5DV3A

Human ppargamma ligand binding dmain complexed with sb1405 in a covalent bonded form
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
272
structure length
263
Chain Sequence
PESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human PPARgamma ligand binding dmain complexed with SB1405 in a covalent bonded form
rcsb
molecule keywords Peroxisome proliferator-activated receptor gamma
molecule tags Transcription/transferase
source organism Homo sapiens
total genus 97
structure length 263
sequence length 272
ec nomenclature
pdb deposition date 2015-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 5dv3A00
4DMAA 4Q0AC 1YMTA 4IW8A 2Q7LA 3HO0A 1M13A 4MDDA 4PLEA 4ZNSA 5DUGA 4IVYA 4E4KA 4OHAA 3KFCA 4ZJWA 3DR1A 1XQ3A 4R06A 3E00A 1LV2A 1NQ2A 2Q1HA 2QW4A 2YJDA 3L3ZA 2AA5A 3ET0A 2Q7KA 1T74A 4TUZB 4MG7A 4UDCA 2OCFA 2J7XA 3W0GA 5KRJA 3PLZA 1T7RA 1G5YA 5E0XA 2OVHA 1X7BA 3L03A 4OKTA 1U9EA 4LBDA 4OEZA 2ACLB 1PZLA 3A40X 1NRLA 2LBDA 2NXXA 3HZFA 2QE4A 4XLDA 1KNUA 3K8SA 5E19A 5E1CA 4G2HA 1FBYA 1BSXA 1R20A 2XKWA 4PLDA 3D5FA 3W5RA 1OT7A 1XP6A 3BQDA 2I0GA 4IQRA 5EGVA 2GP7A 1ILGA 3WFFA 5DLRA 3FS1A 3KMGA 4OEDA 4MG9B 1I38A 1T7TA 3ZR7A 4E4QA 3W0JA 1PCGA 4CI5A 3GN8A 4IA7A 4TUZA 3OS8C 5HZCA 3VRVA 4ZNUA 2POGA 3LMPA 3A2IA 4PP5A 5IZ0A 4K6IA 1K7LA 4QM0A 1T7MA 3EYBA 5C4UA 4EM9A 1ILHA 5APHA 1S0XA 4WHFA 4UDAA 3RUTA 2ACLA 2PIRA 2IHQA 3ERDA 2AX9A 5DKGA 3A78A 5DKBA 5SYZA 1YJEA 2ZXZA 1QKTA 3FC6A 3VT6A 3MNPA 1FCXA 3IA6A 5B5BA 3N00A 3VJIA 2Q3YA 4RZFA 2Q5GA 3OSIA 5FQSA 1RDTA 2Q6RA 5AZVA 4J5WA 5HJPA 3NOAA 5L11A 3PBAA 4DOSA 4MG9A 2Q5PA 3DZYD 1TXIA 5KRHA 5JJMB 2OM9A 1N4HA 1YP0A 2POBA 4FGYA 4PPSA 1UPWA 2A3IA 2AO6A 2NPAA 1NDEA 3OOKA 2P7GA 3H0AD 3W0HA 5G42A 3W0AA 3R8AA 2GL8A 3P0UA 4OIVA 2I0JA 3TKCA 4NB6A 1MV9A 1S0ZA 5M96A 4A4WA 2ZK5A 4XHDA 3NSQA 1L2IA 2IOKA 4HEEX 4NUFA 5E14A 2PIWA 5DV6A 3V4AA 1OSVA 1NQ0A 5FQVA 4PXMA 2PIVA 3G9EA 1A28A 4IV4A 4OFRA 2O4JA 5DXBB 3WT6A 3ADSA 3IPQA 5DY8A 5AZTA 2ZNNA 5KCWA 3SZ1A 2YFEA 2QA8B 2ZASA 4PVUA 1R1KA 1QKNA 5JJMA 3AUNA 3FEIA 3V9YA 5KRKA 3AURA 3V49A 2VSTA 1FM6A 1X7EA 3B1MA 3SP6A 3W0YA 1I7IA 1XQCA 1XP1A 3CDSA 4OZRU 3FEJA 2PIUA 1K74D 2ABIA 2I4JA 2P7ZA 5DKSA 5C4SA 2OVMA 1YOWA 2ZMHA 5DXPA 4JYHA 5AYGA 3OMMA 3VT8A 5KYJA 3PCUA 4RUOX 2EWPA 2FAIA 3D57A 4RUPA 5DXBA 2ZMJA 2NW4A 3AZ2A 3L0EA 2HARA 5E7VA 5APKA 4R6SA 5G5WA 3VHUA 3VT4A 4ZN9A 1WM0X 3R8DA 2HASA 5HJSA 3WWRA 2QA8A 1DKFB 3AN4A 1XDKA 1XIUA 4X1GA 3JZBA 1T5ZA 3ADUA 2P15A 5DWJA 4OZTU 5F9BA 1P93A 2G0GA 2PIXA 3B0RA 1SJ0A 2JFAB 4B7WA 5E0WA 4BCRA 3TKMA 3UVVB 2ZLAA 2GPPA 4F9MA 3D24A 3OMQA 2PNUA 3ZQTA 1XV9B 2ZY0A 2AAXA 3A9EB 4OARA 4LSJA 4N8RA 2QZOB 3UU7B 2PIOA 2P7AA 3U9QA 1NHZA 5DZ3A 2YLOA 2QXMA 5AWKA 3HC5A 2HAMA 3WT5A 2QGWA 3PEQA 3P8XA 4ITEA 1PQCA 3B3KA 3IXPD 5DIGA 5DZIA 5HYRA 1TFCA 2JF9A 2QMVA 2GPOA 4XI3A 4J24A 4OH6A 4ZOMA 1X76A 5KCCA 3UVVA 4FHIA 2GPVA 2Q5SA 3CWDA 4FHHA 4RFWA 5DV8A 2AXAA 5DV3A 4IVWA 3TX7B 4DK7A 2B1ZA 1XV9A 3A9EA 5G45A 2YLQA 2QZOA 2AX8A 3UU7A 1ERRA 5L7HA 3P88A 2Q70A 4J26A 4OKBA 1I37A 3CLDA 3DY6A 3VI8A 2HWRA 3SP9A 4XAOA 2HB8A 4S0SA 4MGCA 1P8DA 2GTKA 3B66A 2R40A 3HODA 2Q8SA 3RLJA 1ZKYA 4POHA 3B65A 5DVCA 1GWXA 2QPYA 5DRMA 4RMDA 3BC5A 4UDDA 1RJKA 5KD9A 1T7FA 5KRMA 5E15A 2HC4A 4LTWA 4WHGA 4YT1A 3VJHA 2ZNPA 5DYBA 2AM9A 2Q60A 3UUDB 2ATHA 5DI7A 4IWFA 1T63A 4ITFA 3WTQA 2G44A 4PWLA 4ZN7A 4DM8A 1G50A 1N83A 2YLPA 2Z4BA 3O1EA 4OLMA 4RWVA 3WJ5A 5DRJA 1ZAFA 1NQ1A 2AYRA 4XUMA 1XB7A 1E3KA 4IA1A 5FQTA 4HLWA 2VV2A 3GZ9A 1DB1A 4QJRA 3G8OA 1ZH7A 5KRLA 3ADVA 4IWCA 1GWQA 2QSEA 5LGAA 2I4PA 1XVPB 5GIEA 3OGTA 1ZDUA 2YLYA 3AX8A 1M2ZA 1FM9A 3V3QA 4OZRE 3F7DA 2XYWA 4TV1B 5AVIA 1XOWA 2Q6JA 3E00D 4REFA 1RKHA 4XUHA 4ZNWA 2AMAA 5GT4A 3CQVA 3ET3A 3PO9A 1OVLB 2OZ7A 5G3JA 3UUDA 2PJLA 5DXKA 1NAXA 2F4BA 2QXSA 1Z95A 2IOGA 3WT7A 4YMQA 3OMKA 1XPCA 4XTAA 4RZEA 1QKUA 4ZI1A 4A2JA 3OZJA 3VT9A 3OKHA 4K7AA 2PIPL 2VV3A 1T79A 1L2JA 5DXMA 3VHWA 4L96A 4OJ9A 5DTVA 1IE8A 2ZXMA 1UPVA 1KKQA 4OJBA 2HVCA 3VTDA 2VV4B 1RK3A 4L98A 3D90A 3ZRAA 3R29A 1R20D 2Z4JA 3CS6A 4OZTE 1PK5A 2J7YA 4PP3A 5GIDA 5EJVA 3TY0A 4OH5A 1PDUA 5EITA 2OUZA 2VV1B 3OS9A 1ZUCA 3DCTA 3K23A 4TV1A 5DUEA 1U3SA 3A3ZX 3OMOA 4WQPA 3L0JA 2GWXA 1HG4A 3GWXA 3UUAB 4OKXA 3IPSA 1OVLA 5DMFA 5DWGA 2AB2A 4MGDB 1T76A 2ZL9A 3FXVA 4MG8B 5AAVB 1PQ9A 4OEYA 3RLLA 4PPPA 2P1VA 3CJWA 4CI4A 1XP9A 5ICKA 1PQ6A 2OAXA 5EI1A 1YA3A 4MGAB 3OKIA 2PIQA 3IXPA 4JYGA 4MGBB 3W0CA 3UP3A 2VV4A 3VRTA 4M8EA 3OSAA 1OSHA 1YYEA 3G0WA 4NIEA 4OKWA 1ZDTA 1YOKA 4OJ4A 4KZMA 1X78A 3AN3A 4EMAA 2VSRA 4OEAA 3ADXA 4DM6A 2B1VA 2B50A 1GWRA 1S9PA 2HBHA 2VV1A 1GS4A 2I4ZA 3B0TA 3R5MA 5DVSA 5KCFA 1N46A 1MZNA 4LNWA 3GBKA 2Q6SA 3L1BA 3OS8A 5AWJA 1U3RA 2YATA 3RUUA 5KCEA 3L0LA 4JAZA 1XNXA 2YHDA 5KROA 3OLSA 4MGDA 4Q13A 5DVVA 5HCVA 4DK8A 2H79A 4MG8A 4UDBA 3VJSA 5AAVA 5HYKA 1H9UA 4YNKA 4PP6A 3W0IA 1X7JA 4J5WC 5KYAA 3VT3A 5C4TA 4DORA 4S0TA 4APUA 2B23A 1FCYA 4OK1A 2HFPA 2QTUA 1T65A 2O9IA 3FLIA 3JZCA 4MGAA 3T03A 5A86A 4YPQA 1NYXA 3FURA 4MGBA 3OSWA 4G1YA 3VJTA 4QE8A 3OZ0A 4G1ZA 2P4YA 5DXQA 5EC9A 3OLLA 5DL4A 4J5XC 3L3XA 3VRUA 2Q59B 3X31A 2R6YA 4Q50A 1FCZA 4M8HA 1DKFA 1YIMA 4LNXA 5L7EA 4RAKA 3CTBA 1R5KA 1ZEOA 3X36A 3KMZA 3RVFA 5KCDA 2P1UA 2XHSA 4JGVA 1R1KD 2BJ4B 4ZO1B 2JFAA 2Q61A 3DCUA 2HCDA 3ET1A 3VRWA 1M7WA 5DIDA 5AK2A 4ONIA 3GYTA 3WGPA 4IW6A 4IU7A 3UUCA 3VT5A 3DZYA 5DUHA 4IA3A 5DYDA 4WPFA 3R2AA 2XYXA 5ACCA 5DSHA 2NV7A 5B41A 4KZJA 4RE8A 5DXGA 3W5TA 4IA2A 3VSPA 3W5PA 5JY3A 3E94A 4ZNVA 4OFUA 2QR9A 5GICA 5KCTA 1EREA 2AX6A 2Q7IA 3H0AA 3R5NA 5KRAA 2ZBSA 3F5CB 2Q7JA 1XZXX 1G2NA 1XLSE 3KMRA 5DIEA 2Q59A 4NQAB 5IXKA 4P6XA 3WFGA 4JL4A 2ZMIA 4RMCA 5DX3A 5LWPA 2ZK3A 3KPZA 3AUQA 1Y9RA 3GYUA 3KBAA 2J4AA 2BJ4A 4N5GA 3B68A 2V7CA 3FC6B 3LBDA 5APJA 3DT3A 3GD2A 2FVJA 1SR7A 4MG6A 2GPUA 2GIUA 5DWLA 3AZ1A 1EXXA 4FNEA 4R2UA 1UHLB 3DZUD 3FALB 3VSOA 5HJPB 5KRIA 4G20A 1FD0A 2W8YA 3NSPA 5EHJA 1G1UA 4IV2A 5DU5A 1Z5XU 3ZRBA 2BAWA 3F5CA 3W5QA 5G44A 3G8IA 3B0QA 4X1FA 5DXRA 2J14A 2ZK6A 3A2HA 1K74A 3V9TA 2O4RA 1NAVA 4Y29A 5FQRA 2QA6A 4P6WA 3S9SA 4DQMA 3MNOA 3VTBA 2V0VA 2Q1VA 1UOMA 3Q95B 2PITA 4WLBA 2HWQA 3D6DA 1IE9A 1S19A 4S14A 3KDUA 4QE6A 5DZ1A 3VT7A 1Y0SA 3WJ4A 1SKXA 1Q4XA 2ZK2A 4FN9A 1UHLA 4QL8A 4S15A 5DZ0A 3UP0A 3FALA 2ZK4A 3HLVA 4REEA 3E7CA 2QH6A 4IS8A 1XJ7A 4E2JA 4KZIA 4ZJRA 2AMBA 5AVLA 4XT9A 5KRCA 5I4VA 5DWEA 3ADWA 1EXAA 1XVPA 4A4VA 4J5XA 3ERTA 5C4OA 2NXXE 4RUJA 2P1TA 4RMEA 3X1HA 1PRGA 1YY4A 3Q95A 4POJA 4OGHA 2R40D 3HVLA 5DZHA 3FUGA 5G43A 1LBDA 3H52A 2PKLA 2ZVTA 4ZNTA 2P54A 2ZXNA 3ILZA 2ZK1A 3KDTA 5AAUA 4IUIA 4K4JA 3B5RA 1K4WA 1ZGYA 3B0WA 5JI0D 3R8IA 4RZGA 1SQNA 1NUOA 2ZNQA 3GWSX 3OAPA 3OMPA 5FQPA 1U3QA 4ZNHA 2G5OA 1XDKB 2ZLCA 4NY9A 3HM1A 2REWA 4O8FA 1MVCA 3VHVA 2AA6A 3K22A 5ETHA 1RDTD 2AA7A 3CDPA 1XLSA 3HQ5A 4ZO1X 1E3GA 5DMCA 2R6WA 1A52A 4N1YA 3OOFA 3UUAA 1I7GA 1FM9D 1S9QA 2YJAB 2ZK0A 1XAPA 3QT0A 4G1DA 4PF3A 5DXEA 1XNNA 5DWIA 2PRGA 4WVDA 5H1EA 2E2RA 5DKEA 2QABA 3OLFA 3CS4A 1T73A 4G21A 5DX3B 2ZFXA 5CJ6A 4MG5A 3V3EA 1YINA 3ET2A 3A2JA 1YUCA 1KV6A 3AZ3A 3WMHA 4OILA 3ADTA 2VV0A 3VN2A 2PINA 5L7GA 1Y0XX 1HJ1A 1NQ7A 1VJBA 2AWHA 4MG7B 4QK4A 5IAWA 2H77A 3O1DA 3P89A 4PRGA 5KRFA 2AX7A 2QNVA 3VTCA 3KYTA 2QGTA 3K6PA 2AA2A 2G0HA 4OC7A 4G2IA 5DK9A 4N73A 1RKGA 3IPUA 3AFRA 4JYIA 1R6GA 5G46A 3DZUA 3PRGA 2ZKCA 1X7RA 4OIUA 5KR9A 3HC6A 2JJ3A 2ZNOA 3M7RA 3CS8A 5DP0A 3BEJA 4CSJA 3X1IA 2FSZA 3KWYA 3B67A 3IMYA 3MNEA 3RY9A 5KCUA 5K13A 1FM6D 1QKMA 1Z5XE 2HB7A 3V9VA 2XYJA
chains in the Genus database with same CATH superfamily
4DMAA 4Q0AC 1YMTA 4IW8A 2Q7LA 3HO0A 1M13A 4MDDA 4PLEA 4ZNSA 5DUGA 4IVYA 4E4KA 4OHAA 3KFCA 4ZJWA 3DR1A 1XQ3A 4R06A 3E00A 1LV2A 1NQ2A 2Q1HA 2QW4A 2YJDA 3L3ZA 2AA5A 3ET0A 2Q7KA 1T74A 4TUZB 4MG7A 4UDCA 2OCFA 2J7XA 3W0GA 5KRJA 3PLZA 1T7RA 1G5YA 5E0XA 2OVHA 1X7BA 3L03A 4OKTA 1U9EA 4LBDA 4OEZA 2ACLB 1PZLA 3A40X 1NRLA 2LBDA 2NXXA 3HZFA 2QE4A 4XLDA 1KNUA 3K8SA 5E19A 5E1CA 4G2HA 1FBYA 1BSXA 1R20A 2XKWA 4PLDA 3D5FA 3W5RA 1OT7A 1XP6A 3BQDA 2I0GA 4IQRA 5EGVA 2GP7A 1ILGA 3WFFA 5DLRA 3FS1A 3KMGA 4OEDA 4MG9B 1I38A 1T7TA 3ZR7A 4E4QA 3W0JA 1PCGA 4CI5A 3GN8A 4IA7A 4TUZA 3OS8C 5HZCA 3VRVA 4ZNUA 2POGA 3LMPA 3A2IA 4PP5A 5IZ0A 4K6IA 1K7LA 4QM0A 1T7MA 3EYBA 5C4UA 4EM9A 1ILHA 5APHA 1S0XA 4WHFA 4UDAA 3RUTA 2ACLA 2PIRA 2IHQA 3ERDA 2AX9A 5DKGA 3A78A 5DKBA 5SYZA 1YJEA 2ZXZA 1QKTA 3FC6A 3VT6A 3MNPA 1FCXA 3IA6A 5B5BA 3N00A 3VJIA 2Q3YA 4RZFA 2Q5GA 3OSIA 5FQSA 1RDTA 2Q6RA 5AZVA 4J5WA 5HJPA 3NOAA 5L11A 3PBAA 4DOSA 4MG9A 2Q5PA 3DZYD 1TXIA 5KRHA 5JJMB 2OM9A 1N4HA 1YP0A 2POBA 4FGYA 4PPSA 1UPWA 2A3IA 2AO6A 2NPAA 1NDEA 3OOKA 2P7GA 3H0AD 3W0HA 5G42A 3W0AA 3R8AA 2GL8A 3P0UA 4OIVA 2I0JA 3TKCA 4NB6A 1MV9A 1S0ZA 5M96A 4A4WA 2ZK5A 4XHDA 3NSQA 1L2IA 2IOKA 4HEEX 4NUFA 5E14A 2PIWA 5DV6A 3V4AA 1OSVA 1NQ0A 5FQVA 4PXMA 2PIVA 3G9EA 1A28A 4IV4A 4OFRA 2O4JA 5DXBB 3WT6A 3ADSA 3IPQA 5DY8A 5AZTA 2ZNNA 5KCWA 3SZ1A 2YFEA 2QA8B 2ZASA 4PVUA 1R1KA 1QKNA 5JJMA 3AUNA 3FEIA 3V9YA 5KRKA 3AURA 3V49A 2VSTA 1FM6A 1X7EA 3B1MA 3SP6A 3W0YA 1I7IA 1XQCA 1XP1A 3CDSA 4OZRU 3FEJA 2PIUA 1K74D 2ABIA 2I4JA 2P7ZA 5DKSA 5C4SA 2OVMA 1YOWA 2ZMHA 5DXPA 4JYHA 5AYGA 3OMMA 3VT8A 5KYJA 3PCUA 4RUOX 2EWPA 2FAIA 3D57A 4RUPA 5DXBA 2ZMJA 2NW4A 3AZ2A 3L0EA 2HARA 5E7VA 5APKA 4R6SA 5G5WA 3VHUA 3VT4A 4ZN9A 1WM0X 3R8DA 2HASA 5HJSA 3WWRA 2QA8A 1DKFB 3AN4A 1XDKA 1XIUA 4X1GA 3JZBA 1T5ZA 3ADUA 2P15A 5DWJA 4OZTU 5F9BA 1P93A 2G0GA 2PIXA 3B0RA 1SJ0A 2JFAB 4B7WA 5E0WA 4BCRA 3TKMA 3UVVB 2ZLAA 2GPPA 4F9MA 3D24A 3OMQA 2PNUA 3ZQTA 1XV9B 2ZY0A 2AAXA 3A9EB 4OARA 4LSJA 4N8RA 2QZOB 3UU7B 2PIOA 2P7AA 3U9QA 1NHZA 5DZ3A 2YLOA 2QXMA 5AWKA 3HC5A 2HAMA 3WT5A 2QGWA 3PEQA 3P8XA 4ITEA 1PQCA 3B3KA 3IXPD 5DIGA 5DZIA 5HYRA 1TFCA 2JF9A 2QMVA 2GPOA 4XI3A 4J24A 4OH6A 4ZOMA 1X76A 5KCCA 3UVVA 4FHIA 2GPVA 2Q5SA 3CWDA 4FHHA 4RFWA 5DV8A 2AXAA 5DV3A 4IVWA 3TX7B 4DK7A 2B1ZA 1XV9A 3A9EA 5G45A 2YLQA 2QZOA 2AX8A 3UU7A 1ERRA 5L7HA 3P88A 2Q70A 4J26A 4OKBA 1I37A 3CLDA 3DY6A 3VI8A 2HWRA 3SP9A 4XAOA 2HB8A 4S0SA 4MGCA 1P8DA 2GTKA 3B66A 2R40A 3HODA 2Q8SA 3RLJA 1ZKYA 4POHA 3B65A 5DVCA 1GWXA 2QPYA 5DRMA 4RMDA 3BC5A 4UDDA 1RJKA 5KD9A 1T7FA 5KRMA 5E15A 2HC4A 4LTWA 4WHGA 4YT1A 3VJHA 2ZNPA 5DYBA 2AM9A 2Q60A 3UUDB 2ATHA 5DI7A 4IWFA 1T63A 4ITFA 3WTQA 2G44A 4PWLA 4ZN7A 4DM8A 1G50A 1N83A 2YLPA 2Z4BA 3O1EA 4OLMA 4RWVA 3WJ5A 5DRJA 1ZAFA 1NQ1A 2AYRA 4XUMA 1XB7A 1E3KA 4IA1A 5FQTA 4HLWA 2VV2A 3GZ9A 1DB1A 4QJRA 3G8OA 1ZH7A 5KRLA 3ADVA 4IWCA 1GWQA 2QSEA 5LGAA 2I4PA 1XVPB 5GIEA 3OGTA 1ZDUA 2YLYA 3AX8A 1M2ZA 1FM9A 3V3QA 4OZRE 3F7DA 2XYWA 4TV1B 5AVIA 1XOWA 2Q6JA 3E00D 4REFA 1RKHA 4XUHA 4ZNWA 2AMAA 5GT4A 3CQVA 3ET3A 3PO9A 1OVLB 2OZ7A 5G3JA 3UUDA 2PJLA 5DXKA 1NAXA 2F4BA 2QXSA 1Z95A 2IOGA 3WT7A 4YMQA 3OMKA 1XPCA 4XTAA 4RZEA 1QKUA 4ZI1A 4A2JA 3OZJA 3VT9A 3OKHA 4K7AA 2PIPL 2VV3A 1T79A 1L2JA 5DXMA 3VHWA 4L96A 4OJ9A 5DTVA 1IE8A 2ZXMA 1UPVA 1KKQA 4OJBA 2HVCA 3VTDA 2VV4B 1RK3A 4L98A 3D90A 3ZRAA 3R29A 1R20D 2Z4JA 3CS6A 4OZTE 1PK5A 2J7YA 4PP3A 5GIDA 5EJVA 3TY0A 4OH5A 1PDUA 5EITA 2OUZA 2VV1B 3OS9A 1ZUCA 3DCTA 3K23A 4TV1A 5DUEA 1U3SA 3A3ZX 3OMOA 4WQPA 3L0JA 2GWXA 1HG4A 3GWXA 3UUAB 4OKXA 3IPSA 1OVLA 5DMFA 5DWGA 2AB2A 4MGDB 1T76A 2ZL9A 3FXVA 4MG8B 5AAVB 1PQ9A 4OEYA 3RLLA 4PPPA 2P1VA 3CJWA 4CI4A 1XP9A 5ICKA 1PQ6A 2OAXA 5EI1A 1YA3A 4MGAB 3OKIA 2PIQA 3IXPA 4JYGA 4MGBB 3W0CA 3UP3A 2VV4A 3VRTA 4M8EA 3OSAA 1OSHA 1YYEA 3G0WA 4NIEA 4OKWA 1ZDTA 1YOKA 4OJ4A 4KZMA 1X78A 3AN3A 4EMAA 2VSRA 4OEAA 3ADXA 4DM6A 2B1VA 2B50A 1GWRA 1S9PA 2HBHA 2VV1A 1GS4A 2I4ZA 3B0TA 3R5MA 5DVSA 5KCFA 1N46A 1MZNA 4LNWA 3GBKA 2Q6SA 3L1BA 3OS8A 5AWJA 1U3RA 2YATA 3RUUA 5KCEA 3L0LA 4JAZA 1XNXA 2YHDA 5KROA 3OLSA 4MGDA 4Q13A 5DVVA 5HCVA 4DK8A 2H79A 4MG8A 4UDBA 3VJSA 5AAVA 5HYKA 1H9UA 4YNKA 4PP6A 3W0IA 1X7JA 4J5WC 5KYAA 3VT3A 5C4TA 4DORA 4S0TA 4APUA 2B23A 1FCYA 4OK1A 2HFPA 2QTUA 1T65A 2O9IA 3FLIA 3JZCA 4MGAA 3T03A 5A86A 4YPQA 1NYXA 3FURA 4MGBA 3OSWA 4G1YA 3VJTA 4QE8A 3OZ0A 4G1ZA 2P4YA 5DXQA 5EC9A 3OLLA 5DL4A 4J5XC 3L3XA 3VRUA 2Q59B 3X31A 2R6YA 4Q50A 1FCZA 4M8HA 1DKFA 1YIMA 4LNXA 5L7EA 4RAKA 3CTBA 1R5KA 1ZEOA 3X36A 3KMZA 3RVFA 5KCDA 2P1UA 2XHSA 4JGVA 1R1KD 2BJ4B 4ZO1B 2JFAA 2Q61A 3DCUA 2HCDA 3ET1A 3VRWA 1M7WA 5DIDA 5AK2A 4ONIA 3GYTA 3WGPA 4IW6A 4IU7A 3UUCA 3VT5A 3DZYA 5DUHA 4IA3A 5DYDA 4WPFA 3R2AA 2XYXA 5ACCA 5DSHA 2NV7A 5B41A 4KZJA 4RE8A 5DXGA 3W5TA 4IA2A 3VSPA 3W5PA 5JY3A 3E94A 4ZNVA 4OFUA 2QR9A 5GICA 5KCTA 1EREA 2AX6A 2Q7IA 3H0AA 3R5NA 5KRAA 2ZBSA 3F5CB 2Q7JA 1XZXX 1G2NA 1XLSE 3KMRA 5DIEA 2Q59A 4NQAB 5IXKA 4P6XA 3WFGA 4JL4A 2ZMIA 4RMCA 5DX3A 5LWPA 2ZK3A 3KPZA 3AUQA 1Y9RA 3GYUA 3KBAA 2J4AA 2BJ4A 4N5GA 3B68A 2V7CA 3FC6B 3LBDA 5APJA 3DT3A 3GD2A 2FVJA 1SR7A 4MG6A 2GPUA 2GIUA 5DWLA 3AZ1A 1EXXA 4FNEA 4R2UA 1UHLB 3DZUD 3FALB 3VSOA 5HJPB 5KRIA 4G20A 1FD0A 2W8YA 3NSPA 5EHJA 1G1UA 4IV2A 5DU5A 1Z5XU 3ZRBA 2BAWA 3F5CA 3W5QA 5G44A 3G8IA 3B0QA 4X1FA 5DXRA 2J14A 2ZK6A 3A2HA 1K74A 3V9TA 2O4RA 1NAVA 4Y29A 5FQRA 2QA6A 4P6WA 3S9SA 4DQMA 3MNOA 3VTBA 2V0VA 2Q1VA 1UOMA 3Q95B 2PITA 4WLBA 2HWQA 3D6DA 1IE9A 1S19A 4S14A 3KDUA 4QE6A 5DZ1A 3VT7A 1Y0SA 3WJ4A 1SKXA 1Q4XA 2ZK2A 4FN9A 1UHLA 4QL8A 4S15A 5DZ0A 3UP0A 3FALA 2ZK4A 3HLVA 4REEA 3E7CA 2QH6A 4IS8A 1XJ7A 4E2JA 4KZIA 4ZJRA 2AMBA 5AVLA 4XT9A 5KRCA 5I4VA 5DWEA 3ADWA 1EXAA 1XVPA 4A4VA 4J5XA 3ERTA 5C4OA 2NXXE 4RUJA 2P1TA 4RMEA 3X1HA 1PRGA 1YY4A 3Q95A 4POJA 4OGHA 2R40D 3HVLA 5DZHA 3FUGA 5G43A 1LBDA 3H52A 2PKLA 2ZVTA 4ZNTA 2P54A 2ZXNA 3ILZA 2ZK1A 3KDTA 5AAUA 4IUIA 4K4JA 3B5RA 1K4WA 1ZGYA 3B0WA 5JI0D 3R8IA 4RZGA 1SQNA 1NUOA 2ZNQA 3GWSX 3OAPA 3OMPA 5FQPA 1U3QA 4ZNHA 2G5OA 1XDKB 2ZLCA 4NY9A 3HM1A 2REWA 4O8FA 1MVCA 3VHVA 2AA6A 3K22A 5ETHA 1RDTD 2AA7A 3CDPA 1XLSA 3HQ5A 4ZO1X 1E3GA 5DMCA 2R6WA 1A52A 4N1YA 3OOFA 3UUAA 1I7GA 1FM9D 1S9QA 2YJAB 2ZK0A 1XAPA 3QT0A 4G1DA 4PF3A 5DXEA 1XNNA 5DWIA 2PRGA 4WVDA 5H1EA 2E2RA 5DKEA 2QABA 3OLFA 3CS4A 1T73A 4G21A 5DX3B 2ZFXA 5CJ6A 4MG5A 3V3EA 1YINA 3ET2A 3A2JA 1YUCA 1KV6A 3AZ3A 3WMHA 4OILA 3ADTA 2VV0A 3VN2A 2PINA 5L7GA 1Y0XX 1HJ1A 1NQ7A 1VJBA 2AWHA 4MG7B 4QK4A 5IAWA 2H77A 3O1DA 3P89A 4PRGA 5KRFA 2AX7A 2QNVA 3VTCA 3KYTA 2QGTA 3K6PA 2AA2A 2G0HA 4OC7A 4G2IA 5DK9A 4N73A 1RKGA 3IPUA 3AFRA 4JYIA 1R6GA 5G46A 3DZUA 3PRGA 2ZKCA 1X7RA 4OIUA 5KR9A 3HC6A 2JJ3A 2ZNOA 3M7RA 3CS8A 5DP0A 3BEJA 4CSJA 3X1IA 2FSZA 3KWYA 3B67A 3IMYA 3MNEA 3RY9A 5KCUA 5K13A 1FM6D 1QKMA 1Z5XE 2HB7A 3V9VA 2XYJA
chains in the Genus database with same CATH topology
4DMAA 4Q0AC 1YMTA 4IW8A 2Q7LA 3HO0A 1M13A 4MDDA 4PLEA 4ZNSA 5DUGA 4IVYA 4E4KA 4OHAA 3KFCA 4ZJWA 3DR1A 1XQ3A 4R06A 3E00A 1LV2A 1NQ2A 2Q1HA 2QW4A 2YJDA 3L3ZA 2AA5A 3ET0A 2Q7KA 1T74A 4TUZB 4MG7A 4UDCA 2OCFA 2J7XA 3W0GA 5KRJA 3PLZA 1T7RA 1G5YA 5E0XA 2OVHA 1X7BA 3L03A 4OKTA 1U9EA 4LBDA 4OEZA 2ACLB 1PZLA 3A40X 1NRLA 2LBDA 2NXXA 3HZFA 2QE4A 4XLDA 1KNUA 3K8SA 5E19A 5E1CA 4G2HA 1FBYA 1BSXA 1R20A 2XKWA 4PLDA 3D5FA 3W5RA 1OT7A 1XP6A 3BQDA 2I0GA 4IQRA 5EGVA 2GP7A 1ILGA 3WFFA 5DLRA 3FS1A 3KMGA 4OEDA 4MG9B 1I38A 1T7TA 3ZR7A 4E4QA 3W0JA 1PCGA 4CI5A 3GN8A 4IA7A 4TUZA 3OS8C 5HZCA 3VRVA 4ZNUA 2POGA 3LMPA 3A2IA 4PP5A 5IZ0A 4K6IA 1K7LA 4QM0A 1T7MA 3EYBA 5C4UA 4EM9A 1ILHA 5APHA 1S0XA 4WHFA 4UDAA 3RUTA 2ACLA 2PIRA 2IHQA 3ERDA 2AX9A 5DKGA 3A78A 5DKBA 5SYZA 1YJEA 2ZXZA 1QKTA 3FC6A 3VT6A 3MNPA 1FCXA 3IA6A 5B5BA 3N00A 3VJIA 2Q3YA 4RZFA 2Q5GA 3OSIA 5FQSA 1RDTA 2Q6RA 5AZVA 4J5WA 5HJPA 3NOAA 5L11A 3PBAA 4DOSA 4MG9A 2Q5PA 3DZYD 1TXIA 5KRHA 5JJMB 2OM9A 1N4HA 1YP0A 2POBA 4FGYA 4PPSA 1UPWA 2A3IA 2AO6A 2NPAA 1NDEA 3OOKA 2P7GA 3H0AD 3W0HA 5G42A 3W0AA 3R8AA 2GL8A 3P0UA 4OIVA 2I0JA 3TKCA 4NB6A 1MV9A 1S0ZA 5M96A 4A4WA 2ZK5A 4XHDA 3NSQA 1L2IA 2IOKA 4HEEX 4NUFA 5E14A 2PIWA 5DV6A 3V4AA 1OSVA 1NQ0A 5FQVA 4PXMA 2PIVA 3G9EA 1A28A 4IV4A 4OFRA 2O4JA 5DXBB 3WT6A 3ADSA 3IPQA 5DY8A 5AZTA 2ZNNA 5KCWA 3SZ1A 2YFEA 2QA8B 2ZASA 4PVUA 1R1KA 1QKNA 5JJMA 3AUNA 3FEIA 3V9YA 5KRKA 3AURA 3V49A 2VSTA 1FM6A 1X7EA 3B1MA 3SP6A 3W0YA 1I7IA 1XQCA 1XP1A 3CDSA 4OZRU 3FEJA 2PIUA 1K74D 2ABIA 2I4JA 2P7ZA 5DKSA 5C4SA 2OVMA 1YOWA 2ZMHA 5DXPA 4JYHA 5AYGA 3OMMA 3VT8A 5KYJA 3PCUA 4RUOX 2EWPA 2FAIA 3D57A 4RUPA 5DXBA 2ZMJA 2NW4A 3AZ2A 3L0EA 2HARA 5E7VA 5APKA 4R6SA 5G5WA 3VHUA 3VT4A 4ZN9A 1WM0X 3R8DA 2HASA 5HJSA 3WWRA 2QA8A 1DKFB 3AN4A 1XDKA 1XIUA 4X1GA 3JZBA 1T5ZA 3ADUA 2P15A 5DWJA 4OZTU 5F9BA 1P93A 2G0GA 2PIXA 3B0RA 1SJ0A 2JFAB 4B7WA 5E0WA 4BCRA 3TKMA 3UVVB 2ZLAA 2GPPA 4F9MA 3D24A 3OMQA 2PNUA 3ZQTA 1XV9B 2ZY0A 2AAXA 3A9EB 4OARA 4LSJA 4N8RA 2QZOB 3UU7B 2PIOA 2P7AA 3U9QA 1NHZA 5DZ3A 2YLOA 2QXMA 5AWKA 3HC5A 2HAMA 3WT5A 2QGWA 3PEQA 3P8XA 4ITEA 1PQCA 3B3KA 3IXPD 5DIGA 5DZIA 5HYRA 1TFCA 2JF9A 2QMVA 2GPOA 4XI3A 4J24A 4OH6A 4ZOMA 1X76A 5KCCA 3UVVA 4FHIA 2GPVA 2Q5SA 3CWDA 4FHHA 4RFWA 5DV8A 2AXAA 5DV3A 4IVWA 3TX7B 4DK7A 2B1ZA 1XV9A 3A9EA 5G45A 2YLQA 2QZOA 2AX8A 3UU7A 1ERRA 5L7HA 3P88A 2Q70A 4J26A 4OKBA 1I37A 3CLDA 3DY6A 3VI8A 2HWRA 3SP9A 4XAOA 2HB8A 4S0SA 4MGCA 1P8DA 2GTKA 3B66A 2R40A 3HODA 2Q8SA 3RLJA 1ZKYA 4POHA 3B65A 5DVCA 1GWXA 2QPYA 5DRMA 4RMDA 3BC5A 4UDDA 1RJKA 5KD9A 1T7FA 5KRMA 5E15A 2HC4A 4LTWA 4WHGA 4YT1A 3VJHA 2ZNPA 5DYBA 2AM9A 2Q60A 3UUDB 2ATHA 5DI7A 4IWFA 1T63A 4ITFA 3WTQA 2G44A 4PWLA 4ZN7A 4DM8A 1G50A 1N83A 2YLPA 2Z4BA 3O1EA 4OLMA 4RWVA 3WJ5A 5DRJA 1ZAFA 1NQ1A 2AYRA 4XUMA 1XB7A 1E3KA 4IA1A 5FQTA 4HLWA 2VV2A 3GZ9A 1DB1A 4QJRA 3G8OA 1ZH7A 5KRLA 3ADVA 4IWCA 1GWQA 2QSEA 5LGAA 2I4PA 1XVPB 5GIEA 3OGTA 1ZDUA 2YLYA 3AX8A 1M2ZA 1FM9A 3V3QA 4OZRE 3F7DA 2XYWA 4TV1B 5AVIA 1XOWA 2Q6JA 3E00D 4REFA 1RKHA 4XUHA 4ZNWA 2AMAA 5GT4A 3CQVA 3ET3A 3PO9A 1OVLB 2OZ7A 5G3JA 3UUDA 2PJLA 5DXKA 1NAXA 2F4BA 2QXSA 1Z95A 2IOGA 3WT7A 4YMQA 3OMKA 1XPCA 4XTAA 4RZEA 1QKUA 4ZI1A 4A2JA 3OZJA 3VT9A 3OKHA 4K7AA 2PIPL 2VV3A 1T79A 1L2JA 5DXMA 3VHWA 4L96A 4OJ9A 5DTVA 1IE8A 2ZXMA 1UPVA 1KKQA 4OJBA 2HVCA 3VTDA 2VV4B 1RK3A 4L98A 3D90A 3ZRAA 3R29A 1R20D 2Z4JA 3CS6A 4OZTE 1PK5A 2J7YA 4PP3A 5GIDA 5EJVA 3TY0A 4OH5A 1PDUA 5EITA 2OUZA 2VV1B 3OS9A 1ZUCA 3DCTA 3K23A 4TV1A 5DUEA 1U3SA 3A3ZX 3OMOA 4WQPA 3L0JA 2GWXA 1HG4A 3GWXA 3UUAB 4OKXA 3IPSA 1OVLA 5DMFA 5DWGA 2AB2A 4MGDB 1T76A 2ZL9A 3FXVA 4MG8B 5AAVB 1PQ9A 4OEYA 3RLLA 4PPPA 2P1VA 3CJWA 4CI4A 1XP9A 5ICKA 1PQ6A 2OAXA 5EI1A 1YA3A 4MGAB 3OKIA 2PIQA 3IXPA 4JYGA 4MGBB 3W0CA 3UP3A 2VV4A 3VRTA 4M8EA 3OSAA 1OSHA 1YYEA 3G0WA 4NIEA 4OKWA 1ZDTA 1YOKA 4OJ4A 4KZMA 1X78A 3AN3A 4EMAA 2VSRA 4OEAA 3ADXA 4DM6A 2B1VA 2B50A 1GWRA 1S9PA 2HBHA 2VV1A 1GS4A 2I4ZA 3B0TA 3R5MA 5DVSA 5KCFA 1N46A 1MZNA 4LNWA 3GBKA 2Q6SA 3L1BA 3OS8A 5AWJA 1U3RA 2YATA 3RUUA 5KCEA 3L0LA 4JAZA 1XNXA 2YHDA 5KROA 3OLSA 4MGDA 4Q13A 5DVVA 5HCVA 4DK8A 2H79A 4MG8A 4UDBA 3VJSA 5AAVA 5HYKA 1H9UA 4YNKA 4PP6A 3W0IA 1X7JA 4J5WC 5KYAA 3VT3A 5C4TA 4DORA 4S0TA 4APUA 2B23A 1FCYA 4OK1A 2HFPA 2QTUA 1T65A 2O9IA 3FLIA 3JZCA 4MGAA 3T03A 5A86A 4YPQA 1NYXA 3FURA 4MGBA 3OSWA 4G1YA 3VJTA 4QE8A 3OZ0A 4G1ZA 2P4YA 5DXQA 5EC9A 3OLLA 5DL4A 4J5XC 3L3XA 3VRUA 2Q59B 3X31A 2R6YA 4Q50A 1FCZA 4M8HA 1DKFA 1YIMA 4LNXA 5L7EA 4RAKA 3CTBA 1R5KA 1ZEOA 3X36A 3KMZA 3RVFA 5KCDA 2P1UA 2XHSA 4JGVA 1R1KD 2BJ4B 4ZO1B 2JFAA 2Q61A 3DCUA 2HCDA 3ET1A 3VRWA 1M7WA 5DIDA 5AK2A 4ONIA 3GYTA 3WGPA 4IW6A 4IU7A 3UUCA 3VT5A 3DZYA 5DUHA 4IA3A 5DYDA 4WPFA 3R2AA 2XYXA 5ACCA 5DSHA 2NV7A 5B41A 4KZJA 4RE8A 5DXGA 3W5TA 4IA2A 3VSPA 3W5PA 5JY3A 3E94A 4ZNVA 4OFUA 2QR9A 5GICA 5KCTA 1EREA 2AX6A 2Q7IA 3H0AA 3R5NA 5KRAA 2ZBSA 3F5CB 2Q7JA 1XZXX 1G2NA 1XLSE 3KMRA 5DIEA 2Q59A 4NQAB 5IXKA 4P6XA 3WFGA 4JL4A 2ZMIA 4RMCA 5DX3A 5LWPA 2ZK3A 3KPZA 3AUQA 1Y9RA 3GYUA 3KBAA 2J4AA 2BJ4A 4N5GA 3B68A 2V7CA 3FC6B 3LBDA 5APJA 3DT3A 3GD2A 2FVJA 1SR7A 4MG6A 2GPUA 2GIUA 5DWLA 3AZ1A 1EXXA 4FNEA 4R2UA 1UHLB 3DZUD 3FALB 3VSOA 5HJPB 5KRIA 4G20A 1FD0A 2W8YA 3NSPA 5EHJA 1G1UA 4IV2A 5DU5A 1Z5XU 3ZRBA 2BAWA 3F5CA 3W5QA 5G44A 3G8IA 3B0QA 4X1FA 5DXRA 2J14A 2ZK6A 3A2HA 1K74A 3V9TA 2O4RA 1NAVA 4Y29A 5FQRA 2QA6A 4P6WA 3S9SA 4DQMA 3MNOA 3VTBA 2V0VA 2Q1VA 1UOMA 3Q95B 2PITA 4WLBA 2HWQA 3D6DA 1IE9A 1S19A 4S14A 3KDUA 4QE6A 5DZ1A 3VT7A 1Y0SA 3WJ4A 1SKXA 1Q4XA 2ZK2A 4FN9A 1UHLA 4QL8A 4S15A 5DZ0A 3UP0A 3FALA 2ZK4A 3HLVA 4REEA 3E7CA 2QH6A 4IS8A 1XJ7A 4E2JA 4KZIA 4ZJRA 2AMBA 5AVLA 4XT9A 5KRCA 5I4VA 5DWEA 3ADWA 1EXAA 1XVPA 4A4VA 4J5XA 3ERTA 5C4OA 2NXXE 4RUJA 2P1TA 4RMEA 3X1HA 1PRGA 1YY4A 3Q95A 4POJA 4OGHA 2R40D 3HVLA 5DZHA 3FUGA 5G43A 1LBDA 3H52A 2PKLA 2ZVTA 4ZNTA 2P54A 2ZXNA 3ILZA 2ZK1A 3KDTA 5AAUA 4IUIA 4K4JA 3B5RA 1K4WA 1ZGYA 3B0WA 5JI0D 3R8IA 4RZGA 1SQNA 1NUOA 2ZNQA 3GWSX 3OAPA 3OMPA 5FQPA 1U3QA 4ZNHA 2G5OA 1XDKB 2ZLCA 4NY9A 3HM1A 2REWA 4O8FA 1MVCA 3VHVA 2AA6A 3K22A 5ETHA 1RDTD 2AA7A 3CDPA 1XLSA 3HQ5A 4ZO1X 1E3GA 5DMCA 2R6WA 1A52A 4N1YA 3OOFA 3UUAA 1I7GA 1FM9D 1S9QA 2YJAB 2ZK0A 1XAPA 3QT0A 4G1DA 4PF3A 5DXEA 1XNNA 5DWIA 2PRGA 4WVDA 5H1EA 2E2RA 5DKEA 2QABA 3OLFA 3CS4A 1T73A 4G21A 5DX3B 2ZFXA 5CJ6A 4MG5A 3V3EA 1YINA 3ET2A 3A2JA 1YUCA 1KV6A 3AZ3A 3WMHA 4OILA 3ADTA 2VV0A 3VN2A 2PINA 5L7GA 1Y0XX 1HJ1A 1NQ7A 1VJBA 2AWHA 4MG7B 4QK4A 5IAWA 2H77A 3O1DA 3P89A 4PRGA 5KRFA 2AX7A 2QNVA 3VTCA 3KYTA 2QGTA 3K6PA 2AA2A 2G0HA 4OC7A 4G2IA 5DK9A 4N73A 1RKGA 3IPUA 3AFRA 4JYIA 1R6GA 5G46A 3DZUA 3PRGA 2ZKCA 1X7RA 4OIUA 5KR9A 3HC6A 2JJ3A 2ZNOA 3M7RA 3CS8A 5DP0A 3BEJA 4CSJA 3X1IA 2FSZA 3KWYA 3B67A 3IMYA 3MNEA 3RY9A 5KCUA 5K13A 1FM6D 1QKMA 1Z5XE 2HB7A 3V9VA 2XYJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DMA A;  4Q0A C;  1YMT A;  4IW8 A;  2Q7L A;  3HO0 A;  1M13 A;  4MDD A;  4PLE A;  4ZNS A;  5DUG A;  4IVY A;  4E4K A;  4OHA A;  3KFC A;  4ZJW A;  3DR1 A;  1XQ3 A;  4R06 A;  3E00 A;  1LV2 A;  1NQ2 A;  2Q1H A;  2QW4 A;  2YJD A;  3L3Z A;  2AA5 A;  3ET0 A;  2Q7K A;  1T74 A;  4TUZ B;  4MG7 A;  4UDC A;  2OCF A;  2J7X A;  3W0G A;  5KRJ A;  3PLZ A;  1T7R A;  1G5Y A;  5E0X A;  2OVH A;  1X7B A;  3L03 A;  4OKT A;  1U9E A;  4LBD A;  4OEZ A;  2ACL B;  1PZL A;  3A40 X;  1NRL A;  2LBD A;  2NXX A;  3HZF A;  2QE4 A;  4XLD A;  1KNU A;  3K8S A;  5E19 A;  5E1C A;  4G2H A;  1FBY A;  1BSX A;  1R20 A;  2XKW A;  4PLD A;  3D5F A;  3W5R A;  1OT7 A;  1XP6 A;  3BQD A;  2I0G A;  4IQR A;  5EGV A;  2GP7 A;  1ILG A;  3WFF A;  5DLR A;  3FS1 A;  3KMG A;  4OED A;  4MG9 B;  1I38 A;  1T7T A;  3ZR7 A;  4E4Q A;  3W0J A;  1PCG A;  4CI5 A;  3GN8 A;  4IA7 A;  4TUZ A;  3OS8 C;  5HZC A;  3VRV A;  4ZNU A;  2POG A;  3LMP A;  3A2I A;  4PP5 A;  5IZ0 A;  4K6I A;  1K7L A;  4QM0 A;  1T7M A;  3EYB A;  5C4U A;  4EM9 A;  1ILH A;  5APH A;  1S0X A;  4WHF A;  4UDA A;  3RUT A;  2ACL A;  2PIR A;  2IHQ A;  3ERD A;  2AX9 A;  5DKG A;  3A78 A;  5DKB A;  5SYZ A;  1YJE A;  2ZXZ A;  1QKT A;  3FC6 A;  3VT6 A;  3MNP A;  1FCX A;  3IA6 A;  5B5B A;  3N00 A;  3VJI A;  2Q3Y A;  4RZF A;  2Q5G A;  3OSI A;  5FQS A;  1RDT A;  2Q6R A;  5AZV A;  4J5W A;  5HJP A;  3NOA A;  5L11 A;  3PBA A;  4DOS A;  4MG9 A;  2Q5P A;  3DZY D;  1TXI A;  5KRH A;  5JJM B;  2OM9 A;  1N4H A;  1YP0 A;  2POB A;  4FGY A;  4PPS A;  1UPW A;  2A3I A;  2AO6 A;  2NPA A;  1NDE A;  3OOK A;  2P7G A;  3H0A D;  3W0H A;  5G42 A;  3W0A A;  3R8A A;  2GL8 A;  3P0U A;  4OIV A;  2I0J A;  3TKC A;  4NB6 A;  1MV9 A;  1S0Z A;  5M96 A;  4A4W A;  2ZK5 A;  4XHD A;  3NSQ A;  1L2I A;  2IOK A;  4HEE X;  4NUF A;  5E14 A;  2PIW A;  5DV6 A;  3V4A A;  1OSV A;  1NQ0 A;  5FQV A;  4PXM A;  2PIV A;  3G9E A;  1A28 A;  4IV4 A;  4OFR A;  2O4J A;  5DXB B;  3WT6 A;  3ADS A;  3IPQ A;  5DY8 A;  5AZT A;  2ZNN A;  5KCW A;  3SZ1 A;  2YFE A;  2QA8 B;  2ZAS A;  4PVU A;  1R1K A;  1QKN A;  5JJM A;  3AUN A;  3FEI A;  3V9Y A;  5KRK A;  3AUR A;  3V49 A;  2VST A;  1FM6 A;  1X7E A;  3B1M A;  3SP6 A;  3W0Y A;  1I7I A;  1XQC A;  1XP1 A;  3CDS A;  4OZR U;  3FEJ A;  2PIU A;  1K74 D;  2ABI A;  2I4J A;  2P7Z A;  5DKS A;  5C4S A;  2OVM A;  1YOW A;  2ZMH A;  5DXP A;  4JYH A;  5AYG A;  3OMM A;  3VT8 A;  5KYJ A;  3PCU A;  4RUO X;  2EWP A;  2FAI A;  3D57 A;  4RUP A;  5DXB A;  2ZMJ A;  2NW4 A;  3AZ2 A;  3L0E A;  2HAR A;  5E7V A;  5APK A;  4R6S A;  5G5W A;  3VHU A;  3VT4 A;  4ZN9 A;  1WM0 X;  3R8D A;  2HAS A;  5HJS A;  3WWR A;  2QA8 A;  1DKF B;  3AN4 A;  1XDK A;  1XIU A;  4X1G A;  3JZB A;  1T5Z A;  3ADU A;  2P15 A;  5DWJ A;  4OZT U;  5F9B A;  1P93 A;  2G0G A;  2PIX A;  3B0R A;  1SJ0 A;  2JFA B;  4B7W A;  5E0W A;  4BCR A;  3TKM A;  3UVV B;  2ZLA A;  2GPP A;  4F9M A;  3D24 A;  3OMQ A;  2PNU A;  3ZQT A;  1XV9 B;  2ZY0 A;  2AAX A;  3A9E B;  4OAR A;  4LSJ A;  4N8R A;  2QZO B;  3UU7 B;  2PIO A;  2P7A A;  3U9Q A;  1NHZ A;  5DZ3 A;  2YLO A;  2QXM A;  5AWK A;  3HC5 A;  2HAM A;  3WT5 A;  2QGW A;  3PEQ A;  3P8X A;  4ITE A;  1PQC A;  3B3K A;  3IXP D;  5DIG A;  5DZI A;  5HYR A;  1TFC A;  2JF9 A;  2QMV A;  2GPO A;  4XI3 A;  4J24 A;  4OH6 A;  4ZOM A;  1X76 A;  5KCC A;  3UVV A;  4FHI A;  2GPV A;  2Q5S A;  3CWD A;  4FHH A;  4RFW A;  5DV8 A;  2AXA A;  5DV3 A;  4IVW A;  3TX7 B;  4DK7 A;  2B1Z A;  1XV9 A;  3A9E A;  5G45 A;  2YLQ A;  2QZO A;  2AX8 A;  3UU7 A;  1ERR A;  5L7H A;  3P88 A;  2Q70 A;  4J26 A;  4OKB A;  1I37 A;  3CLD A;  3DY6 A;  3VI8 A;  2HWR A;  3SP9 A;  4XAO A;  2HB8 A;  4S0S A;  4MGC A;  1P8D A;  2GTK A;  3B66 A;  2R40 A;  3HOD A;  2Q8S A;  3RLJ A;  1ZKY A;  4POH A;  3B65 A;  5DVC A;  1GWX A;  2QPY A;  5DRM A;  4RMD A;  3BC5 A;  4UDD A;  1RJK A;  5KD9 A;  1T7F A;  5KRM A;  5E15 A;  2HC4 A;  4LTW A;  4WHG A;  4YT1 A;  3VJH A;  2ZNP A;  5DYB A;  2AM9 A;  2Q60 A;  3UUD B;  2ATH A;  5DI7 A;  4IWF A;  1T63 A;  4ITF A;  3WTQ A;  2G44 A;  4PWL A;  4ZN7 A;  4DM8 A;  1G50 A;  1N83 A;  2YLP A;  2Z4B A;  3O1E A;  4OLM A;  4RWV A;  3WJ5 A;  5DRJ A;  1ZAF A;  1NQ1 A;  2AYR A;  4XUM A;  1XB7 A;  1E3K A;  4IA1 A;  5FQT A;  4HLW A;  2VV2 A;  3GZ9 A;  1DB1 A;  4QJR A;  3G8O A;  1ZH7 A;  5KRL A;  3ADV A;  4IWC A;  1GWQ A;  2QSE A;  5LGA A;  2I4P A;  1XVP B;  5GIE A;  3OGT A;  1ZDU A;  2YLY A;  3AX8 A;  1M2Z A;  1FM9 A;  3V3Q A;  4OZR E;  3F7D A;  2XYW A;  4TV1 B;  5AVI A;  1XOW A;  2Q6J A;  3E00 D;  4REF A;  1RKH A;  4XUH A;  4ZNW A;  2AMA A;  5GT4 A;  3CQV A;  3ET3 A;  3PO9 A;  1OVL B;  2OZ7 A;  5G3J A;  3UUD A;  2PJL A;  5DXK A;  1NAX A;  2F4B A;  2QXS A;  1Z95 A;  2IOG A;  3WT7 A;  4YMQ A;  3OMK A;  1XPC A;  4XTA A;  4RZE A;  1QKU A;  4ZI1 A;  4A2J A;  3OZJ A;  3VT9 A;  3OKH A;  4K7A A;  2PIP L;  2VV3 A;  1T79 A;  1L2J A;  5DXM A;  3VHW A;  4L96 A;  4OJ9 A;  5DTV A;  1IE8 A;  2ZXM A;  1UPV A;  1KKQ A;  4OJB A;  2HVC A;  3VTD A;  2VV4 B;  1RK3 A;  4L98 A;  3D90 A;  3ZRA A;  3R29 A;  1R20 D;  2Z4J A;  3CS6 A;  4OZT E;  1PK5 A;  2J7Y A;  4PP3 A;  5GID A;  5EJV A;  3TY0 A;  4OH5 A;  1PDU A;  5EIT A;  2OUZ A;  2VV1 B;  3OS9 A;  1ZUC A;  3DCT A;  3K23 A;  4TV1 A;  5DUE A;  1U3S A;  3A3Z X;  3OMO A;  4WQP A;  3L0J A;  2GWX A;  1HG4 A;  3GWX A;  3UUA B;  4OKX A;  3IPS A;  1OVL A;  5DMF A;  5DWG A;  2AB2 A;  4MGD B;  1T76 A;  2ZL9 A;  3FXV A;  4MG8 B;  5AAV B;  1PQ9 A;  4OEY A;  3RLL A;  4PPP A;  2P1V A;  3CJW A;  4CI4 A;  1XP9 A;  5ICK A;  1PQ6 A;  2OAX A;  5EI1 A;  1YA3 A;  4MGA B;  3OKI A;  2PIQ A;  3IXP A;  4JYG A;  4MGB B;  3W0C A;  3UP3 A;  2VV4 A;  3VRT A;  4M8E A;  3OSA A;  1OSH A;  1YYE A;  3G0W A;  4NIE A;  4OKW A;  1ZDT A;  1YOK A;  4OJ4 A;  4KZM A;  1X78 A;  3AN3 A;  4EMA A;  2VSR A;  4OEA A;  3ADX A;  4DM6 A;  2B1V A;  2B50 A;  1GWR A;  1S9P A;  2HBH A;  2VV1 A;  1GS4 A;  2I4Z A;  3B0T A;  3R5M A;  5DVS A;  5KCF A;  1N46 A;  1MZN A;  4LNW A;  3GBK A;  2Q6S A;  3L1B A;  3OS8 A;  5AWJ A;  1U3R A;  2YAT A;  3RUU A;  5KCE A;  3L0L A;  4JAZ A;  1XNX A;  2YHD A;  5KRO A;  3OLS A;  4MGD A;  4Q13 A;  5DVV A;  5HCV A;  4DK8 A;  2H79 A;  4MG8 A;  4UDB A;  3VJS A;  5AAV A;  5HYK A;  1H9U A;  4YNK A;  4PP6 A;  3W0I A;  1X7J A;  4J5W C;  5KYA A;  3VT3 A;  5C4T A;  4DOR A;  4S0T A;  4APU A;  2B23 A;  1FCY A;  4OK1 A;  2HFP A;  2QTU A;  1T65 A;  2O9I A;  3FLI A;  3JZC A;  4MGA A;  3T03 A;  5A86 A;  4YPQ A;  1NYX A;  3FUR A;  4MGB A;  3OSW A;  4G1Y A;  3VJT A;  4QE8 A;  3OZ0 A;  4G1Z A;  2P4Y A;  5DXQ A;  5EC9 A;  3OLL A;  5DL4 A;  4J5X C;  3L3X A;  3VRU A;  2Q59 B;  3X31 A;  2R6Y A;  4Q50 A;  1FCZ A;  4M8H A;  1DKF A;  1YIM A;  4LNX A;  5L7E A;  4RAK A;  3CTB A;  1R5K A;  1ZEO A;  3X36 A;  3KMZ A;  3RVF A;  5KCD A;  2P1U A;  2XHS A;  4JGV A;  1R1K D;  2BJ4 B;  4ZO1 B;  2JFA A;  2Q61 A;  3DCU A;  2HCD A;  3ET1 A;  3VRW A;  1M7W A;  5DID A;  5AK2 A;  4ONI A;  3GYT A;  3WGP A;  4IW6 A;  4IU7 A;  3UUC A;  3VT5 A;  3DZY A;  5DUH A;  4IA3 A;  5DYD A;  4WPF A;  3R2A A;  2XYX A;  5ACC A;  5DSH A;  2NV7 A;  5B41 A;  4KZJ A;  4RE8 A;  5DXG A;  3W5T A;  4IA2 A;  3VSP A;  3W5P A;  5JY3 A;  3E94 A;  4ZNV A;  4OFU A;  2QR9 A;  5GIC A;  5KCT A;  1ERE A;  2AX6 A;  2Q7I A;  3H0A A;  3R5N A;  5KRA A;  2ZBS A;  3F5C B;  2Q7J A;  1XZX X;  1G2N A;  1XLS E;  3KMR A;  5DIE A;  2Q59 A;  4NQA B;  5IXK A;  4P6X A;  3WFG A;  4JL4 A;  2ZMI A;  4RMC A;  5DX3 A;  5LWP A;  2ZK3 A;  3KPZ A;  3AUQ A;  1Y9R A;  3GYU A;  3KBA A;  2J4A A;  2BJ4 A;  4N5G A;  3B68 A;  2V7C A;  3FC6 B;  3LBD A;  5APJ A;  3DT3 A;  3GD2 A;  2FVJ A;  1SR7 A;  4MG6 A;  2GPU A;  2GIU A;  5DWL A;  3AZ1 A;  1EXX A;  4FNE A;  4R2U A;  1UHL B;  3DZU D;  3FAL B;  3VSO A;  5HJP B;  5KRI A;  4G20 A;  1FD0 A;  2W8Y A;  3NSP A;  5EHJ A;  1G1U A;  4IV2 A;  5DU5 A;  1Z5X U;  3ZRB A;  2BAW A;  3F5C A;  3W5Q A;  5G44 A;  3G8I A;  3B0Q A;  4X1F A;  5DXR A;  2J14 A;  2ZK6 A;  3A2H A;  1K74 A;  3V9T A;  2O4R A;  1NAV A;  4Y29 A;  5FQR A;  2QA6 A;  4P6W A;  3S9S A;  4DQM A;  3MNO A;  3VTB A;  2V0V A;  2Q1V A;  1UOM A;  3Q95 B;  2PIT A;  4WLB A;  2HWQ A;  3D6D A;  1IE9 A;  1S19 A;  4S14 A;  3KDU A;  4QE6 A;  5DZ1 A;  3VT7 A;  1Y0S A;  3WJ4 A;  1SKX A;  1Q4X A;  2ZK2 A;  4FN9 A;  1UHL A;  4QL8 A;  4S15 A;  5DZ0 A;  3UP0 A;  3FAL A;  2ZK4 A;  3HLV A;  4REE A;  3E7C A;  2QH6 A;  4IS8 A;  1XJ7 A;  4E2J A;  4KZI A;  4ZJR A;  2AMB A;  5AVL A;  4XT9 A;  5KRC A;  5I4V A;  5DWE A;  3ADW A;  1EXA A;  1XVP A;  4A4V A;  4J5X A;  3ERT A;  5C4O A;  2NXX E;  4RUJ A;  2P1T A;  4RME A;  3X1H A;  1PRG A;  1YY4 A;  3Q95 A;  4POJ A;  4OGH A;  2R40 D;  3HVL A;  5DZH A;  3FUG A;  5G43 A;  1LBD A;  3H52 A;  2PKL A;  2ZVT A;  4ZNT A;  2P54 A;  2ZXN A;  3ILZ A;  2ZK1 A;  3KDT A;  5AAU A;  4IUI A;  4K4J A;  3B5R A;  1K4W A;  1ZGY A;  3B0W A;  5JI0 D;  3R8I A;  4RZG A;  1SQN A;  1NUO A;  2ZNQ A;  3GWS X;  3OAP A;  3OMP A;  5FQP A;  1U3Q A;  4ZNH A;  2G5O A;  1XDK B;  2ZLC A;  4NY9 A;  3HM1 A;  2REW A;  4O8F A;  1MVC A;  3VHV A;  2AA6 A;  3K22 A;  5ETH A;  1RDT D;  2AA7 A;  3CDP A;  1XLS A;  3HQ5 A;  4ZO1 X;  1E3G A;  5DMC A;  2R6W A;  1A52 A;  4N1Y A;  3OOF A;  3UUA A;  1I7G A;  1FM9 D;  1S9Q A;  2YJA B;  2ZK0 A;  1XAP A;  3QT0 A;  4G1D A;  4PF3 A;  5DXE A;  1XNN A;  5DWI A;  2PRG A;  4WVD A;  5H1E A;  2E2R A;  5DKE A;  2QAB A;  3OLF A;  3CS4 A;  1T73 A;  4G21 A;  5DX3 B;  2ZFX A;  5CJ6 A;  4MG5 A;  3V3E A;  1YIN A;  3ET2 A;  3A2J A;  1YUC A;  1KV6 A;  3AZ3 A;  3WMH A;  4OIL A;  3ADT A;  2VV0 A;  3VN2 A;  2PIN A;  5L7G A;  1Y0X X;  1HJ1 A;  1NQ7 A;  1VJB A;  2AWH A;  4MG7 B;  4QK4 A;  5IAW A;  2H77 A;  3O1D A;  3P89 A;  4PRG A;  5KRF A;  2AX7 A;  2QNV A;  3VTC A;  3KYT A;  2QGT A;  3K6P A;  2AA2 A;  2G0H A;  4OC7 A;  4G2I A;  5DK9 A;  4N73 A;  1RKG A;  3IPU A;  3AFR A;  4JYI A;  1R6G A;  5G46 A;  3DZU A;  3PRG A;  2ZKC A;  1X7R A;  4OIU A;  5KR9 A;  3HC6 A;  2JJ3 A;  2ZNO A;  3M7R A;  3CS8 A;  5DP0 A;  3BEJ A;  4CSJ A;  3X1I A;  2FSZ A;  3KWY A;  3B67 A;  3IMY A;  3MNE A;  3RY9 A;  5KCU A;  5K13 A;  1FM6 D;  1QKM A;  1Z5X E;  2HB7 A;  3V9V A;  2XYJ A; 
#chains in the Genus database with same CATH topology
 4DMA A;  4Q0A C;  1YMT A;  4IW8 A;  2Q7L A;  3HO0 A;  1M13 A;  4MDD A;  4PLE A;  4ZNS A;  5DUG A;  4IVY A;  4E4K A;  4OHA A;  3KFC A;  4ZJW A;  3DR1 A;  1XQ3 A;  4R06 A;  3E00 A;  1LV2 A;  1NQ2 A;  2Q1H A;  2QW4 A;  2YJD A;  3L3Z A;  2AA5 A;  3ET0 A;  2Q7K A;  1T74 A;  4TUZ B;  4MG7 A;  4UDC A;  2OCF A;  2J7X A;  3W0G A;  5KRJ A;  3PLZ A;  1T7R A;  1G5Y A;  5E0X A;  2OVH A;  1X7B A;  3L03 A;  4OKT A;  1U9E A;  4LBD A;  4OEZ A;  2ACL B;  1PZL A;  3A40 X;  1NRL A;  2LBD A;  2NXX A;  3HZF A;  2QE4 A;  4XLD A;  1KNU A;  3K8S A;  5E19 A;  5E1C A;  4G2H A;  1FBY A;  1BSX A;  1R20 A;  2XKW A;  4PLD A;  3D5F A;  3W5R A;  1OT7 A;  1XP6 A;  3BQD A;  2I0G A;  4IQR A;  5EGV A;  2GP7 A;  1ILG A;  3WFF A;  5DLR A;  3FS1 A;  3KMG A;  4OED A;  4MG9 B;  1I38 A;  1T7T A;  3ZR7 A;  4E4Q A;  3W0J A;  1PCG A;  4CI5 A;  3GN8 A;  4IA7 A;  4TUZ A;  3OS8 C;  5HZC A;  3VRV A;  4ZNU A;  2POG A;  3LMP A;  3A2I A;  4PP5 A;  5IZ0 A;  4K6I A;  1K7L A;  4QM0 A;  1T7M A;  3EYB A;  5C4U A;  4EM9 A;  1ILH A;  5APH A;  1S0X A;  4WHF A;  4UDA A;  3RUT A;  2ACL A;  2PIR A;  2IHQ A;  3ERD A;  2AX9 A;  5DKG A;  3A78 A;  5DKB A;  5SYZ A;  1YJE A;  2ZXZ A;  1QKT A;  3FC6 A;  3VT6 A;  3MNP A;  1FCX A;  3IA6 A;  5B5B A;  3N00 A;  3VJI A;  2Q3Y A;  4RZF A;  2Q5G A;  3OSI A;  5FQS A;  1RDT A;  2Q6R A;  5AZV A;  4J5W A;  5HJP A;  3NOA A;  5L11 A;  3PBA A;  4DOS A;  4MG9 A;  2Q5P A;  3DZY D;  1TXI A;  5KRH A;  5JJM B;  2OM9 A;  1N4H A;  1YP0 A;  2POB A;  4FGY A;  4PPS A;  1UPW A;  2A3I A;  2AO6 A;  2NPA A;  1NDE A;  3OOK A;  2P7G A;  3H0A D;  3W0H A;  5G42 A;  3W0A A;  3R8A A;  2GL8 A;  3P0U A;  4OIV A;  2I0J A;  3TKC A;  4NB6 A;  1MV9 A;  1S0Z A;  5M96 A;  4A4W A;  2ZK5 A;  4XHD A;  3NSQ A;  1L2I A;  2IOK A;  4HEE X;  4NUF A;  5E14 A;  2PIW A;  5DV6 A;  3V4A A;  1OSV A;  1NQ0 A;  5FQV A;  4PXM A;  2PIV A;  3G9E A;  1A28 A;  4IV4 A;  4OFR A;  2O4J A;  5DXB B;  3WT6 A;  3ADS A;  3IPQ A;  5DY8 A;  5AZT A;  2ZNN A;  5KCW A;  3SZ1 A;  2YFE A;  2QA8 B;  2ZAS A;  4PVU A;  1R1K A;  1QKN A;  5JJM A;  3AUN A;  3FEI A;  3V9Y A;  5KRK A;  3AUR A;  3V49 A;  2VST A;  1FM6 A;  1X7E A;  3B1M A;  3SP6 A;  3W0Y A;  1I7I A;  1XQC A;  1XP1 A;  3CDS A;  4OZR U;  3FEJ A;  2PIU A;  1K74 D;  2ABI A;  2I4J A;  2P7Z A;  5DKS A;  5C4S A;  2OVM A;  1YOW A;  2ZMH A;  5DXP A;  4JYH A;  5AYG A;  3OMM A;  3VT8 A;  5KYJ A;  3PCU A;  4RUO X;  2EWP A;  2FAI A;  3D57 A;  4RUP A;  5DXB A;  2ZMJ A;  2NW4 A;  3AZ2 A;  3L0E A;  2HAR A;  5E7V A;  5APK A;  4R6S A;  5G5W A;  3VHU A;  3VT4 A;  4ZN9 A;  1WM0 X;  3R8D A;  2HAS A;  5HJS A;  3WWR A;  2QA8 A;  1DKF B;  3AN4 A;  1XDK A;  1XIU A;  4X1G A;  3JZB A;  1T5Z A;  3ADU A;  2P15 A;  5DWJ A;  4OZT U;  5F9B A;  1P93 A;  2G0G A;  2PIX A;  3B0R A;  1SJ0 A;  2JFA B;  4B7W A;  5E0W A;  4BCR A;  3TKM A;  3UVV B;  2ZLA A;  2GPP A;  4F9M A;  3D24 A;  3OMQ A;  2PNU A;  3ZQT A;  1XV9 B;  2ZY0 A;  2AAX A;  3A9E B;  4OAR A;  4LSJ A;  4N8R A;  2QZO B;  3UU7 B;  2PIO A;  2P7A A;  3U9Q A;  1NHZ A;  5DZ3 A;  2YLO A;  2QXM A;  5AWK A;  3HC5 A;  2HAM A;  3WT5 A;  2QGW A;  3PEQ A;  3P8X A;  4ITE A;  1PQC A;  3B3K A;  3IXP D;  5DIG A;  5DZI A;  5HYR A;  1TFC A;  2JF9 A;  2QMV A;  2GPO A;  4XI3 A;  4J24 A;  4OH6 A;  4ZOM A;  1X76 A;  5KCC A;  3UVV A;  4FHI A;  2GPV A;  2Q5S A;  3CWD A;  4FHH A;  4RFW A;  5DV8 A;  2AXA A;  5DV3 A;  4IVW A;  3TX7 B;  4DK7 A;  2B1Z A;  1XV9 A;  3A9E A;  5G45 A;  2YLQ A;  2QZO A;  2AX8 A;  3UU7 A;  1ERR A;  5L7H A;  3P88 A;  2Q70 A;  4J26 A;  4OKB A;  1I37 A;  3CLD A;  3DY6 A;  3VI8 A;  2HWR A;  3SP9 A;  4XAO A;  2HB8 A;  4S0S A;  4MGC A;  1P8D A;  2GTK A;  3B66 A;  2R40 A;  3HOD A;  2Q8S A;  3RLJ A;  1ZKY A;  4POH A;  3B65 A;  5DVC A;  1GWX A;  2QPY A;  5DRM A;  4RMD A;  3BC5 A;  4UDD A;  1RJK A;  5KD9 A;  1T7F A;  5KRM A;  5E15 A;  2HC4 A;  4LTW A;  4WHG A;  4YT1 A;  3VJH A;  2ZNP A;  5DYB A;  2AM9 A;  2Q60 A;  3UUD B;  2ATH A;  5DI7 A;  4IWF A;  1T63 A;  4ITF A;  3WTQ A;  2G44 A;  4PWL A;  4ZN7 A;  4DM8 A;  1G50 A;  1N83 A;  2YLP A;  2Z4B A;  3O1E A;  4OLM A;  4RWV A;  3WJ5 A;  5DRJ A;  1ZAF A;  1NQ1 A;  2AYR A;  4XUM A;  1XB7 A;  1E3K A;  4IA1 A;  5FQT A;  4HLW A;  2VV2 A;  3GZ9 A;  1DB1 A;  4QJR A;  3G8O A;  1ZH7 A;  5KRL A;  3ADV A;  4IWC A;  1GWQ A;  2QSE A;  5LGA A;  2I4P A;  1XVP B;  5GIE A;  3OGT A;  1ZDU A;  2YLY A;  3AX8 A;  1M2Z A;  1FM9 A;  3V3Q A;  4OZR E;  3F7D A;  2XYW A;  4TV1 B;  5AVI A;  1XOW A;  2Q6J A;  3E00 D;  4REF A;  1RKH A;  4XUH A;  4ZNW A;  2AMA A;  5GT4 A;  3CQV A;  3ET3 A;  3PO9 A;  1OVL B;  2OZ7 A;  5G3J A;  3UUD A;  2PJL A;  5DXK A;  1NAX A;  2F4B A;  2QXS A;  1Z95 A;  2IOG A;  3WT7 A;  4YMQ A;  3OMK A;  1XPC A;  4XTA A;  4RZE A;  1QKU A;  4ZI1 A;  4A2J A;  3OZJ A;  3VT9 A;  3OKH A;  4K7A A;  2PIP L;  2VV3 A;  1T79 A;  1L2J A;  5DXM A;  3VHW A;  4L96 A;  4OJ9 A;  5DTV A;  1IE8 A;  2ZXM A;  1UPV A;  1KKQ A;  4OJB A;  2HVC A;  3VTD A;  2VV4 B;  1RK3 A;  4L98 A;  3D90 A;  3ZRA A;  3R29 A;  1R20 D;  2Z4J A;  3CS6 A;  4OZT E;  1PK5 A;  2J7Y A;  4PP3 A;  5GID A;  5EJV A;  3TY0 A;  4OH5 A;  1PDU A;  5EIT A;  2OUZ A;  2VV1 B;  3OS9 A;  1ZUC A;  3DCT A;  3K23 A;  4TV1 A;  5DUE A;  1U3S A;  3A3Z X;  3OMO A;  4WQP A;  3L0J A;  2GWX A;  1HG4 A;  3GWX A;  3UUA B;  4OKX A;  3IPS A;  1OVL A;  5DMF A;  5DWG A;  2AB2 A;  4MGD B;  1T76 A;  2ZL9 A;  3FXV A;  4MG8 B;  5AAV B;  1PQ9 A;  4OEY A;  3RLL A;  4PPP A;  2P1V A;  3CJW A;  4CI4 A;  1XP9 A;  5ICK A;  1PQ6 A;  2OAX A;  5EI1 A;  1YA3 A;  4MGA B;  3OKI A;  2PIQ A;  3IXP A;  4JYG A;  4MGB B;  3W0C A;  3UP3 A;  2VV4 A;  3VRT A;  4M8E A;  3OSA A;  1OSH A;  1YYE A;  3G0W A;  4NIE A;  4OKW A;  1ZDT A;  1YOK A;  4OJ4 A;  4KZM A;  1X78 A;  3AN3 A;  4EMA A;  2VSR A;  4OEA A;  3ADX A;  4DM6 A;  2B1V A;  2B50 A;  1GWR A;  1S9P A;  2HBH A;  2VV1 A;  1GS4 A;  2I4Z A;  3B0T A;  3R5M A;  5DVS A;  5KCF A;  1N46 A;  1MZN A;  4LNW A;  3GBK A;  2Q6S A;  3L1B A;  3OS8 A;  5AWJ A;  1U3R A;  2YAT A;  3RUU A;  5KCE A;  3L0L A;  4JAZ A;  1XNX A;  2YHD A;  5KRO A;  3OLS A;  4MGD A;  4Q13 A;  5DVV A;  5HCV A;  4DK8 A;  2H79 A;  4MG8 A;  4UDB A;  3VJS A;  5AAV A;  5HYK A;  1H9U A;  4YNK A;  4PP6 A;  3W0I A;  1X7J A;  4J5W C;  5KYA A;  3VT3 A;  5C4T A;  4DOR A;  4S0T A;  4APU A;  2B23 A;  1FCY A;  4OK1 A;  2HFP A;  2QTU A;  1T65 A;  2O9I A;  3FLI A;  3JZC A;  4MGA A;  3T03 A;  5A86 A;  4YPQ A;  1NYX A;  3FUR A;  4MGB A;  3OSW A;  4G1Y A;  3VJT A;  4QE8 A;  3OZ0 A;  4G1Z A;  2P4Y A;  5DXQ A;  5EC9 A;  3OLL A;  5DL4 A;  4J5X C;  3L3X A;  3VRU A;  2Q59 B;  3X31 A;  2R6Y A;  4Q50 A;  1FCZ A;  4M8H A;  1DKF A;  1YIM A;  4LNX A;  5L7E A;  4RAK A;  3CTB A;  1R5K A;  1ZEO A;  3X36 A;  3KMZ A;  3RVF A;  5KCD A;  2P1U A;  2XHS A;  4JGV A;  1R1K D;  2BJ4 B;  4ZO1 B;  2JFA A;  2Q61 A;  3DCU A;  2HCD A;  3ET1 A;  3VRW A;  1M7W A;  5DID A;  5AK2 A;  4ONI A;  3GYT A;  3WGP A;  4IW6 A;  4IU7 A;  3UUC A;  3VT5 A;  3DZY A;  5DUH A;  4IA3 A;  5DYD A;  4WPF A;  3R2A A;  2XYX A;  5ACC A;  5DSH A;  2NV7 A;  5B41 A;  4KZJ A;  4RE8 A;  5DXG A;  3W5T A;  4IA2 A;  3VSP A;  3W5P A;  5JY3 A;  3E94 A;  4ZNV A;  4OFU A;  2QR9 A;  5GIC A;  5KCT A;  1ERE A;  2AX6 A;  2Q7I A;  3H0A A;  3R5N A;  5KRA A;  2ZBS A;  3F5C B;  2Q7J A;  1XZX X;  1G2N A;  1XLS E;  3KMR A;  5DIE A;  2Q59 A;  4NQA B;  5IXK A;  4P6X A;  3WFG A;  4JL4 A;  2ZMI A;  4RMC A;  5DX3 A;  5LWP A;  2ZK3 A;  3KPZ A;  3AUQ A;  1Y9R A;  3GYU A;  3KBA A;  2J4A A;  2BJ4 A;  4N5G A;  3B68 A;  2V7C A;  3FC6 B;  3LBD A;  5APJ A;  3DT3 A;  3GD2 A;  2FVJ A;  1SR7 A;  4MG6 A;  2GPU A;  2GIU A;  5DWL A;  3AZ1 A;  1EXX A;  4FNE A;  4R2U A;  1UHL B;  3DZU D;  3FAL B;  3VSO A;  5HJP B;  5KRI A;  4G20 A;  1FD0 A;  2W8Y A;  3NSP A;  5EHJ A;  1G1U A;  4IV2 A;  5DU5 A;  1Z5X U;  3ZRB A;  2BAW A;  3F5C A;  3W5Q A;  5G44 A;  3G8I A;  3B0Q A;  4X1F A;  5DXR A;  2J14 A;  2ZK6 A;  3A2H A;  1K74 A;  3V9T A;  2O4R A;  1NAV A;  4Y29 A;  5FQR A;  2QA6 A;  4P6W A;  3S9S A;  4DQM A;  3MNO A;  3VTB A;  2V0V A;  2Q1V A;  1UOM A;  3Q95 B;  2PIT A;  4WLB A;  2HWQ A;  3D6D A;  1IE9 A;  1S19 A;  4S14 A;  3KDU A;  4QE6 A;  5DZ1 A;  3VT7 A;  1Y0S A;  3WJ4 A;  1SKX A;  1Q4X A;  2ZK2 A;  4FN9 A;  1UHL A;  4QL8 A;  4S15 A;  5DZ0 A;  3UP0 A;  3FAL A;  2ZK4 A;  3HLV A;  4REE A;  3E7C A;  2QH6 A;  4IS8 A;  1XJ7 A;  4E2J A;  4KZI A;  4ZJR A;  2AMB A;  5AVL A;  4XT9 A;  5KRC A;  5I4V A;  5DWE A;  3ADW A;  1EXA A;  1XVP A;  4A4V A;  4J5X A;  3ERT A;  5C4O A;  2NXX E;  4RUJ A;  2P1T A;  4RME A;  3X1H A;  1PRG A;  1YY4 A;  3Q95 A;  4POJ A;  4OGH A;  2R40 D;  3HVL A;  5DZH A;  3FUG A;  5G43 A;  1LBD A;  3H52 A;  2PKL A;  2ZVT A;  4ZNT A;  2P54 A;  2ZXN A;  3ILZ A;  2ZK1 A;  3KDT A;  5AAU A;  4IUI A;  4K4J A;  3B5R A;  1K4W A;  1ZGY A;  3B0W A;  5JI0 D;  3R8I A;  4RZG A;  1SQN A;  1NUO A;  2ZNQ A;  3GWS X;  3OAP A;  3OMP A;  5FQP A;  1U3Q A;  4ZNH A;  2G5O A;  1XDK B;  2ZLC A;  4NY9 A;  3HM1 A;  2REW A;  4O8F A;  1MVC A;  3VHV A;  2AA6 A;  3K22 A;  5ETH A;  1RDT D;  2AA7 A;  3CDP A;  1XLS A;  3HQ5 A;  4ZO1 X;  1E3G A;  5DMC A;  2R6W A;  1A52 A;  4N1Y A;  3OOF A;  3UUA A;  1I7G A;  1FM9 D;  1S9Q A;  2YJA B;  2ZK0 A;  1XAP A;  3QT0 A;  4G1D A;  4PF3 A;  5DXE A;  1XNN A;  5DWI A;  2PRG A;  4WVD A;  5H1E A;  2E2R A;  5DKE A;  2QAB A;  3OLF A;  3CS4 A;  1T73 A;  4G21 A;  5DX3 B;  2ZFX A;  5CJ6 A;  4MG5 A;  3V3E A;  1YIN A;  3ET2 A;  3A2J A;  1YUC A;  1KV6 A;  3AZ3 A;  3WMH A;  4OIL A;  3ADT A;  2VV0 A;  3VN2 A;  2PIN A;  5L7G A;  1Y0X X;  1HJ1 A;  1NQ7 A;  1VJB A;  2AWH A;  4MG7 B;  4QK4 A;  5IAW A;  2H77 A;  3O1D A;  3P89 A;  4PRG A;  5KRF A;  2AX7 A;  2QNV A;  3VTC A;  3KYT A;  2QGT A;  3K6P A;  2AA2 A;  2G0H A;  4OC7 A;  4G2I A;  5DK9 A;  4N73 A;  1RKG A;  3IPU A;  3AFR A;  4JYI A;  1R6G A;  5G46 A;  3DZU A;  3PRG A;  2ZKC A;  1X7R A;  4OIU A;  5KR9 A;  3HC6 A;  2JJ3 A;  2ZNO A;  3M7R A;  3CS8 A;  5DP0 A;  3BEJ A;  4CSJ A;  3X1I A;  2FSZ A;  3KWY A;  3B67 A;  3IMY A;  3MNE A;  3RY9 A;  5KCU A;  5K13 A;  1FM6 D;  1QKM A;  1Z5X E;  2HB7 A;  3V9V A;  2XYJ A; 
#chains in the Genus database with same CATH homology
 4DMA A;  4Q0A C;  1YMT A;  4IW8 A;  2Q7L A;  3HO0 A;  1M13 A;  4MDD A;  4PLE A;  4ZNS A;  5DUG A;  4IVY A;  4E4K A;  4OHA A;  3KFC A;  4ZJW A;  3DR1 A;  1XQ3 A;  4R06 A;  3E00 A;  1LV2 A;  1NQ2 A;  2Q1H A;  2QW4 A;  2YJD A;  3L3Z A;  2AA5 A;  3ET0 A;  2Q7K A;  1T74 A;  4TUZ B;  4MG7 A;  4UDC A;  2OCF A;  2J7X A;  3W0G A;  5KRJ A;  3PLZ A;  1T7R A;  1G5Y A;  5E0X A;  2OVH A;  1X7B A;  3L03 A;  4OKT A;  1U9E A;  4LBD A;  4OEZ A;  2ACL B;  1PZL A;  3A40 X;  1NRL A;  2LBD A;  2NXX A;  3HZF A;  2QE4 A;  4XLD A;  1KNU A;  3K8S A;  5E19 A;  5E1C A;  4G2H A;  1FBY A;  1BSX A;  1R20 A;  2XKW A;  4PLD A;  3D5F A;  3W5R A;  1OT7 A;  1XP6 A;  3BQD A;  2I0G A;  4IQR A;  5EGV A;  2GP7 A;  1ILG A;  3WFF A;  5DLR A;  3FS1 A;  3KMG A;  4OED A;  4MG9 B;  1I38 A;  1T7T A;  3ZR7 A;  4E4Q A;  3W0J A;  1PCG A;  4CI5 A;  3GN8 A;  4IA7 A;  4TUZ A;  3OS8 C;  5HZC A;  3VRV A;  4ZNU A;  2POG A;  3LMP A;  3A2I A;  4PP5 A;  5IZ0 A;  4K6I A;  1K7L A;  4QM0 A;  1T7M A;  3EYB A;  5C4U A;  4EM9 A;  1ILH A;  5APH A;  1S0X A;  4WHF A;  4UDA A;  3RUT A;  2ACL A;  2PIR A;  2IHQ A;  3ERD A;  2AX9 A;  5DKG A;  3A78 A;  5DKB A;  5SYZ A;  1YJE A;  2ZXZ A;  1QKT A;  3FC6 A;  3VT6 A;  3MNP A;  1FCX A;  3IA6 A;  5B5B A;  3N00 A;  3VJI A;  2Q3Y A;  4RZF A;  2Q5G A;  3OSI A;  5FQS A;  1RDT A;  2Q6R A;  5AZV A;  4J5W A;  5HJP A;  3NOA A;  5L11 A;  3PBA A;  4DOS A;  4MG9 A;  2Q5P A;  3DZY D;  1TXI A;  5KRH A;  5JJM B;  2OM9 A;  1N4H A;  1YP0 A;  2POB A;  4FGY A;  4PPS A;  1UPW A;  2A3I A;  2AO6 A;  2NPA A;  1NDE A;  3OOK A;  2P7G A;  3H0A D;  3W0H A;  5G42 A;  3W0A A;  3R8A A;  2GL8 A;  3P0U A;  4OIV A;  2I0J A;  3TKC A;  4NB6 A;  1MV9 A;  1S0Z A;  5M96 A;  4A4W A;  2ZK5 A;  4XHD A;  3NSQ A;  1L2I A;  2IOK A;  4HEE X;  4NUF A;  5E14 A;  2PIW A;  5DV6 A;  3V4A A;  1OSV A;  1NQ0 A;  5FQV A;  4PXM A;  2PIV A;  3G9E A;  1A28 A;  4IV4 A;  4OFR A;  2O4J A;  5DXB B;  3WT6 A;  3ADS A;  3IPQ A;  5DY8 A;  5AZT A;  2ZNN A;  5KCW A;  3SZ1 A;  2YFE A;  2QA8 B;  2ZAS A;  4PVU A;  1R1K A;  1QKN A;  5JJM A;  3AUN A;  3FEI A;  3V9Y A;  5KRK A;  3AUR A;  3V49 A;  2VST A;  1FM6 A;  1X7E A;  3B1M A;  3SP6 A;  3W0Y A;  1I7I A;  1XQC A;  1XP1 A;  3CDS A;  4OZR U;  3FEJ A;  2PIU A;  1K74 D;  2ABI A;  2I4J A;  2P7Z A;  5DKS A;  5C4S A;  2OVM A;  1YOW A;  2ZMH A;  5DXP A;  4JYH A;  5AYG A;  3OMM A;  3VT8 A;  5KYJ A;  3PCU A;  4RUO X;  2EWP A;  2FAI A;  3D57 A;  4RUP A;  5DXB A;  2ZMJ A;  2NW4 A;  3AZ2 A;  3L0E A;  2HAR A;  5E7V A;  5APK A;  4R6S A;  5G5W A;  3VHU A;  3VT4 A;  4ZN9 A;  1WM0 X;  3R8D A;  2HAS A;  5HJS A;  3WWR A;  2QA8 A;  1DKF B;  3AN4 A;  1XDK A;  1XIU A;  4X1G A;  3JZB A;  1T5Z A;  3ADU A;  2P15 A;  5DWJ A;  4OZT U;  5F9B A;  1P93 A;  2G0G A;  2PIX A;  3B0R A;  1SJ0 A;  2JFA B;  4B7W A;  5E0W A;  4BCR A;  3TKM A;  3UVV B;  2ZLA A;  2GPP A;  4F9M A;  3D24 A;  3OMQ A;  2PNU A;  3ZQT A;  1XV9 B;  2ZY0 A;  2AAX A;  3A9E B;  4OAR A;  4LSJ A;  4N8R A;  2QZO B;  3UU7 B;  2PIO A;  2P7A A;  3U9Q A;  1NHZ A;  5DZ3 A;  2YLO A;  2QXM A;  5AWK A;  3HC5 A;  2HAM A;  3WT5 A;  2QGW A;  3PEQ A;  3P8X A;  4ITE A;  1PQC A;  3B3K A;  3IXP D;  5DIG A;  5DZI A;  5HYR A;  1TFC A;  2JF9 A;  2QMV A;  2GPO A;  4XI3 A;  4J24 A;  4OH6 A;  4ZOM A;  1X76 A;  5KCC A;  3UVV A;  4FHI A;  2GPV A;  2Q5S A;  3CWD A;  4FHH A;  4RFW A;  5DV8 A;  2AXA A;  5DV3 A;  4IVW A;  3TX7 B;  4DK7 A;  2B1Z A;  1XV9 A;  3A9E A;  5G45 A;  2YLQ A;  2QZO A;  2AX8 A;  3UU7 A;  1ERR A;  5L7H A;  3P88 A;  2Q70 A;  4J26 A;  4OKB A;  1I37 A;  3CLD A;  3DY6 A;  3VI8 A;  2HWR A;  3SP9 A;  4XAO A;  2HB8 A;  4S0S A;  4MGC A;  1P8D A;  2GTK A;  3B66 A;  2R40 A;  3HOD A;  2Q8S A;  3RLJ A;  1ZKY A;  4POH A;  3B65 A;  5DVC A;  1GWX A;  2QPY A;  5DRM A;  4RMD A;  3BC5 A;  4UDD A;  1RJK A;  5KD9 A;  1T7F A;  5KRM A;  5E15 A;  2HC4 A;  4LTW A;  4WHG A;  4YT1 A;  3VJH A;  2ZNP A;  5DYB A;  2AM9 A;  2Q60 A;  3UUD B;  2ATH A;  5DI7 A;  4IWF A;  1T63 A;  4ITF A;  3WTQ A;  2G44 A;  4PWL A;  4ZN7 A;  4DM8 A;  1G50 A;  1N83 A;  2YLP A;  2Z4B A;  3O1E A;  4OLM A;  4RWV A;  3WJ5 A;  5DRJ A;  1ZAF A;  1NQ1 A;  2AYR A;  4XUM A;  1XB7 A;  1E3K A;  4IA1 A;  5FQT A;  4HLW A;  2VV2 A;  3GZ9 A;  1DB1 A;  4QJR A;  3G8O A;  1ZH7 A;  5KRL A;  3ADV A;  4IWC A;  1GWQ A;  2QSE A;  5LGA A;  2I4P A;  1XVP B;  5GIE A;  3OGT A;  1ZDU A;  2YLY A;  3AX8 A;  1M2Z A;  1FM9 A;  3V3Q A;  4OZR E;  3F7D A;  2XYW A;  4TV1 B;  5AVI A;  1XOW A;  2Q6J A;  3E00 D;  4REF A;  1RKH A;  4XUH A;  4ZNW A;  2AMA A;  5GT4 A;  3CQV A;  3ET3 A;  3PO9 A;  1OVL B;  2OZ7 A;  5G3J A;  3UUD A;  2PJL A;  5DXK A;  1NAX A;  2F4B A;  2QXS A;  1Z95 A;  2IOG A;  3WT7 A;  4YMQ A;  3OMK A;  1XPC A;  4XTA A;  4RZE A;  1QKU A;  4ZI1 A;  4A2J A;  3OZJ A;  3VT9 A;  3OKH A;  4K7A A;  2PIP L;  2VV3 A;  1T79 A;  1L2J A;  5DXM A;  3VHW A;  4L96 A;  4OJ9 A;  5DTV A;  1IE8 A;  2ZXM A;  1UPV A;  1KKQ A;  4OJB A;  2HVC A;  3VTD A;  2VV4 B;  1RK3 A;  4L98 A;  3D90 A;  3ZRA A;  3R29 A;  1R20 D;  2Z4J A;  3CS6 A;  4OZT E;  1PK5 A;  2J7Y A;  4PP3 A;  5GID A;  5EJV A;  3TY0 A;  4OH5 A;  1PDU A;  5EIT A;  2OUZ A;  2VV1 B;  3OS9 A;  1ZUC A;  3DCT A;  3K23 A;  4TV1 A;  5DUE A;  1U3S A;  3A3Z X;  3OMO A;  4WQP A;  3L0J A;  2GWX A;  1HG4 A;  3GWX A;  3UUA B;  4OKX A;  3IPS A;  1OVL A;  5DMF A;  5DWG A;  2AB2 A;  4MGD B;  1T76 A;  2ZL9 A;  3FXV A;  4MG8 B;  5AAV B;  1PQ9 A;  4OEY A;  3RLL A;  4PPP A;  2P1V A;  3CJW A;  4CI4 A;  1XP9 A;  5ICK A;  1PQ6 A;  2OAX A;  5EI1 A;  1YA3 A;  4MGA B;  3OKI A;  2PIQ A;  3IXP A;  4JYG A;  4MGB B;  3W0C A;  3UP3 A;  2VV4 A;  3VRT A;  4M8E A;  3OSA A;  1OSH A;  1YYE A;  3G0W A;  4NIE A;  4OKW A;  1ZDT A;  1YOK A;  4OJ4 A;  4KZM A;  1X78 A;  3AN3 A;  4EMA A;  2VSR A;  4OEA A;  3ADX A;  4DM6 A;  2B1V A;  2B50 A;  1GWR A;  1S9P A;  2HBH A;  2VV1 A;  1GS4 A;  2I4Z A;  3B0T A;  3R5M A;  5DVS A;  5KCF A;  1N46 A;  1MZN A;  4LNW A;  3GBK A;  2Q6S A;  3L1B A;  3OS8 A;  5AWJ A;  1U3R A;  2YAT A;  3RUU A;  5KCE A;  3L0L A;  4JAZ A;  1XNX A;  2YHD A;  5KRO A;  3OLS A;  4MGD A;  4Q13 A;  5DVV A;  5HCV A;  4DK8 A;  2H79 A;  4MG8 A;  4UDB A;  3VJS A;  5AAV A;  5HYK A;  1H9U A;  4YNK A;  4PP6 A;  3W0I A;  1X7J A;  4J5W C;  5KYA A;  3VT3 A;  5C4T A;  4DOR A;  4S0T A;  4APU A;  2B23 A;  1FCY A;  4OK1 A;  2HFP A;  2QTU A;  1T65 A;  2O9I A;  3FLI A;  3JZC A;  4MGA A;  3T03 A;  5A86 A;  4YPQ A;  1NYX A;  3FUR A;  4MGB A;  3OSW A;  4G1Y A;  3VJT A;  4QE8 A;  3OZ0 A;  4G1Z A;  2P4Y A;  5DXQ A;  5EC9 A;  3OLL A;  5DL4 A;  4J5X C;  3L3X A;  3VRU A;  2Q59 B;  3X31 A;  2R6Y A;  4Q50 A;  1FCZ A;  4M8H A;  1DKF A;  1YIM A;  4LNX A;  5L7E A;  4RAK A;  3CTB A;  1R5K A;  1ZEO A;  3X36 A;  3KMZ A;  3RVF A;  5KCD A;  2P1U A;  2XHS A;  4JGV A;  1R1K D;  2BJ4 B;  4ZO1 B;  2JFA A;  2Q61 A;  3DCU A;  2HCD A;  3ET1 A;  3VRW A;  1M7W A;  5DID A;  5AK2 A;  4ONI A;  3GYT A;  3WGP A;  4IW6 A;  4IU7 A;  3UUC A;  3VT5 A;  3DZY A;  5DUH A;  4IA3 A;  5DYD A;  4WPF A;  3R2A A;  2XYX A;  5ACC A;  5DSH A;  2NV7 A;  5B41 A;  4KZJ A;  4RE8 A;  5DXG A;  3W5T A;  4IA2 A;  3VSP A;  3W5P A;  5JY3 A;  3E94 A;  4ZNV A;  4OFU A;  2QR9 A;  5GIC A;  5KCT A;  1ERE A;  2AX6 A;  2Q7I A;  3H0A A;  3R5N A;  5KRA A;  2ZBS A;  3F5C B;  2Q7J A;  1XZX X;  1G2N A;  1XLS E;  3KMR A;  5DIE A;  2Q59 A;  4NQA B;  5IXK A;  4P6X A;  3WFG A;  4JL4 A;  2ZMI A;  4RMC A;  5DX3 A;  5LWP A;  2ZK3 A;  3KPZ A;  3AUQ A;  1Y9R A;  3GYU A;  3KBA A;  2J4A A;  2BJ4 A;  4N5G A;  3B68 A;  2V7C A;  3FC6 B;  3LBD A;  5APJ A;  3DT3 A;  3GD2 A;  2FVJ A;  1SR7 A;  4MG6 A;  2GPU A;  2GIU A;  5DWL A;  3AZ1 A;  1EXX A;  4FNE A;  4R2U A;  1UHL B;  3DZU D;  3FAL B;  3VSO A;  5HJP B;  5KRI A;  4G20 A;  1FD0 A;  2W8Y A;  3NSP A;  5EHJ A;  1G1U A;  4IV2 A;  5DU5 A;  1Z5X U;  3ZRB A;  2BAW A;  3F5C A;  3W5Q A;  5G44 A;  3G8I A;  3B0Q A;  4X1F A;  5DXR A;  2J14 A;  2ZK6 A;  3A2H A;  1K74 A;  3V9T A;  2O4R A;  1NAV A;  4Y29 A;  5FQR A;  2QA6 A;  4P6W A;  3S9S A;  4DQM A;  3MNO A;  3VTB A;  2V0V A;  2Q1V A;  1UOM A;  3Q95 B;  2PIT A;  4WLB A;  2HWQ A;  3D6D A;  1IE9 A;  1S19 A;  4S14 A;  3KDU A;  4QE6 A;  5DZ1 A;  3VT7 A;  1Y0S A;  3WJ4 A;  1SKX A;  1Q4X A;  2ZK2 A;  4FN9 A;  1UHL A;  4QL8 A;  4S15 A;  5DZ0 A;  3UP0 A;  3FAL A;  2ZK4 A;  3HLV A;  4REE A;  3E7C A;  2QH6 A;  4IS8 A;  1XJ7 A;  4E2J A;  4KZI A;  4ZJR A;  2AMB A;  5AVL A;  4XT9 A;  5KRC A;  5I4V A;  5DWE A;  3ADW A;  1EXA A;  1XVP A;  4A4V A;  4J5X A;  3ERT A;  5C4O A;  2NXX E;  4RUJ A;  2P1T A;  4RME A;  3X1H A;  1PRG A;  1YY4 A;  3Q95 A;  4POJ A;  4OGH A;  2R40 D;  3HVL A;  5DZH A;  3FUG A;  5G43 A;  1LBD A;  3H52 A;  2PKL A;  2ZVT A;  4ZNT A;  2P54 A;  2ZXN A;  3ILZ A;  2ZK1 A;  3KDT A;  5AAU A;  4IUI A;  4K4J A;  3B5R A;  1K4W A;  1ZGY A;  3B0W A;  5JI0 D;  3R8I A;  4RZG A;  1SQN A;  1NUO A;  2ZNQ A;  3GWS X;  3OAP A;  3OMP A;  5FQP A;  1U3Q A;  4ZNH A;  2G5O A;  1XDK B;  2ZLC A;  4NY9 A;  3HM1 A;  2REW A;  4O8F A;  1MVC A;  3VHV A;  2AA6 A;  3K22 A;  5ETH A;  1RDT D;  2AA7 A;  3CDP A;  1XLS A;  3HQ5 A;  4ZO1 X;  1E3G A;  5DMC A;  2R6W A;  1A52 A;  4N1Y A;  3OOF A;  3UUA A;  1I7G A;  1FM9 D;  1S9Q A;  2YJA B;  2ZK0 A;  1XAP A;  3QT0 A;  4G1D A;  4PF3 A;  5DXE A;  1XNN A;  5DWI A;  2PRG A;  4WVD A;  5H1E A;  2E2R A;  5DKE A;  2QAB A;  3OLF A;  3CS4 A;  1T73 A;  4G21 A;  5DX3 B;  2ZFX A;  5CJ6 A;  4MG5 A;  3V3E A;  1YIN A;  3ET2 A;  3A2J A;  1YUC A;  1KV6 A;  3AZ3 A;  3WMH A;  4OIL A;  3ADT A;  2VV0 A;  3VN2 A;  2PIN A;  5L7G A;  1Y0X X;  1HJ1 A;  1NQ7 A;  1VJB A;  2AWH A;  4MG7 B;  4QK4 A;  5IAW A;  2H77 A;  3O1D A;  3P89 A;  4PRG A;  5KRF A;  2AX7 A;  2QNV A;  3VTC A;  3KYT A;  2QGT A;  3K6P A;  2AA2 A;  2G0H A;  4OC7 A;  4G2I A;  5DK9 A;  4N73 A;  1RKG A;  3IPU A;  3AFR A;  4JYI A;  1R6G A;  5G46 A;  3DZU A;  3PRG A;  2ZKC A;  1X7R A;  4OIU A;  5KR9 A;  3HC6 A;  2JJ3 A;  2ZNO A;  3M7R A;  3CS8 A;  5DP0 A;  3BEJ A;  4CSJ A;  3X1I A;  2FSZ A;  3KWY A;  3B67 A;  3IMY A;  3MNE A;  3RY9 A;  5KCU A;  5K13 A;  1FM6 D;  1QKM A;  1Z5X E;  2HB7 A;  3V9V A;  2XYJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...