3HLVA

Crystal structure of human estrogen receptor alpha ligand-binding domain in complex with a glucocorticoid receptor interacting protein 1 nr box ii peptide and 16-alpha-hydroxy-estrone ((8s,9r,13s,14r,16r)-3,16-dihydroxy-13-methyl-7,8,9,11,12,14,15, 16-octahydro-6h-cyclopenta[a]phenanthren-17-one
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
245
structure length
240
Chain Sequence
NSLALSLTADQMVSALLDAEPPILYSEYDPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of human alphaER-LBD in complex with GRIP peptide and 16alpha-hydroxyestrone
rcsb
molecule keywords Estrogen receptor
molecule tags Transcription
source organism Homo sapiens
total genus 79
structure length 240
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 3hlvA00
3ADTA 4PLDA 1I7GA 3M7RA 3D57A 4N5GA 2GPVA 4S14A 1ZAFA 1HJ1A 2AA5A 4DK8A 4IQRA 3B0WA 3V49A 4QE8A 5KYJA 2ZNOA 3B67A 4TV1A 2POBA 3VHWA 1XP9A 3OSWA 5DIDA 1ILGA 5G46A 4MGBA 3B0RA 3VI8A 2BJ4A 1T7MA 3N00A 2OM9A 2XYJA 5DYDA 4OFRA 2P7GA 2ZKCA 3ADVA 2AMAA 4JAZA 4ZNSA 5DZ3A 1XLSE 3L1BA 4XAOA 5G43A 4KZIA 2PIVA 1PZLA 1PK5A 3NSQA 2VV4B 2W8YA 4OH6A 1LBDA 4ZNTA 4PRGA 5E1CA 1G50A 4RZEA 1XLSA 3G9EA 3D90A 3IA6A 5LWPA 4LBDA 3L0JA 3OSIA 3VT4A 1T5ZA 2QSEA 4KZJA 3SZ1A 2ZK0A 3TKMA 4OKWA 5DZIA 3DCUA 2Q5PA 4OJ9A 1FCZA 2JFAA 3RUUA 3UP3A 5C4TA 3K8SA 5AWJA 3VJSA 4X1GA 1N4HA 2Q5GA 2YHDA 5HZCA 1XDKA 3O1EA 4NQAB 2I0GA 3IPSA 2LBDA 5E19A 3UUAB 2QH6A 3W5QA 3VSPA 3HZFA 2NPAA 2P15A 4XTAA 3ET3A 2VV3A 4IUIA 1ZEOA 2GP7A 3FEJA 1U3SA 3BC5A 4MGAB 5DMFA 3AFRA 1S9PA 2IOKA 3AX8A 5G44A 2EWPA 2O4JA 2IHQA 3AUQA 4UDAA 3IMYA 3U9QA 3WTQA 3OZ0A 2V0VA 5DWIA 1GWRA 2VV1B 4XUMA 4DM8A 3WT7A 4WVDA 4OGHA 2P4YA 1M13A 3B65A 2GL8A 2ACLA 3A2IA 4L98A 4POJA 5DKBA 1YUCA 2QMVA 2YJAB 2XHSA 2NXXA 3LMPA 2AAXA 1T63A 3A78A 2ZNQA 4QL8A 3G8OA 3PBAA 5EGVA 1X78A 2ZK6A 3OOFA 3KDTA 4FHIA 3RLJA 1A28A 3FEIA 4J5WA 3RLLA 4IV2A 4B7WA 5HYKA 4A2JA 1YIMA 4ZO1B 4ZJWA 1MVCA 4G21A 1YA3A 3VT8A 1X7BA 3OMKA 4OFUA 4MGDB 3V9VA 3CS4A 1YMTA 1K74D 1UPWA 2ZK1A 2R6WA 1K7LA 4OKBA 5KRFA 3OZJA 2HFPA 5JJMB 1G2NA 2HC4A 2QA8A 1MZNA 1XPCA 1Z5XU 3CWDA 4WHGA 4DK7A 3SP6A 4MG8A 5DV3A 3W0IA 3FALB 1NQ2A 2QE4A 1ILHA 3WFFA 2POGA 1DKFB 1UPVA 2HCDA 2YJDA 3Q95B 5ACCA 5A86A 1XP6A 3CDSA 3G0WA 4J5WC 4LTWA 3VSOA 1XV9A 3ZQTA 4IVWA 1K74A 4LSJA 5DSHA 3UUCA 4S15A 1FM6D 4TUZA 2Q6SA 3LBDA 1S9QA 3A9EA 3FC6B 4MG7B 1NRLA 1KKQA 2P1TA 3DY6A 3KMGA 3VRWA 3FUGA 5KCWA 4WLBA 1RJKA 3B5RA 4K6IA 4XLDA 3P0UA 3V4AA 4XI3A 5DVCA 5DX3A 5DXGA 1T73A 4APUA 1T79A 5K13A 4UDDA 5L11A 1R1KD 2QGTA 4P6WA 5DIEA 1SJ0A 5DVSA 5ICKA 4ITEA 3GWSX 1FM6A 4RUOX 4E4QA 4RWVA 3OKIA 4RFWA 5G45A 2A3IA 3OMPA 3A40X 4JL4A 1YY4A 4NIEA 4FGYA 3DT3A 5DWGA 2ZK2A 4F9MA 5APHA 3GWXA 5E0WA 5H1EA 3X1HA 2PIXA 5KCDA 1OVLB 1R1KA 3E94A 4OH5A 1UHLB 1T65A 3L0LA 5B41A 1FD0A 3HODA 4OEDA 5DKSA 2PIQA 2QA6A 3X1IA 5HJSA 2Q3YA 5C4OA 2OUZA 3R8AA 3GYTA 4OIUA 1VJBA 3A3ZX 3L3ZA 2HB7A 2ZLCA 4CI4A 4N8RA 3ET2A 4JYGA 2AX7A 3GD2A 4NB6A 2I0JA 4PLEA 2I4JA 4DORA 4RZGA 2ZNPA 4LNWA 4PPPA 2ZMIA 3PLZA 3QT0A 1XB7A 2ABIA 2ZBSA 3UVVB 2GTKA 3KMZA 2NW4A 5EHJA 4YNKA 2QXSA 3DR1A 3UUAA 1RKGA 4CSJA 2ZFXA 2B50A 4ZJRA 3B0QA 3VT5A 2AYRA 2FVJA 2Q59B 3H52A 4G1ZA 4MGAA 4PXMA 5HJPB 4RMCA 5DI7A 3WJ4A 3W0JA 3MNEA 2QNVA 4POHA 2J7YA 5DZ1A 1NAXA 2PIWA 5AVLA 5DXMA 1KV6A 3R2AA 2P7AA 1Z5XE 2Q7LA 3S9SA 5AZTA 4RMDA 5AAVB 3G8IA 2ATHA 2G5OA 5C4SA 1XVPB 2PNUA 3JZBA 3HVLA 1PCGA 4OHAA 4BCRA 4LNXA 3W5RA 3W5TA 4G1YA 3W5PA 5DMCA 1E3KA 2ZY0A 2IOGA 4OJ4A 2HASA 4Q50A 3TKCA 2GPOA 2Q8SA 1IE9A 4REFA 1YJEA 1G5YA 5FQSA 2J4AA 4ZNHA 5GIEA 4K7AA 5DWLA 3K6PA 4S0SA 2GPUA 5DRJA 3UUDB 1N83A 2QZOB 3VJTA 3NSPA 4E2JA 4MGDA 4A4VA 3JZCA 1U3QA 3OMMA 1XQCA 3FLIA 2G44A 2H77A 3VTBA 4IA2A 2G0HA 4Q0AC 3VHVA 3X36A 4WHFA 4J5XA 5KCUA 4UDBA 4ZN9A 3E7CA 3HM1A 5JJMA 1NQ7A 1ZH7A 3WMHA 1T7TA 1ZDTA 5KD9A 2P54A 1XNNA 3D24A 3FALA 5KRIA 5AAUA 4R06A 3R5NA 2OAXA 3NOAA 4OEYA 3HQ5A 5B5BA 1G1UA 1DKFA 3Q95A 5KRAA 2AX8A 1EXXA 4HEEX 1UOMA 4QE6A 5DZ0A 1R6GA 4IU7A 1NQ0A 5DUHA 5DUGA 5C4UA 3DCTA 4REEA 2Q7KA 2QTUA 2PKLA 2OCFA 1LV2A 1KNUA 2PIOA 3F5CB 3FC6A 4MG7A 5E0XA 3ADUA 4S0TA 2AB2A 2AX9A 3F7DA 1K4WA 1ZKYA 1YOWA 2VV0A 5DLRA 4IA3A 4O8FA 3WFGA 3SP9A 3VHUA 3B68A 2Q6JA 5FQPA 3R8DA 2XYWA 3R8IA 3VJIA 3ZR7A 3DZUD 3IPUA 4OZTE 3K22A 4MG9B 4QK4A 4FHHA 3AZ3A 2QXMA 4QM0A 1X7EA 2AX6A 3CTBA 5DUEA 2HVCA 5KR9A 4ONIA 1FCXA 2H79A 3HC5A 3OS8A 2JJ3A 2OZ7A 1RDTD 5G42A 3VTCA 4HLWA 4J26A 3W0HA 3ILZA 3UU7B 1M7WA 4YMQA 3V9TA 2Q7JA 5DWEA 1RK3A 4XT9A 4FN9A 2XYXA 3OLFA 2Q7IA 3AN3A 5DVVA 1PQ9A 2YLQA 5DXEA 5KRHA 5DY8A 3DZUA 1A52A 3B3KA 5L7GA 1M2ZA 3P8XA 1OVLA 3ADSA 2F4BA 2NV7A 1UHLA 3W0GA 3CJWA 2PJLA 5FQTA 3WT5A 4PP3A 5AWKA 5DWJA 4G2HA 4ZN7A 3OS9A 4ZNVA 1Z95A 3B1MA 4OLMA 2Q5SA 4IW8A 2PITA 5DXBB 1RDTA 3L0EA 2I4PA 1H9UA 2B1VA 4EM9A 3PCUA 2HARA 1QKMA 3PRGA 3EYBA 3DZYD 3L3XA 5DKGA 5DV8A 4UDCA 4IS8A 1ERRA 5DIGA 2R6YA 1SR7A 1BSXA 3UVVA 4DQMA 5E7VA 3AURA 3B66A 2AA7A 2VV4A 4OZRE 1EREA 3O1DA 3OMOA 5HYRA 1YP0A 5DP0A 3VRUA 4NY9A 2PRGA 2YFEA 3KYTA 5IZ0A 4OZTU 4G2IA 3GZ9A 2AA2A 2Q59A 3VJHA 2AMBA 4OKXA 3CLDA 1OSHA 1X7RA 5EJVA 3PO9A 2AM9A 2AA6A 2ZXNA 1N46A 4M8EA 3DZYA 4ZNWA 2HAMA 5DXRA 4OIVA 5EC9A 1FBYA 3VT3A 2QGWA 2VSTA 2B1ZA 2R40D 5G3JA 5GICA 1PDUA 5AAVA 4IV4A 5AK2A 1GS4A 4DMAA 3ERDA 4RUJA 5E15A 4YT1A 1XVPA 1XAPA 4QJRA 4L96A 3L03A 1ZDUA 2PINA 5KRCA 5KCCA 1R5KA 3CQVA 2GWXA 2REWA 2YLPA 4E4KA 2FAIA 1NDEA 1ZUCA 2AO6A 4CI5A 4JGVA 2ZK3A 2Z4JA 3CS8A 1YINA 4RUPA 5GT4A 5SYZA 5L7HA 3ZRAA 4FNEA 2FSZA 5CJ6A 1P93A 4X1FA 2VV1A 3VT7A 2YLOA 3UUDA 1EXAA 2QZOA 3VT9A 3VTDA 3K23A 5KRLA 1QKTA 4ZO1X 2R40A 2ZXZA 5GIDA 3TY0A 4DOSA 1NQ1A 1Q4XA 1XP1A 2PIUA 3P89A 4PWLA 3GN8A 3WJ5A 1T7FA 2E2RA 5KYAA 4PP5A 3V3QA 5L7EA 3OLSA 4R2UA 2ZMJA 4DM6A 4TV1B 5AYGA 1WM0X 2J7XA 2QABA 5G5WA 4OZRU 1SKXA 4MGBB 2BJ4B 5DYBA 4IVYA 1PRGA 5DK9A 2VSRA 5AVIA 2HBHA 4RMEA 3OSAA 3KDUA 1NAVA 5IXKA 1I38A 5DZHA 5I4VA 5DL4A 5KRMA 1TFCA 2OVHA 4JYIA 3PEQA 5KRJA 1SQNA 2J14A 2JF9A 3HLVA 4K4JA 3BQDA 1L2JA 4IWCA 5DKEA 5DV6A 4YPQA 1QKNA 4EMAA 3ERTA 3A2HA 5DXKA 3AN4A 2P1VA 4NUFA 5DXQA 3RVFA 3MNPA 2V7CA 3OLLA 1S0ZA 3F5CA 5DRMA 2O9IA 4RZFA 4MGCA 3OOKA 4IA7A 3FURA 2O4RA 1GWQA 1HG4A 4ZNUA 1S0XA 1DB1A 1PQ6A 3E00D 2HWQA 3H0AD 3W0CA 3KFCA 1YYEA 2JFAB 4OARA 3ADXA 2AWHA 5KRKA 2B23A 2G0GA 1L2IA 2NXXE 4MG6A 3KPZA 4MG9A 5LGAA 5IAWA 1XDKB 3WWRA 4PF3A 3WGPA 3GBKA 1T74A 5FQVA 2ZMHA 3A2JA 1IE8A 4RAKA 5JI0D 3WT6A 2HWRA 4ZOMA 5ETHA 4IW6A 1XIUA 3UU7A 4KZMA 1TXIA 1RKHA 2YATA 4J5XC 3VN2A 2Z4BA 4OKTA 2P1UA 3W0YA 4A4WA 3E00A 2Q1VA 3CS6A 3H0AA 3R5MA 3V9YA 1Y0XX 3R29A 1XNXA 4MG5A 4OC7A 2Q1HA 2ZVTA 4PPSA 3KBAA 2YLYA 1Y9RA 4Y29A 3V3EA 1NHZA 2OVMA 3IXPD 4P6XA 2ACLB 1I7IA 2ZASA 2AXAA 1R20D 4WPFA 4XUHA 3BEJA 4ITFA 4OILA 2VV2A 3OKHA 3B0TA 1GWXA 5KCTA 2Q61A 1XJ7A 1MV9A 5DXBA 5F9BA 3ZRBA 1FM9D 5M96A 4XHDA 1P8DA 2ZK5A 3KWYA 4N1YA 4WQPA 5FQRA 3FXVA 3W0AA 5KCFA 1T76A 2GPPA 4RE8A 5APJA 1XOWA 3AUNA 4N73A 1XZXX 2XKWA 4OEAA 5KCEA 3VRVA 2GIUA 3IXPA 2PIRA 2ZK4A 4M8HA 3P88A 4OEZA 1U9EA 3X31A 1R20A 2BAWA 3D6DA 4JYHA 5E14A 3OAPA 5APKA 2HB8A 2QA8B 1NYXA 5EI1A 3RUTA 3VRTA 2ZL9A 2ZXMA 1PQCA 4MG8B 3HC6A 1FM9A 2I4ZA 5KROA 3AZ1A 3ET0A 4J24A 2QR9A 3AZ2A 4Q13A 4ZI1A 1S19A 1ZGYA 3UP0A 3FS1A 5HCVA 5EITA 1OT7A 2ZLAA 2Q6RA 3IPQA 1FCYA 2PIPL 3OS8C 4G1DA 5DU5A 1U3RA 2Q70A 2QPYA 2QW4A 1XV9B 4OJBA 1NUOA 5DXPA 3CDPA 1YOKA 3OGTA 2ZNNA 4MDDA 4OK1A 3TX7B 4IWFA 1QKUA 4TUZB 3OMQA 3ET1A 4IA1A 5DTVA 3T03A 3A9EB 3GYUA 4PVUA 1Y0SA 1T7RA 3ADWA 5HJPA 1E3GA 1XQ3A 3D5FA 3MNOA 4G20A 3KMRA 3RY9A 4R6SA 1X7JA 3HO0A 2Q60A 4PP6A 3VT6A 5DX3B 2P7ZA 5AZVA 1I37A 1X76A 1OSVA 5JY3A
chains in the Genus database with same CATH superfamily
3ADTA 4PLDA 1I7GA 3M7RA 3D57A 4N5GA 2GPVA 4S14A 1ZAFA 1HJ1A 2AA5A 4DK8A 4IQRA 3B0WA 3V49A 4QE8A 5KYJA 2ZNOA 3B67A 4TV1A 2POBA 3VHWA 1XP9A 3OSWA 5DIDA 1ILGA 5G46A 4MGBA 3B0RA 3VI8A 2BJ4A 1T7MA 3N00A 2OM9A 2XYJA 5DYDA 4OFRA 2P7GA 2ZKCA 3ADVA 2AMAA 4JAZA 4ZNSA 5DZ3A 1XLSE 3L1BA 4XAOA 5G43A 4KZIA 2PIVA 1PZLA 1PK5A 3NSQA 2VV4B 2W8YA 4OH6A 1LBDA 4ZNTA 4PRGA 5E1CA 1G50A 4RZEA 1XLSA 3G9EA 3D90A 3IA6A 5LWPA 4LBDA 3L0JA 3OSIA 3VT4A 1T5ZA 2QSEA 4KZJA 3SZ1A 2ZK0A 3TKMA 4OKWA 5DZIA 3DCUA 2Q5PA 4OJ9A 1FCZA 2JFAA 3RUUA 3UP3A 5C4TA 3K8SA 5AWJA 3VJSA 4X1GA 1N4HA 2Q5GA 2YHDA 5HZCA 1XDKA 3O1EA 4NQAB 2I0GA 3IPSA 2LBDA 5E19A 3UUAB 2QH6A 3W5QA 3VSPA 3HZFA 2NPAA 2P15A 4XTAA 3ET3A 2VV3A 4IUIA 1ZEOA 2GP7A 3FEJA 1U3SA 3BC5A 4MGAB 5DMFA 3AFRA 1S9PA 2IOKA 3AX8A 5G44A 2EWPA 2O4JA 2IHQA 3AUQA 4UDAA 3IMYA 3U9QA 3WTQA 3OZ0A 2V0VA 5DWIA 1GWRA 2VV1B 4XUMA 4DM8A 3WT7A 4WVDA 4OGHA 2P4YA 1M13A 3B65A 2GL8A 2ACLA 3A2IA 4L98A 4POJA 5DKBA 1YUCA 2QMVA 2YJAB 2XHSA 2NXXA 3LMPA 2AAXA 1T63A 3A78A 2ZNQA 4QL8A 3G8OA 3PBAA 5EGVA 1X78A 2ZK6A 3OOFA 3KDTA 4FHIA 3RLJA 1A28A 3FEIA 4J5WA 3RLLA 4IV2A 4B7WA 5HYKA 4A2JA 1YIMA 4ZO1B 4ZJWA 1MVCA 4G21A 1YA3A 3VT8A 1X7BA 3OMKA 4OFUA 4MGDB 3V9VA 3CS4A 1YMTA 1K74D 1UPWA 2ZK1A 2R6WA 1K7LA 4OKBA 5KRFA 3OZJA 2HFPA 5JJMB 1G2NA 2HC4A 2QA8A 1MZNA 1XPCA 1Z5XU 3CWDA 4WHGA 4DK7A 3SP6A 4MG8A 5DV3A 3W0IA 3FALB 1NQ2A 2QE4A 1ILHA 3WFFA 2POGA 1DKFB 1UPVA 2HCDA 2YJDA 3Q95B 5ACCA 5A86A 1XP6A 3CDSA 3G0WA 4J5WC 4LTWA 3VSOA 1XV9A 3ZQTA 4IVWA 1K74A 4LSJA 5DSHA 3UUCA 4S15A 1FM6D 4TUZA 2Q6SA 3LBDA 1S9QA 3A9EA 3FC6B 4MG7B 1NRLA 1KKQA 2P1TA 3DY6A 3KMGA 3VRWA 3FUGA 5KCWA 4WLBA 1RJKA 3B5RA 4K6IA 4XLDA 3P0UA 3V4AA 4XI3A 5DVCA 5DX3A 5DXGA 1T73A 4APUA 1T79A 5K13A 4UDDA 5L11A 1R1KD 2QGTA 4P6WA 5DIEA 1SJ0A 5DVSA 5ICKA 4ITEA 3GWSX 1FM6A 4RUOX 4E4QA 4RWVA 3OKIA 4RFWA 5G45A 2A3IA 3OMPA 3A40X 4JL4A 1YY4A 4NIEA 4FGYA 3DT3A 5DWGA 2ZK2A 4F9MA 5APHA 3GWXA 5E0WA 5H1EA 3X1HA 2PIXA 5KCDA 1OVLB 1R1KA 3E94A 4OH5A 1UHLB 1T65A 3L0LA 5B41A 1FD0A 3HODA 4OEDA 5DKSA 2PIQA 2QA6A 3X1IA 5HJSA 2Q3YA 5C4OA 2OUZA 3R8AA 3GYTA 4OIUA 1VJBA 3A3ZX 3L3ZA 2HB7A 2ZLCA 4CI4A 4N8RA 3ET2A 4JYGA 2AX7A 3GD2A 4NB6A 2I0JA 4PLEA 2I4JA 4DORA 4RZGA 2ZNPA 4LNWA 4PPPA 2ZMIA 3PLZA 3QT0A 1XB7A 2ABIA 2ZBSA 3UVVB 2GTKA 3KMZA 2NW4A 5EHJA 4YNKA 2QXSA 3DR1A 3UUAA 1RKGA 4CSJA 2ZFXA 2B50A 4ZJRA 3B0QA 3VT5A 2AYRA 2FVJA 2Q59B 3H52A 4G1ZA 4MGAA 4PXMA 5HJPB 4RMCA 5DI7A 3WJ4A 3W0JA 3MNEA 2QNVA 4POHA 2J7YA 5DZ1A 1NAXA 2PIWA 5AVLA 5DXMA 1KV6A 3R2AA 2P7AA 1Z5XE 2Q7LA 3S9SA 5AZTA 4RMDA 5AAVB 3G8IA 2ATHA 2G5OA 5C4SA 1XVPB 2PNUA 3JZBA 3HVLA 1PCGA 4OHAA 4BCRA 4LNXA 3W5RA 3W5TA 4G1YA 3W5PA 5DMCA 1E3KA 2ZY0A 2IOGA 4OJ4A 2HASA 4Q50A 3TKCA 2GPOA 2Q8SA 1IE9A 4REFA 1YJEA 1G5YA 5FQSA 2J4AA 4ZNHA 5GIEA 4K7AA 5DWLA 3K6PA 4S0SA 2GPUA 5DRJA 3UUDB 1N83A 2QZOB 3VJTA 3NSPA 4E2JA 4MGDA 4A4VA 3JZCA 1U3QA 3OMMA 1XQCA 3FLIA 2G44A 2H77A 3VTBA 4IA2A 2G0HA 4Q0AC 3VHVA 3X36A 4WHFA 4J5XA 5KCUA 4UDBA 4ZN9A 3E7CA 3HM1A 5JJMA 1NQ7A 1ZH7A 3WMHA 1T7TA 1ZDTA 5KD9A 2P54A 1XNNA 3D24A 3FALA 5KRIA 5AAUA 4R06A 3R5NA 2OAXA 3NOAA 4OEYA 3HQ5A 5B5BA 1G1UA 1DKFA 3Q95A 5KRAA 2AX8A 1EXXA 4HEEX 1UOMA 4QE6A 5DZ0A 1R6GA 4IU7A 1NQ0A 5DUHA 5DUGA 5C4UA 3DCTA 4REEA 2Q7KA 2QTUA 2PKLA 2OCFA 1LV2A 1KNUA 2PIOA 3F5CB 3FC6A 4MG7A 5E0XA 3ADUA 4S0TA 2AB2A 2AX9A 3F7DA 1K4WA 1ZKYA 1YOWA 2VV0A 5DLRA 4IA3A 4O8FA 3WFGA 3SP9A 3VHUA 3B68A 2Q6JA 5FQPA 3R8DA 2XYWA 3R8IA 3VJIA 3ZR7A 3DZUD 3IPUA 4OZTE 3K22A 4MG9B 4QK4A 4FHHA 3AZ3A 2QXMA 4QM0A 1X7EA 2AX6A 3CTBA 5DUEA 2HVCA 5KR9A 4ONIA 1FCXA 2H79A 3HC5A 3OS8A 2JJ3A 2OZ7A 1RDTD 5G42A 3VTCA 4HLWA 4J26A 3W0HA 3ILZA 3UU7B 1M7WA 4YMQA 3V9TA 2Q7JA 5DWEA 1RK3A 4XT9A 4FN9A 2XYXA 3OLFA 2Q7IA 3AN3A 5DVVA 1PQ9A 2YLQA 5DXEA 5KRHA 5DY8A 3DZUA 1A52A 3B3KA 5L7GA 1M2ZA 3P8XA 1OVLA 3ADSA 2F4BA 2NV7A 1UHLA 3W0GA 3CJWA 2PJLA 5FQTA 3WT5A 4PP3A 5AWKA 5DWJA 4G2HA 4ZN7A 3OS9A 4ZNVA 1Z95A 3B1MA 4OLMA 2Q5SA 4IW8A 2PITA 5DXBB 1RDTA 3L0EA 2I4PA 1H9UA 2B1VA 4EM9A 3PCUA 2HARA 1QKMA 3PRGA 3EYBA 3DZYD 3L3XA 5DKGA 5DV8A 4UDCA 4IS8A 1ERRA 5DIGA 2R6YA 1SR7A 1BSXA 3UVVA 4DQMA 5E7VA 3AURA 3B66A 2AA7A 2VV4A 4OZRE 1EREA 3O1DA 3OMOA 5HYRA 1YP0A 5DP0A 3VRUA 4NY9A 2PRGA 2YFEA 3KYTA 5IZ0A 4OZTU 4G2IA 3GZ9A 2AA2A 2Q59A 3VJHA 2AMBA 4OKXA 3CLDA 1OSHA 1X7RA 5EJVA 3PO9A 2AM9A 2AA6A 2ZXNA 1N46A 4M8EA 3DZYA 4ZNWA 2HAMA 5DXRA 4OIVA 5EC9A 1FBYA 3VT3A 2QGWA 2VSTA 2B1ZA 2R40D 5G3JA 5GICA 1PDUA 5AAVA 4IV4A 5AK2A 1GS4A 4DMAA 3ERDA 4RUJA 5E15A 4YT1A 1XVPA 1XAPA 4QJRA 4L96A 3L03A 1ZDUA 2PINA 5KRCA 5KCCA 1R5KA 3CQVA 2GWXA 2REWA 2YLPA 4E4KA 2FAIA 1NDEA 1ZUCA 2AO6A 4CI5A 4JGVA 2ZK3A 2Z4JA 3CS8A 1YINA 4RUPA 5GT4A 5SYZA 5L7HA 3ZRAA 4FNEA 2FSZA 5CJ6A 1P93A 4X1FA 2VV1A 3VT7A 2YLOA 3UUDA 1EXAA 2QZOA 3VT9A 3VTDA 3K23A 5KRLA 1QKTA 4ZO1X 2R40A 2ZXZA 5GIDA 3TY0A 4DOSA 1NQ1A 1Q4XA 1XP1A 2PIUA 3P89A 4PWLA 3GN8A 3WJ5A 1T7FA 2E2RA 5KYAA 4PP5A 3V3QA 5L7EA 3OLSA 4R2UA 2ZMJA 4DM6A 4TV1B 5AYGA 1WM0X 2J7XA 2QABA 5G5WA 4OZRU 1SKXA 4MGBB 2BJ4B 5DYBA 4IVYA 1PRGA 5DK9A 2VSRA 5AVIA 2HBHA 4RMEA 3OSAA 3KDUA 1NAVA 5IXKA 1I38A 5DZHA 5I4VA 5DL4A 5KRMA 1TFCA 2OVHA 4JYIA 3PEQA 5KRJA 1SQNA 2J14A 2JF9A 3HLVA 4K4JA 3BQDA 1L2JA 4IWCA 5DKEA 5DV6A 4YPQA 1QKNA 4EMAA 3ERTA 3A2HA 5DXKA 3AN4A 2P1VA 4NUFA 5DXQA 3RVFA 3MNPA 2V7CA 3OLLA 1S0ZA 3F5CA 5DRMA 2O9IA 4RZFA 4MGCA 3OOKA 4IA7A 3FURA 2O4RA 1GWQA 1HG4A 4ZNUA 1S0XA 1DB1A 1PQ6A 3E00D 2HWQA 3H0AD 3W0CA 3KFCA 1YYEA 2JFAB 4OARA 3ADXA 2AWHA 5KRKA 2B23A 2G0GA 1L2IA 2NXXE 4MG6A 3KPZA 4MG9A 5LGAA 5IAWA 1XDKB 3WWRA 4PF3A 3WGPA 3GBKA 1T74A 5FQVA 2ZMHA 3A2JA 1IE8A 4RAKA 5JI0D 3WT6A 2HWRA 4ZOMA 5ETHA 4IW6A 1XIUA 3UU7A 4KZMA 1TXIA 1RKHA 2YATA 4J5XC 3VN2A 2Z4BA 4OKTA 2P1UA 3W0YA 4A4WA 3E00A 2Q1VA 3CS6A 3H0AA 3R5MA 3V9YA 1Y0XX 3R29A 1XNXA 4MG5A 4OC7A 2Q1HA 2ZVTA 4PPSA 3KBAA 2YLYA 1Y9RA 4Y29A 3V3EA 1NHZA 2OVMA 3IXPD 4P6XA 2ACLB 1I7IA 2ZASA 2AXAA 1R20D 4WPFA 4XUHA 3BEJA 4ITFA 4OILA 2VV2A 3OKHA 3B0TA 1GWXA 5KCTA 2Q61A 1XJ7A 1MV9A 5DXBA 5F9BA 3ZRBA 1FM9D 5M96A 4XHDA 1P8DA 2ZK5A 3KWYA 4N1YA 4WQPA 5FQRA 3FXVA 3W0AA 5KCFA 1T76A 2GPPA 4RE8A 5APJA 1XOWA 3AUNA 4N73A 1XZXX 2XKWA 4OEAA 5KCEA 3VRVA 2GIUA 3IXPA 2PIRA 2ZK4A 4M8HA 3P88A 4OEZA 1U9EA 3X31A 1R20A 2BAWA 3D6DA 4JYHA 5E14A 3OAPA 5APKA 2HB8A 2QA8B 1NYXA 5EI1A 3RUTA 3VRTA 2ZL9A 2ZXMA 1PQCA 4MG8B 3HC6A 1FM9A 2I4ZA 5KROA 3AZ1A 3ET0A 4J24A 2QR9A 3AZ2A 4Q13A 4ZI1A 1S19A 1ZGYA 3UP0A 3FS1A 5HCVA 5EITA 1OT7A 2ZLAA 2Q6RA 3IPQA 1FCYA 2PIPL 3OS8C 4G1DA 5DU5A 1U3RA 2Q70A 2QPYA 2QW4A 1XV9B 4OJBA 1NUOA 5DXPA 3CDPA 1YOKA 3OGTA 2ZNNA 4MDDA 4OK1A 3TX7B 4IWFA 1QKUA 4TUZB 3OMQA 3ET1A 4IA1A 5DTVA 3T03A 3A9EB 3GYUA 4PVUA 1Y0SA 1T7RA 3ADWA 5HJPA 1E3GA 1XQ3A 3D5FA 3MNOA 4G20A 3KMRA 3RY9A 4R6SA 1X7JA 3HO0A 2Q60A 4PP6A 3VT6A 5DX3B 2P7ZA 5AZVA 1I37A 1X76A 1OSVA 5JY3A
chains in the Genus database with same CATH topology
3ADTA 4PLDA 1I7GA 3M7RA 3D57A 4N5GA 2GPVA 4S14A 1ZAFA 1HJ1A 2AA5A 4DK8A 4IQRA 3B0WA 3V49A 4QE8A 5KYJA 2ZNOA 3B67A 4TV1A 2POBA 3VHWA 1XP9A 3OSWA 5DIDA 1ILGA 5G46A 4MGBA 3B0RA 3VI8A 2BJ4A 1T7MA 3N00A 2OM9A 2XYJA 5DYDA 4OFRA 2P7GA 2ZKCA 3ADVA 2AMAA 4JAZA 4ZNSA 5DZ3A 1XLSE 3L1BA 4XAOA 5G43A 4KZIA 2PIVA 1PZLA 1PK5A 3NSQA 2VV4B 2W8YA 4OH6A 1LBDA 4ZNTA 4PRGA 5E1CA 1G50A 4RZEA 1XLSA 3G9EA 3D90A 3IA6A 5LWPA 4LBDA 3L0JA 3OSIA 3VT4A 1T5ZA 2QSEA 4KZJA 3SZ1A 2ZK0A 3TKMA 4OKWA 5DZIA 3DCUA 2Q5PA 4OJ9A 1FCZA 2JFAA 3RUUA 3UP3A 5C4TA 3K8SA 5AWJA 3VJSA 4X1GA 1N4HA 2Q5GA 2YHDA 5HZCA 1XDKA 3O1EA 4NQAB 2I0GA 3IPSA 2LBDA 5E19A 3UUAB 2QH6A 3W5QA 3VSPA 3HZFA 2NPAA 2P15A 4XTAA 3ET3A 2VV3A 4IUIA 1ZEOA 2GP7A 3FEJA 1U3SA 3BC5A 4MGAB 5DMFA 3AFRA 1S9PA 2IOKA 3AX8A 5G44A 2EWPA 2O4JA 2IHQA 3AUQA 4UDAA 3IMYA 3U9QA 3WTQA 3OZ0A 2V0VA 5DWIA 1GWRA 2VV1B 4XUMA 4DM8A 3WT7A 4WVDA 4OGHA 2P4YA 1M13A 3B65A 2GL8A 2ACLA 3A2IA 4L98A 4POJA 5DKBA 1YUCA 2QMVA 2YJAB 2XHSA 2NXXA 3LMPA 2AAXA 1T63A 3A78A 2ZNQA 4QL8A 3G8OA 3PBAA 5EGVA 1X78A 2ZK6A 3OOFA 3KDTA 4FHIA 3RLJA 1A28A 3FEIA 4J5WA 3RLLA 4IV2A 4B7WA 5HYKA 4A2JA 1YIMA 4ZO1B 4ZJWA 1MVCA 4G21A 1YA3A 3VT8A 1X7BA 3OMKA 4OFUA 4MGDB 3V9VA 3CS4A 1YMTA 1K74D 1UPWA 2ZK1A 2R6WA 1K7LA 4OKBA 5KRFA 3OZJA 2HFPA 5JJMB 1G2NA 2HC4A 2QA8A 1MZNA 1XPCA 1Z5XU 3CWDA 4WHGA 4DK7A 3SP6A 4MG8A 5DV3A 3W0IA 3FALB 1NQ2A 2QE4A 1ILHA 3WFFA 2POGA 1DKFB 1UPVA 2HCDA 2YJDA 3Q95B 5ACCA 5A86A 1XP6A 3CDSA 3G0WA 4J5WC 4LTWA 3VSOA 1XV9A 3ZQTA 4IVWA 1K74A 4LSJA 5DSHA 3UUCA 4S15A 1FM6D 4TUZA 2Q6SA 3LBDA 1S9QA 3A9EA 3FC6B 4MG7B 1NRLA 1KKQA 2P1TA 3DY6A 3KMGA 3VRWA 3FUGA 5KCWA 4WLBA 1RJKA 3B5RA 4K6IA 4XLDA 3P0UA 3V4AA 4XI3A 5DVCA 5DX3A 5DXGA 1T73A 4APUA 1T79A 5K13A 4UDDA 5L11A 1R1KD 2QGTA 4P6WA 5DIEA 1SJ0A 5DVSA 5ICKA 4ITEA 3GWSX 1FM6A 4RUOX 4E4QA 4RWVA 3OKIA 4RFWA 5G45A 2A3IA 3OMPA 3A40X 4JL4A 1YY4A 4NIEA 4FGYA 3DT3A 5DWGA 2ZK2A 4F9MA 5APHA 3GWXA 5E0WA 5H1EA 3X1HA 2PIXA 5KCDA 1OVLB 1R1KA 3E94A 4OH5A 1UHLB 1T65A 3L0LA 5B41A 1FD0A 3HODA 4OEDA 5DKSA 2PIQA 2QA6A 3X1IA 5HJSA 2Q3YA 5C4OA 2OUZA 3R8AA 3GYTA 4OIUA 1VJBA 3A3ZX 3L3ZA 2HB7A 2ZLCA 4CI4A 4N8RA 3ET2A 4JYGA 2AX7A 3GD2A 4NB6A 2I0JA 4PLEA 2I4JA 4DORA 4RZGA 2ZNPA 4LNWA 4PPPA 2ZMIA 3PLZA 3QT0A 1XB7A 2ABIA 2ZBSA 3UVVB 2GTKA 3KMZA 2NW4A 5EHJA 4YNKA 2QXSA 3DR1A 3UUAA 1RKGA 4CSJA 2ZFXA 2B50A 4ZJRA 3B0QA 3VT5A 2AYRA 2FVJA 2Q59B 3H52A 4G1ZA 4MGAA 4PXMA 5HJPB 4RMCA 5DI7A 3WJ4A 3W0JA 3MNEA 2QNVA 4POHA 2J7YA 5DZ1A 1NAXA 2PIWA 5AVLA 5DXMA 1KV6A 3R2AA 2P7AA 1Z5XE 2Q7LA 3S9SA 5AZTA 4RMDA 5AAVB 3G8IA 2ATHA 2G5OA 5C4SA 1XVPB 2PNUA 3JZBA 3HVLA 1PCGA 4OHAA 4BCRA 4LNXA 3W5RA 3W5TA 4G1YA 3W5PA 5DMCA 1E3KA 2ZY0A 2IOGA 4OJ4A 2HASA 4Q50A 3TKCA 2GPOA 2Q8SA 1IE9A 4REFA 1YJEA 1G5YA 5FQSA 2J4AA 4ZNHA 5GIEA 4K7AA 5DWLA 3K6PA 4S0SA 2GPUA 5DRJA 3UUDB 1N83A 2QZOB 3VJTA 3NSPA 4E2JA 4MGDA 4A4VA 3JZCA 1U3QA 3OMMA 1XQCA 3FLIA 2G44A 2H77A 3VTBA 4IA2A 2G0HA 4Q0AC 3VHVA 3X36A 4WHFA 4J5XA 5KCUA 4UDBA 4ZN9A 3E7CA 3HM1A 5JJMA 1NQ7A 1ZH7A 3WMHA 1T7TA 1ZDTA 5KD9A 2P54A 1XNNA 3D24A 3FALA 5KRIA 5AAUA 4R06A 3R5NA 2OAXA 3NOAA 4OEYA 3HQ5A 5B5BA 1G1UA 1DKFA 3Q95A 5KRAA 2AX8A 1EXXA 4HEEX 1UOMA 4QE6A 5DZ0A 1R6GA 4IU7A 1NQ0A 5DUHA 5DUGA 5C4UA 3DCTA 4REEA 2Q7KA 2QTUA 2PKLA 2OCFA 1LV2A 1KNUA 2PIOA 3F5CB 3FC6A 4MG7A 5E0XA 3ADUA 4S0TA 2AB2A 2AX9A 3F7DA 1K4WA 1ZKYA 1YOWA 2VV0A 5DLRA 4IA3A 4O8FA 3WFGA 3SP9A 3VHUA 3B68A 2Q6JA 5FQPA 3R8DA 2XYWA 3R8IA 3VJIA 3ZR7A 3DZUD 3IPUA 4OZTE 3K22A 4MG9B 4QK4A 4FHHA 3AZ3A 2QXMA 4QM0A 1X7EA 2AX6A 3CTBA 5DUEA 2HVCA 5KR9A 4ONIA 1FCXA 2H79A 3HC5A 3OS8A 2JJ3A 2OZ7A 1RDTD 5G42A 3VTCA 4HLWA 4J26A 3W0HA 3ILZA 3UU7B 1M7WA 4YMQA 3V9TA 2Q7JA 5DWEA 1RK3A 4XT9A 4FN9A 2XYXA 3OLFA 2Q7IA 3AN3A 5DVVA 1PQ9A 2YLQA 5DXEA 5KRHA 5DY8A 3DZUA 1A52A 3B3KA 5L7GA 1M2ZA 3P8XA 1OVLA 3ADSA 2F4BA 2NV7A 1UHLA 3W0GA 3CJWA 2PJLA 5FQTA 3WT5A 4PP3A 5AWKA 5DWJA 4G2HA 4ZN7A 3OS9A 4ZNVA 1Z95A 3B1MA 4OLMA 2Q5SA 4IW8A 2PITA 5DXBB 1RDTA 3L0EA 2I4PA 1H9UA 2B1VA 4EM9A 3PCUA 2HARA 1QKMA 3PRGA 3EYBA 3DZYD 3L3XA 5DKGA 5DV8A 4UDCA 4IS8A 1ERRA 5DIGA 2R6YA 1SR7A 1BSXA 3UVVA 4DQMA 5E7VA 3AURA 3B66A 2AA7A 2VV4A 4OZRE 1EREA 3O1DA 3OMOA 5HYRA 1YP0A 5DP0A 3VRUA 4NY9A 2PRGA 2YFEA 3KYTA 5IZ0A 4OZTU 4G2IA 3GZ9A 2AA2A 2Q59A 3VJHA 2AMBA 4OKXA 3CLDA 1OSHA 1X7RA 5EJVA 3PO9A 2AM9A 2AA6A 2ZXNA 1N46A 4M8EA 3DZYA 4ZNWA 2HAMA 5DXRA 4OIVA 5EC9A 1FBYA 3VT3A 2QGWA 2VSTA 2B1ZA 2R40D 5G3JA 5GICA 1PDUA 5AAVA 4IV4A 5AK2A 1GS4A 4DMAA 3ERDA 4RUJA 5E15A 4YT1A 1XVPA 1XAPA 4QJRA 4L96A 3L03A 1ZDUA 2PINA 5KRCA 5KCCA 1R5KA 3CQVA 2GWXA 2REWA 2YLPA 4E4KA 2FAIA 1NDEA 1ZUCA 2AO6A 4CI5A 4JGVA 2ZK3A 2Z4JA 3CS8A 1YINA 4RUPA 5GT4A 5SYZA 5L7HA 3ZRAA 4FNEA 2FSZA 5CJ6A 1P93A 4X1FA 2VV1A 3VT7A 2YLOA 3UUDA 1EXAA 2QZOA 3VT9A 3VTDA 3K23A 5KRLA 1QKTA 4ZO1X 2R40A 2ZXZA 5GIDA 3TY0A 4DOSA 1NQ1A 1Q4XA 1XP1A 2PIUA 3P89A 4PWLA 3GN8A 3WJ5A 1T7FA 2E2RA 5KYAA 4PP5A 3V3QA 5L7EA 3OLSA 4R2UA 2ZMJA 4DM6A 4TV1B 5AYGA 1WM0X 2J7XA 2QABA 5G5WA 4OZRU 1SKXA 4MGBB 2BJ4B 5DYBA 4IVYA 1PRGA 5DK9A 2VSRA 5AVIA 2HBHA 4RMEA 3OSAA 3KDUA 1NAVA 5IXKA 1I38A 5DZHA 5I4VA 5DL4A 5KRMA 1TFCA 2OVHA 4JYIA 3PEQA 5KRJA 1SQNA 2J14A 2JF9A 3HLVA 4K4JA 3BQDA 1L2JA 4IWCA 5DKEA 5DV6A 4YPQA 1QKNA 4EMAA 3ERTA 3A2HA 5DXKA 3AN4A 2P1VA 4NUFA 5DXQA 3RVFA 3MNPA 2V7CA 3OLLA 1S0ZA 3F5CA 5DRMA 2O9IA 4RZFA 4MGCA 3OOKA 4IA7A 3FURA 2O4RA 1GWQA 1HG4A 4ZNUA 1S0XA 1DB1A 1PQ6A 3E00D 2HWQA 3H0AD 3W0CA 3KFCA 1YYEA 2JFAB 4OARA 3ADXA 2AWHA 5KRKA 2B23A 2G0GA 1L2IA 2NXXE 4MG6A 3KPZA 4MG9A 5LGAA 5IAWA 1XDKB 3WWRA 4PF3A 3WGPA 3GBKA 1T74A 5FQVA 2ZMHA 3A2JA 1IE8A 4RAKA 5JI0D 3WT6A 2HWRA 4ZOMA 5ETHA 4IW6A 1XIUA 3UU7A 4KZMA 1TXIA 1RKHA 2YATA 4J5XC 3VN2A 2Z4BA 4OKTA 2P1UA 3W0YA 4A4WA 3E00A 2Q1VA 3CS6A 3H0AA 3R5MA 3V9YA 1Y0XX 3R29A 1XNXA 4MG5A 4OC7A 2Q1HA 2ZVTA 4PPSA 3KBAA 2YLYA 1Y9RA 4Y29A 3V3EA 1NHZA 2OVMA 3IXPD 4P6XA 2ACLB 1I7IA 2ZASA 2AXAA 1R20D 4WPFA 4XUHA 3BEJA 4ITFA 4OILA 2VV2A 3OKHA 3B0TA 1GWXA 5KCTA 2Q61A 1XJ7A 1MV9A 5DXBA 5F9BA 3ZRBA 1FM9D 5M96A 4XHDA 1P8DA 2ZK5A 3KWYA 4N1YA 4WQPA 5FQRA 3FXVA 3W0AA 5KCFA 1T76A 2GPPA 4RE8A 5APJA 1XOWA 3AUNA 4N73A 1XZXX 2XKWA 4OEAA 5KCEA 3VRVA 2GIUA 3IXPA 2PIRA 2ZK4A 4M8HA 3P88A 4OEZA 1U9EA 3X31A 1R20A 2BAWA 3D6DA 4JYHA 5E14A 3OAPA 5APKA 2HB8A 2QA8B 1NYXA 5EI1A 3RUTA 3VRTA 2ZL9A 2ZXMA 1PQCA 4MG8B 3HC6A 1FM9A 2I4ZA 5KROA 3AZ1A 3ET0A 4J24A 2QR9A 3AZ2A 4Q13A 4ZI1A 1S19A 1ZGYA 3UP0A 3FS1A 5HCVA 5EITA 1OT7A 2ZLAA 2Q6RA 3IPQA 1FCYA 2PIPL 3OS8C 4G1DA 5DU5A 1U3RA 2Q70A 2QPYA 2QW4A 1XV9B 4OJBA 1NUOA 5DXPA 3CDPA 1YOKA 3OGTA 2ZNNA 4MDDA 4OK1A 3TX7B 4IWFA 1QKUA 4TUZB 3OMQA 3ET1A 4IA1A 5DTVA 3T03A 3A9EB 3GYUA 4PVUA 1Y0SA 1T7RA 3ADWA 5HJPA 1E3GA 1XQ3A 3D5FA 3MNOA 4G20A 3KMRA 3RY9A 4R6SA 1X7JA 3HO0A 2Q60A 4PP6A 3VT6A 5DX3B 2P7ZA 5AZVA 1I37A 1X76A 1OSVA 5JY3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ADT A;  4PLD A;  1I7G A;  3M7R A;  3D57 A;  4N5G A;  2GPV A;  4S14 A;  1ZAF A;  1HJ1 A;  2AA5 A;  4DK8 A;  4IQR A;  3B0W A;  3V49 A;  4QE8 A;  5KYJ A;  2ZNO A;  3B67 A;  4TV1 A;  2POB A;  3VHW A;  1XP9 A;  3OSW A;  5DID A;  1ILG A;  5G46 A;  4MGB A;  3B0R A;  3VI8 A;  2BJ4 A;  1T7M A;  3N00 A;  2OM9 A;  2XYJ A;  5DYD A;  4OFR A;  2P7G A;  2ZKC A;  3ADV A;  2AMA A;  4JAZ A;  4ZNS A;  5DZ3 A;  1XLS E;  3L1B A;  4XAO A;  5G43 A;  4KZI A;  2PIV A;  1PZL A;  1PK5 A;  3NSQ A;  2VV4 B;  2W8Y A;  4OH6 A;  1LBD A;  4ZNT A;  4PRG A;  5E1C A;  1G50 A;  4RZE A;  1XLS A;  3G9E A;  3D90 A;  3IA6 A;  5LWP A;  4LBD A;  3L0J A;  3OSI A;  3VT4 A;  1T5Z A;  2QSE A;  4KZJ A;  3SZ1 A;  2ZK0 A;  3TKM A;  4OKW A;  5DZI A;  3DCU A;  2Q5P A;  4OJ9 A;  1FCZ A;  2JFA A;  3RUU A;  3UP3 A;  5C4T A;  3K8S A;  5AWJ A;  3VJS A;  4X1G A;  1N4H A;  2Q5G A;  2YHD A;  5HZC A;  1XDK A;  3O1E A;  4NQA B;  2I0G A;  3IPS A;  2LBD A;  5E19 A;  3UUA B;  2QH6 A;  3W5Q A;  3VSP A;  3HZF A;  2NPA A;  2P15 A;  4XTA A;  3ET3 A;  2VV3 A;  4IUI A;  1ZEO A;  2GP7 A;  3FEJ A;  1U3S A;  3BC5 A;  4MGA B;  5DMF A;  3AFR A;  1S9P A;  2IOK A;  3AX8 A;  5G44 A;  2EWP A;  2O4J A;  2IHQ A;  3AUQ A;  4UDA A;  3IMY A;  3U9Q A;  3WTQ A;  3OZ0 A;  2V0V A;  5DWI A;  1GWR A;  2VV1 B;  4XUM A;  4DM8 A;  3WT7 A;  4WVD A;  4OGH A;  2P4Y A;  1M13 A;  3B65 A;  2GL8 A;  2ACL A;  3A2I A;  4L98 A;  4POJ A;  5DKB A;  1YUC A;  2QMV A;  2YJA B;  2XHS A;  2NXX A;  3LMP A;  2AAX A;  1T63 A;  3A78 A;  2ZNQ A;  4QL8 A;  3G8O A;  3PBA A;  5EGV A;  1X78 A;  2ZK6 A;  3OOF A;  3KDT A;  4FHI A;  3RLJ A;  1A28 A;  3FEI A;  4J5W A;  3RLL A;  4IV2 A;  4B7W A;  5HYK A;  4A2J A;  1YIM A;  4ZO1 B;  4ZJW A;  1MVC A;  4G21 A;  1YA3 A;  3VT8 A;  1X7B A;  3OMK A;  4OFU A;  4MGD B;  3V9V A;  3CS4 A;  1YMT A;  1K74 D;  1UPW A;  2ZK1 A;  2R6W A;  1K7L A;  4OKB A;  5KRF A;  3OZJ A;  2HFP A;  5JJM B;  1G2N A;  2HC4 A;  2QA8 A;  1MZN A;  1XPC A;  1Z5X U;  3CWD A;  4WHG A;  4DK7 A;  3SP6 A;  4MG8 A;  5DV3 A;  3W0I A;  3FAL B;  1NQ2 A;  2QE4 A;  1ILH A;  3WFF A;  2POG A;  1DKF B;  1UPV A;  2HCD A;  2YJD A;  3Q95 B;  5ACC A;  5A86 A;  1XP6 A;  3CDS A;  3G0W A;  4J5W C;  4LTW A;  3VSO A;  1XV9 A;  3ZQT A;  4IVW A;  1K74 A;  4LSJ A;  5DSH A;  3UUC A;  4S15 A;  1FM6 D;  4TUZ A;  2Q6S A;  3LBD A;  1S9Q A;  3A9E A;  3FC6 B;  4MG7 B;  1NRL A;  1KKQ A;  2P1T A;  3DY6 A;  3KMG A;  3VRW A;  3FUG A;  5KCW A;  4WLB A;  1RJK A;  3B5R A;  4K6I A;  4XLD A;  3P0U A;  3V4A A;  4XI3 A;  5DVC A;  5DX3 A;  5DXG A;  1T73 A;  4APU A;  1T79 A;  5K13 A;  4UDD A;  5L11 A;  1R1K D;  2QGT A;  4P6W A;  5DIE A;  1SJ0 A;  5DVS A;  5ICK A;  4ITE A;  3GWS X;  1FM6 A;  4RUO X;  4E4Q A;  4RWV A;  3OKI A;  4RFW A;  5G45 A;  2A3I A;  3OMP A;  3A40 X;  4JL4 A;  1YY4 A;  4NIE A;  4FGY A;  3DT3 A;  5DWG A;  2ZK2 A;  4F9M A;  5APH A;  3GWX A;  5E0W A;  5H1E A;  3X1H A;  2PIX A;  5KCD A;  1OVL B;  1R1K A;  3E94 A;  4OH5 A;  1UHL B;  1T65 A;  3L0L A;  5B41 A;  1FD0 A;  3HOD A;  4OED A;  5DKS A;  2PIQ A;  2QA6 A;  3X1I A;  5HJS A;  2Q3Y A;  5C4O A;  2OUZ A;  3R8A A;  3GYT A;  4OIU A;  1VJB A;  3A3Z X;  3L3Z A;  2HB7 A;  2ZLC A;  4CI4 A;  4N8R A;  3ET2 A;  4JYG A;  2AX7 A;  3GD2 A;  4NB6 A;  2I0J A;  4PLE A;  2I4J A;  4DOR A;  4RZG A;  2ZNP A;  4LNW A;  4PPP A;  2ZMI A;  3PLZ A;  3QT0 A;  1XB7 A;  2ABI A;  2ZBS A;  3UVV B;  2GTK A;  3KMZ A;  2NW4 A;  5EHJ A;  4YNK A;  2QXS A;  3DR1 A;  3UUA A;  1RKG A;  4CSJ A;  2ZFX A;  2B50 A;  4ZJR A;  3B0Q A;  3VT5 A;  2AYR A;  2FVJ A;  2Q59 B;  3H52 A;  4G1Z A;  4MGA A;  4PXM A;  5HJP B;  4RMC A;  5DI7 A;  3WJ4 A;  3W0J A;  3MNE A;  2QNV A;  4POH A;  2J7Y A;  5DZ1 A;  1NAX A;  2PIW A;  5AVL A;  5DXM A;  1KV6 A;  3R2A A;  2P7A A;  1Z5X E;  2Q7L A;  3S9S A;  5AZT A;  4RMD A;  5AAV B;  3G8I A;  2ATH A;  2G5O A;  5C4S A;  1XVP B;  2PNU A;  3JZB A;  3HVL A;  1PCG A;  4OHA A;  4BCR A;  4LNX A;  3W5R A;  3W5T A;  4G1Y A;  3W5P A;  5DMC A;  1E3K A;  2ZY0 A;  2IOG A;  4OJ4 A;  2HAS A;  4Q50 A;  3TKC A;  2GPO A;  2Q8S A;  1IE9 A;  4REF A;  1YJE A;  1G5Y A;  5FQS A;  2J4A A;  4ZNH A;  5GIE A;  4K7A A;  5DWL A;  3K6P A;  4S0S A;  2GPU A;  5DRJ A;  3UUD B;  1N83 A;  2QZO B;  3VJT A;  3NSP A;  4E2J A;  4MGD A;  4A4V A;  3JZC A;  1U3Q A;  3OMM A;  1XQC A;  3FLI A;  2G44 A;  2H77 A;  3VTB A;  4IA2 A;  2G0H A;  4Q0A C;  3VHV A;  3X36 A;  4WHF A;  4J5X A;  5KCU A;  4UDB A;  4ZN9 A;  3E7C A;  3HM1 A;  5JJM A;  1NQ7 A;  1ZH7 A;  3WMH A;  1T7T A;  1ZDT A;  5KD9 A;  2P54 A;  1XNN A;  3D24 A;  3FAL A;  5KRI A;  5AAU A;  4R06 A;  3R5N A;  2OAX A;  3NOA A;  4OEY A;  3HQ5 A;  5B5B A;  1G1U A;  1DKF A;  3Q95 A;  5KRA A;  2AX8 A;  1EXX A;  4HEE X;  1UOM A;  4QE6 A;  5DZ0 A;  1R6G A;  4IU7 A;  1NQ0 A;  5DUH A;  5DUG A;  5C4U A;  3DCT A;  4REE A;  2Q7K A;  2QTU A;  2PKL A;  2OCF A;  1LV2 A;  1KNU A;  2PIO A;  3F5C B;  3FC6 A;  4MG7 A;  5E0X A;  3ADU A;  4S0T A;  2AB2 A;  2AX9 A;  3F7D A;  1K4W A;  1ZKY A;  1YOW A;  2VV0 A;  5DLR A;  4IA3 A;  4O8F A;  3WFG A;  3SP9 A;  3VHU A;  3B68 A;  2Q6J A;  5FQP A;  3R8D A;  2XYW A;  3R8I A;  3VJI A;  3ZR7 A;  3DZU D;  3IPU A;  4OZT E;  3K22 A;  4MG9 B;  4QK4 A;  4FHH A;  3AZ3 A;  2QXM A;  4QM0 A;  1X7E A;  2AX6 A;  3CTB A;  5DUE A;  2HVC A;  5KR9 A;  4ONI A;  1FCX A;  2H79 A;  3HC5 A;  3OS8 A;  2JJ3 A;  2OZ7 A;  1RDT D;  5G42 A;  3VTC A;  4HLW A;  4J26 A;  3W0H A;  3ILZ A;  3UU7 B;  1M7W A;  4YMQ A;  3V9T A;  2Q7J A;  5DWE A;  1RK3 A;  4XT9 A;  4FN9 A;  2XYX A;  3OLF A;  2Q7I A;  3AN3 A;  5DVV A;  1PQ9 A;  2YLQ A;  5DXE A;  5KRH A;  5DY8 A;  3DZU A;  1A52 A;  3B3K A;  5L7G A;  1M2Z A;  3P8X A;  1OVL A;  3ADS A;  2F4B A;  2NV7 A;  1UHL A;  3W0G A;  3CJW A;  2PJL A;  5FQT A;  3WT5 A;  4PP3 A;  5AWK A;  5DWJ A;  4G2H A;  4ZN7 A;  3OS9 A;  4ZNV A;  1Z95 A;  3B1M A;  4OLM A;  2Q5S A;  4IW8 A;  2PIT A;  5DXB B;  1RDT A;  3L0E A;  2I4P A;  1H9U A;  2B1V A;  4EM9 A;  3PCU A;  2HAR A;  1QKM A;  3PRG A;  3EYB A;  3DZY D;  3L3X A;  5DKG A;  5DV8 A;  4UDC A;  4IS8 A;  1ERR A;  5DIG A;  2R6Y A;  1SR7 A;  1BSX A;  3UVV A;  4DQM A;  5E7V A;  3AUR A;  3B66 A;  2AA7 A;  2VV4 A;  4OZR E;  1ERE A;  3O1D A;  3OMO A;  5HYR A;  1YP0 A;  5DP0 A;  3VRU A;  4NY9 A;  2PRG A;  2YFE A;  3KYT A;  5IZ0 A;  4OZT U;  4G2I A;  3GZ9 A;  2AA2 A;  2Q59 A;  3VJH A;  2AMB A;  4OKX A;  3CLD A;  1OSH A;  1X7R A;  5EJV A;  3PO9 A;  2AM9 A;  2AA6 A;  2ZXN A;  1N46 A;  4M8E A;  3DZY A;  4ZNW A;  2HAM A;  5DXR A;  4OIV A;  5EC9 A;  1FBY A;  3VT3 A;  2QGW A;  2VST A;  2B1Z A;  2R40 D;  5G3J A;  5GIC A;  1PDU A;  5AAV A;  4IV4 A;  5AK2 A;  1GS4 A;  4DMA A;  3ERD A;  4RUJ A;  5E15 A;  4YT1 A;  1XVP A;  1XAP A;  4QJR A;  4L96 A;  3L03 A;  1ZDU A;  2PIN A;  5KRC A;  5KCC A;  1R5K A;  3CQV A;  2GWX A;  2REW A;  2YLP A;  4E4K A;  2FAI A;  1NDE A;  1ZUC A;  2AO6 A;  4CI5 A;  4JGV A;  2ZK3 A;  2Z4J A;  3CS8 A;  1YIN A;  4RUP A;  5GT4 A;  5SYZ A;  5L7H A;  3ZRA A;  4FNE A;  2FSZ A;  5CJ6 A;  1P93 A;  4X1F A;  2VV1 A;  3VT7 A;  2YLO A;  3UUD A;  1EXA A;  2QZO A;  3VT9 A;  3VTD A;  3K23 A;  5KRL A;  1QKT A;  4ZO1 X;  2R40 A;  2ZXZ A;  5GID A;  3TY0 A;  4DOS A;  1NQ1 A;  1Q4X A;  1XP1 A;  2PIU A;  3P89 A;  4PWL A;  3GN8 A;  3WJ5 A;  1T7F A;  2E2R A;  5KYA A;  4PP5 A;  3V3Q A;  5L7E A;  3OLS A;  4R2U A;  2ZMJ A;  4DM6 A;  4TV1 B;  5AYG A;  1WM0 X;  2J7X A;  2QAB A;  5G5W A;  4OZR U;  1SKX A;  4MGB B;  2BJ4 B;  5DYB A;  4IVY A;  1PRG A;  5DK9 A;  2VSR A;  5AVI A;  2HBH A;  4RME A;  3OSA A;  3KDU A;  1NAV A;  5IXK A;  1I38 A;  5DZH A;  5I4V A;  5DL4 A;  5KRM A;  1TFC A;  2OVH A;  4JYI A;  3PEQ A;  5KRJ A;  1SQN A;  2J14 A;  2JF9 A;  3HLV A;  4K4J A;  3BQD A;  1L2J A;  4IWC A;  5DKE A;  5DV6 A;  4YPQ A;  1QKN A;  4EMA A;  3ERT A;  3A2H A;  5DXK A;  3AN4 A;  2P1V A;  4NUF A;  5DXQ A;  3RVF A;  3MNP A;  2V7C A;  3OLL A;  1S0Z A;  3F5C A;  5DRM A;  2O9I A;  4RZF A;  4MGC A;  3OOK A;  4IA7 A;  3FUR A;  2O4R A;  1GWQ A;  1HG4 A;  4ZNU A;  1S0X A;  1DB1 A;  1PQ6 A;  3E00 D;  2HWQ A;  3H0A D;  3W0C A;  3KFC A;  1YYE A;  2JFA B;  4OAR A;  3ADX A;  2AWH A;  5KRK A;  2B23 A;  2G0G A;  1L2I A;  2NXX E;  4MG6 A;  3KPZ A;  4MG9 A;  5LGA A;  5IAW A;  1XDK B;  3WWR A;  4PF3 A;  3WGP A;  3GBK A;  1T74 A;  5FQV A;  2ZMH A;  3A2J A;  1IE8 A;  4RAK A;  5JI0 D;  3WT6 A;  2HWR A;  4ZOM A;  5ETH A;  4IW6 A;  1XIU A;  3UU7 A;  4KZM A;  1TXI A;  1RKH A;  2YAT A;  4J5X C;  3VN2 A;  2Z4B A;  4OKT A;  2P1U A;  3W0Y A;  4A4W A;  3E00 A;  2Q1V A;  3CS6 A;  3H0A A;  3R5M A;  3V9Y A;  1Y0X X;  3R29 A;  1XNX A;  4MG5 A;  4OC7 A;  2Q1H A;  2ZVT A;  4PPS A;  3KBA A;  2YLY A;  1Y9R A;  4Y29 A;  3V3E A;  1NHZ A;  2OVM A;  3IXP D;  4P6X A;  2ACL B;  1I7I A;  2ZAS A;  2AXA A;  1R20 D;  4WPF A;  4XUH A;  3BEJ A;  4ITF A;  4OIL A;  2VV2 A;  3OKH A;  3B0T A;  1GWX A;  5KCT A;  2Q61 A;  1XJ7 A;  1MV9 A;  5DXB A;  5F9B A;  3ZRB A;  1FM9 D;  5M96 A;  4XHD A;  1P8D A;  2ZK5 A;  3KWY A;  4N1Y A;  4WQP A;  5FQR A;  3FXV A;  3W0A A;  5KCF A;  1T76 A;  2GPP A;  4RE8 A;  5APJ A;  1XOW A;  3AUN A;  4N73 A;  1XZX X;  2XKW A;  4OEA A;  5KCE A;  3VRV A;  2GIU A;  3IXP A;  2PIR A;  2ZK4 A;  4M8H A;  3P88 A;  4OEZ A;  1U9E A;  3X31 A;  1R20 A;  2BAW A;  3D6D A;  4JYH A;  5E14 A;  3OAP A;  5APK A;  2HB8 A;  2QA8 B;  1NYX A;  5EI1 A;  3RUT A;  3VRT A;  2ZL9 A;  2ZXM A;  1PQC A;  4MG8 B;  3HC6 A;  1FM9 A;  2I4Z A;  5KRO A;  3AZ1 A;  3ET0 A;  4J24 A;  2QR9 A;  3AZ2 A;  4Q13 A;  4ZI1 A;  1S19 A;  1ZGY A;  3UP0 A;  3FS1 A;  5HCV A;  5EIT A;  1OT7 A;  2ZLA A;  2Q6R A;  3IPQ A;  1FCY A;  2PIP L;  3OS8 C;  4G1D A;  5DU5 A;  1U3R A;  2Q70 A;  2QPY A;  2QW4 A;  1XV9 B;  4OJB A;  1NUO A;  5DXP A;  3CDP A;  1YOK A;  3OGT A;  2ZNN A;  4MDD A;  4OK1 A;  3TX7 B;  4IWF A;  1QKU A;  4TUZ B;  3OMQ A;  3ET1 A;  4IA1 A;  5DTV A;  3T03 A;  3A9E B;  3GYU A;  4PVU A;  1Y0S A;  1T7R A;  3ADW A;  5HJP A;  1E3G A;  1XQ3 A;  3D5F A;  3MNO A;  4G20 A;  3KMR A;  3RY9 A;  4R6S A;  1X7J A;  3HO0 A;  2Q60 A;  4PP6 A;  3VT6 A;  5DX3 B;  2P7Z A;  5AZV A;  1I37 A;  1X76 A;  1OSV A;  5JY3 A; 
#chains in the Genus database with same CATH topology
 3ADT A;  4PLD A;  1I7G A;  3M7R A;  3D57 A;  4N5G A;  2GPV A;  4S14 A;  1ZAF A;  1HJ1 A;  2AA5 A;  4DK8 A;  4IQR A;  3B0W A;  3V49 A;  4QE8 A;  5KYJ A;  2ZNO A;  3B67 A;  4TV1 A;  2POB A;  3VHW A;  1XP9 A;  3OSW A;  5DID A;  1ILG A;  5G46 A;  4MGB A;  3B0R A;  3VI8 A;  2BJ4 A;  1T7M A;  3N00 A;  2OM9 A;  2XYJ A;  5DYD A;  4OFR A;  2P7G A;  2ZKC A;  3ADV A;  2AMA A;  4JAZ A;  4ZNS A;  5DZ3 A;  1XLS E;  3L1B A;  4XAO A;  5G43 A;  4KZI A;  2PIV A;  1PZL A;  1PK5 A;  3NSQ A;  2VV4 B;  2W8Y A;  4OH6 A;  1LBD A;  4ZNT A;  4PRG A;  5E1C A;  1G50 A;  4RZE A;  1XLS A;  3G9E A;  3D90 A;  3IA6 A;  5LWP A;  4LBD A;  3L0J A;  3OSI A;  3VT4 A;  1T5Z A;  2QSE A;  4KZJ A;  3SZ1 A;  2ZK0 A;  3TKM A;  4OKW A;  5DZI A;  3DCU A;  2Q5P A;  4OJ9 A;  1FCZ A;  2JFA A;  3RUU A;  3UP3 A;  5C4T A;  3K8S A;  5AWJ A;  3VJS A;  4X1G A;  1N4H A;  2Q5G A;  2YHD A;  5HZC A;  1XDK A;  3O1E A;  4NQA B;  2I0G A;  3IPS A;  2LBD A;  5E19 A;  3UUA B;  2QH6 A;  3W5Q A;  3VSP A;  3HZF A;  2NPA A;  2P15 A;  4XTA A;  3ET3 A;  2VV3 A;  4IUI A;  1ZEO A;  2GP7 A;  3FEJ A;  1U3S A;  3BC5 A;  4MGA B;  5DMF A;  3AFR A;  1S9P A;  2IOK A;  3AX8 A;  5G44 A;  2EWP A;  2O4J A;  2IHQ A;  3AUQ A;  4UDA A;  3IMY A;  3U9Q A;  3WTQ A;  3OZ0 A;  2V0V A;  5DWI A;  1GWR A;  2VV1 B;  4XUM A;  4DM8 A;  3WT7 A;  4WVD A;  4OGH A;  2P4Y A;  1M13 A;  3B65 A;  2GL8 A;  2ACL A;  3A2I A;  4L98 A;  4POJ A;  5DKB A;  1YUC A;  2QMV A;  2YJA B;  2XHS A;  2NXX A;  3LMP A;  2AAX A;  1T63 A;  3A78 A;  2ZNQ A;  4QL8 A;  3G8O A;  3PBA A;  5EGV A;  1X78 A;  2ZK6 A;  3OOF A;  3KDT A;  4FHI A;  3RLJ A;  1A28 A;  3FEI A;  4J5W A;  3RLL A;  4IV2 A;  4B7W A;  5HYK A;  4A2J A;  1YIM A;  4ZO1 B;  4ZJW A;  1MVC A;  4G21 A;  1YA3 A;  3VT8 A;  1X7B A;  3OMK A;  4OFU A;  4MGD B;  3V9V A;  3CS4 A;  1YMT A;  1K74 D;  1UPW A;  2ZK1 A;  2R6W A;  1K7L A;  4OKB A;  5KRF A;  3OZJ A;  2HFP A;  5JJM B;  1G2N A;  2HC4 A;  2QA8 A;  1MZN A;  1XPC A;  1Z5X U;  3CWD A;  4WHG A;  4DK7 A;  3SP6 A;  4MG8 A;  5DV3 A;  3W0I A;  3FAL B;  1NQ2 A;  2QE4 A;  1ILH A;  3WFF A;  2POG A;  1DKF B;  1UPV A;  2HCD A;  2YJD A;  3Q95 B;  5ACC A;  5A86 A;  1XP6 A;  3CDS A;  3G0W A;  4J5W C;  4LTW A;  3VSO A;  1XV9 A;  3ZQT A;  4IVW A;  1K74 A;  4LSJ A;  5DSH A;  3UUC A;  4S15 A;  1FM6 D;  4TUZ A;  2Q6S A;  3LBD A;  1S9Q A;  3A9E A;  3FC6 B;  4MG7 B;  1NRL A;  1KKQ A;  2P1T A;  3DY6 A;  3KMG A;  3VRW A;  3FUG A;  5KCW A;  4WLB A;  1RJK A;  3B5R A;  4K6I A;  4XLD A;  3P0U A;  3V4A A;  4XI3 A;  5DVC A;  5DX3 A;  5DXG A;  1T73 A;  4APU A;  1T79 A;  5K13 A;  4UDD A;  5L11 A;  1R1K D;  2QGT A;  4P6W A;  5DIE A;  1SJ0 A;  5DVS A;  5ICK A;  4ITE A;  3GWS X;  1FM6 A;  4RUO X;  4E4Q A;  4RWV A;  3OKI A;  4RFW A;  5G45 A;  2A3I A;  3OMP A;  3A40 X;  4JL4 A;  1YY4 A;  4NIE A;  4FGY A;  3DT3 A;  5DWG A;  2ZK2 A;  4F9M A;  5APH A;  3GWX A;  5E0W A;  5H1E A;  3X1H A;  2PIX A;  5KCD A;  1OVL B;  1R1K A;  3E94 A;  4OH5 A;  1UHL B;  1T65 A;  3L0L A;  5B41 A;  1FD0 A;  3HOD A;  4OED A;  5DKS A;  2PIQ A;  2QA6 A;  3X1I A;  5HJS A;  2Q3Y A;  5C4O A;  2OUZ A;  3R8A A;  3GYT A;  4OIU A;  1VJB A;  3A3Z X;  3L3Z A;  2HB7 A;  2ZLC A;  4CI4 A;  4N8R A;  3ET2 A;  4JYG A;  2AX7 A;  3GD2 A;  4NB6 A;  2I0J A;  4PLE A;  2I4J A;  4DOR A;  4RZG A;  2ZNP A;  4LNW A;  4PPP A;  2ZMI A;  3PLZ A;  3QT0 A;  1XB7 A;  2ABI A;  2ZBS A;  3UVV B;  2GTK A;  3KMZ A;  2NW4 A;  5EHJ A;  4YNK A;  2QXS A;  3DR1 A;  3UUA A;  1RKG A;  4CSJ A;  2ZFX A;  2B50 A;  4ZJR A;  3B0Q A;  3VT5 A;  2AYR A;  2FVJ A;  2Q59 B;  3H52 A;  4G1Z A;  4MGA A;  4PXM A;  5HJP B;  4RMC A;  5DI7 A;  3WJ4 A;  3W0J A;  3MNE A;  2QNV A;  4POH A;  2J7Y A;  5DZ1 A;  1NAX A;  2PIW A;  5AVL A;  5DXM A;  1KV6 A;  3R2A A;  2P7A A;  1Z5X E;  2Q7L A;  3S9S A;  5AZT A;  4RMD A;  5AAV B;  3G8I A;  2ATH A;  2G5O A;  5C4S A;  1XVP B;  2PNU A;  3JZB A;  3HVL A;  1PCG A;  4OHA A;  4BCR A;  4LNX A;  3W5R A;  3W5T A;  4G1Y A;  3W5P A;  5DMC A;  1E3K A;  2ZY0 A;  2IOG A;  4OJ4 A;  2HAS A;  4Q50 A;  3TKC A;  2GPO A;  2Q8S A;  1IE9 A;  4REF A;  1YJE A;  1G5Y A;  5FQS A;  2J4A A;  4ZNH A;  5GIE A;  4K7A A;  5DWL A;  3K6P A;  4S0S A;  2GPU A;  5DRJ A;  3UUD B;  1N83 A;  2QZO B;  3VJT A;  3NSP A;  4E2J A;  4MGD A;  4A4V A;  3JZC A;  1U3Q A;  3OMM A;  1XQC A;  3FLI A;  2G44 A;  2H77 A;  3VTB A;  4IA2 A;  2G0H A;  4Q0A C;  3VHV A;  3X36 A;  4WHF A;  4J5X A;  5KCU A;  4UDB A;  4ZN9 A;  3E7C A;  3HM1 A;  5JJM A;  1NQ7 A;  1ZH7 A;  3WMH A;  1T7T A;  1ZDT A;  5KD9 A;  2P54 A;  1XNN A;  3D24 A;  3FAL A;  5KRI A;  5AAU A;  4R06 A;  3R5N A;  2OAX A;  3NOA A;  4OEY A;  3HQ5 A;  5B5B A;  1G1U A;  1DKF A;  3Q95 A;  5KRA A;  2AX8 A;  1EXX A;  4HEE X;  1UOM A;  4QE6 A;  5DZ0 A;  1R6G A;  4IU7 A;  1NQ0 A;  5DUH A;  5DUG A;  5C4U A;  3DCT A;  4REE A;  2Q7K A;  2QTU A;  2PKL A;  2OCF A;  1LV2 A;  1KNU A;  2PIO A;  3F5C B;  3FC6 A;  4MG7 A;  5E0X A;  3ADU A;  4S0T A;  2AB2 A;  2AX9 A;  3F7D A;  1K4W A;  1ZKY A;  1YOW A;  2VV0 A;  5DLR A;  4IA3 A;  4O8F A;  3WFG A;  3SP9 A;  3VHU A;  3B68 A;  2Q6J A;  5FQP A;  3R8D A;  2XYW A;  3R8I A;  3VJI A;  3ZR7 A;  3DZU D;  3IPU A;  4OZT E;  3K22 A;  4MG9 B;  4QK4 A;  4FHH A;  3AZ3 A;  2QXM A;  4QM0 A;  1X7E A;  2AX6 A;  3CTB A;  5DUE A;  2HVC A;  5KR9 A;  4ONI A;  1FCX A;  2H79 A;  3HC5 A;  3OS8 A;  2JJ3 A;  2OZ7 A;  1RDT D;  5G42 A;  3VTC A;  4HLW A;  4J26 A;  3W0H A;  3ILZ A;  3UU7 B;  1M7W A;  4YMQ A;  3V9T A;  2Q7J A;  5DWE A;  1RK3 A;  4XT9 A;  4FN9 A;  2XYX A;  3OLF A;  2Q7I A;  3AN3 A;  5DVV A;  1PQ9 A;  2YLQ A;  5DXE A;  5KRH A;  5DY8 A;  3DZU A;  1A52 A;  3B3K A;  5L7G A;  1M2Z A;  3P8X A;  1OVL A;  3ADS A;  2F4B A;  2NV7 A;  1UHL A;  3W0G A;  3CJW A;  2PJL A;  5FQT A;  3WT5 A;  4PP3 A;  5AWK A;  5DWJ A;  4G2H A;  4ZN7 A;  3OS9 A;  4ZNV A;  1Z95 A;  3B1M A;  4OLM A;  2Q5S A;  4IW8 A;  2PIT A;  5DXB B;  1RDT A;  3L0E A;  2I4P A;  1H9U A;  2B1V A;  4EM9 A;  3PCU A;  2HAR A;  1QKM A;  3PRG A;  3EYB A;  3DZY D;  3L3X A;  5DKG A;  5DV8 A;  4UDC A;  4IS8 A;  1ERR A;  5DIG A;  2R6Y A;  1SR7 A;  1BSX A;  3UVV A;  4DQM A;  5E7V A;  3AUR A;  3B66 A;  2AA7 A;  2VV4 A;  4OZR E;  1ERE A;  3O1D A;  3OMO A;  5HYR A;  1YP0 A;  5DP0 A;  3VRU A;  4NY9 A;  2PRG A;  2YFE A;  3KYT A;  5IZ0 A;  4OZT U;  4G2I A;  3GZ9 A;  2AA2 A;  2Q59 A;  3VJH A;  2AMB A;  4OKX A;  3CLD A;  1OSH A;  1X7R A;  5EJV A;  3PO9 A;  2AM9 A;  2AA6 A;  2ZXN A;  1N46 A;  4M8E A;  3DZY A;  4ZNW A;  2HAM A;  5DXR A;  4OIV A;  5EC9 A;  1FBY A;  3VT3 A;  2QGW A;  2VST A;  2B1Z A;  2R40 D;  5G3J A;  5GIC A;  1PDU A;  5AAV A;  4IV4 A;  5AK2 A;  1GS4 A;  4DMA A;  3ERD A;  4RUJ A;  5E15 A;  4YT1 A;  1XVP A;  1XAP A;  4QJR A;  4L96 A;  3L03 A;  1ZDU A;  2PIN A;  5KRC A;  5KCC A;  1R5K A;  3CQV A;  2GWX A;  2REW A;  2YLP A;  4E4K A;  2FAI A;  1NDE A;  1ZUC A;  2AO6 A;  4CI5 A;  4JGV A;  2ZK3 A;  2Z4J A;  3CS8 A;  1YIN A;  4RUP A;  5GT4 A;  5SYZ A;  5L7H A;  3ZRA A;  4FNE A;  2FSZ A;  5CJ6 A;  1P93 A;  4X1F A;  2VV1 A;  3VT7 A;  2YLO A;  3UUD A;  1EXA A;  2QZO A;  3VT9 A;  3VTD A;  3K23 A;  5KRL A;  1QKT A;  4ZO1 X;  2R40 A;  2ZXZ A;  5GID A;  3TY0 A;  4DOS A;  1NQ1 A;  1Q4X A;  1XP1 A;  2PIU A;  3P89 A;  4PWL A;  3GN8 A;  3WJ5 A;  1T7F A;  2E2R A;  5KYA A;  4PP5 A;  3V3Q A;  5L7E A;  3OLS A;  4R2U A;  2ZMJ A;  4DM6 A;  4TV1 B;  5AYG A;  1WM0 X;  2J7X A;  2QAB A;  5G5W A;  4OZR U;  1SKX A;  4MGB B;  2BJ4 B;  5DYB A;  4IVY A;  1PRG A;  5DK9 A;  2VSR A;  5AVI A;  2HBH A;  4RME A;  3OSA A;  3KDU A;  1NAV A;  5IXK A;  1I38 A;  5DZH A;  5I4V A;  5DL4 A;  5KRM A;  1TFC A;  2OVH A;  4JYI A;  3PEQ A;  5KRJ A;  1SQN A;  2J14 A;  2JF9 A;  3HLV A;  4K4J A;  3BQD A;  1L2J A;  4IWC A;  5DKE A;  5DV6 A;  4YPQ A;  1QKN A;  4EMA A;  3ERT A;  3A2H A;  5DXK A;  3AN4 A;  2P1V A;  4NUF A;  5DXQ A;  3RVF A;  3MNP A;  2V7C A;  3OLL A;  1S0Z A;  3F5C A;  5DRM A;  2O9I A;  4RZF A;  4MGC A;  3OOK A;  4IA7 A;  3FUR A;  2O4R A;  1GWQ A;  1HG4 A;  4ZNU A;  1S0X A;  1DB1 A;  1PQ6 A;  3E00 D;  2HWQ A;  3H0A D;  3W0C A;  3KFC A;  1YYE A;  2JFA B;  4OAR A;  3ADX A;  2AWH A;  5KRK A;  2B23 A;  2G0G A;  1L2I A;  2NXX E;  4MG6 A;  3KPZ A;  4MG9 A;  5LGA A;  5IAW A;  1XDK B;  3WWR A;  4PF3 A;  3WGP A;  3GBK A;  1T74 A;  5FQV A;  2ZMH A;  3A2J A;  1IE8 A;  4RAK A;  5JI0 D;  3WT6 A;  2HWR A;  4ZOM A;  5ETH A;  4IW6 A;  1XIU A;  3UU7 A;  4KZM A;  1TXI A;  1RKH A;  2YAT A;  4J5X C;  3VN2 A;  2Z4B A;  4OKT A;  2P1U A;  3W0Y A;  4A4W A;  3E00 A;  2Q1V A;  3CS6 A;  3H0A A;  3R5M A;  3V9Y A;  1Y0X X;  3R29 A;  1XNX A;  4MG5 A;  4OC7 A;  2Q1H A;  2ZVT A;  4PPS A;  3KBA A;  2YLY A;  1Y9R A;  4Y29 A;  3V3E A;  1NHZ A;  2OVM A;  3IXP D;  4P6X A;  2ACL B;  1I7I A;  2ZAS A;  2AXA A;  1R20 D;  4WPF A;  4XUH A;  3BEJ A;  4ITF A;  4OIL A;  2VV2 A;  3OKH A;  3B0T A;  1GWX A;  5KCT A;  2Q61 A;  1XJ7 A;  1MV9 A;  5DXB A;  5F9B A;  3ZRB A;  1FM9 D;  5M96 A;  4XHD A;  1P8D A;  2ZK5 A;  3KWY A;  4N1Y A;  4WQP A;  5FQR A;  3FXV A;  3W0A A;  5KCF A;  1T76 A;  2GPP A;  4RE8 A;  5APJ A;  1XOW A;  3AUN A;  4N73 A;  1XZX X;  2XKW A;  4OEA A;  5KCE A;  3VRV A;  2GIU A;  3IXP A;  2PIR A;  2ZK4 A;  4M8H A;  3P88 A;  4OEZ A;  1U9E A;  3X31 A;  1R20 A;  2BAW A;  3D6D A;  4JYH A;  5E14 A;  3OAP A;  5APK A;  2HB8 A;  2QA8 B;  1NYX A;  5EI1 A;  3RUT A;  3VRT A;  2ZL9 A;  2ZXM A;  1PQC A;  4MG8 B;  3HC6 A;  1FM9 A;  2I4Z A;  5KRO A;  3AZ1 A;  3ET0 A;  4J24 A;  2QR9 A;  3AZ2 A;  4Q13 A;  4ZI1 A;  1S19 A;  1ZGY A;  3UP0 A;  3FS1 A;  5HCV A;  5EIT A;  1OT7 A;  2ZLA A;  2Q6R A;  3IPQ A;  1FCY A;  2PIP L;  3OS8 C;  4G1D A;  5DU5 A;  1U3R A;  2Q70 A;  2QPY A;  2QW4 A;  1XV9 B;  4OJB A;  1NUO A;  5DXP A;  3CDP A;  1YOK A;  3OGT A;  2ZNN A;  4MDD A;  4OK1 A;  3TX7 B;  4IWF A;  1QKU A;  4TUZ B;  3OMQ A;  3ET1 A;  4IA1 A;  5DTV A;  3T03 A;  3A9E B;  3GYU A;  4PVU A;  1Y0S A;  1T7R A;  3ADW A;  5HJP A;  1E3G A;  1XQ3 A;  3D5F A;  3MNO A;  4G20 A;  3KMR A;  3RY9 A;  4R6S A;  1X7J A;  3HO0 A;  2Q60 A;  4PP6 A;  3VT6 A;  5DX3 B;  2P7Z A;  5AZV A;  1I37 A;  1X76 A;  1OSV A;  5JY3 A; 
#chains in the Genus database with same CATH homology
 3ADT A;  4PLD A;  1I7G A;  3M7R A;  3D57 A;  4N5G A;  2GPV A;  4S14 A;  1ZAF A;  1HJ1 A;  2AA5 A;  4DK8 A;  4IQR A;  3B0W A;  3V49 A;  4QE8 A;  5KYJ A;  2ZNO A;  3B67 A;  4TV1 A;  2POB A;  3VHW A;  1XP9 A;  3OSW A;  5DID A;  1ILG A;  5G46 A;  4MGB A;  3B0R A;  3VI8 A;  2BJ4 A;  1T7M A;  3N00 A;  2OM9 A;  2XYJ A;  5DYD A;  4OFR A;  2P7G A;  2ZKC A;  3ADV A;  2AMA A;  4JAZ A;  4ZNS A;  5DZ3 A;  1XLS E;  3L1B A;  4XAO A;  5G43 A;  4KZI A;  2PIV A;  1PZL A;  1PK5 A;  3NSQ A;  2VV4 B;  2W8Y A;  4OH6 A;  1LBD A;  4ZNT A;  4PRG A;  5E1C A;  1G50 A;  4RZE A;  1XLS A;  3G9E A;  3D90 A;  3IA6 A;  5LWP A;  4LBD A;  3L0J A;  3OSI A;  3VT4 A;  1T5Z A;  2QSE A;  4KZJ A;  3SZ1 A;  2ZK0 A;  3TKM A;  4OKW A;  5DZI A;  3DCU A;  2Q5P A;  4OJ9 A;  1FCZ A;  2JFA A;  3RUU A;  3UP3 A;  5C4T A;  3K8S A;  5AWJ A;  3VJS A;  4X1G A;  1N4H A;  2Q5G A;  2YHD A;  5HZC A;  1XDK A;  3O1E A;  4NQA B;  2I0G A;  3IPS A;  2LBD A;  5E19 A;  3UUA B;  2QH6 A;  3W5Q A;  3VSP A;  3HZF A;  2NPA A;  2P15 A;  4XTA A;  3ET3 A;  2VV3 A;  4IUI A;  1ZEO A;  2GP7 A;  3FEJ A;  1U3S A;  3BC5 A;  4MGA B;  5DMF A;  3AFR A;  1S9P A;  2IOK A;  3AX8 A;  5G44 A;  2EWP A;  2O4J A;  2IHQ A;  3AUQ A;  4UDA A;  3IMY A;  3U9Q A;  3WTQ A;  3OZ0 A;  2V0V A;  5DWI A;  1GWR A;  2VV1 B;  4XUM A;  4DM8 A;  3WT7 A;  4WVD A;  4OGH A;  2P4Y A;  1M13 A;  3B65 A;  2GL8 A;  2ACL A;  3A2I A;  4L98 A;  4POJ A;  5DKB A;  1YUC A;  2QMV A;  2YJA B;  2XHS A;  2NXX A;  3LMP A;  2AAX A;  1T63 A;  3A78 A;  2ZNQ A;  4QL8 A;  3G8O A;  3PBA A;  5EGV A;  1X78 A;  2ZK6 A;  3OOF A;  3KDT A;  4FHI A;  3RLJ A;  1A28 A;  3FEI A;  4J5W A;  3RLL A;  4IV2 A;  4B7W A;  5HYK A;  4A2J A;  1YIM A;  4ZO1 B;  4ZJW A;  1MVC A;  4G21 A;  1YA3 A;  3VT8 A;  1X7B A;  3OMK A;  4OFU A;  4MGD B;  3V9V A;  3CS4 A;  1YMT A;  1K74 D;  1UPW A;  2ZK1 A;  2R6W A;  1K7L A;  4OKB A;  5KRF A;  3OZJ A;  2HFP A;  5JJM B;  1G2N A;  2HC4 A;  2QA8 A;  1MZN A;  1XPC A;  1Z5X U;  3CWD A;  4WHG A;  4DK7 A;  3SP6 A;  4MG8 A;  5DV3 A;  3W0I A;  3FAL B;  1NQ2 A;  2QE4 A;  1ILH A;  3WFF A;  2POG A;  1DKF B;  1UPV A;  2HCD A;  2YJD A;  3Q95 B;  5ACC A;  5A86 A;  1XP6 A;  3CDS A;  3G0W A;  4J5W C;  4LTW A;  3VSO A;  1XV9 A;  3ZQT A;  4IVW A;  1K74 A;  4LSJ A;  5DSH A;  3UUC A;  4S15 A;  1FM6 D;  4TUZ A;  2Q6S A;  3LBD A;  1S9Q A;  3A9E A;  3FC6 B;  4MG7 B;  1NRL A;  1KKQ A;  2P1T A;  3DY6 A;  3KMG A;  3VRW A;  3FUG A;  5KCW A;  4WLB A;  1RJK A;  3B5R A;  4K6I A;  4XLD A;  3P0U A;  3V4A A;  4XI3 A;  5DVC A;  5DX3 A;  5DXG A;  1T73 A;  4APU A;  1T79 A;  5K13 A;  4UDD A;  5L11 A;  1R1K D;  2QGT A;  4P6W A;  5DIE A;  1SJ0 A;  5DVS A;  5ICK A;  4ITE A;  3GWS X;  1FM6 A;  4RUO X;  4E4Q A;  4RWV A;  3OKI A;  4RFW A;  5G45 A;  2A3I A;  3OMP A;  3A40 X;  4JL4 A;  1YY4 A;  4NIE A;  4FGY A;  3DT3 A;  5DWG A;  2ZK2 A;  4F9M A;  5APH A;  3GWX A;  5E0W A;  5H1E A;  3X1H A;  2PIX A;  5KCD A;  1OVL B;  1R1K A;  3E94 A;  4OH5 A;  1UHL B;  1T65 A;  3L0L A;  5B41 A;  1FD0 A;  3HOD A;  4OED A;  5DKS A;  2PIQ A;  2QA6 A;  3X1I A;  5HJS A;  2Q3Y A;  5C4O A;  2OUZ A;  3R8A A;  3GYT A;  4OIU A;  1VJB A;  3A3Z X;  3L3Z A;  2HB7 A;  2ZLC A;  4CI4 A;  4N8R A;  3ET2 A;  4JYG A;  2AX7 A;  3GD2 A;  4NB6 A;  2I0J A;  4PLE A;  2I4J A;  4DOR A;  4RZG A;  2ZNP A;  4LNW A;  4PPP A;  2ZMI A;  3PLZ A;  3QT0 A;  1XB7 A;  2ABI A;  2ZBS A;  3UVV B;  2GTK A;  3KMZ A;  2NW4 A;  5EHJ A;  4YNK A;  2QXS A;  3DR1 A;  3UUA A;  1RKG A;  4CSJ A;  2ZFX A;  2B50 A;  4ZJR A;  3B0Q A;  3VT5 A;  2AYR A;  2FVJ A;  2Q59 B;  3H52 A;  4G1Z A;  4MGA A;  4PXM A;  5HJP B;  4RMC A;  5DI7 A;  3WJ4 A;  3W0J A;  3MNE A;  2QNV A;  4POH A;  2J7Y A;  5DZ1 A;  1NAX A;  2PIW A;  5AVL A;  5DXM A;  1KV6 A;  3R2A A;  2P7A A;  1Z5X E;  2Q7L A;  3S9S A;  5AZT A;  4RMD A;  5AAV B;  3G8I A;  2ATH A;  2G5O A;  5C4S A;  1XVP B;  2PNU A;  3JZB A;  3HVL A;  1PCG A;  4OHA A;  4BCR A;  4LNX A;  3W5R A;  3W5T A;  4G1Y A;  3W5P A;  5DMC A;  1E3K A;  2ZY0 A;  2IOG A;  4OJ4 A;  2HAS A;  4Q50 A;  3TKC A;  2GPO A;  2Q8S A;  1IE9 A;  4REF A;  1YJE A;  1G5Y A;  5FQS A;  2J4A A;  4ZNH A;  5GIE A;  4K7A A;  5DWL A;  3K6P A;  4S0S A;  2GPU A;  5DRJ A;  3UUD B;  1N83 A;  2QZO B;  3VJT A;  3NSP A;  4E2J A;  4MGD A;  4A4V A;  3JZC A;  1U3Q A;  3OMM A;  1XQC A;  3FLI A;  2G44 A;  2H77 A;  3VTB A;  4IA2 A;  2G0H A;  4Q0A C;  3VHV A;  3X36 A;  4WHF A;  4J5X A;  5KCU A;  4UDB A;  4ZN9 A;  3E7C A;  3HM1 A;  5JJM A;  1NQ7 A;  1ZH7 A;  3WMH A;  1T7T A;  1ZDT A;  5KD9 A;  2P54 A;  1XNN A;  3D24 A;  3FAL A;  5KRI A;  5AAU A;  4R06 A;  3R5N A;  2OAX A;  3NOA A;  4OEY A;  3HQ5 A;  5B5B A;  1G1U A;  1DKF A;  3Q95 A;  5KRA A;  2AX8 A;  1EXX A;  4HEE X;  1UOM A;  4QE6 A;  5DZ0 A;  1R6G A;  4IU7 A;  1NQ0 A;  5DUH A;  5DUG A;  5C4U A;  3DCT A;  4REE A;  2Q7K A;  2QTU A;  2PKL A;  2OCF A;  1LV2 A;  1KNU A;  2PIO A;  3F5C B;  3FC6 A;  4MG7 A;  5E0X A;  3ADU A;  4S0T A;  2AB2 A;  2AX9 A;  3F7D A;  1K4W A;  1ZKY A;  1YOW A;  2VV0 A;  5DLR A;  4IA3 A;  4O8F A;  3WFG A;  3SP9 A;  3VHU A;  3B68 A;  2Q6J A;  5FQP A;  3R8D A;  2XYW A;  3R8I A;  3VJI A;  3ZR7 A;  3DZU D;  3IPU A;  4OZT E;  3K22 A;  4MG9 B;  4QK4 A;  4FHH A;  3AZ3 A;  2QXM A;  4QM0 A;  1X7E A;  2AX6 A;  3CTB A;  5DUE A;  2HVC A;  5KR9 A;  4ONI A;  1FCX A;  2H79 A;  3HC5 A;  3OS8 A;  2JJ3 A;  2OZ7 A;  1RDT D;  5G42 A;  3VTC A;  4HLW A;  4J26 A;  3W0H A;  3ILZ A;  3UU7 B;  1M7W A;  4YMQ A;  3V9T A;  2Q7J A;  5DWE A;  1RK3 A;  4XT9 A;  4FN9 A;  2XYX A;  3OLF A;  2Q7I A;  3AN3 A;  5DVV A;  1PQ9 A;  2YLQ A;  5DXE A;  5KRH A;  5DY8 A;  3DZU A;  1A52 A;  3B3K A;  5L7G A;  1M2Z A;  3P8X A;  1OVL A;  3ADS A;  2F4B A;  2NV7 A;  1UHL A;  3W0G A;  3CJW A;  2PJL A;  5FQT A;  3WT5 A;  4PP3 A;  5AWK A;  5DWJ A;  4G2H A;  4ZN7 A;  3OS9 A;  4ZNV A;  1Z95 A;  3B1M A;  4OLM A;  2Q5S A;  4IW8 A;  2PIT A;  5DXB B;  1RDT A;  3L0E A;  2I4P A;  1H9U A;  2B1V A;  4EM9 A;  3PCU A;  2HAR A;  1QKM A;  3PRG A;  3EYB A;  3DZY D;  3L3X A;  5DKG A;  5DV8 A;  4UDC A;  4IS8 A;  1ERR A;  5DIG A;  2R6Y A;  1SR7 A;  1BSX A;  3UVV A;  4DQM A;  5E7V A;  3AUR A;  3B66 A;  2AA7 A;  2VV4 A;  4OZR E;  1ERE A;  3O1D A;  3OMO A;  5HYR A;  1YP0 A;  5DP0 A;  3VRU A;  4NY9 A;  2PRG A;  2YFE A;  3KYT A;  5IZ0 A;  4OZT U;  4G2I A;  3GZ9 A;  2AA2 A;  2Q59 A;  3VJH A;  2AMB A;  4OKX A;  3CLD A;  1OSH A;  1X7R A;  5EJV A;  3PO9 A;  2AM9 A;  2AA6 A;  2ZXN A;  1N46 A;  4M8E A;  3DZY A;  4ZNW A;  2HAM A;  5DXR A;  4OIV A;  5EC9 A;  1FBY A;  3VT3 A;  2QGW A;  2VST A;  2B1Z A;  2R40 D;  5G3J A;  5GIC A;  1PDU A;  5AAV A;  4IV4 A;  5AK2 A;  1GS4 A;  4DMA A;  3ERD A;  4RUJ A;  5E15 A;  4YT1 A;  1XVP A;  1XAP A;  4QJR A;  4L96 A;  3L03 A;  1ZDU A;  2PIN A;  5KRC A;  5KCC A;  1R5K A;  3CQV A;  2GWX A;  2REW A;  2YLP A;  4E4K A;  2FAI A;  1NDE A;  1ZUC A;  2AO6 A;  4CI5 A;  4JGV A;  2ZK3 A;  2Z4J A;  3CS8 A;  1YIN A;  4RUP A;  5GT4 A;  5SYZ A;  5L7H A;  3ZRA A;  4FNE A;  2FSZ A;  5CJ6 A;  1P93 A;  4X1F A;  2VV1 A;  3VT7 A;  2YLO A;  3UUD A;  1EXA A;  2QZO A;  3VT9 A;  3VTD A;  3K23 A;  5KRL A;  1QKT A;  4ZO1 X;  2R40 A;  2ZXZ A;  5GID A;  3TY0 A;  4DOS A;  1NQ1 A;  1Q4X A;  1XP1 A;  2PIU A;  3P89 A;  4PWL A;  3GN8 A;  3WJ5 A;  1T7F A;  2E2R A;  5KYA A;  4PP5 A;  3V3Q A;  5L7E A;  3OLS A;  4R2U A;  2ZMJ A;  4DM6 A;  4TV1 B;  5AYG A;  1WM0 X;  2J7X A;  2QAB A;  5G5W A;  4OZR U;  1SKX A;  4MGB B;  2BJ4 B;  5DYB A;  4IVY A;  1PRG A;  5DK9 A;  2VSR A;  5AVI A;  2HBH A;  4RME A;  3OSA A;  3KDU A;  1NAV A;  5IXK A;  1I38 A;  5DZH A;  5I4V A;  5DL4 A;  5KRM A;  1TFC A;  2OVH A;  4JYI A;  3PEQ A;  5KRJ A;  1SQN A;  2J14 A;  2JF9 A;  3HLV A;  4K4J A;  3BQD A;  1L2J A;  4IWC A;  5DKE A;  5DV6 A;  4YPQ A;  1QKN A;  4EMA A;  3ERT A;  3A2H A;  5DXK A;  3AN4 A;  2P1V A;  4NUF A;  5DXQ A;  3RVF A;  3MNP A;  2V7C A;  3OLL A;  1S0Z A;  3F5C A;  5DRM A;  2O9I A;  4RZF A;  4MGC A;  3OOK A;  4IA7 A;  3FUR A;  2O4R A;  1GWQ A;  1HG4 A;  4ZNU A;  1S0X A;  1DB1 A;  1PQ6 A;  3E00 D;  2HWQ A;  3H0A D;  3W0C A;  3KFC A;  1YYE A;  2JFA B;  4OAR A;  3ADX A;  2AWH A;  5KRK A;  2B23 A;  2G0G A;  1L2I A;  2NXX E;  4MG6 A;  3KPZ A;  4MG9 A;  5LGA A;  5IAW A;  1XDK B;  3WWR A;  4PF3 A;  3WGP A;  3GBK A;  1T74 A;  5FQV A;  2ZMH A;  3A2J A;  1IE8 A;  4RAK A;  5JI0 D;  3WT6 A;  2HWR A;  4ZOM A;  5ETH A;  4IW6 A;  1XIU A;  3UU7 A;  4KZM A;  1TXI A;  1RKH A;  2YAT A;  4J5X C;  3VN2 A;  2Z4B A;  4OKT A;  2P1U A;  3W0Y A;  4A4W A;  3E00 A;  2Q1V A;  3CS6 A;  3H0A A;  3R5M A;  3V9Y A;  1Y0X X;  3R29 A;  1XNX A;  4MG5 A;  4OC7 A;  2Q1H A;  2ZVT A;  4PPS A;  3KBA A;  2YLY A;  1Y9R A;  4Y29 A;  3V3E A;  1NHZ A;  2OVM A;  3IXP D;  4P6X A;  2ACL B;  1I7I A;  2ZAS A;  2AXA A;  1R20 D;  4WPF A;  4XUH A;  3BEJ A;  4ITF A;  4OIL A;  2VV2 A;  3OKH A;  3B0T A;  1GWX A;  5KCT A;  2Q61 A;  1XJ7 A;  1MV9 A;  5DXB A;  5F9B A;  3ZRB A;  1FM9 D;  5M96 A;  4XHD A;  1P8D A;  2ZK5 A;  3KWY A;  4N1Y A;  4WQP A;  5FQR A;  3FXV A;  3W0A A;  5KCF A;  1T76 A;  2GPP A;  4RE8 A;  5APJ A;  1XOW A;  3AUN A;  4N73 A;  1XZX X;  2XKW A;  4OEA A;  5KCE A;  3VRV A;  2GIU A;  3IXP A;  2PIR A;  2ZK4 A;  4M8H A;  3P88 A;  4OEZ A;  1U9E A;  3X31 A;  1R20 A;  2BAW A;  3D6D A;  4JYH A;  5E14 A;  3OAP A;  5APK A;  2HB8 A;  2QA8 B;  1NYX A;  5EI1 A;  3RUT A;  3VRT A;  2ZL9 A;  2ZXM A;  1PQC A;  4MG8 B;  3HC6 A;  1FM9 A;  2I4Z A;  5KRO A;  3AZ1 A;  3ET0 A;  4J24 A;  2QR9 A;  3AZ2 A;  4Q13 A;  4ZI1 A;  1S19 A;  1ZGY A;  3UP0 A;  3FS1 A;  5HCV A;  5EIT A;  1OT7 A;  2ZLA A;  2Q6R A;  3IPQ A;  1FCY A;  2PIP L;  3OS8 C;  4G1D A;  5DU5 A;  1U3R A;  2Q70 A;  2QPY A;  2QW4 A;  1XV9 B;  4OJB A;  1NUO A;  5DXP A;  3CDP A;  1YOK A;  3OGT A;  2ZNN A;  4MDD A;  4OK1 A;  3TX7 B;  4IWF A;  1QKU A;  4TUZ B;  3OMQ A;  3ET1 A;  4IA1 A;  5DTV A;  3T03 A;  3A9E B;  3GYU A;  4PVU A;  1Y0S A;  1T7R A;  3ADW A;  5HJP A;  1E3G A;  1XQ3 A;  3D5F A;  3MNO A;  4G20 A;  3KMR A;  3RY9 A;  4R6S A;  1X7J A;  3HO0 A;  2Q60 A;  4PP6 A;  3VT6 A;  5DX3 B;  2P7Z A;  5AZV A;  1I37 A;  1X76 A;  1OSV A;  5JY3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...