV A;  2ZK5 A;  4CI5 A;  1EXX A;  4NUF A;  2P54 A;  3WT6 A;  4A4W A;  4E4Q A;  2B1V A;  2V7C A;  2EWP A;  2PIU A;  5GT4 A;  1NYX A;  2POB A;  1XNX A;  4IS8 A;  3L3Z A;  4R2U A;  2HB7 A;  3ADT A;  4EMA A;  3AUN A;  1FM9 D;  3B0T A;  2POG A;  3GD2 A;  4MG8 A;  3B0R A;  4APU A;  5E19 A;  3IPQ A;  1A28 A;  5C4U A;  2P15 A;  1U3S A;  3HM1 A;  4OAR A;  4MDD A;  2HAR A;  5KRL A;  4MGB A;  4G21 A;  4PLE A;  3W0Y A;  2B50 A;  4XUM A;  1UPW A;  3B65 A;  4MGA B;  2Q5S A;  4OH5 A;  4RAK A;  2AX7 A;  3FXV A;  4RME A; 
#chains in the Genus database with same CATH homology
 3VT9 A;  5GIE A;  3RLL A;  4NQA B;  5KRF A;  2AX6 A;  2FAI A;  2HBH A;  3OAP A;  4OKX A;  5EHJ A;  1X78 A;  1U3R A;  1X7R A;  2YLP A;  2PNU A;  3D24 A;  4NB6 A;  4QM0 A;  5DZH A;  5APJ A;  4RUJ A;  1M7W A;  5AYG A;  5KCD A;  4RE8 A;  5KRA A;  2GPV A;  2GL8 A;  1T73 A;  2GTK A;  1XV9 B;  3M7R A;  4G2H A;  1N4H A;  3A2H A;  3NSP A;  4IVY A;  3CTB A;  3OMP A;  5L7G A;  3DZU A;  3SP9 A;  3ADV A;  2QA6 A;  5AAV A;  1Y0S A;  5DY8 A;  5DVV A;  3WJ5 A;  3G8I A;  2I4P A;  3OOF A;  5AWK A;  1L2J A;  2AA5 A;  1E3K A;  5KYA A;  4ZJW A;  1K74 D;  2ZNQ A;  2GWX A;  1FM6 D;  1G50 A;  5DKS A;  3VRV A;  4JYI A;  3OS9 A;  2QZO B;  4REF A;  2FVJ A;  3VJT A;  1YIM A;  3FEJ A;  1PCG A;  3ADW A;  3B68 A;  3IA6 A;  2QMV A;  4ZI1 A;  3CS4 A;  5DZ1 A;  1T79 A;  3OZ0 A;  5JI0 D;  3OSI A;  2IOK A;  1T7M A;  3FAL B;  3SZ1 A;  1U9E A;  3AFR A;  1X7E A;  4PWL A;  2AYR A;  3W5Q A;  1XQ3 A;  3F7D A;  2ZNO A;  3W5P A;  2VSR A;  2VV3 A;  3LMP A;  4MGA A;  4G1D A;  5DXR A;  1R20 A;  2I4Z A;  5DRJ A;  5G42 A;  5A86 A;  2GPP A;  1P8D A;  3G8O A;  3PRG A;  2PIO A;  1NQ7 A;  3BEJ A;  5DZI A;  2G5O A;  5KCE A;  1UPV A;  2Q6R A;  2ZK0 A;  5E0W A;  1T74 A;  4S15 A;  3T03 A;  3VHV A;  2YLQ A;  3HQ5 A;  4WQP A;  5G3J A;  3TKM A;  3V4A A;  1XV9 A;  1S19 A;  3A78 A;  3QT0 A;  1R5K A;  4G2I A;  2I0J A;  1YY4 A;  2HAS A;  3VSP A;  3KDT A;  2Q70 A;  2AA7 A;  3FUG A;  2ZLC A;  5DWE A;  1ERE A;  5DXB A;  2QE4 A;  4UDC A;  5DXE A;  1NQ0 A;  2YJD A;  4WHG A;  4UDD A;  5DV3 A;  3PLZ A;  5KRK A;  2Q60 A;  2Q7K A;  2QZO A;  4FN9 A;  4PPP A;  1ZUC A;  2O9I A;  5KCW A;  3W0A A;  3IMY A;  1YOK A;  1YP0 A;  3BQD A;  2VV2 A;  5APH A;  4RZE A;  3MNP A;  3FAL A;  4FHI A;  3KMG A;  2QNV A;  4IA1 A;  4JAZ A;  1XNN A;  2IOG A;  4XUH A;  2ZK2 A;  3W5T A;  4MG9 B;  3AUQ A;  5DXQ A;  4WVD A;  4ZNW A;  2XKW A;  4XTA A;  1WM0 X;  2QAB A;  5C4T A;  1YMT A;  3AUR A;  4K4J A;  3B66 A;  2ZXZ A;  3DZY A;  3VT4 A;  2AM9 A;  3VJH A;  4JGV A;  5KRM A;  1K7L A;  1YOW A;  4M8H A;  4ZNT A;  2AXA A;  1X7J A;  5EI1 A;  5DSH A;  2PKL A;  5EJV A;  2Q8S A;  5AK2 A;  1GS4 A;  2Q1V A;  3OLS A;  1DKF B;  2NW4 A;  3AN3 A;  3R5M A;  4G1Y A;  3NSQ A;  1BSX A;  2ZXN A;  1QKM A;  1DB1 A;  4PRG A;  4PP5 A;  4E4K A;  5DWJ A;  5E1C A;  5G46 A;  2Q7I A;  1RJK A;  2Q1H A;  2VV1 B;  1R6G A;  4DK7 A;  3WFG A;  2F4B A;  4PPS A;  4OJB A;  4L96 A;  5DUH A;  4N5G A;  5AWJ A;  5M96 A;  3VI8 A;  5EGV A;  5DXG A;  4ZJR A;  4OZR E;  4A4V A;  5DWL A;  2Q5G A;  5DID A;  4OEY A;  3VHW A;  3ZRA A;  3AZ3 A;  5LWP A;  3DZU D;  4WPF A;  3GWS X;  4MG9 A;  4OIV A;  4X1G A;  5B5B A;  3UUC A;  1G1U A;  1ILG A;  3K8S A;  1ZGY A;  4ZOM A;  2QXS A;  3CS6 A;  4DQM A;  3E00 A;  5IAW A;  4P6W A;  5HYK A;  4R06 A;  3JZB A;  5HYR A;  5KD9 A;  1ZDU A;  5KYJ A;  4IWF A;  1YYE A;  3VT6 A;  2Q7L A;  2XHS A;  3HZF A;  3RUU A;  2V0V A;  1MVC A;  4RZF A;  4XHD A;  1DKF A;  3RY9 A;  2E2R A;  1ZEO A;  4LSJ A;  3DCU A;  4IUI A;  5DVC A;  4MGD B;  3AZ1 A;  4ZNU A;  3D6D A;  5JJM B;  2J7X A;  1R20 D;  2A3I A;  3O1D A;  4HEE X;  3WFF A;  2VV1 A;  3L0J A;  2I0G A;  3D90 A;  3A2J A;  1GWX A;  3CS8 A;  1Y0X X;  3P89 A;  1X76 A;  4ZN9 A;  5DP0 A;  1R1K A;  1UOM A;  3L0E A;  4O8F A;  3ZR7 A;  3MNO A;  4OKT A;  2BJ4 B;  5FQT A;  5AZT A;  3W0C A;  2NV7 A;  5AVI A;  4POJ A;  3K23 A;  5G5W A;  1XIU A;  3DCT A;  1MZN A;  1T7F A;  1Z5X E;  5EC9 A;  3PEQ A;  3KMZ A;  3H0A D;  4PVU A;  5DXB B;  1A52 A;  2ATH A;  4LNX A;  3VJI A;  3OLL A;  5IZ0 A;  4OJ9 A;  1FBY A;  4RMC A;  3CWD A;  4OED A;  1N83 A;  4ZNV A;  2ZNP A;  2GP7 A;  1MV9 A;  3B1M A;  1NQ1 A;  1ZKY A;  3V9Y A;  2ZK4 A;  3KMR A;  3X1I A;  3L03 A;  5DKG A;  3OS8 A;  4OK1 A;  3HC5 A;  2YFE A;  4PP6 A;  5DKE A;  5KRO A;  5ETH A;  3AN4 A;  2ABI A;  4MGD A;  5DXK A;  3N00 A;  4J24 A;  2AX9 A;  5G44 A;  2HWR A;  4OFR A;  5JJM A;  3B5R A;  2NXX A;  2ZL9 A;  1TXI A;  3BC5 A;  3GZ9 A;  3U9Q A;  3OMO A;  5B41 A;  3V49 A;  3DZY D;  3F5C B;  2I4J A;  3AZ2 A;  4CSJ A;  2Z4J A;  3JZC A;  1KKQ A;  3W0I A;  3VSO A;  3UP0 A;  5K13 A;  2J4A A;  2BJ4 A;  1T63 A;  1OSH A;  3GYU A;  3MNE A;  3UVV B;  5ACC A;  2AX8 A;  3KPZ A;  2OCF A;  2R6W A;  2JJ3 A;  1RKH A;  1XLS A;  1ZDT A;  4UDA A;  1NDE A;  5FQS A;  5C4S A;  2PJL A;  2P7G A;  3S9S A;  2ZXM A;  5AZV A;  4ZNH A;  2Q59 A;  3GYT A;  1VJB A;  3B0W A;  3IPU A;  2HWQ A;  5JY3 A;  4QE8 A;  2PIN A;  1IE9 A;  4OZR U;  5KR9 A;  1SR7 A;  2ZY0 A;  4IVW A;  4J5X C;  3G9E A;  3P88 A;  4ITE A;  1RDT A;  2YLY A;  3IXP A;  2ZMJ A;  3ET0 A;  4XT9 A;  1XP6 A;  3X36 A;  3ZRB A;  5FQV A;  3UUD B;  5LGA A;  3WT5 A;  3ERD A;  4TUZ B;  2QR9 A;  4IA3 A;  5H1E A;  1YA3 A;  3ET1 A;  3VRU A;  4Q50 A;  1SQN A;  3K6P A;  1OSV A;  4RMD A;  1LV2 A;  4FGY A;  3WMH A;  5EIT A;  4DM6 A;  3CDP A;  2AA6 A;  3W0J A;  1GWQ A;  2Q6S A;  1HG4 A;  2YAT A;  4OLM A;  3F5C A;  3HLV A;  3OSW A;  2P1V A;  2QGW A;  5DYB A;  1I38 A;  5DV6 A;  3A2I A;  2PIR A;  5G43 A;  4OFU A;  4R6S A;  1E3G A;  4LTW A;  1SJ0 A;  3PBA A;  3O1E A;  4KZM A;  1PRG A;  2P1U A;  5APK A;  3WJ4 A;  2P4Y A;  4RUP A;  3UVV A;  2O4J A;  4IW6 A;  2OAX A;  3DR1 A;  2ZKC A;  3CQV A;  1PDU A;  2R6Y A;  5L7E A;  2R40 A;  1LBD A;  1XJ7 A;  4ITF A;  1QKT A;  2AMA A;  4ZO1 X;  5HJP B;  2QW4 A;  3GBK A;  2P7A A;  1S9P A;  3VTC A;  4OEA A;  1UHL B;  3V9T A;  3ADS A;  2OVM A;  3FS1 A;  5HJS A;  4P6X A;  3H52 A;  4MG7 B;  1G5Y A;  1OT7 A;  5SYZ A;  1I37 A;  3UUD A;  1R1K D;  5KRC A;  3B0Q A;  2ZK3 A;  5DK9 A;  1Z5X U;  1IE8 A;  4TV1 B;  3OMQ A;  4TUZ A;  1PZL A;  4JYH A;  2NXX E;  4Q0A C;  3X31 A;  4S0T A;  4YPQ A;  2AB2 A;  2AMB A;  5KRH A;  3DT3 A;  5KRI A;  3FUR A;  4ZO1 B;  2ZK1 A;  2QH6 A;  3KDU A;  2AAX A;  3LBD A;  3OMM A;  3W0H A;  1XPC A;  1XVP B;  3HVL A;  4LBD A;  4Q13 A;  4Y29 A;  5HJP A;  5DI7 A;  4FNE A;  3VRW A;  1T76 A;  3ILZ A;  5DIG A;  3VJS A;  5F9B A;  4N1Y A;  3L3X A;  3ZQT A;  1XLS E;  2H79 A;  3VT5 A;  1T7T A;  3A3Z X;  1NQ2 A;  2PIP L;  2OM9 A;  2P1T A;  4BCR A;  1RKG A;  2GIU A;  2HVC A;  3K22 A;  4POH A;  2LBD A;  4KZJ A;  1FD0 A;  5DZ0 A;  2AWH A;  1PQ9 A;  4DMA A;  4N8R A;  2ACL B;  2GPO A;  3GWX A;  3OOK A;  4PLD A;  3IPS A;  2AO6 A;  1UHL A;  2XYX A;  2JFA B;  1S9Q A;  4OZT U;  3VTD A;  1ILH A;  1XZX X;  2OUZ A;  4MG7 A;  4OHA A;  4OEZ A;  4QL8 A;  4MG6 A;  5FQR A;  3SP6 A;  4DM8 A;  4ZN7 A;  3CDS A;  4XLD A;  3TY0 A;  2Q61 A;  3DY6 A;  3G0W A;  2VST A;  2QPY A;  4PXM A;  2ZVT A;  4TV1 A;  2ZNN A;  3V3Q A;  3VRT A;  4EM9 A;  2Z4B A;  1NHZ A;  1OVL A;  3ET2 A;  5DIE A;  3WT7 A;  2G0G A;  2NPA A;  1FCZ A;  3RUT A;  5CJ6 A;  4G20 A;  2HAM A;  1XP1 A;  1XVP A;  2Q59 B;  2PIX A;  5DV8 A;  3V3E A;  5AAU A;  5L7H A;  2VV4 A;  2HB8 A;  2JF9 A;  1T65 A;  1Y9R A;  3P0U A;  2W8Y A;  2XYJ A;  3HOD A;  1NUO A;  3Q95 A;  4ONI A;  1RDT D;  3IXP D;  3VTB A;  5DXM A;  4K7A A;  4NY9 A;  4RZG A;  2P7Z A;  2HCD A;  2Q3Y A;  3W0G A;  1RK3 A;  3KYT A;  4IA2 A;  4J5W C;  4S0S A;  5DZ3 A;  4IWC A;  3UU7 A;  3X1H A;  4B7W A;  4IV2 A;  3FEI A;  2OVH A;  1HJ1 A;  5DU5 A;  3FC6 B;  2ACL A;  1XDK B;  3GN8 A;  1XOW A;  2ZAS A;  4F9M A;  1YIN A;  4QJR A;  2QSE A;  3OSA A;  3UUA B;  1G2N A;  2JFA A;  3UP3 A;  5DRM A;  3RLJ A;  1N46 A;  1KV6 A;  5E15 A;  2XYW A;  1P93 A;  5KRJ A;  2YJA B;  3L0L A;  1S0X A;  1XB7 A;  4NIE A;  3OLF A;  3OGT A;  5FQP A;  2O4R A;  1KNU A;  2FSZ A;  1YJE A;  1FM9 A;  3ADX A;  4OC7 A;  4OZT E;  5DYD A;  1M13 A;  3OKH A;  2GPU A;  4HLW A;  1ZH7 A;  5E7V A;  3W5R A;  5KCT A;  1XAP A;  2R40 D;  4WLB A;  3KFC A;  5DLR A;  5GIC A;  4JYG A;  1M2Z A;  1NRL A;  2ZMI A;  3CLD A;  4E2J A;  4QE6 A;  3R2A A;  4X1F A;  4DK8 A;  3R8D A;  1K4W A;  1L2I A;  3FLI A;  1SKX A;  1U3Q A;  3V9V A;  5E0X A;  1PQC A;  4WHF A;  3KBA A;  3L1B A;  1PQ6 A;  4KZI A;  3E94 A;  1Z95 A;  2QGT A;  4J26 A;  4OKW A;  4RFW A;  3CJW A;  4OGH A;  5DUE A;  3FC6 A;  1XDK A;  5HCV A;  1NAV A;  1T7R A;  2QA8 B;  2PIV A;  1H9U A;  3A9E B;  4IQR A;  3HO0 A;  5DMC A;  2AA2 A;  1Q4X A;  1FCY A;  5GID A;  3UUA A;  4OH6 A;  5DWG A;  5DVS A;  3OKI A;  1I7I A;  3E00 D;  4IA7 A;  2G44 A;  3H0A A;  2OZ7 A;  1FCX A;  1YUC A;  3E7C A;  4J5W A;  4OKB A;  5AVL A;  1K74 A;  1PK5 A;  1T5Z A;  4IV4 A;  4K6I A;  1FM6 A;  2J7Y A;  3VT3 A;  5C4O A;  2REW A;  1QKU A;  5E14 A;  4MG5 A;  4REE A;  2ZFX A;  4YMQ A;  2HC4 A;  5KCU A;  3A40 X;  3OMK A;  1X7B A;  1TFC A;  2Q6J A;  2QXM A;  3NOA A;  3VT8 A;  5IXK A;  3R8A A;  2G0H A;  3VT7 A;  4FHH A;  4XAO A;  4S14 A;  4DOS A;  4QK4 A;  2ZK6 A;  2IHQ A;  4UDB A;  4OIL A;  3VN2 A;  4IU7 A;  4PF3 A;  4OIU A;  2PIW A;  1XP9 A;  5DX3 B;  2YLO A;  1ERR A;  5DWI A;  2B1Z A;  3AX8 A;  1ZAF A;  3R5N A;  4DOR A;  2YHD A;  4N73 A;  1QKN A;  2J14 A;  2Q5P A;  3D57 A;  4YNK A;  2QTU A;  4XI3 A;  1I7G A;  1OVL B;  3ADU A;  1S0Z A;  2QA8 A;  4MG8 B;  5DTV A;  3A9E A;  3WTQ A;  1XQC A;  2ZBS A;  3PCU A;  5G45 A;  2PIT A;  2BAW A;  3VHU A;  3ET3 A;  4M8E A;  1NAX A;  2HFP A;  4J5X A;  5L11 A;  1GWR A;  3KWY A;  5KCC A;  3OZJ A;  4IW8 A;  3TKC A;  4MGB B;  3D5F A;  2VV4 B;  4JL4 A;  3R29 A;  3WWR A;  2VV0 A;  2PIQ A;  3Q95 B;  4L98 A;  5DKB A;  5DL4 A;  4YT1 A;  2ZLA A;  4ZNS A;  4LNW A;  2Q7J A;  3P8X A;  3R8I A;  3WGP A;  2H77 A;  3ERT A;  5ICK A;  4OJ4 A;  3UU7 B;  3B67 A;  5KCF A;  4G1Z A;  4A2J A;  5HZC A;  3B3K A;  5DUG A;  2ZMH A;  4PP3 A;  5DMF A;  5I4V A;  3HC6 A;  2B23 A;  4RUO X;  3RVF A;  4CI4 A;  2PRG A;  3OS8 C;  3PO9 A;  3TX7 B;  5AAV B;  4MGC A;  5DXP A;  5DX3 A;  1EXA A;  3EYB A;  4RWV A;  2ZK5 A;  4CI5 A;  1EXX A;  4NUF A;  2P54 A;  3WT6 A;  4A4W A;  4E4Q A;  2B1V A;  2V7C A;  2EWP A;  2PIU A;  5GT4 A;  1NYX A;  2POB A;  1XNX A;  4IS8 A;  3L3Z A;  4R2U A;  2HB7 A;  3ADT A;  4EMA A;  3AUN A;  1FM9 D;  3B0T A;  2POG A;  3GD2 A;  4MG8 A;  3B0R A;  4APU A;  5E19 A;  3IPQ A;  1A28 A;  5C4U A;  2P15 A;  1U3S A;  3HM1 A;  4OAR A;  4MDD A;  2HAR A;  5KRL A;  4MGB A;  4G21 A;  4PLE A;  3W0Y A;  2B50 A;  4XUM A;  1UPW A;  3B65 A;  4MGA B;  2Q5S A;  4OH5 A;  4RAK A;  2AX7 A;  3FXV A;  4RME A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...