4OZTU

Crystal structure of the ligand binding domains of the bovicola ovis ecdysone receptor ecr/usp heterodimer (pona crystal)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
195
structure length
195
Chain Sequence
NAVANICQATNSQLYQLVEWAKHIPHFSSLPIEDQVLLLRAGWNELLIAAFSHRSVEVRDGIVLGAGITVHRNSAHQAGVGTIFDRVLTELVAKMRDMNMDRTELGSLRSIILFNPEVRGLKSGQEVELLREKVYAALEEYTRVTRPEEPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDIPIDTFLMDMLGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Unprecedented conformational flexibility revealed in the ligand-binding domains of the Bovicola ovis ecdysone receptor (EcR) and ultraspiracle (USP) subunits.
pubmed doi rcsb
molecule keywords Ecdysone receptor
molecule tags Transcription
source organism Pediculus humanus subsp. corporis
total genus 65
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2014-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 4oztU00
1X7RA 3ADSA 3AZ2A 3OKHA 2PJLA 2Q1HA 5A86A 3FALB 5DVVA 3WGPA 3VJIA 3RVFA 4NUFA 1XQ3A 3UVVB 4XT9A 3W0YA 4IU7A 3TKMA 1MV9A 3M7RA 2ZLCA 3OS8A 5KRKA 5DUGA 3PCUA 3V9YA 3PO9A 2J14A 1NQ0A 1L2IA 3R2AA 4HEEX 2ZXNA 3NSQA 2PIUA 4WPFA 3W0IA 5E0XA 1Y0SA 3OS8C 2B23A 3JZBA 4G20A 2ZASA 3HODA 2QABA 4YNKA 3PBAA 2W8YA 3NOAA 1N46A 1NHZA 1PCGA 3ET1A 2OAXA 5AVIA 2GPPA 4G2IA 4MGDB 4R06A 3KBAA 1NAVA 2QR9A 1YA3A 4S0TA 5DKGA 1FM9A 5KCTA 3VT8A 3HC6A 2Q7KA 5AZTA 2PIWA 1EXXA 4ZNHA 5GIEA 3IPSA 1UOMA 2AAXA 4NB6A 1GWQA 4OFRA 5AYGA 2BJ4B 4E4KA 2NXXE 3RLJA 3AFRA 1X7BA 1M7WA 3GWSX 3ADXA 3CTBA 5AK2A 5DIEA 1K74D 3UU7A 1XLSA 2QNVA 3IXPA 3LMPA 3X1HA 5APHA 4JYIA 3V9VA 2YATA 5FQVA 5KCUA 2AWHA 1RDTD 1S9PA 2G44A 1T79A 4RWVA 3UU7B 1U3SA 5DL4A 4N8RA 1HJ1A 2ZKCA 3A40X 4ZNWA 5KYAA 2QSEA 2YLYA 4REFA 1T74A 2O4JA 3U9QA 4PPSA 5CJ6A 4R6SA 2Q6SA 3ET3A 3VJSA 3W5QA 5JJMB 4A4WA 2GL8A 3K6PA 4IWFA 3K8SA 3RY9A 3H0AD 3OSWA 4E2JA 1L2JA 3R8DA 4X1FA 4OH5A 3B67A 1FCYA 5IAWA 4ZO1X 3VTDA 5E14A 3ZQTA 3B5RA 4RUJA 3D24A 4XUMA 1NQ7A 3DY6A 2F4BA 2O9IA 2Z4JA 4UDCA 5DWGA 4ZI1A 4RZEA 3VTBA 2GWXA 2ZK0A 2ZMIA 3FS1A 3QT0A 4FHHA 4ITEA 5FQPA 3VSPA 3UP0A 5E7VA 4ZJWA 4M8HA 2Q59A 5KCWA 1MZNA 5KRAA 1ZUCA 1T73A 1PDUA 2P1TA 3VHUA 4LBDA 2ZK6A 4DM6A 2AXAA 4G1YA 3VT6A 1NYXA 4QL8A 3MNPA 1X78A 1YUCA 3A2IA 1YOKA 4KZIA 4RE8A 3A78A 1Z5XU 4DK8A 5G46A 1FM9D 5LWPA 3D6DA 2ZXZA 2JFAA 5DMCA 4KZMA 5DXRA 2QZOA 1IE9A 2Q6JA 4MGBB 3X31A 2QXSA 1I38A 5C4TA 2Q5GA 5KCDA 5KYJA 4L96A 4JYGA 4J5XA 2H77A 3KMZA 3OMPA 3IXPD 1XZXX 3E7CA 2ZVTA 3D57A 3W0JA 5H1EA 4OKTA 4WLBA 5DUEA 5AWKA 3UUCA 5L7HA 1UHLA 2G0HA 3AZ1A 5DV8A 1ILHA 1PQ6A 1TXIA 4K6IA 4QM0A 3GD2A 4IVYA 4XI3A 1M13A 3DCTA 1T7MA 3GBKA 5HCVA 3CLDA 5AVLA 4G1ZA 5KCCA 2YJDA 1H9UA 3PLZA 3R5NA 5DY8A 1T7TA 5EGVA 5EJVA 3GN8A 3VJHA 1Q4XA 1XQCA 5DV6A 5HYKA 5B5BA 2ABIA 4JYHA 2Q5PA 4OIVA 5AAVA 4PPPA 2HFPA 3CS8A 2J4AA 2OUZA 2OVMA 2VV1A 2R40A 5HJSA 5DYBA 3A2HA 3PEQA 4YMQA 1XP9A 5HYRA 2Q7JA 3W0CA 4IVWA 2ACLA 2YLOA 4XHDA 5E0WA 2ZFXA 1G50A 2I4JA 3V3QA 3VT3A 5AAVB 2HWQA 3OSIA 3FALA 5GT4A 1LBDA 2ZK4A 4OEYA 4ZO1B 5DWLA 3UVVA 3O1EA 4OILA 2B1ZA 3FXVA 4ZNVA 4IA2A 3P8XA 3SZ1A 4WQPA 5KRCA 4G2HA 3CDSA 4KZJA 3KWYA 4FN9A 2P7GA 1EREA 2AA5A 4L98A 4CI4A 1PQ9A 2QA6A 3UUDA 3FC6B 3GZ9A 5DVCA 2ZNOA 5DXQA 3IA6A 2XYJA 1SR7A 1IE8A 5GIDA 5KRLA 3CJWA 1RKGA 2G0GA 1YINA 2QH6A 4TV1B 4O8FA 3WMHA 5ACCA 5DRMA 3UUDB 3G8OA 4IS8A 5DZIA 4MGDA 2PIVA 1XDKB 4OJ9A 5DYDA 3VJTA 3V9TA 1FD0A 1ZKYA 4OEDA 1M2ZA 1RKHA 1YMTA 3WT7A 4RZGA 2R6YA 4NY9A 4PXMA 2QGWA 2NV7A 2I0GA 1XJ7A 2BJ4A 1QKUA 2YHDA 3ZRAA 2AMBA 1G1UA 4POHA 4QE8A 5GICA 4N5GA 3BQDA 2PNUA 1Z95A 1ZGYA 2PRGA 1E3GA 2I4PA 3TX7B 4PLEA 4IQRA 2FVJA 2QTUA 3MNOA 5DXEA 4J26A 4FGYA 4NQAB 5G5WA 4IWCA 5DUHA 3WJ4A 4YPQA 2Q1VA 3IPUA 5K13A 2Q60A 1GWXA 2AO6A 5EI1A 3KYTA 2HASA 4ZN9A 5APJA 1RK3A 2PIRA 2GPOA 4DOSA 4ZJRA 5AZVA 2QXMA 5KR9A 2R40D 4M8EA 2GTKA 2NXXA 3Q95B 5DRJA 5JJMA 4N1YA 4DORA 1NRLA 3FEIA 2LBDA 3OMMA 4RFWA 4OH6A 3DT3A 2YLPA 3VT4A 5DV3A 3FEJA 2QGTA 1Z5XE 3OZ0A 2XYXA 4PP3A 3RUUA 5DX3B 2AX8A 2G5OA 3ERDA 3JZCA 3PRGA 4MG9A 5DIGA 1UPVA 4XLDA 5G45A 5DTVA 5DWJA 3W5RA 4A2JA 5I4VA 2GP7A 3OSAA 4OIUA 5ICKA 3GYTA 1N83A 3WT5A 5DZ3A 1T7FA 1OSHA 4OC7A 4ONIA 2PIXA 2ZNNA 3VRTA 4MG9B 3FURA 2ZMJA 4MGCA 4XUHA 5KCFA 1A28A 2QA8A 3ET2A 4OARA 1XP1A 3B1MA 2B50A 1YYEA 2VV3A 3L0JA 1X7EA 3A3ZX 3AN3A 4OKXA 3S9SA 1SJ0A 4NIEA 2QA8B 2GPVA 2AX9A 1PK5A 1QKMA 2HB8A 2XHSA 3ILZA 1S0XA 2ATHA 4MGBA 3AX8A 4K7AA 3OKIA 3MNEA 5DLRA 1GS4A 3DZYA 4QE6A 1LV2A 4PF3A 2VV4A 3P0UA 4MGAB 5DVSA 3N00A 3WJ5A 4J24A 4OJ4A 4LTWA 4XTAA 3GWXA 4RMDA 1R6GA 3E00A 1FCXA 3OMOA 5G3JA 3UUAA 5DXBB 3B66A 3VHVA 1XP6A 4MG8B 2VV4B 3KDUA 3VI8A 2POBA 1E3KA 3AURA 3T03A 3L3ZA 3CS6A 3DZUA 2P7AA 3UUAB 3W0GA 1XAPA 4J5XC 1ZDTA 3VTCA 1NQ1A 1U3RA 1KKQA 3OS9A 3KPZA 4OJBA 4IA3A 3R8AA 2XYWA 3A2JA 3B65A 3GYUA 4MDDA 2P1UA 2FSZA 1R20A 4WHFA 3V4AA 3VT7A 3OMKA 3VRWA 1XOWA 2IOKA 5FQRA 1OSVA 5L11A 1T63A 4XAOA 1R5KA 5ETHA 2QPYA 1ZDUA 3X1IA 3CDPA 4PVUA 2PINA 2FAIA 1U3QA 3ADTA 5G44A 3FC6A 2Q8SA 4MG7B 2AMAA 3CWDA 5F9BA 1FM6A 3ZRBA 4P6WA 3W5PA 2P15A 1T65A 5KRMA 2PIOA 2AA7A 2ZK1A 3AUNA 2HAMA 3DR1A 3F5CB 1YOWA 4TV1A 1NQ2A 3HZFA 1FCZA 3FLIA 4Q13A 3V3EA 3L1BA 1T5ZA 1XDKA 4S15A 4ZNUA 4P6XA 1XV9B 1ZEOA 3DCUA 3P89A 3UP3A 3OOKA 3H52A 3L0LA 3HVLA 3VRUA 3HM1A 1GWRA 2H79A 3DZYD 2HCDA 5KRIA 2HARA 5EHJA 5KCEA 2VSTA 5APKA 1Y9RA 2VV2A 5C4UA 3VN2A 2Q7LA 3R29A 3B0TA 4RMCA 4X1GA 5DU5A 2Q7IA 2O4RA 4QJRA 5DKSA 1R1KA 2Q5SA 1XPCA 2ZBSA 2ZY0A 3E00D 1XVPB 3ERTA 3O1DA 4IW6A 4LNXA 5DKEA 4Q0AC 3E94A 3ET0A 3SP9A 1OT7A 2R6WA 4G21A 5LGAA 2JF9A 2GPUA 3LBDA 4OEAA 5IZ0A 4QK4A 5L7EA 1YP0A 2AB2A 2A3IA 3B3KA 1P8DA 4PLDA 3DZUD 5DWIA 1SQNA 2NPAA 5EITA 3B68A 4APUA 1N4HA 4OHAA 4S14A 1YJEA 3IPQA 3WWRA 2YJAB 5B41A 1XIUA 2YFEA 3Q95A 4PP6A 4FHIA 3TY0A 4POJA 2PIQA 1P93A 4BCRA 4DMAA 5JY3A 4LSJA 5SYZA 4K4JA 3KMGA 1R20D 3VT5A 5DKBA 5DX3A 3ZR7A 1DKFA 4IV4A 1YY4A 1FBYA 2V7CA 4R2UA 1XLSE 1NAXA 1A52A 2AX7A 2HC4A 4OKWA 4Y29A 4OZRE 1U9EA 2REWA 4IA1A 5DXMA 1HG4A 1I7IA 2QW4A 3R5MA 5DZ1A 5C4SA 1G2NA 1K4WA 4OFUA 1FM6D 1MVCA 1DKFB 3L0EA 1YIMA 3OLLA 4IW8A 3RLLA 5AAUA 1S0ZA 1RJKA 3OOFA 4FNEA 4B7WA 4WVDA 4ZN7A 3ADWA 1KV6A 2ZLAA 4E4QA 1VJBA 2E2RA 2HWRA 4JAZA 2QE4A 2PIPL 5HJPA 3AUQA 2VSRA 3D90A 4OGHA 2ZK2A 4TUZA 2P54A 3VSOA 1S9QA 2P4YA 2Q61A 4CI5A 3F7DA 4LNWA 4UDDA 5DMFA 2HBHA 1PQCA 2Q70A 3BC5A 4DK7A 4MG6A 1G5YA 2AM9A 1DB1A 2I0JA 2PKLA 4UDBA 3VHWA 4TUZB 1R1KD 5G42A 4MGAA 5E19A 3K23A 3KDTA 1X76A 2AA2A 2ZNQA 3FUGA 4RMEA 4RUPA 4OZRU 4PWLA 5E15A 3W0HA 5HZCA 4OEZA 4EM9A 3EYBA 5DXKA 1QKTA 5DXBA 5FQSA 1I37A 5KRFA 3RUTA 4YT1A 3WFGA 2ZK3A 4MG8A 4ZNSA 1S19A 4S0SA 1EXAA 2I4ZA 1T76A 5HJPB 4OKBA 3G8IA 1PRGA 5KROA 3L3XA 4A4VA 4CSJA 5DIDA 3A9EA 3OLSA 2IOGA 5DSHA 1ZH7A 4ITFA 2OZ7A 3ADUA 3P88A 3W5TA 3KMRA 2PITA 4PRGA 2EWPA 3D5FA 2J7XA 1TFCA 3B0QA 3OMQA 2GIUA 5DK9A 5G43A 3NSPA 2XKWA 5M96A 2JJ3A 4OZTE 3A9EB 4IV2A 2Q59B 2P7ZA 1NDEA 2AA6A 2IHQA 3G9EA 3OZJA 3CS4A 3AN4A 3K22A 2P1VA 3WT6A 1PZLA 5L7GA 1KNUA 4REEA 2POGA 2Z4BA 5E1CA 3SP6A 1ILGA 5DP0A 1XNNA 1WM0X 4RZFA 3V49A 5DI7A 2ZMHA 5KRHA 1I7GA 3TKCA 4DM8A 2Q3YA 5KD9A 4UDAA 3AZ3A 4RUOX 5DZHA 2J7YA 4MG7A 1Y0XX 3B0WA 1K7LA 3ADVA 2JFAB 2NW4A 4WHGA 3R8IA 5IXKA 2VV0A 2QZOB 3G0WA 4HLWA 3WFFA 3F5CA 3HLVA 4OK1A 4OLMA 2QMVA 3HQ5A 4RAKA 1T7RA 3B0RA 2ZK5A 4ZOMA 4Q50A 4ZNTA 1OVLA 5DXGA 2V0VA 3HC5A 5AWJA 3W0AA 4F9MA 3OGTA 1XV9A 5DXPA 1K74A 1NUOA 2ZNPA 3OAPA 1ERRA 1QKNA 4EMAA 3CQVA 2AYRA 4JGVA 1BSXA 1SKXA 4OZTU 2OCFA 1UHLB 5JI0D 2ZL9A 2ZXMA 5EC9A 4J5WA 1OVLB 2B1VA 2BAWA 4DQMA 5DWEA 5KRJA 1RDTA 2HVCA 4G1DA 4PP5A 3OLFA 1X7JA 1UPWA 2OM9A 3L03A 5FQTA 4N73A 1ZAFA 2OVHA 3VT9A 3X36A 4J5WC 5DZ0A 2AX6A 1XVPA 4IUIA 3BEJA 3VRVA 4JL4A 2HB7A 2YLQA 2VV1B 3KFCA 5C4OA 3HO0A 1XNXA 2Q6RA 3WTQA 4MG5A 4IA7A 3H0AA 1XB7A 2ACLB 3IMYA
chains in the Genus database with same CATH superfamily
1X7RA 3ADSA 3AZ2A 3OKHA 2PJLA 2Q1HA 5A86A 3FALB 5DVVA 3WGPA 3VJIA 3RVFA 4NUFA 1XQ3A 3UVVB 4XT9A 3W0YA 4IU7A 3TKMA 1MV9A 3M7RA 2ZLCA 3OS8A 5KRKA 5DUGA 3PCUA 3V9YA 3PO9A 2J14A 1NQ0A 1L2IA 3R2AA 4HEEX 2ZXNA 3NSQA 2PIUA 4WPFA 3W0IA 5E0XA 1Y0SA 3OS8C 2B23A 3JZBA 4G20A 2ZASA 3HODA 2QABA 4YNKA 3PBAA 2W8YA 3NOAA 1N46A 1NHZA 1PCGA 3ET1A 2OAXA 5AVIA 2GPPA 4G2IA 4MGDB 4R06A 3KBAA 1NAVA 2QR9A 1YA3A 4S0TA 5DKGA 1FM9A 5KCTA 3VT8A 3HC6A 2Q7KA 5AZTA 2PIWA 1EXXA 4ZNHA 5GIEA 3IPSA 1UOMA 2AAXA 4NB6A 1GWQA 4OFRA 5AYGA 2BJ4B 4E4KA 2NXXE 3RLJA 3AFRA 1X7BA 1M7WA 3GWSX 3ADXA 3CTBA 5AK2A 5DIEA 1K74D 3UU7A 1XLSA 2QNVA 3IXPA 3LMPA 3X1HA 5APHA 4JYIA 3V9VA 2YATA 5FQVA 5KCUA 2AWHA 1RDTD 1S9PA 2G44A 1T79A 4RWVA 3UU7B 1U3SA 5DL4A 4N8RA 1HJ1A 2ZKCA 3A40X 4ZNWA 5KYAA 2QSEA 2YLYA 4REFA 1T74A 2O4JA 3U9QA 4PPSA 5CJ6A 4R6SA 2Q6SA 3ET3A 3VJSA 3W5QA 5JJMB 4A4WA 2GL8A 3K6PA 4IWFA 3K8SA 3RY9A 3H0AD 3OSWA 4E2JA 1L2JA 3R8DA 4X1FA 4OH5A 3B67A 1FCYA 5IAWA 4ZO1X 3VTDA 5E14A 3ZQTA 3B5RA 4RUJA 3D24A 4XUMA 1NQ7A 3DY6A 2F4BA 2O9IA 2Z4JA 4UDCA 5DWGA 4ZI1A 4RZEA 3VTBA 2GWXA 2ZK0A 2ZMIA 3FS1A 3QT0A 4FHHA 4ITEA 5FQPA 3VSPA 3UP0A 5E7VA 4ZJWA 4M8HA 2Q59A 5KCWA 1MZNA 5KRAA 1ZUCA 1T73A 1PDUA 2P1TA 3VHUA 4LBDA 2ZK6A 4DM6A 2AXAA 4G1YA 3VT6A 1NYXA 4QL8A 3MNPA 1X78A 1YUCA 3A2IA 1YOKA 4KZIA 4RE8A 3A78A 1Z5XU 4DK8A 5G46A 1FM9D 5LWPA 3D6DA 2ZXZA 2JFAA 5DMCA 4KZMA 5DXRA 2QZOA 1IE9A 2Q6JA 4MGBB 3X31A 2QXSA 1I38A 5C4TA 2Q5GA 5KCDA 5KYJA 4L96A 4JYGA 4J5XA 2H77A 3KMZA 3OMPA 3IXPD 1XZXX 3E7CA 2ZVTA 3D57A 3W0JA 5H1EA 4OKTA 4WLBA 5DUEA 5AWKA 3UUCA 5L7HA 1UHLA 2G0HA 3AZ1A 5DV8A 1ILHA 1PQ6A 1TXIA 4K6IA 4QM0A 3GD2A 4IVYA 4XI3A 1M13A 3DCTA 1T7MA 3GBKA 5HCVA 3CLDA 5AVLA 4G1ZA 5KCCA 2YJDA 1H9UA 3PLZA 3R5NA 5DY8A 1T7TA 5EGVA 5EJVA 3GN8A 3VJHA 1Q4XA 1XQCA 5DV6A 5HYKA 5B5BA 2ABIA 4JYHA 2Q5PA 4OIVA 5AAVA 4PPPA 2HFPA 3CS8A 2J4AA 2OUZA 2OVMA 2VV1A 2R40A 5HJSA 5DYBA 3A2HA 3PEQA 4YMQA 1XP9A 5HYRA 2Q7JA 3W0CA 4IVWA 2ACLA 2YLOA 4XHDA 5E0WA 2ZFXA 1G50A 2I4JA 3V3QA 3VT3A 5AAVB 2HWQA 3OSIA 3FALA 5GT4A 1LBDA 2ZK4A 4OEYA 4ZO1B 5DWLA 3UVVA 3O1EA 4OILA 2B1ZA 3FXVA 4ZNVA 4IA2A 3P8XA 3SZ1A 4WQPA 5KRCA 4G2HA 3CDSA 4KZJA 3KWYA 4FN9A 2P7GA 1EREA 2AA5A 4L98A 4CI4A 1PQ9A 2QA6A 3UUDA 3FC6B 3GZ9A 5DVCA 2ZNOA 5DXQA 3IA6A 2XYJA 1SR7A 1IE8A 5GIDA 5KRLA 3CJWA 1RKGA 2G0GA 1YINA 2QH6A 4TV1B 4O8FA 3WMHA 5ACCA 5DRMA 3UUDB 3G8OA 4IS8A 5DZIA 4MGDA 2PIVA 1XDKB 4OJ9A 5DYDA 3VJTA 3V9TA 1FD0A 1ZKYA 4OEDA 1M2ZA 1RKHA 1YMTA 3WT7A 4RZGA 2R6YA 4NY9A 4PXMA 2QGWA 2NV7A 2I0GA 1XJ7A 2BJ4A 1QKUA 2YHDA 3ZRAA 2AMBA 1G1UA 4POHA 4QE8A 5GICA 4N5GA 3BQDA 2PNUA 1Z95A 1ZGYA 2PRGA 1E3GA 2I4PA 3TX7B 4PLEA 4IQRA 2FVJA 2QTUA 3MNOA 5DXEA 4J26A 4FGYA 4NQAB 5G5WA 4IWCA 5DUHA 3WJ4A 4YPQA 2Q1VA 3IPUA 5K13A 2Q60A 1GWXA 2AO6A 5EI1A 3KYTA 2HASA 4ZN9A 5APJA 1RK3A 2PIRA 2GPOA 4DOSA 4ZJRA 5AZVA 2QXMA 5KR9A 2R40D 4M8EA 2GTKA 2NXXA 3Q95B 5DRJA 5JJMA 4N1YA 4DORA 1NRLA 3FEIA 2LBDA 3OMMA 4RFWA 4OH6A 3DT3A 2YLPA 3VT4A 5DV3A 3FEJA 2QGTA 1Z5XE 3OZ0A 2XYXA 4PP3A 3RUUA 5DX3B 2AX8A 2G5OA 3ERDA 3JZCA 3PRGA 4MG9A 5DIGA 1UPVA 4XLDA 5G45A 5DTVA 5DWJA 3W5RA 4A2JA 5I4VA 2GP7A 3OSAA 4OIUA 5ICKA 3GYTA 1N83A 3WT5A 5DZ3A 1T7FA 1OSHA 4OC7A 4ONIA 2PIXA 2ZNNA 3VRTA 4MG9B 3FURA 2ZMJA 4MGCA 4XUHA 5KCFA 1A28A 2QA8A 3ET2A 4OARA 1XP1A 3B1MA 2B50A 1YYEA 2VV3A 3L0JA 1X7EA 3A3ZX 3AN3A 4OKXA 3S9SA 1SJ0A 4NIEA 2QA8B 2GPVA 2AX9A 1PK5A 1QKMA 2HB8A 2XHSA 3ILZA 1S0XA 2ATHA 4MGBA 3AX8A 4K7AA 3OKIA 3MNEA 5DLRA 1GS4A 3DZYA 4QE6A 1LV2A 4PF3A 2VV4A 3P0UA 4MGAB 5DVSA 3N00A 3WJ5A 4J24A 4OJ4A 4LTWA 4XTAA 3GWXA 4RMDA 1R6GA 3E00A 1FCXA 3OMOA 5G3JA 3UUAA 5DXBB 3B66A 3VHVA 1XP6A 4MG8B 2VV4B 3KDUA 3VI8A 2POBA 1E3KA 3AURA 3T03A 3L3ZA 3CS6A 3DZUA 2P7AA 3UUAB 3W0GA 1XAPA 4J5XC 1ZDTA 3VTCA 1NQ1A 1U3RA 1KKQA 3OS9A 3KPZA 4OJBA 4IA3A 3R8AA 2XYWA 3A2JA 3B65A 3GYUA 4MDDA 2P1UA 2FSZA 1R20A 4WHFA 3V4AA 3VT7A 3OMKA 3VRWA 1XOWA 2IOKA 5FQRA 1OSVA 5L11A 1T63A 4XAOA 1R5KA 5ETHA 2QPYA 1ZDUA 3X1IA 3CDPA 4PVUA 2PINA 2FAIA 1U3QA 3ADTA 5G44A 3FC6A 2Q8SA 4MG7B 2AMAA 3CWDA 5F9BA 1FM6A 3ZRBA 4P6WA 3W5PA 2P15A 1T65A 5KRMA 2PIOA 2AA7A 2ZK1A 3AUNA 2HAMA 3DR1A 3F5CB 1YOWA 4TV1A 1NQ2A 3HZFA 1FCZA 3FLIA 4Q13A 3V3EA 3L1BA 1T5ZA 1XDKA 4S15A 4ZNUA 4P6XA 1XV9B 1ZEOA 3DCUA 3P89A 3UP3A 3OOKA 3H52A 3L0LA 3HVLA 3VRUA 3HM1A 1GWRA 2H79A 3DZYD 2HCDA 5KRIA 2HARA 5EHJA 5KCEA 2VSTA 5APKA 1Y9RA 2VV2A 5C4UA 3VN2A 2Q7LA 3R29A 3B0TA 4RMCA 4X1GA 5DU5A 2Q7IA 2O4RA 4QJRA 5DKSA 1R1KA 2Q5SA 1XPCA 2ZBSA 2ZY0A 3E00D 1XVPB 3ERTA 3O1DA 4IW6A 4LNXA 5DKEA 4Q0AC 3E94A 3ET0A 3SP9A 1OT7A 2R6WA 4G21A 5LGAA 2JF9A 2GPUA 3LBDA 4OEAA 5IZ0A 4QK4A 5L7EA 1YP0A 2AB2A 2A3IA 3B3KA 1P8DA 4PLDA 3DZUD 5DWIA 1SQNA 2NPAA 5EITA 3B68A 4APUA 1N4HA 4OHAA 4S14A 1YJEA 3IPQA 3WWRA 2YJAB 5B41A 1XIUA 2YFEA 3Q95A 4PP6A 4FHIA 3TY0A 4POJA 2PIQA 1P93A 4BCRA 4DMAA 5JY3A 4LSJA 5SYZA 4K4JA 3KMGA 1R20D 3VT5A 5DKBA 5DX3A 3ZR7A 1DKFA 4IV4A 1YY4A 1FBYA 2V7CA 4R2UA 1XLSE 1NAXA 1A52A 2AX7A 2HC4A 4OKWA 4Y29A 4OZRE 1U9EA 2REWA 4IA1A 5DXMA 1HG4A 1I7IA 2QW4A 3R5MA 5DZ1A 5C4SA 1G2NA 1K4WA 4OFUA 1FM6D 1MVCA 1DKFB 3L0EA 1YIMA 3OLLA 4IW8A 3RLLA 5AAUA 1S0ZA 1RJKA 3OOFA 4FNEA 4B7WA 4WVDA 4ZN7A 3ADWA 1KV6A 2ZLAA 4E4QA 1VJBA 2E2RA 2HWRA 4JAZA 2QE4A 2PIPL 5HJPA 3AUQA 2VSRA 3D90A 4OGHA 2ZK2A 4TUZA 2P54A 3VSOA 1S9QA 2P4YA 2Q61A 4CI5A 3F7DA 4LNWA 4UDDA 5DMFA 2HBHA 1PQCA 2Q70A 3BC5A 4DK7A 4MG6A 1G5YA 2AM9A 1DB1A 2I0JA 2PKLA 4UDBA 3VHWA 4TUZB 1R1KD 5G42A 4MGAA 5E19A 3K23A 3KDTA 1X76A 2AA2A 2ZNQA 3FUGA 4RMEA 4RUPA 4OZRU 4PWLA 5E15A 3W0HA 5HZCA 4OEZA 4EM9A 3EYBA 5DXKA 1QKTA 5DXBA 5FQSA 1I37A 5KRFA 3RUTA 4YT1A 3WFGA 2ZK3A 4MG8A 4ZNSA 1S19A 4S0SA 1EXAA 2I4ZA 1T76A 5HJPB 4OKBA 3G8IA 1PRGA 5KROA 3L3XA 4A4VA 4CSJA 5DIDA 3A9EA 3OLSA 2IOGA 5DSHA 1ZH7A 4ITFA 2OZ7A 3ADUA 3P88A 3W5TA 3KMRA 2PITA 4PRGA 2EWPA 3D5FA 2J7XA 1TFCA 3B0QA 3OMQA 2GIUA 5DK9A 5G43A 3NSPA 2XKWA 5M96A 2JJ3A 4OZTE 3A9EB 4IV2A 2Q59B 2P7ZA 1NDEA 2AA6A 2IHQA 3G9EA 3OZJA 3CS4A 3AN4A 3K22A 2P1VA 3WT6A 1PZLA 5L7GA 1KNUA 4REEA 2POGA 2Z4BA 5E1CA 3SP6A 1ILGA 5DP0A 1XNNA 1WM0X 4RZFA 3V49A 5DI7A 2ZMHA 5KRHA 1I7GA 3TKCA 4DM8A 2Q3YA 5KD9A 4UDAA 3AZ3A 4RUOX 5DZHA 2J7YA 4MG7A 1Y0XX 3B0WA 1K7LA 3ADVA 2JFAB 2NW4A 4WHGA 3R8IA 5IXKA 2VV0A 2QZOB 3G0WA 4HLWA 3WFFA 3F5CA 3HLVA 4OK1A 4OLMA 2QMVA 3HQ5A 4RAKA 1T7RA 3B0RA 2ZK5A 4ZOMA 4Q50A 4ZNTA 1OVLA 5DXGA 2V0VA 3HC5A 5AWJA 3W0AA 4F9MA 3OGTA 1XV9A 5DXPA 1K74A 1NUOA 2ZNPA 3OAPA 1ERRA 1QKNA 4EMAA 3CQVA 2AYRA 4JGVA 1BSXA 1SKXA 4OZTU 2OCFA 1UHLB 5JI0D 2ZL9A 2ZXMA 5EC9A 4J5WA 1OVLB 2B1VA 2BAWA 4DQMA 5DWEA 5KRJA 1RDTA 2HVCA 4G1DA 4PP5A 3OLFA 1X7JA 1UPWA 2OM9A 3L03A 5FQTA 4N73A 1ZAFA 2OVHA 3VT9A 3X36A 4J5WC 5DZ0A 2AX6A 1XVPA 4IUIA 3BEJA 3VRVA 4JL4A 2HB7A 2YLQA 2VV1B 3KFCA 5C4OA 3HO0A 1XNXA 2Q6RA 3WTQA 4MG5A 4IA7A 3H0AA 1XB7A 2ACLB 3IMYA
chains in the Genus database with same CATH topology
1X7RA 3ADSA 3AZ2A 3OKHA 2PJLA 2Q1HA 5A86A 3FALB 5DVVA 3WGPA 3VJIA 3RVFA 4NUFA 1XQ3A 3UVVB 4XT9A 3W0YA 4IU7A 3TKMA 1MV9A 3M7RA 2ZLCA 3OS8A 5KRKA 5DUGA 3PCUA 3V9YA 3PO9A 2J14A 1NQ0A 1L2IA 3R2AA 4HEEX 2ZXNA 3NSQA 2PIUA 4WPFA 3W0IA 5E0XA 1Y0SA 3OS8C 2B23A 3JZBA 4G20A 2ZASA 3HODA 2QABA 4YNKA 3PBAA 2W8YA 3NOAA 1N46A 1NHZA 1PCGA 3ET1A 2OAXA 5AVIA 2GPPA 4G2IA 4MGDB 4R06A 3KBAA 1NAVA 2QR9A 1YA3A 4S0TA 5DKGA 1FM9A 5KCTA 3VT8A 3HC6A 2Q7KA 5AZTA 2PIWA 1EXXA 4ZNHA 5GIEA 3IPSA 1UOMA 2AAXA 4NB6A 1GWQA 4OFRA 5AYGA 2BJ4B 4E4KA 2NXXE 3RLJA 3AFRA 1X7BA 1M7WA 3GWSX 3ADXA 3CTBA 5AK2A 5DIEA 1K74D 3UU7A 1XLSA 2QNVA 3IXPA 3LMPA 3X1HA 5APHA 4JYIA 3V9VA 2YATA 5FQVA 5KCUA 2AWHA 1RDTD 1S9PA 2G44A 1T79A 4RWVA 3UU7B 1U3SA 5DL4A 4N8RA 1HJ1A 2ZKCA 3A40X 4ZNWA 5KYAA 2QSEA 2YLYA 4REFA 1T74A 2O4JA 3U9QA 4PPSA 5CJ6A 4R6SA 2Q6SA 3ET3A 3VJSA 3W5QA 5JJMB 4A4WA 2GL8A 3K6PA 4IWFA 3K8SA 3RY9A 3H0AD 3OSWA 4E2JA 1L2JA 3R8DA 4X1FA 4OH5A 3B67A 1FCYA 5IAWA 4ZO1X 3VTDA 5E14A 3ZQTA 3B5RA 4RUJA 3D24A 4XUMA 1NQ7A 3DY6A 2F4BA 2O9IA 2Z4JA 4UDCA 5DWGA 4ZI1A 4RZEA 3VTBA 2GWXA 2ZK0A 2ZMIA 3FS1A 3QT0A 4FHHA 4ITEA 5FQPA 3VSPA 3UP0A 5E7VA 4ZJWA 4M8HA 2Q59A 5KCWA 1MZNA 5KRAA 1ZUCA 1T73A 1PDUA 2P1TA 3VHUA 4LBDA 2ZK6A 4DM6A 2AXAA 4G1YA 3VT6A 1NYXA 4QL8A 3MNPA 1X78A 1YUCA 3A2IA 1YOKA 4KZIA 4RE8A 3A78A 1Z5XU 4DK8A 5G46A 1FM9D 5LWPA 3D6DA 2ZXZA 2JFAA 5DMCA 4KZMA 5DXRA 2QZOA 1IE9A 2Q6JA 4MGBB 3X31A 2QXSA 1I38A 5C4TA 2Q5GA 5KCDA 5KYJA 4L96A 4JYGA 4J5XA 2H77A 3KMZA 3OMPA 3IXPD 1XZXX 3E7CA 2ZVTA 3D57A 3W0JA 5H1EA 4OKTA 4WLBA 5DUEA 5AWKA 3UUCA 5L7HA 1UHLA 2G0HA 3AZ1A 5DV8A 1ILHA 1PQ6A 1TXIA 4K6IA 4QM0A 3GD2A 4IVYA 4XI3A 1M13A 3DCTA 1T7MA 3GBKA 5HCVA 3CLDA 5AVLA 4G1ZA 5KCCA 2YJDA 1H9UA 3PLZA 3R5NA 5DY8A 1T7TA 5EGVA 5EJVA 3GN8A 3VJHA 1Q4XA 1XQCA 5DV6A 5HYKA 5B5BA 2ABIA 4JYHA 2Q5PA 4OIVA 5AAVA 4PPPA 2HFPA 3CS8A 2J4AA 2OUZA 2OVMA 2VV1A 2R40A 5HJSA 5DYBA 3A2HA 3PEQA 4YMQA 1XP9A 5HYRA 2Q7JA 3W0CA 4IVWA 2ACLA 2YLOA 4XHDA 5E0WA 2ZFXA 1G50A 2I4JA 3V3QA 3VT3A 5AAVB 2HWQA 3OSIA 3FALA 5GT4A 1LBDA 2ZK4A 4OEYA 4ZO1B 5DWLA 3UVVA 3O1EA 4OILA 2B1ZA 3FXVA 4ZNVA 4IA2A 3P8XA 3SZ1A 4WQPA 5KRCA 4G2HA 3CDSA 4KZJA 3KWYA 4FN9A 2P7GA 1EREA 2AA5A 4L98A 4CI4A 1PQ9A 2QA6A 3UUDA 3FC6B 3GZ9A 5DVCA 2ZNOA 5DXQA 3IA6A 2XYJA 1SR7A 1IE8A 5GIDA 5KRLA 3CJWA 1RKGA 2G0GA 1YINA 2QH6A 4TV1B 4O8FA 3WMHA 5ACCA 5DRMA 3UUDB 3G8OA 4IS8A 5DZIA 4MGDA 2PIVA 1XDKB 4OJ9A 5DYDA 3VJTA 3V9TA 1FD0A 1ZKYA 4OEDA 1M2ZA 1RKHA 1YMTA 3WT7A 4RZGA 2R6YA 4NY9A 4PXMA 2QGWA 2NV7A 2I0GA 1XJ7A 2BJ4A 1QKUA 2YHDA 3ZRAA 2AMBA 1G1UA 4POHA 4QE8A 5GICA 4N5GA 3BQDA 2PNUA 1Z95A 1ZGYA 2PRGA 1E3GA 2I4PA 3TX7B 4PLEA 4IQRA 2FVJA 2QTUA 3MNOA 5DXEA 4J26A 4FGYA 4NQAB 5G5WA 4IWCA 5DUHA 3WJ4A 4YPQA 2Q1VA 3IPUA 5K13A 2Q60A 1GWXA 2AO6A 5EI1A 3KYTA 2HASA 4ZN9A 5APJA 1RK3A 2PIRA 2GPOA 4DOSA 4ZJRA 5AZVA 2QXMA 5KR9A 2R40D 4M8EA 2GTKA 2NXXA 3Q95B 5DRJA 5JJMA 4N1YA 4DORA 1NRLA 3FEIA 2LBDA 3OMMA 4RFWA 4OH6A 3DT3A 2YLPA 3VT4A 5DV3A 3FEJA 2QGTA 1Z5XE 3OZ0A 2XYXA 4PP3A 3RUUA 5DX3B 2AX8A 2G5OA 3ERDA 3JZCA 3PRGA 4MG9A 5DIGA 1UPVA 4XLDA 5G45A 5DTVA 5DWJA 3W5RA 4A2JA 5I4VA 2GP7A 3OSAA 4OIUA 5ICKA 3GYTA 1N83A 3WT5A 5DZ3A 1T7FA 1OSHA 4OC7A 4ONIA 2PIXA 2ZNNA 3VRTA 4MG9B 3FURA 2ZMJA 4MGCA 4XUHA 5KCFA 1A28A 2QA8A 3ET2A 4OARA 1XP1A 3B1MA 2B50A 1YYEA 2VV3A 3L0JA 1X7EA 3A3ZX 3AN3A 4OKXA 3S9SA 1SJ0A 4NIEA 2QA8B 2GPVA 2AX9A 1PK5A 1QKMA 2HB8A 2XHSA 3ILZA 1S0XA 2ATHA 4MGBA 3AX8A 4K7AA 3OKIA 3MNEA 5DLRA 1GS4A 3DZYA 4QE6A 1LV2A 4PF3A 2VV4A 3P0UA 4MGAB 5DVSA 3N00A 3WJ5A 4J24A 4OJ4A 4LTWA 4XTAA 3GWXA 4RMDA 1R6GA 3E00A 1FCXA 3OMOA 5G3JA 3UUAA 5DXBB 3B66A 3VHVA 1XP6A 4MG8B 2VV4B 3KDUA 3VI8A 2POBA 1E3KA 3AURA 3T03A 3L3ZA 3CS6A 3DZUA 2P7AA 3UUAB 3W0GA 1XAPA 4J5XC 1ZDTA 3VTCA 1NQ1A 1U3RA 1KKQA 3OS9A 3KPZA 4OJBA 4IA3A 3R8AA 2XYWA 3A2JA 3B65A 3GYUA 4MDDA 2P1UA 2FSZA 1R20A 4WHFA 3V4AA 3VT7A 3OMKA 3VRWA 1XOWA 2IOKA 5FQRA 1OSVA 5L11A 1T63A 4XAOA 1R5KA 5ETHA 2QPYA 1ZDUA 3X1IA 3CDPA 4PVUA 2PINA 2FAIA 1U3QA 3ADTA 5G44A 3FC6A 2Q8SA 4MG7B 2AMAA 3CWDA 5F9BA 1FM6A 3ZRBA 4P6WA 3W5PA 2P15A 1T65A 5KRMA 2PIOA 2AA7A 2ZK1A 3AUNA 2HAMA 3DR1A 3F5CB 1YOWA 4TV1A 1NQ2A 3HZFA 1FCZA 3FLIA 4Q13A 3V3EA 3L1BA 1T5ZA 1XDKA 4S15A 4ZNUA 4P6XA 1XV9B 1ZEOA 3DCUA 3P89A 3UP3A 3OOKA 3H52A 3L0LA 3HVLA 3VRUA 3HM1A 1GWRA 2H79A 3DZYD 2HCDA 5KRIA 2HARA 5EHJA 5KCEA 2VSTA 5APKA 1Y9RA 2VV2A 5C4UA 3VN2A 2Q7LA 3R29A 3B0TA 4RMCA 4X1GA 5DU5A 2Q7IA 2O4RA 4QJRA 5DKSA 1R1KA 2Q5SA 1XPCA 2ZBSA 2ZY0A 3E00D 1XVPB 3ERTA 3O1DA 4IW6A 4LNXA 5DKEA 4Q0AC 3E94A 3ET0A 3SP9A 1OT7A 2R6WA 4G21A 5LGAA 2JF9A 2GPUA 3LBDA 4OEAA 5IZ0A 4QK4A 5L7EA 1YP0A 2AB2A 2A3IA 3B3KA 1P8DA 4PLDA 3DZUD 5DWIA 1SQNA 2NPAA 5EITA 3B68A 4APUA 1N4HA 4OHAA 4S14A 1YJEA 3IPQA 3WWRA 2YJAB 5B41A 1XIUA 2YFEA 3Q95A 4PP6A 4FHIA 3TY0A 4POJA 2PIQA 1P93A 4BCRA 4DMAA 5JY3A 4LSJA 5SYZA 4K4JA 3KMGA 1R20D 3VT5A 5DKBA 5DX3A 3ZR7A 1DKFA 4IV4A 1YY4A 1FBYA 2V7CA 4R2UA 1XLSE 1NAXA 1A52A 2AX7A 2HC4A 4OKWA 4Y29A 4OZRE 1U9EA 2REWA 4IA1A 5DXMA 1HG4A 1I7IA 2QW4A 3R5MA 5DZ1A 5C4SA 1G2NA 1K4WA 4OFUA 1FM6D 1MVCA 1DKFB 3L0EA 1YIMA 3OLLA 4IW8A 3RLLA 5AAUA 1S0ZA 1RJKA 3OOFA 4FNEA 4B7WA 4WVDA 4ZN7A 3ADWA 1KV6A 2ZLAA 4E4QA 1VJBA 2E2RA 2HWRA 4JAZA 2QE4A 2PIPL 5HJPA 3AUQA 2VSRA 3D90A 4OGHA 2ZK2A 4TUZA 2P54A 3VSOA 1S9QA 2P4YA 2Q61A 4CI5A 3F7DA 4LNWA 4UDDA 5DMFA 2HBHA 1PQCA 2Q70A 3BC5A 4DK7A 4MG6A 1G5YA 2AM9A 1DB1A 2I0JA 2PKLA 4UDBA 3VHWA 4TUZB 1R1KD 5G42A 4MGAA 5E19A 3K23A 3KDTA 1X76A 2AA2A 2ZNQA 3FUGA 4RMEA 4RUPA 4OZRU 4PWLA 5E15A 3W0HA 5HZCA 4OEZA 4EM9A 3EYBA 5DXKA 1QKTA 5DXBA 5FQSA 1I37A 5KRFA 3RUTA 4YT1A 3WFGA 2ZK3A 4MG8A 4ZNSA 1S19A 4S0SA 1EXAA 2I4ZA 1T76A 5HJPB 4OKBA 3G8IA 1PRGA 5KROA 3L3XA 4A4VA 4CSJA 5DIDA 3A9EA 3OLSA 2IOGA 5DSHA 1ZH7A 4ITFA 2OZ7A 3ADUA 3P88A 3W5TA 3KMRA 2PITA 4PRGA 2EWPA 3D5FA 2J7XA 1TFCA 3B0QA 3OMQA 2GIUA 5DK9A 5G43A 3NSPA 2XKWA 5M96A 2JJ3A 4OZTE 3A9EB 4IV2A 2Q59B 2P7ZA 1NDEA 2AA6A 2IHQA 3G9EA 3OZJA 3CS4A 3AN4A 3K22A 2P1VA 3WT6A 1PZLA 5L7GA 1KNUA 4REEA 2POGA 2Z4BA 5E1CA 3SP6A 1ILGA 5DP0A 1XNNA 1WM0X 4RZFA 3V49A 5DI7A 2ZMHA 5KRHA 1I7GA 3TKCA 4DM8A 2Q3YA 5KD9A 4UDAA 3AZ3A 4RUOX 5DZHA 2J7YA 4MG7A 1Y0XX 3B0WA 1K7LA 3ADVA 2JFAB 2NW4A 4WHGA 3R8IA 5IXKA 2VV0A 2QZOB 3G0WA 4HLWA 3WFFA 3F5CA 3HLVA 4OK1A 4OLMA 2QMVA 3HQ5A 4RAKA 1T7RA 3B0RA 2ZK5A 4ZOMA 4Q50A 4ZNTA 1OVLA 5DXGA 2V0VA 3HC5A 5AWJA 3W0AA 4F9MA 3OGTA 1XV9A 5DXPA 1K74A 1NUOA 2ZNPA 3OAPA 1ERRA 1QKNA 4EMAA 3CQVA 2AYRA 4JGVA 1BSXA 1SKXA 4OZTU 2OCFA 1UHLB 5JI0D 2ZL9A 2ZXMA 5EC9A 4J5WA 1OVLB 2B1VA 2BAWA 4DQMA 5DWEA 5KRJA 1RDTA 2HVCA 4G1DA 4PP5A 3OLFA 1X7JA 1UPWA 2OM9A 3L03A 5FQTA 4N73A 1ZAFA 2OVHA 3VT9A 3X36A 4J5WC 5DZ0A 2AX6A 1XVPA 4IUIA 3BEJA 3VRVA 4JL4A 2HB7A 2YLQA 2VV1B 3KFCA 5C4OA 3HO0A 1XNXA 2Q6RA 3WTQA 4MG5A 4IA7A 3H0AA 1XB7A 2ACLB 3IMYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X7R A;  3ADS A;  3AZ2 A;  3OKH A;  2PJL A;  2Q1H A;  5A86 A;  3FAL B;  5DVV A;  3WGP A;  3VJI A;  3RVF A;  4NUF A;  1XQ3 A;  3UVV B;  4XT9 A;  3W0Y A;  4IU7 A;  3TKM A;  1MV9 A;  3M7R A;  2ZLC A;  3OS8 A;  5KRK A;  5DUG A;  3PCU A;  3V9Y A;  3PO9 A;  2J14 A;  1NQ0 A;  1L2I A;  3R2A A;  4HEE X;  2ZXN A;  3NSQ A;  2PIU A;  4WPF A;  3W0I A;  5E0X A;  1Y0S A;  3OS8 C;  2B23 A;  3JZB A;  4G20 A;  2ZAS A;  3HOD A;  2QAB A;  4YNK A;  3PBA A;  2W8Y A;  3NOA A;  1N46 A;  1NHZ A;  1PCG A;  3ET1 A;  2OAX A;  5AVI A;  2GPP A;  4G2I A;  4MGD B;  4R06 A;  3KBA A;  1NAV A;  2QR9 A;  1YA3 A;  4S0T A;  5DKG A;  1FM9 A;  5KCT A;  3VT8 A;  3HC6 A;  2Q7K A;  5AZT A;  2PIW A;  1EXX A;  4ZNH A;  5GIE A;  3IPS A;  1UOM A;  2AAX A;  4NB6 A;  1GWQ A;  4OFR A;  5AYG A;  2BJ4 B;  4E4K A;  2NXX E;  3RLJ A;  3AFR A;  1X7B A;  1M7W A;  3GWS X;  3ADX A;  3CTB A;  5AK2 A;  5DIE A;  1K74 D;  3UU7 A;  1XLS A;  2QNV A;  3IXP A;  3LMP A;  3X1H A;  5APH A;  4JYI A;  3V9V A;  2YAT A;  5FQV A;  5KCU A;  2AWH A;  1RDT D;  1S9P A;  2G44 A;  1T79 A;  4RWV A;  3UU7 B;  1U3S A;  5DL4 A;  4N8R A;  1HJ1 A;  2ZKC A;  3A40 X;  4ZNW A;  5KYA A;  2QSE A;  2YLY A;  4REF A;  1T74 A;  2O4J A;  3U9Q A;  4PPS A;  5CJ6 A;  4R6S A;  2Q6S A;  3ET3 A;  3VJS A;  3W5Q A;  5JJM B;  4A4W A;  2GL8 A;  3K6P A;  4IWF A;  3K8S A;  3RY9 A;  3H0A D;  3OSW A;  4E2J A;  1L2J A;  3R8D A;  4X1F A;  4OH5 A;  3B67 A;  1FCY A;  5IAW A;  4ZO1 X;  3VTD A;  5E14 A;  3ZQT A;  3B5R A;  4RUJ A;  3D24 A;  4XUM A;  1NQ7 A;  3DY6 A;  2F4B A;  2O9I A;  2Z4J A;  4UDC A;  5DWG A;  4ZI1 A;  4RZE A;  3VTB A;  2GWX A;  2ZK0 A;  2ZMI A;  3FS1 A;  3QT0 A;  4FHH A;  4ITE A;  5FQP A;  3VSP A;  3UP0 A;  5E7V A;  4ZJW A;  4M8H A;  2Q59 A;  5KCW A;  1MZN A;  5KRA A;  1ZUC A;  1T73 A;  1PDU A;  2P1T A;  3VHU A;  4LBD A;  2ZK6 A;  4DM6 A;  2AXA A;  4G1Y A;  3VT6 A;  1NYX A;  4QL8 A;  3MNP A;  1X78 A;  1YUC A;  3A2I A;  1YOK A;  4KZI A;  4RE8 A;  3A78 A;  1Z5X U;  4DK8 A;  5G46 A;  1FM9 D;  5LWP A;  3D6D A;  2ZXZ A;  2JFA A;  5DMC A;  4KZM A;  5DXR A;  2QZO A;  1IE9 A;  2Q6J A;  4MGB B;  3X31 A;  2QXS A;  1I38 A;  5C4T A;  2Q5G A;  5KCD A;  5KYJ A;  4L96 A;  4JYG A;  4J5X A;  2H77 A;  3KMZ A;  3OMP A;  3IXP D;  1XZX X;  3E7C A;  2ZVT A;  3D57 A;  3W0J A;  5H1E A;  4OKT A;  4WLB A;  5DUE A;  5AWK A;  3UUC A;  5L7H A;  1UHL A;  2G0H A;  3AZ1 A;  5DV8 A;  1ILH A;  1PQ6 A;  1TXI A;  4K6I A;  4QM0 A;  3GD2 A;  4IVY A;  4XI3 A;  1M13 A;  3DCT A;  1T7M A;  3GBK A;  5HCV A;  3CLD A;  5AVL A;  4G1Z A;  5KCC A;  2YJD A;  1H9U A;  3PLZ A;  3R5N A;  5DY8 A;  1T7T A;  5EGV A;  5EJV A;  3GN8 A;  3VJH A;  1Q4X A;  1XQC A;  5DV6 A;  5HYK A;  5B5B A;  2ABI A;  4JYH A;  2Q5P A;  4OIV A;  5AAV A;  4PPP A;  2HFP A;  3CS8 A;  2J4A A;  2OUZ A;  2OVM A;  2VV1 A;  2R40 A;  5HJS A;  5DYB A;  3A2H A;  3PEQ A;  4YMQ A;  1XP9 A;  5HYR A;  2Q7J A;  3W0C A;  4IVW A;  2ACL A;  2YLO A;  4XHD A;  5E0W A;  2ZFX A;  1G50 A;  2I4J A;  3V3Q A;  3VT3 A;  5AAV B;  2HWQ A;  3OSI A;  3FAL A;  5GT4 A;  1LBD A;  2ZK4 A;  4OEY A;  4ZO1 B;  5DWL A;  3UVV A;  3O1E A;  4OIL A;  2B1Z A;  3FXV A;  4ZNV A;  4IA2 A;  3P8X A;  3SZ1 A;  4WQP A;  5KRC A;  4G2H A;  3CDS A;  4KZJ A;  3KWY A;  4FN9 A;  2P7G A;  1ERE A;  2AA5 A;  4L98 A;  4CI4 A;  1PQ9 A;  2QA6 A;  3UUD A;  3FC6 B;  3GZ9 A;  5DVC A;  2ZNO A;  5DXQ A;  3IA6 A;  2XYJ A;  1SR7 A;  1IE8 A;  5GID A;  5KRL A;  3CJW A;  1RKG A;  2G0G A;  1YIN A;  2QH6 A;  4TV1 B;  4O8F A;  3WMH A;  5ACC A;  5DRM A;  3UUD B;  3G8O A;  4IS8 A;  5DZI A;  4MGD A;  2PIV A;  1XDK B;  4OJ9 A;  5DYD A;  3VJT A;  3V9T A;  1FD0 A;  1ZKY A;  4OED A;  1M2Z A;  1RKH A;  1YMT A;  3WT7 A;  4RZG A;  2R6Y A;  4NY9 A;  4PXM A;  2QGW A;  2NV7 A;  2I0G A;  1XJ7 A;  2BJ4 A;  1QKU A;  2YHD A;  3ZRA A;  2AMB A;  1G1U A;  4POH A;  4QE8 A;  5GIC A;  4N5G A;  3BQD A;  2PNU A;  1Z95 A;  1ZGY A;  2PRG A;  1E3G A;  2I4P A;  3TX7 B;  4PLE A;  4IQR A;  2FVJ A;  2QTU A;  3MNO A;  5DXE A;  4J26 A;  4FGY A;  4NQA B;  5G5W A;  4IWC A;  5DUH A;  3WJ4 A;  4YPQ A;  2Q1V A;  3IPU A;  5K13 A;  2Q60 A;  1GWX A;  2AO6 A;  5EI1 A;  3KYT A;  2HAS A;  4ZN9 A;  5APJ A;  1RK3 A;  2PIR A;  2GPO A;  4DOS A;  4ZJR A;  5AZV A;  2QXM A;  5KR9 A;  2R40 D;  4M8E A;  2GTK A;  2NXX A;  3Q95 B;  5DRJ A;  5JJM A;  4N1Y A;  4DOR A;  1NRL A;  3FEI A;  2LBD A;  3OMM A;  4RFW A;  4OH6 A;  3DT3 A;  2YLP A;  3VT4 A;  5DV3 A;  3FEJ A;  2QGT A;  1Z5X E;  3OZ0 A;  2XYX A;  4PP3 A;  3RUU A;  5DX3 B;  2AX8 A;  2G5O A;  3ERD A;  3JZC A;  3PRG A;  4MG9 A;  5DIG A;  1UPV A;  4XLD A;  5G45 A;  5DTV A;  5DWJ A;  3W5R A;  4A2J A;  5I4V A;  2GP7 A;  3OSA A;  4OIU A;  5ICK A;  3GYT A;  1N83 A;  3WT5 A;  5DZ3 A;  1T7F A;  1OSH A;  4OC7 A;  4ONI A;  2PIX A;  2ZNN A;  3VRT A;  4MG9 B;  3FUR A;  2ZMJ A;  4MGC A;  4XUH A;  5KCF A;  1A28 A;  2QA8 A;  3ET2 A;  4OAR A;  1XP1 A;  3B1M A;  2B50 A;  1YYE A;  2VV3 A;  3L0J A;  1X7E A;  3A3Z X;  3AN3 A;  4OKX A;  3S9S A;  1SJ0 A;  4NIE A;  2QA8 B;  2GPV A;  2AX9 A;  1PK5 A;  1QKM A;  2HB8 A;  2XHS A;  3ILZ A;  1S0X A;  2ATH A;  4MGB A;  3AX8 A;  4K7A A;  3OKI A;  3MNE A;  5DLR A;  1GS4 A;  3DZY A;  4QE6 A;  1LV2 A;  4PF3 A;  2VV4 A;  3P0U A;  4MGA B;  5DVS A;  3N00 A;  3WJ5 A;  4J24 A;  4OJ4 A;  4LTW A;  4XTA A;  3GWX A;  4RMD A;  1R6G A;  3E00 A;  1FCX A;  3OMO A;  5G3J A;  3UUA A;  5DXB B;  3B66 A;  3VHV A;  1XP6 A;  4MG8 B;  2VV4 B;  3KDU A;  3VI8 A;  2POB A;  1E3K A;  3AUR A;  3T03 A;  3L3Z A;  3CS6 A;  3DZU A;  2P7A A;  3UUA B;  3W0G A;  1XAP A;  4J5X C;  1ZDT A;  3VTC A;  1NQ1 A;  1U3R A;  1KKQ A;  3OS9 A;  3KPZ A;  4OJB A;  4IA3 A;  3R8A A;  2XYW A;  3A2J A;  3B65 A;  3GYU A;  4MDD A;  2P1U A;  2FSZ A;  1R20 A;  4WHF A;  3V4A A;  3VT7 A;  3OMK A;  3VRW A;  1XOW A;  2IOK A;  5FQR A;  1OSV A;  5L11 A;  1T63 A;  4XAO A;  1R5K A;  5ETH A;  2QPY A;  1ZDU A;  3X1I A;  3CDP A;  4PVU A;  2PIN A;  2FAI A;  1U3Q A;  3ADT A;  5G44 A;  3FC6 A;  2Q8S A;  4MG7 B;  2AMA A;  3CWD A;  5F9B A;  1FM6 A;  3ZRB A;  4P6W A;  3W5P A;  2P15 A;  1T65 A;  5KRM A;  2PIO A;  2AA7 A;  2ZK1 A;  3AUN A;  2HAM A;  3DR1 A;  3F5C B;  1YOW A;  4TV1 A;  1NQ2 A;  3HZF A;  1FCZ A;  3FLI A;  4Q13 A;  3V3E A;  3L1B A;  1T5Z A;  1XDK A;  4S15 A;  4ZNU A;  4P6X A;  1XV9 B;  1ZEO A;  3DCU A;  3P89 A;  3UP3 A;  3OOK A;  3H52 A;  3L0L A;  3HVL A;  3VRU A;  3HM1 A;  1GWR A;  2H79 A;  3DZY D;  2HCD A;  5KRI A;  2HAR A;  5EHJ A;  5KCE A;  2VST A;  5APK A;  1Y9R A;  2VV2 A;  5C4U A;  3VN2 A;  2Q7L A;  3R29 A;  3B0T A;  4RMC A;  4X1G A;  5DU5 A;  2Q7I A;  2O4R A;  4QJR A;  5DKS A;  1R1K A;  2Q5S A;  1XPC A;  2ZBS A;  2ZY0 A;  3E00 D;  1XVP B;  3ERT A;  3O1D A;  4IW6 A;  4LNX A;  5DKE A;  4Q0A C;  3E94 A;  3ET0 A;  3SP9 A;  1OT7 A;  2R6W A;  4G21 A;  5LGA A;  2JF9 A;  2GPU A;  3LBD A;  4OEA A;  5IZ0 A;  4QK4 A;  5L7E A;  1YP0 A;  2AB2 A;  2A3I A;  3B3K A;  1P8D A;  4PLD A;  3DZU D;  5DWI A;  1SQN A;  2NPA A;  5EIT A;  3B68 A;  4APU A;  1N4H A;  4OHA A;  4S14 A;  1YJE A;  3IPQ A;  3WWR A;  2YJA B;  5B41 A;  1XIU A;  2YFE A;  3Q95 A;  4PP6 A;  4FHI A;  3TY0 A;  4POJ A;  2PIQ A;  1P93 A;  4BCR A;  4DMA A;  5JY3 A;  4LSJ A;  5SYZ A;  4K4J A;  3KMG A;  1R20 D;  3VT5 A;  5DKB A;  5DX3 A;  3ZR7 A;  1DKF A;  4IV4 A;  1YY4 A;  1FBY A;  2V7C A;  4R2U A;  1XLS E;  1NAX A;  1A52 A;  2AX7 A;  2HC4 A;  4OKW A;  4Y29 A;  4OZR E;  1U9E A;  2REW A;  4IA1 A;  5DXM A;  1HG4 A;  1I7I A;  2QW4 A;  3R5M A;  5DZ1 A;  5C4S A;  1G2N A;  1K4W A;  4OFU A;  1FM6 D;  1MVC A;  1DKF B;  3L0E A;  1YIM A;  3OLL A;  4IW8 A;  3RLL A;  5AAU A;  1S0Z A;  1RJK A;  3OOF A;  4FNE A;  4B7W A;  4WVD A;  4ZN7 A;  3ADW A;  1KV6 A;  2ZLA A;  4E4Q A;  1VJB A;  2E2R A;  2HWR A;  4JAZ A;  2QE4 A;  2PIP L;  5HJP A;  3AUQ A;  2VSR A;  3D90 A;  4OGH A;  2ZK2 A;  4TUZ A;  2P54 A;  3VSO A;  1S9Q A;  2P4Y A;  2Q61 A;  4CI5 A;  3F7D A;  4LNW A;  4UDD A;  5DMF A;  2HBH A;  1PQC A;  2Q70 A;  3BC5 A;  4DK7 A;  4MG6 A;  1G5Y A;  2AM9 A;  1DB1 A;  2I0J A;  2PKL A;  4UDB A;  3VHW A;  4TUZ B;  1R1K D;  5G42 A;  4MGA A;  5E19 A;  3K23 A;  3KDT A;  1X76 A;  2AA2 A;  2ZNQ A;  3FUG A;  4RME A;  4RUP A;  4OZR U;  4PWL A;  5E15 A;  3W0H A;  5HZC A;  4OEZ A;  4EM9 A;  3EYB A;  5DXK A;  1QKT A;  5DXB A;  5FQS A;  1I37 A;  5KRF A;  3RUT A;  4YT1 A;  3WFG A;  2ZK3 A;  4MG8 A;  4ZNS A;  1S19 A;  4S0S A;  1EXA A;  2I4Z A;  1T76 A;  5HJP B;  4OKB A;  3G8I A;  1PRG A;  5KRO A;  3L3X A;  4A4V A;  4CSJ A;  5DID A;  3A9E A;  3OLS A;  2IOG A;  5DSH A;  1ZH7 A;  4ITF A;  2OZ7 A;  3ADU A;  3P88 A;  3W5T A;  3KMR A;  2PIT A;  4PRG A;  2EWP A;  3D5F A;  2J7X A;  1TFC A;  3B0Q A;  3OMQ A;  2GIU A;  5DK9 A;  5G43 A;  3NSP A;  2XKW A;  5M96 A;  2JJ3 A;  4OZT E;  3A9E B;  4IV2 A;  2Q59 B;  2P7Z A;  1NDE A;  2AA6 A;  2IHQ A;  3G9E A;  3OZJ A;  3CS4 A;  3AN4 A;  3K22 A;  2P1V A;  3WT6 A;  1PZL A;  5L7G A;  1KNU A;  4REE A;  2POG A;  2Z4B A;  5E1C A;  3SP6 A;  1ILG A;  5DP0 A;  1XNN A;  1WM0 X;  4RZF A;  3V49 A;  5DI7 A;  2ZMH A;  5KRH A;  1I7G A;  3TKC A;  4DM8 A;  2Q3Y A;  5KD9 A;  4UDA A;  3AZ3 A;  4RUO X;  5DZH A;  2J7Y A;  4MG7 A;  1Y0X X;  3B0W A;  1K7L A;  3ADV A;  2JFA B;  2NW4 A;  4WHG A;  3R8I A;  5IXK A;  2VV0 A;  2QZO B;  3G0W A;  4HLW A;  3WFF A;  3F5C A;  3HLV A;  4OK1 A;  4OLM A;  2QMV A;  3HQ5 A;  4RAK A;  1T7R A;  3B0R A;  2ZK5 A;  4ZOM A;  4Q50 A;  4ZNT A;  1OVL A;  5DXG A;  2V0V A;  3HC5 A;  5AWJ A;  3W0A A;  4F9M A;  3OGT A;  1XV9 A;  5DXP A;  1K74 A;  1NUO A;  2ZNP A;  3OAP A;  1ERR A;  1QKN A;  4EMA A;  3CQV A;  2AYR A;  4JGV A;  1BSX A;  1SKX A;  4OZT U;  2OCF A;  1UHL B;  5JI0 D;  2ZL9 A;  2ZXM A;  5EC9 A;  4J5W A;  1OVL B;  2B1V A;  2BAW A;  4DQM A;  5DWE A;  5KRJ A;  1RDT A;  2HVC A;  4G1D A;  4PP5 A;  3OLF A;  1X7J A;  1UPW A;  2OM9 A;  3L03 A;  5FQT A;  4N73 A;  1ZAF A;  2OVH A;  3VT9 A;  3X36 A;  4J5W C;  5DZ0 A;  2AX6 A;  1XVP A;  4IUI A;  3BEJ A;  3VRV A;  4JL4 A;  2HB7 A;  2YLQ A;  2VV1 B;  3KFC A;  5C4O A;  3HO0 A;  1XNX A;  2Q6R A;  3WTQ A;  4MG5 A;  4IA7 A;  3H0A A;  1XB7 A;  2ACL B;  3IMY A; 
#chains in the Genus database with same CATH topology
 1X7R A;  3ADS A;  3AZ2 A;  3OKH A;  2PJL A;  2Q1H A;  5A86 A;  3FAL B;  5DVV A;  3WGP A;  3VJI A;  3RVF A;  4NUF A;  1XQ3 A;  3UVV B;  4XT9 A;  3W0Y A;  4IU7 A;  3TKM A;  1MV9 A;  3M7R A;  2ZLC A;  3OS8 A;  5KRK A;  5DUG A;  3PCU A;  3V9Y A;  3PO9 A;  2J14 A;  1NQ0 A;  1L2I A;  3R2A A;  4HEE X;  2ZXN A;  3NSQ A;  2PIU A;  4WPF A;  3W0I A;  5E0X A;  1Y0S A;  3OS8 C;  2B23 A;  3JZB A;  4G20 A;  2ZAS A;  3HOD A;  2QAB A;  4YNK A;  3PBA A;  2W8Y A;  3NOA A;  1N46 A;  1NHZ A;  1PCG A;  3ET1 A;  2OAX A;  5AVI A;  2GPP A;  4G2I A;  4MGD B;  4R06 A;  3KBA A;  1NAV A;  2QR9 A;  1YA3 A;  4S0T A;  5DKG A;  1FM9 A;  5KCT A;  3VT8 A;  3HC6 A;  2Q7K A;  5AZT A;  2PIW A;  1EXX A;  4ZNH A;  5GIE A;  3IPS A;  1UOM A;  2AAX A;  4NB6 A;  1GWQ A;  4OFR A;  5AYG A;  2BJ4 B;  4E4K A;  2NXX E;  3RLJ A;  3AFR A;  1X7B A;  1M7W A;  3GWS X;  3ADX A;  3CTB A;  5AK2 A;  5DIE A;  1K74 D;  3UU7 A;  1XLS A;  2QNV A;  3IXP A;  3LMP A;  3X1H A;  5APH A;  4JYI A;  3V9V A;  2YAT A;  5FQV A;  5KCU A;  2AWH A;  1RDT D;  1S9P A;  2G44 A;  1T79 A;  4RWV A;  3UU7 B;  1U3S A;  5DL4 A;  4N8R A;  1HJ1 A;  2ZKC A;  3A40 X;  4ZNW A;  5KYA A;  2QSE A;  2YLY A;  4REF A;  1T74 A;  2O4J A;  3U9Q A;  4PPS A;  5CJ6 A;  4R6S A;  2Q6S A;  3ET3 A;  3VJS A;  3W5Q A;  5JJM B;  4A4W A;  2GL8 A;  3K6P A;  4IWF A;  3K8S A;  3RY9 A;  3H0A D;  3OSW A;  4E2J A;  1L2J A;  3R8D A;  4X1F A;  4OH5 A;  3B67 A;  1FCY A;  5IAW A;  4ZO1 X;  3VTD A;  5E14 A;  3ZQT A;  3B5R A;  4RUJ A;  3D24 A;  4XUM A;  1NQ7 A;  3DY6 A;  2F4B A;  2O9I A;  2Z4J A;  4UDC A;  5DWG A;  4ZI1 A;  4RZE A;  3VTB A;  2GWX A;  2ZK0 A;  2ZMI A;  3FS1 A;  3QT0 A;  4FHH A;  4ITE A;  5FQP A;  3VSP A;  3UP0 A;  5E7V A;  4ZJW A;  4M8H A;  2Q59 A;  5KCW A;  1MZN A;  5KRA A;  1ZUC A;  1T73 A;  1PDU A;  2P1T A;  3VHU A;  4LBD A;  2ZK6 A;  4DM6 A;  2AXA A;  4G1Y A;  3VT6 A;  1NYX A;  4QL8 A;  3MNP A;  1X78 A;  1YUC A;  3A2I A;  1YOK A;  4KZI A;  4RE8 A;  3A78 A;  1Z5X U;  4DK8 A;  5G46 A;  1FM9 D;  5LWP A;  3D6D A;  2ZXZ A;  2JFA A;  5DMC A;  4KZM A;  5DXR A;  2QZO A;  1IE9 A;  2Q6J A;  4MGB B;  3X31 A;  2QXS A;  1I38 A;  5C4T A;  2Q5G A;  5KCD A;  5KYJ A;  4L96 A;  4JYG A;  4J5X A;  2H77 A;  3KMZ A;  3OMP A;  3IXP D;  1XZX X;  3E7C A;  2ZVT A;  3D57 A;  3W0J A;  5H1E A;  4OKT A;  4WLB A;  5DUE A;  5AWK A;  3UUC A;  5L7H A;  1UHL A;  2G0H A;  3AZ1 A;  5DV8 A;  1ILH A;  1PQ6 A;  1TXI A;  4K6I A;  4QM0 A;  3GD2 A;  4IVY A;  4XI3 A;  1M13 A;  3DCT A;  1T7M A;  3GBK A;  5HCV A;  3CLD A;  5AVL A;  4G1Z A;  5KCC A;  2YJD A;  1H9U A;  3PLZ A;  3R5N A;  5DY8 A;  1T7T A;  5EGV A;  5EJV A;  3GN8 A;  3VJH A;  1Q4X A;  1XQC A;  5DV6 A;  5HYK A;  5B5B A;  2ABI A;  4JYH A;  2Q5P A;  4OIV A;  5AAV A;  4PPP A;  2HFP A;  3CS8 A;  2J4A A;  2OUZ A;  2OVM A;  2VV1 A;  2R40 A;  5HJS A;  5DYB A;  3A2H A;  3PEQ A;  4YMQ A;  1XP9 A;  5HYR A;  2Q7J A;  3W0C A;  4IVW A;  2ACL A;  2YLO A;  4XHD A;  5E0W A;  2ZFX A;  1G50 A;  2I4J A;  3V3Q A;  3VT3 A;  5AAV B;  2HWQ A;  3OSI A;  3FAL A;  5GT4 A;  1LBD A;  2ZK4 A;  4OEY A;  4ZO1 B;  5DWL A;  3UVV A;  3O1E A;  4OIL A;  2B1Z A;  3FXV A;  4ZNV A;  4IA2 A;  3P8X A;  3SZ1 A;  4WQP A;  5KRC A;  4G2H A;  3CDS A;  4KZJ A;  3KWY A;  4FN9 A;  2P7G A;  1ERE A;  2AA5 A;  4L98 A;  4CI4 A;  1PQ9 A;  2QA6 A;  3UUD A;  3FC6 B;  3GZ9 A;  5DVC A;  2ZNO A;  5DXQ A;  3IA6 A;  2XYJ A;  1SR7 A;  1IE8 A;  5GID A;  5KRL A;  3CJW A;  1RKG A;  2G0G A;  1YIN A;  2QH6 A;  4TV1 B;  4O8F A;  3WMH A;  5ACC A;  5DRM A;  3UUD B;  3G8O A;  4IS8 A;  5DZI A;  4MGD A;  2PIV A;  1XDK B;  4OJ9 A;  5DYD A;  3VJT A;  3V9T A;  1FD0 A;  1ZKY A;  4OED A;  1M2Z A;  1RKH A;  1YMT A;  3WT7 A;  4RZG A;  2R6Y A;  4NY9 A;  4PXM A;  2QGW A;  2NV7 A;  2I0G A;  1XJ7 A;  2BJ4 A;  1QKU A;  2YHD A;  3ZRA A;  2AMB A;  1G1U A;  4POH A;  4QE8 A;  5GIC A;  4N5G A;  3BQD A;  2PNU A;  1Z95 A;  1ZGY A;  2PRG A;  1E3G A;  2I4P A;  3TX7 B;  4PLE A;  4IQR A;  2FVJ A;  2QTU A;  3MNO A;  5DXE A;  4J26 A;  4FGY A;  4NQA B;  5G5W A;  4IWC A;  5DUH A;  3WJ4 A;  4YPQ A;  2Q1V A;  3IPU A;  5K13 A;  2Q60 A;  1GWX A;  2AO6 A;  5EI1 A;  3KYT A;  2HAS A;  4ZN9 A;  5APJ A;  1RK3 A;  2PIR A;  2GPO A;  4DOS A;  4ZJR A;  5AZV A;  2QXM A;  5KR9 A;  2R40 D;  4M8E A;  2GTK A;  2NXX A;  3Q95 B;  5DRJ A;  5JJM A;  4N1Y A;  4DOR A;  1NRL A;  3FEI A;  2LBD A;  3OMM A;  4RFW A;  4OH6 A;  3DT3 A;  2YLP A;  3VT4 A;  5DV3 A;  3FEJ A;  2QGT A;  1Z5X E;  3OZ0 A;  2XYX A;  4PP3 A;  3RUU A;  5DX3 B;  2AX8 A;  2G5O A;  3ERD A;  3JZC A;  3PRG A;  4MG9 A;  5DIG A;  1UPV A;  4XLD A;  5G45 A;  5DTV A;  5DWJ A;  3W5R A;  4A2J A;  5I4V A;  2GP7 A;  3OSA A;  4OIU A;  5ICK A;  3GYT A;  1N83 A;  3WT5 A;  5DZ3 A;  1T7F A;  1OSH A;  4OC7 A;  4ONI A;  2PIX A;  2ZNN A;  3VRT A;  4MG9 B;  3FUR A;  2ZMJ A;  4MGC A;  4XUH A;  5KCF A;  1A28 A;  2QA8 A;  3ET2 A;  4OAR A;  1XP1 A;  3B1M A;  2B50 A;  1YYE A;  2VV3 A;  3L0J A;  1X7E A;  3A3Z X;  3AN3 A;  4OKX A;  3S9S A;  1SJ0 A;  4NIE A;  2QA8 B;  2GPV A;  2AX9 A;  1PK5 A;  1QKM A;  2HB8 A;  2XHS A;  3ILZ A;  1S0X A;  2ATH A;  4MGB A;  3AX8 A;  4K7A A;  3OKI A;  3MNE A;  5DLR A;  1GS4 A;  3DZY A;  4QE6 A;  1LV2 A;  4PF3 A;  2VV4 A;  3P0U A;  4MGA B;  5DVS A;  3N00 A;  3WJ5 A;  4J24 A;  4OJ4 A;  4LTW A;  4XTA A;  3GWX A;  4RMD A;  1R6G A;  3E00 A;  1FCX A;  3OMO A;  5G3J A;  3UUA A;  5DXB B;  3B66 A;  3VHV A;  1XP6 A;  4MG8 B;  2VV4 B;  3KDU A;  3VI8 A;  2POB A;  1E3K A;  3AUR A;  3T03 A;  3L3Z A;  3CS6 A;  3DZU A;  2P7A A;  3UUA B;  3W0G A;  1XAP A;  4J5X C;  1ZDT A;  3VTC A;  1NQ1 A;  1U3R A;  1KKQ A;  3OS9 A;  3KPZ A;  4OJB A;  4IA3 A;  3R8A A;  2XYW A;  3A2J A;  3B65 A;  3GYU A;  4MDD A;  2P1U A;  2FSZ A;  1R20 A;  4WHF A;  3V4A A;  3VT7 A;  3OMK A;  3VRW A;  1XOW A;  2IOK A;  5FQR A;  1OSV A;  5L11 A;  1T63 A;  4XAO A;  1R5K A;  5ETH A;  2QPY A;  1ZDU A;  3X1I A;  3CDP A;  4PVU A;  2PIN A;  2FAI A;  1U3Q A;  3ADT A;  5G44 A;  3FC6 A;  2Q8S A;  4MG7 B;  2AMA A;  3CWD A;  5F9B A;  1FM6 A;  3ZRB A;  4P6W A;  3W5P A;  2P15 A;  1T65 A;  5KRM A;  2PIO A;  2AA7 A;  2ZK1 A;  3AUN A;  2HAM A;  3DR1 A;  3F5C B;  1YOW A;  4TV1 A;  1NQ2 A;  3HZF A;  1FCZ A;  3FLI A;  4Q13 A;  3V3E A;  3L1B A;  1T5Z A;  1XDK A;  4S15 A;  4ZNU A;  4P6X A;  1XV9 B;  1ZEO A;  3DCU A;  3P89 A;  3UP3 A;  3OOK A;  3H52 A;  3L0L A;  3HVL A;  3VRU A;  3HM1 A;  1GWR A;  2H79 A;  3DZY D;  2HCD A;  5KRI A;  2HAR A;  5EHJ A;  5KCE A;  2VST A;  5APK A;  1Y9R A;  2VV2 A;  5C4U A;  3VN2 A;  2Q7L A;  3R29 A;  3B0T A;  4RMC A;  4X1G A;  5DU5 A;  2Q7I A;  2O4R A;  4QJR A;  5DKS A;  1R1K A;  2Q5S A;  1XPC A;  2ZBS A;  2ZY0 A;  3E00 D;  1XVP B;  3ERT A;  3O1D A;  4IW6 A;  4LNX A;  5DKE A;  4Q0A C;  3E94 A;  3ET0 A;  3SP9 A;  1OT7 A;  2R6W A;  4G21 A;  5LGA A;  2JF9 A;  2GPU A;  3LBD A;  4OEA A;  5IZ0 A;  4QK4 A;  5L7E A;  1YP0 A;  2AB2 A;  2A3I A;  3B3K A;  1P8D A;  4PLD A;  3DZU D;  5DWI A;  1SQN A;  2NPA A;  5EIT A;  3B68 A;  4APU A;  1N4H A;  4OHA A;  4S14 A;  1YJE A;  3IPQ A;  3WWR A;  2YJA B;  5B41 A;  1XIU A;  2YFE A;  3Q95 A;  4PP6 A;  4FHI A;  3TY0 A;  4POJ A;  2PIQ A;  1P93 A;  4BCR A;  4DMA A;  5JY3 A;  4LSJ A;  5SYZ A;  4K4J A;  3KMG A;  1R20 D;  3VT5 A;  5DKB A;  5DX3 A;  3ZR7 A;  1DKF A;  4IV4 A;  1YY4 A;  1FBY A;  2V7C A;  4R2U A;  1XLS E;  1NAX A;  1A52 A;  2AX7 A;  2HC4 A;  4OKW A;  4Y29 A;  4OZR E;  1U9E A;  2REW A;  4IA1 A;  5DXM A;  1HG4 A;  1I7I A;  2QW4 A;  3R5M A;  5DZ1 A;  5C4S A;  1G2N A;  1K4W A;  4OFU A;  1FM6 D;  1MVC A;  1DKF B;  3L0E A;  1YIM A;  3OLL A;  4IW8 A;  3RLL A;  5AAU A;  1S0Z A;  1RJK A;  3OOF A;  4FNE A;  4B7W A;  4WVD A;  4ZN7 A;  3ADW A;  1KV6 A;  2ZLA A;  4E4Q A;  1VJB A;  2E2R A;  2HWR A;  4JAZ A;  2QE4 A;  2PIP L;  5HJP A;  3AUQ A;  2VSR A;  3D90 A;  4OGH A;  2ZK2 A;  4TUZ A;  2P54 A;  3VSO A;  1S9Q A;  2P4Y A;  2Q61 A;  4CI5 A;  3F7D A;  4LNW A;  4UDD A;  5DMF A;  2HBH A;  1PQC A;  2Q70 A;  3BC5 A;  4DK7 A;  4MG6 A;  1G5Y A;  2AM9 A;  1DB1 A;  2I0J A;  2PKL A;  4UDB A;  3VHW A;  4TUZ B;  1R1K D;  5G42 A;  4MGA A;  5E19 A;  3K23 A;  3KDT A;  1X76 A;  2AA2 A;  2ZNQ A;  3FUG A;  4RME A;  4RUP A;  4OZR U;  4PWL A;  5E15 A;  3W0H A;  5HZC A;  4OEZ A;  4EM9 A;  3EYB A;  5DXK A;  1QKT A;  5DXB A;  5FQS A;  1I37 A;  5KRF A;  3RUT A;  4YT1 A;  3WFG A;  2ZK3 A;  4MG8 A;  4ZNS A;  1S19 A;  4S0S A;  1EXA A;  2I4Z A;  1T76 A;  5HJP B;  4OKB A;  3G8I A;  1PRG A;  5KRO A;  3L3X A;  4A4V A;  4CSJ A;  5DID A;  3A9E A;  3OLS A;  2IOG A;  5DSH A;  1ZH7 A;  4ITF A;  2OZ7 A;  3ADU A;  3P88 A;  3W5T A;  3KMR A;  2PIT A;  4PRG A;  2EWP A;  3D5F A;  2J7X A;  1TFC A;  3B0Q A;  3OMQ A;  2GIU A;  5DK9 A;  5G43 A;  3NSP A;  2XKW A;  5M96 A;  2JJ3 A;  4OZT E;  3A9E B;  4IV2 A;  2Q59 B;  2P7Z A;  1NDE A;  2AA6 A;  2IHQ A;  3G9E A;  3OZJ A;  3CS4 A;  3AN4 A;  3K22 A;  2P1V A;  3WT6 A;  1PZL A;  5L7G A;  1KNU A;  4REE A;  2POG A;  2Z4B A;  5E1C A;  3SP6 A;  1ILG A;  5DP0 A;  1XNN A;  1WM0 X;  4RZF A;  3V49 A;  5DI7 A;  2ZMH A;  5KRH A;  1I7G A;  3TKC A;  4DM8 A;  2Q3Y A;  5KD9 A;  4UDA A;  3AZ3 A;  4RUO X;  5DZH A;  2J7Y A;  4MG7 A;  1Y0X X;  3B0W A;  1K7L A;  3ADV A;  2JFA B;  2NW4 A;  4WHG A;  3R8I A;  5IXK A;  2VV0 A;  2QZO B;  3G0W A;  4HLW A;  3WFF A;  3F5C A;  3HLV A;  4OK1 A;  4OLM A;  2QMV A;  3HQ5 A;  4RAK A;  1T7R A;  3B0R A;  2ZK5 A;  4ZOM A;  4Q50 A;  4ZNT A;  1OVL A;  5DXG A;  2V0V A;  3HC5 A;  5AWJ A;  3W0A A;  4F9M A;  3OGT A;  1XV9 A;  5DXP A;  1K74 A;  1NUO A;  2ZNP A;  3OAP A;  1ERR A;  1QKN A;  4EMA A;  3CQV A;  2AYR A;  4JGV A;  1BSX A;  1SKX A;  4OZT U;  2OCF A;  1UHL B;  5JI0 D;  2ZL9 A;  2ZXM A;  5EC9 A;  4J5W A;  1OVL B;  2B1V A;  2BAW A;  4DQM A;  5DWE A;  5KRJ A;  1RDT A;  2HVC A;  4G1D A;  4PP5 A;  3OLF A;  1X7J A;  1UPW A;  2OM9 A;  3L03 A;  5FQT A;  4N73 A;  1ZAF A;  2OVH A;  3VT9 A;  3X36 A;  4J5W C;  5DZ0 A;  2AX6 A;  1XVP A;  4IUI A;  3BEJ A;  3VRV A;  4JL4 A;  2HB7 A;  2YLQ A;  2VV1 B;  3KFC A;  5C4O A;  3HO0 A;  1XNX A;  2Q6R A;  3WTQ A;  4MG5 A;  4IA7 A;  3H0A A;  1XB7 A;  2ACL B;  3IMY A; 
#chains in the Genus database with same CATH homology
 1X7R A;  3ADS A;  3AZ2 A;  3OKH A;  2PJL A;  2Q1H A;  5A86 A;  3FAL B;  5DVV A;  3WGP A;  3VJI A;  3RVF A;  4NUF A;  1XQ3 A;  3UVV B;  4XT9 A;  3W0Y A;  4IU7 A;  3TKM A;  1MV9 A;  3M7R A;  2ZLC A;  3OS8 A;  5KRK A;  5DUG A;  3PCU A;  3V9Y A;  3PO9 A;  2J14 A;  1NQ0 A;  1L2I A;  3R2A A;  4HEE X;  2ZXN A;  3NSQ A;  2PIU A;  4WPF A;  3W0I A;  5E0X A;  1Y0S A;  3OS8 C;  2B23 A;  3JZB A;  4G20 A;  2ZAS A;  3HOD A;  2QAB A;  4YNK A;  3PBA A;  2W8Y A;  3NOA A;  1N46 A;  1NHZ A;  1PCG A;  3ET1 A;  2OAX A;  5AVI A;  2GPP A;  4G2I A;  4MGD B;  4R06 A;  3KBA A;  1NAV A;  2QR9 A;  1YA3 A;  4S0T A;  5DKG A;  1FM9 A;  5KCT A;  3VT8 A;  3HC6 A;  2Q7K A;  5AZT A;  2PIW A;  1EXX A;  4ZNH A;  5GIE A;  3IPS A;  1UOM A;  2AAX A;  4NB6 A;  1GWQ A;  4OFR A;  5AYG A;  2BJ4 B;  4E4K A;  2NXX E;  3RLJ A;  3AFR A;  1X7B A;  1M7W A;  3GWS X;  3ADX A;  3CTB A;  5AK2 A;  5DIE A;  1K74 D;  3UU7 A;  1XLS A;  2QNV A;  3IXP A;  3LMP A;  3X1H A;  5APH A;  4JYI A;  3V9V A;  2YAT A;  5FQV A;  5KCU A;  2AWH A;  1RDT D;  1S9P A;  2G44 A;  1T79 A;  4RWV A;  3UU7 B;  1U3S A;  5DL4 A;  4N8R A;  1HJ1 A;  2ZKC A;  3A40 X;  4ZNW A;  5KYA A;  2QSE A;  2YLY A;  4REF A;  1T74 A;  2O4J A;  3U9Q A;  4PPS A;  5CJ6 A;  4R6S A;  2Q6S A;  3ET3 A;  3VJS A;  3W5Q A;  5JJM B;  4A4W A;  2GL8 A;  3K6P A;  4IWF A;  3K8S A;  3RY9 A;  3H0A D;  3OSW A;  4E2J A;  1L2J A;  3R8D A;  4X1F A;  4OH5 A;  3B67 A;  1FCY A;  5IAW A;  4ZO1 X;  3VTD A;  5E14 A;  3ZQT A;  3B5R A;  4RUJ A;  3D24 A;  4XUM A;  1NQ7 A;  3DY6 A;  2F4B A;  2O9I A;  2Z4J A;  4UDC A;  5DWG A;  4ZI1 A;  4RZE A;  3VTB A;  2GWX A;  2ZK0 A;  2ZMI A;  3FS1 A;  3QT0 A;  4FHH A;  4ITE A;  5FQP A;  3VSP A;  3UP0 A;  5E7V A;  4ZJW A;  4M8H A;  2Q59 A;  5KCW A;  1MZN A;  5KRA A;  1ZUC A;  1T73 A;  1PDU A;  2P1T A;  3VHU A;  4LBD A;  2ZK6 A;  4DM6 A;  2AXA A;  4G1Y A;  3VT6 A;  1NYX A;  4QL8 A;  3MNP A;  1X78 A;  1YUC A;  3A2I A;  1YOK A;  4KZI A;  4RE8 A;  3A78 A;  1Z5X U;  4DK8 A;  5G46 A;  1FM9 D;  5LWP A;  3D6D A;  2ZXZ A;  2JFA A;  5DMC A;  4KZM A;  5DXR A;  2QZO A;  1IE9 A;  2Q6J A;  4MGB B;  3X31 A;  2QXS A;  1I38 A;  5C4T A;  2Q5G A;  5KCD A;  5KYJ A;  4L96 A;  4JYG A;  4J5X A;  2H77 A;  3KMZ A;  3OMP A;  3IXP D;  1XZX X;  3E7C A;  2ZVT A;  3D57 A;  3W0J A;  5H1E A;  4OKT A;  4WLB A;  5DUE A;  5AWK A;  3UUC A;  5L7H A;  1UHL A;  2G0H A;  3AZ1 A;  5DV8 A;  1ILH A;  1PQ6 A;  1TXI A;  4K6I A;  4QM0 A;  3GD2 A;  4IVY A;  4XI3 A;  1M13 A;  3DCT A;  1T7M A;  3GBK A;  5HCV A;  3CLD A;  5AVL A;  4G1Z A;  5KCC A;  2YJD A;  1H9U A;  3PLZ A;  3R5N A;  5DY8 A;  1T7T A;  5EGV A;  5EJV A;  3GN8 A;  3VJH A;  1Q4X A;  1XQC A;  5DV6 A;  5HYK A;  5B5B A;  2ABI A;  4JYH A;  2Q5P A;  4OIV A;  5AAV A;  4PPP A;  2HFP A;  3CS8 A;  2J4A A;  2OUZ A;  2OVM A;  2VV1 A;  2R40 A;  5HJS A;  5DYB A;  3A2H A;  3PEQ A;  4YMQ A;  1XP9 A;  5HYR A;  2Q7J A;  3W0C A;  4IVW A;  2ACL A;  2YLO A;  4XHD A;  5E0W A;  2ZFX A;  1G50 A;  2I4J A;  3V3Q A;  3VT3 A;  5AAV B;  2HWQ A;  3OSI A;  3FAL A;  5GT4 A;  1LBD A;  2ZK4 A;  4OEY A;  4ZO1 B;  5DWL A;  3UVV A;  3O1E A;  4OIL A;  2B1Z A;  3FXV A;  4ZNV A;  4IA2 A;  3P8X A;  3SZ1 A;  4WQP A;  5KRC A;  4G2H A;  3CDS A;  4KZJ A;  3KWY A;  4FN9 A;  2P7G A;  1ERE A;  2AA5 A;  4L98 A;  4CI4 A;  1PQ9 A;  2QA6 A;  3UUD A;  3FC6 B;  3GZ9 A;  5DVC A;  2ZNO A;  5DXQ A;  3IA6 A;  2XYJ A;  1SR7 A;  1IE8 A;  5GID A;  5KRL A;  3CJW A;  1RKG A;  2G0G A;  1YIN A;  2QH6 A;  4TV1 B;  4O8F A;  3WMH A;  5ACC A;  5DRM A;  3UUD B;  3G8O A;  4IS8 A;  5DZI A;  4MGD A;  2PIV A;  1XDK B;  4OJ9 A;  5DYD A;  3VJT A;  3V9T A;  1FD0 A;  1ZKY A;  4OED A;  1M2Z A;  1RKH A;  1YMT A;  3WT7 A;  4RZG A;  2R6Y A;  4NY9 A;  4PXM A;  2QGW A;  2NV7 A;  2I0G A;  1XJ7 A;  2BJ4 A;  1QKU A;  2YHD A;  3ZRA A;  2AMB A;  1G1U A;  4POH A;  4QE8 A;  5GIC A;  4N5G A;  3BQD A;  2PNU A;  1Z95 A;  1ZGY A;  2PRG A;  1E3G A;  2I4P A;  3TX7 B;  4PLE A;  4IQR A;  2FVJ A;  2QTU A;  3MNO A;  5DXE A;  4J26 A;  4FGY A;  4NQA B;  5G5W A;  4IWC A;  5DUH A;  3WJ4 A;  4YPQ A;  2Q1V A;  3IPU A;  5K13 A;  2Q60 A;  1GWX A;  2AO6 A;  5EI1 A;  3KYT A;  2HAS A;  4ZN9 A;  5APJ A;  1RK3 A;  2PIR A;  2GPO A;  4DOS A;  4ZJR A;  5AZV A;  2QXM A;  5KR9 A;  2R40 D;  4M8E A;  2GTK A;  2NXX A;  3Q95 B;  5DRJ A;  5JJM A;  4N1Y A;  4DOR A;  1NRL A;  3FEI A;  2LBD A;  3OMM A;  4RFW A;  4OH6 A;  3DT3 A;  2YLP A;  3VT4 A;  5DV3 A;  3FEJ A;  2QGT A;  1Z5X E;  3OZ0 A;  2XYX A;  4PP3 A;  3RUU A;  5DX3 B;  2AX8 A;  2G5O A;  3ERD A;  3JZC A;  3PRG A;  4MG9 A;  5DIG A;  1UPV A;  4XLD A;  5G45 A;  5DTV A;  5DWJ A;  3W5R A;  4A2J A;  5I4V A;  2GP7 A;  3OSA A;  4OIU A;  5ICK A;  3GYT A;  1N83 A;  3WT5 A;  5DZ3 A;  1T7F A;  1OSH A;  4OC7 A;  4ONI A;  2PIX A;  2ZNN A;  3VRT A;  4MG9 B;  3FUR A;  2ZMJ A;  4MGC A;  4XUH A;  5KCF A;  1A28 A;  2QA8 A;  3ET2 A;  4OAR A;  1XP1 A;  3B1M A;  2B50 A;  1YYE A;  2VV3 A;  3L0J A;  1X7E A;  3A3Z X;  3AN3 A;  4OKX A;  3S9S A;  1SJ0 A;  4NIE A;  2QA8 B;  2GPV A;  2AX9 A;  1PK5 A;  1QKM A;  2HB8 A;  2XHS A;  3ILZ A;  1S0X A;  2ATH A;  4MGB A;  3AX8 A;  4K7A A;  3OKI A;  3MNE A;  5DLR A;  1GS4 A;  3DZY A;  4QE6 A;  1LV2 A;  4PF3 A;  2VV4 A;  3P0U A;  4MGA B;  5DVS A;  3N00 A;  3WJ5 A;  4J24 A;  4OJ4 A;  4LTW A;  4XTA A;  3GWX A;  4RMD A;  1R6G A;  3E00 A;  1FCX A;  3OMO A;  5G3J A;  3UUA A;  5DXB B;  3B66 A;  3VHV A;  1XP6 A;  4MG8 B;  2VV4 B;  3KDU A;  3VI8 A;  2POB A;  1E3K A;  3AUR A;  3T03 A;  3L3Z A;  3CS6 A;  3DZU A;  2P7A A;  3UUA B;  3W0G A;  1XAP A;  4J5X C;  1ZDT A;  3VTC A;  1NQ1 A;  1U3R A;  1KKQ A;  3OS9 A;  3KPZ A;  4OJB A;  4IA3 A;  3R8A A;  2XYW A;  3A2J A;  3B65 A;  3GYU A;  4MDD A;  2P1U A;  2FSZ A;  1R20 A;  4WHF A;  3V4A A;  3VT7 A;  3OMK A;  3VRW A;  1XOW A;  2IOK A;  5FQR A;  1OSV A;  5L11 A;  1T63 A;  4XAO A;  1R5K A;  5ETH A;  2QPY A;  1ZDU A;  3X1I A;  3CDP A;  4PVU A;  2PIN A;  2FAI A;  1U3Q A;  3ADT A;  5G44 A;  3FC6 A;  2Q8S A;  4MG7 B;  2AMA A;  3CWD A;  5F9B A;  1FM6 A;  3ZRB A;  4P6W A;  3W5P A;  2P15 A;  1T65 A;  5KRM A;  2PIO A;  2AA7 A;  2ZK1 A;  3AUN A;  2HAM A;  3DR1 A;  3F5C B;  1YOW A;  4TV1 A;  1NQ2 A;  3HZF A;  1FCZ A;  3FLI A;  4Q13 A;  3V3E A;  3L1B A;  1T5Z A;  1XDK A;  4S15 A;  4ZNU A;  4P6X A;  1XV9 B;  1ZEO A;  3DCU A;  3P89 A;  3UP3 A;  3OOK A;  3H52 A;  3L0L A;  3HVL A;  3VRU A;  3HM1 A;  1GWR A;  2H79 A;  3DZY D;  2HCD A;  5KRI A;  2HAR A;  5EHJ A;  5KCE A;  2VST A;  5APK A;  1Y9R A;  2VV2 A;  5C4U A;  3VN2 A;  2Q7L A;  3R29 A;  3B0T A;  4RMC A;  4X1G A;  5DU5 A;  2Q7I A;  2O4R A;  4QJR A;  5DKS A;  1R1K A;  2Q5S A;  1XPC A;  2ZBS A;  2ZY0 A;  3E00 D;  1XVP B;  3ERT A;  3O1D A;  4IW6 A;  4LNX A;  5DKE A;  4Q0A C;  3E94 A;  3ET0 A;  3SP9 A;  1OT7 A;  2R6W A;  4G21 A;  5LGA A;  2JF9 A;  2GPU A;  3LBD A;  4OEA A;  5IZ0 A;  4QK4 A;  5L7E A;  1YP0 A;  2AB2 A;  2A3I A;  3B3K A;  1P8D A;  4PLD A;  3DZU D;  5DWI A;  1SQN A;  2NPA A;  5EIT A;  3B68 A;  4APU A;  1N4H A;  4OHA A;  4S14 A;  1YJE A;  3IPQ A;  3WWR A;  2YJA B;  5B41 A;  1XIU A;  2YFE A;  3Q95 A;  4PP6 A;  4FHI A;  3TY0 A;  4POJ A;  2PIQ A;  1P93 A;  4BCR A;  4DMA A;  5JY3 A;  4LSJ A;  5SYZ A;  4K4J A;  3KMG A;  1R20 D;  3VT5 A;  5DKB A;  5DX3 A;  3ZR7 A;  1DKF A;  4IV4 A;  1YY4 A;  1FBY A;  2V7C A;  4R2U A;  1XLS E;  1NAX A;  1A52 A;  2AX7 A;  2HC4 A;  4OKW A;  4Y29 A;  4OZR E;  1U9E A;  2REW A;  4IA1 A;  5DXM A;  1HG4 A;  1I7I A;  2QW4 A;  3R5M A;  5DZ1 A;  5C4S A;  1G2N A;  1K4W A;  4OFU A;  1FM6 D;  1MVC A;  1DKF B;  3L0E A;  1YIM A;  3OLL A;  4IW8 A;  3RLL A;  5AAU A;  1S0Z A;  1RJK A;  3OOF A;  4FNE A;  4B7W A;  4WVD A;  4ZN7 A;  3ADW A;  1KV6 A;  2ZLA A;  4E4Q A;  1VJB A;  2E2R A;  2HWR A;  4JAZ A;  2QE4 A;  2PIP L;  5HJP A;  3AUQ A;  2VSR A;  3D90 A;  4OGH A;  2ZK2 A;  4TUZ A;  2P54 A;  3VSO A;  1S9Q A;  2P4Y A;  2Q61 A;  4CI5 A;  3F7D A;  4LNW A;  4UDD A;  5DMF A;  2HBH A;  1PQC A;  2Q70 A;  3BC5 A;  4DK7 A;  4MG6 A;  1G5Y A;  2AM9 A;  1DB1 A;  2I0J A;  2PKL A;  4UDB A;  3VHW A;  4TUZ B;  1R1K D;  5G42 A;  4MGA A;  5E19 A;  3K23 A;  3KDT A;  1X76 A;  2AA2 A;  2ZNQ A;  3FUG A;  4RME A;  4RUP A;  4OZR U;  4PWL A;  5E15 A;  3W0H A;  5HZC A;  4OEZ A;  4EM9 A;  3EYB A;  5DXK A;  1QKT A;  5DXB A;  5FQS A;  1I37 A;  5KRF A;  3RUT A;  4YT1 A;  3WFG A;  2ZK3 A;  4MG8 A;  4ZNS A;  1S19 A;  4S0S A;  1EXA A;  2I4Z A;  1T76 A;  5HJP B;  4OKB A;  3G8I A;  1PRG A;  5KRO A;  3L3X A;  4A4V A;  4CSJ A;  5DID A;  3A9E A;  3OLS A;  2IOG A;  5DSH A;  1ZH7 A;  4ITF A;  2OZ7 A;  3ADU A;  3P88 A;  3W5T A;  3KMR A;  2PIT A;  4PRG A;  2EWP A;  3D5F A;  2J7X A;  1TFC A;  3B0Q A;  3OMQ A;  2GIU A;  5DK9 A;  5G43 A;  3NSP A;  2XKW A;  5M96 A;  2JJ3 A;  4OZT E;  3A9E B;  4IV2 A;  2Q59 B;  2P7Z A;  1NDE A;  2AA6 A;  2IHQ A;  3G9E A;  3OZJ A;  3CS4 A;  3AN4 A;  3K22 A;  2P1V A;  3WT6 A;  1PZL A;  5L7G A;  1KNU A;  4REE A;  2POG A;  2Z4B A;  5E1C A;  3SP6 A;  1ILG A;  5DP0 A;  1XNN A;  1WM0 X;  4RZF A;  3V49 A;  5DI7 A;  2ZMH A;  5KRH A;  1I7G A;  3TKC A;  4DM8 A;  2Q3Y A;  5KD9 A;  4UDA A;  3AZ3 A;  4RUO X;  5DZH A;  2J7Y A;  4MG7 A;  1Y0X X;  3B0W A;  1K7L A;  3ADV A;  2JFA B;  2NW4 A;  4WHG A;  3R8I A;  5IXK A;  2VV0 A;  2QZO B;  3G0W A;  4HLW A;  3WFF A;  3F5C A;  3HLV A;  4OK1 A;  4OLM A;  2QMV A;  3HQ5 A;  4RAK A;  1T7R A;  3B0R A;  2ZK5 A;  4ZOM A;  4Q50 A;  4ZNT A;  1OVL A;  5DXG A;  2V0V A;  3HC5 A;  5AWJ A;  3W0A A;  4F9M A;  3OGT A;  1XV9 A;  5DXP A;  1K74 A;  1NUO A;  2ZNP A;  3OAP A;  1ERR A;  1QKN A;  4EMA A;  3CQV A;  2AYR A;  4JGV A;  1BSX A;  1SKX A;  4OZT U;  2OCF A;  1UHL B;  5JI0 D;  2ZL9 A;  2ZXM A;  5EC9 A;  4J5W A;  1OVL B;  2B1V A;  2BAW A;  4DQM A;  5DWE A;  5KRJ A;  1RDT A;  2HVC A;  4G1D A;  4PP5 A;  3OLF A;  1X7J A;  1UPW A;  2OM9 A;  3L03 A;  5FQT A;  4N73 A;  1ZAF A;  2OVH A;  3VT9 A;  3X36 A;  4J5W C;  5DZ0 A;  2AX6 A;  1XVP A;  4IUI A;  3BEJ A;  3VRV A;  4JL4 A;  2HB7 A;  2YLQ A;  2VV1 B;  3KFC A;  5C4O A;  3HO0 A;  1XNX A;  2Q6R A;  3WTQ A;  4MG5 A;  4IA7 A;  3H0A A;  1XB7 A;  2ACL B;  3IMY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...