3ERDA

Human estrogen receptor alpha ligand-binding domain in complex with diethylstilbestrol and a glucocorticoid receptor interacting protein 1 nr box ii peptide
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
245
structure length
245
Chain Sequence
SLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structural basis of estrogen receptor/coactivator recognition and the antagonism of this interaction by tamoxifen.
pubmed doi rcsb
molecule keywords ESTROGEN RECEPTOR ALPHA
molecule tags Nuclear receptor
source organism Homo sapiens
total genus 93
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 3erdA00
3QT0A 3OZJA 1NAVA 1TXIA 1OVLB 4K4JA 1T5ZA 1DB1A 3WJ4A 4F9MA 3F5CA 5KYAA 3B0RA 2O9IA 2XYJA 4J5XC 4OHAA 5DKSA 4MG9B 3K6PA 3V9TA 4JGVA 2VV3A 2ZXMA 3FEIA 3IXPA 3FURA 2YJDA 2HAMA 5DXBA 5F9BA 5FQSA 3RVFA 3AX8A 2GIUA 1R6GA 4MGAA 4MG8B 4MG7B 2Q7JA 2Z4JA 2YATA 4FN9A 2QGTA 4RZEA 3RLLA 3W0IA 1XP6A 1X78A 3UP3A 3VHWA 1T65A 1XV9A 2HFPA 1K4WA 4DK8A 4POHA 1R20A 2O4JA 4DOSA 4DQMA 3KYTA 3ADUA 2PIRA 1ZUCA 1R5KA 3HODA 3H0AD 3FC6B 5HYKA 4M8EA 4OEYA 5DWGA 5HJSA 5DL4A 3AN3A 1YA3A 2Q5GA 2QE4A 2OVHA 2QGWA 2XYWA 1PCGA 1PQ9A 1MV9A 3OMOA 4WLBA 3A78A 2ZL9A 2VV0A 2FSZA 4NY9A 3W5RA 4LNXA 5K13A 5AZVA 3VTBA 3CTBA 4HLWA 4RMDA 2AMBA 5E0XA 2XKWA 3V9VA 3OMKA 3DZYA 4L98A 1M2ZA 2ZY0A 5ACCA 4IWCA 4RMCA 1ERRA 4QE8A 4PRGA 3UVVB 3S9SA 3B0QA 3V4AA 1RDTA 3VTCA 3H52A 1G5YA 3ZQTA 1YUCA 2HC4A 3VHVA 4O8FA 5DMCA 3CS4A 4XT9A 4R06A 1EXAA 3B1MA 1N4HA 3W0GA 3ZR7A 5DIEA 1U3QA 2Q5PA 4IVWA 3W5PA 2ATHA 4JYHA 4XLDA 3KMZA 3PO9A 1LV2A 2Q8SA 2QXMA 1ILHA 3VT4A 2ZLCA 5HZCA 3X1IA 3DT3A 2HBHA 3CDPA 4OGHA 5APHA 3WT6A 4PLEA 5KCUA 4RE8A 1KV6A 4RWVA 3OLFA 5DZ0A 4YNKA 1NRLA 1SJ0A 1NQ2A 3OLSA 4DORA 5DIDA 5I4VA 3SZ1A 3G8OA 4TUZA 3FLIA 4CI4A 5DV3A 5DWEA 3B3KA 4UDCA 1P8DA 3D5FA 4G2HA 3KPZA 2JF9A 4OJ9A 5G42A 3DZUD 3GWSX 1FCYA 1QKMA 3WJ5A 2AA5A 3O1DA 2ZK2A 1UHLA 4XTAA 2QMVA 3P89A 2PIVA 3A40X 3FUGA 5JI0D 4M8HA 2R6WA 2QW4A 5DXBB 4WVDA 5KRAA 3B0TA 3CS8A 1VJBA 4LBDA 1M7WA 1YOWA 1XNXA 4MGAB 4G1ZA 3VJSA 4LTWA 3L0LA 3TX7B 1PRGA 1XP9A 2ZK4A 4OEZA 4TV1A 5GICA 5SYZA 5L7EA 2PNUA 1OT7A 2QZOA 1XV9B 2Q59A 1XZXX 4G2IA 4ZO1X 1P93A 2ZMHA 3GWXA 5KROA 3E7CA 4IQRA 2QR9A 1YY4A 3ERTA 4RUOX 4X1FA 1XP1A 4XHDA 5H1EA 2R40A 3TKCA 3OMQA 3LBDA 4ITFA 3DCUA 3DR1A 5DWIA 5EITA 1QKUA 2AAXA 3ADTA 3OSWA 4S14A 1X7RA 1SR7A 2GPVA 3L0JA 3HC5A 4IA3A 4JYIA 1I38A 3G0WA 4PP3A 4KZIA 5DUGA 3E00A 3A3ZX 3A9EB 2R6YA 3Q95A 4IV2A 4J26A 4LSJA 5AK2A 4OH5A 3W0JA 3TKMA 1T74A 4OFUA 5G3JA 3AUNA 3FEJA 2B1ZA 5L7GA 2AX7A 5KRCA 1XPCA 1PDUA 3DCTA 2Z4BA 3UU7A 4ZJWA 1YIMA 4IS8A 1FBYA 5KCDA 3KWYA 4PLDA 3AURA 5DXGA 5DI7A 3L03A 5DKBA 5DIGA 3VT5A 3HC6A 2OUZA 5KRJA 3X36A 4EM9A 1YYEA 3OS8A 4ZOMA 2NW4A 1XQ3A 2I4ZA 2G0GA 4S15A 3IPUA 4S0SA 3RUTA 1SQNA 3B68A 1XLSA 4JYGA 3VJHA 5AAVA 4OKXA 2Q7KA 3GYUA 5DUEA 3GBKA 4A2JA 4G1DA 2ZBSA 1R20D 3ET1A 4QM0A 4LNWA 1N83A 4TUZB 3ADVA 3NSQA 5DZ3A 1GWQA 2QSEA 3KMRA 4NUFA 1KNUA 4CI5A 4OKBA 1FCZA 2EWPA 3FS1A 2VV1A 2GWXA 1N46A 3M7RA 3VRTA 2V7CA 1YJEA 1T63A 2J7XA 3ADXA 3OZ0A 4OZTE 1L2JA 5EGVA 5KCFA 4DMAA 5KCEA 5DV6A 4DM8A 1QKNA 1X7JA 1PK5A 1PQ6A 1YINA 5DLRA 1XDKA 2QA8B 3DZYD 4Q50A 5DV8A 5DVSA 3L0EA 1M13A 5G5WA 1ZDTA 4N73A 5DWLA 4TV1B 4G21A 2QZOB 3K22A 3PCUA 5KRHA 1RDTD 1IE8A 5C4UA 5KRMA 3VTDA 2B23A 1FM6A 3EYBA 1XVPA 1FD0A 3R8IA 4XAOA 3R29A 1T7MA 3VRUA 1FM9A 3GYTA 4L96A 1RK3A 3AFRA 1DKFA 4PWLA 5DX3A 5DU5A 4YPQA 3OGTA 3OOKA 2AXAA 2ZFXA 4RUPA 3JZCA 1G1UA 4QL8A 5DVVA 4MGDA 4OZRE 1XJ7A 1NQ1A 5EHJA 3WGPA 1L2IA 5KYJA 1K74A 5LWPA 5B41A 3HZFA 3CQVA 3Q95B 3VT3A 1HJ1A 2JFAA 1X7BA 2ZK1A 5KRLA 2LBDA 1ZAFA 4ZNUA 3X1HA 2P4YA 1T73A 4MGBA 2Q6SA 4QE6A 3UU7B 5KR9A 5KRKA 1UPVA 5C4OA 3A2HA 1MVCA 3AN4A 4OARA 1S9PA 4OEAA 3FXVA 3KBAA 3VI8A 2VV4A 5DTVA 5KCTA 2P7GA 2BJ4A 1BSXA 1T76A 4DK7A 3PEQA 2YLPA 1UPWA 3BQDA 3TY0A 3ZRBA 2ABIA 4IVYA 5DK9A 5DXEA 3VT6A 4ZNTA 2HASA 2OZ7A 4KZMA 5DRMA 1Z5XU 2I0GA 3W0AA 2Q7IA 3F5CB 4ZO1B 2E2RA 2ZKCA 3GZ9A 3R5MA 3WFGA 3IPQA 2Q6JA 2OM9A 5EC9A 5IXKA 5C4TA 2GPPA 4FHHA 4Q13A 5APJA 2H77A 3UUAA 1E3KA 4RAKA 5FQPA 2ZMIA 2HCDA 4IA7A 4OJ4A 2A3IA 4ZN9A 2P54A 2Q61A 2R40D 1NUOA 2ZK0A 5DZHA 4E4KA 5DVCA 5IAWA 2VV1B 4PP6A 2ACLA 2B50A 5KCCA 2YLOA 3ADWA 3KMGA 1Y9RA 4IW6A 3R8AA 4POJA 2G5OA 5AWKA 3WWRA 2AA7A 4MG7A 1ZH7A 3K8SA 4WPFA 3E00D 2PIXA 3OMPA 1X7EA 1XDKB 1Y0SA 2J14A 1NQ0A 2AA2A 5DKGA 5DXRA 3VT9A 3IXPD 3VJIA 2QPYA 2HARA 5E15A 2I0JA 4YT1A 1G2NA 3PBAA 4OLMA 2PINA 4JL4A 2PJLA 4QJRA 5DSHA 5FQTA 1X76A 5GT4A 5JJMA 4PVUA 3OS8C 4RFWA 3OSAA 4BCRA 1XVPB 3P8XA 5KD9A 2Q5SA 1U3RA 5G44A 4KZJA 3D90A 2PIOA 3ET2A 2NXXA 5DX3B 5DZ1A 2ZXNA 1FCXA 4MG5A 3UUDA 1UOMA 2H79A 3B5RA 2G0HA 4A4WA 2HB8A 3VRWA 3UP0A 1XNNA 1T7RA 4X1GA 5G46A 1PZLA 2QNVA 4NB6A 5CJ6A 5E19A 4OC7A 2Q3YA 5DY8A 2QXSA 5E0WA 2YHDA 4ITEA 1S0ZA 2AM9A 5DZIA 4ZI1A 2FVJA 2QABA 2JFAB 4NIEA 4OK1A 4XUHA 5DRJA 3R5NA 5DYDA 1EREA 3W5TA 1OSHA 3PRGA 3V3QA 5A86A 4MGBB 2YLQA 3W0HA 4JAZA 1I37A 2AYRA 3R8DA 3F7DA 2W8YA 3VN2A 2Q7LA 5KRFA 4DM6A 5L7HA 5KCWA 4ZNSA 2VSRA 4J5WA 4N8RA 4R6SA 3K23A 3VRVA 5DXQA 1Y0XX 2OCFA 4FHIA 1H9UA 2VV4B 5AYGA 5GIEA 5HYRA 1A28A 5E14A 1LBDA 1XOWA 2POGA 1GWXA 3R2AA 1GS4A 2AB2A 3OMMA 2GPOA 1G50A 4PP5A 3NOAA 1YP0A 2ZASA 3G8IA 5LGAA 2Q70A 1SKXA 3ADSA 5EI1A 4ZNWA 3UUCA 3LMPA 2Q60A 2ZNQA 3A2JA 4S0TA 3SP9A 4WHFA 2I4PA 4E2JA 4NQAB 3GD2A 1ZDUA 1UHLB 3L1BA 3PLZA 3UUAB 2YJAB 2PIWA 3HO0A 3V3EA 4ZJRA 2P7ZA 3T03A 2Q1VA 1FM6D 4YMQA 4J24A 2J7YA 3L3XA 4E4QA 5HJPA 1FM9D 4XUMA 4WQPA 5M96A 1NHZA 5AAUA 1YOKA 1NDEA 2Q6RA 3P0UA 2ACLB 3MNOA 3P88A 4P6XA 5DKEA 5G45A 2Q59B 3X31A 4RMEA 1S9QA 2VV2A 3D6DA 4RUJA 3KDUA 2PIUA 1K74D 2HVCA 2OVMA 2P15A 4PXMA 3RUUA 1Q4XA 4HEEX 4OH6A 5ICKA 4P6WA 5IZ0A 3VT7A 4OEDA 3NSPA 2XYXA 4RZFA 5AWJA 1NQ7A 2OAXA 4K7AA 5JJMB 3VT8A 4N5GA 2PIPL 2PRGA 3N00A 4IWFA 5DXPA 3OS9A 1I7IA 2B1VA 2G44A 5ETHA 2AWHA 4J5XA 5DXKA 3IA6A 2AA6A 5DYBA 4MDDA 4PPSA 4UDBA 3OOFA 3V49A 2F4BA 3W0YA 1T79A 2FAIA 3UUDB 3B65A 4Q0AC 3AUQA 4WHGA 3B67A 5G43A 5HCVA 4REEA 1XAPA 2V0VA 3OKHA 3A9EA 4UDDA 4EMAA 3RLJA 3W0CA 3H0AA 3A2IA 1ILGA 4MG6A 4Y29A 4IW8A 3VHUA 5B5BA 3CDSA 1XQCA 5AZTA 3CLDA 5L11A 1YMTA 2P7AA 2ZNPA 4OKWA 5FQRA 3WMHA 1PQCA 4FNEA 4REFA 4APUA 1RJKA 2P1VA 3HLVA 1A52A 2ZNNA 3MNPA 1NYXA 2IOGA 3AZ2A 3OAPA 2NV7A 1U3SA 2AX6A 2NXXE 1EXXA 1MZNA 3WFFA 3W5QA 3CS6A 2QH6A 4OILA 4G20A 5AAVB 4ZN7A 3ZRAA 3E94A 5DXMA 3VJTA 3BEJA 1NAXA 1QKTA 3FALA 3U9QA 4OIUA 2ZNOA 3VSPA 2ZLAA 2HB7A 1OVLA 3ET3A 4XI3A 1Z95A 4MGCA 4R2UA 1KKQA 3OKIA 5APKA 2O4RA 2PITA 4RZGA 2ZK6A 5E7VA 4MG9A 3B66A 4ZNVA 3AZ3A 3AZ1A 3IMYA 1I7GA 3V9YA 3MNEA 2QA6A 4OFRA 4IV4A 2Q1HA 5EJVA 2GP7A 5AVIA 5GIDA 1ZEOA 4MG8A 1RKGA 1S0XA 2HWQA 1XLSE 3ERDA 5DWJA 2ZK3A 2ZMJA 4K6IA 4B7WA 1XB7A 3L3ZA 4QK4A 2NPAA 1S19A 2POBA 3G9EA 5HJPB 5DMFA 3CWDA 3ILZA 2XHSA 2AO6A 2ZVTA 4OIVA 1IE9A 3HVLA 4OZTU 2QTUA 1T7FA 3ET0A 4OJBA 2QA8A 2AMAA 3BC5A 3FC6A 1XIUA 3OSIA 5FQVA 3OLLA 3DZUA 4J5WC 1DKFB 3D24A 3WT7A 3WT5A 1E3GA 2GTKA 2ZXZA 4PPPA 1TFCA 4MGDB 2P1UA 1GWRA 4CSJA 3KFCA 2IHQA 3HM1A 1HG4A 1R1KD 2AX9A 2ZK5A 4FGYA 4IU7A 4IUIA 3UVVA 5KRIA 3RY9A 3WTQA 4N1YA 1WM0X 2HWRA 3JZBA 2JJ3A 3SP6A 1RKHA 3DY6A 4OZRU 3KDTA 1R1KA 2I4JA 2J4AA 1OSVA 1T7TA 4G1YA 3B0WA 3GN8A 4IA1A 2BJ4B 2BAWA 3HQ5A 4ONIA 5DP0A 2IOKA 2GL8A 3FALB 3O1EA 2VSTA 1ZGYA 2YFEA 1ZKYA 1Z5XE 3VSOA 3IPSA 4OKTA 4IA2A 2AX8A 2P1TA 1U9EA 4UDAA 5C4SA 2YLYA 4A4VA 1K7LA 5AVLA 2PKLA 5JY3A 2PIQA 3CJWA 5DUHA 2REWA 4ZNHA 4PF3A 5E1CA 2GPUA 3D57A
chains in the Genus database with same CATH superfamily
3QT0A 3OZJA 1NAVA 1TXIA 1OVLB 4K4JA 1T5ZA 1DB1A 3WJ4A 4F9MA 3F5CA 5KYAA 3B0RA 2O9IA 2XYJA 4J5XC 4OHAA 5DKSA 4MG9B 3K6PA 3V9TA 4JGVA 2VV3A 2ZXMA 3FEIA 3IXPA 3FURA 2YJDA 2HAMA 5DXBA 5F9BA 5FQSA 3RVFA 3AX8A 2GIUA 1R6GA 4MGAA 4MG8B 4MG7B 2Q7JA 2Z4JA 2YATA 4FN9A 2QGTA 4RZEA 3RLLA 3W0IA 1XP6A 1X78A 3UP3A 3VHWA 1T65A 1XV9A 2HFPA 1K4WA 4DK8A 4POHA 1R20A 2O4JA 4DOSA 4DQMA 3KYTA 3ADUA 2PIRA 1ZUCA 1R5KA 3HODA 3H0AD 3FC6B 5HYKA 4M8EA 4OEYA 5DWGA 5HJSA 5DL4A 3AN3A 1YA3A 2Q5GA 2QE4A 2OVHA 2QGWA 2XYWA 1PCGA 1PQ9A 1MV9A 3OMOA 4WLBA 3A78A 2ZL9A 2VV0A 2FSZA 4NY9A 3W5RA 4LNXA 5K13A 5AZVA 3VTBA 3CTBA 4HLWA 4RMDA 2AMBA 5E0XA 2XKWA 3V9VA 3OMKA 3DZYA 4L98A 1M2ZA 2ZY0A 5ACCA 4IWCA 4RMCA 1ERRA 4QE8A 4PRGA 3UVVB 3S9SA 3B0QA 3V4AA 1RDTA 3VTCA 3H52A 1G5YA 3ZQTA 1YUCA 2HC4A 3VHVA 4O8FA 5DMCA 3CS4A 4XT9A 4R06A 1EXAA 3B1MA 1N4HA 3W0GA 3ZR7A 5DIEA 1U3QA 2Q5PA 4IVWA 3W5PA 2ATHA 4JYHA 4XLDA 3KMZA 3PO9A 1LV2A 2Q8SA 2QXMA 1ILHA 3VT4A 2ZLCA 5HZCA 3X1IA 3DT3A 2HBHA 3CDPA 4OGHA 5APHA 3WT6A 4PLEA 5KCUA 4RE8A 1KV6A 4RWVA 3OLFA 5DZ0A 4YNKA 1NRLA 1SJ0A 1NQ2A 3OLSA 4DORA 5DIDA 5I4VA 3SZ1A 3G8OA 4TUZA 3FLIA 4CI4A 5DV3A 5DWEA 3B3KA 4UDCA 1P8DA 3D5FA 4G2HA 3KPZA 2JF9A 4OJ9A 5G42A 3DZUD 3GWSX 1FCYA 1QKMA 3WJ5A 2AA5A 3O1DA 2ZK2A 1UHLA 4XTAA 2QMVA 3P89A 2PIVA 3A40X 3FUGA 5JI0D 4M8HA 2R6WA 2QW4A 5DXBB 4WVDA 5KRAA 3B0TA 3CS8A 1VJBA 4LBDA 1M7WA 1YOWA 1XNXA 4MGAB 4G1ZA 3VJSA 4LTWA 3L0LA 3TX7B 1PRGA 1XP9A 2ZK4A 4OEZA 4TV1A 5GICA 5SYZA 5L7EA 2PNUA 1OT7A 2QZOA 1XV9B 2Q59A 1XZXX 4G2IA 4ZO1X 1P93A 2ZMHA 3GWXA 5KROA 3E7CA 4IQRA 2QR9A 1YY4A 3ERTA 4RUOX 4X1FA 1XP1A 4XHDA 5H1EA 2R40A 3TKCA 3OMQA 3LBDA 4ITFA 3DCUA 3DR1A 5DWIA 5EITA 1QKUA 2AAXA 3ADTA 3OSWA 4S14A 1X7RA 1SR7A 2GPVA 3L0JA 3HC5A 4IA3A 4JYIA 1I38A 3G0WA 4PP3A 4KZIA 5DUGA 3E00A 3A3ZX 3A9EB 2R6YA 3Q95A 4IV2A 4J26A 4LSJA 5AK2A 4OH5A 3W0JA 3TKMA 1T74A 4OFUA 5G3JA 3AUNA 3FEJA 2B1ZA 5L7GA 2AX7A 5KRCA 1XPCA 1PDUA 3DCTA 2Z4BA 3UU7A 4ZJWA 1YIMA 4IS8A 1FBYA 5KCDA 3KWYA 4PLDA 3AURA 5DXGA 5DI7A 3L03A 5DKBA 5DIGA 3VT5A 3HC6A 2OUZA 5KRJA 3X36A 4EM9A 1YYEA 3OS8A 4ZOMA 2NW4A 1XQ3A 2I4ZA 2G0GA 4S15A 3IPUA 4S0SA 3RUTA 1SQNA 3B68A 1XLSA 4JYGA 3VJHA 5AAVA 4OKXA 2Q7KA 3GYUA 5DUEA 3GBKA 4A2JA 4G1DA 2ZBSA 1R20D 3ET1A 4QM0A 4LNWA 1N83A 4TUZB 3ADVA 3NSQA 5DZ3A 1GWQA 2QSEA 3KMRA 4NUFA 1KNUA 4CI5A 4OKBA 1FCZA 2EWPA 3FS1A 2VV1A 2GWXA 1N46A 3M7RA 3VRTA 2V7CA 1YJEA 1T63A 2J7XA 3ADXA 3OZ0A 4OZTE 1L2JA 5EGVA 5KCFA 4DMAA 5KCEA 5DV6A 4DM8A 1QKNA 1X7JA 1PK5A 1PQ6A 1YINA 5DLRA 1XDKA 2QA8B 3DZYD 4Q50A 5DV8A 5DVSA 3L0EA 1M13A 5G5WA 1ZDTA 4N73A 5DWLA 4TV1B 4G21A 2QZOB 3K22A 3PCUA 5KRHA 1RDTD 1IE8A 5C4UA 5KRMA 3VTDA 2B23A 1FM6A 3EYBA 1XVPA 1FD0A 3R8IA 4XAOA 3R29A 1T7MA 3VRUA 1FM9A 3GYTA 4L96A 1RK3A 3AFRA 1DKFA 4PWLA 5DX3A 5DU5A 4YPQA 3OGTA 3OOKA 2AXAA 2ZFXA 4RUPA 3JZCA 1G1UA 4QL8A 5DVVA 4MGDA 4OZRE 1XJ7A 1NQ1A 5EHJA 3WGPA 1L2IA 5KYJA 1K74A 5LWPA 5B41A 3HZFA 3CQVA 3Q95B 3VT3A 1HJ1A 2JFAA 1X7BA 2ZK1A 5KRLA 2LBDA 1ZAFA 4ZNUA 3X1HA 2P4YA 1T73A 4MGBA 2Q6SA 4QE6A 3UU7B 5KR9A 5KRKA 1UPVA 5C4OA 3A2HA 1MVCA 3AN4A 4OARA 1S9PA 4OEAA 3FXVA 3KBAA 3VI8A 2VV4A 5DTVA 5KCTA 2P7GA 2BJ4A 1BSXA 1T76A 4DK7A 3PEQA 2YLPA 1UPWA 3BQDA 3TY0A 3ZRBA 2ABIA 4IVYA 5DK9A 5DXEA 3VT6A 4ZNTA 2HASA 2OZ7A 4KZMA 5DRMA 1Z5XU 2I0GA 3W0AA 2Q7IA 3F5CB 4ZO1B 2E2RA 2ZKCA 3GZ9A 3R5MA 3WFGA 3IPQA 2Q6JA 2OM9A 5EC9A 5IXKA 5C4TA 2GPPA 4FHHA 4Q13A 5APJA 2H77A 3UUAA 1E3KA 4RAKA 5FQPA 2ZMIA 2HCDA 4IA7A 4OJ4A 2A3IA 4ZN9A 2P54A 2Q61A 2R40D 1NUOA 2ZK0A 5DZHA 4E4KA 5DVCA 5IAWA 2VV1B 4PP6A 2ACLA 2B50A 5KCCA 2YLOA 3ADWA 3KMGA 1Y9RA 4IW6A 3R8AA 4POJA 2G5OA 5AWKA 3WWRA 2AA7A 4MG7A 1ZH7A 3K8SA 4WPFA 3E00D 2PIXA 3OMPA 1X7EA 1XDKB 1Y0SA 2J14A 1NQ0A 2AA2A 5DKGA 5DXRA 3VT9A 3IXPD 3VJIA 2QPYA 2HARA 5E15A 2I0JA 4YT1A 1G2NA 3PBAA 4OLMA 2PINA 4JL4A 2PJLA 4QJRA 5DSHA 5FQTA 1X76A 5GT4A 5JJMA 4PVUA 3OS8C 4RFWA 3OSAA 4BCRA 1XVPB 3P8XA 5KD9A 2Q5SA 1U3RA 5G44A 4KZJA 3D90A 2PIOA 3ET2A 2NXXA 5DX3B 5DZ1A 2ZXNA 1FCXA 4MG5A 3UUDA 1UOMA 2H79A 3B5RA 2G0HA 4A4WA 2HB8A 3VRWA 3UP0A 1XNNA 1T7RA 4X1GA 5G46A 1PZLA 2QNVA 4NB6A 5CJ6A 5E19A 4OC7A 2Q3YA 5DY8A 2QXSA 5E0WA 2YHDA 4ITEA 1S0ZA 2AM9A 5DZIA 4ZI1A 2FVJA 2QABA 2JFAB 4NIEA 4OK1A 4XUHA 5DRJA 3R5NA 5DYDA 1EREA 3W5TA 1OSHA 3PRGA 3V3QA 5A86A 4MGBB 2YLQA 3W0HA 4JAZA 1I37A 2AYRA 3R8DA 3F7DA 2W8YA 3VN2A 2Q7LA 5KRFA 4DM6A 5L7HA 5KCWA 4ZNSA 2VSRA 4J5WA 4N8RA 4R6SA 3K23A 3VRVA 5DXQA 1Y0XX 2OCFA 4FHIA 1H9UA 2VV4B 5AYGA 5GIEA 5HYRA 1A28A 5E14A 1LBDA 1XOWA 2POGA 1GWXA 3R2AA 1GS4A 2AB2A 3OMMA 2GPOA 1G50A 4PP5A 3NOAA 1YP0A 2ZASA 3G8IA 5LGAA 2Q70A 1SKXA 3ADSA 5EI1A 4ZNWA 3UUCA 3LMPA 2Q60A 2ZNQA 3A2JA 4S0TA 3SP9A 4WHFA 2I4PA 4E2JA 4NQAB 3GD2A 1ZDUA 1UHLB 3L1BA 3PLZA 3UUAB 2YJAB 2PIWA 3HO0A 3V3EA 4ZJRA 2P7ZA 3T03A 2Q1VA 1FM6D 4YMQA 4J24A 2J7YA 3L3XA 4E4QA 5HJPA 1FM9D 4XUMA 4WQPA 5M96A 1NHZA 5AAUA 1YOKA 1NDEA 2Q6RA 3P0UA 2ACLB 3MNOA 3P88A 4P6XA 5DKEA 5G45A 2Q59B 3X31A 4RMEA 1S9QA 2VV2A 3D6DA 4RUJA 3KDUA 2PIUA 1K74D 2HVCA 2OVMA 2P15A 4PXMA 3RUUA 1Q4XA 4HEEX 4OH6A 5ICKA 4P6WA 5IZ0A 3VT7A 4OEDA 3NSPA 2XYXA 4RZFA 5AWJA 1NQ7A 2OAXA 4K7AA 5JJMB 3VT8A 4N5GA 2PIPL 2PRGA 3N00A 4IWFA 5DXPA 3OS9A 1I7IA 2B1VA 2G44A 5ETHA 2AWHA 4J5XA 5DXKA 3IA6A 2AA6A 5DYBA 4MDDA 4PPSA 4UDBA 3OOFA 3V49A 2F4BA 3W0YA 1T79A 2FAIA 3UUDB 3B65A 4Q0AC 3AUQA 4WHGA 3B67A 5G43A 5HCVA 4REEA 1XAPA 2V0VA 3OKHA 3A9EA 4UDDA 4EMAA 3RLJA 3W0CA 3H0AA 3A2IA 1ILGA 4MG6A 4Y29A 4IW8A 3VHUA 5B5BA 3CDSA 1XQCA 5AZTA 3CLDA 5L11A 1YMTA 2P7AA 2ZNPA 4OKWA 5FQRA 3WMHA 1PQCA 4FNEA 4REFA 4APUA 1RJKA 2P1VA 3HLVA 1A52A 2ZNNA 3MNPA 1NYXA 2IOGA 3AZ2A 3OAPA 2NV7A 1U3SA 2AX6A 2NXXE 1EXXA 1MZNA 3WFFA 3W5QA 3CS6A 2QH6A 4OILA 4G20A 5AAVB 4ZN7A 3ZRAA 3E94A 5DXMA 3VJTA 3BEJA 1NAXA 1QKTA 3FALA 3U9QA 4OIUA 2ZNOA 3VSPA 2ZLAA 2HB7A 1OVLA 3ET3A 4XI3A 1Z95A 4MGCA 4R2UA 1KKQA 3OKIA 5APKA 2O4RA 2PITA 4RZGA 2ZK6A 5E7VA 4MG9A 3B66A 4ZNVA 3AZ3A 3AZ1A 3IMYA 1I7GA 3V9YA 3MNEA 2QA6A 4OFRA 4IV4A 2Q1HA 5EJVA 2GP7A 5AVIA 5GIDA 1ZEOA 4MG8A 1RKGA 1S0XA 2HWQA 1XLSE 3ERDA 5DWJA 2ZK3A 2ZMJA 4K6IA 4B7WA 1XB7A 3L3ZA 4QK4A 2NPAA 1S19A 2POBA 3G9EA 5HJPB 5DMFA 3CWDA 3ILZA 2XHSA 2AO6A 2ZVTA 4OIVA 1IE9A 3HVLA 4OZTU 2QTUA 1T7FA 3ET0A 4OJBA 2QA8A 2AMAA 3BC5A 3FC6A 1XIUA 3OSIA 5FQVA 3OLLA 3DZUA 4J5WC 1DKFB 3D24A 3WT7A 3WT5A 1E3GA 2GTKA 2ZXZA 4PPPA 1TFCA 4MGDB 2P1UA 1GWRA 4CSJA 3KFCA 2IHQA 3HM1A 1HG4A 1R1KD 2AX9A 2ZK5A 4FGYA 4IU7A 4IUIA 3UVVA 5KRIA 3RY9A 3WTQA 4N1YA 1WM0X 2HWRA 3JZBA 2JJ3A 3SP6A 1RKHA 3DY6A 4OZRU 3KDTA 1R1KA 2I4JA 2J4AA 1OSVA 1T7TA 4G1YA 3B0WA 3GN8A 4IA1A 2BJ4B 2BAWA 3HQ5A 4ONIA 5DP0A 2IOKA 2GL8A 3FALB 3O1EA 2VSTA 1ZGYA 2YFEA 1ZKYA 1Z5XE 3VSOA 3IPSA 4OKTA 4IA2A 2AX8A 2P1TA 1U9EA 4UDAA 5C4SA 2YLYA 4A4VA 1K7LA 5AVLA 2PKLA 5JY3A 2PIQA 3CJWA 5DUHA 2REWA 4ZNHA 4PF3A 5E1CA 2GPUA 3D57A
chains in the Genus database with same CATH topology
3QT0A 3OZJA 1NAVA 1TXIA 1OVLB 4K4JA 1T5ZA 1DB1A 3WJ4A 4F9MA 3F5CA 5KYAA 3B0RA 2O9IA 2XYJA 4J5XC 4OHAA 5DKSA 4MG9B 3K6PA 3V9TA 4JGVA 2VV3A 2ZXMA 3FEIA 3IXPA 3FURA 2YJDA 2HAMA 5DXBA 5F9BA 5FQSA 3RVFA 3AX8A 2GIUA 1R6GA 4MGAA 4MG8B 4MG7B 2Q7JA 2Z4JA 2YATA 4FN9A 2QGTA 4RZEA 3RLLA 3W0IA 1XP6A 1X78A 3UP3A 3VHWA 1T65A 1XV9A 2HFPA 1K4WA 4DK8A 4POHA 1R20A 2O4JA 4DOSA 4DQMA 3KYTA 3ADUA 2PIRA 1ZUCA 1R5KA 3HODA 3H0AD 3FC6B 5HYKA 4M8EA 4OEYA 5DWGA 5HJSA 5DL4A 3AN3A 1YA3A 2Q5GA 2QE4A 2OVHA 2QGWA 2XYWA 1PCGA 1PQ9A 1MV9A 3OMOA 4WLBA 3A78A 2ZL9A 2VV0A 2FSZA 4NY9A 3W5RA 4LNXA 5K13A 5AZVA 3VTBA 3CTBA 4HLWA 4RMDA 2AMBA 5E0XA 2XKWA 3V9VA 3OMKA 3DZYA 4L98A 1M2ZA 2ZY0A 5ACCA 4IWCA 4RMCA 1ERRA 4QE8A 4PRGA 3UVVB 3S9SA 3B0QA 3V4AA 1RDTA 3VTCA 3H52A 1G5YA 3ZQTA 1YUCA 2HC4A 3VHVA 4O8FA 5DMCA 3CS4A 4XT9A 4R06A 1EXAA 3B1MA 1N4HA 3W0GA 3ZR7A 5DIEA 1U3QA 2Q5PA 4IVWA 3W5PA 2ATHA 4JYHA 4XLDA 3KMZA 3PO9A 1LV2A 2Q8SA 2QXMA 1ILHA 3VT4A 2ZLCA 5HZCA 3X1IA 3DT3A 2HBHA 3CDPA 4OGHA 5APHA 3WT6A 4PLEA 5KCUA 4RE8A 1KV6A 4RWVA 3OLFA 5DZ0A 4YNKA 1NRLA 1SJ0A 1NQ2A 3OLSA 4DORA 5DIDA 5I4VA 3SZ1A 3G8OA 4TUZA 3FLIA 4CI4A 5DV3A 5DWEA 3B3KA 4UDCA 1P8DA 3D5FA 4G2HA 3KPZA 2JF9A 4OJ9A 5G42A 3DZUD 3GWSX 1FCYA 1QKMA 3WJ5A 2AA5A 3O1DA 2ZK2A 1UHLA 4XTAA 2QMVA 3P89A 2PIVA 3A40X 3FUGA 5JI0D 4M8HA 2R6WA 2QW4A 5DXBB 4WVDA 5KRAA 3B0TA 3CS8A 1VJBA 4LBDA 1M7WA 1YOWA 1XNXA 4MGAB 4G1ZA 3VJSA 4LTWA 3L0LA 3TX7B 1PRGA 1XP9A 2ZK4A 4OEZA 4TV1A 5GICA 5SYZA 5L7EA 2PNUA 1OT7A 2QZOA 1XV9B 2Q59A 1XZXX 4G2IA 4ZO1X 1P93A 2ZMHA 3GWXA 5KROA 3E7CA 4IQRA 2QR9A 1YY4A 3ERTA 4RUOX 4X1FA 1XP1A 4XHDA 5H1EA 2R40A 3TKCA 3OMQA 3LBDA 4ITFA 3DCUA 3DR1A 5DWIA 5EITA 1QKUA 2AAXA 3ADTA 3OSWA 4S14A 1X7RA 1SR7A 2GPVA 3L0JA 3HC5A 4IA3A 4JYIA 1I38A 3G0WA 4PP3A 4KZIA 5DUGA 3E00A 3A3ZX 3A9EB 2R6YA 3Q95A 4IV2A 4J26A 4LSJA 5AK2A 4OH5A 3W0JA 3TKMA 1T74A 4OFUA 5G3JA 3AUNA 3FEJA 2B1ZA 5L7GA 2AX7A 5KRCA 1XPCA 1PDUA 3DCTA 2Z4BA 3UU7A 4ZJWA 1YIMA 4IS8A 1FBYA 5KCDA 3KWYA 4PLDA 3AURA 5DXGA 5DI7A 3L03A 5DKBA 5DIGA 3VT5A 3HC6A 2OUZA 5KRJA 3X36A 4EM9A 1YYEA 3OS8A 4ZOMA 2NW4A 1XQ3A 2I4ZA 2G0GA 4S15A 3IPUA 4S0SA 3RUTA 1SQNA 3B68A 1XLSA 4JYGA 3VJHA 5AAVA 4OKXA 2Q7KA 3GYUA 5DUEA 3GBKA 4A2JA 4G1DA 2ZBSA 1R20D 3ET1A 4QM0A 4LNWA 1N83A 4TUZB 3ADVA 3NSQA 5DZ3A 1GWQA 2QSEA 3KMRA 4NUFA 1KNUA 4CI5A 4OKBA 1FCZA 2EWPA 3FS1A 2VV1A 2GWXA 1N46A 3M7RA 3VRTA 2V7CA 1YJEA 1T63A 2J7XA 3ADXA 3OZ0A 4OZTE 1L2JA 5EGVA 5KCFA 4DMAA 5KCEA 5DV6A 4DM8A 1QKNA 1X7JA 1PK5A 1PQ6A 1YINA 5DLRA 1XDKA 2QA8B 3DZYD 4Q50A 5DV8A 5DVSA 3L0EA 1M13A 5G5WA 1ZDTA 4N73A 5DWLA 4TV1B 4G21A 2QZOB 3K22A 3PCUA 5KRHA 1RDTD 1IE8A 5C4UA 5KRMA 3VTDA 2B23A 1FM6A 3EYBA 1XVPA 1FD0A 3R8IA 4XAOA 3R29A 1T7MA 3VRUA 1FM9A 3GYTA 4L96A 1RK3A 3AFRA 1DKFA 4PWLA 5DX3A 5DU5A 4YPQA 3OGTA 3OOKA 2AXAA 2ZFXA 4RUPA 3JZCA 1G1UA 4QL8A 5DVVA 4MGDA 4OZRE 1XJ7A 1NQ1A 5EHJA 3WGPA 1L2IA 5KYJA 1K74A 5LWPA 5B41A 3HZFA 3CQVA 3Q95B 3VT3A 1HJ1A 2JFAA 1X7BA 2ZK1A 5KRLA 2LBDA 1ZAFA 4ZNUA 3X1HA 2P4YA 1T73A 4MGBA 2Q6SA 4QE6A 3UU7B 5KR9A 5KRKA 1UPVA 5C4OA 3A2HA 1MVCA 3AN4A 4OARA 1S9PA 4OEAA 3FXVA 3KBAA 3VI8A 2VV4A 5DTVA 5KCTA 2P7GA 2BJ4A 1BSXA 1T76A 4DK7A 3PEQA 2YLPA 1UPWA 3BQDA 3TY0A 3ZRBA 2ABIA 4IVYA 5DK9A 5DXEA 3VT6A 4ZNTA 2HASA 2OZ7A 4KZMA 5DRMA 1Z5XU 2I0GA 3W0AA 2Q7IA 3F5CB 4ZO1B 2E2RA 2ZKCA 3GZ9A 3R5MA 3WFGA 3IPQA 2Q6JA 2OM9A 5EC9A 5IXKA 5C4TA 2GPPA 4FHHA 4Q13A 5APJA 2H77A 3UUAA 1E3KA 4RAKA 5FQPA 2ZMIA 2HCDA 4IA7A 4OJ4A 2A3IA 4ZN9A 2P54A 2Q61A 2R40D 1NUOA 2ZK0A 5DZHA 4E4KA 5DVCA 5IAWA 2VV1B 4PP6A 2ACLA 2B50A 5KCCA 2YLOA 3ADWA 3KMGA 1Y9RA 4IW6A 3R8AA 4POJA 2G5OA 5AWKA 3WWRA 2AA7A 4MG7A 1ZH7A 3K8SA 4WPFA 3E00D 2PIXA 3OMPA 1X7EA 1XDKB 1Y0SA 2J14A 1NQ0A 2AA2A 5DKGA 5DXRA 3VT9A 3IXPD 3VJIA 2QPYA 2HARA 5E15A 2I0JA 4YT1A 1G2NA 3PBAA 4OLMA 2PINA 4JL4A 2PJLA 4QJRA 5DSHA 5FQTA 1X76A 5GT4A 5JJMA 4PVUA 3OS8C 4RFWA 3OSAA 4BCRA 1XVPB 3P8XA 5KD9A 2Q5SA 1U3RA 5G44A 4KZJA 3D90A 2PIOA 3ET2A 2NXXA 5DX3B 5DZ1A 2ZXNA 1FCXA 4MG5A 3UUDA 1UOMA 2H79A 3B5RA 2G0HA 4A4WA 2HB8A 3VRWA 3UP0A 1XNNA 1T7RA 4X1GA 5G46A 1PZLA 2QNVA 4NB6A 5CJ6A 5E19A 4OC7A 2Q3YA 5DY8A 2QXSA 5E0WA 2YHDA 4ITEA 1S0ZA 2AM9A 5DZIA 4ZI1A 2FVJA 2QABA 2JFAB 4NIEA 4OK1A 4XUHA 5DRJA 3R5NA 5DYDA 1EREA 3W5TA 1OSHA 3PRGA 3V3QA 5A86A 4MGBB 2YLQA 3W0HA 4JAZA 1I37A 2AYRA 3R8DA 3F7DA 2W8YA 3VN2A 2Q7LA 5KRFA 4DM6A 5L7HA 5KCWA 4ZNSA 2VSRA 4J5WA 4N8RA 4R6SA 3K23A 3VRVA 5DXQA 1Y0XX 2OCFA 4FHIA 1H9UA 2VV4B 5AYGA 5GIEA 5HYRA 1A28A 5E14A 1LBDA 1XOWA 2POGA 1GWXA 3R2AA 1GS4A 2AB2A 3OMMA 2GPOA 1G50A 4PP5A 3NOAA 1YP0A 2ZASA 3G8IA 5LGAA 2Q70A 1SKXA 3ADSA 5EI1A 4ZNWA 3UUCA 3LMPA 2Q60A 2ZNQA 3A2JA 4S0TA 3SP9A 4WHFA 2I4PA 4E2JA 4NQAB 3GD2A 1ZDUA 1UHLB 3L1BA 3PLZA 3UUAB 2YJAB 2PIWA 3HO0A 3V3EA 4ZJRA 2P7ZA 3T03A 2Q1VA 1FM6D 4YMQA 4J24A 2J7YA 3L3XA 4E4QA 5HJPA 1FM9D 4XUMA 4WQPA 5M96A 1NHZA 5AAUA 1YOKA 1NDEA 2Q6RA 3P0UA 2ACLB 3MNOA 3P88A 4P6XA 5DKEA 5G45A 2Q59B 3X31A 4RMEA 1S9QA 2VV2A 3D6DA 4RUJA 3KDUA 2PIUA 1K74D 2HVCA 2OVMA 2P15A 4PXMA 3RUUA 1Q4XA 4HEEX 4OH6A 5ICKA 4P6WA 5IZ0A 3VT7A 4OEDA 3NSPA 2XYXA 4RZFA 5AWJA 1NQ7A 2OAXA 4K7AA 5JJMB 3VT8A 4N5GA 2PIPL 2PRGA 3N00A 4IWFA 5DXPA 3OS9A 1I7IA 2B1VA 2G44A 5ETHA 2AWHA 4J5XA 5DXKA 3IA6A 2AA6A 5DYBA 4MDDA 4PPSA 4UDBA 3OOFA 3V49A 2F4BA 3W0YA 1T79A 2FAIA 3UUDB 3B65A 4Q0AC 3AUQA 4WHGA 3B67A 5G43A 5HCVA 4REEA 1XAPA 2V0VA 3OKHA 3A9EA 4UDDA 4EMAA 3RLJA 3W0CA 3H0AA 3A2IA 1ILGA 4MG6A 4Y29A 4IW8A 3VHUA 5B5BA 3CDSA 1XQCA 5AZTA 3CLDA 5L11A 1YMTA 2P7AA 2ZNPA 4OKWA 5FQRA 3WMHA 1PQCA 4FNEA 4REFA 4APUA 1RJKA 2P1VA 3HLVA 1A52A 2ZNNA 3MNPA 1NYXA 2IOGA 3AZ2A 3OAPA 2NV7A 1U3SA 2AX6A 2NXXE 1EXXA 1MZNA 3WFFA 3W5QA 3CS6A 2QH6A 4OILA 4G20A 5AAVB 4ZN7A 3ZRAA 3E94A 5DXMA 3VJTA 3BEJA 1NAXA 1QKTA 3FALA 3U9QA 4OIUA 2ZNOA 3VSPA 2ZLAA 2HB7A 1OVLA 3ET3A 4XI3A 1Z95A 4MGCA 4R2UA 1KKQA 3OKIA 5APKA 2O4RA 2PITA 4RZGA 2ZK6A 5E7VA 4MG9A 3B66A 4ZNVA 3AZ3A 3AZ1A 3IMYA 1I7GA 3V9YA 3MNEA 2QA6A 4OFRA 4IV4A 2Q1HA 5EJVA 2GP7A 5AVIA 5GIDA 1ZEOA 4MG8A 1RKGA 1S0XA 2HWQA 1XLSE 3ERDA 5DWJA 2ZK3A 2ZMJA 4K6IA 4B7WA 1XB7A 3L3ZA 4QK4A 2NPAA 1S19A 2POBA 3G9EA 5HJPB 5DMFA 3CWDA 3ILZA 2XHSA 2AO6A 2ZVTA 4OIVA 1IE9A 3HVLA 4OZTU 2QTUA 1T7FA 3ET0A 4OJBA 2QA8A 2AMAA 3BC5A 3FC6A 1XIUA 3OSIA 5FQVA 3OLLA 3DZUA 4J5WC 1DKFB 3D24A 3WT7A 3WT5A 1E3GA 2GTKA 2ZXZA 4PPPA 1TFCA 4MGDB 2P1UA 1GWRA 4CSJA 3KFCA 2IHQA 3HM1A 1HG4A 1R1KD 2AX9A 2ZK5A 4FGYA 4IU7A 4IUIA 3UVVA 5KRIA 3RY9A 3WTQA 4N1YA 1WM0X 2HWRA 3JZBA 2JJ3A 3SP6A 1RKHA 3DY6A 4OZRU 3KDTA 1R1KA 2I4JA 2J4AA 1OSVA 1T7TA 4G1YA 3B0WA 3GN8A 4IA1A 2BJ4B 2BAWA 3HQ5A 4ONIA 5DP0A 2IOKA 2GL8A 3FALB 3O1EA 2VSTA 1ZGYA 2YFEA 1ZKYA 1Z5XE 3VSOA 3IPSA 4OKTA 4IA2A 2AX8A 2P1TA 1U9EA 4UDAA 5C4SA 2YLYA 4A4VA 1K7LA 5AVLA 2PKLA 5JY3A 2PIQA 3CJWA 5DUHA 2REWA 4ZNHA 4PF3A 5E1CA 2GPUA 3D57A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QT0 A;  3OZJ A;  1NAV A;  1TXI A;  1OVL B;  4K4J A;  1T5Z A;  1DB1 A;  3WJ4 A;  4F9M A;  3F5C A;  5KYA A;  3B0R A;  2O9I A;  2XYJ A;  4J5X C;  4OHA A;  5DKS A;  4MG9 B;  3K6P A;  3V9T A;  4JGV A;  2VV3 A;  2ZXM A;  3FEI A;  3IXP A;  3FUR A;  2YJD A;  2HAM A;  5DXB A;  5F9B A;  5FQS A;  3RVF A;  3AX8 A;  2GIU A;  1R6G A;  4MGA A;  4MG8 B;  4MG7 B;  2Q7J A;  2Z4J A;  2YAT A;  4FN9 A;  2QGT A;  4RZE A;  3RLL A;  3W0I A;  1XP6 A;  1X78 A;  3UP3 A;  3VHW A;  1T65 A;  1XV9 A;  2HFP A;  1K4W A;  4DK8 A;  4POH A;  1R20 A;  2O4J A;  4DOS A;  4DQM A;  3KYT A;  3ADU A;  2PIR A;  1ZUC A;  1R5K A;  3HOD A;  3H0A D;  3FC6 B;  5HYK A;  4M8E A;  4OEY A;  5DWG A;  5HJS A;  5DL4 A;  3AN3 A;  1YA3 A;  2Q5G A;  2QE4 A;  2OVH A;  2QGW A;  2XYW A;  1PCG A;  1PQ9 A;  1MV9 A;  3OMO A;  4WLB A;  3A78 A;  2ZL9 A;  2VV0 A;  2FSZ A;  4NY9 A;  3W5R A;  4LNX A;  5K13 A;  5AZV A;  3VTB A;  3CTB A;  4HLW A;  4RMD A;  2AMB A;  5E0X A;  2XKW A;  3V9V A;  3OMK A;  3DZY A;  4L98 A;  1M2Z A;  2ZY0 A;  5ACC A;  4IWC A;  4RMC A;  1ERR A;  4QE8 A;  4PRG A;  3UVV B;  3S9S A;  3B0Q A;  3V4A A;  1RDT A;  3VTC A;  3H52 A;  1G5Y A;  3ZQT A;  1YUC A;  2HC4 A;  3VHV A;  4O8F A;  5DMC A;  3CS4 A;  4XT9 A;  4R06 A;  1EXA A;  3B1M A;  1N4H A;  3W0G A;  3ZR7 A;  5DIE A;  1U3Q A;  2Q5P A;  4IVW A;  3W5P A;  2ATH A;  4JYH A;  4XLD A;  3KMZ A;  3PO9 A;  1LV2 A;  2Q8S A;  2QXM A;  1ILH A;  3VT4 A;  2ZLC A;  5HZC A;  3X1I A;  3DT3 A;  2HBH A;  3CDP A;  4OGH A;  5APH A;  3WT6 A;  4PLE A;  5KCU A;  4RE8 A;  1KV6 A;  4RWV A;  3OLF A;  5DZ0 A;  4YNK A;  1NRL A;  1SJ0 A;  1NQ2 A;  3OLS A;  4DOR A;  5DID A;  5I4V A;  3SZ1 A;  3G8O A;  4TUZ A;  3FLI A;  4CI4 A;  5DV3 A;  5DWE A;  3B3K A;  4UDC A;  1P8D A;  3D5F A;  4G2H A;  3KPZ A;  2JF9 A;  4OJ9 A;  5G42 A;  3DZU D;  3GWS X;  1FCY A;  1QKM A;  3WJ5 A;  2AA5 A;  3O1D A;  2ZK2 A;  1UHL A;  4XTA A;  2QMV A;  3P89 A;  2PIV A;  3A40 X;  3FUG A;  5JI0 D;  4M8H A;  2R6W A;  2QW4 A;  5DXB B;  4WVD A;  5KRA A;  3B0T A;  3CS8 A;  1VJB A;  4LBD A;  1M7W A;  1YOW A;  1XNX A;  4MGA B;  4G1Z A;  3VJS A;  4LTW A;  3L0L A;  3TX7 B;  1PRG A;  1XP9 A;  2ZK4 A;  4OEZ A;  4TV1 A;  5GIC A;  5SYZ A;  5L7E A;  2PNU A;  1OT7 A;  2QZO A;  1XV9 B;  2Q59 A;  1XZX X;  4G2I A;  4ZO1 X;  1P93 A;  2ZMH A;  3GWX A;  5KRO A;  3E7C A;  4IQR A;  2QR9 A;  1YY4 A;  3ERT A;  4RUO X;  4X1F A;  1XP1 A;  4XHD A;  5H1E A;  2R40 A;  3TKC A;  3OMQ A;  3LBD A;  4ITF A;  3DCU A;  3DR1 A;  5DWI A;  5EIT A;  1QKU A;  2AAX A;  3ADT A;  3OSW A;  4S14 A;  1X7R A;  1SR7 A;  2GPV A;  3L0J A;  3HC5 A;  4IA3 A;  4JYI A;  1I38 A;  3G0W A;  4PP3 A;  4KZI A;  5DUG A;  3E00 A;  3A3Z X;  3A9E B;  2R6Y A;  3Q95 A;  4IV2 A;  4J26 A;  4LSJ A;  5AK2 A;  4OH5 A;  3W0J A;  3TKM A;  1T74 A;  4OFU A;  5G3J A;  3AUN A;  3FEJ A;  2B1Z A;  5L7G A;  2AX7 A;  5KRC A;  1XPC A;  1PDU A;  3DCT A;  2Z4B A;  3UU7 A;  4ZJW A;  1YIM A;  4IS8 A;  1FBY A;  5KCD A;  3KWY A;  4PLD A;  3AUR A;  5DXG A;  5DI7 A;  3L03 A;  5DKB A;  5DIG A;  3VT5 A;  3HC6 A;  2OUZ A;  5KRJ A;  3X36 A;  4EM9 A;  1YYE A;  3OS8 A;  4ZOM A;  2NW4 A;  1XQ3 A;  2I4Z A;  2G0G A;  4S15 A;  3IPU A;  4S0S A;  3RUT A;  1SQN A;  3B68 A;  1XLS A;  4JYG A;  3VJH A;  5AAV A;  4OKX A;  2Q7K A;  3GYU A;  5DUE A;  3GBK A;  4A2J A;  4G1D A;  2ZBS A;  1R20 D;  3ET1 A;  4QM0 A;  4LNW A;  1N83 A;  4TUZ B;  3ADV A;  3NSQ A;  5DZ3 A;  1GWQ A;  2QSE A;  3KMR A;  4NUF A;  1KNU A;  4CI5 A;  4OKB A;  1FCZ A;  2EWP A;  3FS1 A;  2VV1 A;  2GWX A;  1N46 A;  3M7R A;  3VRT A;  2V7C A;  1YJE A;  1T63 A;  2J7X A;  3ADX A;  3OZ0 A;  4OZT E;  1L2J A;  5EGV A;  5KCF A;  4DMA A;  5KCE A;  5DV6 A;  4DM8 A;  1QKN A;  1X7J A;  1PK5 A;  1PQ6 A;  1YIN A;  5DLR A;  1XDK A;  2QA8 B;  3DZY D;  4Q50 A;  5DV8 A;  5DVS A;  3L0E A;  1M13 A;  5G5W A;  1ZDT A;  4N73 A;  5DWL A;  4TV1 B;  4G21 A;  2QZO B;  3K22 A;  3PCU A;  5KRH A;  1RDT D;  1IE8 A;  5C4U A;  5KRM A;  3VTD A;  2B23 A;  1FM6 A;  3EYB A;  1XVP A;  1FD0 A;  3R8I A;  4XAO A;  3R29 A;  1T7M A;  3VRU A;  1FM9 A;  3GYT A;  4L96 A;  1RK3 A;  3AFR A;  1DKF A;  4PWL A;  5DX3 A;  5DU5 A;  4YPQ A;  3OGT A;  3OOK A;  2AXA A;  2ZFX A;  4RUP A;  3JZC A;  1G1U A;  4QL8 A;  5DVV A;  4MGD A;  4OZR E;  1XJ7 A;  1NQ1 A;  5EHJ A;  3WGP A;  1L2I A;  5KYJ A;  1K74 A;  5LWP A;  5B41 A;  3HZF A;  3CQV A;  3Q95 B;  3VT3 A;  1HJ1 A;  2JFA A;  1X7B A;  2ZK1 A;  5KRL A;  2LBD A;  1ZAF A;  4ZNU A;  3X1H A;  2P4Y A;  1T73 A;  4MGB A;  2Q6S A;  4QE6 A;  3UU7 B;  5KR9 A;  5KRK A;  1UPV A;  5C4O A;  3A2H A;  1MVC A;  3AN4 A;  4OAR A;  1S9P A;  4OEA A;  3FXV A;  3KBA A;  3VI8 A;  2VV4 A;  5DTV A;  5KCT A;  2P7G A;  2BJ4 A;  1BSX A;  1T76 A;  4DK7 A;  3PEQ A;  2YLP A;  1UPW A;  3BQD A;  3TY0 A;  3ZRB A;  2ABI A;  4IVY A;  5DK9 A;  5DXE A;  3VT6 A;  4ZNT A;  2HAS A;  2OZ7 A;  4KZM A;  5DRM A;  1Z5X U;  2I0G A;  3W0A A;  2Q7I A;  3F5C B;  4ZO1 B;  2E2R A;  2ZKC A;  3GZ9 A;  3R5M A;  3WFG A;  3IPQ A;  2Q6J A;  2OM9 A;  5EC9 A;  5IXK A;  5C4T A;  2GPP A;  4FHH A;  4Q13 A;  5APJ A;  2H77 A;  3UUA A;  1E3K A;  4RAK A;  5FQP A;  2ZMI A;  2HCD A;  4IA7 A;  4OJ4 A;  2A3I A;  4ZN9 A;  2P54 A;  2Q61 A;  2R40 D;  1NUO A;  2ZK0 A;  5DZH A;  4E4K A;  5DVC A;  5IAW A;  2VV1 B;  4PP6 A;  2ACL A;  2B50 A;  5KCC A;  2YLO A;  3ADW A;  3KMG A;  1Y9R A;  4IW6 A;  3R8A A;  4POJ A;  2G5O A;  5AWK A;  3WWR A;  2AA7 A;  4MG7 A;  1ZH7 A;  3K8S A;  4WPF A;  3E00 D;  2PIX A;  3OMP A;  1X7E A;  1XDK B;  1Y0S A;  2J14 A;  1NQ0 A;  2AA2 A;  5DKG A;  5DXR A;  3VT9 A;  3IXP D;  3VJI A;  2QPY A;  2HAR A;  5E15 A;  2I0J A;  4YT1 A;  1G2N A;  3PBA A;  4OLM A;  2PIN A;  4JL4 A;  2PJL A;  4QJR A;  5DSH A;  5FQT A;  1X76 A;  5GT4 A;  5JJM A;  4PVU A;  3OS8 C;  4RFW A;  3OSA A;  4BCR A;  1XVP B;  3P8X A;  5KD9 A;  2Q5S A;  1U3R A;  5G44 A;  4KZJ A;  3D90 A;  2PIO A;  3ET2 A;  2NXX A;  5DX3 B;  5DZ1 A;  2ZXN A;  1FCX A;  4MG5 A;  3UUD A;  1UOM A;  2H79 A;  3B5R A;  2G0H A;  4A4W A;  2HB8 A;  3VRW A;  3UP0 A;  1XNN A;  1T7R A;  4X1G A;  5G46 A;  1PZL A;  2QNV A;  4NB6 A;  5CJ6 A;  5E19 A;  4OC7 A;  2Q3Y A;  5DY8 A;  2QXS A;  5E0W A;  2YHD A;  4ITE A;  1S0Z A;  2AM9 A;  5DZI A;  4ZI1 A;  2FVJ A;  2QAB A;  2JFA B;  4NIE A;  4OK1 A;  4XUH A;  5DRJ A;  3R5N A;  5DYD A;  1ERE A;  3W5T A;  1OSH A;  3PRG A;  3V3Q A;  5A86 A;  4MGB B;  2YLQ A;  3W0H A;  4JAZ A;  1I37 A;  2AYR A;  3R8D A;  3F7D A;  2W8Y A;  3VN2 A;  2Q7L A;  5KRF A;  4DM6 A;  5L7H A;  5KCW A;  4ZNS A;  2VSR A;  4J5W A;  4N8R A;  4R6S A;  3K23 A;  3VRV A;  5DXQ A;  1Y0X X;  2OCF A;  4FHI A;  1H9U A;  2VV4 B;  5AYG A;  5GIE A;  5HYR A;  1A28 A;  5E14 A;  1LBD A;  1XOW A;  2POG A;  1GWX A;  3R2A A;  1GS4 A;  2AB2 A;  3OMM A;  2GPO A;  1G50 A;  4PP5 A;  3NOA A;  1YP0 A;  2ZAS A;  3G8I A;  5LGA A;  2Q70 A;  1SKX A;  3ADS A;  5EI1 A;  4ZNW A;  3UUC A;  3LMP A;  2Q60 A;  2ZNQ A;  3A2J A;  4S0T A;  3SP9 A;  4WHF A;  2I4P A;  4E2J A;  4NQA B;  3GD2 A;  1ZDU A;  1UHL B;  3L1B A;  3PLZ A;  3UUA B;  2YJA B;  2PIW A;  3HO0 A;  3V3E A;  4ZJR A;  2P7Z A;  3T03 A;  2Q1V A;  1FM6 D;  4YMQ A;  4J24 A;  2J7Y A;  3L3X A;  4E4Q A;  5HJP A;  1FM9 D;  4XUM A;  4WQP A;  5M96 A;  1NHZ A;  5AAU A;  1YOK A;  1NDE A;  2Q6R A;  3P0U A;  2ACL B;  3MNO A;  3P88 A;  4P6X A;  5DKE A;  5G45 A;  2Q59 B;  3X31 A;  4RME A;  1S9Q A;  2VV2 A;  3D6D A;  4RUJ A;  3KDU A;  2PIU A;  1K74 D;  2HVC A;  2OVM A;  2P15 A;  4PXM A;  3RUU A;  1Q4X A;  4HEE X;  4OH6 A;  5ICK A;  4P6W A;  5IZ0 A;  3VT7 A;  4OED A;  3NSP A;  2XYX A;  4RZF A;  5AWJ A;  1NQ7 A;  2OAX A;  4K7A A;  5JJM B;  3VT8 A;  4N5G A;  2PIP L;  2PRG A;  3N00 A;  4IWF A;  5DXP A;  3OS9 A;  1I7I A;  2B1V A;  2G44 A;  5ETH A;  2AWH A;  4J5X A;  5DXK A;  3IA6 A;  2AA6 A;  5DYB A;  4MDD A;  4PPS A;  4UDB A;  3OOF A;  3V49 A;  2F4B A;  3W0Y A;  1T79 A;  2FAI A;  3UUD B;  3B65 A;  4Q0A C;  3AUQ A;  4WHG A;  3B67 A;  5G43 A;  5HCV A;  4REE A;  1XAP A;  2V0V A;  3OKH A;  3A9E A;  4UDD A;  4EMA A;  3RLJ A;  3W0C A;  3H0A A;  3A2I A;  1ILG A;  4MG6 A;  4Y29 A;  4IW8 A;  3VHU A;  5B5B A;  3CDS A;  1XQC A;  5AZT A;  3CLD A;  5L11 A;  1YMT A;  2P7A A;  2ZNP A;  4OKW A;  5FQR A;  3WMH A;  1PQC A;  4FNE A;  4REF A;  4APU A;  1RJK A;  2P1V A;  3HLV A;  1A52 A;  2ZNN A;  3MNP A;  1NYX A;  2IOG A;  3AZ2 A;  3OAP A;  2NV7 A;  1U3S A;  2AX6 A;  2NXX E;  1EXX A;  1MZN A;  3WFF A;  3W5Q A;  3CS6 A;  2QH6 A;  4OIL A;  4G20 A;  5AAV B;  4ZN7 A;  3ZRA A;  3E94 A;  5DXM A;  3VJT A;  3BEJ A;  1NAX A;  1QKT A;  3FAL A;  3U9Q A;  4OIU A;  2ZNO A;  3VSP A;  2ZLA A;  2HB7 A;  1OVL A;  3ET3 A;  4XI3 A;  1Z95 A;  4MGC A;  4R2U A;  1KKQ A;  3OKI A;  5APK A;  2O4R A;  2PIT A;  4RZG A;  2ZK6 A;  5E7V A;  4MG9 A;  3B66 A;  4ZNV A;  3AZ3 A;  3AZ1 A;  3IMY A;  1I7G A;  3V9Y A;  3MNE A;  2QA6 A;  4OFR A;  4IV4 A;  2Q1H A;  5EJV A;  2GP7 A;  5AVI A;  5GID A;  1ZEO A;  4MG8 A;  1RKG A;  1S0X A;  2HWQ A;  1XLS E;  3ERD A;  5DWJ A;  2ZK3 A;  2ZMJ A;  4K6I A;  4B7W A;  1XB7 A;  3L3Z A;  4QK4 A;  2NPA A;  1S19 A;  2POB A;  3G9E A;  5HJP B;  5DMF A;  3CWD A;  3ILZ A;  2XHS A;  2AO6 A;  2ZVT A;  4OIV A;  1IE9 A;  3HVL A;  4OZT U;  2QTU A;  1T7F A;  3ET0 A;  4OJB A;  2QA8 A;  2AMA A;  3BC5 A;  3FC6 A;  1XIU A;  3OSI A;  5FQV A;  3OLL A;  3DZU A;  4J5W C;  1DKF B;  3D24 A;  3WT7 A;  3WT5 A;  1E3G A;  2GTK A;  2ZXZ A;  4PPP A;  1TFC A;  4MGD B;  2P1U A;  1GWR A;  4CSJ A;  3KFC A;  2IHQ A;  3HM1 A;  1HG4 A;  1R1K D;  2AX9 A;  2ZK5 A;  4FGY A;  4IU7 A;  4IUI A;  3UVV A;  5KRI A;  3RY9 A;  3WTQ A;  4N1Y A;  1WM0 X;  2HWR A;  3JZB A;  2JJ3 A;  3SP6 A;  1RKH A;  3DY6 A;  4OZR U;  3KDT A;  1R1K A;  2I4J A;  2J4A A;  1OSV A;  1T7T A;  4G1Y A;  3B0W A;  3GN8 A;  4IA1 A;  2BJ4 B;  2BAW A;  3HQ5 A;  4ONI A;  5DP0 A;  2IOK A;  2GL8 A;  3FAL B;  3O1E A;  2VST A;  1ZGY A;  2YFE A;  1ZKY A;  1Z5X E;  3VSO A;  3IPS A;  4OKT A;  4IA2 A;  2AX8 A;  2P1T A;  1U9E A;  4UDA A;  5C4S A;  2YLY A;  4A4V A;  1K7L A;  5AVL A;  2PKL A;  5JY3 A;  2PIQ A;  3CJW A;  5DUH A;  2REW A;  4ZNH A;  4PF3 A;  5E1C A;  2GPU A;  3D57 A; 
#chains in the Genus database with same CATH topology
 3QT0 A;  3OZJ A;  1NAV A;  1TXI A;  1OVL B;  4K4J A;  1T5Z A;  1DB1 A;  3WJ4 A;  4F9M A;  3F5C A;  5KYA A;  3B0R A;  2O9I A;  2XYJ A;  4J5X C;  4OHA A;  5DKS A;  4MG9 B;  3K6P A;  3V9T A;  4JGV A;  2VV3 A;  2ZXM A;  3FEI A;  3IXP A;  3FUR A;  2YJD A;  2HAM A;  5DXB A;  5F9B A;  5FQS A;  3RVF A;  3AX8 A;  2GIU A;  1R6G A;  4MGA A;  4MG8 B;  4MG7 B;  2Q7J A;  2Z4J A;  2YAT A;  4FN9 A;  2QGT A;  4RZE A;  3RLL A;  3W0I A;  1XP6 A;  1X78 A;  3UP3 A;  3VHW A;  1T65 A;  1XV9 A;  2HFP A;  1K4W A;  4DK8 A;  4POH A;  1R20 A;  2O4J A;  4DOS A;  4DQM A;  3KYT A;  3ADU A;  2PIR A;  1ZUC A;  1R5K A;  3HOD A;  3H0A D;  3FC6 B;  5HYK A;  4M8E A;  4OEY A;  5DWG A;  5HJS A;  5DL4 A;  3AN3 A;  1YA3 A;  2Q5G A;  2QE4 A;  2OVH A;  2QGW A;  2XYW A;  1PCG A;  1PQ9 A;  1MV9 A;  3OMO A;  4WLB A;  3A78 A;  2ZL9 A;  2VV0 A;  2FSZ A;  4NY9 A;  3W5R A;  4LNX A;  5K13 A;  5AZV A;  3VTB A;  3CTB A;  4HLW A;  4RMD A;  2AMB A;  5E0X A;  2XKW A;  3V9V A;  3OMK A;  3DZY A;  4L98 A;  1M2Z A;  2ZY0 A;  5ACC A;  4IWC A;  4RMC A;  1ERR A;  4QE8 A;  4PRG A;  3UVV B;  3S9S A;  3B0Q A;  3V4A A;  1RDT A;  3VTC A;  3H52 A;  1G5Y A;  3ZQT A;  1YUC A;  2HC4 A;  3VHV A;  4O8F A;  5DMC A;  3CS4 A;  4XT9 A;  4R06 A;  1EXA A;  3B1M A;  1N4H A;  3W0G A;  3ZR7 A;  5DIE A;  1U3Q A;  2Q5P A;  4IVW A;  3W5P A;  2ATH A;  4JYH A;  4XLD A;  3KMZ A;  3PO9 A;  1LV2 A;  2Q8S A;  2QXM A;  1ILH A;  3VT4 A;  2ZLC A;  5HZC A;  3X1I A;  3DT3 A;  2HBH A;  3CDP A;  4OGH A;  5APH A;  3WT6 A;  4PLE A;  5KCU A;  4RE8 A;  1KV6 A;  4RWV A;  3OLF A;  5DZ0 A;  4YNK A;  1NRL A;  1SJ0 A;  1NQ2 A;  3OLS A;  4DOR A;  5DID A;  5I4V A;  3SZ1 A;  3G8O A;  4TUZ A;  3FLI A;  4CI4 A;  5DV3 A;  5DWE A;  3B3K A;  4UDC A;  1P8D A;  3D5F A;  4G2H A;  3KPZ A;  2JF9 A;  4OJ9 A;  5G42 A;  3DZU D;  3GWS X;  1FCY A;  1QKM A;  3WJ5 A;  2AA5 A;  3O1D A;  2ZK2 A;  1UHL A;  4XTA A;  2QMV A;  3P89 A;  2PIV A;  3A40 X;  3FUG A;  5JI0 D;  4M8H A;  2R6W A;  2QW4 A;  5DXB B;  4WVD A;  5KRA A;  3B0T A;  3CS8 A;  1VJB A;  4LBD A;  1M7W A;  1YOW A;  1XNX A;  4MGA B;  4G1Z A;  3VJS A;  4LTW A;  3L0L A;  3TX7 B;  1PRG A;  1XP9 A;  2ZK4 A;  4OEZ A;  4TV1 A;  5GIC A;  5SYZ A;  5L7E A;  2PNU A;  1OT7 A;  2QZO A;  1XV9 B;  2Q59 A;  1XZX X;  4G2I A;  4ZO1 X;  1P93 A;  2ZMH A;  3GWX A;  5KRO A;  3E7C A;  4IQR A;  2QR9 A;  1YY4 A;  3ERT A;  4RUO X;  4X1F A;  1XP1 A;  4XHD A;  5H1E A;  2R40 A;  3TKC A;  3OMQ A;  3LBD A;  4ITF A;  3DCU A;  3DR1 A;  5DWI A;  5EIT A;  1QKU A;  2AAX A;  3ADT A;  3OSW A;  4S14 A;  1X7R A;  1SR7 A;  2GPV A;  3L0J A;  3HC5 A;  4IA3 A;  4JYI A;  1I38 A;  3G0W A;  4PP3 A;  4KZI A;  5DUG A;  3E00 A;  3A3Z X;  3A9E B;  2R6Y A;  3Q95 A;  4IV2 A;  4J26 A;  4LSJ A;  5AK2 A;  4OH5 A;  3W0J A;  3TKM A;  1T74 A;  4OFU A;  5G3J A;  3AUN A;  3FEJ A;  2B1Z A;  5L7G A;  2AX7 A;  5KRC A;  1XPC A;  1PDU A;  3DCT A;  2Z4B A;  3UU7 A;  4ZJW A;  1YIM A;  4IS8 A;  1FBY A;  5KCD A;  3KWY A;  4PLD A;  3AUR A;  5DXG A;  5DI7 A;  3L03 A;  5DKB A;  5DIG A;  3VT5 A;  3HC6 A;  2OUZ A;  5KRJ A;  3X36 A;  4EM9 A;  1YYE A;  3OS8 A;  4ZOM A;  2NW4 A;  1XQ3 A;  2I4Z A;  2G0G A;  4S15 A;  3IPU A;  4S0S A;  3RUT A;  1SQN A;  3B68 A;  1XLS A;  4JYG A;  3VJH A;  5AAV A;  4OKX A;  2Q7K A;  3GYU A;  5DUE A;  3GBK A;  4A2J A;  4G1D A;  2ZBS A;  1R20 D;  3ET1 A;  4QM0 A;  4LNW A;  1N83 A;  4TUZ B;  3ADV A;  3NSQ A;  5DZ3 A;  1GWQ A;  2QSE A;  3KMR A;  4NUF A;  1KNU A;  4CI5 A;  4OKB A;  1FCZ A;  2EWP A;  3FS1 A;  2VV1 A;  2GWX A;  1N46 A;  3M7R A;  3VRT A;  2V7C A;  1YJE A;  1T63 A;  2J7X A;  3ADX A;  3OZ0 A;  4OZT E;  1L2J A;  5EGV A;  5KCF A;  4DMA A;  5KCE A;  5DV6 A;  4DM8 A;  1QKN A;  1X7J A;  1PK5 A;  1PQ6 A;  1YIN A;  5DLR A;  1XDK A;  2QA8 B;  3DZY D;  4Q50 A;  5DV8 A;  5DVS A;  3L0E A;  1M13 A;  5G5W A;  1ZDT A;  4N73 A;  5DWL A;  4TV1 B;  4G21 A;  2QZO B;  3K22 A;  3PCU A;  5KRH A;  1RDT D;  1IE8 A;  5C4U A;  5KRM A;  3VTD A;  2B23 A;  1FM6 A;  3EYB A;  1XVP A;  1FD0 A;  3R8I A;  4XAO A;  3R29 A;  1T7M A;  3VRU A;  1FM9 A;  3GYT A;  4L96 A;  1RK3 A;  3AFR A;  1DKF A;  4PWL A;  5DX3 A;  5DU5 A;  4YPQ A;  3OGT A;  3OOK A;  2AXA A;  2ZFX A;  4RUP A;  3JZC A;  1G1U A;  4QL8 A;  5DVV A;  4MGD A;  4OZR E;  1XJ7 A;  1NQ1 A;  5EHJ A;  3WGP A;  1L2I A;  5KYJ A;  1K74 A;  5LWP A;  5B41 A;  3HZF A;  3CQV A;  3Q95 B;  3VT3 A;  1HJ1 A;  2JFA A;  1X7B A;  2ZK1 A;  5KRL A;  2LBD A;  1ZAF A;  4ZNU A;  3X1H A;  2P4Y A;  1T73 A;  4MGB A;  2Q6S A;  4QE6 A;  3UU7 B;  5KR9 A;  5KRK A;  1UPV A;  5C4O A;  3A2H A;  1MVC A;  3AN4 A;  4OAR A;  1S9P A;  4OEA A;  3FXV A;  3KBA A;  3VI8 A;  2VV4 A;  5DTV A;  5KCT A;  2P7G A;  2BJ4 A;  1BSX A;  1T76 A;  4DK7 A;  3PEQ A;  2YLP A;  1UPW A;  3BQD A;  3TY0 A;  3ZRB A;  2ABI A;  4IVY A;  5DK9 A;  5DXE A;  3VT6 A;  4ZNT A;  2HAS A;  2OZ7 A;  4KZM A;  5DRM A;  1Z5X U;  2I0G A;  3W0A A;  2Q7I A;  3F5C B;  4ZO1 B;  2E2R A;  2ZKC A;  3GZ9 A;  3R5M A;  3WFG A;  3IPQ A;  2Q6J A;  2OM9 A;  5EC9 A;  5IXK A;  5C4T A;  2GPP A;  4FHH A;  4Q13 A;  5APJ A;  2H77 A;  3UUA A;  1E3K A;  4RAK A;  5FQP A;  2ZMI A;  2HCD A;  4IA7 A;  4OJ4 A;  2A3I A;  4ZN9 A;  2P54 A;  2Q61 A;  2R40 D;  1NUO A;  2ZK0 A;  5DZH A;  4E4K A;  5DVC A;  5IAW A;  2VV1 B;  4PP6 A;  2ACL A;  2B50 A;  5KCC A;  2YLO A;  3ADW A;  3KMG A;  1Y9R A;  4IW6 A;  3R8A A;  4POJ A;  2G5O A;  5AWK A;  3WWR A;  2AA7 A;  4MG7 A;  1ZH7 A;  3K8S A;  4WPF A;  3E00 D;  2PIX A;  3OMP A;  1X7E A;  1XDK B;  1Y0S A;  2J14 A;  1NQ0 A;  2AA2 A;  5DKG A;  5DXR A;  3VT9 A;  3IXP D;  3VJI A;  2QPY A;  2HAR A;  5E15 A;  2I0J A;  4YT1 A;  1G2N A;  3PBA A;  4OLM A;  2PIN A;  4JL4 A;  2PJL A;  4QJR A;  5DSH A;  5FQT A;  1X76 A;  5GT4 A;  5JJM A;  4PVU A;  3OS8 C;  4RFW A;  3OSA A;  4BCR A;  1XVP B;  3P8X A;  5KD9 A;  2Q5S A;  1U3R A;  5G44 A;  4KZJ A;  3D90 A;  2PIO A;  3ET2 A;  2NXX A;  5DX3 B;  5DZ1 A;  2ZXN A;  1FCX A;  4MG5 A;  3UUD A;  1UOM A;  2H79 A;  3B5R A;  2G0H A;  4A4W A;  2HB8 A;  3VRW A;  3UP0 A;  1XNN A;  1T7R A;  4X1G A;  5G46 A;  1PZL A;  2QNV A;  4NB6 A;  5CJ6 A;  5E19 A;  4OC7 A;  2Q3Y A;  5DY8 A;  2QXS A;  5E0W A;  2YHD A;  4ITE A;  1S0Z A;  2AM9 A;  5DZI A;  4ZI1 A;  2FVJ A;  2QAB A;  2JFA B;  4NIE A;  4OK1 A;  4XUH A;  5DRJ A;  3R5N A;  5DYD A;  1ERE A;  3W5T A;  1OSH A;  3PRG A;  3V3Q A;  5A86 A;  4MGB B;  2YLQ A;  3W0H A;  4JAZ A;  1I37 A;  2AYR A;  3R8D A;  3F7D A;  2W8Y A;  3VN2 A;  2Q7L A;  5KRF A;  4DM6 A;  5L7H A;  5KCW A;  4ZNS A;  2VSR A;  4J5W A;  4N8R A;  4R6S A;  3K23 A;  3VRV A;  5DXQ A;  1Y0X X;  2OCF A;  4FHI A;  1H9U A;  2VV4 B;  5AYG A;  5GIE A;  5HYR A;  1A28 A;  5E14 A;  1LBD A;  1XOW A;  2POG A;  1GWX A;  3R2A A;  1GS4 A;  2AB2 A;  3OMM A;  2GPO A;  1G50 A;  4PP5 A;  3NOA A;  1YP0 A;  2ZAS A;  3G8I A;  5LGA A;  2Q70 A;  1SKX A;  3ADS A;  5EI1 A;  4ZNW A;  3UUC A;  3LMP A;  2Q60 A;  2ZNQ A;  3A2J A;  4S0T A;  3SP9 A;  4WHF A;  2I4P A;  4E2J A;  4NQA B;  3GD2 A;  1ZDU A;  1UHL B;  3L1B A;  3PLZ A;  3UUA B;  2YJA B;  2PIW A;  3HO0 A;  3V3E A;  4ZJR A;  2P7Z A;  3T03 A;  2Q1V A;  1FM6 D;  4YMQ A;  4J24 A;  2J7Y A;  3L3X A;  4E4Q A;  5HJP A;  1FM9 D;  4XUM A;  4WQP A;  5M96 A;  1NHZ A;  5AAU A;  1YOK A;  1NDE A;  2Q6R A;  3P0U A;  2ACL B;  3MNO A;  3P88 A;  4P6X A;  5DKE A;  5G45 A;  2Q59 B;  3X31 A;  4RME A;  1S9Q A;  2VV2 A;  3D6D A;  4RUJ A;  3KDU A;  2PIU A;  1K74 D;  2HVC A;  2OVM A;  2P15 A;  4PXM A;  3RUU A;  1Q4X A;  4HEE X;  4OH6 A;  5ICK A;  4P6W A;  5IZ0 A;  3VT7 A;  4OED A;  3NSP A;  2XYX A;  4RZF A;  5AWJ A;  1NQ7 A;  2OAX A;  4K7A A;  5JJM B;  3VT8 A;  4N5G A;  2PIP L;  2PRG A;  3N00 A;  4IWF A;  5DXP A;  3OS9 A;  1I7I A;  2B1V A;  2G44 A;  5ETH A;  2AWH A;  4J5X A;  5DXK A;  3IA6 A;  2AA6 A;  5DYB A;  4MDD A;  4PPS A;  4UDB A;  3OOF A;  3V49 A;  2F4B A;  3W0Y A;  1T79 A;  2FAI A;  3UUD B;  3B65 A;  4Q0A C;  3AUQ A;  4WHG A;  3B67 A;  5G43 A;  5HCV A;  4REE A;  1XAP A;  2V0V A;  3OKH A;  3A9E A;  4UDD A;  4EMA A;  3RLJ A;  3W0C A;  3H0A A;  3A2I A;  1ILG A;  4MG6 A;  4Y29 A;  4IW8 A;  3VHU A;  5B5B A;  3CDS A;  1XQC A;  5AZT A;  3CLD A;  5L11 A;  1YMT A;  2P7A A;  2ZNP A;  4OKW A;  5FQR A;  3WMH A;  1PQC A;  4FNE A;  4REF A;  4APU A;  1RJK A;  2P1V A;  3HLV A;  1A52 A;  2ZNN A;  3MNP A;  1NYX A;  2IOG A;  3AZ2 A;  3OAP A;  2NV7 A;  1U3S A;  2AX6 A;  2NXX E;  1EXX A;  1MZN A;  3WFF A;  3W5Q A;  3CS6 A;  2QH6 A;  4OIL A;  4G20 A;  5AAV B;  4ZN7 A;  3ZRA A;  3E94 A;  5DXM A;  3VJT A;  3BEJ A;  1NAX A;  1QKT A;  3FAL A;  3U9Q A;  4OIU A;  2ZNO A;  3VSP A;  2ZLA A;  2HB7 A;  1OVL A;  3ET3 A;  4XI3 A;  1Z95 A;  4MGC A;  4R2U A;  1KKQ A;  3OKI A;  5APK A;  2O4R A;  2PIT A;  4RZG A;  2ZK6 A;  5E7V A;  4MG9 A;  3B66 A;  4ZNV A;  3AZ3 A;  3AZ1 A;  3IMY A;  1I7G A;  3V9Y A;  3MNE A;  2QA6 A;  4OFR A;  4IV4 A;  2Q1H A;  5EJV A;  2GP7 A;  5AVI A;  5GID A;  1ZEO A;  4MG8 A;  1RKG A;  1S0X A;  2HWQ A;  1XLS E;  3ERD A;  5DWJ A;  2ZK3 A;  2ZMJ A;  4K6I A;  4B7W A;  1XB7 A;  3L3Z A;  4QK4 A;  2NPA A;  1S19 A;  2POB A;  3G9E A;  5HJP B;  5DMF A;  3CWD A;  3ILZ A;  2XHS A;  2AO6 A;  2ZVT A;  4OIV A;  1IE9 A;  3HVL A;  4OZT U;  2QTU A;  1T7F A;  3ET0 A;  4OJB A;  2QA8 A;  2AMA A;  3BC5 A;  3FC6 A;  1XIU A;  3OSI A;  5FQV A;  3OLL A;  3DZU A;  4J5W C;  1DKF B;  3D24 A;  3WT7 A;  3WT5 A;  1E3G A;  2GTK A;  2ZXZ A;  4PPP A;  1TFC A;  4MGD B;  2P1U A;  1GWR A;  4CSJ A;  3KFC A;  2IHQ A;  3HM1 A;  1HG4 A;  1R1K D;  2AX9 A;  2ZK5 A;  4FGY A;  4IU7 A;  4IUI A;  3UVV A;  5KRI A;  3RY9 A;  3WTQ A;  4N1Y A;  1WM0 X;  2HWR A;  3JZB A;  2JJ3 A;  3SP6 A;  1RKH A;  3DY6 A;  4OZR U;  3KDT A;  1R1K A;  2I4J A;  2J4A A;  1OSV A;  1T7T A;  4G1Y A;  3B0W A;  3GN8 A;  4IA1 A;  2BJ4 B;  2BAW A;  3HQ5 A;  4ONI A;  5DP0 A;  2IOK A;  2GL8 A;  3FAL B;  3O1E A;  2VST A;  1ZGY A;  2YFE A;  1ZKY A;  1Z5X E;  3VSO A;  3IPS A;  4OKT A;  4IA2 A;  2AX8 A;  2P1T A;  1U9E A;  4UDA A;  5C4S A;  2YLY A;  4A4V A;  1K7L A;  5AVL A;  2PKL A;  5JY3 A;  2PIQ A;  3CJW A;  5DUH A;  2REW A;  4ZNH A;  4PF3 A;  5E1C A;  2GPU A;  3D57 A; 
#chains in the Genus database with same CATH homology
 3QT0 A;  3OZJ A;  1NAV A;  1TXI A;  1OVL B;  4K4J A;  1T5Z A;  1DB1 A;  3WJ4 A;  4F9M A;  3F5C A;  5KYA A;  3B0R A;  2O9I A;  2XYJ A;  4J5X C;  4OHA A;  5DKS A;  4MG9 B;  3K6P A;  3V9T A;  4JGV A;  2VV3 A;  2ZXM A;  3FEI A;  3IXP A;  3FUR A;  2YJD A;  2HAM A;  5DXB A;  5F9B A;  5FQS A;  3RVF A;  3AX8 A;  2GIU A;  1R6G A;  4MGA A;  4MG8 B;  4MG7 B;  2Q7J A;  2Z4J A;  2YAT A;  4FN9 A;  2QGT A;  4RZE A;  3RLL A;  3W0I A;  1XP6 A;  1X78 A;  3UP3 A;  3VHW A;  1T65 A;  1XV9 A;  2HFP A;  1K4W A;  4DK8 A;  4POH A;  1R20 A;  2O4J A;  4DOS A;  4DQM A;  3KYT A;  3ADU A;  2PIR A;  1ZUC A;  1R5K A;  3HOD A;  3H0A D;  3FC6 B;  5HYK A;  4M8E A;  4OEY A;  5DWG A;  5HJS A;  5DL4 A;  3AN3 A;  1YA3 A;  2Q5G A;  2QE4 A;  2OVH A;  2QGW A;  2XYW A;  1PCG A;  1PQ9 A;  1MV9 A;  3OMO A;  4WLB A;  3A78 A;  2ZL9 A;  2VV0 A;  2FSZ A;  4NY9 A;  3W5R A;  4LNX A;  5K13 A;  5AZV A;  3VTB A;  3CTB A;  4HLW A;  4RMD A;  2AMB A;  5E0X A;  2XKW A;  3V9V A;  3OMK A;  3DZY A;  4L98 A;  1M2Z A;  2ZY0 A;  5ACC A;  4IWC A;  4RMC A;  1ERR A;  4QE8 A;  4PRG A;  3UVV B;  3S9S A;  3B0Q A;  3V4A A;  1RDT A;  3VTC A;  3H52 A;  1G5Y A;  3ZQT A;  1YUC A;  2HC4 A;  3VHV A;  4O8F A;  5DMC A;  3CS4 A;  4XT9 A;  4R06 A;  1EXA A;  3B1M A;  1N4H A;  3W0G A;  3ZR7 A;  5DIE A;  1U3Q A;  2Q5P A;  4IVW A;  3W5P A;  2ATH A;  4JYH A;  4XLD A;  3KMZ A;  3PO9 A;  1LV2 A;  2Q8S A;  2QXM A;  1ILH A;  3VT4 A;  2ZLC A;  5HZC A;  3X1I A;  3DT3 A;  2HBH A;  3CDP A;  4OGH A;  5APH A;  3WT6 A;  4PLE A;  5KCU A;  4RE8 A;  1KV6 A;  4RWV A;  3OLF A;  5DZ0 A;  4YNK A;  1NRL A;  1SJ0 A;  1NQ2 A;  3OLS A;  4DOR A;  5DID A;  5I4V A;  3SZ1 A;  3G8O A;  4TUZ A;  3FLI A;  4CI4 A;  5DV3 A;  5DWE A;  3B3K A;  4UDC A;  1P8D A;  3D5F A;  4G2H A;  3KPZ A;  2JF9 A;  4OJ9 A;  5G42 A;  3DZU D;  3GWS X;  1FCY A;  1QKM A;  3WJ5 A;  2AA5 A;  3O1D A;  2ZK2 A;  1UHL A;  4XTA A;  2QMV A;  3P89 A;  2PIV A;  3A40 X;  3FUG A;  5JI0 D;  4M8H A;  2R6W A;  2QW4 A;  5DXB B;  4WVD A;  5KRA A;  3B0T A;  3CS8 A;  1VJB A;  4LBD A;  1M7W A;  1YOW A;  1XNX A;  4MGA B;  4G1Z A;  3VJS A;  4LTW A;  3L0L A;  3TX7 B;  1PRG A;  1XP9 A;  2ZK4 A;  4OEZ A;  4TV1 A;  5GIC A;  5SYZ A;  5L7E A;  2PNU A;  1OT7 A;  2QZO A;  1XV9 B;  2Q59 A;  1XZX X;  4G2I A;  4ZO1 X;  1P93 A;  2ZMH A;  3GWX A;  5KRO A;  3E7C A;  4IQR A;  2QR9 A;  1YY4 A;  3ERT A;  4RUO X;  4X1F A;  1XP1 A;  4XHD A;  5H1E A;  2R40 A;  3TKC A;  3OMQ A;  3LBD A;  4ITF A;  3DCU A;  3DR1 A;  5DWI A;  5EIT A;  1QKU A;  2AAX A;  3ADT A;  3OSW A;  4S14 A;  1X7R A;  1SR7 A;  2GPV A;  3L0J A;  3HC5 A;  4IA3 A;  4JYI A;  1I38 A;  3G0W A;  4PP3 A;  4KZI A;  5DUG A;  3E00 A;  3A3Z X;  3A9E B;  2R6Y A;  3Q95 A;  4IV2 A;  4J26 A;  4LSJ A;  5AK2 A;  4OH5 A;  3W0J A;  3TKM A;  1T74 A;  4OFU A;  5G3J A;  3AUN A;  3FEJ A;  2B1Z A;  5L7G A;  2AX7 A;  5KRC A;  1XPC A;  1PDU A;  3DCT A;  2Z4B A;  3UU7 A;  4ZJW A;  1YIM A;  4IS8 A;  1FBY A;  5KCD A;  3KWY A;  4PLD A;  3AUR A;  5DXG A;  5DI7 A;  3L03 A;  5DKB A;  5DIG A;  3VT5 A;  3HC6 A;  2OUZ A;  5KRJ A;  3X36 A;  4EM9 A;  1YYE A;  3OS8 A;  4ZOM A;  2NW4 A;  1XQ3 A;  2I4Z A;  2G0G A;  4S15 A;  3IPU A;  4S0S A;  3RUT A;  1SQN A;  3B68 A;  1XLS A;  4JYG A;  3VJH A;  5AAV A;  4OKX A;  2Q7K A;  3GYU A;  5DUE A;  3GBK A;  4A2J A;  4G1D A;  2ZBS A;  1R20 D;  3ET1 A;  4QM0 A;  4LNW A;  1N83 A;  4TUZ B;  3ADV A;  3NSQ A;  5DZ3 A;  1GWQ A;  2QSE A;  3KMR A;  4NUF A;  1KNU A;  4CI5 A;  4OKB A;  1FCZ A;  2EWP A;  3FS1 A;  2VV1 A;  2GWX A;  1N46 A;  3M7R A;  3VRT A;  2V7C A;  1YJE A;  1T63 A;  2J7X A;  3ADX A;  3OZ0 A;  4OZT E;  1L2J A;  5EGV A;  5KCF A;  4DMA A;  5KCE A;  5DV6 A;  4DM8 A;  1QKN A;  1X7J A;  1PK5 A;  1PQ6 A;  1YIN A;  5DLR A;  1XDK A;  2QA8 B;  3DZY D;  4Q50 A;  5DV8 A;  5DVS A;  3L0E A;  1M13 A;  5G5W A;  1ZDT A;  4N73 A;  5DWL A;  4TV1 B;  4G21 A;  2QZO B;  3K22 A;  3PCU A;  5KRH A;  1RDT D;  1IE8 A;  5C4U A;  5KRM A;  3VTD A;  2B23 A;  1FM6 A;  3EYB A;  1XVP A;  1FD0 A;  3R8I A;  4XAO A;  3R29 A;  1T7M A;  3VRU A;  1FM9 A;  3GYT A;  4L96 A;  1RK3 A;  3AFR A;  1DKF A;  4PWL A;  5DX3 A;  5DU5 A;  4YPQ A;  3OGT A;  3OOK A;  2AXA A;  2ZFX A;  4RUP A;  3JZC A;  1G1U A;  4QL8 A;  5DVV A;  4MGD A;  4OZR E;  1XJ7 A;  1NQ1 A;  5EHJ A;  3WGP A;  1L2I A;  5KYJ A;  1K74 A;  5LWP A;  5B41 A;  3HZF A;  3CQV A;  3Q95 B;  3VT3 A;  1HJ1 A;  2JFA A;  1X7B A;  2ZK1 A;  5KRL A;  2LBD A;  1ZAF A;  4ZNU A;  3X1H A;  2P4Y A;  1T73 A;  4MGB A;  2Q6S A;  4QE6 A;  3UU7 B;  5KR9 A;  5KRK A;  1UPV A;  5C4O A;  3A2H A;  1MVC A;  3AN4 A;  4OAR A;  1S9P A;  4OEA A;  3FXV A;  3KBA A;  3VI8 A;  2VV4 A;  5DTV A;  5KCT A;  2P7G A;  2BJ4 A;  1BSX A;  1T76 A;  4DK7 A;  3PEQ A;  2YLP A;  1UPW A;  3BQD A;  3TY0 A;  3ZRB A;  2ABI A;  4IVY A;  5DK9 A;  5DXE A;  3VT6 A;  4ZNT A;  2HAS A;  2OZ7 A;  4KZM A;  5DRM A;  1Z5X U;  2I0G A;  3W0A A;  2Q7I A;  3F5C B;  4ZO1 B;  2E2R A;  2ZKC A;  3GZ9 A;  3R5M A;  3WFG A;  3IPQ A;  2Q6J A;  2OM9 A;  5EC9 A;  5IXK A;  5C4T A;  2GPP A;  4FHH A;  4Q13 A;  5APJ A;  2H77 A;  3UUA A;  1E3K A;  4RAK A;  5FQP A;  2ZMI A;  2HCD A;  4IA7 A;  4OJ4 A;  2A3I A;  4ZN9 A;  2P54 A;  2Q61 A;  2R40 D;  1NUO A;  2ZK0 A;  5DZH A;  4E4K A;  5DVC A;  5IAW A;  2VV1 B;  4PP6 A;  2ACL A;  2B50 A;  5KCC A;  2YLO A;  3ADW A;  3KMG A;  1Y9R A;  4IW6 A;  3R8A A;  4POJ A;  2G5O A;  5AWK A;  3WWR A;  2AA7 A;  4MG7 A;  1ZH7 A;  3K8S A;  4WPF A;  3E00 D;  2PIX A;  3OMP A;  1X7E A;  1XDK B;  1Y0S A;  2J14 A;  1NQ0 A;  2AA2 A;  5DKG A;  5DXR A;  3VT9 A;  3IXP D;  3VJI A;  2QPY A;  2HAR A;  5E15 A;  2I0J A;  4YT1 A;  1G2N A;  3PBA A;  4OLM A;  2PIN A;  4JL4 A;  2PJL A;  4QJR A;  5DSH A;  5FQT A;  1X76 A;  5GT4 A;  5JJM A;  4PVU A;  3OS8 C;  4RFW A;  3OSA A;  4BCR A;  1XVP B;  3P8X A;  5KD9 A;  2Q5S A;  1U3R A;  5G44 A;  4KZJ A;  3D90 A;  2PIO A;  3ET2 A;  2NXX A;  5DX3 B;  5DZ1 A;  2ZXN A;  1FCX A;  4MG5 A;  3UUD A;  1UOM A;  2H79 A;  3B5R A;  2G0H A;  4A4W A;  2HB8 A;  3VRW A;  3UP0 A;  1XNN A;  1T7R A;  4X1G A;  5G46 A;  1PZL A;  2QNV A;  4NB6 A;  5CJ6 A;  5E19 A;  4OC7 A;  2Q3Y A;  5DY8 A;  2QXS A;  5E0W A;  2YHD A;  4ITE A;  1S0Z A;  2AM9 A;  5DZI A;  4ZI1 A;  2FVJ A;  2QAB A;  2JFA B;  4NIE A;  4OK1 A;  4XUH A;  5DRJ A;  3R5N A;  5DYD A;  1ERE A;  3W5T A;  1OSH A;  3PRG A;  3V3Q A;  5A86 A;  4MGB B;  2YLQ A;  3W0H A;  4JAZ A;  1I37 A;  2AYR A;  3R8D A;  3F7D A;  2W8Y A;  3VN2 A;  2Q7L A;  5KRF A;  4DM6 A;  5L7H A;  5KCW A;  4ZNS A;  2VSR A;  4J5W A;  4N8R A;  4R6S A;  3K23 A;  3VRV A;  5DXQ A;  1Y0X X;  2OCF A;  4FHI A;  1H9U A;  2VV4 B;  5AYG A;  5GIE A;  5HYR A;  1A28 A;  5E14 A;  1LBD A;  1XOW A;  2POG A;  1GWX A;  3R2A A;  1GS4 A;  2AB2 A;  3OMM A;  2GPO A;  1G50 A;  4PP5 A;  3NOA A;  1YP0 A;  2ZAS A;  3G8I A;  5LGA A;  2Q70 A;  1SKX A;  3ADS A;  5EI1 A;  4ZNW A;  3UUC A;  3LMP A;  2Q60 A;  2ZNQ A;  3A2J A;  4S0T A;  3SP9 A;  4WHF A;  2I4P A;  4E2J A;  4NQA B;  3GD2 A;  1ZDU A;  1UHL B;  3L1B A;  3PLZ A;  3UUA B;  2YJA B;  2PIW A;  3HO0 A;  3V3E A;  4ZJR A;  2P7Z A;  3T03 A;  2Q1V A;  1FM6 D;  4YMQ A;  4J24 A;  2J7Y A;  3L3X A;  4E4Q A;  5HJP A;  1FM9 D;  4XUM A;  4WQP A;  5M96 A;  1NHZ A;  5AAU A;  1YOK A;  1NDE A;  2Q6R A;  3P0U A;  2ACL B;  3MNO A;  3P88 A;  4P6X A;  5DKE A;  5G45 A;  2Q59 B;  3X31 A;  4RME A;  1S9Q A;  2VV2 A;  3D6D A;  4RUJ A;  3KDU A;  2PIU A;  1K74 D;  2HVC A;  2OVM A;  2P15 A;  4PXM A;  3RUU A;  1Q4X A;  4HEE X;  4OH6 A;  5ICK A;  4P6W A;  5IZ0 A;  3VT7 A;  4OED A;  3NSP A;  2XYX A;  4RZF A;  5AWJ A;  1NQ7 A;  2OAX A;  4K7A A;  5JJM B;  3VT8 A;  4N5G A;  2PIP L;  2PRG A;  3N00 A;  4IWF A;  5DXP A;  3OS9 A;  1I7I A;  2B1V A;  2G44 A;  5ETH A;  2AWH A;  4J5X A;  5DXK A;  3IA6 A;  2AA6 A;  5DYB A;  4MDD A;  4PPS A;  4UDB A;  3OOF A;  3V49 A;  2F4B A;  3W0Y A;  1T79 A;  2FAI A;  3UUD B;  3B65 A;  4Q0A C;  3AUQ A;  4WHG A;  3B67 A;  5G43 A;  5HCV A;  4REE A;  1XAP A;  2V0V A;  3OKH A;  3A9E A;  4UDD A;  4EMA A;  3RLJ A;  3W0C A;  3H0A A;  3A2I A;  1ILG A;  4MG6 A;  4Y29 A;  4IW8 A;  3VHU A;  5B5B A;  3CDS A;  1XQC A;  5AZT A;  3CLD A;  5L11 A;  1YMT A;  2P7A A;  2ZNP A;  4OKW A;  5FQR A;  3WMH A;  1PQC A;  4FNE A;  4REF A;  4APU A;  1RJK A;  2P1V A;  3HLV A;  1A52 A;  2ZNN A;  3MNP A;  1NYX A;  2IOG A;  3AZ2 A;  3OAP A;  2NV7 A;  1U3S A;  2AX6 A;  2NXX E;  1EXX A;  1MZN A;  3WFF A;  3W5Q A;  3CS6 A;  2QH6 A;  4OIL A;  4G20 A;  5AAV B;  4ZN7 A;  3ZRA A;  3E94 A;  5DXM A;  3VJT A;  3BEJ A;  1NAX A;  1QKT A;  3FAL A;  3U9Q A;  4OIU A;  2ZNO A;  3VSP A;  2ZLA A;  2HB7 A;  1OVL A;  3ET3 A;  4XI3 A;  1Z95 A;  4MGC A;  4R2U A;  1KKQ A;  3OKI A;  5APK A;  2O4R A;  2PIT A;  4RZG A;  2ZK6 A;  5E7V A;  4MG9 A;  3B66 A;  4ZNV A;  3AZ3 A;  3AZ1 A;  3IMY A;  1I7G A;  3V9Y A;  3MNE A;  2QA6 A;  4OFR A;  4IV4 A;  2Q1H A;  5EJV A;  2GP7 A;  5AVI A;  5GID A;  1ZEO A;  4MG8 A;  1RKG A;  1S0X A;  2HWQ A;  1XLS E;  3ERD A;  5DWJ A;  2ZK3 A;  2ZMJ A;  4K6I A;  4B7W A;  1XB7 A;  3L3Z A;  4QK4 A;  2NPA A;  1S19 A;  2POB A;  3G9E A;  5HJP B;  5DMF A;  3CWD A;  3ILZ A;  2XHS A;  2AO6 A;  2ZVT A;  4OIV A;  1IE9 A;  3HVL A;  4OZT U;  2QTU A;  1T7F A;  3ET0 A;  4OJB A;  2QA8 A;  2AMA A;  3BC5 A;  3FC6 A;  1XIU A;  3OSI A;  5FQV A;  3OLL A;  3DZU A;  4J5W C;  1DKF B;  3D24 A;  3WT7 A;  3WT5 A;  1E3G A;  2GTK A;  2ZXZ A;  4PPP A;  1TFC A;  4MGD B;  2P1U A;  1GWR A;  4CSJ A;  3KFC A;  2IHQ A;  3HM1 A;  1HG4 A;  1R1K D;  2AX9 A;  2ZK5 A;  4FGY A;  4IU7 A;  4IUI A;  3UVV A;  5KRI A;  3RY9 A;  3WTQ A;  4N1Y A;  1WM0 X;  2HWR A;  3JZB A;  2JJ3 A;  3SP6 A;  1RKH A;  3DY6 A;  4OZR U;  3KDT A;  1R1K A;  2I4J A;  2J4A A;  1OSV A;  1T7T A;  4G1Y A;  3B0W A;  3GN8 A;  4IA1 A;  2BJ4 B;  2BAW A;  3HQ5 A;  4ONI A;  5DP0 A;  2IOK A;  2GL8 A;  3FAL B;  3O1E A;  2VST A;  1ZGY A;  2YFE A;  1ZKY A;  1Z5X E;  3VSO A;  3IPS A;  4OKT A;  4IA2 A;  2AX8 A;  2P1T A;  1U9E A;  4UDA A;  5C4S A;  2YLY A;  4A4V A;  1K7L A;  5AVL A;  2PKL A;  5JY3 A;  2PIQ A;  3CJW A;  5DUH A;  2REW A;  4ZNH A;  4PF3 A;  5E1C A;  2GPU A;  3D57 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...